4YKPA

Mnemiopsis leidyi ml032222a iglur lbd serine complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
247
Chain Sequence
b'LIGRHLRLGSVEEQPFMFFATEGCEGNDCWSGMVNDMVVKLSEDLGFTYEYIQPDDRKFGALNKTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEGTTLNQVLELLDQDKYKWGVIGSRHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGLFVFIDEGPVLAHNLISDCDVFSVGEEFQSFEYAFGLPKDSPYKSLIDSHLLKFREEGFIDILWEKWSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ML032222a iGluR
publication title Glycine activated ion channel subunits encoded by ctenophore glutamate receptor genes.
pubmed doi rcsb
source organism Mnemiopsis leidyi
molecule tags Membrane protein
total genus 80
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykpA02
5CBSA 3LSLA 4ONYA 3T96B 3LSFB 4ZECA 5L8DA 4LZ8A 5I59B 1ZIUA 1R1NA 2O1LA 3VFJA 2F78A 4DCXA 1N04A 3L6GA 1H43A 2ZYKA 1LAXA 3OEKA 5HBCA 1RYXA 4QSCA 1N3XA 4OYVA 3G3FA 2DWIA 1LFIA 3KZGA 1A55A 3N94A 1B5JA 1Y20A 2BJJX 2O7IA 2ZNUA 3RY3A 1TT1A 4EDPA 4EQBA 2XHDA 1SYHA 2A5TA 3H6UA 3C32A 1B9JA 4ELPA 1B05A 1BTJA 1HSEA 4R74A 2UVJA 3TCGA 4RXLA 3HV1A 4P11A 1B46A 3CFLA 3KEIA 4NMYA 3IK6B 1LLSA 5I2KA 3BFTA 2Z8EA 4JWYA 3IO6A 3T9HB 4BDQA 2XD3A 3FVNA 4XTCQ 3OXNA 1DOTA 3RLFE 3BBRA 3PPPA 3MUQA 3T93B 5DEXA 4K3FA 3U92A 2CZLA 2D3IA 1A40A 2AL5A 4U4SA 1XS5A 1IXHA 4O3AA 3B6QA 4RA1A 4X1DA 5H8FB 3QYTA 4RK9A 2Z8DA 4GXAA 3PUVE 4POWA 2HZKA 3C35A 4EUOA 3M8UA 4LVQA 2AIXA 4TOZA 2I0CA 5IKBA 3V89B 5AA2B 1SD3A 4G2ZA 2GRVA 5J1DA 1Z7NE 3G3IA 3B7DA 5TPAA 4ELRA 1XHYA 2GHAA 4F39A 4H0WA 3OSQA 2HQ0A 1ZKBA 1Y4CA 1B3GA 3K01A 1AIVA 3E3KA 1O7TA 4X9TA 2V3UA 2ZYMA 3A3UA 3L6HA 3FGSA 4ZEIA 1I69A 3K2DA 2VHAA 2XD2A 1EZOA 3KOSA 4KYSA 5L9OA 5CMKA 4AB6A 4I1DA 1QUKA 2Y7KA 3VVDA 3KSXA 5JTYB 3I6VA 3O2AA 4ZS9A 4I8CA 4JBZA 1BP5A 4Z0IA 4F1YA 1B0LA 2E0SA 4F3SA 3RQTA 1B5HA 3UK4A 4U1ZA 2RKMA 5EYFA 2QPQA 4RNSA 1VSOA 1B4ZA 2DVZA 1POTA 3C31A 2H99A 3IAZA 3CG1A 4WKMA 1M5EA 1YPNA 2AYSA 4IO4A 1JW5A 4OEUA 4KQPA 3EHUA 1POY1 2KLFA 2QRYA 2Q2CA 1PC3A 4KYEA 2I49A 2RC7A 4ZE8A 3TCHA 2R9JA 4R2FA 4KCDA 1USYH 2HFBA 5F1QA 3O97A 1NH8A 4TLMB 2DWHA 1MXXA 3GBAA 4NF5A 1SW2A 5ICTA 3SESA 2O7UA 1MM6A 3IJOB 4NF4A 1HSJA 3H06B 1LAGE 4LP2B 1NNTA 2HEUA 1P1QA 3H6VA 3O66A 1UTHB 3FVOA 3MZBA 3SEUA 3EPEA 3RT6B 4KYDA 2B3FA 1SI0A 5CBRA 2REJA 3FJGA 3VV5A 4ZZEA 3MC2A 1FQCA 2E1SA 1TXFA 4P0GA 2OCUA 5M2VA 1MY0A 3TQWA 2F36A 2V3TA 5BWJA 4ZEKA 1J1NA 4OETA 1JEUA 3THIA 1IXGA 1IXCA 5KDTB 1US5A 1ZJLA 3SEWA 1URGA 4H5FA 2DP8A 1H44A 3JV9A 4XIGQ 4NF6A 3D4GA 4R2BA 3HPIA 3PPNA 3FVGA 3KN8A 4H8JA 3DLNA 4FECA 5H8HA 4F19A 3IOUA 5TP9B 2V93A 2M8CA 2RCAA 1IITA 3O6HA 1MPCA 3QUFA 2GHBA 4IY5A 3SERA 4E0XA 2I6EA 4MLQA 4GLIA 4OWDA 4FORA 4Q30B 3IB0A 3K6VA 4HS7A 4ISUA 2O1MA 5I57B 2Z23A 4OERA 3UORA 4DXCA 1B3HA 4OHNA 4ECFA 4RK2A 3E4RA 3LBSA 1B1XA 1B4HA 3T9VA 1AH5A 5ICQA 4G8NA 4FATA 5L9SA 3QAXA 4EXLA 1P1WA 1Y3NA 4AB5A 1QVSA 3CR9A 3PPOA 4EXKA 2DSFA 2QS2A 2F7BA 1M5FA 2X26A 2Q9TA 2DXYA 1Y1MA 3MP6A 2HCAA 3SKPA 3FXQA 3HN0A 5KZTA 3HHFA 1FTKA 3UN6A 3M3FA 1DSNA 4JWOA 2ESNA 4OQOA 1NH7A 3MVYA 2FA7A 1N76A 4OEVA 5AA4B 5AA1A 3ZS6A 5DYHA 2QMXA 2UYFA 4YKPA 1NMUA 3K0VA 3BKIB 4BLAA 3SEVA 1LCFA 4C1UA 3ZSFA 1P99A 2DE4A 2Q88A 4RY1A 2ANJA 1LBCA 5DVFA 4YB6A 4BDLA 3RTWB 3B6TA 1MY4A 1B7HA 4THIA 5EHSA 3T66A 3S2VA 3AXFA 2PX1A 4GD5A 1B3EA 3SEYA 3EHTA 4GF8A 3PGFA 3TTMA 1A54A 2WKYA 1N0TA 1D3KA 2IEEA 3OO9A 4G68C 3VLVA 4F3GA 3MW0A 4FIMA 5K2YA 2NUVA 4EF1A 1AL3A 4GXSB 4QFLA 1BKAA 2HAUA 4R73A 1OQGA 4L17A 3H03A 2RINA 1LB9A 4AQ4A 1CB6A 4NEDA 3PMWA 1EU8A 4YU0A 1ZU0A 1MS7A 2XX9A 5A5XB 1BIYA 2I4BA 2RCBA 2YJPA 4HCWA 1SW1A 5AA2A 5JK4A 5I56B 3UIFA 5KCJA 1JEVA 1MQGA 2ABHA 3QSLA 1II5A 2XXQA 3MWBA 3IOVA 4UA8A 1FW0A 1DMBA 1NNPA 3ONMA 4DIGA 1ZTYA 4ZDMA 1PEBA 3K1MA 4HCYA 3N6UA 4ZEDA 1B6HA 3PMXA 4GOTA 1OQHA 4OZ9A 4POXA 3TYHA 3S9LC 1MQIA 1A8EA 3VVEA 4LA9A 5DVIA 4QF9A 1NKXA 3RTFB 4PP0A 4LZ5A 1FTMA 1MQJA 4RYAA 1F9BA 1WVJA 1FTLA 3E9XA 2H5YA 3K00A 3PMVA 4LONB 1B52A 3H7MA 4NWCA 1T0KA 5CRYA 3VLUA 3A3CA 5DVJA 3MVXA 4MBPA 3H3GA 4Z7EA 2HZLA 3CIJA 1OVTA 3CSBA 3LUYA 3DP6A 3U1OA 3RUMA 5H8SA 4EF2A 1Q35A 3QUJA 3N26A 3IL1B 1GVCA 1FQDA 2QS4A 4U4XA 4KR5A 4GWOA 3MVWA 1JNFA 3M3KA 3IORA 2P1SA 3CFXA 1N84A 1GR2A 1FQFA 1IXIA 2I48A 1PBPA 5CM6A 3K02A 3S9NC 4YKIA 1B58A 4OMBA 3HHGA 3I5OA 2F35A 2LAOA 3GZGA 1N3WA 3TTNA 3TUSA 5H8NA 2ONSA 4MLVA 5FHMA 2I0BA 4LQ5A 4G68A 1R9QA 3C33A 1URSA 4GQOA 5FTIA 1HSLA 3S9EA 2QS1A 5FHNA 3C9HA 2NVUB 5KDTA 1B7ZA 3KN3A 4YMAA 2QMWA 4JSDA 3FUZA 3EN3A 1QKBA 4YB5A 4FEBA 3PV0E 1UTBA 2PYYA 1Y9UA 4IB2A 4ZE9A 2X7QA 2DYXA 4PQJA 2Y7PA 1B40A 1I6QA 1QUIA 1DPPA 3TTKA 4IO6A 1UIUA 2Z22A 4XXUA 1MPDA 5DEXB 1N7XA 3ZKLA 1B1HA 3MAMA 3RN8A 2G93A 3OENA 1PBQA 3OO8A 1Y1ZA 2OWTA 5I2NA 2QL3A 2H4IA 2D5WA 4EQ9A 1NNKA 4OENA 4NF8A 4TLLB 4ESWA 4P0IA 3MVZA 4PFYA 5ITPA 3O6IA 2Y7RA 5CMCA 4MH5A 1URDA 3FVKA 4N6PA 4G8MA 4QRZA 3KBRA 4KCCA 2I4CA 3TKDA 1A8FA 3VXCA 3KG2A 4QSEA 1B51A 2FYIA 4PFWA 1B3LA 4XKNA 5TPAB 2O68A 2VOZA 4BDMA 2XXVA 1Z7ME 1O63A 4Q5TA 4R9FA 2PT2A 1MY1A 1UIVA 1OMPA 5EHMA 3TFLA 4WEPA 4HTGA 4OVJA 1D4NA 1SW4A 1P1NA 3QK6A 2OK2A 3MBPA 4IO2A 3U8QA 4IGTA 4WEDA 4U1OA 2UVHA 2NWJA 3OO6A 1AOVA 1P1UA 3O6GA 5CC2A 4DXBA 3G3KA 1FCKA 2F8DA 1M5DA 3ODBA 1H45A 1MPBA 4QFPA 3IB2A 1XC1A 2RF1A 1OVBA 4KFQA 2DE2A 2I58A 4GFRA 3O29A 4G4PA 3ILTB 1VFDA 1LFGA 3TEPA 5H8QA 1PB9A 2UXAA 4YZZA 4JB7A 1B0HA 4NF5B 4IGRA 3OELA 2UVIA 3W9WA 4F2OA 2YLNA 1MQHA 5I58B 3FJ7A 4QFOA 1EZPA 4NF4B 4ESXA 2XXUA 4DCYA 1N7WA 1FTJA 2V25A 3R26A 4OESA 4Q0CA 4O3CA 3LR1A 3PPQA 4IO5A 3TDJA 3K6UA 3ZKKA 4YMBA 5AA3A 2VP1A 4I9DA 3LSXA 4M1VA 4XKRA 4ZEFA 4H65A 4DE8A 2F97A 1O64A 2ZYOA 5I59A 2V3QA 2V84A 3VLWA 5A5XA 1YAEA 1B2HA 2QSXA 3S9MC 1DTGA 3C34A 1MXZA 5ELVA 3ILUB 1DPEA 2XX7A 4GVOA 4JSOA 2ZNTA 4KI0E 4X1BA 2AL4A 4NF6B 1LFHA 1A99A 1EZ9A 1TWYA 3CSGA 4C0RA 1MG1A 2HXWA 1PB8A 2FNCA 5H8HB 3DP8A 3GBBA 2F6PA 2F6GA 4GIZA 3FV1A 3PUYE 3E13X 2Y84A 1ZMGA 4E0WA 2XXPA 3KOTA 4H6DA 3FIRA 5HM4B 4H67A 2G29A 2OBGA 3RGYA 5CMMA 1VE4A 3TCFA 4ZEBA 2QS3A 3KJ7A 4FAJA 5IAIA 4RJZA 4R72A 3IX1A 3FXRA 4YAHX 1TFAA 1RKMA 1SW5A 4N13A 3FASA 3SEXA 2I3VA 2R71A 2DOJA 4MFIA 3OSRA 5H8FA 3VVFA 1MRPA 1GGGA 4C1TA 1NL5A 3TZAA 2A5SA 3MPLA 3O9PA 3JYRA 3N5LA 3DELB 1QKAA 4BDNA 1SVXB 4OFJA 4X48A 3PUXE 3KN7A 2ZXTA 4G8HA 4LUBA 2OLBA 1IEJA 2ONKE 2RC8A 3U94A 1SYIA 1XVXA 2W7YA 4H8IA 4NWDA 4WXJA 3OD7A 1UQWA 1FTOA 5AE4A 1MQDA 4R75A 4IO7A 5K2XA 3B6WA 2NOOA 3I3VA 1LAFE 3O28A 3Q28A 5BUUA 4O3BA 3RPWA 2VD2A 5JTYA 4BDRA 3A09A 4Q8RA 2XXTA 4FJPA 2F34A 2O51A 3GLBA 3TMGA 4QHQA 2VD3A 4NE4A 3Q26A 1FQEA 1LSTA 4ND9A 3MP8A 1H76A 1IUDA 1H3DA 4FEDA 3Q27A 3UGWA 2DVCA 4OTEA 1I6BA 2ONRA 4TQUQ 2DQVA 3WAEA 1I6AA 2H9BA 2P0SA 1ELJA 2REGA 3G3HA 2YPNA 3FJMA 3VE1B 1XT8A 4F22A 3VDFA 4IO3A 3T22A 4OXVA 5TU0A 1ZLQA 5JEIA 3ECRA 2O69A 4LZ7A 1S7YA 3G3JA 1UTHA 3K1NA 2GFEA 1MM7A 1L5TA 3VXBA 4YKKA 4XKQA 2UVGA 5KCJB 2XX8A 2DS9A 2ZMBA 4F1VA 4R6HA 4YKJA 1SBPA 1OLCA 4UACA 4LQ2A 5ISUA 3OO7A 2R6GE 2A5TB 4RPNA 2RC9A 3TAJA 1YTVA 4DZ1A 2OJTA 4EQ7A 2I3WA 1SQYA 3EQ1A 3IO4A 4F2QA 1OIBA 3G3GA 5B7DA 2DXRA 5I2KB 1KWHA 2Q8JA 5TP9A 3FZVA 3RT8A 1PB7A 1LGBC 2Q89A 2UYEA 4QSDA 3P7IA 1FQAA 3PPRA 3DP4A 1JVXA 3WAFA 3BFUA 1LB8A 1Y3QA 2QJEA 2XXYA 5L9MA 3JZJA 2DWJA 3SDFA 1NFTA 1IZ1A 2PMSA 1R9LA 1AMFA 2H25A 5I57A 1WODA 4LATA 2O6AA 3SETA 1MDQA 5F7VA 1P1OA 4I62A 1LBBA 3C4MA 5LOMA 3M3LA 1XVYA 3MQ9A 1DTZA 3K6WA 1US4A 3LC8A 4PE5B 1M5CA 2CMOA 1MY2A 1RYOA 4F3PA 4JWXA 2Y7WA 1IQ7A 2XXWA 2XXIA 1USYE 4F29A 2Q2AA 1VFEA 4GL8A 3KJTA 4U2RA 5I58A 3TELA 1MXWA 2XXXA 1LCTA 1MXYA 3FATA 4GRKA 1S50A 3EF7A 3N6TA 1ZBMA 1JW1A 4GL0A 3OEMA 1D9VA 5I84A 4G77A 5H8NB 3TQLA 3V5AA 1GTKA 5CMBA 3IOTA 3CI8A 1FQBA 4R9GA 3QXMA 4JXIA 4QFKA 1YCJA 4NTLA 2HAVA 2XXRA 5HPQA 4DDDA 1GV8A 4G68B 1ANFA 2PT1A 1B5IA 4QFNA 1JW4A 5AA4A 5DTBA 5FHOA 4F18A 1A7LA 3IOWA 3FD3A 3FV2A 1Y4TA 1WDNA 4PETA 1OLAA 1MH3A 3Q29A 2IA4A 2OZZA 1LAHE 2PBWA 4ELOA 1QW0A 3FXUA 1UTBB 3T9UA 3S4UA 3KGCA 3R7XA 3V83A 4YICA 3CRBA 3PUWE 4KHZE 3U72A 3UA8A 1EH3A 2DE3A 3CVGA 2DWAA 1MDP1 4F1UA 4M4GA 3OMBA 1CE2A 2ALUA 3Q25A 2H98A 2XXHA 1SDXA 3K6XA 3G7WA 4DXUA 2F7AA 5I2NB 1JQFA 4F3BA 5FTHA 3IJXB 2X7PA 1TFDA 4KD5A 1MH4A 4NF8B 2Z8FA 3IR1A 3LSWA 3CFZA 3DM0A 1ATGA 1QULA 4FE8A 3T9XB 3MZ9A 1D9YA 2VGQA 5ITOA 4F31B 4IY6A 1Y3PA 4ELQA 1BLFA 1QJMA 3IB1A 4JDFA 1JVYA 4KPTA 1R6ZA 2D21A 4BDOA 4N07A 5I56A 2P2AA 1NNFA 3EHSA 4H5GA 3PD9A 5CI5A 3V8XB 1B7UA 3PD8A 4U21A 4YB7A 2THIA 3W15C 1MXUA 3MJNA 1S9TA 4U22A 1MXVA 2ZYNA 3F11A 3PU5A 3TODA 4OFLA 1Q1KA 4R6YA 3MZ1A 3HCQA 2B3BA 1B32A 3TTRA 3CG3A 2Y7IA 3HO7A 5DT6A 3GXAA 2O84X 1SI1A 4R6KA 2GH9A 3OOAA 3QIMA 1QUJA 1JETA 2F5XA 5B70A 2OWSA 4OFOA 2NXOA 3H4ZA 1B3FA 1IIWA 2F7CA 3U93A 3HSTA 2PVUA 3C36A 3H6WA 3RNNA 1VR5A 1PDAA 3MP1A 2ZNSA 4PFUA 3K4UA 3KSJA 5H8QB 3W9VA 4DLDA 2B65A 5AA2D 4U23A 4HW8A 1XOCA 3UP9A 3D4CA 4PFTA 3TPAA 3KFMA 3H6TA 3MPKA 3PUZE 1M5BA 4MF3A 3USDA 4ZZAA 3R6UA 4H1XA 4RPOA 3K1PA 1MY3A 3TTLA 4XKPA
chains in the Genus database with same CATH superfamily
5CBSA 3LSLA 4ONYA 3T96B 3LSFB 2CZHA 4ZECA 5L8DA 4LZ8A 5I59B 2QFLA 1ZIUA 1R1NA 2O1LA 3VFJA 2F78A 4DCXA 1N04A 3L6GA 1H43A 2Y5LA 4GX4A 2ZYKA 1LAXA 3OEKA 5HBCA 1RYXA 4QSCA 3T0JA 1N3XA 4OYVA 3G3FA 4MEVA 2DWIA 3IFCA 1YYZA 1LFIA 1LBVA 3KZGA 2QVUA 1A55A 2XWOA 3N94A 1B5JA 1Y20A 2BJJX 2O7IA 2ZNUA 3RY3A 1TT1A 1RDYA 4EDPA 4EQBA 2XHDA 1SYHA 2A5TA 3H6UA 3C32A 1B9JA 4ELPA 1B05A 1G0HA 1BTJA 1HSEA 1NV7A 4R74A 2UVJA 3TCGA 4RXLA 3HV1A 4P11A 1B46A 3CFLA 3KEIA 4N6KA 4NMYA 3IK6B 1LLSA 5I2KA 3BFTA 2Z8EA 4JWYA 3IO6A 3T9HB 4N6DA 4BDQA 2XD3A 3FVNA 4XTCQ 3OXNA 1DOTA 3RLFE 1IMCA 1FPIA 3BBRA 3PPPA 1RDZA 3MUQA 3T93B 5DEXA 2CZIA 4K3FA 3U92A 2CZLA 2D3IA 1A40A 2AL5A 4U4SA 1XS5A 1IXHA 4O3AA 3B6QA 4RA1A 4X1DA 5H8FB 3QYTA 2B4MA 4RK9A 2PFZA 2Z8DA 4GXAA 3PUVE 4I3EA 4POWA 2FHYA 2HZKA 3C35A 4EUOA 3M8UA 4LVQA 2AIXA 4TOZA 2I0CA 5IKBA 3V89B 5AA2B 1SD3A 2MKZA 3QMFA 4G2ZA 2GRVA 1FPFA 5J1DA 1Z7NE 4IR8A 3G3IA 3B7DA 5TPAA 4ELRA 1XHYA 2GHAA 4F39A 4H0WA 1LBZA 3OSQA 2HQ0A 4MIJA 1ZKBA 1Y4CA 1B3GA 3K01A 1AIVA 3E3KA 1O7TA 1QGXA 2PFYA 4X9TA 4X04A 2V3UA 2ZYMA 3A3UA 3L6HA 3FGSA 1FPJA 4ZEIA 1I69A 3K2DA 2VHAA 2XD2A 2BJIA 1EZOA 3KOSA 4KYSA 5L9OA 5CMKA 4AB6A 4I1DA 4MJOA 1KZ8A 3RPLB 1QUKA 2Y7KA 3VVDA 3KSXA 5JTYB 3I6VA 3O2AA 4ZS9A 1FPDA 4I8CA 4JBZA 1BP5A 4Z0IA 4F1YA 1B0LA 2E0SA 4F3SA 3RQTA 1B5HA 3UK4A 4O7IA 4U1ZA 1NV0A 2RKMA 5EYFA 2QPQA 4RNSA 1VSOA 1B4ZA 2DVZA 1POTA 3C31A 2H99A 3IAZA 3CG1A 4WKMA 1M5EA 1YPNA 2AYSA 4IO4A 1JW5A 1NV2A 4OEUA 4KQPA 3EHUA 1POY1 2KLFA 2QRYA 2Q2CA 1PC3A 4KYEA 2I49A 2RC7A 4ZE8A 3TCHA 2R9JA 4R2FA 4KCDA 1USYH 2HFBA 5F1QA 3O97A 1FPEA 1NH8A 4MMPA 4TLMB 2DWHA 1MXXA 3GBAA 4NF5A 1SW2A 5ICTA 3SESA 2O7UA 4PDDA 3IFAA 1MM6A 1FBFA 4NF0A 3IJOB 4NF4A 3B8BA 2OWZA 1HSJA 3H06B 1LAGE 4LP2B 1NNTA 2HEUA 1P1QA 3H6VA 3O66A 1UTHB 3FVOA 3MZBA 3SEUA 3EPEA 3RT6B 4KYDA 1K9YA 5IM2A 2B3FA 1SI0A 4PBQA 4NN3A 5CBRA 2REJA 2KQZA 3FJGA 3VV5A 4OVQA 4ZZEA 3MC2A 1FQCA 2E1SA 1TXFA 4P0GA 2OCUA 5M2VA 4PGNA 1MY0A 3TQWA 2F36A 2V3TA 5BWJA 4ZEKA 1J1NA 2WYKA 4OETA 1G0IA 1JEUA 3THIA 1IXGA 4MAGA 1IXCA 1FBCA 5KDTB 1US5A 1FTAA 1ZJLA 3SEWA 5FBPA 1URGA 4H5FA 2DP8A 1H44A 3JV9A 4XIGQ 4NF6A 3D4GA 4R2BA 3HPIA 3PPNA 3FVGA 3KN8A 4H8JA 3DLNA 3NOHA 4FECA 5H8HA 4F19A 3IOUA 5TP9B 2V93A 2M8CA 2RCAA 4PE3A 1IITA 3O6HA 1MPCA 2ZZVA 3QUFA 2GHBA 4IY5A 3SERA 4E0XA 2I6EA 4MLQA 4GLIA 4OWDA 4FORA 4Q30B 1NV1A 3IB0A 3K6VA 4HS7A 4ISUA 3U65A 4NX1A 2O1MA 5I57B 2Z23A 4OERA 3UORA 4DXCA 1B3HA 4OHNA 2ZZWA 4ECFA 4RK2A 1D9QA 3E4RA 2FIEA 3LBSA 1B1XA 1B4HA 3T9VA 1AH5A 5ICQA 4G8NA 4FATA 5L9SA 3QAXA 4EXLA 1P1WA 1Y3NA 4AB5A 1QVSA 3CR9A 3PPOA 4JVIA 4EXKA 2DSFA 2QS2A 2F7BA 1M5FA 2X26A 2Q9TA 2XWIA 5IGAA 2DXYA 1Y1MA 1FRPA 3MP6A 2HCAA 3SKPA 3FXQA 4PCDA 3T1BA 3HN0A 5KZTA 1IMAA 4H45A 3HHFA 1FTKA 3UN6A 3LV0A 3M3FA 4O8MA 1DSNA 4JWOA 2ESNA 4OQOA 1NH7A 3MVYA 4NAPA 2FA7A 2F3BA 1N76A 4OEVA 5AA4B 5AA1A 3ZS6A 5DYHA 4QXDA 1NUZA 2QVVA 2QMXA 2UYFA 3KBZA 4YKPA 1NMUA 3K0VA 3BKIB 4BLAA 1EYJA 3SEVA 1LCFA 4C1UA 1FBDA 3ZSFA 1P99A 2DE4A 5EYGA 2Q88A 2KR0A 4RY1A 2ANJA 1LBCA 5DVFA 3HFUA 4YB6A 4BDLA 3RTWB 1RDXA 2FVZA 3B6TA 1MY4A 1B7HA 4THIA 5EHSA 1FPGA 3T66A 3S2VA 3AXFA 2PX1A 4GD5A 1B3EA 1NV5A 2WEFA 2XXKA 3SEYA 3EHTA 4GF8A 3PGFA 3TTMA 1A54A 2WKYA 1N0TA 1D3KA 2IEEA 3OO9A 1IMDA 4G68C 3VLVA 4DI4B 4N17A 4F3GA 3MW0A 4FIMA 5K2YA 1Q9DA 2NUVA 4EF1A 1AL3A 4GXSB 4QFLA 1BKAA 2HAUA 4R73A 1OQGA 4L17A 3H03A 2RINA 1LB9A 4AQ4A 1CB6A 4NEDA 3PMWA 1EU8A 4YU0A 1ZU0A 1MS7A 4P1EA 2XX9A 5A5XB 1BIYA 2I4BA 1XI6A 4PAKA 2RCBA 2YJPA 4HCWA 1SW1A 5T3JA 5AA2A 4PF8A 5JK4A 4XF5A 1LBXA 5I56B 3UIFA 4NQ8A 4O7MA 5KCJA 4PFRA 1JEVA 1MQGA 2ABHA 3FBPA 3E78A 3QSLA 1II5A 2XXQA 3MWBA 3IOVA 4UA8A 1FW0A 1DMBA 1NNPA 3ONMA 4DIGA 1ZTYA 4ZDMA 1PEBA 1NV6A 3K1MA 4HCYA 3N6UA 4ZEDA 1B6HA 1KA1A 3PMXA 4GOTA 1OQHA 2P3NA 2FIXA 3BIGA 4OZ9A 4POXA 3TYHA 3S9LC 1MQIA 1A8EA 3VVEA 4LA9A 5DVIA 4QF9A 1NKXA 3RTFB 4PP0A 1EYKA 4LZ5A 1FTMA 1MQJA 2GQ1A 4RYAA 1F9BA 1WVJA 4NHBA 1FTLA 3E9XA 2H5YA 3K00A 2B4LA 3PMVA 4LONB 1B52A 1IMEA 3H7MA 4NWCA 1T0KA 5CRYA 3VLUA 3E79A 3A3CA 5DVJA 4O94A 2XWVA 2QVRA 5LTCA 3MVXA 4MBPA 3H3GA 4Z7EA 2HZLA 3CIJA 1OVTA 1K9ZA 3CSBA 3LUYA 3DP6A 3U1OA 3RUMA 5H8SA 4EF2A 1Q35A 3QUJA 4GWZA 3N26A 3IL1B 1GVCA 1FQDA 2QS4A 4U4XA 4KR5A 4GWOA 3MVWA 1JNFA 5I3SA 3M3KA 3IORA 2P1SA 3CFXA 4MHFA 1N84A 1GR2A 1FQFA 1IXIA 5IZ3A 2I48A 1PBPA 5CM6A 3K02A 3S9NC 4YKIA 1B58A 4OMBA 3HHGA 3I5OA 2F35A 2LAOA 3GZGA 1N3WA 3TTNA 3TUSA 5H8NA 2ONSA 5EQ8A 4MLVA 5FHMA 2I0BA 4LQ5A 4G68A 1R9QA 3C33A 1URSA 4GQOA 5FTIA 2VPNA 1HSLA 3S9EA 1YXIA 2QS1A 5FHNA 3C9HA 2NVUB 5KDTA 1B7ZA 3KN3A 4YMAA 4JSDA 2QMWA 3FUZA 1FBEA 3PTYA 3EN3A 1QKBA 4YB5A 4FEBA 3PV0E 1UTBA 2PYYA 4N81A 1Y9UA 4IB2A 5ESYA 4ZE9A 2X7QA 2DYXA 4PQJA 5EQ9A 1FBGA 2Y7PA 1B40A 2CEYA 1I6QA 1QUIA 1DPPA 3TTKA 4MNPA 4IO6A 5ET6A 1UIUA 2Z22A 4XXUA 1MPDA 5DEXB 1N7XA 3ZKLA 1B1HA 3MAMA 3RN8A 2G93A 4OVSA 3OENA 1PBQA 3OO8A 1Y1ZA 2OWTA 5I2NA 2QL3A 2H4IA 5IZ1A 2D5WA 4EQ9A 1NNKA 4OENA 4NF8A 4TLLB 4ESWA 4P0IA 3MVZA 3FXBA 4PFYA 5ITPA 3O6IA 2Y7RA 5CMCA 4MH5A 1URDA 3FVKA 4N6PA 4G8MA 2OX3A 4QRZA 3KBRA 1DBZA 2Y5KA 4KCCA 2I4CA 3TKDA 1A8FA 3ROJA 3VXCA 3KG2A 4QSEA 1B51A 2FYIA 4PFWA 1B3LA 1FPBA 4XKNA 5TPAB 2O68A 2VOZA 4BDMA 2XXVA 1Z7ME 1O63A 4Q5TA 4R9FA 2PT2A 1MY1A 1UIVA 1OMPA 5EHMA 3TFLA 2HHMA 4WEPA 4H46A 4GWUA 4HTGA 3LUZA 4OVJA 1D4NA 1SW4A 1P1NA 3QK6A 2OK2A 4PC9A 3MBPA 4IO2A 3U8QA 1JP4A 4IGTA 4WEDA 4U1OA 2UVHA 2NWJA 3OO6A 1AOVA 1P1UA 3O6GA 5CC2A 4DXBA 3G3KA 1FCKA 2F8DA 4GX3A 1M5DA 4DI3D 4LN5A 3ODBA 1H45A 1MPBA 1IMFA 4QFPA 3IB2A 1LEVA 1DK4A 1XC1A 2RF1A 1OVBA 4KFQA 2DE2A 4N91A 4GWYA 4PGPA 1FPKA 2I58A 4GFRA 2CZKA 3O29A 3ILTB 4G4PA 4HXVA 1VFDA 4JVCA 1LFGA 3TEPA 5H8QA 1PB9A 2UXAA 4YZZA 1YZ0A 4JB7A 1B0HA 4NF5B 5EYHA 4IGRA 3OELA 2UVIA 3W9WA 4F2OA 4GWXA 2YLNA 1MQHA 4GBWA 5I58B 3FJ7A 4QFOA 1EZPA 4NF4B 4ESXA 2XXUA 1EYIA 4DCYA 1N7WA 1FTJA 2V25A 3R26A 4OESA 4Q0CA 4O3CA 3LR1A 3PPQA 4IO5A 3TDJA 5A5LA 3K6UA 3ZKKA 4YMBA 5AA3A 2VP1A 4I9DA 3LSXA 4M1VA 4XKRA 4ZEFA 4H65A 4DE8A 2F97A 1SPIA 1O64A 2ZYOA 5I59A 2V3QA 4UABA 2V84A 3VLWA 5A5XA 1YAEA 1B2HA 2QSXA 3S9MC 1DTGA 3GYYA 4AS4A 5IZZA 3C34A 1MXZA 5ELVA 2ZZXA 3ILUB 1DPEA 2XX7A 1BK4A 4MCOA 4GVOA 4XFEA 4JSOA 2ZNTA 4KI0E 2P3VA 4X1BA 2AL4A 4NF6B 1LFHA 1A99A 1EZ9A 1TWYA 3CSGA 4C0RA 1LBWA 1MG1A 2HXWA 2XWKA 1PB8A 2FNCA 5H8HB 3DP8A 5ET7A 3GBBA 2F6PA 2F6GA 4NG7A 4GIZA 3FV1A 3PUYE 3E13X 4QBAA 2Y84A 2PCRA 1ZMGA 4E0WA 2XXPA 3KOTA 4H6DA 3FIRA 5HM4B 4H67A 2G29A 5J16A 2JJKA 2OBGA 3RGYA 5CMMA 1VE4A 3TCFA 4ZEBA 2QS3A 3KJ7A 4FAJA 5IAIA 4RJZA 4R72A 4PFIA 3IX1A 3KC0A 3FXRA 4YAHX 1TFAA 1RKMA 1SW5A 4N13A 3CHGA 3FASA 4PBHA 3SEXA 4OVTA 2I3VA 2R71A 2DOJA 4MFIA 4OVRA 4XEQA 3OSRA 5H8FA 3VVFA 1MRPA 1GGGA 4C1TA 1NL5A 3TZAA 2A5SA 3MPLA 2XA5A 3O9PA 4MX6A 3JYRA 3N5LA 3DELB 1QKAA 2L5VA 2HPGA 4BDNA 1SVXB 1VDWA 5DW8A 5I5PA 4OFJA 4X48A 3PUXE 3KN7A 2ZXTA 3RYDA 1FBPA 4G8HA 4LUBA 2OLBA 1IEJA 2ONKE 2RC8A 3U94A 1SYIA 1XVXA 2W7YA 4P8BA 4H8IA 4NWDA 4AS5A 4N8YA 3OD7A 4WXJA 3KC1A 4MNCA 1UQWA 1FTOA 5AE4A 1MQDA 4R75A 4IO7A 5K2XA 3B6WA 2NOOA 5EQAA 3I3VA 1LAFE 3O28A 3Q28A 5BUUA 4O3BA 3RPLA 3RPWA 2VD2A 5JTYA 2R8TA 4BDRA 3A09A 4Q8RA 2XXTA 4FJPA 2F34A 2O51A 3GLBA 3TMGA 4QHQA 2VD3A 4NE4A 3Q26A 4GWWA 1FQEA 1LSTA 4ND9A 3MP8A 1H76A 1IUDA 1H3DA 4FEDA 3Q27A 3UGWA 2DVCA 4OTEA 1I6BA 2ONRA 4TQUQ 1INPA 2DQVA 3WAEA 1I6AA 2H9BA 2P0SA 1ELJA 2REGA 3G3HA 2YPNA 3FJMA 3VE1B 1XT8A 4F22A 3VDFA 1AWBA 4IO3A 3T22A 4OXVA 5TU0A 3BIHA 1ZLQA 5JEIA 3ECRA 2O69A 4LZ7A 5LDZA 1S7YA 3G3JA 2WBDA 1UTHA 5ET8A 3K1NA 2GFEA 4N15A 4OANA 1MM7A 1L5TA 3VXBA 4YKKA 4P3LA 4XKQA 2UVGA 5KCJB 2XX8A 2DS9A 4P9KA 2ZMBA 4F1VA 4R6HA 4YKJA 1SBPA 1OLCA 1DCUA 4UACA 4LQ2A 5ISUA 3OO7A 2R6GE 2A5TB 4RPNA 2RC9A 3TAJA 3EKIA 1YTVA 4NGUA 4DZ1A 2OJTA 4EQ7A 2I3WA 1SQYA 3D1RA 3EQ1A 2CEXA 3IO4A 4F2QA 1OIBA 3G3GA 5B7DA 2DXRA 5I2KB 1FJ6A 1KWHA 1NUXA 2Q8JA 5TP9A 2Q74A 3FZVA 4PAFA 3RT8A 1PB7A 1LGBC 2Q89A 3MYUA 2UYEA 4QSDA 3P7IA 1FQAA 3PPRA 3DP4A 1JVXA 3WAFA 3BFUA 1LB8A 1Y3QA 2QJEA 2XXYA 5L9MA 3JZJA 2DWJA 3SDFA 1NFTA 1IZ1A 2PMSA 1R9LA 1AMFA 2H25A 5I57A 1WODA 4LATA 2O6AA 3SETA 1MDQA 5F7VA 1P1OA 4I62A 3B50A 1LBBA 3C4MA 5LOMA 3M3LA 4PF6A 1FPLA 1XVYA 4GWSA 4JVDA 3MQ9A 1DTZA 3K6WA 1US4A 3LC8A 4PE5B 1M5CA 2VPOA 4OA4A 2F3DA 2CMOA 1MY2A 1RYOA 4F3PA 4JWXA 2Y7WA 1IQ7A 4PAIA 2XXWA 4N4UA 2XXIA 1USYE 4F29A 2Q2AA 1VFEA 4GL8A 1FBHA 4X8RA 3KJTA 4U2RA 4PTKA 1KA0A 5I58A 3TELA 1MXWA 5IZ3B 2XXXA 1LCTA 1MXYA 4N8GA 3FATA 4GRKA 1S50A 3EF7A 3N6TA 1ZBMA 1JW1A 3A29A 2HXRA 4GL0A 1NI9A 3OEMA 1D9VA 5I84A 4G77A 5H8NB 2WYPA 3TQLA 1FSAA 3V5AA 1GTKA 5CMBA 3IOTA 4P56A 3CI8A 1FQBA 4R9GA 3QXMA 4JXIA 4QFKA 1YCJA 4NTLA 2HAVA 2XXRA 5HPQA 1NV3A 4DDDA 1GV8A 4G68B 1ANFA 2PT1A 1B5IA 4QFNA 1JW4A 4HE1A 5AA4A 5DTBA 4FBPA 5FHOA 1FJ9A 4F18A 1A7LA 3IOWA 3FD3A 3FV2A 1Y4TA 1WDNA 4PETA 1OLAA 1MH3A 4GBVA 3Q29A 2IA4A 2OZZA 1LAHE 2PBWA 4ELOA 1QW0A 3FXUA 1IMBA 5I7IA 4G61A 1UTBB 3T9UA 5EQ7A 3S4UA 5ET5A 3KGCA 3R7XA 3ISPA 4I3YA 3V83A 4YICA 3CRBA 3PUWE 4KHZE 3U72A 3UA8A 1EH3A 2DE3A 3CVGA 2DWAA 1MDP1 4F1UA 4OVPA 4M4GA 3OMBA 1CE2A 4P1LA 2ALUA 3SZPA 3Q25A 2H98A 2XXHA 1SDXA 3K6XA 1NUWA 3G7WA 4DXUA 2F7AA 5I2NB 1JQFA 4F3BA 5FTHA 3IJXB 4GX6A 2X7PA 1TFDA 4KD5A 1MH4A 4NF8B 4PFBA 2Z8FA 3IR1A 3LSWA 3CFZA 1CNQA 1LBYA 3DM0A 1ATGA 1QULA 4FE8A 3T9XB 4KXPA 3MZ9A 1D9YA 2VGQA 3MSTA 1NV4A 5ITOA 4F31B 4IY6A 1Y3PA 4ELQA 1BLFA 1QJMA 2VT5A 3IB1A 4JDFA 1JVYA 4KPTA 1R6ZA 4I40A 2D21A 4PDHA 4BDOA 4N07A 5I56A 2P2AA 1NNFA 3EHSA 4H5GA 3PD9A 5CI5A 3V8XB 1B7UA 3PD8A 4U21A 4YB7A 2THIA 3W15C 1MXUA 2DDKA 4P47A 3MJNA 1S9TA 4U22A 1MXVA 4MNIA 2ZYNA 3F11A 3PU5A 3TODA 4OFLA 1Q1KA 4R6YA 1NUYA 3MZ1A 3HCQA 2V4CA 2B3BA 1B32A 3TTRA 3CG3A 2Y7IA 3HO7A 5DT6A 3GXAA 2O84X 4HE0A 5F24A 1SI1A 2WX9A 4R6KA 2GH9A 3OOAA 3QIMA 1QUJA 1JETA 2F5XA 2WBBA 5B70A 2OWSA 4OFOA 2NXOA 3H4ZA 1B3FA 1IIWA 2F7CA 3U93A 3HSTA 2PVUA 3C36A 3H6WA 3RNNA 1VR5A 1PDAA 3MP1A 2ZNSA 4PFUA 3K4UA 2FBPA 3KSJA 5H8QB 3W9VA 4DLDA 2B65A 5AA2D 4U23A 4HW8A 1XOCA 3UP9A 3D4CA 4PFTA 3TPAA 3KFMA 3H6TA 3MPKA 3PUZE 1M5BA 4MF3A 4HE2A 3USDA 4ZZAA 3R6UA 2Q8MA 4H1XA 4RPOA 3K1PA 1MY3A 3TTLA 4XKPA
chains in the Genus database with same CATH topology
5CBSA 3LSLA 4ONYA 3T96B 3LSFB 4ZECA 5L8DA 4LZ8A 5I59B 1ZIUA 1R1NA 2O1LA 3VFJA 2F78A 4DCXA 1N04A 3L6GA 1H43A 2ZYKA 1LAXA 3OEKA 5HBCA 1RYXA 4QSCA 1N3XA 4OYVA 3G3FA 2DWIA 1LFIA 3KZGA 1A55A 3N94A 1B5JA 1Y20A 2BJJX 2O7IA 2ZNUA 3RY3A 1TT1A 4EDPA 4EQBA 2XHDA 1SYHA 2A5TA 3H6UA 3C32A 1B9JA 4ELPA 1B05A 1BTJA 1HSEA 4R74A 2UVJA 3TCGA 4RXLA 3HV1A 4P11A 1B46A 3CFLA 3KEIA 4NMYA 3IK6B 1LLSA 5I2KA 3BFTA 2Z8EA 4JWYA 3IO6A 3T9HB 4BDQA 2XD3A 3FVNA 4XTCQ 3OXNA 1DOTA 3RLFE 3BBRA 3PPPA 3MUQA 3T93B 5DEXA 4K3FA 3U92A 2CZLA 2D3IA 1A40A 2AL5A 4U4SA 1XS5A 1IXHA 4O3AA 3B6QA 4RA1A 4X1DA 5H8FB 3QYTA 4RK9A 2Z8DA 4GXAA 3PUVE 4POWA 2HZKA 3C35A 4EUOA 3M8UA 4LVQA 2AIXA 4TOZA 2I0CA 5IKBA 3V89B 5AA2B 1SD3A 4G2ZA 2GRVA 5J1DA 1Z7NE 3G3IA 3B7DA 5TPAA 4ELRA 1XHYA 2GHAA 4F39A 4H0WA 3OSQA 2HQ0A 1ZKBA 1Y4CA 1B3GA 3K01A 1AIVA 3E3KA 1O7TA 4X9TA 2V3UA 2ZYMA 3A3UA 3L6HA 3FGSA 4ZEIA 1I69A 3K2DA 2VHAA 2XD2A 1EZOA 3KOSA 4KYSA 5L9OA 5CMKA 4AB6A 4I1DA 1QUKA 2Y7KA 3VVDA 3KSXA 5JTYB 3I6VA 3O2AA 4ZS9A 4I8CA 4JBZA 1BP5A 4Z0IA 4F1YA 1B0LA 2E0SA 4F3SA 3RQTA 1B5HA 3UK4A 4U1ZA 2RKMA 5EYFA 2QPQA 4RNSA 1VSOA 1B4ZA 2DVZA 1POTA 3C31A 2H99A 3IAZA 3CG1A 4WKMA 1M5EA 1YPNA 2AYSA 4IO4A 1JW5A 4OEUA 4KQPA 3EHUA 1POY1 2KLFA 2QRYA 2Q2CA 1PC3A 4KYEA 2I49A 2RC7A 4ZE8A 3TCHA 2R9JA 4R2FA 4KCDA 1USYH 2HFBA 5F1QA 3O97A 1NH8A 4TLMB 2DWHA 1MXXA 3GBAA 4NF5A 1SW2A 5ICTA 3SESA 2O7UA 1MM6A 3IJOB 4NF4A 1HSJA 3H06B 1LAGE 4LP2B 1NNTA 2HEUA 1P1QA 3H6VA 3O66A 1UTHB 3FVOA 3MZBA 3SEUA 3EPEA 3RT6B 4KYDA 2B3FA 1SI0A 5CBRA 2REJA 3FJGA 3VV5A 4ZZEA 3MC2A 1FQCA 2E1SA 1TXFA 4P0GA 2OCUA 5M2VA 1MY0A 3TQWA 2F36A 2V3TA 5BWJA 4ZEKA 1J1NA 4OETA 1JEUA 3THIA 1IXGA 1IXCA 5KDTB 1US5A 1ZJLA 3SEWA 1URGA 4H5FA 2DP8A 1H44A 3JV9A 4XIGQ 4NF6A 3D4GA 4R2BA 3HPIA 3PPNA 3FVGA 3KN8A 4H8JA 3DLNA 4FECA 5H8HA 4F19A 3IOUA 5TP9B 2V93A 2M8CA 2RCAA 1IITA 3O6HA 1MPCA 3QUFA 2GHBA 4IY5A 3SERA 4E0XA 2I6EA 4MLQA 4GLIA 4OWDA 4FORA 4Q30B 3IB0A 3K6VA 4HS7A 4ISUA 2O1MA 5I57B 2Z23A 4OERA 3UORA 4DXCA 1B3HA 4OHNA 4ECFA 4RK2A 3E4RA 3LBSA 1B1XA 1B4HA 3T9VA 1AH5A 5ICQA 4G8NA 4FATA 5L9SA 3QAXA 4EXLA 1P1WA 1Y3NA 4AB5A 1QVSA 3CR9A 3PPOA 4EXKA 2DSFA 2QS2A 2F7BA 1M5FA 2X26A 2Q9TA 2DXYA 1Y1MA 3MP6A 2HCAA 3SKPA 3FXQA 3HN0A 5KZTA 3HHFA 1FTKA 3UN6A 3M3FA 1DSNA 4JWOA 2ESNA 4OQOA 1NH7A 3MVYA 2FA7A 1N76A 4OEVA 5AA4B 5AA1A 3ZS6A 5DYHA 2QMXA 2UYFA 4YKPA 1NMUA 3K0VA 3BKIB 4BLAA 3SEVA 1LCFA 4C1UA 3ZSFA 1P99A 2DE4A 2Q88A 4RY1A 2ANJA 1LBCA 5DVFA 4YB6A 4BDLA 3RTWB 3B6TA 1MY4A 1B7HA 4THIA 5EHSA 3T66A 3S2VA 3AXFA 2PX1A 4GD5A 1B3EA 3SEYA 3EHTA 4GF8A 3PGFA 3TTMA 1A54A 2WKYA 1N0TA 1D3KA 2IEEA 3OO9A 4G68C 3VLVA 4F3GA 3MW0A 4FIMA 5K2YA 2NUVA 4EF1A 1AL3A 4GXSB 4QFLA 1BKAA 2HAUA 4R73A 1OQGA 4L17A 3H03A 2RINA 1LB9A 4AQ4A 1CB6A 4NEDA 3PMWA 1EU8A 4YU0A 1ZU0A 1MS7A 2XX9A 5A5XB 1BIYA 2I4BA 2RCBA 2YJPA 4HCWA 1SW1A 5AA2A 5JK4A 5I56B 3UIFA 5KCJA 1JEVA 1MQGA 2ABHA 3QSLA 1II5A 2XXQA 3MWBA 3IOVA 4UA8A 1FW0A 1DMBA 1NNPA 3ONMA 4DIGA 1ZTYA 4ZDMA 1PEBA 3K1MA 4HCYA 3N6UA 4ZEDA 1B6HA 3PMXA 4GOTA 1OQHA 4OZ9A 4POXA 3TYHA 3S9LC 1MQIA 1A8EA 3VVEA 4LA9A 5DVIA 4QF9A 1NKXA 3RTFB 4PP0A 4LZ5A 1FTMA 1MQJA 4RYAA 1F9BA 1WVJA 1FTLA 3E9XA 2H5YA 3K00A 3PMVA 4LONB 1B52A 3H7MA 4NWCA 1T0KA 5CRYA 3VLUA 3A3CA 5DVJA 3MVXA 4MBPA 3H3GA 4Z7EA 2HZLA 3CIJA 1OVTA 3CSBA 3LUYA 3DP6A 3U1OA 3RUMA 5H8SA 4EF2A 1Q35A 3QUJA 3N26A 3IL1B 1GVCA 1FQDA 2QS4A 4U4XA 4KR5A 4GWOA 3MVWA 1JNFA 3M3KA 3IORA 2P1SA 3CFXA 1N84A 1GR2A 1FQFA 1IXIA 2I48A 1PBPA 5CM6A 3K02A 3S9NC 4YKIA 1B58A 4OMBA 3HHGA 3I5OA 2F35A 2LAOA 3GZGA 1N3WA 3TTNA 3TUSA 5H8NA 2ONSA 4MLVA 5FHMA 2I0BA 4LQ5A 4G68A 1R9QA 3C33A 1URSA 4GQOA 5FTIA 1HSLA 3S9EA 2QS1A 5FHNA 3C9HA 2NVUB 5KDTA 1B7ZA 3KN3A 4YMAA 2QMWA 4JSDA 3FUZA 3EN3A 1QKBA 4YB5A 4FEBA 3PV0E 1UTBA 2PYYA 1Y9UA 4IB2A 4ZE9A 2X7QA 2DYXA 4PQJA 2Y7PA 1B40A 1I6QA 1QUIA 1DPPA 3TTKA 4IO6A 1UIUA 2Z22A 4XXUA 1MPDA 5DEXB 1N7XA 3ZKLA 1B1HA 3MAMA 3RN8A 2G93A 3OENA 1PBQA 3OO8A 1Y1ZA 2OWTA 5I2NA 2QL3A 2H4IA 2D5WA 4EQ9A 1NNKA 4OENA 4NF8A 4TLLB 4ESWA 4P0IA 3MVZA 4PFYA 5ITPA 3O6IA 2Y7RA 5CMCA 4MH5A 1URDA 3FVKA 4N6PA 4G8MA 4QRZA 3KBRA 4KCCA 2I4CA 3TKDA 1A8FA 3VXCA 3KG2A 4QSEA 1B51A 2FYIA 4PFWA 1B3LA 4XKNA 5TPAB 2O68A 2VOZA 4BDMA 2XXVA 1Z7ME 1O63A 4Q5TA 4R9FA 2PT2A 1MY1A 1UIVA 1OMPA 5EHMA 3TFLA 4WEPA 4HTGA 4OVJA 1D4NA 1SW4A 1P1NA 3QK6A 2OK2A 3MBPA 4IO2A 3U8QA 4IGTA 4WEDA 4U1OA 2UVHA 2NWJA 3OO6A 1AOVA 1P1UA 3O6GA 5CC2A 4DXBA 3G3KA 1FCKA 2F8DA 1M5DA 3ODBA 1H45A 1MPBA 4QFPA 3IB2A 1XC1A 2RF1A 1OVBA 4KFQA 2DE2A 2I58A 4GFRA 3O29A 4G4PA 3ILTB 1VFDA 1LFGA 3TEPA 5H8QA 1PB9A 2UXAA 4YZZA 4JB7A 1B0HA 4NF5B 4IGRA 3OELA 2UVIA 3W9WA 4F2OA 2YLNA 1MQHA 5I58B 3FJ7A 4QFOA 1EZPA 4NF4B 4ESXA 2XXUA 4DCYA 1N7WA 1FTJA 2V25A 3R26A 4OESA 4Q0CA 4O3CA 3LR1A 3PPQA 4IO5A 3TDJA 3K6UA 3ZKKA 4YMBA 5AA3A 2VP1A 4I9DA 3LSXA 4M1VA 4XKRA 4ZEFA 4H65A 4DE8A 2F97A 1O64A 2ZYOA 5I59A 2V3QA 2V84A 3VLWA 5A5XA 1YAEA 1B2HA 2QSXA 3S9MC 1DTGA 3C34A 1MXZA 5ELVA 3ILUB 1DPEA 2XX7A 4GVOA 4JSOA 2ZNTA 4KI0E 4X1BA 2AL4A 4NF6B 1LFHA 1A99A 1EZ9A 1TWYA 3CSGA 4C0RA 1MG1A 2HXWA 1PB8A 2FNCA 5H8HB 3DP8A 3GBBA 2F6PA 2F6GA 4GIZA 3FV1A 3PUYE 3E13X 2Y84A 1ZMGA 4E0WA 2XXPA 3KOTA 4H6DA 3FIRA 5HM4B 4H67A 2G29A 2OBGA 3RGYA 5CMMA 1VE4A 3TCFA 4ZEBA 2QS3A 3KJ7A 4FAJA 5IAIA 4RJZA 4R72A 3IX1A 3FXRA 4YAHX 1TFAA 1RKMA 1SW5A 4N13A 3FASA 3SEXA 2I3VA 2R71A 2DOJA 4MFIA 3OSRA 5H8FA 3VVFA 1MRPA 1GGGA 4C1TA 1NL5A 3TZAA 2A5SA 3MPLA 3O9PA 3JYRA 3N5LA 3DELB 1QKAA 4BDNA 1SVXB 4OFJA 4X48A 3PUXE 3KN7A 2ZXTA 4G8HA 4LUBA 2OLBA 1IEJA 2ONKE 2RC8A 3U94A 1SYIA 1XVXA 2W7YA 4H8IA 4NWDA 4WXJA 3OD7A 1UQWA 1FTOA 5AE4A 1MQDA 4R75A 4IO7A 5K2XA 3B6WA 2NOOA 3I3VA 1LAFE 3O28A 3Q28A 5BUUA 4O3BA 3RPWA 2VD2A 5JTYA 4BDRA 3A09A 4Q8RA 2XXTA 4FJPA 2F34A 2O51A 3GLBA 3TMGA 4QHQA 2VD3A 4NE4A 3Q26A 1FQEA 1LSTA 4ND9A 3MP8A 1H76A 1IUDA 1H3DA 4FEDA 3Q27A 3UGWA 2DVCA 4OTEA 1I6BA 2ONRA 4TQUQ 2DQVA 3WAEA 1I6AA 2H9BA 2P0SA 1ELJA 2REGA 3G3HA 2YPNA 3FJMA 3VE1B 1XT8A 4F22A 3VDFA 4IO3A 3T22A 4OXVA 5TU0A 1ZLQA 5JEIA 3ECRA 2O69A 4LZ7A 1S7YA 3G3JA 1UTHA 3K1NA 2GFEA 1MM7A 1L5TA 3VXBA 4YKKA 4XKQA 2UVGA 5KCJB 2XX8A 2DS9A 2ZMBA 4F1VA 4R6HA 4YKJA 1SBPA 1OLCA 4UACA 4LQ2A 5ISUA 3OO7A 2R6GE 2A5TB 4RPNA 2RC9A 3TAJA 1YTVA 4DZ1A 2OJTA 4EQ7A 2I3WA 1SQYA 3EQ1A 3IO4A 4F2QA 1OIBA 3G3GA 5B7DA 2DXRA 5I2KB 1KWHA 2Q8JA 5TP9A 3FZVA 3RT8A 1PB7A 1LGBC 2Q89A 2UYEA 4QSDA 3P7IA 1FQAA 3PPRA 3DP4A 1JVXA 3WAFA 3BFUA 1LB8A 1Y3QA 2QJEA 2XXYA 5L9MA 3JZJA 2DWJA 3SDFA 1NFTA 1IZ1A 2PMSA 1R9LA 1AMFA 2H25A 5I57A 1WODA 4LATA 2O6AA 3SETA 1MDQA 5F7VA 1P1OA 4I62A 1LBBA 3C4MA 5LOMA 3M3LA 1XVYA 3MQ9A 1DTZA 3K6WA 1US4A 3LC8A 4PE5B 1M5CA 2CMOA 1MY2A 1RYOA 4F3PA 4JWXA 2Y7WA 1IQ7A 2XXWA 2XXIA 1USYE 4F29A 2Q2AA 1VFEA 4GL8A 3KJTA 4U2RA 5I58A 3TELA 1MXWA 2XXXA 1LCTA 1MXYA 3FATA 4GRKA 1S50A 3EF7A 3N6TA 1ZBMA 1JW1A 4GL0A 3OEMA 1D9VA 5I84A 4G77A 5H8NB 3TQLA 3V5AA 1GTKA 5CMBA 3IOTA 3CI8A 1FQBA 4R9GA 3QXMA 4JXIA 4QFKA 1YCJA 4NTLA 2HAVA 2XXRA 5HPQA 4DDDA 1GV8A 4G68B 1ANFA 2PT1A 1B5IA 4QFNA 1JW4A 5AA4A 5DTBA 5FHOA 4F18A 1A7LA 3IOWA 3FD3A 3FV2A 1Y4TA 1WDNA 4PETA 1OLAA 1MH3A 3Q29A 2IA4A 2OZZA 1LAHE 2PBWA 4ELOA 1QW0A 3FXUA 1UTBB 3T9UA 3S4UA 3KGCA 3R7XA 3V83A 4YICA 3CRBA 3PUWE 4KHZE 3U72A 3UA8A 1EH3A 2DE3A 3CVGA 2DWAA 1MDP1 4F1UA 4M4GA 3OMBA 1CE2A 2ALUA 3Q25A 2H98A 2XXHA 1SDXA 3K6XA 3G7WA 4DXUA 2F7AA 5I2NB 1JQFA 4F3BA 5FTHA 3IJXB 2X7PA 1TFDA 4KD5A 1MH4A 4NF8B 2Z8FA 3IR1A 3LSWA 3CFZA 3DM0A 1ATGA 1QULA 4FE8A 3T9XB 3MZ9A 1D9YA 2VGQA 5ITOA 4F31B 4IY6A 1Y3PA 4ELQA 1BLFA 1QJMA 3IB1A 4JDFA 1JVYA 4KPTA 1R6ZA 2D21A 4BDOA 4N07A 5I56A 2P2AA 1NNFA 3EHSA 4H5GA 3PD9A 5CI5A 3V8XB 1B7UA 3PD8A 4U21A 4YB7A 2THIA 3W15C 1MXUA 3MJNA 1S9TA 4U22A 1MXVA 2ZYNA 3F11A 3PU5A 3TODA 4OFLA 1Q1KA 4R6YA 3MZ1A 3HCQA 2B3BA 1B32A 3TTRA 3CG3A 2Y7IA 3HO7A 5DT6A 3GXAA 2O84X 1SI1A 4R6KA 2GH9A 3OOAA 3QIMA 1QUJA 1JETA 2F5XA 5B70A 2OWSA 4OFOA 2NXOA 3H4ZA 1B3FA 1IIWA 2F7CA 3U93A 3HSTA 2PVUA 3C36A 3H6WA 3RNNA 1VR5A 1PDAA 3MP1A 2ZNSA 4PFUA 3K4UA 3KSJA 5H8QB 3W9VA 4DLDA 2B65A 5AA2D 4U23A 4HW8A 1XOCA 3UP9A 3D4CA 4PFTA 3TPAA 3KFMA 3H6TA 3MPKA 3PUZE 1M5BA 4MF3A 3USDA 4ZZAA 3R6UA 4H1XA 4RPOA 3K1PA 1MY3A 3TTLA 4XKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBS A;  3LSL A;  4ONY A;  3T96 B;  3LSF B;  4ZEC A;  5L8D A;  4LZ8 A;  5I59 B;  1ZIU A;  1R1N A;  2O1L A;  3VFJ A;  2F78 A;  4DCX A;  1N04 A;  3L6G A;  1H43 A;  2ZYK A;  1LAX A;  3OEK A;  5HBC A;  1RYX A;  4QSC A;  1N3X A;  4OYV A;  3G3F A;  2DWI A;  1LFI A;  3KZG A;  1A55 A;  3N94 A;  1B5J A;  1Y20 A;  2BJJ X;  2O7I A;  2ZNU A;  3RY3 A;  1TT1 A;  4EDP A;  4EQB A;  2XHD A;  1SYH A;  2A5T A;  3H6U A;  3C32 A;  1B9J A;  4ELP A;  1B05 A;  1BTJ A;  1HSE A;  4R74 A;  2UVJ A;  3TCG A;  4RXL A;  3HV1 A;  4P11 A;  1B46 A;  3CFL A;  3KEI A;  4NMY A;  3IK6 B;  1LLS A;  5I2K A;  3BFT A;  2Z8E A;  4JWY A;  3IO6 A;  3T9H B;  4BDQ A;  2XD3 A;  3FVN A;  4XTC Q;  3OXN A;  1DOT A;  3RLF E;  3BBR A;  3PPP A;  3MUQ A;  3T93 B;  5DEX A;  4K3F A;  3U92 A;  2CZL A;  2D3I A;  1A40 A;  2AL5 A;  4U4S A;  1XS5 A;  1IXH A;  4O3A A;  3B6Q A;  4RA1 A;  4X1D A;  5H8F B;  3QYT A;  4RK9 A;  2Z8D A;  4GXA A;  3PUV E;  4POW A;  2HZK A;  3C35 A;  4EUO A;  3M8U A;  4LVQ A;  2AIX A;  4TOZ A;  2I0C A;  5IKB A;  3V89 B;  5AA2 B;  1SD3 A;  4G2Z A;  2GRV A;  5J1D A;  1Z7N E;  3G3I A;  3B7D A;  5TPA A;  4ELR A;  1XHY A;  2GHA A;  4F39 A;  4H0W A;  3OSQ A;  2HQ0 A;  1ZKB A;  1Y4C A;  1B3G A;  3K01 A;  1AIV A;  3E3K A;  1O7T A;  4X9T A;  2V3U A;  2ZYM A;  3A3U A;  3L6H A;  3FGS A;  4ZEI A;  1I69 A;  3K2D A;  2VHA A;  2XD2 A;  1EZO A;  3KOS A;  4KYS A;  5L9O A;  5CMK A;  4AB6 A;  4I1D A;  1QUK A;  2Y7K A;  3VVD A;  3KSX A;  5JTY B;  3I6V A;  3O2A A;  4ZS9 A;  4I8C A;  4JBZ A;  1BP5 A;  4Z0I A;  4F1Y A;  1B0L A;  2E0S A;  4F3S A;  3RQT A;  1B5H A;  3UK4 A;  4U1Z A;  2RKM A;  5EYF A;  2QPQ A;  4RNS A;  1VSO A;  1B4Z A;  2DVZ A;  1POT A;  3C31 A;  2H99 A;  3IAZ A;  3CG1 A;  4WKM A;  1M5E A;  1YPN A;  2AYS A;  4IO4 A;  1JW5 A;  4OEU A;  4KQP A;  3EHU A;  1POY 1;  2KLF A;  2QRY A;  2Q2C A;  1PC3 A;  4KYE A;  2I49 A;  2RC7 A;  4ZE8 A;  3TCH A;  2R9J A;  4R2F A;  4KCD A;  1USY H;  2HFB A;  5F1Q A;  3O97 A;  1NH8 A;  4TLM B;  2DWH A;  1MXX A;  3GBA A;  4NF5 A;  1SW2 A;  5ICT A;  3SES A;  2O7U A;  1MM6 A;  3IJO B;  4NF4 A;  1HSJ A;  3H06 B;  1LAG E;  4LP2 B;  1NNT A;  2HEU A;  1P1Q A;  3H6V A;  3O66 A;  1UTH B;  3FVO A;  3MZB A;  3SEU A;  3EPE A;  3RT6 B;  4KYD A;  2B3F A;  1SI0 A;  5CBR A;  2REJ A;  3FJG A;  3VV5 A;  4ZZE A;  3MC2 A;  1FQC A;  2E1S A;  1TXF A;  4P0G A;  2OCU A;  5M2V A;  1MY0 A;  3TQW A;  2F36 A;  2V3T A;  5BWJ A;  4ZEK A;  1J1N A;  4OET A;  1JEU A;  3THI A;  1IXG A;  1IXC A;  5KDT B;  1US5 A;  1ZJL A;  3SEW A;  1URG A;  4H5F A;  2DP8 A;  1H44 A;  3JV9 A;  4XIG Q;  4NF6 A;  3D4G A;  4R2B A;  3HPI A;  3PPN A;  3FVG A;  3KN8 A;  4H8J A;  3DLN A;  4FEC A;  5H8H A;  4F19 A;  3IOU A;  5TP9 B;  2V93 A;  2M8C A;  2RCA A;  1IIT A;  3O6H A;  1MPC A;  3QUF A;  2GHB A;  4IY5 A;  3SER A;  4E0X A;  2I6E A;  4MLQ A;  4GLI A;  4OWD A;  4FOR A;  4Q30 B;  3IB0 A;  3K6V A;  4HS7 A;  4ISU A;  2O1M A;  5I57 B;  2Z23 A;  4OER A;  3UOR A;  4DXC A;  1B3H A;  4OHN A;  4ECF A;  4RK2 A;  3E4R A;  3LBS A;  1B1X A;  1B4H A;  3T9V A;  1AH5 A;  5ICQ A;  4G8N A;  4FAT A;  5L9S A;  3QAX A;  4EXL A;  1P1W A;  1Y3N A;  4AB5 A;  1QVS A;  3CR9 A;  3PPO A;  4EXK A;  2DSF A;  2QS2 A;  2F7B A;  1M5F A;  2X26 A;  2Q9T A;  2DXY A;  1Y1M A;  3MP6 A;  2HCA A;  3SKP A;  3FXQ A;  3HN0 A;  5KZT A;  3HHF A;  1FTK A;  3UN6 A;  3M3F A;  1DSN A;  4JWO A;  2ESN A;  4OQO A;  1NH7 A;  3MVY A;  2FA7 A;  1N76 A;  4OEV A;  5AA4 B;  5AA1 A;  3ZS6 A;  5DYH A;  2QMX A;  2UYF A;  4YKP A;  1NMU A;  3K0V A;  3BKI B;  4BLA A;  3SEV A;  1LCF A;  4C1U A;  3ZSF A;  1P99 A;  2DE4 A;  2Q88 A;  4RY1 A;  2ANJ A;  1LBC A;  5DVF A;  4YB6 A;  4BDL A;  3RTW B;  3B6T A;  1MY4 A;  1B7H A;  4THI A;  5EHS A;  3T66 A;  3S2V A;  3AXF A;  2PX1 A;  4GD5 A;  1B3E A;  3SEY A;  3EHT A;  4GF8 A;  3PGF A;  3TTM A;  1A54 A;  2WKY A;  1N0T A;  1D3K A;  2IEE A;  3OO9 A;  4G68 C;  3VLV A;  4F3G A;  3MW0 A;  4FIM A;  5K2Y A;  2NUV A;  4EF1 A;  1AL3 A;  4GXS B;  4QFL A;  1BKA A;  2HAU A;  4R73 A;  1OQG A;  4L17 A;  3H03 A;  2RIN A;  1LB9 A;  4AQ4 A;  1CB6 A;  4NED A;  3PMW A;  1EU8 A;  4YU0 A;  1ZU0 A;  1MS7 A;  2XX9 A;  5A5X B;  1BIY A;  2I4B A;  2RCB A;  2YJP A;  4HCW A;  1SW1 A;  5AA2 A;  5JK4 A;  5I56 B;  3UIF A;  5KCJ A;  1JEV A;  1MQG A;  2ABH A;  3QSL A;  1II5 A;  2XXQ A;  3MWB A;  3IOV A;  4UA8 A;  1FW0 A;  1DMB A;  1NNP A;  3ONM A;  4DIG A;  1ZTY A;  4ZDM A;  1PEB A;  3K1M A;  4HCY A;  3N6U A;  4ZED A;  1B6H A;  3PMX A;  4GOT A;  1OQH A;  4OZ9 A;  4POX A;  3TYH A;  3S9L C;  1MQI A;  1A8E A;  3VVE A;  4LA9 A;  5DVI A;  4QF9 A;  1NKX A;  3RTF B;  4PP0 A;  4LZ5 A;  1FTM A;  1MQJ A;  4RYA A;  1F9B A;  1WVJ A;  1FTL A;  3E9X A;  2H5Y A;  3K00 A;  3PMV A;  4LON B;  1B52 A;  3H7M A;  4NWC A;  1T0K A;  5CRY A;  3VLU A;  3A3C A;  5DVJ A;  3MVX A;  4MBP A;  3H3G A;  4Z7E A;  2HZL A;  3CIJ A;  1OVT A;  3CSB A;  3LUY A;  3DP6 A;  3U1O A;  3RUM A;  5H8S A;  4EF2 A;  1Q35 A;  3QUJ A;  3N26 A;  3IL1 B;  1GVC A;  1FQD A;  2QS4 A;  4U4X A;  4KR5 A;  4GWO A;  3MVW A;  1JNF A;  3M3K A;  3IOR A;  2P1S A;  3CFX A;  1N84 A;  1GR2 A;  1FQF A;  1IXI A;  2I48 A;  1PBP A;  5CM6 A;  3K02 A;  3S9N C;  4YKI A;  1B58 A;  4OMB A;  3HHG A;  3I5O A;  2F35 A;  2LAO A;  3GZG A;  1N3W A;  3TTN A;  3TUS A;  5H8N A;  2ONS A;  4MLV A;  5FHM A;  2I0B A;  4LQ5 A;  4G68 A;  1R9Q A;  3C33 A;  1URS A;  4GQO A;  5FTI A;  1HSL A;  3S9E A;  2QS1 A;  5FHN A;  3C9H A;  2NVU B;  5KDT A;  1B7Z A;  3KN3 A;  4YMA A;  2QMW A;  4JSD A;  3FUZ A;  3EN3 A;  1QKB A;  4YB5 A;  4FEB A;  3PV0 E;  1UTB A;  2PYY A;  1Y9U A;  4IB2 A;  4ZE9 A;  2X7Q A;  2DYX A;  4PQJ A;  2Y7P A;  1B40 A;  1I6Q A;  1QUI A;  1DPP A;  3TTK A;  4IO6 A;  1UIU A;  2Z22 A;  4XXU A;  1MPD A;  5DEX B;  1N7X A;  3ZKL A;  1B1H A;  3MAM A;  3RN8 A;  2G93 A;  3OEN A;  1PBQ A;  3OO8 A;  1Y1Z A;  2OWT A;  5I2N A;  2QL3 A;  2H4I A;  2D5W A;  4EQ9 A;  1NNK A;  4OEN A;  4NF8 A;  4TLL B;  4ESW A;  4P0I A;  3MVZ A;  4PFY A;  5ITP A;  3O6I A;  2Y7R A;  5CMC A;  4MH5 A;  1URD A;  3FVK A;  4N6P A;  4G8M A;  4QRZ A;  3KBR A;  4KCC A;  2I4C A;  3TKD A;  1A8F A;  3VXC A;  3KG2 A;  4QSE A;  1B51 A;  2FYI A;  4PFW A;  1B3L A;  4XKN A;  5TPA B;  2O68 A;  2VOZ A;  4BDM A;  2XXV A;  1Z7M E;  1O63 A;  4Q5T A;  4R9F A;  2PT2 A;  1MY1 A;  1UIV A;  1OMP A;  5EHM A;  3TFL A;  4WEP A;  4HTG A;  4OVJ A;  1D4N A;  1SW4 A;  1P1N A;  3QK6 A;  2OK2 A;  3MBP A;  4IO2 A;  3U8Q A;  4IGT A;  4WED A;  4U1O A;  2UVH A;  2NWJ A;  3OO6 A;  1AOV A;  1P1U A;  3O6G A;  5CC2 A;  4DXB A;  3G3K A;  1FCK A;  2F8D A;  1M5D A;  3ODB A;  1H45 A;  1MPB A;  4QFP A;  3IB2 A;  1XC1 A;  2RF1 A;  1OVB A;  4KFQ A;  2DE2 A;  2I58 A;  4GFR A;  3O29 A;  4G4P A;  3ILT B;  1VFD A;  1LFG A;  3TEP A;  5H8Q A;  1PB9 A;  2UXA A;  4YZZ A;  4JB7 A;  1B0H A;  4NF5 B;  4IGR A;  3OEL A;  2UVI A;  3W9W A;  4F2O A;  2YLN A;  1MQH A;  5I58 B;  3FJ7 A;  4QFO A;  1EZP A;  4NF4 B;  4ESX A;  2XXU A;  4DCY A;  1N7W A;  1FTJ A;  2V25 A;  3R26 A;  4OES A;  4Q0C A;  4O3C A;  3LR1 A;  3PPQ A;  4IO5 A;  3TDJ A;  3K6U A;  3ZKK A;  4YMB A;  5AA3 A;  2VP1 A;  4I9D A;  3LSX A;  4M1V A;  4XKR A;  4ZEF A;  4H65 A;  4DE8 A;  2F97 A;  1O64 A;  2ZYO A;  5I59 A;  2V3Q A;  2V84 A;  3VLW A;  5A5X A;  1YAE A;  1B2H A;  2QSX A;  3S9M C;  1DTG A;  3C34 A;  1MXZ A;  5ELV A;  3ILU B;  1DPE A;  2XX7 A;  4GVO A;  4JSO A;  2ZNT A;  4KI0 E;  4X1B A;  2AL4 A;  4NF6 B;  1LFH A;  1A99 A;  1EZ9 A;  1TWY A;  3CSG A;  4C0R A;  1MG1 A;  2HXW A;  1PB8 A;  2FNC A;  5H8H B;  3DP8 A;  3GBB A;  2F6P A;  2F6G A;  4GIZ A;  3FV1 A;  3PUY E;  3E13 X;  2Y84 A;  1ZMG A;  4E0W A;  2XXP A;  3KOT A;  4H6D A;  3FIR A;  5HM4 B;  4H67 A;  2G29 A;  2OBG A;  3RGY A;  5CMM A;  1VE4 A;  3TCF A;  4ZEB A;  2QS3 A;  3KJ7 A;  4FAJ A;  5IAI A;  4RJZ A;  4R72 A;  3IX1 A;  3FXR A;  4YAH X;  1TFA A;  1RKM A;  1SW5 A;  4N13 A;  3FAS A;  3SEX A;  2I3V A;  2R71 A;  2DOJ A;  4MFI A;  3OSR A;  5H8F A;  3VVF A;  1MRP A;  1GGG A;  4C1T A;  1NL5 A;  3TZA A;  2A5S A;  3MPL A;  3O9P A;  3JYR A;  3N5L A;  3DEL B;  1QKA A;  4BDN A;  1SVX B;  4OFJ A;  4X48 A;  3PUX E;  3KN7 A;  2ZXT A;  4G8H A;  4LUB A;  2OLB A;  1IEJ A;  2ONK E;  2RC8 A;  3U94 A;  1SYI A;  1XVX A;  2W7Y A;  4H8I A;  4NWD A;  4WXJ A;  3OD7 A;  1UQW A;  1FTO A;  5AE4 A;  1MQD A;  4R75 A;  4IO7 A;  5K2X A;  3B6W A;  2NOO A;  3I3V A;  1LAF E;  3O28 A;  3Q28 A;  5BUU A;  4O3B A;  3RPW A;  2VD2 A;  5JTY A;  4BDR A;  3A09 A;  4Q8R A;  2XXT A;  4FJP A;  2F34 A;  2O51 A;  3GLB A;  3TMG A;  4QHQ A;  2VD3 A;  4NE4 A;  3Q26 A;  1FQE A;  1LST A;  4ND9 A;  3MP8 A;  1H76 A;  1IUD A;  1H3D A;  4FED A;  3Q27 A;  3UGW A;  2DVC A;  4OTE A;  1I6B A;  2ONR A;  4TQU Q;  2DQV A;  3WAE A;  1I6A A;  2H9B A;  2P0S A;  1ELJ A;  2REG A;  3G3H A;  2YPN A;  3FJM A;  3VE1 B;  1XT8 A;  4F22 A;  3VDF A;  4IO3 A;  3T22 A;  4OXV A;  5TU0 A;  1ZLQ A;  5JEI A;  3ECR A;  2O69 A;  4LZ7 A;  1S7Y A;  3G3J A;  1UTH A;  3K1N A;  2GFE A;  1MM7 A;  1L5T A;  3VXB A;  4YKK A;  4XKQ A;  2UVG A;  5KCJ B;  2XX8 A;  2DS9 A;  2ZMB A;  4F1V A;  4R6H A;  4YKJ A;  1SBP A;  1OLC A;  4UAC A;  4LQ2 A;  5ISU A;  3OO7 A;  2R6G E;  2A5T B;  4RPN A;  2RC9 A;  3TAJ A;  1YTV A;  4DZ1 A;  2OJT A;  4EQ7 A;  2I3W A;  1SQY A;  3EQ1 A;  3IO4 A;  4F2Q A;  1OIB A;  3G3G A;  5B7D A;  2DXR A;  5I2K B;  1KWH A;  2Q8J A;  5TP9 A;  3FZV A;  3RT8 A;  1PB7 A;  1LGB C;  2Q89 A;  2UYE A;  4QSD A;  3P7I A;  1FQA A;  3PPR A;  3DP4 A;  1JVX A;  3WAF A;  3BFU A;  1LB8 A;  1Y3Q A;  2QJE A;  2XXY A;  5L9M A;  3JZJ A;  2DWJ A;  3SDF A;  1NFT A;  1IZ1 A;  2PMS A;  1R9L A;  1AMF A;  2H25 A;  5I57 A;  1WOD A;  4LAT A;  2O6A A;  3SET A;  1MDQ A;  5F7V A;  1P1O A;  4I62 A;  1LBB A;  3C4M A;  5LOM A;  3M3L A;  1XVY A;  3MQ9 A;  1DTZ A;  3K6W A;  1US4 A;  3LC8 A;  4PE5 B;  1M5C A;  2CMO A;  1MY2 A;  1RYO A;  4F3P A;  4JWX A;  2Y7W A;  1IQ7 A;  2XXW A;  2XXI A;  1USY E;  4F29 A;  2Q2A A;  1VFE A;  4GL8 A;  3KJT A;  4U2R A;  5I58 A;  3TEL A;  1MXW A;  2XXX A;  1LCT A;  1MXY A;  3FAT A;  4GRK A;  1S50 A;  3EF7 A;  3N6T A;  1ZBM A;  1JW1 A;  4GL0 A;  3OEM A;  1D9V A;  5I84 A;  4G77 A;  5H8N B;  3TQL A;  3V5A A;  1GTK A;  5CMB A;  3IOT A;  3CI8 A;  1FQB A;  4R9G A;  3QXM A;  4JXI A;  4QFK A;  1YCJ A;  4NTL A;  2HAV A;  2XXR A;  5HPQ A;  4DDD A;  1GV8 A;  4G68 B;  1ANF A;  2PT1 A;  1B5I A;  4QFN A;  1JW4 A;  5AA4 A;  5DTB A;  5FHO A;  4F18 A;  1A7L A;  3IOW A;  3FD3 A;  3FV2 A;  1Y4T A;  1WDN A;  4PET A;  1OLA A;  1MH3 A;  3Q29 A;  2IA4 A;  2OZZ A;  1LAH E;  2PBW A;  4ELO A;  1QW0 A;  3FXU A;  1UTB B;  3T9U A;  3S4U A;  3KGC A;  3R7X A;  3V83 A;  4YIC A;  3CRB A;  3PUW E;  4KHZ E;  3U72 A;  3UA8 A;  1EH3 A;  2DE3 A;  3CVG A;  2DWA A;  1MDP 1;  4F1U A;  4M4G A;  3OMB A;  1CE2 A;  2ALU A;  3Q25 A;  2H98 A;  2XXH A;  1SDX A;  3K6X A;  3G7W A;  4DXU A;  2F7A A;  5I2N B;  1JQF A;  4F3B A;  5FTH A;  3IJX B;  2X7P A;  1TFD A;  4KD5 A;  1MH4 A;  4NF8 B;  2Z8F A;  3IR1 A;  3LSW A;  3CFZ A;  3DM0 A;  1ATG A;  1QUL A;  4FE8 A;  3T9X B;  3MZ9 A;  1D9Y A;  2VGQ A;  5ITO A;  4F31 B;  4IY6 A;  1Y3P A;  4ELQ A;  1BLF A;  1QJM A;  3IB1 A;  4JDF A;  1JVY A;  4KPT A;  1R6Z A;  2D21 A;  4BDO A;  4N07 A;  5I56 A;  2P2A A;  1NNF A;  3EHS A;  4H5G A;  3PD9 A;  5CI5 A;  3V8X B;  1B7U A;  3PD8 A;  4U21 A;  4YB7 A;  2THI A;  3W15 C;  1MXU A;  3MJN A;  1S9T A;  4U22 A;  1MXV A;  2ZYN A;  3F11 A;  3PU5 A;  3TOD A;  4OFL A;  1Q1K A;  4R6Y A;  3MZ1 A;  3HCQ A;  2B3B A;  1B32 A;  3TTR A;  3CG3 A;  2Y7I A;  3HO7 A;  5DT6 A;  3GXA A;  2O84 X;  1SI1 A;  4R6K A;  2GH9 A;  3OOA A;  3QIM A;  1QUJ A;  1JET A;  2F5X A;  5B70 A;  2OWS A;  4OFO A;  2NXO A;  3H4Z A;  1B3F A;  1IIW A;  2F7C A;  3U93 A;  3HST A;  2PVU A;  3C36 A;  3H6W A;  3RNN A;  1VR5 A;  1PDA A;  3MP1 A;  2ZNS A;  4PFU A;  3K4U A;  3KSJ A;  5H8Q B;  3W9V A;  4DLD A;  2B65 A;  5AA2 D;  4U23 A;  4HW8 A;  1XOC A;  3UP9 A;  3D4C A;  4PFT A;  3TPA A;  3KFM A;  3H6T A;  3MPK A;  3PUZ E;  1M5B A;  4MF3 A;  3USD A;  4ZZA A;  3R6U A;  4H1X A;  4RPO A;  3K1P A;  1MY3 A;  3TTL A;  4XKP A; 
#chains in the Genus database with same CATH topology
 5CBS A;  3LSL A;  4ONY A;  3T96 B;  3LSF B;  2CZH A;  4ZEC A;  5L8D A;  4LZ8 A;  5I59 B;  2QFL A;  1ZIU A;  1R1N A;  2O1L A;  3VFJ A;  2F78 A;  4DCX A;  1N04 A;  3L6G A;  1H43 A;  2Y5L A;  4GX4 A;  2ZYK A;  1LAX A;  3OEK A;  5HBC A;  1RYX A;  4QSC A;  3T0J A;  1N3X A;  4OYV A;  3G3F A;  4MEV A;  2DWI A;  3IFC A;  1YYZ A;  1LFI A;  1LBV A;  3KZG A;  2QVU A;  1A55 A;  2XWO A;  3N94 A;  1B5J A;  1Y20 A;  2BJJ X;  2O7I A;  2ZNU A;  3RY3 A;  1TT1 A;  1RDY A;  4EDP A;  4EQB A;  2XHD A;  1SYH A;  2A5T A;  3H6U A;  3C32 A;  1B9J A;  4ELP A;  1B05 A;  1G0H A;  1BTJ A;  1HSE A;  1NV7 A;  4R74 A;  2UVJ A;  3TCG A;  4RXL A;  3HV1 A;  4P11 A;  1B46 A;  3CFL A;  3KEI A;  4N6K A;  4NMY A;  3IK6 B;  1LLS A;  5I2K A;  3BFT A;  2Z8E A;  4JWY A;  3IO6 A;  3T9H B;  4N6D A;  4BDQ A;  2XD3 A;  3FVN A;  4XTC Q;  3OXN A;  1DOT A;  3RLF E;  1IMC A;  1FPI A;  3BBR A;  3PPP A;  1RDZ A;  3MUQ A;  3T93 B;  5DEX A;  2CZI A;  4K3F A;  3U92 A;  2CZL A;  2D3I A;  1A40 A;  2AL5 A;  4U4S A;  1XS5 A;  1IXH A;  4O3A A;  3B6Q A;  4RA1 A;  4X1D A;  5H8F B;  3QYT A;  2B4M A;  4RK9 A;  2PFZ A;  2Z8D A;  4GXA A;  3PUV E;  4I3E A;  4POW A;  2FHY A;  2HZK A;  3C35 A;  4EUO A;  3M8U A;  4LVQ A;  2AIX A;  4TOZ A;  2I0C A;  5IKB A;  3V89 B;  5AA2 B;  1SD3 A;  2MKZ A;  3QMF A;  4G2Z A;  2GRV A;  1FPF A;  5J1D A;  1Z7N E;  4IR8 A;  3G3I A;  3B7D A;  5TPA A;  4ELR A;  1XHY A;  2GHA A;  4F39 A;  4H0W A;  1LBZ A;  3OSQ A;  2HQ0 A;  4MIJ A;  1ZKB A;  1Y4C A;  1B3G A;  3K01 A;  1AIV A;  3E3K A;  1O7T A;  1QGX A;  2PFY A;  4X9T A;  4X04 A;  2V3U A;  2ZYM A;  3A3U A;  3L6H A;  3FGS A;  1FPJ A;  4ZEI A;  1I69 A;  3K2D A;  2VHA A;  2XD2 A;  2BJI A;  1EZO A;  3KOS A;  4KYS A;  5L9O A;  5CMK A;  4AB6 A;  4I1D A;  4MJO A;  1KZ8 A;  3RPL B;  1QUK A;  2Y7K A;  3VVD A;  3KSX A;  5JTY B;  3I6V A;  3O2A A;  4ZS9 A;  1FPD A;  4I8C A;  4JBZ A;  1BP5 A;  4Z0I A;  4F1Y A;  1B0L A;  2E0S A;  4F3S A;  3RQT A;  1B5H A;  3UK4 A;  4O7I A;  4U1Z A;  1NV0 A;  2RKM A;  5EYF A;  2QPQ A;  4RNS A;  1VSO A;  1B4Z A;  2DVZ A;  1POT A;  3C31 A;  2H99 A;  3IAZ A;  3CG1 A;  4WKM A;  1M5E A;  1YPN A;  2AYS A;  4IO4 A;  1JW5 A;  1NV2 A;  4OEU A;  4KQP A;  3EHU A;  1POY 1;  2KLF A;  2QRY A;  2Q2C A;  1PC3 A;  4KYE A;  2I49 A;  2RC7 A;  4ZE8 A;  3TCH A;  2R9J A;  4R2F A;  4KCD A;  1USY H;  2HFB A;  5F1Q A;  3O97 A;  1FPE A;  1NH8 A;  4MMP A;  4TLM B;  2DWH A;  1MXX A;  3GBA A;  4NF5 A;  1SW2 A;  5ICT A;  3SES A;  2O7U A;  4PDD A;  3IFA A;  1MM6 A;  1FBF A;  4NF0 A;  3IJO B;  4NF4 A;  3B8B A;  2OWZ A;  1HSJ A;  3H06 B;  1LAG E;  4LP2 B;  1NNT A;  2HEU A;  1P1Q A;  3H6V A;  3O66 A;  1UTH B;  3FVO A;  3MZB A;  3SEU A;  3EPE A;  3RT6 B;  4KYD A;  1K9Y A;  5IM2 A;  2B3F A;  1SI0 A;  4PBQ A;  4NN3 A;  5CBR A;  2REJ A;  2KQZ A;  3FJG A;  3VV5 A;  4OVQ A;  4ZZE A;  3MC2 A;  1FQC A;  2E1S A;  1TXF A;  4P0G A;  2OCU A;  5M2V A;  4PGN A;  1MY0 A;  3TQW A;  2F36 A;  2V3T A;  5BWJ A;  4ZEK A;  1J1N A;  2WYK A;  4OET A;  1G0I A;  1JEU A;  3THI A;  1IXG A;  4MAG A;  1IXC A;  1FBC A;  5KDT B;  1US5 A;  1FTA A;  1ZJL A;  3SEW A;  5FBP A;  1URG A;  4H5F A;  2DP8 A;  1H44 A;  3JV9 A;  4XIG Q;  4NF6 A;  3D4G A;  4R2B A;  3HPI A;  3PPN A;  3FVG A;  3KN8 A;  4H8J A;  3DLN A;  3NOH A;  4FEC A;  5H8H A;  4F19 A;  3IOU A;  5TP9 B;  2V93 A;  2M8C A;  2RCA A;  4PE3 A;  1IIT A;  3O6H A;  1MPC A;  2ZZV A;  3QUF A;  2GHB A;  4IY5 A;  3SER A;  4E0X A;  2I6E A;  4MLQ A;  4GLI A;  4OWD A;  4FOR A;  4Q30 B;  1NV1 A;  3IB0 A;  3K6V A;  4HS7 A;  4ISU A;  3U65 A;  4NX1 A;  2O1M A;  5I57 B;  2Z23 A;  4OER A;  3UOR A;  4DXC A;  1B3H A;  4OHN A;  2ZZW A;  4ECF A;  4RK2 A;  1D9Q A;  3E4R A;  2FIE A;  3LBS A;  1B1X A;  1B4H A;  3T9V A;  1AH5 A;  5ICQ A;  4G8N A;  4FAT A;  5L9S A;  3QAX A;  4EXL A;  1P1W A;  1Y3N A;  4AB5 A;  1QVS A;  3CR9 A;  3PPO A;  4JVI A;  4EXK A;  2DSF A;  2QS2 A;  2F7B A;  1M5F A;  2X26 A;  2Q9T A;  2XWI A;  5IGA A;  2DXY A;  1Y1M A;  1FRP A;  3MP6 A;  2HCA A;  3SKP A;  3FXQ A;  4PCD A;  3T1B A;  3HN0 A;  5KZT A;  1IMA A;  4H45 A;  3HHF A;  1FTK A;  3UN6 A;  3LV0 A;  3M3F A;  4O8M A;  1DSN A;  4JWO A;  2ESN A;  4OQO A;  1NH7 A;  3MVY A;  4NAP A;  2FA7 A;  2F3B A;  1N76 A;  4OEV A;  5AA4 B;  5AA1 A;  3ZS6 A;  5DYH A;  4QXD A;  1NUZ A;  2QVV A;  2QMX A;  2UYF A;  3KBZ A;  4YKP A;  1NMU A;  3K0V A;  3BKI B;  4BLA A;  1EYJ A;  3SEV A;  1LCF A;  4C1U A;  1FBD A;  3ZSF A;  1P99 A;  2DE4 A;  5EYG A;  2Q88 A;  2KR0 A;  4RY1 A;  2ANJ A;  1LBC A;  5DVF A;  3HFU A;  4YB6 A;  4BDL A;  3RTW B;  1RDX A;  2FVZ A;  3B6T A;  1MY4 A;  1B7H A;  4THI A;  5EHS A;  1FPG A;  3T66 A;  3S2V A;  3AXF A;  2PX1 A;  4GD5 A;  1B3E A;  1NV5 A;  2WEF A;  2XXK A;  3SEY A;  3EHT A;  4GF8 A;  3PGF A;  3TTM A;  1A54 A;  2WKY A;  1N0T A;  1D3K A;  2IEE A;  3OO9 A;  1IMD A;  4G68 C;  3VLV A;  4DI4 B;  4N17 A;  4F3G A;  3MW0 A;  4FIM A;  5K2Y A;  1Q9D A;  2NUV A;  4EF1 A;  1AL3 A;  4GXS B;  4QFL A;  1BKA A;  2HAU A;  4R73 A;  1OQG A;  4L17 A;  3H03 A;  2RIN A;  1LB9 A;  4AQ4 A;  1CB6 A;  4NED A;  3PMW A;  1EU8 A;  4YU0 A;  1ZU0 A;  1MS7 A;  4P1E A;  2XX9 A;  5A5X B;  1BIY A;  2I4B A;  1XI6 A;  4PAK A;  2RCB A;  2YJP A;  4HCW A;  1SW1 A;  5T3J A;  5AA2 A;  4PF8 A;  5JK4 A;  4XF5 A;  1LBX A;  5I56 B;  3UIF A;  4NQ8 A;  4O7M A;  5KCJ A;  4PFR A;  1JEV A;  1MQG A;  2ABH A;  3FBP A;  3E78 A;  3QSL A;  1II5 A;  2XXQ A;  3MWB A;  3IOV A;  4UA8 A;  1FW0 A;  1DMB A;  1NNP A;  3ONM A;  4DIG A;  1ZTY A;  4ZDM A;  1PEB A;  1NV6 A;  3K1M A;  4HCY A;  3N6U A;  4ZED A;  1B6H A;  1KA1 A;  3PMX A;  4GOT A;  1OQH A;  2P3N A;  2FIX A;  3BIG A;  4OZ9 A;  4POX A;  3TYH A;  3S9L C;  1MQI A;  1A8E A;  3VVE A;  4LA9 A;  5DVI A;  4QF9 A;  1NKX A;  3RTF B;  4PP0 A;  1EYK A;  4LZ5 A;  1FTM A;  1MQJ A;  2GQ1 A;  4RYA A;  1F9B A;  1WVJ A;  4NHB A;  1FTL A;  3E9X A;  2H5Y A;  3K00 A;  2B4L A;  3PMV A;  4LON B;  1B52 A;  1IME A;  3H7M A;  4NWC A;  1T0K A;  5CRY A;  3VLU A;  3E79 A;  3A3C A;  5DVJ A;  4O94 A;  2XWV A;  2QVR A;  5LTC A;  3MVX A;  4MBP A;  3H3G A;  4Z7E A;  2HZL A;  3CIJ A;  1OVT A;  1K9Z A;  3CSB A;  3LUY A;  3DP6 A;  3U1O A;  3RUM A;  5H8S A;  4EF2 A;  1Q35 A;  3QUJ A;  4GWZ A;  3N26 A;  3IL1 B;  1GVC A;  1FQD A;  2QS4 A;  4U4X A;  4KR5 A;  4GWO A;  3MVW A;  1JNF A;  5I3S A;  3M3K A;  3IOR A;  2P1S A;  3CFX A;  4MHF A;  1N84 A;  1GR2 A;  1FQF A;  1IXI A;  5IZ3 A;  2I48 A;  1PBP A;  5CM6 A;  3K02 A;  3S9N C;  4YKI A;  1B58 A;  4OMB A;  3HHG A;  3I5O A;  2F35 A;  2LAO A;  3GZG A;  1N3W A;  3TTN A;  3TUS A;  5H8N A;  2ONS A;  5EQ8 A;  4MLV A;  5FHM A;  2I0B A;  4LQ5 A;  4G68 A;  1R9Q A;  3C33 A;  1URS A;  4GQO A;  5FTI A;  2VPN A;  1HSL A;  3S9E A;  1YXI A;  2QS1 A;  5FHN A;  3C9H A;  2NVU B;  5KDT A;  1B7Z A;  3KN3 A;  4YMA A;  4JSD A;  2QMW A;  3FUZ A;  1FBE A;  3PTY A;  3EN3 A;  1QKB A;  4YB5 A;  4FEB A;  3PV0 E;  1UTB A;  2PYY A;  4N81 A;  1Y9U A;  4IB2 A;  5ESY A;  4ZE9 A;  2X7Q A;  2DYX A;  4PQJ A;  5EQ9 A;  1FBG A;  2Y7P A;  1B40 A;  2CEY A;  1I6Q A;  1QUI A;  1DPP A;  3TTK A;  4MNP A;  4IO6 A;  5ET6 A;  1UIU A;  2Z22 A;  4XXU A;  1MPD A;  5DEX B;  1N7X A;  3ZKL A;  1B1H A;  3MAM A;  3RN8 A;  2G93 A;  4OVS A;  3OEN A;  1PBQ A;  3OO8 A;  1Y1Z A;  2OWT A;  5I2N A;  2QL3 A;  2H4I A;  5IZ1 A;  2D5W A;  4EQ9 A;  1NNK A;  4OEN A;  4NF8 A;  4TLL B;  4ESW A;  4P0I A;  3MVZ A;  3FXB A;  4PFY A;  5ITP A;  3O6I A;  2Y7R A;  5CMC A;  4MH5 A;  1URD A;  3FVK A;  4N6P A;  4G8M A;  2OX3 A;  4QRZ A;  3KBR A;  1DBZ A;  2Y5K A;  4KCC A;  2I4C A;  3TKD A;  1A8F A;  3ROJ A;  3VXC A;  3KG2 A;  4QSE A;  1B51 A;  2FYI A;  4PFW A;  1B3L A;  1FPB A;  4XKN A;  5TPA B;  2O68 A;  2VOZ A;  4BDM A;  2XXV A;  1Z7M E;  1O63 A;  4Q5T A;  4R9F A;  2PT2 A;  1MY1 A;  1UIV A;  1OMP A;  5EHM A;  3TFL A;  2HHM A;  4WEP A;  4H46 A;  4GWU A;  4HTG A;  3LUZ A;  4OVJ A;  1D4N A;  1SW4 A;  1P1N A;  3QK6 A;  2OK2 A;  4PC9 A;  3MBP A;  4IO2 A;  3U8Q A;  1JP4 A;  4IGT A;  4WED A;  4U1O A;  2UVH A;  2NWJ A;  3OO6 A;  1AOV A;  1P1U A;  3O6G A;  5CC2 A;  4DXB A;  3G3K A;  1FCK A;  2F8D A;  4GX3 A;  1M5D A;  4DI3 D;  4LN5 A;  3ODB A;  1H45 A;  1MPB A;  1IMF A;  4QFP A;  3IB2 A;  1LEV A;  1DK4 A;  1XC1 A;  2RF1 A;  1OVB A;  4KFQ A;  2DE2 A;  4N91 A;  4GWY A;  4PGP A;  1FPK A;  2I58 A;  4GFR A;  2CZK A;  3O29 A;  3ILT B;  4G4P A;  4HXV A;  1VFD A;  4JVC A;  1LFG A;  3TEP A;  5H8Q A;  1PB9 A;  2UXA A;  4YZZ A;  1YZ0 A;  4JB7 A;  1B0H A;  4NF5 B;  5EYH A;  4IGR A;  3OEL A;  2UVI A;  3W9W A;  4F2O A;  4GWX A;  2YLN A;  1MQH A;  4GBW A;  5I58 B;  3FJ7 A;  4QFO A;  1EZP A;  4NF4 B;  4ESX A;  2XXU A;  1EYI A;  4DCY A;  1N7W A;  1FTJ A;  2V25 A;  3R26 A;  4OES A;  4Q0C A;  4O3C A;  3LR1 A;  3PPQ A;  4IO5 A;  3TDJ A;  5A5L A;  3K6U A;  3ZKK A;  4YMB A;  5AA3 A;  2VP1 A;  4I9D A;  3LSX A;  4M1V A;  4XKR A;  4ZEF A;  4H65 A;  4DE8 A;  2F97 A;  1SPI A;  1O64 A;  2ZYO A;  5I59 A;  2V3Q A;  4UAB A;  2V84 A;  3VLW A;  5A5X A;  1YAE A;  1B2H A;  2QSX A;  3S9M C;  1DTG A;  3GYY A;  4AS4 A;  5IZZ A;  3C34 A;  1MXZ A;  5ELV A;  2ZZX A;  3ILU B;  1DPE A;  2XX7 A;  1BK4 A;  4MCO A;  4GVO A;  4XFE A;  4JSO A;  2ZNT A;  4KI0 E;  2P3V A;  4X1B A;  2AL4 A;  4NF6 B;  1LFH A;  1A99 A;  1EZ9 A;  1TWY A;  3CSG A;  4C0R A;  1LBW A;  1MG1 A;  2HXW A;  2XWK A;  1PB8 A;  2FNC A;  5H8H B;  3DP8 A;  5ET7 A;  3GBB A;  2F6P A;  2F6G A;  4NG7 A;  4GIZ A;  3FV1 A;  3PUY E;  3E13 X;  4QBA A;  2Y84 A;  2PCR A;  1ZMG A;  4E0W A;  2XXP A;  3KOT A;  4H6D A;  3FIR A;  5HM4 B;  4H67 A;  2G29 A;  5J16 A;  2JJK A;  2OBG A;  3RGY A;  5CMM A;  1VE4 A;  3TCF A;  4ZEB A;  2QS3 A;  3KJ7 A;  4FAJ A;  5IAI A;  4RJZ A;  4R72 A;  4PFI A;  3IX1 A;  3KC0 A;  3FXR A;  4YAH X;  1TFA A;  1RKM A;  1SW5 A;  4N13 A;  3CHG A;  3FAS A;  4PBH A;  3SEX A;  4OVT A;  2I3V A;  2R71 A;  2DOJ A;  4MFI A;  4OVR A;  4XEQ A;  3OSR A;  5H8F A;  3VVF A;  1MRP A;  1GGG A;  4C1T A;  1NL5 A;  3TZA A;  2A5S A;  3MPL A;  2XA5 A;  3O9P A;  4MX6 A;  3JYR A;  3N5L A;  3DEL B;  1QKA A;  2L5V A;  2HPG A;  4BDN A;  1SVX B;  1VDW A;  5DW8 A;  5I5P A;  4OFJ A;  4X48 A;  3PUX E;  3KN7 A;  2ZXT A;  3RYD A;  1FBP A;  4G8H A;  4LUB A;  2OLB A;  1IEJ A;  2ONK E;  2RC8 A;  3U94 A;  1SYI A;  1XVX A;  2W7Y A;  4P8B A;  4H8I A;  4NWD A;  4AS5 A;  4N8Y A;  3OD7 A;  4WXJ A;  3KC1 A;  4MNC A;  1UQW A;  1FTO A;  5AE4 A;  1MQD A;  4R75 A;  4IO7 A;  5K2X A;  3B6W A;  2NOO A;  5EQA A;  3I3V A;  1LAF E;  3O28 A;  3Q28 A;  5BUU A;  4O3B A;  3RPL A;  3RPW A;  2VD2 A;  5JTY A;  2R8T A;  4BDR A;  3A09 A;  4Q8R A;  2XXT A;  4FJP A;  2F34 A;  2O51 A;  3GLB A;  3TMG A;  4QHQ A;  2VD3 A;  4NE4 A;  3Q26 A;  4GWW A;  1FQE A;  1LST A;  4ND9 A;  3MP8 A;  1H76 A;  1IUD A;  1H3D A;  4FED A;  3Q27 A;  3UGW A;  2DVC A;  4OTE A;  1I6B A;  2ONR A;  4TQU Q;  1INP A;  2DQV A;  3WAE A;  1I6A A;  2H9B A;  2P0S A;  1ELJ A;  2REG A;  3G3H A;  2YPN A;  3FJM A;  3VE1 B;  1XT8 A;  4F22 A;  3VDF A;  1AWB A;  4IO3 A;  3T22 A;  4OXV A;  5TU0 A;  3BIH A;  1ZLQ A;  5JEI A;  3ECR A;  2O69 A;  4LZ7 A;  5LDZ A;  1S7Y A;  3G3J A;  2WBD A;  1UTH A;  5ET8 A;  3K1N A;  2GFE A;  4N15 A;  4OAN A;  1MM7 A;  1L5T A;  3VXB A;  4YKK A;  4P3L A;  4XKQ A;  2UVG A;  5KCJ B;  2XX8 A;  2DS9 A;  4P9K A;  2ZMB A;  4F1V A;  4R6H A;  4YKJ A;  1SBP A;  1OLC A;  1DCU A;  4UAC A;  4LQ2 A;  5ISU A;  3OO7 A;  2R6G E;  2A5T B;  4RPN A;  2RC9 A;  3TAJ A;  3EKI A;  1YTV A;  4NGU A;  4DZ1 A;  2OJT A;  4EQ7 A;  2I3W A;  1SQY A;  3D1R A;  3EQ1 A;  2CEX A;  3IO4 A;  4F2Q A;  1OIB A;  3G3G A;  5B7D A;  2DXR A;  5I2K B;  1FJ6 A;  1KWH A;  1NUX A;  2Q8J A;  5TP9 A;  2Q74 A;  3FZV A;  4PAF A;  3RT8 A;  1PB7 A;  1LGB C;  2Q89 A;  3MYU A;  2UYE A;  4QSD A;  3P7I A;  1FQA A;  3PPR A;  3DP4 A;  1JVX A;  3WAF A;  3BFU A;  1LB8 A;  1Y3Q A;  2QJE A;  2XXY A;  5L9M A;  3JZJ A;  2DWJ A;  3SDF A;  1NFT A;  1IZ1 A;  2PMS A;  1R9L A;  1AMF A;  2H25 A;  5I57 A;  1WOD A;  4LAT A;  2O6A A;  3SET A;  1MDQ A;  5F7V A;  1P1O A;  4I62 A;  3B50 A;  1LBB A;  3C4M A;  5LOM A;  3M3L A;  4PF6 A;  1FPL A;  1XVY A;  4GWS A;  4JVD A;  3MQ9 A;  1DTZ A;  3K6W A;  1US4 A;  3LC8 A;  4PE5 B;  1M5C A;  2VPO A;  4OA4 A;  2F3D A;  2CMO A;  1MY2 A;  1RYO A;  4F3P A;  4JWX A;  2Y7W A;  1IQ7 A;  4PAI A;  2XXW A;  4N4U A;  2XXI A;  1USY E;  4F29 A;  2Q2A A;  1VFE A;  4GL8 A;  1FBH A;  4X8R A;  3KJT A;  4U2R A;  4PTK A;  1KA0 A;  5I58 A;  3TEL A;  1MXW A;  5IZ3 B;  2XXX A;  1LCT A;  1MXY A;  4N8G A;  3FAT A;  4GRK A;  1S50 A;  3EF7 A;  3N6T A;  1ZBM A;  1JW1 A;  3A29 A;  2HXR A;  4GL0 A;  1NI9 A;  3OEM A;  1D9V A;  5I84 A;  4G77 A;  5H8N B;  2WYP A;  3TQL A;  1FSA A;  3V5A A;  1GTK A;  5CMB A;  3IOT A;  4P56 A;  3CI8 A;  1FQB A;  4R9G A;  3QXM A;  4JXI A;  4QFK A;  1YCJ A;  4NTL A;  2HAV A;  2XXR A;  5HPQ A;  1NV3 A;  4DDD A;  1GV8 A;  4G68 B;  1ANF A;  2PT1 A;  1B5I A;  4QFN A;  1JW4 A;  4HE1 A;  5AA4 A;  5DTB A;  4FBP A;  5FHO A;  1FJ9 A;  4F18 A;  1A7L A;  3IOW A;  3FD3 A;  3FV2 A;  1Y4T A;  1WDN A;  4PET A;  1OLA A;  1MH3 A;  4GBV A;  3Q29 A;  2IA4 A;  2OZZ A;  1LAH E;  2PBW A;  4ELO A;  1QW0 A;  3FXU A;  1IMB A;  5I7I A;  4G61 A;  1UTB B;  3T9U A;  5EQ7 A;  3S4U A;  5ET5 A;  3KGC A;  3R7X A;  3ISP A;  4I3Y A;  3V83 A;  4YIC A;  3CRB A;  3PUW E;  4KHZ E;  3U72 A;  3UA8 A;  1EH3 A;  2DE3 A;  3CVG A;  2DWA A;  1MDP 1;  4F1U A;  4OVP A;  4M4G A;  3OMB A;  1CE2 A;  4P1L A;  2ALU A;  3SZP A;  3Q25 A;  2H98 A;  2XXH A;  1SDX A;  3K6X A;  1NUW A;  3G7W A;  4DXU A;  2F7A A;  5I2N B;  1JQF A;  4F3B A;  5FTH A;  3IJX B;  4GX6 A;  2X7P A;  1TFD A;  4KD5 A;  1MH4 A;  4NF8 B;  4PFB A;  2Z8F A;  3IR1 A;  3LSW A;  3CFZ A;  1CNQ A;  1LBY A;  3DM0 A;  1ATG A;  1QUL A;  4FE8 A;  3T9X B;  4KXP A;  3MZ9 A;  1D9Y A;  2VGQ A;  3MST A;  1NV4 A;  5ITO A;  4F31 B;  4IY6 A;  1Y3P A;  4ELQ A;  1BLF A;  1QJM A;  2VT5 A;  3IB1 A;  4JDF A;  1JVY A;  4KPT A;  1R6Z A;  4I40 A;  2D21 A;  4PDH A;  4BDO A;  4N07 A;  5I56 A;  2P2A A;  1NNF A;  3EHS A;  4H5G A;  3PD9 A;  5CI5 A;  3V8X B;  1B7U A;  3PD8 A;  4U21 A;  4YB7 A;  2THI A;  3W15 C;  1MXU A;  2DDK A;  4P47 A;  3MJN A;  1S9T A;  4U22 A;  1MXV A;  4MNI A;  2ZYN A;  3F11 A;  3PU5 A;  3TOD A;  4OFL A;  1Q1K A;  4R6Y A;  1NUY A;  3MZ1 A;  3HCQ A;  2V4C A;  2B3B A;  1B32 A;  3TTR A;  3CG3 A;  2Y7I A;  3HO7 A;  5DT6 A;  3GXA A;  2O84 X;  4HE0 A;  5F24 A;  1SI1 A;  2WX9 A;  4R6K A;  2GH9 A;  3OOA A;  3QIM A;  1QUJ A;  1JET A;  2F5X A;  2WBB A;  5B70 A;  2OWS A;  4OFO A;  2NXO A;  3H4Z A;  1B3F A;  1IIW A;  2F7C A;  3U93 A;  3HST A;  2PVU A;  3C36 A;  3H6W A;  3RNN A;  1VR5 A;  1PDA A;  3MP1 A;  2ZNS A;  4PFU A;  3K4U A;  2FBP A;  3KSJ A;  5H8Q B;  3W9V A;  4DLD A;  2B65 A;  5AA2 D;  4U23 A;  4HW8 A;  1XOC A;  3UP9 A;  3D4C A;  4PFT A;  3TPA A;  3KFM A;  3H6T A;  3MPK A;  3PUZ E;  1M5B A;  4MF3 A;  4HE2 A;  3USD A;  4ZZA A;  3R6U A;  2Q8M A;  4H1X A;  4RPO A;  3K1P A;  1MY3 A;  3TTL A;  4XKP A; 
#chains in the Genus database with same CATH homology
 5CBS A;  3LSL A;  4ONY A;  3T96 B;  3LSF B;  4ZEC A;  5L8D A;  4LZ8 A;  5I59 B;  1ZIU A;  1R1N A;  2O1L A;  3VFJ A;  2F78 A;  4DCX A;  1N04 A;  3L6G A;  1H43 A;  2ZYK A;  1LAX A;  3OEK A;  5HBC A;  1RYX A;  4QSC A;  1N3X A;  4OYV A;  3G3F A;  2DWI A;  1LFI A;  3KZG A;  1A55 A;  3N94 A;  1B5J A;  1Y20 A;  2BJJ X;  2O7I A;  2ZNU A;  3RY3 A;  1TT1 A;  4EDP A;  4EQB A;  2XHD A;  1SYH A;  2A5T A;  3H6U A;  3C32 A;  1B9J A;  4ELP A;  1B05 A;  1BTJ A;  1HSE A;  4R74 A;  2UVJ A;  3TCG A;  4RXL A;  3HV1 A;  4P11 A;  1B46 A;  3CFL A;  3KEI A;  4NMY A;  3IK6 B;  1LLS A;  5I2K A;  3BFT A;  2Z8E A;  4JWY A;  3IO6 A;  3T9H B;  4BDQ A;  2XD3 A;  3FVN A;  4XTC Q;  3OXN A;  1DOT A;  3RLF E;  3BBR A;  3PPP A;  3MUQ A;  3T93 B;  5DEX A;  4K3F A;  3U92 A;  2CZL A;  2D3I A;  1A40 A;  2AL5 A;  4U4S A;  1XS5 A;  1IXH A;  4O3A A;  3B6Q A;  4RA1 A;  4X1D A;  5H8F B;  3QYT A;  4RK9 A;  2Z8D A;  4GXA A;  3PUV E;  4POW A;  2HZK A;  3C35 A;  4EUO A;  3M8U A;  4LVQ A;  2AIX A;  4TOZ A;  2I0C A;  5IKB A;  3V89 B;  5AA2 B;  1SD3 A;  4G2Z A;  2GRV A;  5J1D A;  1Z7N E;  3G3I A;  3B7D A;  5TPA A;  4ELR A;  1XHY A;  2GHA A;  4F39 A;  4H0W A;  3OSQ A;  2HQ0 A;  1ZKB A;  1Y4C A;  1B3G A;  3K01 A;  1AIV A;  3E3K A;  1O7T A;  4X9T A;  2V3U A;  2ZYM A;  3A3U A;  3L6H A;  3FGS A;  4ZEI A;  1I69 A;  3K2D A;  2VHA A;  2XD2 A;  1EZO A;  3KOS A;  4KYS A;  5L9O A;  5CMK A;  4AB6 A;  4I1D A;  1QUK A;  2Y7K A;  3VVD A;  3KSX A;  5JTY B;  3I6V A;  3O2A A;  4ZS9 A;  4I8C A;  4JBZ A;  1BP5 A;  4Z0I A;  4F1Y A;  1B0L A;  2E0S A;  4F3S A;  3RQT A;  1B5H A;  3UK4 A;  4U1Z A;  2RKM A;  5EYF A;  2QPQ A;  4RNS A;  1VSO A;  1B4Z A;  2DVZ A;  1POT A;  3C31 A;  2H99 A;  3IAZ A;  3CG1 A;  4WKM A;  1M5E A;  1YPN A;  2AYS A;  4IO4 A;  1JW5 A;  4OEU A;  4KQP A;  3EHU A;  1POY 1;  2KLF A;  2QRY A;  2Q2C A;  1PC3 A;  4KYE A;  2I49 A;  2RC7 A;  4ZE8 A;  3TCH A;  2R9J A;  4R2F A;  4KCD A;  1USY H;  2HFB A;  5F1Q A;  3O97 A;  1NH8 A;  4TLM B;  2DWH A;  1MXX A;  3GBA A;  4NF5 A;  1SW2 A;  5ICT A;  3SES A;  2O7U A;  1MM6 A;  3IJO B;  4NF4 A;  1HSJ A;  3H06 B;  1LAG E;  4LP2 B;  1NNT A;  2HEU A;  1P1Q A;  3H6V A;  3O66 A;  1UTH B;  3FVO A;  3MZB A;  3SEU A;  3EPE A;  3RT6 B;  4KYD A;  2B3F A;  1SI0 A;  5CBR A;  2REJ A;  3FJG A;  3VV5 A;  4ZZE A;  3MC2 A;  1FQC A;  2E1S A;  1TXF A;  4P0G A;  2OCU A;  5M2V A;  1MY0 A;  3TQW A;  2F36 A;  2V3T A;  5BWJ A;  4ZEK A;  1J1N A;  4OET A;  1JEU A;  3THI A;  1IXG A;  1IXC A;  5KDT B;  1US5 A;  1ZJL A;  3SEW A;  1URG A;  4H5F A;  2DP8 A;  1H44 A;  3JV9 A;  4XIG Q;  4NF6 A;  3D4G A;  4R2B A;  3HPI A;  3PPN A;  3FVG A;  3KN8 A;  4H8J A;  3DLN A;  4FEC A;  5H8H A;  4F19 A;  3IOU A;  5TP9 B;  2V93 A;  2M8C A;  2RCA A;  1IIT A;  3O6H A;  1MPC A;  3QUF A;  2GHB A;  4IY5 A;  3SER A;  4E0X A;  2I6E A;  4MLQ A;  4GLI A;  4OWD A;  4FOR A;  4Q30 B;  3IB0 A;  3K6V A;  4HS7 A;  4ISU A;  2O1M A;  5I57 B;  2Z23 A;  4OER A;  3UOR A;  4DXC A;  1B3H A;  4OHN A;  4ECF A;  4RK2 A;  3E4R A;  3LBS A;  1B1X A;  1B4H A;  3T9V A;  1AH5 A;  5ICQ A;  4G8N A;  4FAT A;  5L9S A;  3QAX A;  4EXL A;  1P1W A;  1Y3N A;  4AB5 A;  1QVS A;  3CR9 A;  3PPO A;  4EXK A;  2DSF A;  2QS2 A;  2F7B A;  1M5F A;  2X26 A;  2Q9T A;  2DXY A;  1Y1M A;  3MP6 A;  2HCA A;  3SKP A;  3FXQ A;  3HN0 A;  5KZT A;  3HHF A;  1FTK A;  3UN6 A;  3M3F A;  1DSN A;  4JWO A;  2ESN A;  4OQO A;  1NH7 A;  3MVY A;  2FA7 A;  1N76 A;  4OEV A;  5AA4 B;  5AA1 A;  3ZS6 A;  5DYH A;  2QMX A;  2UYF A;  4YKP A;  1NMU A;  3K0V A;  3BKI B;  4BLA A;  3SEV A;  1LCF A;  4C1U A;  3ZSF A;  1P99 A;  2DE4 A;  2Q88 A;  4RY1 A;  2ANJ A;  1LBC A;  5DVF A;  4YB6 A;  4BDL A;  3RTW B;  3B6T A;  1MY4 A;  1B7H A;  4THI A;  5EHS A;  3T66 A;  3S2V A;  3AXF A;  2PX1 A;  4GD5 A;  1B3E A;  3SEY A;  3EHT A;  4GF8 A;  3PGF A;  3TTM A;  1A54 A;  2WKY A;  1N0T A;  1D3K A;  2IEE A;  3OO9 A;  4G68 C;  3VLV A;  4F3G A;  3MW0 A;  4FIM A;  5K2Y A;  2NUV A;  4EF1 A;  1AL3 A;  4GXS B;  4QFL A;  1BKA A;  2HAU A;  4R73 A;  1OQG A;  4L17 A;  3H03 A;  2RIN A;  1LB9 A;  4AQ4 A;  1CB6 A;  4NED A;  3PMW A;  1EU8 A;  4YU0 A;  1ZU0 A;  1MS7 A;  2XX9 A;  5A5X B;  1BIY A;  2I4B A;  2RCB A;  2YJP A;  4HCW A;  1SW1 A;  5AA2 A;  5JK4 A;  5I56 B;  3UIF A;  5KCJ A;  1JEV A;  1MQG A;  2ABH A;  3QSL A;  1II5 A;  2XXQ A;  3MWB A;  3IOV A;  4UA8 A;  1FW0 A;  1DMB A;  1NNP A;  3ONM A;  4DIG A;  1ZTY A;  4ZDM A;  1PEB A;  3K1M A;  4HCY A;  3N6U A;  4ZED A;  1B6H A;  3PMX A;  4GOT A;  1OQH A;  4OZ9 A;  4POX A;  3TYH A;  3S9L C;  1MQI A;  1A8E A;  3VVE A;  4LA9 A;  5DVI A;  4QF9 A;  1NKX A;  3RTF B;  4PP0 A;  4LZ5 A;  1FTM A;  1MQJ A;  4RYA A;  1F9B A;  1WVJ A;  1FTL A;  3E9X A;  2H5Y A;  3K00 A;  3PMV A;  4LON B;  1B52 A;  3H7M A;  4NWC A;  1T0K A;  5CRY A;  3VLU A;  3A3C A;  5DVJ A;  3MVX A;  4MBP A;  3H3G A;  4Z7E A;  2HZL A;  3CIJ A;  1OVT A;  3CSB A;  3LUY A;  3DP6 A;  3U1O A;  3RUM A;  5H8S A;  4EF2 A;  1Q35 A;  3QUJ A;  3N26 A;  3IL1 B;  1GVC A;  1FQD A;  2QS4 A;  4U4X A;  4KR5 A;  4GWO A;  3MVW A;  1JNF A;  3M3K A;  3IOR A;  2P1S A;  3CFX A;  1N84 A;  1GR2 A;  1FQF A;  1IXI A;  2I48 A;  1PBP A;  5CM6 A;  3K02 A;  3S9N C;  4YKI A;  1B58 A;  4OMB A;  3HHG A;  3I5O A;  2F35 A;  2LAO A;  3GZG A;  1N3W A;  3TTN A;  3TUS A;  5H8N A;  2ONS A;  4MLV A;  5FHM A;  2I0B A;  4LQ5 A;  4G68 A;  1R9Q A;  3C33 A;  1URS A;  4GQO A;  5FTI A;  1HSL A;  3S9E A;  2QS1 A;  5FHN A;  3C9H A;  2NVU B;  5KDT A;  1B7Z A;  3KN3 A;  4YMA A;  2QMW A;  4JSD A;  3FUZ A;  3EN3 A;  1QKB A;  4YB5 A;  4FEB A;  3PV0 E;  1UTB A;  2PYY A;  1Y9U A;  4IB2 A;  4ZE9 A;  2X7Q A;  2DYX A;  4PQJ A;  2Y7P A;  1B40 A;  1I6Q A;  1QUI A;  1DPP A;  3TTK A;  4IO6 A;  1UIU A;  2Z22 A;  4XXU A;  1MPD A;  5DEX B;  1N7X A;  3ZKL A;  1B1H A;  3MAM A;  3RN8 A;  2G93 A;  3OEN A;  1PBQ A;  3OO8 A;  1Y1Z A;  2OWT A;  5I2N A;  2QL3 A;  2H4I A;  2D5W A;  4EQ9 A;  1NNK A;  4OEN A;  4NF8 A;  4TLL B;  4ESW A;  4P0I A;  3MVZ A;  4PFY A;  5ITP A;  3O6I A;  2Y7R A;  5CMC A;  4MH5 A;  1URD A;  3FVK A;  4N6P A;  4G8M A;  4QRZ A;  3KBR A;  4KCC A;  2I4C A;  3TKD A;  1A8F A;  3VXC A;  3KG2 A;  4QSE A;  1B51 A;  2FYI A;  4PFW A;  1B3L A;  4XKN A;  5TPA B;  2O68 A;  2VOZ A;  4BDM A;  2XXV A;  1Z7M E;  1O63 A;  4Q5T A;  4R9F A;  2PT2 A;  1MY1 A;  1UIV A;  1OMP A;  5EHM A;  3TFL A;  4WEP A;  4HTG A;  4OVJ A;  1D4N A;  1SW4 A;  1P1N A;  3QK6 A;  2OK2 A;  3MBP A;  4IO2 A;  3U8Q A;  4IGT A;  4WED A;  4U1O A;  2UVH A;  2NWJ A;  3OO6 A;  1AOV A;  1P1U A;  3O6G A;  5CC2 A;  4DXB A;  3G3K A;  1FCK A;  2F8D A;  1M5D A;  3ODB A;  1H45 A;  1MPB A;  4QFP A;  3IB2 A;  1XC1 A;  2RF1 A;  1OVB A;  4KFQ A;  2DE2 A;  2I58 A;  4GFR A;  3O29 A;  4G4P A;  3ILT B;  1VFD A;  1LFG A;  3TEP A;  5H8Q A;  1PB9 A;  2UXA A;  4YZZ A;  4JB7 A;  1B0H A;  4NF5 B;  4IGR A;  3OEL A;  2UVI A;  3W9W A;  4F2O A;  2YLN A;  1MQH A;  5I58 B;  3FJ7 A;  4QFO A;  1EZP A;  4NF4 B;  4ESX A;  2XXU A;  4DCY A;  1N7W A;  1FTJ A;  2V25 A;  3R26 A;  4OES A;  4Q0C A;  4O3C A;  3LR1 A;  3PPQ A;  4IO5 A;  3TDJ A;  3K6U A;  3ZKK A;  4YMB A;  5AA3 A;  2VP1 A;  4I9D A;  3LSX A;  4M1V A;  4XKR A;  4ZEF A;  4H65 A;  4DE8 A;  2F97 A;  1O64 A;  2ZYO A;  5I59 A;  2V3Q A;  2V84 A;  3VLW A;  5A5X A;  1YAE A;  1B2H A;  2QSX A;  3S9M C;  1DTG A;  3C34 A;  1MXZ A;  5ELV A;  3ILU B;  1DPE A;  2XX7 A;  4GVO A;  4JSO A;  2ZNT A;  4KI0 E;  4X1B A;  2AL4 A;  4NF6 B;  1LFH A;  1A99 A;  1EZ9 A;  1TWY A;  3CSG A;  4C0R A;  1MG1 A;  2HXW A;  1PB8 A;  2FNC A;  5H8H B;  3DP8 A;  3GBB A;  2F6P A;  2F6G A;  4GIZ A;  3FV1 A;  3PUY E;  3E13 X;  2Y84 A;  1ZMG A;  4E0W A;  2XXP A;  3KOT A;  4H6D A;  3FIR A;  5HM4 B;  4H67 A;  2G29 A;  2OBG A;  3RGY A;  5CMM A;  1VE4 A;  3TCF A;  4ZEB A;  2QS3 A;  3KJ7 A;  4FAJ A;  5IAI A;  4RJZ A;  4R72 A;  3IX1 A;  3FXR A;  4YAH X;  1TFA A;  1RKM A;  1SW5 A;  4N13 A;  3FAS A;  3SEX A;  2I3V A;  2R71 A;  2DOJ A;  4MFI A;  3OSR A;  5H8F A;  3VVF A;  1MRP A;  1GGG A;  4C1T A;  1NL5 A;  3TZA A;  2A5S A;  3MPL A;  3O9P A;  3JYR A;  3N5L A;  3DEL B;  1QKA A;  4BDN A;  1SVX B;  4OFJ A;  4X48 A;  3PUX E;  3KN7 A;  2ZXT A;  4G8H A;  4LUB A;  2OLB A;  1IEJ A;  2ONK E;  2RC8 A;  3U94 A;  1SYI A;  1XVX A;  2W7Y A;  4H8I A;  4NWD A;  4WXJ A;  3OD7 A;  1UQW A;  1FTO A;  5AE4 A;  1MQD A;  4R75 A;  4IO7 A;  5K2X A;  3B6W A;  2NOO A;  3I3V A;  1LAF E;  3O28 A;  3Q28 A;  5BUU A;  4O3B A;  3RPW A;  2VD2 A;  5JTY A;  4BDR A;  3A09 A;  4Q8R A;  2XXT A;  4FJP A;  2F34 A;  2O51 A;  3GLB A;  3TMG A;  4QHQ A;  2VD3 A;  4NE4 A;  3Q26 A;  1FQE A;  1LST A;  4ND9 A;  3MP8 A;  1H76 A;  1IUD A;  1H3D A;  4FED A;  3Q27 A;  3UGW A;  2DVC A;  4OTE A;  1I6B A;  2ONR A;  4TQU Q;  2DQV A;  3WAE A;  1I6A A;  2H9B A;  2P0S A;  1ELJ A;  2REG A;  3G3H A;  2YPN A;  3FJM A;  3VE1 B;  1XT8 A;  4F22 A;  3VDF A;  4IO3 A;  3T22 A;  4OXV A;  5TU0 A;  1ZLQ A;  5JEI A;  3ECR A;  2O69 A;  4LZ7 A;  1S7Y A;  3G3J A;  1UTH A;  3K1N A;  2GFE A;  1MM7 A;  1L5T A;  3VXB A;  4YKK A;  4XKQ A;  2UVG A;  5KCJ B;  2XX8 A;  2DS9 A;  2ZMB A;  4F1V A;  4R6H A;  4YKJ A;  1SBP A;  1OLC A;  4UAC A;  4LQ2 A;  5ISU A;  3OO7 A;  2R6G E;  2A5T B;  4RPN A;  2RC9 A;  3TAJ A;  1YTV A;  4DZ1 A;  2OJT A;  4EQ7 A;  2I3W A;  1SQY A;  3EQ1 A;  3IO4 A;  4F2Q A;  1OIB A;  3G3G A;  5B7D A;  2DXR A;  5I2K B;  1KWH A;  2Q8J A;  5TP9 A;  3FZV A;  3RT8 A;  1PB7 A;  1LGB C;  2Q89 A;  2UYE A;  4QSD A;  3P7I A;  1FQA A;  3PPR A;  3DP4 A;  1JVX A;  3WAF A;  3BFU A;  1LB8 A;  1Y3Q A;  2QJE A;  2XXY A;  5L9M A;  3JZJ A;  2DWJ A;  3SDF A;  1NFT A;  1IZ1 A;  2PMS A;  1R9L A;  1AMF A;  2H25 A;  5I57 A;  1WOD A;  4LAT A;  2O6A A;  3SET A;  1MDQ A;  5F7V A;  1P1O A;  4I62 A;  1LBB A;  3C4M A;  5LOM A;  3M3L A;  1XVY A;  3MQ9 A;  1DTZ A;  3K6W A;  1US4 A;  3LC8 A;  4PE5 B;  1M5C A;  2CMO A;  1MY2 A;  1RYO A;  4F3P A;  4JWX A;  2Y7W A;  1IQ7 A;  2XXW A;  2XXI A;  1USY E;  4F29 A;  2Q2A A;  1VFE A;  4GL8 A;  3KJT A;  4U2R A;  5I58 A;  3TEL A;  1MXW A;  2XXX A;  1LCT A;  1MXY A;  3FAT A;  4GRK A;  1S50 A;  3EF7 A;  3N6T A;  1ZBM A;  1JW1 A;  4GL0 A;  3OEM A;  1D9V A;  5I84 A;  4G77 A;  5H8N B;  3TQL A;  3V5A A;  1GTK A;  5CMB A;  3IOT A;  3CI8 A;  1FQB A;  4R9G A;  3QXM A;  4JXI A;  4QFK A;  1YCJ A;  4NTL A;  2HAV A;  2XXR A;  5HPQ A;  4DDD A;  1GV8 A;  4G68 B;  1ANF A;  2PT1 A;  1B5I A;  4QFN A;  1JW4 A;  5AA4 A;  5DTB A;  5FHO A;  4F18 A;  1A7L A;  3IOW A;  3FD3 A;  3FV2 A;  1Y4T A;  1WDN A;  4PET A;  1OLA A;  1MH3 A;  3Q29 A;  2IA4 A;  2OZZ A;  1LAH E;  2PBW A;  4ELO A;  1QW0 A;  3FXU A;  1UTB B;  3T9U A;  3S4U A;  3KGC A;  3R7X A;  3V83 A;  4YIC A;  3CRB A;  3PUW E;  4KHZ E;  3U72 A;  3UA8 A;  1EH3 A;  2DE3 A;  3CVG A;  2DWA A;  1MDP 1;  4F1U A;  4M4G A;  3OMB A;  1CE2 A;  2ALU A;  3Q25 A;  2H98 A;  2XXH A;  1SDX A;  3K6X A;  3G7W A;  4DXU A;  2F7A A;  5I2N B;  1JQF A;  4F3B A;  5FTH A;  3IJX B;  2X7P A;  1TFD A;  4KD5 A;  1MH4 A;  4NF8 B;  2Z8F A;  3IR1 A;  3LSW A;  3CFZ A;  3DM0 A;  1ATG A;  1QUL A;  4FE8 A;  3T9X B;  3MZ9 A;  1D9Y A;  2VGQ A;  5ITO A;  4F31 B;  4IY6 A;  1Y3P A;  4ELQ A;  1BLF A;  1QJM A;  3IB1 A;  4JDF A;  1JVY A;  4KPT A;  1R6Z A;  2D21 A;  4BDO A;  4N07 A;  5I56 A;  2P2A A;  1NNF A;  3EHS A;  4H5G A;  3PD9 A;  5CI5 A;  3V8X B;  1B7U A;  3PD8 A;  4U21 A;  4YB7 A;  2THI A;  3W15 C;  1MXU A;  3MJN A;  1S9T A;  4U22 A;  1MXV A;  2ZYN A;  3F11 A;  3PU5 A;  3TOD A;  4OFL A;  1Q1K A;  4R6Y A;  3MZ1 A;  3HCQ A;  2B3B A;  1B32 A;  3TTR A;  3CG3 A;  2Y7I A;  3HO7 A;  5DT6 A;  3GXA A;  2O84 X;  1SI1 A;  4R6K A;  2GH9 A;  3OOA A;  3QIM A;  1QUJ A;  1JET A;  2F5X A;  5B70 A;  2OWS A;  4OFO A;  2NXO A;  3H4Z A;  1B3F A;  1IIW A;  2F7C A;  3U93 A;  3HST A;  2PVU A;  3C36 A;  3H6W A;  3RNN A;  1VR5 A;  1PDA A;  3MP1 A;  2ZNS A;  4PFU A;  3K4U A;  3KSJ A;  5H8Q B;  3W9V A;  4DLD A;  2B65 A;  5AA2 D;  4U23 A;  4HW8 A;  1XOC A;  3UP9 A;  3D4C A;  4PFT A;  3TPA A;  3KFM A;  3H6T A;  3MPK A;  3PUZ E;  1M5B A;  4MF3 A;  3USD A;  4ZZA A;  3R6U A;  4H1X A;  4RPO A;  3K1P A;  1MY3 A;  3TTL A;  4XKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...