4YKPA

Mnemiopsis leidyi ml032222a iglur lbd serine complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
247
Chain Sequence
LIGRHLRLGSVEEQPFMFFATEGCEGNDCWSGMVNDMVVKLSEDLGFTYEYIQPDDRKFGALNKTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEGTTLNQVLELLDQDKYKWGVIGSRHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGLFVFIDEGPVLAHNLISDCDVFSVGEEFQSFEYAFGLPKDSPYKSLIDSHLLKFREEGFIDILWEKWSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycine activated ion channel subunits encoded by ctenophore glutamate receptor genes.
pubmed doi rcsb
source organism Mnemiopsis leidyi
molecule tags Membrane protein
molecule keywords ML032222a iGluR
total genus 80
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykpA02
3A09A 3O66A 2P2AA 4KHZE 4YKIA 3K6WA 1N3WA 4FECA 4RYAA 4JB7A 4ESWA 2Q88A 3O2AA 2QJEA 4PFTA 1FTMA 2DXRA 4RPNA 1S9TA 2F6GA 4YKJA 4G2ZA 3U94A 5BWJA 2QMXA 2HAUA 5I2NB 1A55A 1FQFA 2XXYA 3I5OA 3T9UA 4ZECA 5I56B 1VE4A 4LZ7A 1FTJA 1NNFA 4GVOA 2F6PA 4OERA 4H5GA 1UIVA 2E1SA 2QS3A 1PDAA 3CRBA 4LQ5A 3VXBA 2YPNA 4QFKA 2F35A 2F7AA 3FJGA 4EQ7A 1A99A 1MQIA 1SW5A 1NNTA 3MP6A 4G8MA 4KYSA 4MBPA 4YMBA 1AMFA 2RF1A 2BJJX 2E0SA 4I9DA 1M5DA 5H8FB 4R74A 3DLNA 4RNSA 4E0XA 4U1OA 4G4PA 2CZLA 4DCYA 3H06B 3IORA 3IX1A 3OELA 5IAIA 3QIMA 1LFHA 4GD5A 4G8NA 1QUIA 2O51A 3FVNA 4OFJA 5JK4A 2PMSA 5I2NA 2DE2A 1EZ9A 4LVQA 4H0WA 3Q29A 2AL5A 1M5CA 3TTMA 1A40A 3FATA 3G7WA 3PPOA 3QUFA 4EXKA 5I57B 1B3FA 3U93A 2XXIA 1ANFA 3RT8A 3V89B 5I2KA 4LONB 4IO7A 3RNNA 4E0WA 2XXHA 3QUJA 4GF8A 4EDPA 4EQ9A 1MM6A 1YTVA 1FQAA 3TELA 2DE4A 3IK6B 2DE3A 2R6GE 2AYSA 2HXWA 1Y3NA 2ZYNA 3FVOA 2X7QA 4LUBA 1YPNA 4NE4A 2O84X 4RK2A 5FTIA 4F2OA 4F31B 2QMWA 1RYOA 2DYXA 1FTOA 1ZIUA 4OHNA 5M2VA 4GLIA 1JEUA 1B4ZA 1MQGA 2V3TA 2PT2A 3IO6A 4YU0A 1P1WA 2RKMA 3MPKA 4OFOA 2WKYA 3HO7A 3M8UA 3PMVA 3TCHA 4GRKA 3TTLA 1POTA 3IOUA 1QKBA 1GV8A 3F11A 5I57A 1JVYA 1IITA 1NL5A 3DP4A 3L6GA 4Z7EA 3PMXA 4G68A 4TQUQ 1XVYA 2KLFA 3LSWA 1AIVA 1P1NA 2DXYA 3MVWA 2OZZA 3PPRA 1LAHE 4ECFA 3N6TA 3R6UA 4GIZA 2QS1A 5CI5A 3IJXB 4KD5A 3RLFE 3TMGA 2DOJA 2ONSA 2DSFA 1I6AA 2O7UA 3H4ZA 4JWYA 4NMYA 3CSBA 2DVZA 4AB6A 1B3LA 2H25A 4QSEA 4OXVA 3TUSA 3ZSFA 1OLAA 3FUZA 4F22A 1QVSA 4QFOA 3GXAA 1H44A 4MLVA 4KFQA 4PFYA 4JSDA 4KR5A 4OQOA 4M4GA 3R7XA 1VFEA 1GGGA 1Q1KA 1SYIA 2VOZA 3FV1A 5F7VA 3T66A 1DOTA 1FCKA 2QRYA 2Z8EA 3B6QA 3PGFA 1MDQA 4BDNA 5I59B 3V8XB 1CB6A 1BTJA 3L6HA 1SYHA 2VD3A 2NOOA 2O6AA 4N6PA 1MDP1 1PBPA 2RCBA 3LSFB 4HS7A 4KPTA 2ZYMA 4OTEA 2G29A 4I1DA 1NMUA 2H9BA 3EN3A 3MUQA 3T9VA 4ZEIA 4DIGA 1H76A 4FIMA 1ZJLA 2XXWA 4U2RA 4YAHX 5HBCA 2HZLA 3HHFA 2VP1A 3FASA 3PU5A 4OVJA 4P0IA 1B3HA 3UA8A 1BP5A 4F3SA 1F9BA 2AIXA 2F5XA 2Q89A 2HEUA 2O1LA 2Y7RA 2ZYOA 3KSJA 3O28A 4FEDA 4HTGA 4RXLA 1FQCA 3USDA 4IY6A 5IKBA 4MFIA 1FQDA 4IO3A 3OO8A 1SW4A 2I4CA 2I49A 2QS2A 1D3KA 3B6TA 3LR1A 2OCUA 1NH8A 1YAEA 3DP6A 4H8IA 4NF4B 2I3VA 4N13A 4U21A 2XHDA 1O64A 2B3BA 1LFIA 1OIBA 3LUYA 4O3BA 4NF5B 4R9FA 1T0KA 1RKMA 2F78A 3C34A 3IOVA 2RCAA 3ONMA 3OO6A 4XKQA 3OO7A 2GH9A 1DPPA 4DXUA 4F39A 1TFAA 2DVCA 2VD2A 1JQFA 4ONYA 2F8DA 1MPDA 2DWAA 3TODA 3PMWA 3E13X 3AXFA 4RPOA 1QULA 4R6YA 1NFTA 4EF1A 5CMBA 1XS5A 4FORA 3Q25A 5DVFA 4F2QA 3SEXA 1CE2A 3ZKKA 1XHYA 3K0VA 1I6BA 4ZZEA 3IR1A 4GL8A 3WAFA 2DP8A 4NF6A 4PP0A 2I48A 2XX8A 4R75A 1FTLA 3QAXA 2YLNA 3MVZA 3D4CA 4IGTA 4M1VA 1EU8A 1N84A 1M5BA 1Y4CA 1PBQA 3HPIA 5I2KB 4C1TA 1MS7A 3RT6B 2PX1A 1M5EA 3T22A 1FQBA 1MH3A 4IO6A 4MH5A 4P11A 3VVEA 2A5SA 5KCJB 1O7TA 2GRVA 4OFLA 1N0TA 2NUVA 3FZVA 2NXOA 4IB2A 4YICA 3RQTA 3U72A 4QFLA 2I4BA 3VLUA 4F3PA 5B70A 4BDLA 2RC8A 4NF8B 3VVFA 2VHAA 3M3KA 2HFBA 3S4UA 1ZKBA 4NWDA 1DPEA 4MLQA 3S2VA 4JSOA 2XX9A 2GHBA 1USYH 1B4HA 3OOAA 4NWCA 4LQ2A 4UACA 1A8FA 1B6HA 1ZU0A 3BKIB 3N5LA 1S7YA 4OETA 5AA2A 1VFDA 3KN8A 3K1PA 3O97A 5H8HB 1N04A 3THIA 5DTBA 3U1OA 3VLVA 3K02A 2A5TA 3QYTA 3TTRA 1P1QA 4JDFA 3SEWA 3G3IA 4JWXA 1XC1A 4OEVA 4F1VA 5L9MA 5TPAB 5H8FA 3Q26A 2ZNSA 1A7LA 3S9NC 1B1HA 2REJA 4RK9A 3CFXA 4AB5A 2REGA 3JZJA 1AH5A 5AA1A 2I58A 3M3FA 1B51A 1LB8A 4DXCA 4Q8RA 4PETA 2O68A 4RY1A 5HPQA 3OMBA 3H6UA 4FE8A 1QUKA 3O6HA 3CR9A 4JWOA 1D9YA 2V3QA 2XXUA 1MY2A 3H6WA 3EF7A 1Y1MA 1DMBA 2QS4A 1YCJA 2Z8FA 3RPWA 3TQLA 2RINA 4H65A 3RUMA 3ECRA 3UIFA 3PUWE 1A54A 4ZZAA 3PUXE 2F34A 3IL1B 3CI8A 1O63A 3M3LA 1SDXA 2Z23A 3FV2A 2XD3A 1QJMA 3RTWB 2V3UA 1DTZA 2I6EA 3KBRA 1H45A 3BBRA 5JTYB 3K1NA 2F36A 5K2YA 4YB5A 1Q35A 3JV9A 5CBRA 2XD2A 3MP8A 3MVXA 1XOCA 1UIUA 1Y3QA 1SW1A 5I84A 3E3KA 2ABHA 3C32A 2UYFA 5FHOA 4NF6B 1MXWA 3FVGA 4R2FA 1N7XA 1MRPA 3VXCA 1EZPA 3TYHA 4C1UA 4X1BA 4R72A 3MVYA 3PPQA 1URDA 2YJPA 1B9JA 2HQ0A 3HCQA 3KZGA 1MPCA 3KN7A 5H8HA 2PYYA 3C4MA 4I62A 4KYEA 1TWYA 1LAXA 4GL0A 1B58A 3GLBA 2Y7PA 4ZDMA 4EXLA 1WODA 3G3FA 3VE1B 1MY0A 2PVUA 1QW0A 1XT8A 3KEIA 1SD3A 3PV0E 1Y4TA 2I3WA 4F29A 5JTYA 1IXHA 5I56A 1B3EA 5F1QA 2HZKA 1JW5A 1SI1A 3SEYA 4ELOA 1UTHB 4GQOA 4Q30B 4UA8A 1WVJA 2Q8JA 1OVBA 4YB6A 3MQ9A 4U22A 1JETA 3KG2A 3P7IA 4F19A 3MJNA 1R9LA 1USYE 2PBWA 1SBPA 1B5JA 1H43A 2ZXTA 4TLMB 1II5A 3C35A 3MZBA 1OQHA 4L17A 4WXJA 5DEXA 2V25A 5L9SA 1PB8A 1LCFA 4R9GA 5DVIA 1LBCA 1UTBB 1QKAA 1LAFE 2ESNA 3B7DA 3ILTB 4ISUA 4NTLA 3TAJA 1ZMGA 5TPAA 4U4SA 1BIYA 3BFTA 2NWJA 1B46A 2XXXA 3HN0A 4X48A 5H8QA 4LZ5A 1B0LA 3CG1A 5BUUA 2G93A 3VLWA 5FHNA 2O1MA 3MZ9A 3O29A 3PUZE 4JBZA 1S50A 4C0RA 3KFMA 3MP1A 1MXYA 2RC9A 2CMOA 5I58B 1TFDA 3I3VA 1OMPA 3TFLA 2AL4A 4XKPA 3K01A 5L8DA 3EHUA 1LBBA 5AA2B 3S9MC 2D5WA 4HCYA 4G68B 4EQBA 4DDDA 3OENA 1Z7ME 3IB1A 1FW0A 1ZLQA 2LAOA 4BDQA 3GZGA 1AOVA 2QL3A 1GVCA 1LGBC 2ALUA 4POXA 4HW8A 2FYIA 1EZOA 2OJTA 3EPEA 4P0GA 1FTKA 3KJ7A 5L9OA 1HSLA 1SQYA 3H6TA 4OENA 4DXBA 1SI0A 4KQPA 2P1SA 1N7WA 3Q27A 3FJMA 4EF2A 2XXQA 1URSA 3Q28A 1MQHA 1OQGA 3K2DA 3ODBA 2HAVA 3PUVE 4IY5A 3O6GA 3WAEA 5B7DA 4DE8A 1MPBA 5DEXB 4YKKA 3A3UA 4G8HA 1IXGA 3MPLA 2QPQA 3PD9A 1Y3PA 1MXZA 2XX7A 4QSCA 2ZMBA 2UVGA 2NVUB 3G3JA 4QSDA 3OEMA 1MY3A 1N76A 3CG3A 2XXVA 4H5FA 2R71A 2ZYKA 4ELRA 1R6ZA 4PFUA 3HSTA 4ZEDA 3V83A 1Y20A 3K6UA 4IGRA 2Y7WA 1B7HA 2DS9A 4NF8A 2I0BA 3GBBA 4ZEBA 4ESXA 3E4RA 2I0CA 1ELJA 3H03A 4IO2A 1MY4A 1RYXA 2UVHA 4NF4A 3UP9A 3CIJA 4QRZA 2O69A 1MQJA 3KGCA 5H8SA 1ATGA 1UQWA 3T93B 3ZS6A 4ELPA 3SEUA 1UTBA 1IUDA 4KI0E 4TOZA 5CRYA 3FGSA 3SKPA 2H98A 3IOTA 3OD7A 2XXPA 3FXQA 2DWIA 2RC7A 3VV5A 2Z8DA 3EHTA 3IO4A 5TU0A 5A5XA 3SESA 3FJ7A 4F3GA 2QSXA 2THIA 4DCXA 5ITOA 4OESA 4QHQA 3TPAA 3IAZA 5AE4A 4O3AA 2GHAA 3FD3A 4OMBA 4MF3A 4H1XA 4FJPA 5AA4A 5I58A 1NH7A 3TTKA 3QSLA 3VVDA 4RJZA 4YZZA 4X1DA 3G3KA 2Z22A 1JVXA 3GBAA 4H8JA 1EH3A 1US5A 1VR5A 1WDNA 5J1DA 3OXNA 1ZBMA 1B7ZA 3H7MA 4NF5A 5ELVA 3UORA 3TQWA 3K00A 3UGWA 5CM6A 1OLCA 1B05A 3TTNA 2GFEA 5ICQA 4RA1A 3IOWA 4AQ4A 2Q2CA 3O6IA 3TDJA 5H8QB 1P1OA 5AA2D 2IA4A 3G3HA 4LA9A 2VGQA 3S9EA 3OSQA 4R73A 5FTHA 4XKRA 4Q0CA 3N6UA 3O9PA 1MQDA 2P0SA 3E9XA 4TLLB 3HV1A 2IEEA 2M8CA 3W9VA 4BLAA 2W7YA 5K2XA 5AA4B 5CMKA 3RY3A 4GOTA 1MY1A 5EHSA 4U23A 1B40A 2V93A 2B65A 1J1NA 2FA7A 3N94A 3K4UA 4Q5TA 5DVJA 5EHMA 5CBSA 3R26A 1M5FA 3K6XA 5H8NA 3TCFA 1IEJA 3C9HA 1B5IA 4QF9A 3SDFA 5KDTB 3A3CA 4IO4A 1IZ1A 3OSRA 1I69A 3C31A 4HCWA 3W9WA 1R1NA 2F97A 2FNCA 1R9QA 1JNFA 2H99A 3D4GA 4THIA 4XIGQ 3VFJA 4F3BA 1DSNA 2DQVA 3RGYA 3IJOB 1LSTA 3TZAA 5JEIA 1KWHA 1SW2A 3CSGA 4ZEFA 5ISUA 4OYVA 3LSXA 4R6HA 3BFUA 3QXMA 3QK6A 1A8EA 3KJTA 2DWJA 3CVGA 3SETA 2X26A 1LFGA 1N3XA 3RTFB 4ZEKA 3G3GA 2OK2A 4ZS9A 1BKAA 2OWTA 4LATA 4EUOA 1IQ7A 1B52A 1JW4A 3EQ1A 1B7UA 3U92A 1VSOA 4BDOA 1IIWA 1BLFA 2F7BA 3IB2A 3K1MA 3KN3A 2V84A 1LAGE 2XXRA 3K6VA 3LC8A 3TKDA 1P99A 4DLDA 4DZ1A 3MC2A 4YB7A 1ZTYA 3ZKLA 4ELQA 2X7PA 5AA3A 1DTGA 2Y84A 3PD8A 4IO5A 3T9HB 4U4XA 3FIRA 3KSXA 3PPNA 5KZTA 1UTHA 5CMMA 2OWSA 5FHMA 4R6KA 3H6VA 4ZE9A 2PT1A 1OVTA 1US4A 3MW0A 1B2HA 3FXRA 1PB9A 2H5YA 4G77A 4GXSB 2XXTA 4ND9A 4QFNA 5I59A 1MM7A 1Y1ZA 5LOMA 3T9XB 5CMCA 4FAJA 4KYDA 1TXFA 5H8NB 3LBSA 4OWDA 1JEVA 5HM4B 5KDTA 2Y7KA 3HHGA 4FEBA 4OZ9A 2B3FA 3DM0A 4POWA 3V5AA 1URGA 1IXIA 1D4NA 5KCJA 4X9TA 4KCCA 1MXVA 4BDRA 2UXAA 1Y9UA 2ONKE 1NKXA 3PPPA 4NEDA 3N26A 1MXXA 4GWOA 4F1UA 4PFWA 4R2BA 1HSJA 3DP8A 3DELB 3FXUA 3C33A 3KOTA 4XKNA 3MZ1A 4PQJA 4F18A 1POY1 1TT1A 4WEPA 4QFPA 4BDMA 1Z7NE 1FQEA 4I8CA 1PEBA 2F7CA 4K3FA 2OBGA 5DYHA 3H3GA 1HSEA 4LZ8A 4Z0IA 2UYEA 3SERA 3VDFA 3LSLA 1IXCA 2H4IA 4GXAA 3RN8A 1B0HA 3T96B 1L5TA 4F1YA 1GR2A 4OEUA 5TP9A 5EYFA 4FATA 2O7IA 3MWBA 3OO9A 4WKMA 1XVXA 1NNKA 2Q2AA 1NNPA 1GTKA 3PUYE 1LLSA 3I6VA 4YMAA 1I6QA 4ZE8A 1MXUA 3TCGA 4LP2B 5ICTA 2D21A 2ZNTA 1B32A 3C36A 4XXUA 1PB7A 3UK4A 4U1ZA 3S9LC 1AL3A 4PE5B 2ONRA 2ANJA 3OEKA 3CFZA 3SEVA 1LCTA 1B5HA 1SVXB 1B3GA 3JYRA 3U8QA 3B6WA 1H3DA 1MG1A 3CFLA 1MH4A 2A5TB 2DWHA 2UVJA 4XTCQ 1QUJA 2UVIA 3MAMA 3W15C 4N07A 3EHSA 2Y7IA 3FVKA 5TP9B 1P1UA 2R9JA 3KOSA 4H6DA 5A5XB 2HCAA 2ZNUA 1B1XA 4WEDA 2Q9TA 3MBPA 3TEPA 4JXIA 5DT6A 5ITPA 1LB9A 3ILUB 1PC3A 1JW1A 3IB0A 5CC2A 4KCDA 2D3IA 4GFRA 4G68C 4O3CA 3UN6A 2OLBA 4YKPA 4H67A 1D9VA
chains in the Genus database with same CATH superfamily
4HE2A 1N3WA 5IZ1A 2DXRA 4RPNA 1S9TA 3U94A 2QMXA 4GVOA 1UIVA 2QS3A 4LQ5A 4PDHA 1MQIA 4MBPA 1VDWA 1AMFA 1NV1A 2RF1A 4R74A 4RNSA 4E0XA 4G4PA 3H06B 3IX1A 2VPNA 3LUZA 4G8NA 4MNIA 5T3JA 2DE2A 4H0WA 5I57B 1A40A 3PPOA 2XXIA 5I2KA 4EQ9A 3TELA 2DE4A 4GWXA 4YB7A 4LUBA 2ZYNA 2O84X 4F31B 1KA1A 2DYXA 5M2VA 3IO6A 2V3TA 4YU0A 2RKMA 2OX3A 3TCHA 3TTLA 1POTA 1QKBA 1GV8A 5I57A 1IITA 4G68A 3LSWA 4ECFA 2OZZA 3PPRA 1LAHE 1FPKA 3H4ZA 4OXVA 4F22A 1H44A 5FBPA 4H46A 2WYPA 1FCKA 5I59B 4BDNA 1MDQA 1SYHA 4N6PA 2O6AA 1MDP1 1PBPA 2H9BA 1ZJLA 1LBWA 2VP1A 4P0IA 1B3HA 3UA8A 2AIXA 2F5XA 3OXNA 4O7MA 2BJIA 2I3VA 2XHDA 1LFIA 2B3BA 1FPLA 3TPAA 4YMBA 4F39A 5AE4A 3ONMA 4DXUA 4PAFA 1FPGA 1IMCA 4R6YA 1XS5A 1XHYA 4ZZEA 3IR1A 4NF6A 4PP0A 2XX8A 4R75A 2YLNA 3D4CA 1N84A 4OANA 4C1TA 3RT6B 3T22A 3VVEA 4HE0A 5KCJB 1N0TA 4N91A 2CEYA 3VVFA 2VHAA 1SPIA 4HXVA 4JSOA 2XX9A 4UACA 1A8FA 3BKIB 1S7YA 5AA2A 2WBBA 3KN8A 3K1PA 3O97A 5DTBA 3TTRA 4JDFA 1XC1A 2XA5A 5TPAB 3S9NC 1DK4A 3JZJA 3QMFA 4G61A 4RY1A 3O6HA 1YCJA 2WEFA 3RUMA 3UIFA 2F34A 3CI8A 1O63A 3M3LA 1SDXA 1QJMA 2CZHA 1DTZA 3BBRA 3K1NA 5K2YA 3JV9A 1XOCA 1Y3QA 4NG7A 5FHOA 1MXWA 3VXCA 2HXRA 4GWSA 3C4MA 4QXDA 3KC1A 1FPFA 1KA0A 1NV5A 1WODA 2I3WA 1SI1A 1NV2A 1OVBA 4U22A 3KG2A 3P7IA 1NV7A 1B5JA 2ZXTA 4N17A 4ISUA 4NTLA 3TAJA 3BFTA 2NWJA 4PBHA 5H8QA 4LZ5A 5BUUA 5FHNA 3MZ9A 3MP1A 2RC9A 3TFLA 4N81A 1LBBA 2MKZA 3OENA 2LAOA 2GQ1A 3GZGA 1AOVA 1GVCA 4HW8A 1EZOA 4EF2A 1MQHA 1OQGA 5B7DA 4YKKA 2QPQA 1MXZA 2ZMBA 2UVGA 2NVUB 1MY3A 3CG3A 3HSTA 4NF8A 3H03A 3LV0A 3CIJA 2O69A 3KGCA 4ELPA 4TOZA 3E78A 3OD7A 3EHTA 5A5XA 4F3GA 2THIA 4MF3A 3GBAA 4NGUA 3UGWA 1B05A 3IOWA 2Q2CA 1P1OA 3S9EA 3OSQA 4R73A 3O9PA 4OA4A 2P0SA 3E9XA 4GOTA 2FVZA 2OWZA 2V93A 5ET6A 2B65A 5EHMA 5CBSA 5ET7A 1M5FA 5H8NA 1IEJA 3C9HA 4QF9A 3OSRA 4F3BA 3VFJA 5JEIA 3CSGA 4ZEFA 3LSXA 2P3NA 1A8EA 2X26A 1BKAA 2OWTA 4LATA 5ET8A 1JW4A 3EQ1A 1B7UA 3U92A 1VSOA 4BDOA 1IIWA 4F3SA 4DLDA 1P99A 4OVRA 3ZKLA 2Y84A 3T9HB 4PFIA 4QBAA 5KZTA 2OWSA 5FHMA 5J16A 3H6VA 3RPLB 1US4A 4NWCA 4G77A 1INPA 4P56A 2WBDA 3T9XB 5H8NB 3LBSA 4OWDA 4POWA 4AS4A 3PPPA 4GWOA 1HSJA 3DP8A 3FXUA 3C33A 3MZ1A 3RPLA 1TT1A 1IMFA 4QFPA 1FQEA 2F7CA 4K3FA 2QVUA 4GXAA 1B0HA 1L5TA 4OEUA 5EYFA 1CNQA 4PCDA 1XVXA 2Q2AA 3PUYE 4MNCA 4O7IA 1B32A 1NV3A 3C36A 4XXUA 3S9LC 5I5PA 2ONRA 2ANJA 3OEKA 1B5HA 1SVXB 4JVCA 1B3GA 1H3DA 3U65A 4O94A 2ZZWA 1FBFA 2UVJA 3EHSA 1IMAA 4MCOA 1B1XA 1K9ZA 3MBPA 4JXIA 4KCDA 4O3CA 4PAIA 3UN6A 4H67A 3A09A 2P2AA 4KHZE 3K6WA 4JB7A 2Q88A 2QJEA 4PFTA 4YKJA 5BWJA 4GBWA 4GX3A 5I56B 1FQFA 1VE4A 1NNFA 2XWKA 4H5GA 3CRBA 3ROJA 4QFKA 1D9QA 4EQ7A 3MP6A 2BJJX 2E0SA 3EKIA 1M5DA 3DLNA 4U1OA 3OELA 5IAIA 3QIMA 4GBVA 5IZZA 5JK4A 4GWUA 4LVQA 3Q29A 2AL5A 3TTMA 3G7WA 3FATA 3QUFA 1B3FA 3V89B 1FBCA 3RNNA 4IO7A 2XXHA 4GF8A 2QVVA 1YXIA 2R6GE 3FVOA 1YPNA 1NV6A 4F2OA 5I7IA 2QMWA 1IMDA 4GLIA 5I58B 1P1WA 3MPKA 3HO7A 3PMVA 3M8UA 3IOUA 1NI9A 3L6GA 3PMXA 4HE1A 5I3SA 3N6TA 3R6UA 3TMGA 2DOJA 2ONSA 2XXKA 3CSBA 4AB6A 1B3LA 3TUSA 3ZSFA 3GXAA 4MLVA 5IGAA 4PAKA 4KFQA 4JSDA 4M4GA 3R7XA 1VFEA 4MIJA 1GGGA 1Q1KA 2QRYA 3PGFA 2Z8EA 3V8XB 4OVTA 1CB6A 1IMBA 4MEVA 4KPTA 1NMUA 2XXWA 3PU5A 4OVJA 2Y7RA 4HTGA 2XWVA 4IY6A 1FQDA 4IO3A 3OO8A 2QS2A 4OVSA 1D3KA 2CZKA 1NH8A 2OCUA 4NF4B 1O64A 2XWOA 3LUYA 2WYKA 1RKMA 2F78A 3C34A 3IOVA 2RCAA 3ISPA 2GH9A 2VD2A 1MPDA 3AXFA 5CMBA 4P3LA 5DVFA 3ZKKA 1K9YA 3WAFA 4I3EA 2I48A 1FTLA 1NUXA 3QAXA 4M1VA 1M5BA 1PBQA 2PX1A 3MYUA 1FQBA 1MH3A 4IO6A 2A5SA 3RQTA 2NXOA 4IB2A 4BDLA 4NF8B 3S4UA 1ZKBA 1DPEA 4MLQA 1B4HA 1NUZA 1B6HA 4OETA 4X04A 3K02A 2A5TA 3QYTA 3SEWA 3G3IA 4JWXA 5L9MA 5H8FA 3RYDA 1B1HA 2REJA 3CFXA 1AH5A 3M3FA 4DXCA 1B51A 1FTAA 1LB8A 2O68A 3OMBA 4FE8A 3SZPA 2XXUA 1Y1MA 1DMBA 3RPWA 2RINA 3ECRA 1A54A 2Z23A 2XD3A 2V3UA 1H45A 3MP8A 3MVXA 2CZIA 3E3KA 2UYFA 1MRPA 3TYHA 4C1UA 3MVYA 4PFBA 2YJPA 1B9JA 3HCQA 4I62A 1LAXA 3GLBA 2Y7PA 4EXLA 1LBZA 1QW0A 1SD3A 3PV0E 1Y4TA 4F29A 2PBWA 1FBEA 4TLMB 3C35A 4L17A 1OQHA 5DEXA 2V25A 4R9GA 1QKAA 3ILTB 3B7DA 1B46A 2XXXA 4X48A 2QFLA 5LDZA 2XWIA 4C0RA 3PUZE 3KFMA 1TFDA 4XKPA 3S9MC 2D5WA 4HCYA 1Z7ME 1FW0A 2QL3A 2ALUA 2FYIA 1FTKA 3KJ7A 5L9OA 3H6TA 4DXBA 3KBZA 2P1SA 1RDXA 3IFAA 5EQ9A 3ODBA 3K2DA 5IZ3B 4IY5A 5DEXB 4G8HA 1IXGA 3MPLA 5LTCA 1Y3PA 4QSDA 1RDYA 4ELRA 1R6ZA 1Y20A 3E4RA 1ELJA 1MY4A 1RYXA 3BIHA 3UP9A 1MQJA 4KI0E 3IOTA 5ITOA 3IAZA 4O3AA 2GHAA 4OMBA 1NH7A 4XF5A 3TTKA 3VVDA 4YZZA 1JVXA 4H8JA 1EH3A 1US5A 1VR5A 1B7ZA 2PFYA 3UORA 3TQWA 2GFEA 4AQ4A 3TEPA 4LA9A 5FTHA 4XKRA 4BLAA 2IEEA 2M8CA 3W9VA 5CMKA 3RY3A 4U23A 1J1NA 3FXBA 3K4UA 3BIGA 3R26A 4IO4A 4PE3A 1I69A 3C31A 4HCWA 1R9QA 4THIA 4XIGQ 2DQVA 1LSTA 1KWHA 1EYKA 4N6DA 4R6HA 1N3XA 4ZEKA 3G3GA 1B52A 3HFUA 3IB2A 2F7BA 1LAGE 3K6VA 1FBDA 1AWBA 3MC2A 4ELQA 3PD8A 4IO5A 1UTHA 5CMMA 4NHBA 4R6KA 3FXRA 4ND9A 2H5YA 5ET5A 5I59A 1Y1ZA 5LOMA 1JEVA 4PC9A 2Y7KA 3HHGA 4FEBA 2B3FA 1IXIA 4X9TA 4KCCA 4BDRA 1Y9UA 3N26A 3KOTA 4F18A 5DYHA 4LZ8A 3VDFA 3LSLA 2H4IA 4P1LA 4FATA 2O7IA 3OO9A 2ZZXA 2WX9A 3I6VA 3TCGA 1MXUA 3UK4A 4U1ZA 1AL3A 3SEVA 3U8QA 3CFLA 1MH4A 3W15C 1BK4A 2R9JA 3KOSA 2ZNUA 2Q9TA 5DT6A 1LB9A 1JW1A 3IB0A 5CC2A 2D3IA 1D9VA 4YKIA 4RYAA 4ESWA 1FTMA 4G2ZA 4OVQA 5I2NB 1A55A 3I5OA 4ZECA 1FTJA 2F6PA 2E1SA 3VXBA 2FIXA 2V4CA 2YPNA 3FJGA 5B70A 1SW5A 4KYSA 5H8FB 4DCYA 1FBPA 5I2NA 1EZ9A 1M5CA 3RT8A 1ANFA 4EDPA 1YTVA 2VPOA 2DE3A 4NE4A 4Z7EA 1RYOA 4OHNA 1MQGA 3U72A 4OFOA 2HPGA 2WKYA 4GRKA 5ESYA 4MAGA 1JVYA 1NL5A 2KLFA 1AIVA 1P1NA 3MVWA 2QS1A 2PCRA 3RLFE 4NMYA 2DVZA 2H25A 3FUZA 1FRPA 3GYYA 2VOZA 3T66A 1DOTA 3B6QA 2KQZA 1BTJA 3LSFB 4OTEA 4HS7A 4I1DA 3T9VA 4DI3D 4DIGA 4ZEIA 4U2RA 4YAHX 3HHFA 3FASA 1F9BA 3KSJA 4RXLA 2HEUA 1RDZA 2O1LA 2ZYOA 3O28A 2I4CA 4JVIA 3TODA 3B6TA 3LR1A 4H8IA 3DP6A 5A5LA 4O3BA 4NF5B 4R9FA 1T0KA 3OO6A 2B4LA 3OO7A 1DPPA 2FHYA 1JQFA 2F8DA 3PMWA 3E13X 4MHFA 1NFTA 4FORA 3Q25A 3SEXA 1CE2A 3K0VA 1I6BA 4GL8A 5EQ8A 3MVZA 1EU8A 1Y4CA 3HPIA 1MS7A 1M5EA 2Q8MA 1O7TA 4OFLA 2NUVA 3FZVA 4PGPA 3VLUA 4QFLA 2RC8A 4NWDA 3S2VA 2GHBA 1USYH 3OOAA 4LQ2A 1ZU0A 3N5LA 4I3YA 1VFDA 4MJOA 5H8HB 3U1OA 3THIA 4N15A 1P1QA 4F1VA 4PF6A 1A7LA 4RK9A 4AB5A 4P9KA 5AA1A 5HPQA 3H6UA 1QUKA 3CR9A 4JWOA 1D9YA 2V3QA 4JVDA 2QS4A 3TQLA 1Q9DA 3IL1B 4N6KA 3KBRA 4YB5A 1Q35A 5I84A 1SW1A 1NV0A 2B4MA 2ABHA 3FVGA 1N7XA 4X1BA 4R72A 2HQ0A 1MPCA 5H8HA 4FBPA 4NN3A 3VE1B 1MY0A 1XT8A 1IXHA 5I56A 1B3EA 1G0IA 2HZKA 5F1QA 3SEYA 4DI4B 4ELOA 4GQOA 4Q30B 4UA8A 1WVJA 2Q8JA 4YB6A 4F19A 1R9LA 1II5A 3MZBA 4WXJA 1PB8A 4N8YA 1LBCA 2ESNA 2HHMA 1LBYA 3HN0A 2O1MA 3O29A 1S50A 2CMOA 1OMPA 2AL4A 4G68B 4BDQA 1LBXA 4POXA 2OJTA 4P0GA 2F3BA 1HSLA 1SQYA 1SI0A 4KQPA 1N7WA 3Q27A 3FJMA 2XXQA 1URSA 3Q28A 4NF0A 3PUVE 1NUYA 3O6GA 3WAEA 1MPBA 3A3UA 3PD9A 4QSCA 4NAPA 3G3JA 2XXVA 4H5FA 2ZYKA 3V83A 3K6UA 4IGRA 2DS9A 2I0BA 2UVHA 4QRZA 3MSTA 3ZS6A 1UQWA 3T93B 3SEUA 1UTBA 3E79A 5CRYA 3SKPA 2DWIA 3IO4A 5TU0A 3SESA 2QSXA 4OESA 4QHQA 3FD3A 5AA4A 4RJZA 4X1DA 1WDNA 5J1DA 5ELVA 3H7MA 5CM6A 1OLCA 5ICQA 1FPDA 3O6IA 3TDJA 3G3HA 2VGQA 3N6UA 3HV1A 1EYJA 5AA4B 2W7YA 1MY1A 5EHSA 5DVJA 2FA7A 3N94A 4GWYA 4GWWA 3TCFA 1B5IA 3A3CA 1R1NA 2F97A 2P3VA 2H99A 1KZ8A 1DSNA 1FJ9A 5ISUA 1NV4A 3KJTA 3SETA 3CVGA 1LFGA 3RTFB 2OK2A 4EUOA 1IQ7A 4MNPA 1BLFA 4UABA 2QVRA 3KN3A 2V84A 3TKDA 3LC8A 4DZ1A 5AA3A 2X7PA 1DTGA 4U4XA 3PPNA 3KSXA 4ZE9A 2PT1A 3MW0A 1IMEA 4FAJA 1TXFA 5HM4B 4PDDA 4OZ9A 3V5AA 1D4NA 5KCJA 2Y5KA 2VT5A 4NEDA 4PFWA 4R2BA 3DELB 4P8BA 1POY1 1EYIA 4BDMA 4Z0IA 2UYEA 1IXCA 3RN8A 5F24A 4F1YA 1GR2A 5TP9A 3MWBA 5EYGA 1GTKA 1LLSA 4LP2B 2ZNTA 2DDKA 4PE5B 3CFZA 2CEXA 3JYRA 1MG1A 1XI6A 2A5TB 2DWHA 2Q74A 4XTCQ 4N07A 4P1EA 5TP9B 5ITPA 4NX1A 2FIEA 4GFRA 4G68C 1FBHA 2OLBA 2PFZA 3B50A 3O66A 5EYHA 4FECA 3O2AA 2F6GA 2HAUA 2XXYA 3T9UA 4LZ7A 4OERA 1PDAA 2F35A 2F7AA 1A99A 4GWZA 1NNTA 4G8MA 4I9DA 3T0JA 2CZLA 3IORA 1LFHA 4GD5A 1QUIA 2O51A 3FVNA 4OFJA 2PMSA 1DBZA 4EXKA 3U93A 4LONB 4E0WA 3QUJA 4NQ8A 1MM6A 1FQAA 3IK6B 2AYSA 2HXWA 1Y3NA 4RK2A 2X7QA 5FTIA 1FTOA 1ZIUA 4AS5A 1JEUA 1B4ZA 2PT2A 3F11A 3DP4A 2JJKA 4TQUQ 1XVYA 2DXYA 4GIZA 5CI5A 3IJXB 4KD5A 2DSFA 1I6AA 2O7UA 4JWYA 4DDDA 4QSEA 3B8BA 2FBPA 1OLAA 1QVSA 4QFOA 4PFYA 4KR5A 4OQOA 1SYIA 3FV1A 5F7VA 4YKPA 3L6HA 2VD3A 2NOOA 5DVIA 2RCBA 2ZYMA 2G29A 3EN3A 3MUQA 1H76A 4FIMA 5HBCA 2HZLA 1FPBA 4P47A 1BP5A 2Q89A 3USDA 4FEDA 1FQCA 5IKBA 4MFIA 1SW4A 2I49A 4EQBA 1YAEA 4N13A 4U21A 2KR0A 1OIBA 4XKQA 4PFRA 1TFAA 2DVCA 4ONYA 2DWAA 4RPOA 1QULA 4EF1A 4F2QA 4GX4A 4GX6A 2DP8A 4IGTA 5I2KB 4MH5A 4P11A 4IR8A 2GRVA 4YICA 4F3PA 2I4BA 3NOHA 1FSAA 3M3KA 2HFBA 1N04A 3VLVA 4PBQA 4I40A 4OEVA 3A29A 3Q26A 2ZNSA 2REGA 2I58A 2R8TA 4Q8RA 4PETA 1MY2A 3H6WA 3EF7A 2Z8FA 4H65A 1G0HA 3PUWE 4ZZAA 3PUXE 3FV2A 4MMPA 3RTWB 2I6EA 5JTYB 2F36A 4H45A 5CBRA 2XD2A 1UIUA 3C32A 4NF6B 1DCUA 4R2FA 1EZPA 3PPQA 1URDA 3KZGA 3KN7A 2PYYA 4KYEA 1TWYA 4GL0A 1B58A 3PTYA 4ZDMA 3G3FA 2PVUA 3KEIA 5JTYA 1JW5A 1UTHB 2F3DA 1LEVA 3MQ9A 1JETA 3MJNA 1USYE 1SBPA 1H43A 5L9SA 1LCFA 1UTBB 3FBPA 1LAFE 1ZMGA 5TPAA 4U4SA 1BIYA 2ZZVA 1B0LA 3CG1A 2G93A 3VLWA 4JBZA 4OVPA 1MXYA 3I3VA 5L8DA 3IFCA 3K01A 3EHUA 4X8RA 5AA2B 4N4UA 3IB1A 1ZLQA 4PF8A 1LGBC 3EPEA 4XEQA 4OENA 2HAVA 4DE8A 1LBVA 2XX7A 1QGXA 3OEMA 1N76A 2R71A 4PFUA 4ZEDA 2Y7WA 1B7HA 3GBBA 4ZEBA 4ESXA 2I0CA 4IO2A 3KC0A 4NF4A 5DW8A 5H8SA 1ATGA 1IUDA 3FGSA 2H98A 2XXPA 3FXQA 2RC7A 3VV5A 2Z8DA 3FJ7A 3T1BA 4DCXA 3CHGA 5I58A 4H1XA 4FJPA 1FJ6A 3QSLA 4LN5A 3G3KA 2Z22A 5EQ7A 4NF5A 1ZBMA 3K00A 3TTNA 4RA1A 2Y5LA 5H8QB 5AA2D 2IA4A 5IM2A 3D1RA 5EQAA 4Q0CA 1MQDA 4PTKA 4TLLB 5K2XA 1B40A 4Q5TA 4O8MA 3K6XA 4N8GA 3SDFA 5KDTB 1IZ1A 3W9WA 2FNCA 1JNFA 3D4GA 3RGYA 3IJOB 3TZAA 1YYZA 1SW2A 2L5VA 4OYVA 3BFUA 3QXMA 3QK6A 2DWJA 4ZS9A 3K1MA 2XXRA 1YZ0A 1ZTYA 3FIRA 1OVTA 4QFNA 1B2HA 1FPEA 1PB9A 4GXSB 2XXTA 1FPIA 1MM7A 1FBGA 1FPJA 5CMCA 4KYDA 5KDTA 3DM0A 1URGA 1MXVA 2UXAA 4PGNA 2ONKE 1NKXA 4KXPA 1MXXA 4F1UA 4XKNA 4PQJA 4MX6A 4WEPA 1Z7NE 4I8CA 1PEBA 2OBGA 3H3GA 1HSEA 3SERA 3T96B 4WKMA 1NNKA 1NNPA 4XFEA 4YMAA 1I6QA 4ZE8A 5ICTA 2D21A 1PB7A 1LCTA 3B6WA 1NUWA 1QUJA 2UVIA 3MAMA 2Y7IA 3FVKA 1P1UA 4H6DA 5A5XB 2HCAA 4WEDA 1JP4A 3ILUB 1PC3A 5IZ3A
chains in the Genus database with same CATH topology
3A09A 3O66A 2P2AA 4KHZE 4YKIA 3K6WA 1N3WA 4FECA 4RYAA 4JB7A 4ESWA 2Q88A 3O2AA 2QJEA 4PFTA 1FTMA 2DXRA 4RPNA 1S9TA 2F6GA 4YKJA 4G2ZA 3U94A 5BWJA 2QMXA 2HAUA 5I2NB 1A55A 1FQFA 2XXYA 3I5OA 3T9UA 4ZECA 5I56B 1VE4A 4LZ7A 1FTJA 1NNFA 4GVOA 2F6PA 4OERA 4H5GA 1UIVA 2E1SA 2QS3A 1PDAA 3CRBA 4LQ5A 3VXBA 2YPNA 4QFKA 2F35A 2F7AA 3FJGA 4EQ7A 1A99A 1MQIA 1SW5A 1NNTA 3MP6A 4G8MA 4KYSA 4MBPA 4YMBA 1AMFA 2RF1A 2BJJX 2E0SA 4I9DA 1M5DA 5H8FB 4R74A 3DLNA 4RNSA 4E0XA 4U1OA 4G4PA 2CZLA 4DCYA 3H06B 3IORA 3IX1A 3OELA 5IAIA 3QIMA 1LFHA 4GD5A 4G8NA 1QUIA 2O51A 3FVNA 4OFJA 5JK4A 2PMSA 5I2NA 2DE2A 1EZ9A 4LVQA 4H0WA 3Q29A 2AL5A 1M5CA 3TTMA 1A40A 3FATA 3G7WA 3PPOA 3QUFA 4EXKA 5I57B 1B3FA 3U93A 2XXIA 1ANFA 3RT8A 3V89B 5I2KA 4LONB 4IO7A 3RNNA 4E0WA 2XXHA 3QUJA 4GF8A 4EDPA 4EQ9A 1MM6A 1YTVA 1FQAA 3TELA 2DE4A 3IK6B 2DE3A 2R6GE 2AYSA 2HXWA 1Y3NA 2ZYNA 3FVOA 2X7QA 4LUBA 1YPNA 4NE4A 2O84X 4RK2A 5FTIA 4F2OA 4F31B 2QMWA 1RYOA 2DYXA 1FTOA 1ZIUA 4OHNA 5M2VA 4GLIA 1JEUA 1B4ZA 1MQGA 2V3TA 2PT2A 3IO6A 4YU0A 1P1WA 2RKMA 3MPKA 4OFOA 2WKYA 3HO7A 3M8UA 3PMVA 3TCHA 4GRKA 3TTLA 1POTA 3IOUA 1QKBA 1GV8A 3F11A 5I57A 1JVYA 1IITA 1NL5A 3DP4A 3L6GA 4Z7EA 3PMXA 4G68A 4TQUQ 1XVYA 2KLFA 3LSWA 1AIVA 1P1NA 2DXYA 3MVWA 2OZZA 3PPRA 1LAHE 4ECFA 3N6TA 3R6UA 4GIZA 2QS1A 5CI5A 3IJXB 4KD5A 3RLFE 3TMGA 2DOJA 2ONSA 2DSFA 1I6AA 2O7UA 3H4ZA 4JWYA 4NMYA 3CSBA 2DVZA 4AB6A 1B3LA 2H25A 4QSEA 4OXVA 3TUSA 3ZSFA 1OLAA 3FUZA 4F22A 1QVSA 4QFOA 3GXAA 1H44A 4MLVA 4KFQA 4PFYA 4JSDA 4KR5A 4OQOA 4M4GA 3R7XA 1VFEA 1GGGA 1Q1KA 1SYIA 2VOZA 3FV1A 5F7VA 3T66A 1DOTA 1FCKA 2QRYA 2Z8EA 3B6QA 3PGFA 1MDQA 4BDNA 5I59B 3V8XB 1CB6A 1BTJA 3L6HA 1SYHA 2VD3A 2NOOA 2O6AA 4N6PA 1MDP1 1PBPA 2RCBA 3LSFB 4HS7A 4KPTA 2ZYMA 4OTEA 2G29A 4I1DA 1NMUA 2H9BA 3EN3A 3MUQA 3T9VA 4ZEIA 4DIGA 1H76A 4FIMA 1ZJLA 2XXWA 4U2RA 4YAHX 5HBCA 2HZLA 3HHFA 2VP1A 3FASA 3PU5A 4OVJA 4P0IA 1B3HA 3UA8A 1BP5A 4F3SA 1F9BA 2AIXA 2F5XA 2Q89A 2HEUA 2O1LA 2Y7RA 2ZYOA 3KSJA 3O28A 4FEDA 4HTGA 4RXLA 1FQCA 3USDA 4IY6A 5IKBA 4MFIA 1FQDA 4IO3A 3OO8A 1SW4A 2I4CA 2I49A 2QS2A 1D3KA 3B6TA 3LR1A 2OCUA 1NH8A 1YAEA 3DP6A 4H8IA 4NF4B 2I3VA 4N13A 4U21A 2XHDA 1O64A 2B3BA 1LFIA 1OIBA 3LUYA 4O3BA 4NF5B 4R9FA 1T0KA 1RKMA 2F78A 3C34A 3IOVA 2RCAA 3ONMA 3OO6A 4XKQA 3OO7A 2GH9A 1DPPA 4DXUA 4F39A 1TFAA 2DVCA 2VD2A 1JQFA 4ONYA 2F8DA 1MPDA 2DWAA 3TODA 3PMWA 3E13X 3AXFA 4RPOA 1QULA 4R6YA 1NFTA 4EF1A 5CMBA 1XS5A 4FORA 3Q25A 5DVFA 4F2QA 3SEXA 1CE2A 3ZKKA 1XHYA 3K0VA 1I6BA 4ZZEA 3IR1A 4GL8A 3WAFA 2DP8A 4NF6A 4PP0A 2I48A 2XX8A 4R75A 1FTLA 3QAXA 2YLNA 3MVZA 3D4CA 4IGTA 4M1VA 1EU8A 1N84A 1M5BA 1Y4CA 1PBQA 3HPIA 5I2KB 4C1TA 1MS7A 3RT6B 2PX1A 1M5EA 3T22A 1FQBA 1MH3A 4IO6A 4MH5A 4P11A 3VVEA 2A5SA 5KCJB 1O7TA 2GRVA 4OFLA 1N0TA 2NUVA 3FZVA 2NXOA 4IB2A 4YICA 3RQTA 3U72A 4QFLA 2I4BA 3VLUA 4F3PA 5B70A 4BDLA 2RC8A 4NF8B 3VVFA 2VHAA 3M3KA 2HFBA 3S4UA 1ZKBA 4NWDA 1DPEA 4MLQA 3S2VA 4JSOA 2XX9A 2GHBA 1USYH 1B4HA 3OOAA 4NWCA 4LQ2A 4UACA 1A8FA 1B6HA 1ZU0A 3BKIB 3N5LA 1S7YA 4OETA 5AA2A 1VFDA 3KN8A 3K1PA 3O97A 5H8HB 1N04A 3THIA 5DTBA 3U1OA 3VLVA 3K02A 2A5TA 3QYTA 3TTRA 1P1QA 4JDFA 3SEWA 3G3IA 4JWXA 1XC1A 4OEVA 4F1VA 5L9MA 5TPAB 5H8FA 3Q26A 2ZNSA 1A7LA 3S9NC 1B1HA 2REJA 4RK9A 3CFXA 4AB5A 2REGA 3JZJA 1AH5A 5AA1A 2I58A 3M3FA 1B51A 1LB8A 4DXCA 4Q8RA 4PETA 2O68A 4RY1A 5HPQA 3OMBA 3H6UA 4FE8A 1QUKA 3O6HA 3CR9A 4JWOA 1D9YA 2V3QA 2XXUA 1MY2A 3H6WA 3EF7A 1Y1MA 1DMBA 2QS4A 1YCJA 2Z8FA 3RPWA 3TQLA 2RINA 4H65A 3RUMA 3ECRA 3UIFA 3PUWE 1A54A 4ZZAA 3PUXE 2F34A 3IL1B 3CI8A 1O63A 3M3LA 1SDXA 2Z23A 3FV2A 2XD3A 1QJMA 3RTWB 2V3UA 1DTZA 2I6EA 3KBRA 1H45A 3BBRA 5JTYB 3K1NA 2F36A 5K2YA 4YB5A 1Q35A 3JV9A 5CBRA 2XD2A 3MP8A 3MVXA 1XOCA 1UIUA 1Y3QA 1SW1A 5I84A 3E3KA 2ABHA 3C32A 2UYFA 5FHOA 4NF6B 1MXWA 3FVGA 4R2FA 1N7XA 1MRPA 3VXCA 1EZPA 3TYHA 4C1UA 4X1BA 4R72A 3MVYA 3PPQA 1URDA 2YJPA 1B9JA 2HQ0A 3HCQA 3KZGA 1MPCA 3KN7A 5H8HA 2PYYA 3C4MA 4I62A 4KYEA 1TWYA 1LAXA 4GL0A 1B58A 3GLBA 2Y7PA 4ZDMA 4EXLA 1WODA 3G3FA 3VE1B 1MY0A 2PVUA 1QW0A 1XT8A 3KEIA 1SD3A 3PV0E 1Y4TA 2I3WA 4F29A 5JTYA 1IXHA 5I56A 1B3EA 5F1QA 2HZKA 1JW5A 1SI1A 3SEYA 4ELOA 1UTHB 4GQOA 4Q30B 4UA8A 1WVJA 2Q8JA 1OVBA 4YB6A 3MQ9A 4U22A 1JETA 3KG2A 3P7IA 4F19A 3MJNA 1R9LA 1USYE 2PBWA 1SBPA 1B5JA 1H43A 2ZXTA 4TLMB 1II5A 3C35A 3MZBA 1OQHA 4L17A 4WXJA 5DEXA 2V25A 5L9SA 1PB8A 1LCFA 4R9GA 5DVIA 1LBCA 1UTBB 1QKAA 1LAFE 2ESNA 3B7DA 3ILTB 4ISUA 4NTLA 3TAJA 1ZMGA 5TPAA 4U4SA 1BIYA 3BFTA 2NWJA 1B46A 2XXXA 3HN0A 4X48A 5H8QA 4LZ5A 1B0LA 3CG1A 5BUUA 2G93A 3VLWA 5FHNA 2O1MA 3MZ9A 3O29A 3PUZE 4JBZA 1S50A 4C0RA 3KFMA 3MP1A 1MXYA 2RC9A 2CMOA 5I58B 1TFDA 3I3VA 1OMPA 3TFLA 2AL4A 4XKPA 3K01A 5L8DA 3EHUA 1LBBA 5AA2B 3S9MC 2D5WA 4HCYA 4G68B 4EQBA 4DDDA 3OENA 1Z7ME 3IB1A 1FW0A 1ZLQA 2LAOA 4BDQA 3GZGA 1AOVA 2QL3A 1GVCA 1LGBC 2ALUA 4POXA 4HW8A 2FYIA 1EZOA 2OJTA 3EPEA 4P0GA 1FTKA 3KJ7A 5L9OA 1HSLA 1SQYA 3H6TA 4OENA 4DXBA 1SI0A 4KQPA 2P1SA 1N7WA 3Q27A 3FJMA 4EF2A 2XXQA 1URSA 3Q28A 1MQHA 1OQGA 3K2DA 3ODBA 2HAVA 3PUVE 4IY5A 3O6GA 3WAEA 5B7DA 4DE8A 1MPBA 5DEXB 4YKKA 3A3UA 4G8HA 1IXGA 3MPLA 2QPQA 3PD9A 1Y3PA 1MXZA 2XX7A 4QSCA 2ZMBA 2UVGA 2NVUB 3G3JA 4QSDA 3OEMA 1MY3A 1N76A 3CG3A 2XXVA 4H5FA 2R71A 2ZYKA 4ELRA 1R6ZA 4PFUA 3HSTA 4ZEDA 3V83A 1Y20A 3K6UA 4IGRA 2Y7WA 1B7HA 2DS9A 4NF8A 2I0BA 3GBBA 4ZEBA 4ESXA 3E4RA 2I0CA 1ELJA 3H03A 4IO2A 1MY4A 1RYXA 2UVHA 4NF4A 3UP9A 3CIJA 4QRZA 2O69A 1MQJA 3KGCA 5H8SA 1ATGA 1UQWA 3T93B 3ZS6A 4ELPA 3SEUA 1UTBA 1IUDA 4KI0E 4TOZA 5CRYA 3FGSA 3SKPA 2H98A 3IOTA 3OD7A 2XXPA 3FXQA 2DWIA 2RC7A 3VV5A 2Z8DA 3EHTA 3IO4A 5TU0A 5A5XA 3SESA 3FJ7A 4F3GA 2QSXA 2THIA 4DCXA 5ITOA 4OESA 4QHQA 3TPAA 3IAZA 5AE4A 4O3AA 2GHAA 3FD3A 4OMBA 4MF3A 4H1XA 4FJPA 5AA4A 5I58A 1NH7A 3TTKA 3QSLA 3VVDA 4RJZA 4YZZA 4X1DA 3G3KA 2Z22A 1JVXA 3GBAA 4H8JA 1EH3A 1US5A 1VR5A 1WDNA 5J1DA 3OXNA 1ZBMA 1B7ZA 3H7MA 4NF5A 5ELVA 3UORA 3TQWA 3K00A 3UGWA 5CM6A 1OLCA 1B05A 3TTNA 2GFEA 5ICQA 4RA1A 3IOWA 4AQ4A 2Q2CA 3O6IA 3TDJA 5H8QB 1P1OA 5AA2D 2IA4A 3G3HA 4LA9A 2VGQA 3S9EA 3OSQA 4R73A 5FTHA 4XKRA 4Q0CA 3N6UA 3O9PA 1MQDA 2P0SA 3E9XA 4TLLB 3HV1A 2IEEA 2M8CA 3W9VA 4BLAA 2W7YA 5K2XA 5AA4B 5CMKA 3RY3A 4GOTA 1MY1A 5EHSA 4U23A 1B40A 2V93A 2B65A 1J1NA 2FA7A 3N94A 3K4UA 4Q5TA 5DVJA 5EHMA 5CBSA 3R26A 1M5FA 3K6XA 5H8NA 3TCFA 1IEJA 3C9HA 1B5IA 4QF9A 3SDFA 5KDTB 3A3CA 4IO4A 1IZ1A 3OSRA 1I69A 3C31A 4HCWA 3W9WA 1R1NA 2F97A 2FNCA 1R9QA 1JNFA 2H99A 3D4GA 4THIA 4XIGQ 3VFJA 4F3BA 1DSNA 2DQVA 3RGYA 3IJOB 1LSTA 3TZAA 5JEIA 1KWHA 1SW2A 3CSGA 4ZEFA 5ISUA 4OYVA 3LSXA 4R6HA 3BFUA 3QXMA 3QK6A 1A8EA 3KJTA 2DWJA 3CVGA 3SETA 2X26A 1LFGA 1N3XA 3RTFB 4ZEKA 3G3GA 2OK2A 4ZS9A 1BKAA 2OWTA 4LATA 4EUOA 1IQ7A 1B52A 1JW4A 3EQ1A 1B7UA 3U92A 1VSOA 4BDOA 1IIWA 1BLFA 2F7BA 3IB2A 3K1MA 3KN3A 2V84A 1LAGE 2XXRA 3K6VA 3LC8A 3TKDA 1P99A 4DLDA 4DZ1A 3MC2A 4YB7A 1ZTYA 3ZKLA 4ELQA 2X7PA 5AA3A 1DTGA 2Y84A 3PD8A 4IO5A 3T9HB 4U4XA 3FIRA 3KSXA 3PPNA 5KZTA 1UTHA 5CMMA 2OWSA 5FHMA 4R6KA 3H6VA 4ZE9A 2PT1A 1OVTA 1US4A 3MW0A 1B2HA 3FXRA 1PB9A 2H5YA 4G77A 4GXSB 2XXTA 4ND9A 4QFNA 5I59A 1MM7A 1Y1ZA 5LOMA 3T9XB 5CMCA 4FAJA 4KYDA 1TXFA 5H8NB 3LBSA 4OWDA 1JEVA 5HM4B 5KDTA 2Y7KA 3HHGA 4FEBA 4OZ9A 2B3FA 3DM0A 4POWA 3V5AA 1URGA 1IXIA 1D4NA 5KCJA 4X9TA 4KCCA 1MXVA 4BDRA 2UXAA 1Y9UA 2ONKE 1NKXA 3PPPA 4NEDA 3N26A 1MXXA 4GWOA 4F1UA 4PFWA 4R2BA 1HSJA 3DP8A 3DELB 3FXUA 3C33A 3KOTA 4XKNA 3MZ1A 4PQJA 4F18A 1POY1 1TT1A 4WEPA 4QFPA 4BDMA 1Z7NE 1FQEA 4I8CA 1PEBA 2F7CA 4K3FA 2OBGA 5DYHA 3H3GA 1HSEA 4LZ8A 4Z0IA 2UYEA 3SERA 3VDFA 3LSLA 1IXCA 2H4IA 4GXAA 3RN8A 1B0HA 3T96B 1L5TA 4F1YA 1GR2A 4OEUA 5TP9A 5EYFA 4FATA 2O7IA 3MWBA 3OO9A 4WKMA 1XVXA 1NNKA 2Q2AA 1NNPA 1GTKA 3PUYE 1LLSA 3I6VA 4YMAA 1I6QA 4ZE8A 1MXUA 3TCGA 4LP2B 5ICTA 2D21A 2ZNTA 1B32A 3C36A 4XXUA 1PB7A 3UK4A 4U1ZA 3S9LC 1AL3A 4PE5B 2ONRA 2ANJA 3OEKA 3CFZA 3SEVA 1LCTA 1B5HA 1SVXB 1B3GA 3JYRA 3U8QA 3B6WA 1H3DA 1MG1A 3CFLA 1MH4A 2A5TB 2DWHA 2UVJA 4XTCQ 1QUJA 2UVIA 3MAMA 3W15C 4N07A 3EHSA 2Y7IA 3FVKA 5TP9B 1P1UA 2R9JA 3KOSA 4H6DA 5A5XB 2HCAA 2ZNUA 1B1XA 4WEDA 2Q9TA 3MBPA 3TEPA 4JXIA 5DT6A 5ITPA 1LB9A 3ILUB 1PC3A 1JW1A 3IB0A 5CC2A 4KCDA 2D3IA 4GFRA 4G68C 4O3CA 3UN6A 2OLBA 4YKPA 4H67A 1D9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A09 A;  3O66 A;  2P2A A;  4KHZ E;  4YKI A;  3K6W A;  1N3W A;  4FEC A;  4RYA A;  4JB7 A;  4ESW A;  2Q88 A;  3O2A A;  2QJE A;  4PFT A;  1FTM A;  2DXR A;  4RPN A;  1S9T A;  2F6G A;  4YKJ A;  4G2Z A;  3U94 A;  5BWJ A;  2QMX A;  2HAU A;  5I2N B;  1A55 A;  1FQF A;  2XXY A;  3I5O A;  3T9U A;  4ZEC A;  5I56 B;  1VE4 A;  4LZ7 A;  1FTJ A;  1NNF A;  4GVO A;  2F6P A;  4OER A;  4H5G A;  1UIV A;  2E1S A;  2QS3 A;  1PDA A;  3CRB A;  4LQ5 A;  3VXB A;  2YPN A;  4QFK A;  2F35 A;  2F7A A;  3FJG A;  4EQ7 A;  1A99 A;  1MQI A;  1SW5 A;  1NNT A;  3MP6 A;  4G8M A;  4KYS A;  4MBP A;  4YMB A;  1AMF A;  2RF1 A;  2BJJ X;  2E0S A;  4I9D A;  1M5D A;  5H8F B;  4R74 A;  3DLN A;  4RNS A;  4E0X A;  4U1O A;  4G4P A;  2CZL A;  4DCY A;  3H06 B;  3IOR A;  3IX1 A;  3OEL A;  5IAI A;  3QIM A;  1LFH A;  4GD5 A;  4G8N A;  1QUI A;  2O51 A;  3FVN A;  4OFJ A;  5JK4 A;  2PMS A;  5I2N A;  2DE2 A;  1EZ9 A;  4LVQ A;  4H0W A;  3Q29 A;  2AL5 A;  1M5C A;  3TTM A;  1A40 A;  3FAT A;  3G7W A;  3PPO A;  3QUF A;  4EXK A;  5I57 B;  1B3F A;  3U93 A;  2XXI A;  1ANF A;  3RT8 A;  3V89 B;  5I2K A;  4LON B;  4IO7 A;  3RNN A;  4E0W A;  2XXH A;  3QUJ A;  4GF8 A;  4EDP A;  4EQ9 A;  1MM6 A;  1YTV A;  1FQA A;  3TEL A;  2DE4 A;  3IK6 B;  2DE3 A;  2R6G E;  2AYS A;  2HXW A;  1Y3N A;  2ZYN A;  3FVO A;  2X7Q A;  4LUB A;  1YPN A;  4NE4 A;  2O84 X;  4RK2 A;  5FTI A;  4F2O A;  4F31 B;  2QMW A;  1RYO A;  2DYX A;  1FTO A;  1ZIU A;  4OHN A;  5M2V A;  4GLI A;  1JEU A;  1B4Z A;  1MQG A;  2V3T A;  2PT2 A;  3IO6 A;  4YU0 A;  1P1W A;  2RKM A;  3MPK A;  4OFO A;  2WKY A;  3HO7 A;  3M8U A;  3PMV A;  3TCH A;  4GRK A;  3TTL A;  1POT A;  3IOU A;  1QKB A;  1GV8 A;  3F11 A;  5I57 A;  1JVY A;  1IIT A;  1NL5 A;  3DP4 A;  3L6G A;  4Z7E A;  3PMX A;  4G68 A;  4TQU Q;  1XVY A;  2KLF A;  3LSW A;  1AIV A;  1P1N A;  2DXY A;  3MVW A;  2OZZ A;  3PPR A;  1LAH E;  4ECF A;  3N6T A;  3R6U A;  4GIZ A;  2QS1 A;  5CI5 A;  3IJX B;  4KD5 A;  3RLF E;  3TMG A;  2DOJ A;  2ONS A;  2DSF A;  1I6A A;  2O7U A;  3H4Z A;  4JWY A;  4NMY A;  3CSB A;  2DVZ A;  4AB6 A;  1B3L A;  2H25 A;  4QSE A;  4OXV A;  3TUS A;  3ZSF A;  1OLA A;  3FUZ A;  4F22 A;  1QVS A;  4QFO A;  3GXA A;  1H44 A;  4MLV A;  4KFQ A;  4PFY A;  4JSD A;  4KR5 A;  4OQO A;  4M4G A;  3R7X A;  1VFE A;  1GGG A;  1Q1K A;  1SYI A;  2VOZ A;  3FV1 A;  5F7V A;  3T66 A;  1DOT A;  1FCK A;  2QRY A;  2Z8E A;  3B6Q A;  3PGF A;  1MDQ A;  4BDN A;  5I59 B;  3V8X B;  1CB6 A;  1BTJ A;  3L6H A;  1SYH A;  2VD3 A;  2NOO A;  2O6A A;  4N6P A;  1MDP 1;  1PBP A;  2RCB A;  3LSF B;  4HS7 A;  4KPT A;  2ZYM A;  4OTE A;  2G29 A;  4I1D A;  1NMU A;  2H9B A;  3EN3 A;  3MUQ A;  3T9V A;  4ZEI A;  4DIG A;  1H76 A;  4FIM A;  1ZJL A;  2XXW A;  4U2R A;  4YAH X;  5HBC A;  2HZL A;  3HHF A;  2VP1 A;  3FAS A;  3PU5 A;  4OVJ A;  4P0I A;  1B3H A;  3UA8 A;  1BP5 A;  4F3S A;  1F9B A;  2AIX A;  2F5X A;  2Q89 A;  2HEU A;  2O1L A;  2Y7R A;  2ZYO A;  3KSJ A;  3O28 A;  4FED A;  4HTG A;  4RXL A;  1FQC A;  3USD A;  4IY6 A;  5IKB A;  4MFI A;  1FQD A;  4IO3 A;  3OO8 A;  1SW4 A;  2I4C A;  2I49 A;  2QS2 A;  1D3K A;  3B6T A;  3LR1 A;  2OCU A;  1NH8 A;  1YAE A;  3DP6 A;  4H8I A;  4NF4 B;  2I3V A;  4N13 A;  4U21 A;  2XHD A;  1O64 A;  2B3B A;  1LFI A;  1OIB A;  3LUY A;  4O3B A;  4NF5 B;  4R9F A;  1T0K A;  1RKM A;  2F78 A;  3C34 A;  3IOV A;  2RCA A;  3ONM A;  3OO6 A;  4XKQ A;  3OO7 A;  2GH9 A;  1DPP A;  4DXU A;  4F39 A;  1TFA A;  2DVC A;  2VD2 A;  1JQF A;  4ONY A;  2F8D A;  1MPD A;  2DWA A;  3TOD A;  3PMW A;  3E13 X;  3AXF A;  4RPO A;  1QUL A;  4R6Y A;  1NFT A;  4EF1 A;  5CMB A;  1XS5 A;  4FOR A;  3Q25 A;  5DVF A;  4F2Q A;  3SEX A;  1CE2 A;  3ZKK A;  1XHY A;  3K0V A;  1I6B A;  4ZZE A;  3IR1 A;  4GL8 A;  3WAF A;  2DP8 A;  4NF6 A;  4PP0 A;  2I48 A;  2XX8 A;  4R75 A;  1FTL A;  3QAX A;  2YLN A;  3MVZ A;  3D4C A;  4IGT A;  4M1V A;  1EU8 A;  1N84 A;  1M5B A;  1Y4C A;  1PBQ A;  3HPI A;  5I2K B;  4C1T A;  1MS7 A;  3RT6 B;  2PX1 A;  1M5E A;  3T22 A;  1FQB A;  1MH3 A;  4IO6 A;  4MH5 A;  4P11 A;  3VVE A;  2A5S A;  5KCJ B;  1O7T A;  2GRV A;  4OFL A;  1N0T A;  2NUV A;  3FZV A;  2NXO A;  4IB2 A;  4YIC A;  3RQT A;  3U72 A;  4QFL A;  2I4B A;  3VLU A;  4F3P A;  5B70 A;  4BDL A;  2RC8 A;  4NF8 B;  3VVF A;  2VHA A;  3M3K A;  2HFB A;  3S4U A;  1ZKB A;  4NWD A;  1DPE A;  4MLQ A;  3S2V A;  4JSO A;  2XX9 A;  2GHB A;  1USY H;  1B4H A;  3OOA A;  4NWC A;  4LQ2 A;  4UAC A;  1A8F A;  1B6H A;  1ZU0 A;  3BKI B;  3N5L A;  1S7Y A;  4OET A;  5AA2 A;  1VFD A;  3KN8 A;  3K1P A;  3O97 A;  5H8H B;  1N04 A;  3THI A;  5DTB A;  3U1O A;  3VLV A;  3K02 A;  2A5T A;  3QYT A;  3TTR A;  1P1Q A;  4JDF A;  3SEW A;  3G3I A;  4JWX A;  1XC1 A;  4OEV A;  4F1V A;  5L9M A;  5TPA B;  5H8F A;  3Q26 A;  2ZNS A;  1A7L A;  3S9N C;  1B1H A;  2REJ A;  4RK9 A;  3CFX A;  4AB5 A;  2REG A;  3JZJ A;  1AH5 A;  5AA1 A;  2I58 A;  3M3F A;  1B51 A;  1LB8 A;  4DXC A;  4Q8R A;  4PET A;  2O68 A;  4RY1 A;  5HPQ A;  3OMB A;  3H6U A;  4FE8 A;  1QUK A;  3O6H A;  3CR9 A;  4JWO A;  1D9Y A;  2V3Q A;  2XXU A;  1MY2 A;  3H6W A;  3EF7 A;  1Y1M A;  1DMB A;  2QS4 A;  1YCJ A;  2Z8F A;  3RPW A;  3TQL A;  2RIN A;  4H65 A;  3RUM A;  3ECR A;  3UIF A;  3PUW E;  1A54 A;  4ZZA A;  3PUX E;  2F34 A;  3IL1 B;  3CI8 A;  1O63 A;  3M3L A;  1SDX A;  2Z23 A;  3FV2 A;  2XD3 A;  1QJM A;  3RTW B;  2V3U A;  1DTZ A;  2I6E A;  3KBR A;  1H45 A;  3BBR A;  5JTY B;  3K1N A;  2F36 A;  5K2Y A;  4YB5 A;  1Q35 A;  3JV9 A;  5CBR A;  2XD2 A;  3MP8 A;  3MVX A;  1XOC A;  1UIU A;  1Y3Q A;  1SW1 A;  5I84 A;  3E3K A;  2ABH A;  3C32 A;  2UYF A;  5FHO A;  4NF6 B;  1MXW A;  3FVG A;  4R2F A;  1N7X A;  1MRP A;  3VXC A;  1EZP A;  3TYH A;  4C1U A;  4X1B A;  4R72 A;  3MVY A;  3PPQ A;  1URD A;  2YJP A;  1B9J A;  2HQ0 A;  3HCQ A;  3KZG A;  1MPC A;  3KN7 A;  5H8H A;  2PYY A;  3C4M A;  4I62 A;  4KYE A;  1TWY A;  1LAX A;  4GL0 A;  1B58 A;  3GLB A;  2Y7P A;  4ZDM A;  4EXL A;  1WOD A;  3G3F A;  3VE1 B;  1MY0 A;  2PVU A;  1QW0 A;  1XT8 A;  3KEI A;  1SD3 A;  3PV0 E;  1Y4T A;  2I3W A;  4F29 A;  5JTY A;  1IXH A;  5I56 A;  1B3E A;  5F1Q A;  2HZK A;  1JW5 A;  1SI1 A;  3SEY A;  4ELO A;  1UTH B;  4GQO A;  4Q30 B;  4UA8 A;  1WVJ A;  2Q8J A;  1OVB A;  4YB6 A;  3MQ9 A;  4U22 A;  1JET A;  3KG2 A;  3P7I A;  4F19 A;  3MJN A;  1R9L A;  1USY E;  2PBW A;  1SBP A;  1B5J A;  1H43 A;  2ZXT A;  4TLM B;  1II5 A;  3C35 A;  3MZB A;  1OQH A;  4L17 A;  4WXJ A;  5DEX A;  2V25 A;  5L9S A;  1PB8 A;  1LCF A;  4R9G A;  5DVI A;  1LBC A;  1UTB B;  1QKA A;  1LAF E;  2ESN A;  3B7D A;  3ILT B;  4ISU A;  4NTL A;  3TAJ A;  1ZMG A;  5TPA A;  4U4S A;  1BIY A;  3BFT A;  2NWJ A;  1B46 A;  2XXX A;  3HN0 A;  4X48 A;  5H8Q A;  4LZ5 A;  1B0L A;  3CG1 A;  5BUU A;  2G93 A;  3VLW A;  5FHN A;  2O1M A;  3MZ9 A;  3O29 A;  3PUZ E;  4JBZ A;  1S50 A;  4C0R A;  3KFM A;  3MP1 A;  1MXY A;  2RC9 A;  2CMO A;  5I58 B;  1TFD A;  3I3V A;  1OMP A;  3TFL A;  2AL4 A;  4XKP A;  3K01 A;  5L8D A;  3EHU A;  1LBB A;  5AA2 B;  3S9M C;  2D5W A;  4HCY A;  4G68 B;  4EQB A;  4DDD A;  3OEN A;  1Z7M E;  3IB1 A;  1FW0 A;  1ZLQ A;  2LAO A;  4BDQ A;  3GZG A;  1AOV A;  2QL3 A;  1GVC A;  1LGB C;  2ALU A;  4POX A;  4HW8 A;  2FYI A;  1EZO A;  2OJT A;  3EPE A;  4P0G A;  1FTK A;  3KJ7 A;  5L9O A;  1HSL A;  1SQY A;  3H6T A;  4OEN A;  4DXB A;  1SI0 A;  4KQP A;  2P1S A;  1N7W A;  3Q27 A;  3FJM A;  4EF2 A;  2XXQ A;  1URS A;  3Q28 A;  1MQH A;  1OQG A;  3K2D A;  3ODB A;  2HAV A;  3PUV E;  4IY5 A;  3O6G A;  3WAE A;  5B7D A;  4DE8 A;  1MPB A;  5DEX B;  4YKK A;  3A3U A;  4G8H A;  1IXG A;  3MPL A;  2QPQ A;  3PD9 A;  1Y3P A;  1MXZ A;  2XX7 A;  4QSC A;  2ZMB A;  2UVG A;  2NVU B;  3G3J A;  4QSD A;  3OEM A;  1MY3 A;  1N76 A;  3CG3 A;  2XXV A;  4H5F A;  2R71 A;  2ZYK A;  4ELR A;  1R6Z A;  4PFU A;  3HST A;  4ZED A;  3V83 A;  1Y20 A;  3K6U A;  4IGR A;  2Y7W A;  1B7H A;  2DS9 A;  4NF8 A;  2I0B A;  3GBB A;  4ZEB A;  4ESX A;  3E4R A;  2I0C A;  1ELJ A;  3H03 A;  4IO2 A;  1MY4 A;  1RYX A;  2UVH A;  4NF4 A;  3UP9 A;  3CIJ A;  4QRZ A;  2O69 A;  1MQJ A;  3KGC A;  5H8S A;  1ATG A;  1UQW A;  3T93 B;  3ZS6 A;  4ELP A;  3SEU A;  1UTB A;  1IUD A;  4KI0 E;  4TOZ A;  5CRY A;  3FGS A;  3SKP A;  2H98 A;  3IOT A;  3OD7 A;  2XXP A;  3FXQ A;  2DWI A;  2RC7 A;  3VV5 A;  2Z8D A;  3EHT A;  3IO4 A;  5TU0 A;  5A5X A;  3SES A;  3FJ7 A;  4F3G A;  2QSX A;  2THI A;  4DCX A;  5ITO A;  4OES A;  4QHQ A;  3TPA A;  3IAZ A;  5AE4 A;  4O3A A;  2GHA A;  3FD3 A;  4OMB A;  4MF3 A;  4H1X A;  4FJP A;  5AA4 A;  5I58 A;  1NH7 A;  3TTK A;  3QSL A;  3VVD A;  4RJZ A;  4YZZ A;  4X1D A;  3G3K A;  2Z22 A;  1JVX A;  3GBA A;  4H8J A;  1EH3 A;  1US5 A;  1VR5 A;  1WDN A;  5J1D A;  3OXN A;  1ZBM A;  1B7Z A;  3H7M A;  4NF5 A;  5ELV A;  3UOR A;  3TQW A;  3K00 A;  3UGW A;  5CM6 A;  1OLC A;  1B05 A;  3TTN A;  2GFE A;  5ICQ A;  4RA1 A;  3IOW A;  4AQ4 A;  2Q2C A;  3O6I A;  3TDJ A;  5H8Q B;  1P1O A;  5AA2 D;  2IA4 A;  3G3H A;  4LA9 A;  2VGQ A;  3S9E A;  3OSQ A;  4R73 A;  5FTH A;  4XKR A;  4Q0C A;  3N6U A;  3O9P A;  1MQD A;  2P0S A;  3E9X A;  4TLL B;  3HV1 A;  2IEE A;  2M8C A;  3W9V A;  4BLA A;  2W7Y A;  5K2X A;  5AA4 B;  5CMK A;  3RY3 A;  4GOT A;  1MY1 A;  5EHS A;  4U23 A;  1B40 A;  2V93 A;  2B65 A;  1J1N A;  2FA7 A;  3N94 A;  3K4U A;  4Q5T A;  5DVJ A;  5EHM A;  5CBS A;  3R26 A;  1M5F A;  3K6X A;  5H8N A;  3TCF A;  1IEJ A;  3C9H A;  1B5I A;  4QF9 A;  3SDF A;  5KDT B;  3A3C A;  4IO4 A;  1IZ1 A;  3OSR A;  1I69 A;  3C31 A;  4HCW A;  3W9W A;  1R1N A;  2F97 A;  2FNC A;  1R9Q A;  1JNF A;  2H99 A;  3D4G A;  4THI A;  4XIG Q;  3VFJ A;  4F3B A;  1DSN A;  2DQV A;  3RGY A;  3IJO B;  1LST A;  3TZA A;  5JEI A;  1KWH A;  1SW2 A;  3CSG A;  4ZEF A;  5ISU A;  4OYV A;  3LSX A;  4R6H A;  3BFU A;  3QXM A;  3QK6 A;  1A8E A;  3KJT A;  2DWJ A;  3CVG A;  3SET A;  2X26 A;  1LFG A;  1N3X A;  3RTF B;  4ZEK A;  3G3G A;  2OK2 A;  4ZS9 A;  1BKA A;  2OWT A;  4LAT A;  4EUO A;  1IQ7 A;  1B52 A;  1JW4 A;  3EQ1 A;  1B7U A;  3U92 A;  1VSO A;  4BDO A;  1IIW A;  1BLF A;  2F7B A;  3IB2 A;  3K1M A;  3KN3 A;  2V84 A;  1LAG E;  2XXR A;  3K6V A;  3LC8 A;  3TKD A;  1P99 A;  4DLD A;  4DZ1 A;  3MC2 A;  4YB7 A;  1ZTY A;  3ZKL A;  4ELQ A;  2X7P A;  5AA3 A;  1DTG A;  2Y84 A;  3PD8 A;  4IO5 A;  3T9H B;  4U4X A;  3FIR A;  3KSX A;  3PPN A;  5KZT A;  1UTH A;  5CMM A;  2OWS A;  5FHM A;  4R6K A;  3H6V A;  4ZE9 A;  2PT1 A;  1OVT A;  1US4 A;  3MW0 A;  1B2H A;  3FXR A;  1PB9 A;  2H5Y A;  4G77 A;  4GXS B;  2XXT A;  4ND9 A;  4QFN A;  5I59 A;  1MM7 A;  1Y1Z A;  5LOM A;  3T9X B;  5CMC A;  4FAJ A;  4KYD A;  1TXF A;  5H8N B;  3LBS A;  4OWD A;  1JEV A;  5HM4 B;  5KDT A;  2Y7K A;  3HHG A;  4FEB A;  4OZ9 A;  2B3F A;  3DM0 A;  4POW A;  3V5A A;  1URG A;  1IXI A;  1D4N A;  5KCJ A;  4X9T A;  4KCC A;  1MXV A;  4BDR A;  2UXA A;  1Y9U A;  2ONK E;  1NKX A;  3PPP A;  4NED A;  3N26 A;  1MXX A;  4GWO A;  4F1U A;  4PFW A;  4R2B A;  1HSJ A;  3DP8 A;  3DEL B;  3FXU A;  3C33 A;  3KOT A;  4XKN A;  3MZ1 A;  4PQJ A;  4F18 A;  1POY 1;  1TT1 A;  4WEP A;  4QFP A;  4BDM A;  1Z7N E;  1FQE A;  4I8C A;  1PEB A;  2F7C A;  4K3F A;  2OBG A;  5DYH A;  3H3G A;  1HSE A;  4LZ8 A;  4Z0I A;  2UYE A;  3SER A;  3VDF A;  3LSL A;  1IXC A;  2H4I A;  4GXA A;  3RN8 A;  1B0H A;  3T96 B;  1L5T A;  4F1Y A;  1GR2 A;  4OEU A;  5TP9 A;  5EYF A;  4FAT A;  2O7I A;  3MWB A;  3OO9 A;  4WKM A;  1XVX A;  1NNK A;  2Q2A A;  1NNP A;  1GTK A;  3PUY E;  1LLS A;  3I6V A;  4YMA A;  1I6Q A;  4ZE8 A;  1MXU A;  3TCG A;  4LP2 B;  5ICT A;  2D21 A;  2ZNT A;  1B32 A;  3C36 A;  4XXU A;  1PB7 A;  3UK4 A;  4U1Z A;  3S9L C;  1AL3 A;  4PE5 B;  2ONR A;  2ANJ A;  3OEK A;  3CFZ A;  3SEV A;  1LCT A;  1B5H A;  1SVX B;  1B3G A;  3JYR A;  3U8Q A;  3B6W A;  1H3D A;  1MG1 A;  3CFL A;  1MH4 A;  2A5T B;  2DWH A;  2UVJ A;  4XTC Q;  1QUJ A;  2UVI A;  3MAM A;  3W15 C;  4N07 A;  3EHS A;  2Y7I A;  3FVK A;  5TP9 B;  1P1U A;  2R9J A;  3KOS A;  4H6D A;  5A5X B;  2HCA A;  2ZNU A;  1B1X A;  4WED A;  2Q9T A;  3MBP A;  3TEP A;  4JXI A;  5DT6 A;  5ITP A;  1LB9 A;  3ILU B;  1PC3 A;  1JW1 A;  3IB0 A;  5CC2 A;  4KCD A;  2D3I A;  4GFR A;  4G68 C;  4O3C A;  3UN6 A;  2OLB A;  4YKP A;  4H67 A;  1D9V A; 
#chains in the Genus database with same CATH topology
 4HE2 A;  1N3W A;  5IZ1 A;  2DXR A;  4RPN A;  1S9T A;  3U94 A;  2QMX A;  4GVO A;  1UIV A;  2QS3 A;  4LQ5 A;  4PDH A;  1MQI A;  4MBP A;  1VDW A;  1AMF A;  1NV1 A;  2RF1 A;  4R74 A;  4RNS A;  4E0X A;  4G4P A;  3H06 B;  3IX1 A;  2VPN A;  3LUZ A;  4G8N A;  4MNI A;  5T3J A;  2DE2 A;  4H0W A;  5I57 B;  1A40 A;  3PPO A;  2XXI A;  5I2K A;  4EQ9 A;  3TEL A;  2DE4 A;  4GWX A;  4YB7 A;  4LUB A;  2ZYN A;  2O84 X;  4F31 B;  1KA1 A;  2DYX A;  5M2V A;  3IO6 A;  2V3T A;  4YU0 A;  2RKM A;  2OX3 A;  3TCH A;  3TTL A;  1POT A;  1QKB A;  1GV8 A;  5I57 A;  1IIT A;  4G68 A;  3LSW A;  4ECF A;  2OZZ A;  3PPR A;  1LAH E;  1FPK A;  3H4Z A;  4OXV A;  4F22 A;  1H44 A;  5FBP A;  4H46 A;  2WYP A;  1FCK A;  5I59 B;  4BDN A;  1MDQ A;  1SYH A;  4N6P A;  2O6A A;  1MDP 1;  1PBP A;  2H9B A;  1ZJL A;  1LBW A;  2VP1 A;  4P0I A;  1B3H A;  3UA8 A;  2AIX A;  2F5X A;  3OXN A;  4O7M A;  2BJI A;  2I3V A;  2XHD A;  1LFI A;  2B3B A;  1FPL A;  3TPA A;  4YMB A;  4F39 A;  5AE4 A;  3ONM A;  4DXU A;  4PAF A;  1FPG A;  1IMC A;  4R6Y A;  1XS5 A;  1XHY A;  4ZZE A;  3IR1 A;  4NF6 A;  4PP0 A;  2XX8 A;  4R75 A;  2YLN A;  3D4C A;  1N84 A;  4OAN A;  4C1T A;  3RT6 B;  3T22 A;  3VVE A;  4HE0 A;  5KCJ B;  1N0T A;  4N91 A;  2CEY A;  3VVF A;  2VHA A;  1SPI A;  4HXV A;  4JSO A;  2XX9 A;  4UAC A;  1A8F A;  3BKI B;  1S7Y A;  5AA2 A;  2WBB A;  3KN8 A;  3K1P A;  3O97 A;  5DTB A;  3TTR A;  4JDF A;  1XC1 A;  2XA5 A;  5TPA B;  3S9N C;  1DK4 A;  3JZJ A;  3QMF A;  4G61 A;  4RY1 A;  3O6H A;  1YCJ A;  2WEF A;  3RUM A;  3UIF A;  2F34 A;  3CI8 A;  1O63 A;  3M3L A;  1SDX A;  1QJM A;  2CZH A;  1DTZ A;  3BBR A;  3K1N A;  5K2Y A;  3JV9 A;  1XOC A;  1Y3Q A;  4NG7 A;  5FHO A;  1MXW A;  3VXC A;  2HXR A;  4GWS A;  3C4M A;  4QXD A;  3KC1 A;  1FPF A;  1KA0 A;  1NV5 A;  1WOD A;  2I3W A;  1SI1 A;  1NV2 A;  1OVB A;  4U22 A;  3KG2 A;  3P7I A;  1NV7 A;  1B5J A;  2ZXT A;  4N17 A;  4ISU A;  4NTL A;  3TAJ A;  3BFT A;  2NWJ A;  4PBH A;  5H8Q A;  4LZ5 A;  5BUU A;  5FHN A;  3MZ9 A;  3MP1 A;  2RC9 A;  3TFL A;  4N81 A;  1LBB A;  2MKZ A;  3OEN A;  2LAO A;  2GQ1 A;  3GZG A;  1AOV A;  1GVC A;  4HW8 A;  1EZO A;  4EF2 A;  1MQH A;  1OQG A;  5B7D A;  4YKK A;  2QPQ A;  1MXZ A;  2ZMB A;  2UVG A;  2NVU B;  1MY3 A;  3CG3 A;  3HST A;  4NF8 A;  3H03 A;  3LV0 A;  3CIJ A;  2O69 A;  3KGC A;  4ELP A;  4TOZ A;  3E78 A;  3OD7 A;  3EHT A;  5A5X A;  4F3G A;  2THI A;  4MF3 A;  3GBA A;  4NGU A;  3UGW A;  1B05 A;  3IOW A;  2Q2C A;  1P1O A;  3S9E A;  3OSQ A;  4R73 A;  3O9P A;  4OA4 A;  2P0S A;  3E9X A;  4GOT A;  2FVZ A;  2OWZ A;  2V93 A;  5ET6 A;  2B65 A;  5EHM A;  5CBS A;  5ET7 A;  1M5F A;  5H8N A;  1IEJ A;  3C9H A;  4QF9 A;  3OSR A;  4F3B A;  3VFJ A;  5JEI A;  3CSG A;  4ZEF A;  3LSX A;  2P3N A;  1A8E A;  2X26 A;  1BKA A;  2OWT A;  4LAT A;  5ET8 A;  1JW4 A;  3EQ1 A;  1B7U A;  3U92 A;  1VSO A;  4BDO A;  1IIW A;  4F3S A;  4DLD A;  1P99 A;  4OVR A;  3ZKL A;  2Y84 A;  3T9H B;  4PFI A;  4QBA A;  5KZT A;  2OWS A;  5FHM A;  5J16 A;  3H6V A;  3RPL B;  1US4 A;  4NWC A;  4G77 A;  1INP A;  4P56 A;  2WBD A;  3T9X B;  5H8N B;  3LBS A;  4OWD A;  4POW A;  4AS4 A;  3PPP A;  4GWO A;  1HSJ A;  3DP8 A;  3FXU A;  3C33 A;  3MZ1 A;  3RPL A;  1TT1 A;  1IMF A;  4QFP A;  1FQE A;  2F7C A;  4K3F A;  2QVU A;  4GXA A;  1B0H A;  1L5T A;  4OEU A;  5EYF A;  1CNQ A;  4PCD A;  1XVX A;  2Q2A A;  3PUY E;  4MNC A;  4O7I A;  1B32 A;  1NV3 A;  3C36 A;  4XXU A;  3S9L C;  5I5P A;  2ONR A;  2ANJ A;  3OEK A;  1B5H A;  1SVX B;  4JVC A;  1B3G A;  1H3D A;  3U65 A;  4O94 A;  2ZZW A;  1FBF A;  2UVJ A;  3EHS A;  1IMA A;  4MCO A;  1B1X A;  1K9Z A;  3MBP A;  4JXI A;  4KCD A;  4O3C A;  4PAI A;  3UN6 A;  4H67 A;  3A09 A;  2P2A A;  4KHZ E;  3K6W A;  4JB7 A;  2Q88 A;  2QJE A;  4PFT A;  4YKJ A;  5BWJ A;  4GBW A;  4GX3 A;  5I56 B;  1FQF A;  1VE4 A;  1NNF A;  2XWK A;  4H5G A;  3CRB A;  3ROJ A;  4QFK A;  1D9Q A;  4EQ7 A;  3MP6 A;  2BJJ X;  2E0S A;  3EKI A;  1M5D A;  3DLN A;  4U1O A;  3OEL A;  5IAI A;  3QIM A;  4GBV A;  5IZZ A;  5JK4 A;  4GWU A;  4LVQ A;  3Q29 A;  2AL5 A;  3TTM A;  3G7W A;  3FAT A;  3QUF A;  1B3F A;  3V89 B;  1FBC A;  3RNN A;  4IO7 A;  2XXH A;  4GF8 A;  2QVV A;  1YXI A;  2R6G E;  3FVO A;  1YPN A;  1NV6 A;  4F2O A;  5I7I A;  2QMW A;  1IMD A;  4GLI A;  5I58 B;  1P1W A;  3MPK A;  3HO7 A;  3PMV A;  3M8U A;  3IOU A;  1NI9 A;  3L6G A;  3PMX A;  4HE1 A;  5I3S A;  3N6T A;  3R6U A;  3TMG A;  2DOJ A;  2ONS A;  2XXK A;  3CSB A;  4AB6 A;  1B3L A;  3TUS A;  3ZSF A;  3GXA A;  4MLV A;  5IGA A;  4PAK A;  4KFQ A;  4JSD A;  4M4G A;  3R7X A;  1VFE A;  4MIJ A;  1GGG A;  1Q1K A;  2QRY A;  3PGF A;  2Z8E A;  3V8X B;  4OVT A;  1CB6 A;  1IMB A;  4MEV A;  4KPT A;  1NMU A;  2XXW A;  3PU5 A;  4OVJ A;  2Y7R A;  4HTG A;  2XWV A;  4IY6 A;  1FQD A;  4IO3 A;  3OO8 A;  2QS2 A;  4OVS A;  1D3K A;  2CZK A;  1NH8 A;  2OCU A;  4NF4 B;  1O64 A;  2XWO A;  3LUY A;  2WYK A;  1RKM A;  2F78 A;  3C34 A;  3IOV A;  2RCA A;  3ISP A;  2GH9 A;  2VD2 A;  1MPD A;  3AXF A;  5CMB A;  4P3L A;  5DVF A;  3ZKK A;  1K9Y A;  3WAF A;  4I3E A;  2I48 A;  1FTL A;  1NUX A;  3QAX A;  4M1V A;  1M5B A;  1PBQ A;  2PX1 A;  3MYU A;  1FQB A;  1MH3 A;  4IO6 A;  2A5S A;  3RQT A;  2NXO A;  4IB2 A;  4BDL A;  4NF8 B;  3S4U A;  1ZKB A;  1DPE A;  4MLQ A;  1B4H A;  1NUZ A;  1B6H A;  4OET A;  4X04 A;  3K02 A;  2A5T A;  3QYT A;  3SEW A;  3G3I A;  4JWX A;  5L9M A;  5H8F A;  3RYD A;  1B1H A;  2REJ A;  3CFX A;  1AH5 A;  3M3F A;  4DXC A;  1B51 A;  1FTA A;  1LB8 A;  2O68 A;  3OMB A;  4FE8 A;  3SZP A;  2XXU A;  1Y1M A;  1DMB A;  3RPW A;  2RIN A;  3ECR A;  1A54 A;  2Z23 A;  2XD3 A;  2V3U A;  1H45 A;  3MP8 A;  3MVX A;  2CZI A;  3E3K A;  2UYF A;  1MRP A;  3TYH A;  4C1U A;  3MVY A;  4PFB A;  2YJP A;  1B9J A;  3HCQ A;  4I62 A;  1LAX A;  3GLB A;  2Y7P A;  4EXL A;  1LBZ A;  1QW0 A;  1SD3 A;  3PV0 E;  1Y4T A;  4F29 A;  2PBW A;  1FBE A;  4TLM B;  3C35 A;  4L17 A;  1OQH A;  5DEX A;  2V25 A;  4R9G A;  1QKA A;  3ILT B;  3B7D A;  1B46 A;  2XXX A;  4X48 A;  2QFL A;  5LDZ A;  2XWI A;  4C0R A;  3PUZ E;  3KFM A;  1TFD A;  4XKP A;  3S9M C;  2D5W A;  4HCY A;  1Z7M E;  1FW0 A;  2QL3 A;  2ALU A;  2FYI A;  1FTK A;  3KJ7 A;  5L9O A;  3H6T A;  4DXB A;  3KBZ A;  2P1S A;  1RDX A;  3IFA A;  5EQ9 A;  3ODB A;  3K2D A;  5IZ3 B;  4IY5 A;  5DEX B;  4G8H A;  1IXG A;  3MPL A;  5LTC A;  1Y3P A;  4QSD A;  1RDY A;  4ELR A;  1R6Z A;  1Y20 A;  3E4R A;  1ELJ A;  1MY4 A;  1RYX A;  3BIH A;  3UP9 A;  1MQJ A;  4KI0 E;  3IOT A;  5ITO A;  3IAZ A;  4O3A A;  2GHA A;  4OMB A;  1NH7 A;  4XF5 A;  3TTK A;  3VVD A;  4YZZ A;  1JVX A;  4H8J A;  1EH3 A;  1US5 A;  1VR5 A;  1B7Z A;  2PFY A;  3UOR A;  3TQW A;  2GFE A;  4AQ4 A;  3TEP A;  4LA9 A;  5FTH A;  4XKR A;  4BLA A;  2IEE A;  2M8C A;  3W9V A;  5CMK A;  3RY3 A;  4U23 A;  1J1N A;  3FXB A;  3K4U A;  3BIG A;  3R26 A;  4IO4 A;  4PE3 A;  1I69 A;  3C31 A;  4HCW A;  1R9Q A;  4THI A;  4XIG Q;  2DQV A;  1LST A;  1KWH A;  1EYK A;  4N6D A;  4R6H A;  1N3X A;  4ZEK A;  3G3G A;  1B52 A;  3HFU A;  3IB2 A;  2F7B A;  1LAG E;  3K6V A;  1FBD A;  1AWB A;  3MC2 A;  4ELQ A;  3PD8 A;  4IO5 A;  1UTH A;  5CMM A;  4NHB A;  4R6K A;  3FXR A;  4ND9 A;  2H5Y A;  5ET5 A;  5I59 A;  1Y1Z A;  5LOM A;  1JEV A;  4PC9 A;  2Y7K A;  3HHG A;  4FEB A;  2B3F A;  1IXI A;  4X9T A;  4KCC A;  4BDR A;  1Y9U A;  3N26 A;  3KOT A;  4F18 A;  5DYH A;  4LZ8 A;  3VDF A;  3LSL A;  2H4I A;  4P1L A;  4FAT A;  2O7I A;  3OO9 A;  2ZZX A;  2WX9 A;  3I6V A;  3TCG A;  1MXU A;  3UK4 A;  4U1Z A;  1AL3 A;  3SEV A;  3U8Q A;  3CFL A;  1MH4 A;  3W15 C;  1BK4 A;  2R9J A;  3KOS A;  2ZNU A;  2Q9T A;  5DT6 A;  1LB9 A;  1JW1 A;  3IB0 A;  5CC2 A;  2D3I A;  1D9V A;  4YKI A;  4RYA A;  4ESW A;  1FTM A;  4G2Z A;  4OVQ A;  5I2N B;  1A55 A;  3I5O A;  4ZEC A;  1FTJ A;  2F6P A;  2E1S A;  3VXB A;  2FIX A;  2V4C A;  2YPN A;  3FJG A;  5B70 A;  1SW5 A;  4KYS A;  5H8F B;  4DCY A;  1FBP A;  5I2N A;  1EZ9 A;  1M5C A;  3RT8 A;  1ANF A;  4EDP A;  1YTV A;  2VPO A;  2DE3 A;  4NE4 A;  4Z7E A;  1RYO A;  4OHN A;  1MQG A;  3U72 A;  4OFO A;  2HPG A;  2WKY A;  4GRK A;  5ESY A;  4MAG A;  1JVY A;  1NL5 A;  2KLF A;  1AIV A;  1P1N A;  3MVW A;  2QS1 A;  2PCR A;  3RLF E;  4NMY A;  2DVZ A;  2H25 A;  3FUZ A;  1FRP A;  3GYY A;  2VOZ A;  3T66 A;  1DOT A;  3B6Q A;  2KQZ A;  1BTJ A;  3LSF B;  4OTE A;  4HS7 A;  4I1D A;  3T9V A;  4DI3 D;  4DIG A;  4ZEI A;  4U2R A;  4YAH X;  3HHF A;  3FAS A;  1F9B A;  3KSJ A;  4RXL A;  2HEU A;  1RDZ A;  2O1L A;  2ZYO A;  3O28 A;  2I4C A;  4JVI A;  3TOD A;  3B6T A;  3LR1 A;  4H8I A;  3DP6 A;  5A5L A;  4O3B A;  4NF5 B;  4R9F A;  1T0K A;  3OO6 A;  2B4L A;  3OO7 A;  1DPP A;  2FHY A;  1JQF A;  2F8D A;  3PMW A;  3E13 X;  4MHF A;  1NFT A;  4FOR A;  3Q25 A;  3SEX A;  1CE2 A;  3K0V A;  1I6B A;  4GL8 A;  5EQ8 A;  3MVZ A;  1EU8 A;  1Y4C A;  3HPI A;  1MS7 A;  1M5E A;  2Q8M A;  1O7T A;  4OFL A;  2NUV A;  3FZV A;  4PGP A;  3VLU A;  4QFL A;  2RC8 A;  4NWD A;  3S2V A;  2GHB A;  1USY H;  3OOA A;  4LQ2 A;  1ZU0 A;  3N5L A;  4I3Y A;  1VFD A;  4MJO A;  5H8H B;  3U1O A;  3THI A;  4N15 A;  1P1Q A;  4F1V A;  4PF6 A;  1A7L A;  4RK9 A;  4AB5 A;  4P9K A;  5AA1 A;  5HPQ A;  3H6U A;  1QUK A;  3CR9 A;  4JWO A;  1D9Y A;  2V3Q A;  4JVD A;  2QS4 A;  3TQL A;  1Q9D A;  3IL1 B;  4N6K A;  3KBR A;  4YB5 A;  1Q35 A;  5I84 A;  1SW1 A;  1NV0 A;  2B4M A;  2ABH A;  3FVG A;  1N7X A;  4X1B A;  4R72 A;  2HQ0 A;  1MPC A;  5H8H A;  4FBP A;  4NN3 A;  3VE1 B;  1MY0 A;  1XT8 A;  1IXH A;  5I56 A;  1B3E A;  1G0I A;  2HZK A;  5F1Q A;  3SEY A;  4DI4 B;  4ELO A;  4GQO A;  4Q30 B;  4UA8 A;  1WVJ A;  2Q8J A;  4YB6 A;  4F19 A;  1R9L A;  1II5 A;  3MZB A;  4WXJ A;  1PB8 A;  4N8Y A;  1LBC A;  2ESN A;  2HHM A;  1LBY A;  3HN0 A;  2O1M A;  3O29 A;  1S50 A;  2CMO A;  1OMP A;  2AL4 A;  4G68 B;  4BDQ A;  1LBX A;  4POX A;  2OJT A;  4P0G A;  2F3B A;  1HSL A;  1SQY A;  1SI0 A;  4KQP A;  1N7W A;  3Q27 A;  3FJM A;  2XXQ A;  1URS A;  3Q28 A;  4NF0 A;  3PUV E;  1NUY A;  3O6G A;  3WAE A;  1MPB A;  3A3U A;  3PD9 A;  4QSC A;  4NAP A;  3G3J A;  2XXV A;  4H5F A;  2ZYK A;  3V83 A;  3K6U A;  4IGR A;  2DS9 A;  2I0B A;  2UVH A;  4QRZ A;  3MST A;  3ZS6 A;  1UQW A;  3T93 B;  3SEU A;  1UTB A;  3E79 A;  5CRY A;  3SKP A;  2DWI A;  3IO4 A;  5TU0 A;  3SES A;  2QSX A;  4OES A;  4QHQ A;  3FD3 A;  5AA4 A;  4RJZ A;  4X1D A;  1WDN A;  5J1D A;  5ELV A;  3H7M A;  5CM6 A;  1OLC A;  5ICQ A;  1FPD A;  3O6I A;  3TDJ A;  3G3H A;  2VGQ A;  3N6U A;  3HV1 A;  1EYJ A;  5AA4 B;  2W7Y A;  1MY1 A;  5EHS A;  5DVJ A;  2FA7 A;  3N94 A;  4GWY A;  4GWW A;  3TCF A;  1B5I A;  3A3C A;  1R1N A;  2F97 A;  2P3V A;  2H99 A;  1KZ8 A;  1DSN A;  1FJ9 A;  5ISU A;  1NV4 A;  3KJT A;  3SET A;  3CVG A;  1LFG A;  3RTF B;  2OK2 A;  4EUO A;  1IQ7 A;  4MNP A;  1BLF A;  4UAB A;  2QVR A;  3KN3 A;  2V84 A;  3TKD A;  3LC8 A;  4DZ1 A;  5AA3 A;  2X7P A;  1DTG A;  4U4X A;  3PPN A;  3KSX A;  4ZE9 A;  2PT1 A;  3MW0 A;  1IME A;  4FAJ A;  1TXF A;  5HM4 B;  4PDD A;  4OZ9 A;  3V5A A;  1D4N A;  5KCJ A;  2Y5K A;  2VT5 A;  4NED A;  4PFW A;  4R2B A;  3DEL B;  4P8B A;  1POY 1;  1EYI A;  4BDM A;  4Z0I A;  2UYE A;  1IXC A;  3RN8 A;  5F24 A;  4F1Y A;  1GR2 A;  5TP9 A;  3MWB A;  5EYG A;  1GTK A;  1LLS A;  4LP2 B;  2ZNT A;  2DDK A;  4PE5 B;  3CFZ A;  2CEX A;  3JYR A;  1MG1 A;  1XI6 A;  2A5T B;  2DWH A;  2Q74 A;  4XTC Q;  4N07 A;  4P1E A;  5TP9 B;  5ITP A;  4NX1 A;  2FIE A;  4GFR A;  4G68 C;  1FBH A;  2OLB A;  2PFZ A;  3B50 A;  3O66 A;  5EYH A;  4FEC A;  3O2A A;  2F6G A;  2HAU A;  2XXY A;  3T9U A;  4LZ7 A;  4OER A;  1PDA A;  2F35 A;  2F7A A;  1A99 A;  4GWZ A;  1NNT A;  4G8M A;  4I9D A;  3T0J A;  2CZL A;  3IOR A;  1LFH A;  4GD5 A;  1QUI A;  2O51 A;  3FVN A;  4OFJ A;  2PMS A;  1DBZ A;  4EXK A;  3U93 A;  4LON B;  4E0W A;  3QUJ A;  4NQ8 A;  1MM6 A;  1FQA A;  3IK6 B;  2AYS A;  2HXW A;  1Y3N A;  4RK2 A;  2X7Q A;  5FTI A;  1FTO A;  1ZIU A;  4AS5 A;  1JEU A;  1B4Z A;  2PT2 A;  3F11 A;  3DP4 A;  2JJK A;  4TQU Q;  1XVY A;  2DXY A;  4GIZ A;  5CI5 A;  3IJX B;  4KD5 A;  2DSF A;  1I6A A;  2O7U A;  4JWY A;  4DDD A;  4QSE A;  3B8B A;  2FBP A;  1OLA A;  1QVS A;  4QFO A;  4PFY A;  4KR5 A;  4OQO A;  1SYI A;  3FV1 A;  5F7V A;  4YKP A;  3L6H A;  2VD3 A;  2NOO A;  5DVI A;  2RCB A;  2ZYM A;  2G29 A;  3EN3 A;  3MUQ A;  1H76 A;  4FIM A;  5HBC A;  2HZL A;  1FPB A;  4P47 A;  1BP5 A;  2Q89 A;  3USD A;  4FED A;  1FQC A;  5IKB A;  4MFI A;  1SW4 A;  2I49 A;  4EQB A;  1YAE A;  4N13 A;  4U21 A;  2KR0 A;  1OIB A;  4XKQ A;  4PFR A;  1TFA A;  2DVC A;  4ONY A;  2DWA A;  4RPO A;  1QUL A;  4EF1 A;  4F2Q A;  4GX4 A;  4GX6 A;  2DP8 A;  4IGT A;  5I2K B;  4MH5 A;  4P11 A;  4IR8 A;  2GRV A;  4YIC A;  4F3P A;  2I4B A;  3NOH A;  1FSA A;  3M3K A;  2HFB A;  1N04 A;  3VLV A;  4PBQ A;  4I40 A;  4OEV A;  3A29 A;  3Q26 A;  2ZNS A;  2REG A;  2I58 A;  2R8T A;  4Q8R A;  4PET A;  1MY2 A;  3H6W A;  3EF7 A;  2Z8F A;  4H65 A;  1G0H A;  3PUW E;  4ZZA A;  3PUX E;  3FV2 A;  4MMP A;  3RTW B;  2I6E A;  5JTY B;  2F36 A;  4H45 A;  5CBR A;  2XD2 A;  1UIU A;  3C32 A;  4NF6 B;  1DCU A;  4R2F A;  1EZP A;  3PPQ A;  1URD A;  3KZG A;  3KN7 A;  2PYY A;  4KYE A;  1TWY A;  4GL0 A;  1B58 A;  3PTY A;  4ZDM A;  3G3F A;  2PVU A;  3KEI A;  5JTY A;  1JW5 A;  1UTH B;  2F3D A;  1LEV A;  3MQ9 A;  1JET A;  3MJN A;  1USY E;  1SBP A;  1H43 A;  5L9S A;  1LCF A;  1UTB B;  3FBP A;  1LAF E;  1ZMG A;  5TPA A;  4U4S A;  1BIY A;  2ZZV A;  1B0L A;  3CG1 A;  2G93 A;  3VLW A;  4JBZ A;  4OVP A;  1MXY A;  3I3V A;  5L8D A;  3IFC A;  3K01 A;  3EHU A;  4X8R A;  5AA2 B;  4N4U A;  3IB1 A;  1ZLQ A;  4PF8 A;  1LGB C;  3EPE A;  4XEQ A;  4OEN A;  2HAV A;  4DE8 A;  1LBV A;  2XX7 A;  1QGX A;  3OEM A;  1N76 A;  2R71 A;  4PFU A;  4ZED A;  2Y7W A;  1B7H A;  3GBB A;  4ZEB A;  4ESX A;  2I0C A;  4IO2 A;  3KC0 A;  4NF4 A;  5DW8 A;  5H8S A;  1ATG A;  1IUD A;  3FGS A;  2H98 A;  2XXP A;  3FXQ A;  2RC7 A;  3VV5 A;  2Z8D A;  3FJ7 A;  3T1B A;  4DCX A;  3CHG A;  5I58 A;  4H1X A;  4FJP A;  1FJ6 A;  3QSL A;  4LN5 A;  3G3K A;  2Z22 A;  5EQ7 A;  4NF5 A;  1ZBM A;  3K00 A;  3TTN A;  4RA1 A;  2Y5L A;  5H8Q B;  5AA2 D;  2IA4 A;  5IM2 A;  3D1R A;  5EQA A;  4Q0C A;  1MQD A;  4PTK A;  4TLL B;  5K2X A;  1B40 A;  4Q5T A;  4O8M A;  3K6X A;  4N8G A;  3SDF A;  5KDT B;  1IZ1 A;  3W9W A;  2FNC A;  1JNF A;  3D4G A;  3RGY A;  3IJO B;  3TZA A;  1YYZ A;  1SW2 A;  2L5V A;  4OYV A;  3BFU A;  3QXM A;  3QK6 A;  2DWJ A;  4ZS9 A;  3K1M A;  2XXR A;  1YZ0 A;  1ZTY A;  3FIR A;  1OVT A;  4QFN A;  1B2H A;  1FPE A;  1PB9 A;  4GXS B;  2XXT A;  1FPI A;  1MM7 A;  1FBG A;  1FPJ A;  5CMC A;  4KYD A;  5KDT A;  3DM0 A;  1URG A;  1MXV A;  2UXA A;  4PGN A;  2ONK E;  1NKX A;  4KXP A;  1MXX A;  4F1U A;  4XKN A;  4PQJ A;  4MX6 A;  4WEP A;  1Z7N E;  4I8C A;  1PEB A;  2OBG A;  3H3G A;  1HSE A;  3SER A;  3T96 B;  4WKM A;  1NNK A;  1NNP A;  4XFE A;  4YMA A;  1I6Q A;  4ZE8 A;  5ICT A;  2D21 A;  1PB7 A;  1LCT A;  3B6W A;  1NUW A;  1QUJ A;  2UVI A;  3MAM A;  2Y7I A;  3FVK A;  1P1U A;  4H6D A;  5A5X B;  2HCA A;  4WED A;  1JP4 A;  3ILU B;  1PC3 A;  5IZ3 A; 
#chains in the Genus database with same CATH homology
 3A09 A;  3O66 A;  2P2A A;  4KHZ E;  4YKI A;  3K6W A;  1N3W A;  4FEC A;  4RYA A;  4JB7 A;  4ESW A;  2Q88 A;  3O2A A;  2QJE A;  4PFT A;  1FTM A;  2DXR A;  4RPN A;  1S9T A;  2F6G A;  4YKJ A;  4G2Z A;  3U94 A;  5BWJ A;  2QMX A;  2HAU A;  5I2N B;  1A55 A;  1FQF A;  2XXY A;  3I5O A;  3T9U A;  4ZEC A;  5I56 B;  1VE4 A;  4LZ7 A;  1FTJ A;  1NNF A;  4GVO A;  2F6P A;  4OER A;  4H5G A;  1UIV A;  2E1S A;  2QS3 A;  1PDA A;  3CRB A;  4LQ5 A;  3VXB A;  2YPN A;  4QFK A;  2F35 A;  2F7A A;  3FJG A;  4EQ7 A;  1A99 A;  1MQI A;  1SW5 A;  1NNT A;  3MP6 A;  4G8M A;  4KYS A;  4MBP A;  4YMB A;  1AMF A;  2RF1 A;  2BJJ X;  2E0S A;  4I9D A;  1M5D A;  5H8F B;  4R74 A;  3DLN A;  4RNS A;  4E0X A;  4U1O A;  4G4P A;  2CZL A;  4DCY A;  3H06 B;  3IOR A;  3IX1 A;  3OEL A;  5IAI A;  3QIM A;  1LFH A;  4GD5 A;  4G8N A;  1QUI A;  2O51 A;  3FVN A;  4OFJ A;  5JK4 A;  2PMS A;  5I2N A;  2DE2 A;  1EZ9 A;  4LVQ A;  4H0W A;  3Q29 A;  2AL5 A;  1M5C A;  3TTM A;  1A40 A;  3FAT A;  3G7W A;  3PPO A;  3QUF A;  4EXK A;  5I57 B;  1B3F A;  3U93 A;  2XXI A;  1ANF A;  3RT8 A;  3V89 B;  5I2K A;  4LON B;  4IO7 A;  3RNN A;  4E0W A;  2XXH A;  3QUJ A;  4GF8 A;  4EDP A;  4EQ9 A;  1MM6 A;  1YTV A;  1FQA A;  3TEL A;  2DE4 A;  3IK6 B;  2DE3 A;  2R6G E;  2AYS A;  2HXW A;  1Y3N A;  2ZYN A;  3FVO A;  2X7Q A;  4LUB A;  1YPN A;  4NE4 A;  2O84 X;  4RK2 A;  5FTI A;  4F2O A;  4F31 B;  2QMW A;  1RYO A;  2DYX A;  1FTO A;  1ZIU A;  4OHN A;  5M2V A;  4GLI A;  1JEU A;  1B4Z A;  1MQG A;  2V3T A;  2PT2 A;  3IO6 A;  4YU0 A;  1P1W A;  2RKM A;  3MPK A;  4OFO A;  2WKY A;  3HO7 A;  3M8U A;  3PMV A;  3TCH A;  4GRK A;  3TTL A;  1POT A;  3IOU A;  1QKB A;  1GV8 A;  3F11 A;  5I57 A;  1JVY A;  1IIT A;  1NL5 A;  3DP4 A;  3L6G A;  4Z7E A;  3PMX A;  4G68 A;  4TQU Q;  1XVY A;  2KLF A;  3LSW A;  1AIV A;  1P1N A;  2DXY A;  3MVW A;  2OZZ A;  3PPR A;  1LAH E;  4ECF A;  3N6T A;  3R6U A;  4GIZ A;  2QS1 A;  5CI5 A;  3IJX B;  4KD5 A;  3RLF E;  3TMG A;  2DOJ A;  2ONS A;  2DSF A;  1I6A A;  2O7U A;  3H4Z A;  4JWY A;  4NMY A;  3CSB A;  2DVZ A;  4AB6 A;  1B3L A;  2H25 A;  4QSE A;  4OXV A;  3TUS A;  3ZSF A;  1OLA A;  3FUZ A;  4F22 A;  1QVS A;  4QFO A;  3GXA A;  1H44 A;  4MLV A;  4KFQ A;  4PFY A;  4JSD A;  4KR5 A;  4OQO A;  4M4G A;  3R7X A;  1VFE A;  1GGG A;  1Q1K A;  1SYI A;  2VOZ A;  3FV1 A;  5F7V A;  3T66 A;  1DOT A;  1FCK A;  2QRY A;  2Z8E A;  3B6Q A;  3PGF A;  1MDQ A;  4BDN A;  5I59 B;  3V8X B;  1CB6 A;  1BTJ A;  3L6H A;  1SYH A;  2VD3 A;  2NOO A;  2O6A A;  4N6P A;  1MDP 1;  1PBP A;  2RCB A;  3LSF B;  4HS7 A;  4KPT A;  2ZYM A;  4OTE A;  2G29 A;  4I1D A;  1NMU A;  2H9B A;  3EN3 A;  3MUQ A;  3T9V A;  4ZEI A;  4DIG A;  1H76 A;  4FIM A;  1ZJL A;  2XXW A;  4U2R A;  4YAH X;  5HBC A;  2HZL A;  3HHF A;  2VP1 A;  3FAS A;  3PU5 A;  4OVJ A;  4P0I A;  1B3H A;  3UA8 A;  1BP5 A;  4F3S A;  1F9B A;  2AIX A;  2F5X A;  2Q89 A;  2HEU A;  2O1L A;  2Y7R A;  2ZYO A;  3KSJ A;  3O28 A;  4FED A;  4HTG A;  4RXL A;  1FQC A;  3USD A;  4IY6 A;  5IKB A;  4MFI A;  1FQD A;  4IO3 A;  3OO8 A;  1SW4 A;  2I4C A;  2I49 A;  2QS2 A;  1D3K A;  3B6T A;  3LR1 A;  2OCU A;  1NH8 A;  1YAE A;  3DP6 A;  4H8I A;  4NF4 B;  2I3V A;  4N13 A;  4U21 A;  2XHD A;  1O64 A;  2B3B A;  1LFI A;  1OIB A;  3LUY A;  4O3B A;  4NF5 B;  4R9F A;  1T0K A;  1RKM A;  2F78 A;  3C34 A;  3IOV A;  2RCA A;  3ONM A;  3OO6 A;  4XKQ A;  3OO7 A;  2GH9 A;  1DPP A;  4DXU A;  4F39 A;  1TFA A;  2DVC A;  2VD2 A;  1JQF A;  4ONY A;  2F8D A;  1MPD A;  2DWA A;  3TOD A;  3PMW A;  3E13 X;  3AXF A;  4RPO A;  1QUL A;  4R6Y A;  1NFT A;  4EF1 A;  5CMB A;  1XS5 A;  4FOR A;  3Q25 A;  5DVF A;  4F2Q A;  3SEX A;  1CE2 A;  3ZKK A;  1XHY A;  3K0V A;  1I6B A;  4ZZE A;  3IR1 A;  4GL8 A;  3WAF A;  2DP8 A;  4NF6 A;  4PP0 A;  2I48 A;  2XX8 A;  4R75 A;  1FTL A;  3QAX A;  2YLN A;  3MVZ A;  3D4C A;  4IGT A;  4M1V A;  1EU8 A;  1N84 A;  1M5B A;  1Y4C A;  1PBQ A;  3HPI A;  5I2K B;  4C1T A;  1MS7 A;  3RT6 B;  2PX1 A;  1M5E A;  3T22 A;  1FQB A;  1MH3 A;  4IO6 A;  4MH5 A;  4P11 A;  3VVE A;  2A5S A;  5KCJ B;  1O7T A;  2GRV A;  4OFL A;  1N0T A;  2NUV A;  3FZV A;  2NXO A;  4IB2 A;  4YIC A;  3RQT A;  3U72 A;  4QFL A;  2I4B A;  3VLU A;  4F3P A;  5B70 A;  4BDL A;  2RC8 A;  4NF8 B;  3VVF A;  2VHA A;  3M3K A;  2HFB A;  3S4U A;  1ZKB A;  4NWD A;  1DPE A;  4MLQ A;  3S2V A;  4JSO A;  2XX9 A;  2GHB A;  1USY H;  1B4H A;  3OOA A;  4NWC A;  4LQ2 A;  4UAC A;  1A8F A;  1B6H A;  1ZU0 A;  3BKI B;  3N5L A;  1S7Y A;  4OET A;  5AA2 A;  1VFD A;  3KN8 A;  3K1P A;  3O97 A;  5H8H B;  1N04 A;  3THI A;  5DTB A;  3U1O A;  3VLV A;  3K02 A;  2A5T A;  3QYT A;  3TTR A;  1P1Q A;  4JDF A;  3SEW A;  3G3I A;  4JWX A;  1XC1 A;  4OEV A;  4F1V A;  5L9M A;  5TPA B;  5H8F A;  3Q26 A;  2ZNS A;  1A7L A;  3S9N C;  1B1H A;  2REJ A;  4RK9 A;  3CFX A;  4AB5 A;  2REG A;  3JZJ A;  1AH5 A;  5AA1 A;  2I58 A;  3M3F A;  1B51 A;  1LB8 A;  4DXC A;  4Q8R A;  4PET A;  2O68 A;  4RY1 A;  5HPQ A;  3OMB A;  3H6U A;  4FE8 A;  1QUK A;  3O6H A;  3CR9 A;  4JWO A;  1D9Y A;  2V3Q A;  2XXU A;  1MY2 A;  3H6W A;  3EF7 A;  1Y1M A;  1DMB A;  2QS4 A;  1YCJ A;  2Z8F A;  3RPW A;  3TQL A;  2RIN A;  4H65 A;  3RUM A;  3ECR A;  3UIF A;  3PUW E;  1A54 A;  4ZZA A;  3PUX E;  2F34 A;  3IL1 B;  3CI8 A;  1O63 A;  3M3L A;  1SDX A;  2Z23 A;  3FV2 A;  2XD3 A;  1QJM A;  3RTW B;  2V3U A;  1DTZ A;  2I6E A;  3KBR A;  1H45 A;  3BBR A;  5JTY B;  3K1N A;  2F36 A;  5K2Y A;  4YB5 A;  1Q35 A;  3JV9 A;  5CBR A;  2XD2 A;  3MP8 A;  3MVX A;  1XOC A;  1UIU A;  1Y3Q A;  1SW1 A;  5I84 A;  3E3K A;  2ABH A;  3C32 A;  2UYF A;  5FHO A;  4NF6 B;  1MXW A;  3FVG A;  4R2F A;  1N7X A;  1MRP A;  3VXC A;  1EZP A;  3TYH A;  4C1U A;  4X1B A;  4R72 A;  3MVY A;  3PPQ A;  1URD A;  2YJP A;  1B9J A;  2HQ0 A;  3HCQ A;  3KZG A;  1MPC A;  3KN7 A;  5H8H A;  2PYY A;  3C4M A;  4I62 A;  4KYE A;  1TWY A;  1LAX A;  4GL0 A;  1B58 A;  3GLB A;  2Y7P A;  4ZDM A;  4EXL A;  1WOD A;  3G3F A;  3VE1 B;  1MY0 A;  2PVU A;  1QW0 A;  1XT8 A;  3KEI A;  1SD3 A;  3PV0 E;  1Y4T A;  2I3W A;  4F29 A;  5JTY A;  1IXH A;  5I56 A;  1B3E A;  5F1Q A;  2HZK A;  1JW5 A;  1SI1 A;  3SEY A;  4ELO A;  1UTH B;  4GQO A;  4Q30 B;  4UA8 A;  1WVJ A;  2Q8J A;  1OVB A;  4YB6 A;  3MQ9 A;  4U22 A;  1JET A;  3KG2 A;  3P7I A;  4F19 A;  3MJN A;  1R9L A;  1USY E;  2PBW A;  1SBP A;  1B5J A;  1H43 A;  2ZXT A;  4TLM B;  1II5 A;  3C35 A;  3MZB A;  1OQH A;  4L17 A;  4WXJ A;  5DEX A;  2V25 A;  5L9S A;  1PB8 A;  1LCF A;  4R9G A;  5DVI A;  1LBC A;  1UTB B;  1QKA A;  1LAF E;  2ESN A;  3B7D A;  3ILT B;  4ISU A;  4NTL A;  3TAJ A;  1ZMG A;  5TPA A;  4U4S A;  1BIY A;  3BFT A;  2NWJ A;  1B46 A;  2XXX A;  3HN0 A;  4X48 A;  5H8Q A;  4LZ5 A;  1B0L A;  3CG1 A;  5BUU A;  2G93 A;  3VLW A;  5FHN A;  2O1M A;  3MZ9 A;  3O29 A;  3PUZ E;  4JBZ A;  1S50 A;  4C0R A;  3KFM A;  3MP1 A;  1MXY A;  2RC9 A;  2CMO A;  5I58 B;  1TFD A;  3I3V A;  1OMP A;  3TFL A;  2AL4 A;  4XKP A;  3K01 A;  5L8D A;  3EHU A;  1LBB A;  5AA2 B;  3S9M C;  2D5W A;  4HCY A;  4G68 B;  4EQB A;  4DDD A;  3OEN A;  1Z7M E;  3IB1 A;  1FW0 A;  1ZLQ A;  2LAO A;  4BDQ A;  3GZG A;  1AOV A;  2QL3 A;  1GVC A;  1LGB C;  2ALU A;  4POX A;  4HW8 A;  2FYI A;  1EZO A;  2OJT A;  3EPE A;  4P0G A;  1FTK A;  3KJ7 A;  5L9O A;  1HSL A;  1SQY A;  3H6T A;  4OEN A;  4DXB A;  1SI0 A;  4KQP A;  2P1S A;  1N7W A;  3Q27 A;  3FJM A;  4EF2 A;  2XXQ A;  1URS A;  3Q28 A;  1MQH A;  1OQG A;  3K2D A;  3ODB A;  2HAV A;  3PUV E;  4IY5 A;  3O6G A;  3WAE A;  5B7D A;  4DE8 A;  1MPB A;  5DEX B;  4YKK A;  3A3U A;  4G8H A;  1IXG A;  3MPL A;  2QPQ A;  3PD9 A;  1Y3P A;  1MXZ A;  2XX7 A;  4QSC A;  2ZMB A;  2UVG A;  2NVU B;  3G3J A;  4QSD A;  3OEM A;  1MY3 A;  1N76 A;  3CG3 A;  2XXV A;  4H5F A;  2R71 A;  2ZYK A;  4ELR A;  1R6Z A;  4PFU A;  3HST A;  4ZED A;  3V83 A;  1Y20 A;  3K6U A;  4IGR A;  2Y7W A;  1B7H A;  2DS9 A;  4NF8 A;  2I0B A;  3GBB A;  4ZEB A;  4ESX A;  3E4R A;  2I0C A;  1ELJ A;  3H03 A;  4IO2 A;  1MY4 A;  1RYX A;  2UVH A;  4NF4 A;  3UP9 A;  3CIJ A;  4QRZ A;  2O69 A;  1MQJ A;  3KGC A;  5H8S A;  1ATG A;  1UQW A;  3T93 B;  3ZS6 A;  4ELP A;  3SEU A;  1UTB A;  1IUD A;  4KI0 E;  4TOZ A;  5CRY A;  3FGS A;  3SKP A;  2H98 A;  3IOT A;  3OD7 A;  2XXP A;  3FXQ A;  2DWI A;  2RC7 A;  3VV5 A;  2Z8D A;  3EHT A;  3IO4 A;  5TU0 A;  5A5X A;  3SES A;  3FJ7 A;  4F3G A;  2QSX A;  2THI A;  4DCX A;  5ITO A;  4OES A;  4QHQ A;  3TPA A;  3IAZ A;  5AE4 A;  4O3A A;  2GHA A;  3FD3 A;  4OMB A;  4MF3 A;  4H1X A;  4FJP A;  5AA4 A;  5I58 A;  1NH7 A;  3TTK A;  3QSL A;  3VVD A;  4RJZ A;  4YZZ A;  4X1D A;  3G3K A;  2Z22 A;  1JVX A;  3GBA A;  4H8J A;  1EH3 A;  1US5 A;  1VR5 A;  1WDN A;  5J1D A;  3OXN A;  1ZBM A;  1B7Z A;  3H7M A;  4NF5 A;  5ELV A;  3UOR A;  3TQW A;  3K00 A;  3UGW A;  5CM6 A;  1OLC A;  1B05 A;  3TTN A;  2GFE A;  5ICQ A;  4RA1 A;  3IOW A;  4AQ4 A;  2Q2C A;  3O6I A;  3TDJ A;  5H8Q B;  1P1O A;  5AA2 D;  2IA4 A;  3G3H A;  4LA9 A;  2VGQ A;  3S9E A;  3OSQ A;  4R73 A;  5FTH A;  4XKR A;  4Q0C A;  3N6U A;  3O9P A;  1MQD A;  2P0S A;  3E9X A;  4TLL B;  3HV1 A;  2IEE A;  2M8C A;  3W9V A;  4BLA A;  2W7Y A;  5K2X A;  5AA4 B;  5CMK A;  3RY3 A;  4GOT A;  1MY1 A;  5EHS A;  4U23 A;  1B40 A;  2V93 A;  2B65 A;  1J1N A;  2FA7 A;  3N94 A;  3K4U A;  4Q5T A;  5DVJ A;  5EHM A;  5CBS A;  3R26 A;  1M5F A;  3K6X A;  5H8N A;  3TCF A;  1IEJ A;  3C9H A;  1B5I A;  4QF9 A;  3SDF A;  5KDT B;  3A3C A;  4IO4 A;  1IZ1 A;  3OSR A;  1I69 A;  3C31 A;  4HCW A;  3W9W A;  1R1N A;  2F97 A;  2FNC A;  1R9Q A;  1JNF A;  2H99 A;  3D4G A;  4THI A;  4XIG Q;  3VFJ A;  4F3B A;  1DSN A;  2DQV A;  3RGY A;  3IJO B;  1LST A;  3TZA A;  5JEI A;  1KWH A;  1SW2 A;  3CSG A;  4ZEF A;  5ISU A;  4OYV A;  3LSX A;  4R6H A;  3BFU A;  3QXM A;  3QK6 A;  1A8E A;  3KJT A;  2DWJ A;  3CVG A;  3SET A;  2X26 A;  1LFG A;  1N3X A;  3RTF B;  4ZEK A;  3G3G A;  2OK2 A;  4ZS9 A;  1BKA A;  2OWT A;  4LAT A;  4EUO A;  1IQ7 A;  1B52 A;  1JW4 A;  3EQ1 A;  1B7U A;  3U92 A;  1VSO A;  4BDO A;  1IIW A;  1BLF A;  2F7B A;  3IB2 A;  3K1M A;  3KN3 A;  2V84 A;  1LAG E;  2XXR A;  3K6V A;  3LC8 A;  3TKD A;  1P99 A;  4DLD A;  4DZ1 A;  3MC2 A;  4YB7 A;  1ZTY A;  3ZKL A;  4ELQ A;  2X7P A;  5AA3 A;  1DTG A;  2Y84 A;  3PD8 A;  4IO5 A;  3T9H B;  4U4X A;  3FIR A;  3KSX A;  3PPN A;  5KZT A;  1UTH A;  5CMM A;  2OWS A;  5FHM A;  4R6K A;  3H6V A;  4ZE9 A;  2PT1 A;  1OVT A;  1US4 A;  3MW0 A;  1B2H A;  3FXR A;  1PB9 A;  2H5Y A;  4G77 A;  4GXS B;  2XXT A;  4ND9 A;  4QFN A;  5I59 A;  1MM7 A;  1Y1Z A;  5LOM A;  3T9X B;  5CMC A;  4FAJ A;  4KYD A;  1TXF A;  5H8N B;  3LBS A;  4OWD A;  1JEV A;  5HM4 B;  5KDT A;  2Y7K A;  3HHG A;  4FEB A;  4OZ9 A;  2B3F A;  3DM0 A;  4POW A;  3V5A A;  1URG A;  1IXI A;  1D4N A;  5KCJ A;  4X9T A;  4KCC A;  1MXV A;  4BDR A;  2UXA A;  1Y9U A;  2ONK E;  1NKX A;  3PPP A;  4NED A;  3N26 A;  1MXX A;  4GWO A;  4F1U A;  4PFW A;  4R2B A;  1HSJ A;  3DP8 A;  3DEL B;  3FXU A;  3C33 A;  3KOT A;  4XKN A;  3MZ1 A;  4PQJ A;  4F18 A;  1POY 1;  1TT1 A;  4WEP A;  4QFP A;  4BDM A;  1Z7N E;  1FQE A;  4I8C A;  1PEB A;  2F7C A;  4K3F A;  2OBG A;  5DYH A;  3H3G A;  1HSE A;  4LZ8 A;  4Z0I A;  2UYE A;  3SER A;  3VDF A;  3LSL A;  1IXC A;  2H4I A;  4GXA A;  3RN8 A;  1B0H A;  3T96 B;  1L5T A;  4F1Y A;  1GR2 A;  4OEU A;  5TP9 A;  5EYF A;  4FAT A;  2O7I A;  3MWB A;  3OO9 A;  4WKM A;  1XVX A;  1NNK A;  2Q2A A;  1NNP A;  1GTK A;  3PUY E;  1LLS A;  3I6V A;  4YMA A;  1I6Q A;  4ZE8 A;  1MXU A;  3TCG A;  4LP2 B;  5ICT A;  2D21 A;  2ZNT A;  1B32 A;  3C36 A;  4XXU A;  1PB7 A;  3UK4 A;  4U1Z A;  3S9L C;  1AL3 A;  4PE5 B;  2ONR A;  2ANJ A;  3OEK A;  3CFZ A;  3SEV A;  1LCT A;  1B5H A;  1SVX B;  1B3G A;  3JYR A;  3U8Q A;  3B6W A;  1H3D A;  1MG1 A;  3CFL A;  1MH4 A;  2A5T B;  2DWH A;  2UVJ A;  4XTC Q;  1QUJ A;  2UVI A;  3MAM A;  3W15 C;  4N07 A;  3EHS A;  2Y7I A;  3FVK A;  5TP9 B;  1P1U A;  2R9J A;  3KOS A;  4H6D A;  5A5X B;  2HCA A;  2ZNU A;  1B1X A;  4WED A;  2Q9T A;  3MBP A;  3TEP A;  4JXI A;  5DT6 A;  5ITP A;  1LB9 A;  3ILU B;  1PC3 A;  1JW1 A;  3IB0 A;  5CC2 A;  4KCD A;  2D3I A;  4GFR A;  4G68 C;  4O3C A;  3UN6 A;  2OLB A;  4YKP A;  4H67 A;  1D9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...