4YKPA

Mnemiopsis leidyi ml032222a iglur lbd serine complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
247
Chain Sequence
LIGRHLRLGSVEEQPFMFFATEGCEGNDCWSGMVNDMVVKLSEDLGFTYEYIQPDDRKFGALNKTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEGTTLNQVLELLDQDKYKWGVIGSRHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGLFVFIDEGPVLAHNLISDCDVFSVGEEFQSFEYAFGLPKDSPYKSLIDSHLLKFREEGFIDILWEKWSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords ML032222a iGluR
publication title Glycine activated ion channel subunits encoded by ctenophore glutamate receptor genes.
pubmed doi rcsb
source organism Mnemiopsis leidyi
total genus 80
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykpA02
3MJNA 5CI5A 5A5XB 1FQEA 1A8EA 5I2NA 3EQ1A 1MXYA 4P11A 1B9JA 2IA4A 1A55A 2XXUA 1POTA 5B70A 1O64A 3UK4A 1MM6A 4GQOA 3L6HA 3IOTA 1PDAA 1ZMGA 3CSBA 4JWXA 1UTBB 1VSOA 3FUZA 3IB0A 1OMPA 1D9YA 1SYIA 3G3HA 3K6XA 3TELA 3PPRA 3CFLA 1DPEA 5DEXB 1B5HA 1ZJLA 1B7ZA 4IGTA 4F39A 4IO7A 3CVGA 4DE8A 1A54A 5I84A 2GFEA 2RC7A 1B5IA 1IZ1A 1LAGE 3OSRA 3VDFA 3PPPA 5A5XA 4ELPA 4YU0A 1SW5A 3K1PA 4OFJA 4F19A 4R75A 3U1OA 3IR1A 2ONKE 1DSNA 4FORA 2QS1A 4C1UA 4GL0A 1MPDA 3HSTA 4YKKA 3T66A 4ND9A 3RLFE 3CFZA 3OOAA 3OO7A 3C34A 4N13A 1UTBA 4HTGA 4PFYA 1LFIA 4BDNA 3QIMA 4KPTA 4KHZE 3Q27A 4G77A 2UYFA 3IAZA 5DEXA 3TZAA 3PUYE 4C0RA 2A5SA 1B1XA 1NL5A 1QKBA 2FNCA 1Q1KA 2ALUA 5FTHA 4R2FA 4U23A 3RTWB 4U1OA 3ZSFA 4GWOA 1H3DA 2I3VA 2AIXA 3MZBA 3OENA 1II5A 3PUVE 2O1MA 4ZEKA 3O6IA 4H65A 3T22A 1AMFA 3E4RA 1FTLA 4IO5A 2H4IA 1ZU0A 1UIUA 3UA8A 1LB8A 1ZBMA 3OO8A 1WDNA 2OZZA 2VOZA 2KLFA 4OVJA 4PP0A 1MH3A 4NEDA 1GV8A 4MFIA 4DLDA 3KBRA 2Q9TA 4ONYA 2I58A 1HSLA 2DE4A 3FV1A 5DT6A 4R6YA 1PB9A 1QUIA 5LOMA 1EZ9A 3RT6B 3UP9A 3IJOB 4FAJA 1PC3A 3MVWA 4OEUA 5I57B 3JV9A 5J1DA 1NNTA 3K0VA 4RYAA 3P7IA 4H8JA 1P1WA 1AL3A 3KG2A 1WODA 3SESA 1R9LA 3R7XA 3T93B 5TP9B 3VLVA 3G3JA 3PD9A 4RXLA 1LAXA 1DTGA 3IL1B 2Y7KA 4OEVA 3JYRA 3T9UA 3Q25A 3RQTA 1KWHA 1H45A 5DVIA 2XX9A 5BUUA 3W9WA 4YKIA 2HZKA 4IO6A 1H43A 2XXIA 1RYXA 2XXVA 2Z8EA 2FA7A 4QSDA 1PBPA 4NF5B 3TCGA 1I6AA 2ANJA 3SERA 4OHNA 3CG3A 5I57A 1GGGA 5I2KB 1SW4A 4Q0CA 5EHSA 3H3GA 2PT1A 4GRKA 2HZLA 1B58A 4IY6A 3DP4A 3MP8A 3VVFA 2VD3A 1D4NA 5TP9A 4H5GA 3VFJA 3Q26A 2F6GA 4THIA 1NNPA 2NUVA 2ZYMA 1R1NA 1VFDA 4WXJA 2Z8FA 2BJJX 3HO7A 4NE4A 1AOVA 1MQGA 1IUDA 1A8FA 5ITPA 3TMGA 1LFHA 3PMVA 5EHMA 4NF5A 5H8HB 1O63A 2DWIA 5I2KA 4YAHX 2F6PA 2F97A 2QRYA 2WKYA 1FQBA 2DXRA 3BKIB 3UIFA 1LAHE 4LZ7A 3TAJA 4YKJA 4WEDA 3A09A 4XKPA 4FATA 1B7HA 2B3FA 1VE4A 3CFXA 4XTCQ 2XXRA 4GXSB 4NWCA 3N6TA 1MXZA 1Y3QA 2PMSA 2RKMA 1ATGA 4TLLB 1FQAA 4LA9A 4KD5A 3IK6B 4PFWA 4FJPA 1H76A 3TDJA 1BIYA 3T96B 1SBPA 2NVUB 1M5BA 5H8HA 2F78A 4MH5A 5JTYB 1Y9UA 4QFNA 2YLNA 4OFLA 4NWDA 4DXUA 1B40A 3ZS6A 1MXXA 1IEJA 2O1LA 4Z0IA 4AB5A 2ZYNA 5AA2B 1MQDA 3WAFA 1PEBA 2XHDA 1XHYA 5FTIA 3D4CA 3EHSA 2QJEA 4F29A 2QL3A 3TKDA 2ZYKA 4ELQA 2XXYA 2O51A 4EDPA 1WVJA 4YZZA 4GXAA 1A40A 4DCYA 2HCAA 1D3KA 4U22A 3FV2A 3KSXA 2DSFA 5JTYA 2XXHA 1B6HA 4BDQA 5CMCA 3CI8A 2VD2A 2F7BA 3IO6A 3G7WA 3VVDA 3SEXA 5AA2A 5FHNA 4OTEA 1UQWA 3O6GA 1OQHA 1MQHA 2RC8A 1BKAA 4ZDMA 1MPCA 4OQOA 4GL8A 2THIA 4JSOA 1POY1 2OCUA 3O97A 4UA8A 1NFTA 3IOWA 3O9PA 3S2VA 4G8HA 4HW8A 3MPKA 3PPNA 3I6VA 3DP8A 3SKPA 2V25A 1MDP1 3GLBA 4YB7A 4G4PA 1B05A 2Z8DA 4QF9A 2HQ0A 1P1NA 4HS7A 4TLMB 2DYXA 4OZ9A 5CM6A 4I62A 1TWYA 4GF8A 3LC8A 4LVQA 2GHBA 4KFQA 1B3EA 1SDXA 4X1BA 3O29A 2G93A 3IX1A 1LSTA 3T9VA 3CRBA 4ZEBA 1I6QA 4O3BA 2UVGA 3IJXB 4G68C 1B2HA 3M3FA 4EXKA 1BTJA 3IOUA 2QS3A 3ILUB 2OBGA 5HBCA 3RNNA 1FW0A 3KEIA 2O6AA 5DTBA 1VR5A 1XVXA 3V8XB 3QK6A 4R2BA 5ITOA 3K4UA 2FYIA 3C4MA 1SVXB 4JWOA 3I3VA 4PQJA 3TTRA 2XXXA 1LCFA 4KYEA 3QYTA 4GLIA 4ESXA 1US5A 1DOTA 1NNFA 1AIVA 4KR5A 5H8NB 4AQ4A 4GVOA 4JWYA 2ZYOA 1IITA 3ODBA 1MXUA 1QVSA 2H25A 4U2RA 2F35A 2R9JA 3CR9A 3Q28A 4FEDA 3DP6A 5KZTA 1S9TA 1FQDA 1EU8A 2QSXA 2XD2A 3KOTA 1USYH 3M3KA 3S4UA 1SI0A 3SEUA 4RK9A 4RPOA 3G3GA 4F3GA 2ZNUA 4WKMA 2OWSA 3USDA 3IB1A 4EQBA 3FIRA 1NH8A 4R6KA 5IKBA 3PMWA 2Y84A 2PBWA 2DWHA 2ZMBA 3PU5A 3OELA 3QUJA 1MH4A 1MQIA 4FECA 2V3QA 5H8NA 5DVJA 2GRVA 1D9VA 4YMAA 1MY4A 2Y7IA 3S9MC 1B0LA 3C33A 4F3SA 3E9XA 2Z22A 3HV1A 3SETA 3TCHA 4EUOA 3KOSA 3QXMA 2DE2A 3E13X 3KJTA 3CG1A 1SW2A 3LSXA 1BLFA 3R26A 2F36A 4OENA 1JQFA 3TTMA 2QMWA 1I69A 3C32A 1JW5A 3LUYA 4WEPA 5EYFA 1B1HA 1XC1A 4ZE9A 1FQFA 3K6UA 3S9LC 4H5FA 3H03A 3AXFA 3GZGA 3RUMA 3SEVA 4DCXA 4F22A 4RPNA 3KN7A 1MDQA 5TPAB 4N07A 2A5TB 3U92A 2HEUA 4DXBA 3ONMA 1OVTA 4YB5A 5K2YA 1Y3PA 2F7AA 3B6QA 2H99A 3EF7A 1NH7A 4ECFA 1GVCA 3O2AA 2UVJA 1B5JA 4IO3A 3ECRA 2Y7PA 3S9NC 3TTNA 3C35A 4O3CA 3SEYA 1FQCA 2F8DA 1JW4A 2B3BA 3L6GA 3FJMA 3MZ9A 4XKRA 5FHOA 4Q5TA 4G8NA 1OVBA 3WAEA 4M1VA 2F5XA 3MAMA 4RNSA 4ZEDA 2HAVA 5TPAA 4OFOA 2I3WA 2A5TA 5I56B 1GTKA 1ANFA 3PV0E 3EPEA 2XX8A 1TXFA 3TFLA 1R9QA 3LSFB 5CBSA 1Y4CA 3UGWA 1B51A 1N3XA 1YPNA 2O84X 2OWTA 2E1SA 3N94A 2CMOA 4E0WA 4BDLA 3FXQA 2AL4A 3T9HB 2R71A 1QJMA 1N84A 1TFDA 2VP1A 3OO6A 1R6ZA 4YKPA 1RKMA 1T0KA 2DQVA 4QSCA 5DVFA 2OJTA 4I1DA 5IAIA 4F1YA 1Z7ME 1B4ZA 3M3LA 1SQYA 5I56A 4YB6A 1OLCA 5HPQA 4U1ZA 3DLNA 4ELRA 4Q8RA 4GFRA 1Y20A 4K3FA 5BWJA 1B46A 2UYEA 3A3UA 4R6HA 2UVIA 3N6UA 3MBPA 3DELB 2O68A 4R74A 5L8DA 5I58B 3TTLA 3MUQA 3OSQA 5CMKA 1LAFE 4LP2B 1US4A 4F3PA 4ZZEA 3UORA 1N76A 1UIVA 1MXVA 3MVXA 4DIGA 3D4GA 1FTOA 5B7DA 2NXOA 1IXGA 4IO2A 3SDFA 2NWJA 3MZ1A 4F31B 1N04A 4RJZA 3VV5A 5L9OA 3KFMA 4IGRA 4QFOA 3V89B 4H67A 3O6HA 3RTFB 1PBQA 1EZOA 1YCJA 3TYHA 5CRYA 2YJPA 1VFEA 3MP1A 5I58A 4EQ9A 3EN3A 1LBCA 1MG1A 5AA2D 2OK2A 4QRZA 3RT8A 1LLSA 3CIJA 1S50A 3FJ7A 3V83A 2RC9A 3PPQA 3KJ7A 1IXIA 3BBRA 2XD3A 3RGYA 3C36A 5F1QA 4EXLA 2QS2A 4MBPA 3U94A 1SYHA 1B52A 1F9BA 1M5CA 2V93A 3MPLA 1BP5A 4XKQA 3K02A 3MVYA 4ZS9A 4UACA 1M5EA 2ZNSA 2Q8JA 1RYOA 2RINA 3U93A 2XXWA 1P1UA 3C31A 1USYE 1JEVA 1Q35A 4GIZA 4XIGQ 3W15C 2Y7WA 3THIA 4IB2A 2V3UA 1XS5A 2OLBA 5KDTB 4YICA 1QULA 5CBRA 3O28A 3TQWA 3HHFA 2RCBA 2O7UA 3MP6A 1IQ7A 1ELJA 4HCWA 3RPWA 1SI1A 3SEWA 4I8CA 4KYSA 4AB6A 2CZLA 2I4CA 1MY3A 2I4BA 1MQJA 2X7PA 3S9EA 1IXHA 1DPPA 2O7IA 4LUBA 4Q30B 4DXCA 1URSA 2AL5A 2M8CA 3TPAA 5KCJB 3BFUA 2Q2CA 2XXQA 3TQLA 4H8IA 2D21A 1Y4TA 1EH3A 5JEIA 1B3LA 1N0TA 1B0HA 1LB9A 3F11A 2G29A 3K6VA 5KDTA 1Y1ZA 4G2ZA 3OD7A 2XXPA 1NNKA 2R6GE 1YAEA 4LATA 4LZ5A 3I5OA 3QSLA 2H9BA 1IIWA 5ICTA 1IXCA 1LFGA 3R6UA 3B6WA 1JVXA 4MLQA 1S7YA 2D5WA 2ZXTA 1O7TA 4QSEA 1ZKBA 1HSEA 5KCJA 1SW1A 4POWA 4JDFA 4GOTA 4H1XA 4MLVA 1N7XA 4O3AA 5F7VA 4ZE8A 3B7DA 4LZ8A 3ZKLA 3K01A 3H4ZA 1B3GA 3H6TA 2ZNTA 4F3BA 4X48A 3LSWA 2Z23A 4ZEIA 1A99A 3PMXA 3H6VA 1EZPA 1P1OA 4G68B 3LR1A 5HM4B 3UN6A 3MW0A 3OEKA 4YMBA 1NKXA 1B7UA 3FXRA 3JZJA 1JEUA 1MPBA 1ZIUA 1JETA 2YPNA 3PD8A 5L9MA 1PB8A 1B32A 2XX7A 4QFLA 4RA1A 3H06B 4FE8A 2P1SA 4KCDA 3IOVA 2XXTA 3G3IA 2Q2AA 3FJGA 1P99A 1OIBA 3KN8A 1TFAA 3GXAA 1FTJA 3H6WA 1OQGA 1Y3NA 3EHTA 1MY2A 3VVEA 5ELVA 3GBAA 2I49A 1MS7A 4H6DA 2F34A 3MVZA 3VLUA 4OESA 1Y1MA 3BFTA 3GBBA 3LBSA 2HAUA 2PYYA 5AA4B 1CB6A 2P0SA 2P2AA 4ISUA 3FVOA 3RY3A 1MY1A 5AE4A 4G68A 5K2XA 5I59B 1SD3A 1MM7A 1UTHB 1DMBA 3KGCA 3IO4A 2PT2A 4ZEFA 3W9VA 4U21A 3N5LA 4BLAA 3FD3A 3G3KA 3PUWE 3FZVA 1QUKA 1NMUA 1J1NA 2UXAA 4GD5A 2QMXA 4R9FA 3O66A 3MC2A 1QUJA 2X7QA 1L5TA 2VGQA 2RCAA 3MQ9A 1QKAA 3EHUA 3M8UA 4QFKA 4POXA 4BDRA 4IY5A 4P0GA 2DP8A 1AH5A 5AA4A 4ESWA 4F2OA 3OXNA 3QUFA 1N7WA 2ESNA 5I59A 2DOJA 1UTHA 4QHQA 2REJA 4HCYA 2Q89A 3PUZE 2H5YA 2HFBA 3FATA 3K1MA 3K1NA 3IB2A 3B6TA 4RK2A 4BDMA 4PE5B 2QS4A 2W7YA 4QFPA 4U4SA 3HCQA 3TUSA 4EF1A 2DWAA 4JXIA 3HN0A 3E3KA 4NTLA 3N26A 4ELOA 3V5AA 4XXUA 1MRPA 2RF1A 3Q29A 3VXBA 4P0IA 4E0XA 1XT8A 3OEMA 4F1UA 5FHMA 4L17A 4NF6B 4OMBA 1M5FA 1XVYA 2REGA 2PVUA 3FVKA 4Z7EA 4LQ2A 4PFTA 2H98A 3K2DA 4KQPA 1LBBA 4R72A 1YTVA 1H44A 4F2QA 1ZTYA 2D3IA 5ICQA 4NF4B 3U8QA 3IORA 3FVGA 3LSLA 1URGA 3TEPA 3HPIA 2ONRA 5CMMA 2DE3A 4U4XA 5M2VA 1CE2A 2HXWA 4BDOA 4NF6A 3C9HA 3MWBA 3G3FA 4LQ5A 1FCKA 4IO4A 1B3FA 5AA3A 2IEEA 2DWJA 1LCTA 1JNFA 4OERA 4H0WA 4KYDA 4JB7A 2O69A 5L9SA 3DM0A 1XOCA 4TQUQ 3TCFA 2UVHA 4NF8B 2DS9A 4NF4A 2X26A 1HSJA 3KN3A 5TU0A 3KSJA 3VE1B 4DZ1A 5DYHA 4KI0E 5ISUA 5H8QB 5H8FB 2I48A 2V84A 2GH9A 2ONSA 2LAOA 5CC2A 2I6EA 4LONB 3ILTB 1ZLQA 5AA1A 3OMBA 3CSGA 4JBZA 2B65A 3FVNA 1MXWA 4EQ7A 4OXVA 3RN8A 3K6WA 2ABHA 3QAXA 3H6UA 3VLWA 4XKNA 3T9XB 4PETA 2AYSA 1B4HA 2V3TA 1JW1A 1OLAA 2E0SA 3TODA 4NF8A 1FTKA 3TTKA 2I0CA 4X9TA 3H7MA 1B3HA 3PPOA 3FASA 5JK4A 2GHAA 2VHAA 4TOZA 1P1QA 4ZECA 5H8QA 5H8FA 4FEBA 1MY0A 1A7LA 4G8MA 4R9GA 4OWDA 3KZGA 4C1TA 4R73A 3VXCA 4EF2A 4I9DA 3K00A 2QPQA 1QW0A 2NOOA 4OYVA 5I2NB 4F1VA 1N3WA 4M4GA 2Q88A 1JVYA 2DVZA 4MF3A 2F7CA 3PGFA 1FTMA 2PX1A 4NMYA 4RY1A 2DVCA 3PUXE 3HHGA 4DDDA 4N6PA 2Y7RA 3A3CA 4FIMA 2I0BA 3OO9A 4KCCA 3FXUA 4OETA 3FGSA 1PB7A 5H8SA 3ZKKA 1GR2A 1URDA 4F18A 3U72A 1Z7NE 4PFUA 1I6BA 4JSDA 1LGBC 1TT1A 2DXYA 1DTZA 1M5DA 4ZZAA 5CMBA 4X1DA
chains in the Genus database with same CATH superfamily
3MJNA 5CI5A 5A5XB 1VDWA 3QMFA 1FQEA 1A8EA 5I2NA 5LTCA 3EQ1A 1MXYA 4P11A 2FIEA 1B9JA 1FPJA 2IA4A 1A55A 4XFEA 2XXUA 1POTA 5B70A 1O64A 3UK4A 1MM6A 4GQOA 1FPEA 3L6HA 3IOTA 1PDAA 5DW8A 1ZMGA 3CSBA 4JWXA 1G0HA 1UTBB 1VSOA 3FUZA 1NV6A 3IB0A 4PDDA 1OMPA 1D9YA 1SYIA 2QVRA 3G3HA 3K6XA 3TELA 3PPRA 3CFLA 1DPEA 5DEXB 4JVDA 1B5HA 1ZJLA 1B7ZA 4NAPA 4IGTA 4F39A 4IO7A 3CVGA 4DE8A 1A54A 5I84A 2GFEA 2RC7A 1B5IA 1IZ1A 1LAGE 3OSRA 3VDFA 3PPPA 5A5XA 2R8TA 4ELPA 4YU0A 1SW5A 3K1PA 4OFJA 4F19A 2HHMA 4R75A 1IMFA 3U1OA 3IR1A 4NF0A 2ONKE 1SPIA 1DSNA 3A29A 4FORA 2QS1A 4C1UA 4GL0A 1MPDA 3HSTA 4YKKA 3T66A 4ND9A 4N6DA 3RLFE 3CFZA 3OOAA 3OO7A 3C34A 4N13A 1UTBA 2GQ1A 4MNPA 4HTGA 4PFYA 1LFIA 4BDNA 3QIMA 4KPTA 4KHZE 3Q27A 4G77A 2UYFA 3IAZA 5DEXA 3TZAA 3PUYE 4C0RA 2A5SA 1B1XA 1NL5A 1QKBA 2FNCA 1Q1KA 2ALUA 4P1LA 5FTHA 4R2FA 4U23A 3RTWB 4U1OA 3ZSFA 4GWOA 1H3DA 2I3VA 2AIXA 3MZBA 3OENA 1EYJA 1II5A 3PUVE 2O1MA 4ZEKA 3O6IA 5IGAA 4H65A 3T22A 3BIHA 1AMFA 4O8MA 3E4RA 1FTLA 4IO5A 2H4IA 1ZU0A 1UIUA 3HFUA 3UA8A 1LB8A 1ZBMA 2Y5KA 3OO8A 1WDNA 2OZZA 2VOZA 2KLFA 4OVJA 4PP0A 1MH3A 4NEDA 4H45A 1GV8A 3D1RA 4MFIA 4DLDA 3KBRA 2Q9TA 4ONYA 2I58A 1HSLA 2DE4A 3FV1A 5DT6A 4R6YA 1PB9A 1QUIA 5LOMA 1EZ9A 3RT6B 2XWOA 3IJOB 3UP9A 4FAJA 1PC3A 1NV5A 3IFCA 3MVWA 4N91A 4OEUA 5I57B 3JV9A 5J1DA 1NNTA 3K0VA 4GWYA 4RYAA 3P7IA 4H8JA 1JP4A 1P1WA 1AL3A 3KG2A 1WODA 3SESA 1R9LA 3R7XA 3T93B 5TP9B 3VLVA 3G3JA 4OANA 3PD9A 4RXLA 1LAXA 3FBPA 1AWBA 1DTGA 3IL1B 1YYZA 2Y7KA 4OEVA 3JYRA 3T9UA 3Q25A 3RQTA 1KWHA 1H45A 5DVIA 2XX9A 5BUUA 3W9WA 4YKIA 2HZKA 1FPIA 4IO6A 4N15A 5F24A 1H43A 2XXIA 1RYXA 2XXVA 2Z8EA 2FA7A 4QSDA 1PBPA 4NF5B 3TCGA 1I6AA 2ANJA 3SERA 4OHNA 3CG3A 5I57A 1GGGA 5I2KB 1SW4A 2CZKA 4Q0CA 5EHSA 1DBZA 3H3GA 2PT1A 4GRKA 2HZLA 1B58A 4IY6A 3DP4A 3MP8A 3VVFA 2VD3A 4QBAA 3BIGA 1D4NA 4QXDA 5TP9A 4HE1A 4H5GA 3VFJA 3Q26A 2F6GA 4THIA 1NNPA 2NUVA 4FBPA 2ZYMA 1R1NA 4AS4A 1VFDA 4WXJA 2Z8FA 2BJJX 3HO7A 4NHBA 4NE4A 1AOVA 1MQGA 1IUDA 1A8FA 5ITPA 3TMGA 1LFHA 3PMVA 5EHMA 4NF5A 5H8HB 1O63A 2DWIA 5I2KA 4YAHX 2F6PA 2F97A 2PFZA 1FPFA 2QRYA 2WKYA 1FQBA 2DXRA 3BKIB 3UIFA 1LAHE 2Y5LA 4LZ7A 3TAJA 4YKJA 4WEDA 3A09A 4XKPA 1B7HA 4FATA 2B3FA 1VE4A 4O94A 3CFXA 4XTCQ 2XXRA 4GXSB 4NWCA 3N6TA 1MXZA 1Y3QA 2PMSA 2RKMA 1ATGA 4TLLB 1FQAA 3CHGA 4LA9A 4KD5A 4AS5A 3IK6B 4PFWA 5ET5A 1LBZA 4FJPA 1H76A 3TDJA 1BIYA 3T96B 1SBPA 2NVUB 1M5BA 5H8HA 4P56A 2F78A 4MH5A 5JTYB 5ET7A 1Y9UA 4OVQA 4QFNA 2YLNA 4OFLA 4NWDA 4DXUA 1B40A 4I3YA 3ZS6A 1KZ8A 1MXXA 4N8YA 1IEJA 2O1LA 4Z0IA 4AB5A 2ZYNA 5AA2B 1MQDA 3WAFA 1PEBA 2XHDA 4OVPA 3KC1A 1XHYA 5FTIA 3D4CA 3EHSA 2QJEA 4DI4B 4F29A 2QL3A 3U65A 3TKDA 2ZYKA 2QFLA 4ELQA 2XXYA 3EKIA 2O51A 4EDPA 1WVJA 4YZZA 4GXAA 1A40A 4DCYA 2B4MA 1FBCA 2HCAA 1D3KA 4U22A 1DCUA 3FV2A 3KSXA 2F3DA 4MIJA 2DSFA 5JTYA 2XXHA 1B6HA 4N8GA 4BDQA 5CMCA 3CI8A 2VD2A 2F7BA 3IO6A 5LDZA 3G7WA 3VVDA 3SEXA 5AA2A 2CZIA 5FHNA 3B8BA 4OTEA 1UQWA 3O6GA 1OQHA 1MQHA 2RC8A 1BKAA 4ZDMA 1MPCA 4OQOA 4GL8A 4MEVA 2THIA 4JSOA 1POY1 2OCUA 3O97A 4UA8A 1NFTA 3IOWA 3O9PA 4JVIA 3S2VA 4G8HA 4HW8A 3MPKA 1NV0A 3PPNA 4H46A 1NV2A 3I6VA 3DP8A 3SKPA 2V25A 1MDP1 3GLBA 4YB7A 4G4PA 1B05A 2Q74A 2Z8DA 4QF9A 2HQ0A 1P1NA 4HS7A 4TLMB 2DYXA 4OZ9A 5CM6A 4I62A 1TWYA 4GF8A 2XWKA 3LC8A 4LVQA 2GHBA 4KFQA 5EQ9A 3B50A 1B3EA 1SDXA 4X1BA 3O29A 3IFAA 2G93A 3IX1A 1LSTA 3T9VA 3CRBA 4ZEBA 1I6QA 4O3BA 2UVGA 3IJXB 4G68C 1B2HA 3M3FA 4EXKA 5EQ8A 1BTJA 3IOUA 4GWZA 2QS3A 3ILUB 2OBGA 5HBCA 3E78A 3RNNA 1FW0A 4PGPA 3KEIA 1DK4A 2O6AA 5DTBA 1VR5A 1XVXA 3V8XB 3QK6A 4R2BA 5ITOA 3K4UA 2FYIA 3C4MA 1SVXB 4DI3D 2HPGA 4X04A 4JWOA 3I3VA 4PQJA 3TTRA 2XXXA 1LCFA 4KYEA 3QYTA 4OVTA 4GLIA 4ESXA 1FRPA 1US5A 1DOTA 1NNFA 4MMPA 4KR5A 1AIVA 5H8NB 4AQ4A 4GVOA 4JWYA 2ZYOA 5EQAA 1IITA 3MSTA 3ODBA 1MXUA 1QVSA 2H25A 4U2RA 2F35A 2R9JA 3CR9A 3Q28A 4FEDA 2XA5A 3DP6A 5KZTA 1S9TA 1FQDA 1EU8A 2QSXA 2XD2A 1CNQA 1USYH 3KOTA 4NG7A 3M3KA 3S4UA 1SI0A 1YXIA 3SEUA 4RK9A 4RPOA 3G3GA 1LBVA 4PFIA 4F3GA 2ZNUA 4WKMA 5EQ7A 2OWSA 3USDA 1IMEA 3IB1A 4EQBA 3FIRA 1NH8A 4R6KA 5IKBA 4HXVA 3PMWA 2Y84A 4PBHA 1IMCA 2PBWA 4JVCA 2DWHA 2ZMBA 3PU5A 3OELA 3QUJA 1EYIA 1MH4A 1MQIA 4FECA 2V3QA 5H8NA 5DVJA 1FBHA 4PF6A 2GRVA 1D9VA 4YMAA 1MY4A 2Y7IA 3S9MC 1IMAA 1LBYA 1IMDA 1NUWA 1B0LA 3C33A 4F3SA 2Q8MA 3E9XA 2Z22A 3HV1A 1IMBA 1KA1A 3SETA 3TCHA 4EUOA 3KOSA 3KBZA 3QXMA 2DE2A 3E13X 4MNIA 3KJTA 3CG1A 1SW2A 3LSXA 1BLFA 3R26A 2F36A 4OENA 4PAKA 1JQFA 3TTMA 2QMWA 1I69A 3RYDA 3C32A 2V4CA 1XI6A 1JW5A 1RDZA 3LUYA 5ET8A 4WEPA 4GWWA 5EYFA 1B1HA 1XC1A 4ZE9A 1FQFA 3K6UA 3S9LC 4H5FA 3H03A 3AXFA 3GZGA 4NQ8A 1NV3A 3RUMA 3SEVA 2OWZA 4DCXA 4F22A 4RPNA 3KN7A 1MDQA 3SZPA 5TPAB 4N07A 4OVRA 5IZZA 2A5TB 3U92A 2HEUA 4DXBA 3ONMA 1OVTA 4YB5A 5K2YA 1Y3PA 2F7AA 3B6QA 2H99A 5FBPA 3EF7A 1NH7A 4ECFA 1GVCA 3O2AA 2UVJA 1B5JA 4XF5A 4IO3A 3ECRA 2Y7PA 3S9NC 3TTNA 3C35A 4O3CA 3SEYA 1FQCA 3E79A 4HE2A 2F8DA 4HE0A 1JW4A 2B3BA 3L6GA 3FJMA 3MZ9A 4XKRA 5FHOA 2VT5A 4Q5TA 4G8NA 1OVBA 3WAEA 4M1VA 2F5XA 3MAMA 4RNSA 4PTKA 4ZEDA 2HAVA 5TPAA 4OFOA 1FPLA 2I3WA 3LV0A 2A5TA 5I56B 1GTKA 1ANFA 3PV0E 2QVUA 3EPEA 2XX8A 1TXFA 3TFLA 1R9QA 3LSFB 5CBSA 1Y4CA 3UGWA 1B51A 1N3XA 1FBGA 1YPNA 2O84X 2OWTA 2E1SA 3N94A 2CMOA 1LEVA 4E0WA 4BDLA 3FXQA 2AL4A 3T9HB 2R71A 4PDHA 3KC0A 1QJMA 1N84A 1TFDA 2VP1A 3OO6A 1R6ZA 3LUZA 4YKPA 1RKMA 1T0KA 2DQVA 4QSCA 5DVFA 2OJTA 4I1DA 4N6KA 5IAIA 4F1YA 3T0JA 1Z7ME 1B4ZA 3M3LA 1SQYA 5I56A 4YB6A 1OLCA 5HPQA 4U1ZA 4P1EA 1NUZA 3DLNA 4ELRA 1FBFA 4Q8RA 4GFRA 1Y20A 4K3FA 5BWJA 1B46A 2UYEA 3A3UA 1K9YA 4R6HA 2UVIA 3N6UA 1NV4A 3MBPA 3DELB 1FPBA 5IM2A 2O68A 2MKZA 4R74A 5L8DA 5I58B 3PTYA 3TTLA 3MUQA 3OSQA 5CMKA 1LAFE 4LP2B 4MJOA 1US4A 4GWXA 4F3PA 4ZZEA 3UORA 1N76A 1UIVA 1Q9DA 1MXVA 3MVXA 4DIGA 3D4GA 1FTOA 5B7DA 2NXOA 2F3BA 1IXGA 4IO2A 3SDFA 2NWJA 3MZ1A 4F31B 1N04A 4RJZA 3VV5A 5L9OA 3KFMA 4IGRA 4QFOA 3V89B 4MNCA 4H67A 3O6HA 3RTFB 1PBQA 1EZOA 1YCJA 3TYHA 5CRYA 2YJPA 1VFEA 4IR8A 3MP1A 5I58A 4EQ9A 3EN3A 1LBCA 1MG1A 5AA2D 2OK2A 4QRZA 1LBWA 3RT8A 1LLSA 3CIJA 1S50A 3NOHA 4GX4A 3MYUA 2CZHA 3FJ7A 3V83A 2RC9A 3PPQA 3KJ7A 1IXIA 3BBRA 5I7IA 1NUYA 2XD3A 5ET6A 3RGYA 3C36A 5F1QA 4EXLA 2QS2A 4MBPA 4NGUA 3U94A 1SYHA 1B52A 1F9BA 1M5CA 1FBEA 2V93A 3T1BA 3MPLA 4MCOA 1BP5A 4XKQA 3K02A 3MVYA 4ZS9A 4UACA 1M5EA 2ZNSA 2Q8JA 1RYOA 2RINA 3U93A 4P8BA 2XXWA 1P1UA 3C31A 1USYE 1JEVA 1Q35A 4GIZA 4PAFA 4XIGQ 3W15C 2Y7WA 2FHYA 3THIA 4IB2A 2V3UA 1D9QA 1XS5A 2OLBA 5KDTB 4YICA 1QULA 2HXRA 3O28A 5CBRA 3TQWA 3HHFA 2RCBA 2O7UA 3MP6A 1IQ7A 5IZ3B 1ELJA 4HCWA 3RPWA 1SI1A 3SEWA 4I8CA 4KYSA 4AB6A 2CZLA 2I4CA 2WYKA 1MY3A 2I4BA 1MQJA 2X7PA 3S9EA 1IXHA 1DPPA 2O7IA 4LUBA 4Q30B 4DXCA 1NV7A 1URSA 1NI9A 2AL5A 2M8CA 2XWIA 3TPAA 5KCJB 3BFUA 2Q2CA 2XXQA 3TQLA 4H8IA 2D21A 1Y4TA 1EH3A 5JEIA 1B3LA 1N0TA 1B0HA 1EYKA 1LB9A 3F11A 2G29A 3K6VA 5KDTA 5A5LA 1Y1ZA 4G2ZA 3OD7A 2XXPA 1NNKA 2R6GE 1YAEA 5IZ3A 4LATA 4LZ5A 1NV1A 3I5OA 3QSLA 2H9BA 1IIWA 5ICTA 1IXCA 1LFGA 3R6UA 3B6WA 2FBPA 1JVXA 4MLQA 4NX1A 3ROJA 3FXBA 1S7YA 2D5WA 1FPDA 2ZXTA 1O7TA 1FTAA 4OA4A 4QSEA 1ZKBA 2ZZWA 1HSEA 5KCJA 1SW1A 4POWA 4JDFA 4GOTA 2FIXA 4H1XA 4MLVA 1N7XA 4O3AA 1QGXA 5F7VA 1K9ZA 4ZE8A 3B7DA 4LZ8A 3ZKLA 4P9KA 3K01A 3H4ZA 4OVSA 3RPLB 1B3GA 3H6TA 2ZNTA 4F3BA 4PE3A 4X48A 3LSWA 2Z23A 4ZEIA 1A99A 3PMXA 1INPA 3H6VA 1EZPA 1P1OA 4G68B 3LR1A 5HM4B 3UN6A 3MW0A 3OEKA 4YMBA 1NKXA 1B7UA 3FXRA 3JZJA 1JEUA 1MPBA 1ZIUA 1JETA 2YPNA 3PD8A 5L9MA 1PB8A 1B32A 2XX7A 4QFLA 4RA1A 3H06B 4FE8A 2P1SA 4KCDA 3IOVA 2XXTA 3G3IA 2ZZXA 2Q2AA 3FJGA 1P99A 4XEQA 1OIBA 3KN8A 1TFAA 4MX6A 3GXAA 1FTJA 3H6WA 1OQGA 1Y3NA 3EHTA 2ZZVA 1MY2A 3VVEA 2VPNA 1FSAA 2CEXA 5ELVA 3GBAA 2I49A 1MS7A 4H6DA 2F34A 3MVZA 3VLUA 4OESA 1Y1MA 3RPLA 3BFTA 3GBBA 3LBSA 2HAUA 2PYYA 5AA4B 1CB6A 2P0SA 2P2AA 4ISUA 3FVOA 3RY3A 1LBXA 1MY1A 5AE4A 4G68A 5K2XA 5I59B 1SD3A 1MM7A 1UTHB 1DMBA 3KGCA 3IO4A 2PT2A 4ZEFA 3W9VA 4U21A 3N5LA 4BLAA 2P3VA 3FD3A 3G3KA 1KA0A 3PUWE 3FZVA 5EYGA 1QUKA 1NMUA 1J1NA 4X8RA 2PFYA 2UXAA 4GD5A 4PAIA 2DDKA 2QMXA 2VPOA 4R9FA 3O66A 3MC2A 1QUJA 2X7QA 4GWSA 1L5TA 2VGQA 4MHFA 2RCAA 3MQ9A 1QKAA 3EHUA 3M8UA 4QFKA 4POXA 4BDRA 2KQZA 4IY5A 4P0GA 2DP8A 1AH5A 5AA4A 2XXKA 4ESWA 4F2OA 3OXNA 1NUXA 2OX3A 3QUFA 1N7WA 2ESNA 5I59A 2DOJA 4LN5A 1UTHA 4QHQA 2REJA 4HCYA 2Q89A 3PUZE 2H5YA 2HFBA 3FATA 2PCRA 3K1MA 1FBDA 3K1NA 3IB2A 3B6TA 4RK2A 4BDMA 4PE5B 2QS4A 2KR0A 2W7YA 4QFPA 4U4SA 4I40A 3HCQA 3TUSA 4EF1A 2B4LA 2DWAA 5T3JA 4JXIA 3HN0A 3E3KA 4NTLA 3N26A 4ELOA 4PF8A 3V5AA 4XXUA 1MRPA 2RF1A 3Q29A 3VXBA 4P0IA 4E0XA 1XT8A 3OEMA 4F1UA 1BK4A 5FHMA 4L17A 4NF6B 4OMBA 4N81A 1M5FA 1XVYA 2REGA 2PVUA 3FVKA 4Z7EA 4GWUA 4LQ2A 4PFTA 2H98A 3K2DA 4KQPA 1LBBA 4R72A 1YTVA 1H44A 4F2QA 1ZTYA 2D3IA 5ICQA 4GX3A 4NF4B 4GX6A 3U8QA 4N17A 3IORA 4P47A 3FVGA 1YZ0A 3LSLA 1URGA 3TEPA 3HPIA 2ONRA 5CMMA 2DE3A 4U4XA 4I3EA 5M2VA 2WBBA 1G0IA 4O7MA 1CE2A 2HXWA 4BDOA 4NF6A 3C9HA 3MWBA 2XWVA 3G3FA 4LQ5A 1FCKA 4NN3A 4IO4A 4KXPA 1B3FA 5AA3A 2JJKA 2IEEA 4N4UA 2DWJA 1LCTA 5IZ1A 2WYPA 1JNFA 4OERA 4H0WA 4KYDA 4JB7A 4PBQA 1RDXA 2O69A 5L9SA 5J16A 3DM0A 1XOCA 4TQUQ 3TCFA 2UVHA 4NF8B 4O7IA 2DS9A 4NF4A 2X26A 1HSJA 3KN3A 5TU0A 3KSJA 3VE1B 4DZ1A 5DYHA 4KI0E 5ISUA 5H8QB 5H8FB 2I48A 2V84A 2GH9A 2ONSA 2LAOA 5CC2A 2I6EA 4LONB 1RDYA 4UABA 3ILTB 1ZLQA 1FBPA 4P3LA 5AA1A 3OMBA 3CSGA 4JBZA 2B65A 3FVNA 1MXWA 4EQ7A 4OXVA 3RN8A 3K6WA 2ABHA 3QAXA 4PCDA 2CEYA 3H6UA 3VLWA 4PGNA 4XKNA 2QVVA 3T9XB 4PETA 2AYSA 1B4HA 2V3TA 1JW1A 1OLAA 2E0SA 3TODA 4NF8A 2WX9A 1FTKA 3TTKA 2I0CA 4X9TA 3H7MA 1B3HA 5ESYA 3PPOA 3FASA 4GBWA 5JK4A 2BJIA 2GHAA 2VHAA 4TOZA 1P1QA 4ZECA 5H8QA 5H8FA 4FEBA 3ISPA 1MY0A 3GYYA 1A7LA 4G8MA 4R9GA 1FPGA 4OWDA 3KZGA 4C1TA 5I3SA 4R73A 3VXCA 4EF2A 4I9DA 1FJ9A 3K00A 2QPQA 1QW0A 2NOOA 4OYVA 2P3NA 5I2NB 4F1VA 1N3WA 4M4GA 2Q88A 1FPKA 1JVYA 2DVZA 4MF3A 2F7CA 3PGFA 1FTMA 2PX1A 4G61A 4NMYA 4RY1A 2DVCA 3PUXE 2FVZA 4PC9A 3HHGA 4DDDA 4N6PA 2Y7RA 3A3CA 2WEFA 4FIMA 4GBVA 2I0BA 3OO9A 4KCCA 4MAGA 3FXUA 4OETA 3FGSA 1PB7A 1FJ6A 5H8SA 3ZKKA 1GR2A 1URDA 5EYHA 2WBDA 4F18A 5I5PA 4PFUA 1Z7NE 3U72A 1I6BA 4JSDA 4PFRA 4PFBA 1LGBC 2L5VA 1TT1A 2DXYA 1DTZA 1M5DA 4ZZAA 5CMBA 4X1DA
chains in the Genus database with same CATH topology
3MJNA 5CI5A 5A5XB 1FQEA 1A8EA 5I2NA 3EQ1A 1MXYA 4P11A 1B9JA 2IA4A 1A55A 2XXUA 1POTA 5B70A 1O64A 3UK4A 1MM6A 4GQOA 3L6HA 3IOTA 1PDAA 1ZMGA 3CSBA 4JWXA 1UTBB 1VSOA 3FUZA 3IB0A 1OMPA 1D9YA 1SYIA 3G3HA 3K6XA 3TELA 3PPRA 3CFLA 1DPEA 5DEXB 1B5HA 1ZJLA 1B7ZA 4IGTA 4F39A 4IO7A 3CVGA 4DE8A 1A54A 5I84A 2GFEA 2RC7A 1B5IA 1IZ1A 1LAGE 3OSRA 3VDFA 3PPPA 5A5XA 4ELPA 4YU0A 1SW5A 3K1PA 4OFJA 4F19A 4R75A 3U1OA 3IR1A 2ONKE 1DSNA 4FORA 2QS1A 4C1UA 4GL0A 1MPDA 3HSTA 4YKKA 3T66A 4ND9A 3RLFE 3CFZA 3OOAA 3OO7A 3C34A 4N13A 1UTBA 4HTGA 4PFYA 1LFIA 4BDNA 3QIMA 4KPTA 4KHZE 3Q27A 4G77A 2UYFA 3IAZA 5DEXA 3TZAA 3PUYE 4C0RA 2A5SA 1B1XA 1NL5A 1QKBA 2FNCA 1Q1KA 2ALUA 5FTHA 4R2FA 4U23A 3RTWB 4U1OA 3ZSFA 4GWOA 1H3DA 2I3VA 2AIXA 3MZBA 3OENA 1II5A 3PUVE 2O1MA 4ZEKA 3O6IA 4H65A 3T22A 1AMFA 3E4RA 1FTLA 4IO5A 2H4IA 1ZU0A 1UIUA 3UA8A 1LB8A 1ZBMA 3OO8A 1WDNA 2OZZA 2VOZA 2KLFA 4OVJA 4PP0A 1MH3A 4NEDA 1GV8A 4MFIA 4DLDA 3KBRA 2Q9TA 4ONYA 2I58A 1HSLA 2DE4A 3FV1A 5DT6A 4R6YA 1PB9A 1QUIA 5LOMA 1EZ9A 3RT6B 3UP9A 3IJOB 4FAJA 1PC3A 3MVWA 4OEUA 5I57B 3JV9A 5J1DA 1NNTA 3K0VA 4RYAA 3P7IA 4H8JA 1P1WA 1AL3A 3KG2A 1WODA 3SESA 1R9LA 3R7XA 3T93B 5TP9B 3VLVA 3G3JA 3PD9A 4RXLA 1LAXA 1DTGA 3IL1B 2Y7KA 4OEVA 3JYRA 3T9UA 3Q25A 3RQTA 1KWHA 1H45A 5DVIA 2XX9A 5BUUA 3W9WA 4YKIA 2HZKA 4IO6A 1H43A 2XXIA 1RYXA 2XXVA 2Z8EA 2FA7A 4QSDA 1PBPA 4NF5B 3TCGA 1I6AA 2ANJA 3SERA 4OHNA 3CG3A 5I57A 1GGGA 5I2KB 1SW4A 4Q0CA 5EHSA 3H3GA 2PT1A 4GRKA 2HZLA 1B58A 4IY6A 3DP4A 3MP8A 3VVFA 2VD3A 1D4NA 5TP9A 4H5GA 3VFJA 3Q26A 2F6GA 4THIA 1NNPA 2NUVA 2ZYMA 1R1NA 1VFDA 4WXJA 2Z8FA 2BJJX 3HO7A 4NE4A 1AOVA 1MQGA 1IUDA 1A8FA 5ITPA 3TMGA 1LFHA 3PMVA 5EHMA 4NF5A 5H8HB 1O63A 2DWIA 5I2KA 4YAHX 2F6PA 2F97A 2QRYA 2WKYA 1FQBA 2DXRA 3BKIB 3UIFA 1LAHE 4LZ7A 3TAJA 4YKJA 4WEDA 3A09A 4XKPA 4FATA 1B7HA 2B3FA 1VE4A 3CFXA 4XTCQ 2XXRA 4GXSB 4NWCA 3N6TA 1MXZA 1Y3QA 2PMSA 2RKMA 1ATGA 4TLLB 1FQAA 4LA9A 4KD5A 3IK6B 4PFWA 4FJPA 1H76A 3TDJA 1BIYA 3T96B 1SBPA 2NVUB 1M5BA 5H8HA 2F78A 4MH5A 5JTYB 1Y9UA 4QFNA 2YLNA 4OFLA 4NWDA 4DXUA 1B40A 3ZS6A 1MXXA 1IEJA 2O1LA 4Z0IA 4AB5A 2ZYNA 5AA2B 1MQDA 3WAFA 1PEBA 2XHDA 1XHYA 5FTIA 3D4CA 3EHSA 2QJEA 4F29A 2QL3A 3TKDA 2ZYKA 4ELQA 2XXYA 2O51A 4EDPA 1WVJA 4YZZA 4GXAA 1A40A 4DCYA 2HCAA 1D3KA 4U22A 3FV2A 3KSXA 2DSFA 5JTYA 2XXHA 1B6HA 4BDQA 5CMCA 3CI8A 2VD2A 2F7BA 3IO6A 3G7WA 3VVDA 3SEXA 5AA2A 5FHNA 4OTEA 1UQWA 3O6GA 1OQHA 1MQHA 2RC8A 1BKAA 4ZDMA 1MPCA 4OQOA 4GL8A 2THIA 4JSOA 1POY1 2OCUA 3O97A 4UA8A 1NFTA 3IOWA 3O9PA 3S2VA 4G8HA 4HW8A 3MPKA 3PPNA 3I6VA 3DP8A 3SKPA 2V25A 1MDP1 3GLBA 4YB7A 4G4PA 1B05A 2Z8DA 4QF9A 2HQ0A 1P1NA 4HS7A 4TLMB 2DYXA 4OZ9A 5CM6A 4I62A 1TWYA 4GF8A 3LC8A 4LVQA 2GHBA 4KFQA 1B3EA 1SDXA 4X1BA 3O29A 2G93A 3IX1A 1LSTA 3T9VA 3CRBA 4ZEBA 1I6QA 4O3BA 2UVGA 3IJXB 4G68C 1B2HA 3M3FA 4EXKA 1BTJA 3IOUA 2QS3A 3ILUB 2OBGA 5HBCA 3RNNA 1FW0A 3KEIA 2O6AA 5DTBA 1VR5A 1XVXA 3V8XB 3QK6A 4R2BA 5ITOA 3K4UA 2FYIA 3C4MA 1SVXB 4JWOA 3I3VA 4PQJA 3TTRA 2XXXA 1LCFA 4KYEA 3QYTA 4GLIA 4ESXA 1US5A 1DOTA 1NNFA 1AIVA 4KR5A 5H8NB 4AQ4A 4GVOA 4JWYA 2ZYOA 1IITA 3ODBA 1MXUA 1QVSA 2H25A 4U2RA 2F35A 2R9JA 3CR9A 3Q28A 4FEDA 3DP6A 5KZTA 1S9TA 1FQDA 1EU8A 2QSXA 2XD2A 3KOTA 1USYH 3M3KA 3S4UA 1SI0A 3SEUA 4RK9A 4RPOA 3G3GA 4F3GA 2ZNUA 4WKMA 2OWSA 3USDA 3IB1A 4EQBA 3FIRA 1NH8A 4R6KA 5IKBA 3PMWA 2Y84A 2PBWA 2DWHA 2ZMBA 3PU5A 3OELA 3QUJA 1MH4A 1MQIA 4FECA 2V3QA 5H8NA 5DVJA 2GRVA 1D9VA 4YMAA 1MY4A 2Y7IA 3S9MC 1B0LA 3C33A 4F3SA 3E9XA 2Z22A 3HV1A 3SETA 3TCHA 4EUOA 3KOSA 3QXMA 2DE2A 3E13X 3KJTA 3CG1A 1SW2A 3LSXA 1BLFA 3R26A 2F36A 4OENA 1JQFA 3TTMA 2QMWA 1I69A 3C32A 1JW5A 3LUYA 4WEPA 5EYFA 1B1HA 1XC1A 4ZE9A 1FQFA 3K6UA 3S9LC 4H5FA 3H03A 3AXFA 3GZGA 3RUMA 3SEVA 4DCXA 4F22A 4RPNA 3KN7A 1MDQA 5TPAB 4N07A 2A5TB 3U92A 2HEUA 4DXBA 3ONMA 1OVTA 4YB5A 5K2YA 1Y3PA 2F7AA 3B6QA 2H99A 3EF7A 1NH7A 4ECFA 1GVCA 3O2AA 2UVJA 1B5JA 4IO3A 3ECRA 2Y7PA 3S9NC 3TTNA 3C35A 4O3CA 3SEYA 1FQCA 2F8DA 1JW4A 2B3BA 3L6GA 3FJMA 3MZ9A 4XKRA 5FHOA 4Q5TA 4G8NA 1OVBA 3WAEA 4M1VA 2F5XA 3MAMA 4RNSA 4ZEDA 2HAVA 5TPAA 4OFOA 2I3WA 2A5TA 5I56B 1GTKA 1ANFA 3PV0E 3EPEA 2XX8A 1TXFA 3TFLA 1R9QA 3LSFB 5CBSA 1Y4CA 3UGWA 1B51A 1N3XA 1YPNA 2O84X 2OWTA 2E1SA 3N94A 2CMOA 4E0WA 4BDLA 3FXQA 2AL4A 3T9HB 2R71A 1QJMA 1N84A 1TFDA 2VP1A 3OO6A 1R6ZA 4YKPA 1RKMA 1T0KA 2DQVA 4QSCA 5DVFA 2OJTA 4I1DA 5IAIA 4F1YA 1Z7ME 1B4ZA 3M3LA 1SQYA 5I56A 4YB6A 1OLCA 5HPQA 4U1ZA 3DLNA 4ELRA 4Q8RA 4GFRA 1Y20A 4K3FA 5BWJA 1B46A 2UYEA 3A3UA 4R6HA 2UVIA 3N6UA 3MBPA 3DELB 2O68A 4R74A 5L8DA 5I58B 3TTLA 3MUQA 3OSQA 5CMKA 1LAFE 4LP2B 1US4A 4F3PA 4ZZEA 3UORA 1N76A 1UIVA 1MXVA 3MVXA 4DIGA 3D4GA 1FTOA 5B7DA 2NXOA 1IXGA 4IO2A 3SDFA 2NWJA 3MZ1A 4F31B 1N04A 4RJZA 3VV5A 5L9OA 3KFMA 4IGRA 4QFOA 3V89B 4H67A 3O6HA 3RTFB 1PBQA 1EZOA 1YCJA 3TYHA 5CRYA 2YJPA 1VFEA 3MP1A 5I58A 4EQ9A 3EN3A 1LBCA 1MG1A 5AA2D 2OK2A 4QRZA 3RT8A 1LLSA 3CIJA 1S50A 3FJ7A 3V83A 2RC9A 3PPQA 3KJ7A 1IXIA 3BBRA 2XD3A 3RGYA 3C36A 5F1QA 4EXLA 2QS2A 4MBPA 3U94A 1SYHA 1B52A 1F9BA 1M5CA 2V93A 3MPLA 1BP5A 4XKQA 3K02A 3MVYA 4ZS9A 4UACA 1M5EA 2ZNSA 2Q8JA 1RYOA 2RINA 3U93A 2XXWA 1P1UA 3C31A 1USYE 1JEVA 1Q35A 4GIZA 4XIGQ 3W15C 2Y7WA 3THIA 4IB2A 2V3UA 1XS5A 2OLBA 5KDTB 4YICA 1QULA 5CBRA 3O28A 3TQWA 3HHFA 2RCBA 2O7UA 3MP6A 1IQ7A 1ELJA 4HCWA 3RPWA 1SI1A 3SEWA 4I8CA 4KYSA 4AB6A 2CZLA 2I4CA 1MY3A 2I4BA 1MQJA 2X7PA 3S9EA 1IXHA 1DPPA 2O7IA 4LUBA 4Q30B 4DXCA 1URSA 2AL5A 2M8CA 3TPAA 5KCJB 3BFUA 2Q2CA 2XXQA 3TQLA 4H8IA 2D21A 1Y4TA 1EH3A 5JEIA 1B3LA 1N0TA 1B0HA 1LB9A 3F11A 2G29A 3K6VA 5KDTA 1Y1ZA 4G2ZA 3OD7A 2XXPA 1NNKA 2R6GE 1YAEA 4LATA 4LZ5A 3I5OA 3QSLA 2H9BA 1IIWA 5ICTA 1IXCA 1LFGA 3R6UA 3B6WA 1JVXA 4MLQA 1S7YA 2D5WA 2ZXTA 1O7TA 4QSEA 1ZKBA 1HSEA 5KCJA 1SW1A 4POWA 4JDFA 4GOTA 4H1XA 4MLVA 1N7XA 4O3AA 5F7VA 4ZE8A 3B7DA 4LZ8A 3ZKLA 3K01A 3H4ZA 1B3GA 3H6TA 2ZNTA 4F3BA 4X48A 3LSWA 2Z23A 4ZEIA 1A99A 3PMXA 3H6VA 1EZPA 1P1OA 4G68B 3LR1A 5HM4B 3UN6A 3MW0A 3OEKA 4YMBA 1NKXA 1B7UA 3FXRA 3JZJA 1JEUA 1MPBA 1ZIUA 1JETA 2YPNA 3PD8A 5L9MA 1PB8A 1B32A 2XX7A 4QFLA 4RA1A 3H06B 4FE8A 2P1SA 4KCDA 3IOVA 2XXTA 3G3IA 2Q2AA 3FJGA 1P99A 1OIBA 3KN8A 1TFAA 3GXAA 1FTJA 3H6WA 1OQGA 1Y3NA 3EHTA 1MY2A 3VVEA 5ELVA 3GBAA 2I49A 1MS7A 4H6DA 2F34A 3MVZA 3VLUA 4OESA 1Y1MA 3BFTA 3GBBA 3LBSA 2HAUA 2PYYA 5AA4B 1CB6A 2P0SA 2P2AA 4ISUA 3FVOA 3RY3A 1MY1A 5AE4A 4G68A 5K2XA 5I59B 1SD3A 1MM7A 1UTHB 1DMBA 3KGCA 3IO4A 2PT2A 4ZEFA 3W9VA 4U21A 3N5LA 4BLAA 3FD3A 3G3KA 3PUWE 3FZVA 1QUKA 1NMUA 1J1NA 2UXAA 4GD5A 2QMXA 4R9FA 3O66A 3MC2A 1QUJA 2X7QA 1L5TA 2VGQA 2RCAA 3MQ9A 1QKAA 3EHUA 3M8UA 4QFKA 4POXA 4BDRA 4IY5A 4P0GA 2DP8A 1AH5A 5AA4A 4ESWA 4F2OA 3OXNA 3QUFA 1N7WA 2ESNA 5I59A 2DOJA 1UTHA 4QHQA 2REJA 4HCYA 2Q89A 3PUZE 2H5YA 2HFBA 3FATA 3K1MA 3K1NA 3IB2A 3B6TA 4RK2A 4BDMA 4PE5B 2QS4A 2W7YA 4QFPA 4U4SA 3HCQA 3TUSA 4EF1A 2DWAA 4JXIA 3HN0A 3E3KA 4NTLA 3N26A 4ELOA 3V5AA 4XXUA 1MRPA 2RF1A 3Q29A 3VXBA 4P0IA 4E0XA 1XT8A 3OEMA 4F1UA 5FHMA 4L17A 4NF6B 4OMBA 1M5FA 1XVYA 2REGA 2PVUA 3FVKA 4Z7EA 4LQ2A 4PFTA 2H98A 3K2DA 4KQPA 1LBBA 4R72A 1YTVA 1H44A 4F2QA 1ZTYA 2D3IA 5ICQA 4NF4B 3U8QA 3IORA 3FVGA 3LSLA 1URGA 3TEPA 3HPIA 2ONRA 5CMMA 2DE3A 4U4XA 5M2VA 1CE2A 2HXWA 4BDOA 4NF6A 3C9HA 3MWBA 3G3FA 4LQ5A 1FCKA 4IO4A 1B3FA 5AA3A 2IEEA 2DWJA 1LCTA 1JNFA 4OERA 4H0WA 4KYDA 4JB7A 2O69A 5L9SA 3DM0A 1XOCA 4TQUQ 3TCFA 2UVHA 4NF8B 2DS9A 4NF4A 2X26A 1HSJA 3KN3A 5TU0A 3KSJA 3VE1B 4DZ1A 5DYHA 4KI0E 5ISUA 5H8QB 5H8FB 2I48A 2V84A 2GH9A 2ONSA 2LAOA 5CC2A 2I6EA 4LONB 3ILTB 1ZLQA 5AA1A 3OMBA 3CSGA 4JBZA 2B65A 3FVNA 1MXWA 4EQ7A 4OXVA 3RN8A 3K6WA 2ABHA 3QAXA 3H6UA 3VLWA 4XKNA 3T9XB 4PETA 2AYSA 1B4HA 2V3TA 1JW1A 1OLAA 2E0SA 3TODA 4NF8A 1FTKA 3TTKA 2I0CA 4X9TA 3H7MA 1B3HA 3PPOA 3FASA 5JK4A 2GHAA 2VHAA 4TOZA 1P1QA 4ZECA 5H8QA 5H8FA 4FEBA 1MY0A 1A7LA 4G8MA 4R9GA 4OWDA 3KZGA 4C1TA 4R73A 3VXCA 4EF2A 4I9DA 3K00A 2QPQA 1QW0A 2NOOA 4OYVA 5I2NB 4F1VA 1N3WA 4M4GA 2Q88A 1JVYA 2DVZA 4MF3A 2F7CA 3PGFA 1FTMA 2PX1A 4NMYA 4RY1A 2DVCA 3PUXE 3HHGA 4DDDA 4N6PA 2Y7RA 3A3CA 4FIMA 2I0BA 3OO9A 4KCCA 3FXUA 4OETA 3FGSA 1PB7A 5H8SA 3ZKKA 1GR2A 1URDA 4F18A 3U72A 1Z7NE 4PFUA 1I6BA 4JSDA 1LGBC 1TT1A 2DXYA 1DTZA 1M5DA 4ZZAA 5CMBA 4X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJN A;  5CI5 A;  5A5X B;  1FQE A;  1A8E A;  5I2N A;  3EQ1 A;  1MXY A;  4P11 A;  1B9J A;  2IA4 A;  1A55 A;  2XXU A;  1POT A;  5B70 A;  1O64 A;  3UK4 A;  1MM6 A;  4GQO A;  3L6H A;  3IOT A;  1PDA A;  1ZMG A;  3CSB A;  4JWX A;  1UTB B;  1VSO A;  3FUZ A;  3IB0 A;  1OMP A;  1D9Y A;  1SYI A;  3G3H A;  3K6X A;  3TEL A;  3PPR A;  3CFL A;  1DPE A;  5DEX B;  1B5H A;  1ZJL A;  1B7Z A;  4IGT A;  4F39 A;  4IO7 A;  3CVG A;  4DE8 A;  1A54 A;  5I84 A;  2GFE A;  2RC7 A;  1B5I A;  1IZ1 A;  1LAG E;  3OSR A;  3VDF A;  3PPP A;  5A5X A;  4ELP A;  4YU0 A;  1SW5 A;  3K1P A;  4OFJ A;  4F19 A;  4R75 A;  3U1O A;  3IR1 A;  2ONK E;  1DSN A;  4FOR A;  2QS1 A;  4C1U A;  4GL0 A;  1MPD A;  3HST A;  4YKK A;  3T66 A;  4ND9 A;  3RLF E;  3CFZ A;  3OOA A;  3OO7 A;  3C34 A;  4N13 A;  1UTB A;  4HTG A;  4PFY A;  1LFI A;  4BDN A;  3QIM A;  4KPT A;  4KHZ E;  3Q27 A;  4G77 A;  2UYF A;  3IAZ A;  5DEX A;  3TZA A;  3PUY E;  4C0R A;  2A5S A;  1B1X A;  1NL5 A;  1QKB A;  2FNC A;  1Q1K A;  2ALU A;  5FTH A;  4R2F A;  4U23 A;  3RTW B;  4U1O A;  3ZSF A;  4GWO A;  1H3D A;  2I3V A;  2AIX A;  3MZB A;  3OEN A;  1II5 A;  3PUV E;  2O1M A;  4ZEK A;  3O6I A;  4H65 A;  3T22 A;  1AMF A;  3E4R A;  1FTL A;  4IO5 A;  2H4I A;  1ZU0 A;  1UIU A;  3UA8 A;  1LB8 A;  1ZBM A;  3OO8 A;  1WDN A;  2OZZ A;  2VOZ A;  2KLF A;  4OVJ A;  4PP0 A;  1MH3 A;  4NED A;  1GV8 A;  4MFI A;  4DLD A;  3KBR A;  2Q9T A;  4ONY A;  2I58 A;  1HSL A;  2DE4 A;  3FV1 A;  5DT6 A;  4R6Y A;  1PB9 A;  1QUI A;  5LOM A;  1EZ9 A;  3RT6 B;  3UP9 A;  3IJO B;  4FAJ A;  1PC3 A;  3MVW A;  4OEU A;  5I57 B;  3JV9 A;  5J1D A;  1NNT A;  3K0V A;  4RYA A;  3P7I A;  4H8J A;  1P1W A;  1AL3 A;  3KG2 A;  1WOD A;  3SES A;  1R9L A;  3R7X A;  3T93 B;  5TP9 B;  3VLV A;  3G3J A;  3PD9 A;  4RXL A;  1LAX A;  1DTG A;  3IL1 B;  2Y7K A;  4OEV A;  3JYR A;  3T9U A;  3Q25 A;  3RQT A;  1KWH A;  1H45 A;  5DVI A;  2XX9 A;  5BUU A;  3W9W A;  4YKI A;  2HZK A;  4IO6 A;  1H43 A;  2XXI A;  1RYX A;  2XXV A;  2Z8E A;  2FA7 A;  4QSD A;  1PBP A;  4NF5 B;  3TCG A;  1I6A A;  2ANJ A;  3SER A;  4OHN A;  3CG3 A;  5I57 A;  1GGG A;  5I2K B;  1SW4 A;  4Q0C A;  5EHS A;  3H3G A;  2PT1 A;  4GRK A;  2HZL A;  1B58 A;  4IY6 A;  3DP4 A;  3MP8 A;  3VVF A;  2VD3 A;  1D4N A;  5TP9 A;  4H5G A;  3VFJ A;  3Q26 A;  2F6G A;  4THI A;  1NNP A;  2NUV A;  2ZYM A;  1R1N A;  1VFD A;  4WXJ A;  2Z8F A;  2BJJ X;  3HO7 A;  4NE4 A;  1AOV A;  1MQG A;  1IUD A;  1A8F A;  5ITP A;  3TMG A;  1LFH A;  3PMV A;  5EHM A;  4NF5 A;  5H8H B;  1O63 A;  2DWI A;  5I2K A;  4YAH X;  2F6P A;  2F97 A;  2QRY A;  2WKY A;  1FQB A;  2DXR A;  3BKI B;  3UIF A;  1LAH E;  4LZ7 A;  3TAJ A;  4YKJ A;  4WED A;  3A09 A;  4XKP A;  4FAT A;  1B7H A;  2B3F A;  1VE4 A;  3CFX A;  4XTC Q;  2XXR A;  4GXS B;  4NWC A;  3N6T A;  1MXZ A;  1Y3Q A;  2PMS A;  2RKM A;  1ATG A;  4TLL B;  1FQA A;  4LA9 A;  4KD5 A;  3IK6 B;  4PFW A;  4FJP A;  1H76 A;  3TDJ A;  1BIY A;  3T96 B;  1SBP A;  2NVU B;  1M5B A;  5H8H A;  2F78 A;  4MH5 A;  5JTY B;  1Y9U A;  4QFN A;  2YLN A;  4OFL A;  4NWD A;  4DXU A;  1B40 A;  3ZS6 A;  1MXX A;  1IEJ A;  2O1L A;  4Z0I A;  4AB5 A;  2ZYN A;  5AA2 B;  1MQD A;  3WAF A;  1PEB A;  2XHD A;  1XHY A;  5FTI A;  3D4C A;  3EHS A;  2QJE A;  4F29 A;  2QL3 A;  3TKD A;  2ZYK A;  4ELQ A;  2XXY A;  2O51 A;  4EDP A;  1WVJ A;  4YZZ A;  4GXA A;  1A40 A;  4DCY A;  2HCA A;  1D3K A;  4U22 A;  3FV2 A;  3KSX A;  2DSF A;  5JTY A;  2XXH A;  1B6H A;  4BDQ A;  5CMC A;  3CI8 A;  2VD2 A;  2F7B A;  3IO6 A;  3G7W A;  3VVD A;  3SEX A;  5AA2 A;  5FHN A;  4OTE A;  1UQW A;  3O6G A;  1OQH A;  1MQH A;  2RC8 A;  1BKA A;  4ZDM A;  1MPC A;  4OQO A;  4GL8 A;  2THI A;  4JSO A;  1POY 1;  2OCU A;  3O97 A;  4UA8 A;  1NFT A;  3IOW A;  3O9P A;  3S2V A;  4G8H A;  4HW8 A;  3MPK A;  3PPN A;  3I6V A;  3DP8 A;  3SKP A;  2V25 A;  1MDP 1;  3GLB A;  4YB7 A;  4G4P A;  1B05 A;  2Z8D A;  4QF9 A;  2HQ0 A;  1P1N A;  4HS7 A;  4TLM B;  2DYX A;  4OZ9 A;  5CM6 A;  4I62 A;  1TWY A;  4GF8 A;  3LC8 A;  4LVQ A;  2GHB A;  4KFQ A;  1B3E A;  1SDX A;  4X1B A;  3O29 A;  2G93 A;  3IX1 A;  1LST A;  3T9V A;  3CRB A;  4ZEB A;  1I6Q A;  4O3B A;  2UVG A;  3IJX B;  4G68 C;  1B2H A;  3M3F A;  4EXK A;  1BTJ A;  3IOU A;  2QS3 A;  3ILU B;  2OBG A;  5HBC A;  3RNN A;  1FW0 A;  3KEI A;  2O6A A;  5DTB A;  1VR5 A;  1XVX A;  3V8X B;  3QK6 A;  4R2B A;  5ITO A;  3K4U A;  2FYI A;  3C4M A;  1SVX B;  4JWO A;  3I3V A;  4PQJ A;  3TTR A;  2XXX A;  1LCF A;  4KYE A;  3QYT A;  4GLI A;  4ESX A;  1US5 A;  1DOT A;  1NNF A;  1AIV A;  4KR5 A;  5H8N B;  4AQ4 A;  4GVO A;  4JWY A;  2ZYO A;  1IIT A;  3ODB A;  1MXU A;  1QVS A;  2H25 A;  4U2R A;  2F35 A;  2R9J A;  3CR9 A;  3Q28 A;  4FED A;  3DP6 A;  5KZT A;  1S9T A;  1FQD A;  1EU8 A;  2QSX A;  2XD2 A;  3KOT A;  1USY H;  3M3K A;  3S4U A;  1SI0 A;  3SEU A;  4RK9 A;  4RPO A;  3G3G A;  4F3G A;  2ZNU A;  4WKM A;  2OWS A;  3USD A;  3IB1 A;  4EQB A;  3FIR A;  1NH8 A;  4R6K A;  5IKB A;  3PMW A;  2Y84 A;  2PBW A;  2DWH A;  2ZMB A;  3PU5 A;  3OEL A;  3QUJ A;  1MH4 A;  1MQI A;  4FEC A;  2V3Q A;  5H8N A;  5DVJ A;  2GRV A;  1D9V A;  4YMA A;  1MY4 A;  2Y7I A;  3S9M C;  1B0L A;  3C33 A;  4F3S A;  3E9X A;  2Z22 A;  3HV1 A;  3SET A;  3TCH A;  4EUO A;  3KOS A;  3QXM A;  2DE2 A;  3E13 X;  3KJT A;  3CG1 A;  1SW2 A;  3LSX A;  1BLF A;  3R26 A;  2F36 A;  4OEN A;  1JQF A;  3TTM A;  2QMW A;  1I69 A;  3C32 A;  1JW5 A;  3LUY A;  4WEP A;  5EYF A;  1B1H A;  1XC1 A;  4ZE9 A;  1FQF A;  3K6U A;  3S9L C;  4H5F A;  3H03 A;  3AXF A;  3GZG A;  3RUM A;  3SEV A;  4DCX A;  4F22 A;  4RPN A;  3KN7 A;  1MDQ A;  5TPA B;  4N07 A;  2A5T B;  3U92 A;  2HEU A;  4DXB A;  3ONM A;  1OVT A;  4YB5 A;  5K2Y A;  1Y3P A;  2F7A A;  3B6Q A;  2H99 A;  3EF7 A;  1NH7 A;  4ECF A;  1GVC A;  3O2A A;  2UVJ A;  1B5J A;  4IO3 A;  3ECR A;  2Y7P A;  3S9N C;  3TTN A;  3C35 A;  4O3C A;  3SEY A;  1FQC A;  2F8D A;  1JW4 A;  2B3B A;  3L6G A;  3FJM A;  3MZ9 A;  4XKR A;  5FHO A;  4Q5T A;  4G8N A;  1OVB A;  3WAE A;  4M1V A;  2F5X A;  3MAM A;  4RNS A;  4ZED A;  2HAV A;  5TPA A;  4OFO A;  2I3W A;  2A5T A;  5I56 B;  1GTK A;  1ANF A;  3PV0 E;  3EPE A;  2XX8 A;  1TXF A;  3TFL A;  1R9Q A;  3LSF B;  5CBS A;  1Y4C A;  3UGW A;  1B51 A;  1N3X A;  1YPN A;  2O84 X;  2OWT A;  2E1S A;  3N94 A;  2CMO A;  4E0W A;  4BDL A;  3FXQ A;  2AL4 A;  3T9H B;  2R71 A;  1QJM A;  1N84 A;  1TFD A;  2VP1 A;  3OO6 A;  1R6Z A;  4YKP A;  1RKM A;  1T0K A;  2DQV A;  4QSC A;  5DVF A;  2OJT A;  4I1D A;  5IAI A;  4F1Y A;  1Z7M E;  1B4Z A;  3M3L A;  1SQY A;  5I56 A;  4YB6 A;  1OLC A;  5HPQ A;  4U1Z A;  3DLN A;  4ELR A;  4Q8R A;  4GFR A;  1Y20 A;  4K3F A;  5BWJ A;  1B46 A;  2UYE A;  3A3U A;  4R6H A;  2UVI A;  3N6U A;  3MBP A;  3DEL B;  2O68 A;  4R74 A;  5L8D A;  5I58 B;  3TTL A;  3MUQ A;  3OSQ A;  5CMK A;  1LAF E;  4LP2 B;  1US4 A;  4F3P A;  4ZZE A;  3UOR A;  1N76 A;  1UIV A;  1MXV A;  3MVX A;  4DIG A;  3D4G A;  1FTO A;  5B7D A;  2NXO A;  1IXG A;  4IO2 A;  3SDF A;  2NWJ A;  3MZ1 A;  4F31 B;  1N04 A;  4RJZ A;  3VV5 A;  5L9O A;  3KFM A;  4IGR A;  4QFO A;  3V89 B;  4H67 A;  3O6H A;  3RTF B;  1PBQ A;  1EZO A;  1YCJ A;  3TYH A;  5CRY A;  2YJP A;  1VFE A;  3MP1 A;  5I58 A;  4EQ9 A;  3EN3 A;  1LBC A;  1MG1 A;  5AA2 D;  2OK2 A;  4QRZ A;  3RT8 A;  1LLS A;  3CIJ A;  1S50 A;  3FJ7 A;  3V83 A;  2RC9 A;  3PPQ A;  3KJ7 A;  1IXI A;  3BBR A;  2XD3 A;  3RGY A;  3C36 A;  5F1Q A;  4EXL A;  2QS2 A;  4MBP A;  3U94 A;  1SYH A;  1B52 A;  1F9B A;  1M5C A;  2V93 A;  3MPL A;  1BP5 A;  4XKQ A;  3K02 A;  3MVY A;  4ZS9 A;  4UAC A;  1M5E A;  2ZNS A;  2Q8J A;  1RYO A;  2RIN A;  3U93 A;  2XXW A;  1P1U A;  3C31 A;  1USY E;  1JEV A;  1Q35 A;  4GIZ A;  4XIG Q;  3W15 C;  2Y7W A;  3THI A;  4IB2 A;  2V3U A;  1XS5 A;  2OLB A;  5KDT B;  4YIC A;  1QUL A;  5CBR A;  3O28 A;  3TQW A;  3HHF A;  2RCB A;  2O7U A;  3MP6 A;  1IQ7 A;  1ELJ A;  4HCW A;  3RPW A;  1SI1 A;  3SEW A;  4I8C A;  4KYS A;  4AB6 A;  2CZL A;  2I4C A;  1MY3 A;  2I4B A;  1MQJ A;  2X7P A;  3S9E A;  1IXH A;  1DPP A;  2O7I A;  4LUB A;  4Q30 B;  4DXC A;  1URS A;  2AL5 A;  2M8C A;  3TPA A;  5KCJ B;  3BFU A;  2Q2C A;  2XXQ A;  3TQL A;  4H8I A;  2D21 A;  1Y4T A;  1EH3 A;  5JEI A;  1B3L A;  1N0T A;  1B0H A;  1LB9 A;  3F11 A;  2G29 A;  3K6V A;  5KDT A;  1Y1Z A;  4G2Z A;  3OD7 A;  2XXP A;  1NNK A;  2R6G E;  1YAE A;  4LAT A;  4LZ5 A;  3I5O A;  3QSL A;  2H9B A;  1IIW A;  5ICT A;  1IXC A;  1LFG A;  3R6U A;  3B6W A;  1JVX A;  4MLQ A;  1S7Y A;  2D5W A;  2ZXT A;  1O7T A;  4QSE A;  1ZKB A;  1HSE A;  5KCJ A;  1SW1 A;  4POW A;  4JDF A;  4GOT A;  4H1X A;  4MLV A;  1N7X A;  4O3A A;  5F7V A;  4ZE8 A;  3B7D A;  4LZ8 A;  3ZKL A;  3K01 A;  3H4Z A;  1B3G A;  3H6T A;  2ZNT A;  4F3B A;  4X48 A;  3LSW A;  2Z23 A;  4ZEI A;  1A99 A;  3PMX A;  3H6V A;  1EZP A;  1P1O A;  4G68 B;  3LR1 A;  5HM4 B;  3UN6 A;  3MW0 A;  3OEK A;  4YMB A;  1NKX A;  1B7U A;  3FXR A;  3JZJ A;  1JEU A;  1MPB A;  1ZIU A;  1JET A;  2YPN A;  3PD8 A;  5L9M A;  1PB8 A;  1B32 A;  2XX7 A;  4QFL A;  4RA1 A;  3H06 B;  4FE8 A;  2P1S A;  4KCD A;  3IOV A;  2XXT A;  3G3I A;  2Q2A A;  3FJG A;  1P99 A;  1OIB A;  3KN8 A;  1TFA A;  3GXA A;  1FTJ A;  3H6W A;  1OQG A;  1Y3N A;  3EHT A;  1MY2 A;  3VVE A;  5ELV A;  3GBA A;  2I49 A;  1MS7 A;  4H6D A;  2F34 A;  3MVZ A;  3VLU A;  4OES A;  1Y1M A;  3BFT A;  3GBB A;  3LBS A;  2HAU A;  2PYY A;  5AA4 B;  1CB6 A;  2P0S A;  2P2A A;  4ISU A;  3FVO A;  3RY3 A;  1MY1 A;  5AE4 A;  4G68 A;  5K2X A;  5I59 B;  1SD3 A;  1MM7 A;  1UTH B;  1DMB A;  3KGC A;  3IO4 A;  2PT2 A;  4ZEF A;  3W9V A;  4U21 A;  3N5L A;  4BLA A;  3FD3 A;  3G3K A;  3PUW E;  3FZV A;  1QUK A;  1NMU A;  1J1N A;  2UXA A;  4GD5 A;  2QMX A;  4R9F A;  3O66 A;  3MC2 A;  1QUJ A;  2X7Q A;  1L5T A;  2VGQ A;  2RCA A;  3MQ9 A;  1QKA A;  3EHU A;  3M8U A;  4QFK A;  4POX A;  4BDR A;  4IY5 A;  4P0G A;  2DP8 A;  1AH5 A;  5AA4 A;  4ESW A;  4F2O A;  3OXN A;  3QUF A;  1N7W A;  2ESN A;  5I59 A;  2DOJ A;  1UTH A;  4QHQ A;  2REJ A;  4HCY A;  2Q89 A;  3PUZ E;  2H5Y A;  2HFB A;  3FAT A;  3K1M A;  3K1N A;  3IB2 A;  3B6T A;  4RK2 A;  4BDM A;  4PE5 B;  2QS4 A;  2W7Y A;  4QFP A;  4U4S A;  3HCQ A;  3TUS A;  4EF1 A;  2DWA A;  4JXI A;  3HN0 A;  3E3K A;  4NTL A;  3N26 A;  4ELO A;  3V5A A;  4XXU A;  1MRP A;  2RF1 A;  3Q29 A;  3VXB A;  4P0I A;  4E0X A;  1XT8 A;  3OEM A;  4F1U A;  5FHM A;  4L17 A;  4NF6 B;  4OMB A;  1M5F A;  1XVY A;  2REG A;  2PVU A;  3FVK A;  4Z7E A;  4LQ2 A;  4PFT A;  2H98 A;  3K2D A;  4KQP A;  1LBB A;  4R72 A;  1YTV A;  1H44 A;  4F2Q A;  1ZTY A;  2D3I A;  5ICQ A;  4NF4 B;  3U8Q A;  3IOR A;  3FVG A;  3LSL A;  1URG A;  3TEP A;  3HPI A;  2ONR A;  5CMM A;  2DE3 A;  4U4X A;  5M2V A;  1CE2 A;  2HXW A;  4BDO A;  4NF6 A;  3C9H A;  3MWB A;  3G3F A;  4LQ5 A;  1FCK A;  4IO4 A;  1B3F A;  5AA3 A;  2IEE A;  2DWJ A;  1LCT A;  1JNF A;  4OER A;  4H0W A;  4KYD A;  4JB7 A;  2O69 A;  5L9S A;  3DM0 A;  1XOC A;  4TQU Q;  3TCF A;  2UVH A;  4NF8 B;  2DS9 A;  4NF4 A;  2X26 A;  1HSJ A;  3KN3 A;  5TU0 A;  3KSJ A;  3VE1 B;  4DZ1 A;  5DYH A;  4KI0 E;  5ISU A;  5H8Q B;  5H8F B;  2I48 A;  2V84 A;  2GH9 A;  2ONS A;  2LAO A;  5CC2 A;  2I6E A;  4LON B;  3ILT B;  1ZLQ A;  5AA1 A;  3OMB A;  3CSG A;  4JBZ A;  2B65 A;  3FVN A;  1MXW A;  4EQ7 A;  4OXV A;  3RN8 A;  3K6W A;  2ABH A;  3QAX A;  3H6U A;  3VLW A;  4XKN A;  3T9X B;  4PET A;  2AYS A;  1B4H A;  2V3T A;  1JW1 A;  1OLA A;  2E0S A;  3TOD A;  4NF8 A;  1FTK A;  3TTK A;  2I0C A;  4X9T A;  3H7M A;  1B3H A;  3PPO A;  3FAS A;  5JK4 A;  2GHA A;  2VHA A;  4TOZ A;  1P1Q A;  4ZEC A;  5H8Q A;  5H8F A;  4FEB A;  1MY0 A;  1A7L A;  4G8M A;  4R9G A;  4OWD A;  3KZG A;  4C1T A;  4R73 A;  3VXC A;  4EF2 A;  4I9D A;  3K00 A;  2QPQ A;  1QW0 A;  2NOO A;  4OYV A;  5I2N B;  4F1V A;  1N3W A;  4M4G A;  2Q88 A;  1JVY A;  2DVZ A;  4MF3 A;  2F7C A;  3PGF A;  1FTM A;  2PX1 A;  4NMY A;  4RY1 A;  2DVC A;  3PUX E;  3HHG A;  4DDD A;  4N6P A;  2Y7R A;  3A3C A;  4FIM A;  2I0B A;  3OO9 A;  4KCC A;  3FXU A;  4OET A;  3FGS A;  1PB7 A;  5H8S A;  3ZKK A;  1GR2 A;  1URD A;  4F18 A;  3U72 A;  1Z7N E;  4PFU A;  1I6B A;  4JSD A;  1LGB C;  1TT1 A;  2DXY A;  1DTZ A;  1M5D A;  4ZZA A;  5CMB A;  4X1D A; 
#chains in the Genus database with same CATH topology
 3MJN A;  5CI5 A;  5A5X B;  1VDW A;  3QMF A;  1FQE A;  1A8E A;  5I2N A;  5LTC A;  3EQ1 A;  1MXY A;  4P11 A;  2FIE A;  1B9J A;  1FPJ A;  2IA4 A;  1A55 A;  4XFE A;  2XXU A;  1POT A;  5B70 A;  1O64 A;  3UK4 A;  1MM6 A;  4GQO A;  1FPE A;  3L6H A;  3IOT A;  1PDA A;  5DW8 A;  1ZMG A;  3CSB A;  4JWX A;  1G0H A;  1UTB B;  1VSO A;  3FUZ A;  1NV6 A;  3IB0 A;  4PDD A;  1OMP A;  1D9Y A;  1SYI A;  2QVR A;  3G3H A;  3K6X A;  3TEL A;  3PPR A;  3CFL A;  1DPE A;  5DEX B;  4JVD A;  1B5H A;  1ZJL A;  1B7Z A;  4NAP A;  4IGT A;  4F39 A;  4IO7 A;  3CVG A;  4DE8 A;  1A54 A;  5I84 A;  2GFE A;  2RC7 A;  1B5I A;  1IZ1 A;  1LAG E;  3OSR A;  3VDF A;  3PPP A;  5A5X A;  2R8T A;  4ELP A;  4YU0 A;  1SW5 A;  3K1P A;  4OFJ A;  4F19 A;  2HHM A;  4R75 A;  1IMF A;  3U1O A;  3IR1 A;  4NF0 A;  2ONK E;  1SPI A;  1DSN A;  3A29 A;  4FOR A;  2QS1 A;  4C1U A;  4GL0 A;  1MPD A;  3HST A;  4YKK A;  3T66 A;  4ND9 A;  4N6D A;  3RLF E;  3CFZ A;  3OOA A;  3OO7 A;  3C34 A;  4N13 A;  1UTB A;  2GQ1 A;  4MNP A;  4HTG A;  4PFY A;  1LFI A;  4BDN A;  3QIM A;  4KPT A;  4KHZ E;  3Q27 A;  4G77 A;  2UYF A;  3IAZ A;  5DEX A;  3TZA A;  3PUY E;  4C0R A;  2A5S A;  1B1X A;  1NL5 A;  1QKB A;  2FNC A;  1Q1K A;  2ALU A;  4P1L A;  5FTH A;  4R2F A;  4U23 A;  3RTW B;  4U1O A;  3ZSF A;  4GWO A;  1H3D A;  2I3V A;  2AIX A;  3MZB A;  3OEN A;  1EYJ A;  1II5 A;  3PUV E;  2O1M A;  4ZEK A;  3O6I A;  5IGA A;  4H65 A;  3T22 A;  3BIH A;  1AMF A;  4O8M A;  3E4R A;  1FTL A;  4IO5 A;  2H4I A;  1ZU0 A;  1UIU A;  3HFU A;  3UA8 A;  1LB8 A;  1ZBM A;  2Y5K A;  3OO8 A;  1WDN A;  2OZZ A;  2VOZ A;  2KLF A;  4OVJ A;  4PP0 A;  1MH3 A;  4NED A;  4H45 A;  1GV8 A;  3D1R A;  4MFI A;  4DLD A;  3KBR A;  2Q9T A;  4ONY A;  2I58 A;  1HSL A;  2DE4 A;  3FV1 A;  5DT6 A;  4R6Y A;  1PB9 A;  1QUI A;  5LOM A;  1EZ9 A;  3RT6 B;  2XWO A;  3IJO B;  3UP9 A;  4FAJ A;  1PC3 A;  1NV5 A;  3IFC A;  3MVW A;  4N91 A;  4OEU A;  5I57 B;  3JV9 A;  5J1D A;  1NNT A;  3K0V A;  4GWY A;  4RYA A;  3P7I A;  4H8J A;  1JP4 A;  1P1W A;  1AL3 A;  3KG2 A;  1WOD A;  3SES A;  1R9L A;  3R7X A;  3T93 B;  5TP9 B;  3VLV A;  3G3J A;  4OAN A;  3PD9 A;  4RXL A;  1LAX A;  3FBP A;  1AWB A;  1DTG A;  3IL1 B;  1YYZ A;  2Y7K A;  4OEV A;  3JYR A;  3T9U A;  3Q25 A;  3RQT A;  1KWH A;  1H45 A;  5DVI A;  2XX9 A;  5BUU A;  3W9W A;  4YKI A;  2HZK A;  1FPI A;  4IO6 A;  4N15 A;  5F24 A;  1H43 A;  2XXI A;  1RYX A;  2XXV A;  2Z8E A;  2FA7 A;  4QSD A;  1PBP A;  4NF5 B;  3TCG A;  1I6A A;  2ANJ A;  3SER A;  4OHN A;  3CG3 A;  5I57 A;  1GGG A;  5I2K B;  1SW4 A;  2CZK A;  4Q0C A;  5EHS A;  1DBZ A;  3H3G A;  2PT1 A;  4GRK A;  2HZL A;  1B58 A;  4IY6 A;  3DP4 A;  3MP8 A;  3VVF A;  2VD3 A;  4QBA A;  3BIG A;  1D4N A;  4QXD A;  5TP9 A;  4HE1 A;  4H5G A;  3VFJ A;  3Q26 A;  2F6G A;  4THI A;  1NNP A;  2NUV A;  4FBP A;  2ZYM A;  1R1N A;  4AS4 A;  1VFD A;  4WXJ A;  2Z8F A;  2BJJ X;  3HO7 A;  4NHB A;  4NE4 A;  1AOV A;  1MQG A;  1IUD A;  1A8F A;  5ITP A;  3TMG A;  1LFH A;  3PMV A;  5EHM A;  4NF5 A;  5H8H B;  1O63 A;  2DWI A;  5I2K A;  4YAH X;  2F6P A;  2F97 A;  2PFZ A;  1FPF A;  2QRY A;  2WKY A;  1FQB A;  2DXR A;  3BKI B;  3UIF A;  1LAH E;  2Y5L A;  4LZ7 A;  3TAJ A;  4YKJ A;  4WED A;  3A09 A;  4XKP A;  1B7H A;  4FAT A;  2B3F A;  1VE4 A;  4O94 A;  3CFX A;  4XTC Q;  2XXR A;  4GXS B;  4NWC A;  3N6T A;  1MXZ A;  1Y3Q A;  2PMS A;  2RKM A;  1ATG A;  4TLL B;  1FQA A;  3CHG A;  4LA9 A;  4KD5 A;  4AS5 A;  3IK6 B;  4PFW A;  5ET5 A;  1LBZ A;  4FJP A;  1H76 A;  3TDJ A;  1BIY A;  3T96 B;  1SBP A;  2NVU B;  1M5B A;  5H8H A;  4P56 A;  2F78 A;  4MH5 A;  5JTY B;  5ET7 A;  1Y9U A;  4OVQ A;  4QFN A;  2YLN A;  4OFL A;  4NWD A;  4DXU A;  1B40 A;  4I3Y A;  3ZS6 A;  1KZ8 A;  1MXX A;  4N8Y A;  1IEJ A;  2O1L A;  4Z0I A;  4AB5 A;  2ZYN A;  5AA2 B;  1MQD A;  3WAF A;  1PEB A;  2XHD A;  4OVP A;  3KC1 A;  1XHY A;  5FTI A;  3D4C A;  3EHS A;  2QJE A;  4DI4 B;  4F29 A;  2QL3 A;  3U65 A;  3TKD A;  2ZYK A;  2QFL A;  4ELQ A;  2XXY A;  3EKI A;  2O51 A;  4EDP A;  1WVJ A;  4YZZ A;  4GXA A;  1A40 A;  4DCY A;  2B4M A;  1FBC A;  2HCA A;  1D3K A;  4U22 A;  1DCU A;  3FV2 A;  3KSX A;  2F3D A;  4MIJ A;  2DSF A;  5JTY A;  2XXH A;  1B6H A;  4N8G A;  4BDQ A;  5CMC A;  3CI8 A;  2VD2 A;  2F7B A;  3IO6 A;  5LDZ A;  3G7W A;  3VVD A;  3SEX A;  5AA2 A;  2CZI A;  5FHN A;  3B8B A;  4OTE A;  1UQW A;  3O6G A;  1OQH A;  1MQH A;  2RC8 A;  1BKA A;  4ZDM A;  1MPC A;  4OQO A;  4GL8 A;  4MEV A;  2THI A;  4JSO A;  1POY 1;  2OCU A;  3O97 A;  4UA8 A;  1NFT A;  3IOW A;  3O9P A;  4JVI A;  3S2V A;  4G8H A;  4HW8 A;  3MPK A;  1NV0 A;  3PPN A;  4H46 A;  1NV2 A;  3I6V A;  3DP8 A;  3SKP A;  2V25 A;  1MDP 1;  3GLB A;  4YB7 A;  4G4P A;  1B05 A;  2Q74 A;  2Z8D A;  4QF9 A;  2HQ0 A;  1P1N A;  4HS7 A;  4TLM B;  2DYX A;  4OZ9 A;  5CM6 A;  4I62 A;  1TWY A;  4GF8 A;  2XWK A;  3LC8 A;  4LVQ A;  2GHB A;  4KFQ A;  5EQ9 A;  3B50 A;  1B3E A;  1SDX A;  4X1B A;  3O29 A;  3IFA A;  2G93 A;  3IX1 A;  1LST A;  3T9V A;  3CRB A;  4ZEB A;  1I6Q A;  4O3B A;  2UVG A;  3IJX B;  4G68 C;  1B2H A;  3M3F A;  4EXK A;  5EQ8 A;  1BTJ A;  3IOU A;  4GWZ A;  2QS3 A;  3ILU B;  2OBG A;  5HBC A;  3E78 A;  3RNN A;  1FW0 A;  4PGP A;  3KEI A;  1DK4 A;  2O6A A;  5DTB A;  1VR5 A;  1XVX A;  3V8X B;  3QK6 A;  4R2B A;  5ITO A;  3K4U A;  2FYI A;  3C4M A;  1SVX B;  4DI3 D;  2HPG A;  4X04 A;  4JWO A;  3I3V A;  4PQJ A;  3TTR A;  2XXX A;  1LCF A;  4KYE A;  3QYT A;  4OVT A;  4GLI A;  4ESX A;  1FRP A;  1US5 A;  1DOT A;  1NNF A;  4MMP A;  4KR5 A;  1AIV A;  5H8N B;  4AQ4 A;  4GVO A;  4JWY A;  2ZYO A;  5EQA A;  1IIT A;  3MST A;  3ODB A;  1MXU A;  1QVS A;  2H25 A;  4U2R A;  2F35 A;  2R9J A;  3CR9 A;  3Q28 A;  4FED A;  2XA5 A;  3DP6 A;  5KZT A;  1S9T A;  1FQD A;  1EU8 A;  2QSX A;  2XD2 A;  1CNQ A;  1USY H;  3KOT A;  4NG7 A;  3M3K A;  3S4U A;  1SI0 A;  1YXI A;  3SEU A;  4RK9 A;  4RPO A;  3G3G A;  1LBV A;  4PFI A;  4F3G A;  2ZNU A;  4WKM A;  5EQ7 A;  2OWS A;  3USD A;  1IME A;  3IB1 A;  4EQB A;  3FIR A;  1NH8 A;  4R6K A;  5IKB A;  4HXV A;  3PMW A;  2Y84 A;  4PBH A;  1IMC A;  2PBW A;  4JVC A;  2DWH A;  2ZMB A;  3PU5 A;  3OEL A;  3QUJ A;  1EYI A;  1MH4 A;  1MQI A;  4FEC A;  2V3Q A;  5H8N A;  5DVJ A;  1FBH A;  4PF6 A;  2GRV A;  1D9V A;  4YMA A;  1MY4 A;  2Y7I A;  3S9M C;  1IMA A;  1LBY A;  1IMD A;  1NUW A;  1B0L A;  3C33 A;  4F3S A;  2Q8M A;  3E9X A;  2Z22 A;  3HV1 A;  1IMB A;  1KA1 A;  3SET A;  3TCH A;  4EUO A;  3KOS A;  3KBZ A;  3QXM A;  2DE2 A;  3E13 X;  4MNI A;  3KJT A;  3CG1 A;  1SW2 A;  3LSX A;  1BLF A;  3R26 A;  2F36 A;  4OEN A;  4PAK A;  1JQF A;  3TTM A;  2QMW A;  1I69 A;  3RYD A;  3C32 A;  2V4C A;  1XI6 A;  1JW5 A;  1RDZ A;  3LUY A;  5ET8 A;  4WEP A;  4GWW A;  5EYF A;  1B1H A;  1XC1 A;  4ZE9 A;  1FQF A;  3K6U A;  3S9L C;  4H5F A;  3H03 A;  3AXF A;  3GZG A;  4NQ8 A;  1NV3 A;  3RUM A;  3SEV A;  2OWZ A;  4DCX A;  4F22 A;  4RPN A;  3KN7 A;  1MDQ A;  3SZP A;  5TPA B;  4N07 A;  4OVR A;  5IZZ A;  2A5T B;  3U92 A;  2HEU A;  4DXB A;  3ONM A;  1OVT A;  4YB5 A;  5K2Y A;  1Y3P A;  2F7A A;  3B6Q A;  2H99 A;  5FBP A;  3EF7 A;  1NH7 A;  4ECF A;  1GVC A;  3O2A A;  2UVJ A;  1B5J A;  4XF5 A;  4IO3 A;  3ECR A;  2Y7P A;  3S9N C;  3TTN A;  3C35 A;  4O3C A;  3SEY A;  1FQC A;  3E79 A;  4HE2 A;  2F8D A;  4HE0 A;  1JW4 A;  2B3B A;  3L6G A;  3FJM A;  3MZ9 A;  4XKR A;  5FHO A;  2VT5 A;  4Q5T A;  4G8N A;  1OVB A;  3WAE A;  4M1V A;  2F5X A;  3MAM A;  4RNS A;  4PTK A;  4ZED A;  2HAV A;  5TPA A;  4OFO A;  1FPL A;  2I3W A;  3LV0 A;  2A5T A;  5I56 B;  1GTK A;  1ANF A;  3PV0 E;  2QVU A;  3EPE A;  2XX8 A;  1TXF A;  3TFL A;  1R9Q A;  3LSF B;  5CBS A;  1Y4C A;  3UGW A;  1B51 A;  1N3X A;  1FBG A;  1YPN A;  2O84 X;  2OWT A;  2E1S A;  3N94 A;  2CMO A;  1LEV A;  4E0W A;  4BDL A;  3FXQ A;  2AL4 A;  3T9H B;  2R71 A;  4PDH A;  3KC0 A;  1QJM A;  1N84 A;  1TFD A;  2VP1 A;  3OO6 A;  1R6Z A;  3LUZ A;  4YKP A;  1RKM A;  1T0K A;  2DQV A;  4QSC A;  5DVF A;  2OJT A;  4I1D A;  4N6K A;  5IAI A;  4F1Y A;  3T0J A;  1Z7M E;  1B4Z A;  3M3L A;  1SQY A;  5I56 A;  4YB6 A;  1OLC A;  5HPQ A;  4U1Z A;  4P1E A;  1NUZ A;  3DLN A;  4ELR A;  1FBF A;  4Q8R A;  4GFR A;  1Y20 A;  4K3F A;  5BWJ A;  1B46 A;  2UYE A;  3A3U A;  1K9Y A;  4R6H A;  2UVI A;  3N6U A;  1NV4 A;  3MBP A;  3DEL B;  1FPB A;  5IM2 A;  2O68 A;  2MKZ A;  4R74 A;  5L8D A;  5I58 B;  3PTY A;  3TTL A;  3MUQ A;  3OSQ A;  5CMK A;  1LAF E;  4LP2 B;  4MJO A;  1US4 A;  4GWX A;  4F3P A;  4ZZE A;  3UOR A;  1N76 A;  1UIV A;  1Q9D A;  1MXV A;  3MVX A;  4DIG A;  3D4G A;  1FTO A;  5B7D A;  2NXO A;  2F3B A;  1IXG A;  4IO2 A;  3SDF A;  2NWJ A;  3MZ1 A;  4F31 B;  1N04 A;  4RJZ A;  3VV5 A;  5L9O A;  3KFM A;  4IGR A;  4QFO A;  3V89 B;  4MNC A;  4H67 A;  3O6H A;  3RTF B;  1PBQ A;  1EZO A;  1YCJ A;  3TYH A;  5CRY A;  2YJP A;  1VFE A;  4IR8 A;  3MP1 A;  5I58 A;  4EQ9 A;  3EN3 A;  1LBC A;  1MG1 A;  5AA2 D;  2OK2 A;  4QRZ A;  1LBW A;  3RT8 A;  1LLS A;  3CIJ A;  1S50 A;  3NOH A;  4GX4 A;  3MYU A;  2CZH A;  3FJ7 A;  3V83 A;  2RC9 A;  3PPQ A;  3KJ7 A;  1IXI A;  3BBR A;  5I7I A;  1NUY A;  2XD3 A;  5ET6 A;  3RGY A;  3C36 A;  5F1Q A;  4EXL A;  2QS2 A;  4MBP A;  4NGU A;  3U94 A;  1SYH A;  1B52 A;  1F9B A;  1M5C A;  1FBE A;  2V93 A;  3T1B A;  3MPL A;  4MCO A;  1BP5 A;  4XKQ A;  3K02 A;  3MVY A;  4ZS9 A;  4UAC A;  1M5E A;  2ZNS A;  2Q8J A;  1RYO A;  2RIN A;  3U93 A;  4P8B A;  2XXW A;  1P1U A;  3C31 A;  1USY E;  1JEV A;  1Q35 A;  4GIZ A;  4PAF A;  4XIG Q;  3W15 C;  2Y7W A;  2FHY A;  3THI A;  4IB2 A;  2V3U A;  1D9Q A;  1XS5 A;  2OLB A;  5KDT B;  4YIC A;  1QUL A;  2HXR A;  3O28 A;  5CBR A;  3TQW A;  3HHF A;  2RCB A;  2O7U A;  3MP6 A;  1IQ7 A;  5IZ3 B;  1ELJ A;  4HCW A;  3RPW A;  1SI1 A;  3SEW A;  4I8C A;  4KYS A;  4AB6 A;  2CZL A;  2I4C A;  2WYK A;  1MY3 A;  2I4B A;  1MQJ A;  2X7P A;  3S9E A;  1IXH A;  1DPP A;  2O7I A;  4LUB A;  4Q30 B;  4DXC A;  1NV7 A;  1URS A;  1NI9 A;  2AL5 A;  2M8C A;  2XWI A;  3TPA A;  5KCJ B;  3BFU A;  2Q2C A;  2XXQ A;  3TQL A;  4H8I A;  2D21 A;  1Y4T A;  1EH3 A;  5JEI A;  1B3L A;  1N0T A;  1B0H A;  1EYK A;  1LB9 A;  3F11 A;  2G29 A;  3K6V A;  5KDT A;  5A5L A;  1Y1Z A;  4G2Z A;  3OD7 A;  2XXP A;  1NNK A;  2R6G E;  1YAE A;  5IZ3 A;  4LAT A;  4LZ5 A;  1NV1 A;  3I5O A;  3QSL A;  2H9B A;  1IIW A;  5ICT A;  1IXC A;  1LFG A;  3R6U A;  3B6W A;  2FBP A;  1JVX A;  4MLQ A;  4NX1 A;  3ROJ A;  3FXB A;  1S7Y A;  2D5W A;  1FPD A;  2ZXT A;  1O7T A;  1FTA A;  4OA4 A;  4QSE A;  1ZKB A;  2ZZW A;  1HSE A;  5KCJ A;  1SW1 A;  4POW A;  4JDF A;  4GOT A;  2FIX A;  4H1X A;  4MLV A;  1N7X A;  4O3A A;  1QGX A;  5F7V A;  1K9Z A;  4ZE8 A;  3B7D A;  4LZ8 A;  3ZKL A;  4P9K A;  3K01 A;  3H4Z A;  4OVS A;  3RPL B;  1B3G A;  3H6T A;  2ZNT A;  4F3B A;  4PE3 A;  4X48 A;  3LSW A;  2Z23 A;  4ZEI A;  1A99 A;  3PMX A;  1INP A;  3H6V A;  1EZP A;  1P1O A;  4G68 B;  3LR1 A;  5HM4 B;  3UN6 A;  3MW0 A;  3OEK A;  4YMB A;  1NKX A;  1B7U A;  3FXR A;  3JZJ A;  1JEU A;  1MPB A;  1ZIU A;  1JET A;  2YPN A;  3PD8 A;  5L9M A;  1PB8 A;  1B32 A;  2XX7 A;  4QFL A;  4RA1 A;  3H06 B;  4FE8 A;  2P1S A;  4KCD A;  3IOV A;  2XXT A;  3G3I A;  2ZZX A;  2Q2A A;  3FJG A;  1P99 A;  4XEQ A;  1OIB A;  3KN8 A;  1TFA A;  4MX6 A;  3GXA A;  1FTJ A;  3H6W A;  1OQG A;  1Y3N A;  3EHT A;  2ZZV A;  1MY2 A;  3VVE A;  2VPN A;  1FSA A;  2CEX A;  5ELV A;  3GBA A;  2I49 A;  1MS7 A;  4H6D A;  2F34 A;  3MVZ A;  3VLU A;  4OES A;  1Y1M A;  3RPL A;  3BFT A;  3GBB A;  3LBS A;  2HAU A;  2PYY A;  5AA4 B;  1CB6 A;  2P0S A;  2P2A A;  4ISU A;  3FVO A;  3RY3 A;  1LBX A;  1MY1 A;  5AE4 A;  4G68 A;  5K2X A;  5I59 B;  1SD3 A;  1MM7 A;  1UTH B;  1DMB A;  3KGC A;  3IO4 A;  2PT2 A;  4ZEF A;  3W9V A;  4U21 A;  3N5L A;  4BLA A;  2P3V A;  3FD3 A;  3G3K A;  1KA0 A;  3PUW E;  3FZV A;  5EYG A;  1QUK A;  1NMU A;  1J1N A;  4X8R A;  2PFY A;  2UXA A;  4GD5 A;  4PAI A;  2DDK A;  2QMX A;  2VPO A;  4R9F A;  3O66 A;  3MC2 A;  1QUJ A;  2X7Q A;  4GWS A;  1L5T A;  2VGQ A;  4MHF A;  2RCA A;  3MQ9 A;  1QKA A;  3EHU A;  3M8U A;  4QFK A;  4POX A;  4BDR A;  2KQZ A;  4IY5 A;  4P0G A;  2DP8 A;  1AH5 A;  5AA4 A;  2XXK A;  4ESW A;  4F2O A;  3OXN A;  1NUX A;  2OX3 A;  3QUF A;  1N7W A;  2ESN A;  5I59 A;  2DOJ A;  4LN5 A;  1UTH A;  4QHQ A;  2REJ A;  4HCY A;  2Q89 A;  3PUZ E;  2H5Y A;  2HFB A;  3FAT A;  2PCR A;  3K1M A;  1FBD A;  3K1N A;  3IB2 A;  3B6T A;  4RK2 A;  4BDM A;  4PE5 B;  2QS4 A;  2KR0 A;  2W7Y A;  4QFP A;  4U4S A;  4I40 A;  3HCQ A;  3TUS A;  4EF1 A;  2B4L A;  2DWA A;  5T3J A;  4JXI A;  3HN0 A;  3E3K A;  4NTL A;  3N26 A;  4ELO A;  4PF8 A;  3V5A A;  4XXU A;  1MRP A;  2RF1 A;  3Q29 A;  3VXB A;  4P0I A;  4E0X A;  1XT8 A;  3OEM A;  4F1U A;  1BK4 A;  5FHM A;  4L17 A;  4NF6 B;  4OMB A;  4N81 A;  1M5F A;  1XVY A;  2REG A;  2PVU A;  3FVK A;  4Z7E A;  4GWU A;  4LQ2 A;  4PFT A;  2H98 A;  3K2D A;  4KQP A;  1LBB A;  4R72 A;  1YTV A;  1H44 A;  4F2Q A;  1ZTY A;  2D3I A;  5ICQ A;  4GX3 A;  4NF4 B;  4GX6 A;  3U8Q A;  4N17 A;  3IOR A;  4P47 A;  3FVG A;  1YZ0 A;  3LSL A;  1URG A;  3TEP A;  3HPI A;  2ONR A;  5CMM A;  2DE3 A;  4U4X A;  4I3E A;  5M2V A;  2WBB A;  1G0I A;  4O7M A;  1CE2 A;  2HXW A;  4BDO A;  4NF6 A;  3C9H A;  3MWB A;  2XWV A;  3G3F A;  4LQ5 A;  1FCK A;  4NN3 A;  4IO4 A;  4KXP A;  1B3F A;  5AA3 A;  2JJK A;  2IEE A;  4N4U A;  2DWJ A;  1LCT A;  5IZ1 A;  2WYP A;  1JNF A;  4OER A;  4H0W A;  4KYD A;  4JB7 A;  4PBQ A;  1RDX A;  2O69 A;  5L9S A;  5J16 A;  3DM0 A;  1XOC A;  4TQU Q;  3TCF A;  2UVH A;  4NF8 B;  4O7I A;  2DS9 A;  4NF4 A;  2X26 A;  1HSJ A;  3KN3 A;  5TU0 A;  3KSJ A;  3VE1 B;  4DZ1 A;  5DYH A;  4KI0 E;  5ISU A;  5H8Q B;  5H8F B;  2I48 A;  2V84 A;  2GH9 A;  2ONS A;  2LAO A;  5CC2 A;  2I6E A;  4LON B;  1RDY A;  4UAB A;  3ILT B;  1ZLQ A;  1FBP A;  4P3L A;  5AA1 A;  3OMB A;  3CSG A;  4JBZ A;  2B65 A;  3FVN A;  1MXW A;  4EQ7 A;  4OXV A;  3RN8 A;  3K6W A;  2ABH A;  3QAX A;  4PCD A;  2CEY A;  3H6U A;  3VLW A;  4PGN A;  4XKN A;  2QVV A;  3T9X B;  4PET A;  2AYS A;  1B4H A;  2V3T A;  1JW1 A;  1OLA A;  2E0S A;  3TOD A;  4NF8 A;  2WX9 A;  1FTK A;  3TTK A;  2I0C A;  4X9T A;  3H7M A;  1B3H A;  5ESY A;  3PPO A;  3FAS A;  4GBW A;  5JK4 A;  2BJI A;  2GHA A;  2VHA A;  4TOZ A;  1P1Q A;  4ZEC A;  5H8Q A;  5H8F A;  4FEB A;  3ISP A;  1MY0 A;  3GYY A;  1A7L A;  4G8M A;  4R9G A;  1FPG A;  4OWD A;  3KZG A;  4C1T A;  5I3S A;  4R73 A;  3VXC A;  4EF2 A;  4I9D A;  1FJ9 A;  3K00 A;  2QPQ A;  1QW0 A;  2NOO A;  4OYV A;  2P3N A;  5I2N B;  4F1V A;  1N3W A;  4M4G A;  2Q88 A;  1FPK A;  1JVY A;  2DVZ A;  4MF3 A;  2F7C A;  3PGF A;  1FTM A;  2PX1 A;  4G61 A;  4NMY A;  4RY1 A;  2DVC A;  3PUX E;  2FVZ A;  4PC9 A;  3HHG A;  4DDD A;  4N6P A;  2Y7R A;  3A3C A;  2WEF A;  4FIM A;  4GBV A;  2I0B A;  3OO9 A;  4KCC A;  4MAG A;  3FXU A;  4OET A;  3FGS A;  1PB7 A;  1FJ6 A;  5H8S A;  3ZKK A;  1GR2 A;  1URD A;  5EYH A;  2WBD A;  4F18 A;  5I5P A;  4PFU A;  1Z7N E;  3U72 A;  1I6B A;  4JSD A;  4PFR A;  4PFB A;  1LGB C;  2L5V A;  1TT1 A;  2DXY A;  1DTZ A;  1M5D A;  4ZZA A;  5CMB A;  4X1D A; 
#chains in the Genus database with same CATH homology
 3MJN A;  5CI5 A;  5A5X B;  1FQE A;  1A8E A;  5I2N A;  3EQ1 A;  1MXY A;  4P11 A;  1B9J A;  2IA4 A;  1A55 A;  2XXU A;  1POT A;  5B70 A;  1O64 A;  3UK4 A;  1MM6 A;  4GQO A;  3L6H A;  3IOT A;  1PDA A;  1ZMG A;  3CSB A;  4JWX A;  1UTB B;  1VSO A;  3FUZ A;  3IB0 A;  1OMP A;  1D9Y A;  1SYI A;  3G3H A;  3K6X A;  3TEL A;  3PPR A;  3CFL A;  1DPE A;  5DEX B;  1B5H A;  1ZJL A;  1B7Z A;  4IGT A;  4F39 A;  4IO7 A;  3CVG A;  4DE8 A;  1A54 A;  5I84 A;  2GFE A;  2RC7 A;  1B5I A;  1IZ1 A;  1LAG E;  3OSR A;  3VDF A;  3PPP A;  5A5X A;  4ELP A;  4YU0 A;  1SW5 A;  3K1P A;  4OFJ A;  4F19 A;  4R75 A;  3U1O A;  3IR1 A;  2ONK E;  1DSN A;  4FOR A;  2QS1 A;  4C1U A;  4GL0 A;  1MPD A;  3HST A;  4YKK A;  3T66 A;  4ND9 A;  3RLF E;  3CFZ A;  3OOA A;  3OO7 A;  3C34 A;  4N13 A;  1UTB A;  4HTG A;  4PFY A;  1LFI A;  4BDN A;  3QIM A;  4KPT A;  4KHZ E;  3Q27 A;  4G77 A;  2UYF A;  3IAZ A;  5DEX A;  3TZA A;  3PUY E;  4C0R A;  2A5S A;  1B1X A;  1NL5 A;  1QKB A;  2FNC A;  1Q1K A;  2ALU A;  5FTH A;  4R2F A;  4U23 A;  3RTW B;  4U1O A;  3ZSF A;  4GWO A;  1H3D A;  2I3V A;  2AIX A;  3MZB A;  3OEN A;  1II5 A;  3PUV E;  2O1M A;  4ZEK A;  3O6I A;  4H65 A;  3T22 A;  1AMF A;  3E4R A;  1FTL A;  4IO5 A;  2H4I A;  1ZU0 A;  1UIU A;  3UA8 A;  1LB8 A;  1ZBM A;  3OO8 A;  1WDN A;  2OZZ A;  2VOZ A;  2KLF A;  4OVJ A;  4PP0 A;  1MH3 A;  4NED A;  1GV8 A;  4MFI A;  4DLD A;  3KBR A;  2Q9T A;  4ONY A;  2I58 A;  1HSL A;  2DE4 A;  3FV1 A;  5DT6 A;  4R6Y A;  1PB9 A;  1QUI A;  5LOM A;  1EZ9 A;  3RT6 B;  3UP9 A;  3IJO B;  4FAJ A;  1PC3 A;  3MVW A;  4OEU A;  5I57 B;  3JV9 A;  5J1D A;  1NNT A;  3K0V A;  4RYA A;  3P7I A;  4H8J A;  1P1W A;  1AL3 A;  3KG2 A;  1WOD A;  3SES A;  1R9L A;  3R7X A;  3T93 B;  5TP9 B;  3VLV A;  3G3J A;  3PD9 A;  4RXL A;  1LAX A;  1DTG A;  3IL1 B;  2Y7K A;  4OEV A;  3JYR A;  3T9U A;  3Q25 A;  3RQT A;  1KWH A;  1H45 A;  5DVI A;  2XX9 A;  5BUU A;  3W9W A;  4YKI A;  2HZK A;  4IO6 A;  1H43 A;  2XXI A;  1RYX A;  2XXV A;  2Z8E A;  2FA7 A;  4QSD A;  1PBP A;  4NF5 B;  3TCG A;  1I6A A;  2ANJ A;  3SER A;  4OHN A;  3CG3 A;  5I57 A;  1GGG A;  5I2K B;  1SW4 A;  4Q0C A;  5EHS A;  3H3G A;  2PT1 A;  4GRK A;  2HZL A;  1B58 A;  4IY6 A;  3DP4 A;  3MP8 A;  3VVF A;  2VD3 A;  1D4N A;  5TP9 A;  4H5G A;  3VFJ A;  3Q26 A;  2F6G A;  4THI A;  1NNP A;  2NUV A;  2ZYM A;  1R1N A;  1VFD A;  4WXJ A;  2Z8F A;  2BJJ X;  3HO7 A;  4NE4 A;  1AOV A;  1MQG A;  1IUD A;  1A8F A;  5ITP A;  3TMG A;  1LFH A;  3PMV A;  5EHM A;  4NF5 A;  5H8H B;  1O63 A;  2DWI A;  5I2K A;  4YAH X;  2F6P A;  2F97 A;  2QRY A;  2WKY A;  1FQB A;  2DXR A;  3BKI B;  3UIF A;  1LAH E;  4LZ7 A;  3TAJ A;  4YKJ A;  4WED A;  3A09 A;  4XKP A;  4FAT A;  1B7H A;  2B3F A;  1VE4 A;  3CFX A;  4XTC Q;  2XXR A;  4GXS B;  4NWC A;  3N6T A;  1MXZ A;  1Y3Q A;  2PMS A;  2RKM A;  1ATG A;  4TLL B;  1FQA A;  4LA9 A;  4KD5 A;  3IK6 B;  4PFW A;  4FJP A;  1H76 A;  3TDJ A;  1BIY A;  3T96 B;  1SBP A;  2NVU B;  1M5B A;  5H8H A;  2F78 A;  4MH5 A;  5JTY B;  1Y9U A;  4QFN A;  2YLN A;  4OFL A;  4NWD A;  4DXU A;  1B40 A;  3ZS6 A;  1MXX A;  1IEJ A;  2O1L A;  4Z0I A;  4AB5 A;  2ZYN A;  5AA2 B;  1MQD A;  3WAF A;  1PEB A;  2XHD A;  1XHY A;  5FTI A;  3D4C A;  3EHS A;  2QJE A;  4F29 A;  2QL3 A;  3TKD A;  2ZYK A;  4ELQ A;  2XXY A;  2O51 A;  4EDP A;  1WVJ A;  4YZZ A;  4GXA A;  1A40 A;  4DCY A;  2HCA A;  1D3K A;  4U22 A;  3FV2 A;  3KSX A;  2DSF A;  5JTY A;  2XXH A;  1B6H A;  4BDQ A;  5CMC A;  3CI8 A;  2VD2 A;  2F7B A;  3IO6 A;  3G7W A;  3VVD A;  3SEX A;  5AA2 A;  5FHN A;  4OTE A;  1UQW A;  3O6G A;  1OQH A;  1MQH A;  2RC8 A;  1BKA A;  4ZDM A;  1MPC A;  4OQO A;  4GL8 A;  2THI A;  4JSO A;  1POY 1;  2OCU A;  3O97 A;  4UA8 A;  1NFT A;  3IOW A;  3O9P A;  3S2V A;  4G8H A;  4HW8 A;  3MPK A;  3PPN A;  3I6V A;  3DP8 A;  3SKP A;  2V25 A;  1MDP 1;  3GLB A;  4YB7 A;  4G4P A;  1B05 A;  2Z8D A;  4QF9 A;  2HQ0 A;  1P1N A;  4HS7 A;  4TLM B;  2DYX A;  4OZ9 A;  5CM6 A;  4I62 A;  1TWY A;  4GF8 A;  3LC8 A;  4LVQ A;  2GHB A;  4KFQ A;  1B3E A;  1SDX A;  4X1B A;  3O29 A;  2G93 A;  3IX1 A;  1LST A;  3T9V A;  3CRB A;  4ZEB A;  1I6Q A;  4O3B A;  2UVG A;  3IJX B;  4G68 C;  1B2H A;  3M3F A;  4EXK A;  1BTJ A;  3IOU A;  2QS3 A;  3ILU B;  2OBG A;  5HBC A;  3RNN A;  1FW0 A;  3KEI A;  2O6A A;  5DTB A;  1VR5 A;  1XVX A;  3V8X B;  3QK6 A;  4R2B A;  5ITO A;  3K4U A;  2FYI A;  3C4M A;  1SVX B;  4JWO A;  3I3V A;  4PQJ A;  3TTR A;  2XXX A;  1LCF A;  4KYE A;  3QYT A;  4GLI A;  4ESX A;  1US5 A;  1DOT A;  1NNF A;  1AIV A;  4KR5 A;  5H8N B;  4AQ4 A;  4GVO A;  4JWY A;  2ZYO A;  1IIT A;  3ODB A;  1MXU A;  1QVS A;  2H25 A;  4U2R A;  2F35 A;  2R9J A;  3CR9 A;  3Q28 A;  4FED A;  3DP6 A;  5KZT A;  1S9T A;  1FQD A;  1EU8 A;  2QSX A;  2XD2 A;  3KOT A;  1USY H;  3M3K A;  3S4U A;  1SI0 A;  3SEU A;  4RK9 A;  4RPO A;  3G3G A;  4F3G A;  2ZNU A;  4WKM A;  2OWS A;  3USD A;  3IB1 A;  4EQB A;  3FIR A;  1NH8 A;  4R6K A;  5IKB A;  3PMW A;  2Y84 A;  2PBW A;  2DWH A;  2ZMB A;  3PU5 A;  3OEL A;  3QUJ A;  1MH4 A;  1MQI A;  4FEC A;  2V3Q A;  5H8N A;  5DVJ A;  2GRV A;  1D9V A;  4YMA A;  1MY4 A;  2Y7I A;  3S9M C;  1B0L A;  3C33 A;  4F3S A;  3E9X A;  2Z22 A;  3HV1 A;  3SET A;  3TCH A;  4EUO A;  3KOS A;  3QXM A;  2DE2 A;  3E13 X;  3KJT A;  3CG1 A;  1SW2 A;  3LSX A;  1BLF A;  3R26 A;  2F36 A;  4OEN A;  1JQF A;  3TTM A;  2QMW A;  1I69 A;  3C32 A;  1JW5 A;  3LUY A;  4WEP A;  5EYF A;  1B1H A;  1XC1 A;  4ZE9 A;  1FQF A;  3K6U A;  3S9L C;  4H5F A;  3H03 A;  3AXF A;  3GZG A;  3RUM A;  3SEV A;  4DCX A;  4F22 A;  4RPN A;  3KN7 A;  1MDQ A;  5TPA B;  4N07 A;  2A5T B;  3U92 A;  2HEU A;  4DXB A;  3ONM A;  1OVT A;  4YB5 A;  5K2Y A;  1Y3P A;  2F7A A;  3B6Q A;  2H99 A;  3EF7 A;  1NH7 A;  4ECF A;  1GVC A;  3O2A A;  2UVJ A;  1B5J A;  4IO3 A;  3ECR A;  2Y7P A;  3S9N C;  3TTN A;  3C35 A;  4O3C A;  3SEY A;  1FQC A;  2F8D A;  1JW4 A;  2B3B A;  3L6G A;  3FJM A;  3MZ9 A;  4XKR A;  5FHO A;  4Q5T A;  4G8N A;  1OVB A;  3WAE A;  4M1V A;  2F5X A;  3MAM A;  4RNS A;  4ZED A;  2HAV A;  5TPA A;  4OFO A;  2I3W A;  2A5T A;  5I56 B;  1GTK A;  1ANF A;  3PV0 E;  3EPE A;  2XX8 A;  1TXF A;  3TFL A;  1R9Q A;  3LSF B;  5CBS A;  1Y4C A;  3UGW A;  1B51 A;  1N3X A;  1YPN A;  2O84 X;  2OWT A;  2E1S A;  3N94 A;  2CMO A;  4E0W A;  4BDL A;  3FXQ A;  2AL4 A;  3T9H B;  2R71 A;  1QJM A;  1N84 A;  1TFD A;  2VP1 A;  3OO6 A;  1R6Z A;  4YKP A;  1RKM A;  1T0K A;  2DQV A;  4QSC A;  5DVF A;  2OJT A;  4I1D A;  5IAI A;  4F1Y A;  1Z7M E;  1B4Z A;  3M3L A;  1SQY A;  5I56 A;  4YB6 A;  1OLC A;  5HPQ A;  4U1Z A;  3DLN A;  4ELR A;  4Q8R A;  4GFR A;  1Y20 A;  4K3F A;  5BWJ A;  1B46 A;  2UYE A;  3A3U A;  4R6H A;  2UVI A;  3N6U A;  3MBP A;  3DEL B;  2O68 A;  4R74 A;  5L8D A;  5I58 B;  3TTL A;  3MUQ A;  3OSQ A;  5CMK A;  1LAF E;  4LP2 B;  1US4 A;  4F3P A;  4ZZE A;  3UOR A;  1N76 A;  1UIV A;  1MXV A;  3MVX A;  4DIG A;  3D4G A;  1FTO A;  5B7D A;  2NXO A;  1IXG A;  4IO2 A;  3SDF A;  2NWJ A;  3MZ1 A;  4F31 B;  1N04 A;  4RJZ A;  3VV5 A;  5L9O A;  3KFM A;  4IGR A;  4QFO A;  3V89 B;  4H67 A;  3O6H A;  3RTF B;  1PBQ A;  1EZO A;  1YCJ A;  3TYH A;  5CRY A;  2YJP A;  1VFE A;  3MP1 A;  5I58 A;  4EQ9 A;  3EN3 A;  1LBC A;  1MG1 A;  5AA2 D;  2OK2 A;  4QRZ A;  3RT8 A;  1LLS A;  3CIJ A;  1S50 A;  3FJ7 A;  3V83 A;  2RC9 A;  3PPQ A;  3KJ7 A;  1IXI A;  3BBR A;  2XD3 A;  3RGY A;  3C36 A;  5F1Q A;  4EXL A;  2QS2 A;  4MBP A;  3U94 A;  1SYH A;  1B52 A;  1F9B A;  1M5C A;  2V93 A;  3MPL A;  1BP5 A;  4XKQ A;  3K02 A;  3MVY A;  4ZS9 A;  4UAC A;  1M5E A;  2ZNS A;  2Q8J A;  1RYO A;  2RIN A;  3U93 A;  2XXW A;  1P1U A;  3C31 A;  1USY E;  1JEV A;  1Q35 A;  4GIZ A;  4XIG Q;  3W15 C;  2Y7W A;  3THI A;  4IB2 A;  2V3U A;  1XS5 A;  2OLB A;  5KDT B;  4YIC A;  1QUL A;  5CBR A;  3O28 A;  3TQW A;  3HHF A;  2RCB A;  2O7U A;  3MP6 A;  1IQ7 A;  1ELJ A;  4HCW A;  3RPW A;  1SI1 A;  3SEW A;  4I8C A;  4KYS A;  4AB6 A;  2CZL A;  2I4C A;  1MY3 A;  2I4B A;  1MQJ A;  2X7P A;  3S9E A;  1IXH A;  1DPP A;  2O7I A;  4LUB A;  4Q30 B;  4DXC A;  1URS A;  2AL5 A;  2M8C A;  3TPA A;  5KCJ B;  3BFU A;  2Q2C A;  2XXQ A;  3TQL A;  4H8I A;  2D21 A;  1Y4T A;  1EH3 A;  5JEI A;  1B3L A;  1N0T A;  1B0H A;  1LB9 A;  3F11 A;  2G29 A;  3K6V A;  5KDT A;  1Y1Z A;  4G2Z A;  3OD7 A;  2XXP A;  1NNK A;  2R6G E;  1YAE A;  4LAT A;  4LZ5 A;  3I5O A;  3QSL A;  2H9B A;  1IIW A;  5ICT A;  1IXC A;  1LFG A;  3R6U A;  3B6W A;  1JVX A;  4MLQ A;  1S7Y A;  2D5W A;  2ZXT A;  1O7T A;  4QSE A;  1ZKB A;  1HSE A;  5KCJ A;  1SW1 A;  4POW A;  4JDF A;  4GOT A;  4H1X A;  4MLV A;  1N7X A;  4O3A A;  5F7V A;  4ZE8 A;  3B7D A;  4LZ8 A;  3ZKL A;  3K01 A;  3H4Z A;  1B3G A;  3H6T A;  2ZNT A;  4F3B A;  4X48 A;  3LSW A;  2Z23 A;  4ZEI A;  1A99 A;  3PMX A;  3H6V A;  1EZP A;  1P1O A;  4G68 B;  3LR1 A;  5HM4 B;  3UN6 A;  3MW0 A;  3OEK A;  4YMB A;  1NKX A;  1B7U A;  3FXR A;  3JZJ A;  1JEU A;  1MPB A;  1ZIU A;  1JET A;  2YPN A;  3PD8 A;  5L9M A;  1PB8 A;  1B32 A;  2XX7 A;  4QFL A;  4RA1 A;  3H06 B;  4FE8 A;  2P1S A;  4KCD A;  3IOV A;  2XXT A;  3G3I A;  2Q2A A;  3FJG A;  1P99 A;  1OIB A;  3KN8 A;  1TFA A;  3GXA A;  1FTJ A;  3H6W A;  1OQG A;  1Y3N A;  3EHT A;  1MY2 A;  3VVE A;  5ELV A;  3GBA A;  2I49 A;  1MS7 A;  4H6D A;  2F34 A;  3MVZ A;  3VLU A;  4OES A;  1Y1M A;  3BFT A;  3GBB A;  3LBS A;  2HAU A;  2PYY A;  5AA4 B;  1CB6 A;  2P0S A;  2P2A A;  4ISU A;  3FVO A;  3RY3 A;  1MY1 A;  5AE4 A;  4G68 A;  5K2X A;  5I59 B;  1SD3 A;  1MM7 A;  1UTH B;  1DMB A;  3KGC A;  3IO4 A;  2PT2 A;  4ZEF A;  3W9V A;  4U21 A;  3N5L A;  4BLA A;  3FD3 A;  3G3K A;  3PUW E;  3FZV A;  1QUK A;  1NMU A;  1J1N A;  2UXA A;  4GD5 A;  2QMX A;  4R9F A;  3O66 A;  3MC2 A;  1QUJ A;  2X7Q A;  1L5T A;  2VGQ A;  2RCA A;  3MQ9 A;  1QKA A;  3EHU A;  3M8U A;  4QFK A;  4POX A;  4BDR A;  4IY5 A;  4P0G A;  2DP8 A;  1AH5 A;  5AA4 A;  4ESW A;  4F2O A;  3OXN A;  3QUF A;  1N7W A;  2ESN A;  5I59 A;  2DOJ A;  1UTH A;  4QHQ A;  2REJ A;  4HCY A;  2Q89 A;  3PUZ E;  2H5Y A;  2HFB A;  3FAT A;  3K1M A;  3K1N A;  3IB2 A;  3B6T A;  4RK2 A;  4BDM A;  4PE5 B;  2QS4 A;  2W7Y A;  4QFP A;  4U4S A;  3HCQ A;  3TUS A;  4EF1 A;  2DWA A;  4JXI A;  3HN0 A;  3E3K A;  4NTL A;  3N26 A;  4ELO A;  3V5A A;  4XXU A;  1MRP A;  2RF1 A;  3Q29 A;  3VXB A;  4P0I A;  4E0X A;  1XT8 A;  3OEM A;  4F1U A;  5FHM A;  4L17 A;  4NF6 B;  4OMB A;  1M5F A;  1XVY A;  2REG A;  2PVU A;  3FVK A;  4Z7E A;  4LQ2 A;  4PFT A;  2H98 A;  3K2D A;  4KQP A;  1LBB A;  4R72 A;  1YTV A;  1H44 A;  4F2Q A;  1ZTY A;  2D3I A;  5ICQ A;  4NF4 B;  3U8Q A;  3IOR A;  3FVG A;  3LSL A;  1URG A;  3TEP A;  3HPI A;  2ONR A;  5CMM A;  2DE3 A;  4U4X A;  5M2V A;  1CE2 A;  2HXW A;  4BDO A;  4NF6 A;  3C9H A;  3MWB A;  3G3F A;  4LQ5 A;  1FCK A;  4IO4 A;  1B3F A;  5AA3 A;  2IEE A;  2DWJ A;  1LCT A;  1JNF A;  4OER A;  4H0W A;  4KYD A;  4JB7 A;  2O69 A;  5L9S A;  3DM0 A;  1XOC A;  4TQU Q;  3TCF A;  2UVH A;  4NF8 B;  2DS9 A;  4NF4 A;  2X26 A;  1HSJ A;  3KN3 A;  5TU0 A;  3KSJ A;  3VE1 B;  4DZ1 A;  5DYH A;  4KI0 E;  5ISU A;  5H8Q B;  5H8F B;  2I48 A;  2V84 A;  2GH9 A;  2ONS A;  2LAO A;  5CC2 A;  2I6E A;  4LON B;  3ILT B;  1ZLQ A;  5AA1 A;  3OMB A;  3CSG A;  4JBZ A;  2B65 A;  3FVN A;  1MXW A;  4EQ7 A;  4OXV A;  3RN8 A;  3K6W A;  2ABH A;  3QAX A;  3H6U A;  3VLW A;  4XKN A;  3T9X B;  4PET A;  2AYS A;  1B4H A;  2V3T A;  1JW1 A;  1OLA A;  2E0S A;  3TOD A;  4NF8 A;  1FTK A;  3TTK A;  2I0C A;  4X9T A;  3H7M A;  1B3H A;  3PPO A;  3FAS A;  5JK4 A;  2GHA A;  2VHA A;  4TOZ A;  1P1Q A;  4ZEC A;  5H8Q A;  5H8F A;  4FEB A;  1MY0 A;  1A7L A;  4G8M A;  4R9G A;  4OWD A;  3KZG A;  4C1T A;  4R73 A;  3VXC A;  4EF2 A;  4I9D A;  3K00 A;  2QPQ A;  1QW0 A;  2NOO A;  4OYV A;  5I2N B;  4F1V A;  1N3W A;  4M4G A;  2Q88 A;  1JVY A;  2DVZ A;  4MF3 A;  2F7C A;  3PGF A;  1FTM A;  2PX1 A;  4NMY A;  4RY1 A;  2DVC A;  3PUX E;  3HHG A;  4DDD A;  4N6P A;  2Y7R A;  3A3C A;  4FIM A;  2I0B A;  3OO9 A;  4KCC A;  3FXU A;  4OET A;  3FGS A;  1PB7 A;  5H8S A;  3ZKK A;  1GR2 A;  1URD A;  4F18 A;  3U72 A;  1Z7N E;  4PFU A;  1I6B A;  4JSD A;  1LGB C;  1TT1 A;  2DXY A;  1DTZ A;  1M5D A;  4ZZA A;  5CMB A;  4X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...