1N7XA

Human serum transferrin, n-lobe y45e mutant
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASELDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serotransferrin
publication title THE POSITION OF ARGININE 124 CONTROLS THE RATE OF IRON RELEASE FROM THE N-LOBE OF HUMAN SERUM TRANSFERRIN. A STRUCTURAL STUDY
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 104
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2002-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n7xA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n7xA01
3D4GA 4RXLA 1M5EA 1A8FA 2VP1A 4FEDA 2Q88A 1FQAA 3IX1A 2AIXA 3C34A 2F97A 2PT1A 1QUIA 5DEXB 4FORA 2OWTA 3KSXA 5I58B 1NNTA 2I6EA 3MUQA 5H8QB 1XOCA 5HM4B 3TCGA 1GV8A 2H5YA 1Y3PA 3OMBA 4GQOA 4MLVA 4GXAA 1BLFA 2X7QA 5ITOA 3K02A 3OELA 4UA8A 2P2AA 1I6BA 4WXJA 3DLNA 2AYSA 4OQOA 4BDMA 5AA2B 1B9JA 4KFQA 3V5AA 3H7MA 4OHNA 2A5TA 1TXFA 2WKYA 3DM0A 1YPNA 1MXUA 1QVSA 4GD5A 2O1LA 2V25A 3PPOA 3TZAA 1Y3QA 4QFLA 3QXMA 4U2RA 1RKMA 2O7IA 4DXCA 5I2NA 1O64A 2XXQA 4BDRA 1SW4A 2REJA 2W7YA 1P1WA 3P7IA 3FUZA 4DLDA 4GFRA 4OFOA 4OESA 3USDA 2V93A 2FYIA 3L6GA 4Q0CA 1FQFA 2UVGA 1UTHB 4ELQA 2RINA 4AQ4A 1CB6A 2UYEA 4KR5A 1D9YA 1MY2A 3SERA 4NF4A 3RTWB 5AA1A 2OBGA 4H8JA 2ZYKA 1SBPA 4HW8A 4LZ7A 4IY6A 1S7YA 4G8HA 2E1SA 5K2XA 3HHGA 4H67A 4XXUA 3ZSFA 2O1MA 4NF6A 1I6QA 1B2HA 3CR9A 3MP8A 4TLLB 2O6AA 4AB6A 2XXXA 4U1OA 2AL4A 4TOZA 2THIA 3EHSA 2B3BA 4RA1A 4LUBA 2KLFA 3OO8A 4OMBA 3PGFA 2VOZA 5JK4A 1B32A 2HZKA 2Y7RA 4DCYA 3W15C 2P1SA 3DP4A 4F3SA 4Z7EA 3Q28A 2DVCA 5CC2A 4HCWA 2Y7IA 4PFWA 3M8UA 2ZYOA 3PPPA 4N6PA 3TCFA 5J1DA 2REGA 4DCXA 4DE8A 5I56A 1UTBB 3N26A 1O63A 3FJMA 2ABHA 1N04A 3VLVA 3Q27A 3QAXA 1N84A 3MVYA 3MP6A 2XXVA 4DZ1A 1Y4TA 3MZBA 3M3FA 3TTMA 3G3JA 3SETA 3M3LA 5KDTA 2OK2A 1VE4A 3E9XA 1H45A 2IA4A 3OD7A 5HBCA 4ZEBA 4I1DA 5FHNA 1QUJA 2O7UA 1D9VA 1FTOA 4O3BA 4THIA 2QS3A 3FVGA 1WDNA 2UXAA 3MVZA 3FXUA 4JXIA 2G29A 2QL3A 3MJNA 4F3PA 1Y9UA 4P0IA 2X7PA 1US4A 3C35A 2I58A 1MH3A 4K3FA 3RNNA 5JTYA 4ZE9A 4GIZA 3FVNA 3MP1A 5IAIA 1POY1 4AB5A 3OENA 4POWA 1NL5A 1M5CA 2DP8A 3OSRA 3V89B 4F2OA 2Z8FA 3W9VA 3MQ9A 1JW1A 1P1NA 4Z0IA 3B6QA 3IJXB 1JQFA 4XTCQ 3VVFA 3CG3A 2Z8DA 1MQGA 3QUJA 3TYHA 3UN6A 2PT2A 4M4GA 3TUSA 2F7AA 4EXLA 4GLIA 2QMWA 3C33A 4NEDA 1B51A 3K6UA 2Y7WA 4C1TA 3OO9A 1SI0A 4KD5A 2A5TB 1IXCA 1SW5A 1CE2A 1SQYA 1SD3A 2Z22A 5I57A 1P1UA 2HAUA 1WODA 1LFGA 2XHDA 2GHBA 4H65A 4LQ2A 3K6WA 4YZZA 1B05A 1MY1A 3HSTA 5A5XA 3CRBA 3DP8A 1B3GA 2Y84A 3QSLA 3VVEA 1IUDA 4XKPA 1A8EA 1MDP1 2GHAA 2PVUA 3UORA 3IB0A 1B58A 5H8FA 4XKNA 3CI8A 4GRKA 1N0TA 4NMYA 1VFDA 3T93B 2Y7KA 4NF4B 3N5LA 2O84X 2I4BA 4ECFA 3TAJA 1B0LA 2ESNA 1J1NA 2UVIA 1PB7A 3PUXE 3JV9A 4QFOA 2ANJA 4P0GA 3ILUB 3MPLA 4JBZA 4DDDA 5LOMA 4NF6B 4JWYA 4R6KA 4BDLA 4E0XA 4H5FA 5DVIA 1P1OA 1OLAA 3TELA 3KJTA 3ILTB 4YAHX 1FQCA 2I3VA 4U4XA 2RCAA 2DS9A 3SKPA 2I48A 2Q8JA 4BDOA 4ZZAA 2F7CA 1LB8A 3KN8A 1DPPA 2YJPA 4KCDA 5L9MA 1GGGA 3GLBA 3IO4A 4P11A 1IEJA 1XT8A 2ZMBA 2UVJA 5I56B 4PE5B 4RK9A 1OIBA 4YB5A 5IKBA 1URDA 1N3XA 2QJEA 1HSEA 5ITPA 3PUYE 1WVJA 1LCFA 2F78A 4KYEA 2Q9TA 3TMGA 5CBRA 4I9DA 4F29A 4Q8RA 2D5WA 3O9PA 5KDTB 4YKJA 4NWDA 3THIA 3KSJA 4OETA 4ZE8A 1M5BA 3UGWA 4IO2A 3MC2A 4IGRA 3FXRA 3RLFE 2O68A 4RK2A 4LVQA 1QJMA 5HPQA 4YMBA 2VD3A 2XD3A 3IOTA 2Q2CA 3E13X 1URGA 2LAOA 1RYOA 2I4CA 2PYYA 3SEYA 1FW0A 1B1XA 1BKAA 3TQWA 5JTYB 2ZNTA 1LCTA 2F36A 1A7LA 3LUYA 2O69A 2UVHA 4X9TA 2XXWA 1LAXA 4ISUA 5EHSA 3FJGA 1NH8A 2XXIA 2XXHA 1NKXA 1R9QA 2GRVA 1A99A 4QSEA 1AIVA 3FZVA 4MH5A 5I59A 1MXZA 2PMSA 1NFTA 3K01A 3SESA 3RQTA 3GZGA 4F22A 1MPDA 3TTLA 4Q30B 1N3WA 3O6IA 4H8IA 3IORA 3BBRA 2NWJA 1A55A 4U22A 2ONSA 4KCCA 1IXHA 3N6TA 1MQHA 1DSNA 3CVGA 5I2KA 1H43A 1VFEA 1FTMA 5A5XB 3MBPA 5DYHA 2ZXTA 1OVTA 3PD9A 4F2QA 3HPIA 2DE3A 1D3KA 3FASA 4NF8A 1MXXA 2UYFA 3JZJA 1JW4A 2F35A 1M5FA 2NOOA 4G8MA 4ELRA 5H8FB 3RTFB 3ODBA 4OFLA 3UIFA 3D4CA 4YB6A 4H0WA 5I84A 3EN3A 5DTBA 4OFJA 1SW2A 2H9BA 4G8NA 4EXKA 4KHZE 1EZPA 1Z7NE 5M2VA 2HQ0A 2PX1A 4RY1A 4ESXA 1QKBA 4OWDA 1URSA 1LFHA 5EYFA 1MQIA 3PUVE 3W9WA 4F1UA 1F9BA 4JSDA 3UK4A 2CZLA 3LSLA 4G68C 2DYXA 4R6YA 2NVUB 4F19A 1FQEA 4OENA 2ZYMA 2IEEA 3RT8A 1KWHA 4PFYA 3DELB 1QUKA 3CSBA 3R7XA 3T9UA 3H06B 4ZEKA 4OTEA 2OJTA 2I49A 3GXAA 4X48A 4ESWA 1B6HA 2M8CA 3U94A 1ZBMA 2ZYNA 3QUFA 2XX9A 4GL8A 4WKMA 3O66A 3ZKKA 4HTGA 2FNCA 4JDFA 3U72A 1NNFA 2VGQA 2DXRA 4Q5TA 2XXTA 1JETA 5ELVA 1IZ1A 3IB1A 3TFLA 4XKRA 5AA2D 4QFNA 4R9FA 1NNPA 2F34A 3MVWA 3LR1A 1VR5A 4YKIA 3GBBA 1MG1A 4LZ8A 5ISUA 1UQWA 3C31A 1QW0A 3I6VA 4H1XA 2Z8EA 3Q29A 2V3UA 2P0SA 3HN0A 2XXUA 1II5A 1Q35A 1Y1MA 1BTJA 2V3QA 2GFEA 4LATA 3FD3A 3KGCA 1DMBA 4R73A 3GBAA 1Q1KA 2I0BA 2R71A 3FATA 3PUZE 1ZLQA 3G3FA 2A5SA 3TTRA 3FV2A 1JVYA 5FHMA 1DPEA 2NXOA 1N7XA 1LBBA 4HS7A 1BIYA 4GF8A 5B7DA 4BLAA 3O29A 5CMKA 1AOVA 3JYRA 3T96B 4OVJA 3VE1B 1MM7A 1EH3A 2H4IA 3H6UA 3TQLA 4IO3A 4F39A 1H76A 4NF5A 4IB2A 4YB7A 4YKPA 1OLCA 4R9GA 2HZLA 3PUWE 5CM6A 3E4RA 2QPQA 4G68A 5I59B 3LSXA 3OO7A 1MPCA 1TT1A 1LLSA 4IY5A 2DXYA 4I62A 4BDQA 3G3IA 4RPOA 4RJZA 3R26A 4ONYA 4R72A 3C32A 3K6XA 1I69A 5L9SA 3IL1B 3EHTA 3S9NC 2RKMA 3H6WA 2Q89A 4PP0A 3SEWA 2X26A 5I2NB 3O6GA 4R74A 1QULA 5I2KB 3K4UA 3VXCA 3I3VA 4ELPA 3CFXA 5F1QA 2DOJA 4LP2B 4R75A 1FTLA 3MAMA 2DVZA 3H6TA 2XX7A 1TFDA 3T9VA 4YU0A 4NF8B 5JEIA 3HO7A 3SEUA 4L17A 4FAJA 3KFMA 3U1OA 4X1DA 4G4PA 1JW5A 3LSWA 2DWAA 3TODA 3VV5A 4N07A 1LAGE 4U23A 2D21A 4QFKA 4DXUA 4IO5A 5KCJA 4EQ9A 1ZJLA 3O28A 2XXPA 2RC7A 2RC8A 3B7DA 3PU5A 2ONKE 3QYTA 1AMFA 1LFIA 4FECA 1ZTYA 2DQVA 1S50A 2GH9A 2H25A 4QSDA 2F6GA 3PMWA 2RF1A 1B5HA 3KZGA 1NNKA 3OXNA 2R6GE 3IJOB 1SVXB 3T9XB 1NMUA 1N7WA 5TPAA 2VHAA 3G3GA 4OERA 3FJ7A 2Y7PA 4X1BA 2CMOA 1MDQA 1PEBA 4YICA 4R2FA 4MFIA 1ANFA 2PBWA 3AXFA 2DSFA 2DWJA 2I3WA 3CSGA 5BWJA 3G3KA 4N13A 5ICQA 4POXA 3UA8A 4FE8A 4DIGA 3DP6A 4BDNA 4ZS9A 3TTNA 3IR1A 4JSOA 1GR2A 3H3GA 4U21A 3TPAA 1LAFE 3KJ7A 1SI1A 1B52A 3N6UA 2OCUA 4PETA 2OLBA 5CMCA 5H8NA 4PFTA 3KOTA 1BP5A 2OZZA 1XHYA 4RNSA 2XXYA 4G2ZA 3B6WA 1JEUA 3QIMA 4OYVA 3RN8A 3A3CA 3TDJA 1Y1ZA 4EQBA 2ZNSA 3VLWA 4KYDA 3MPKA 3V83A 3PV0E 1EZOA 4EF1A 1Y3NA 3CG1A 3KOSA 4F3BA 3KN7A 1OVBA 3IAZA 4IGTA 3FIRA 1M5DA 3V8XB 1VSOA 1S9TA 2F7BA 3MZ9A 4IO4A 3B6TA 1PB8A 4IO7A 2F6PA 1H44A 2NUVA 3RY3A 4WEDA 3KG2A 2B3FA 4NF5B 3T9HB 1OMPA 3C9HA 1H3DA 2DWIA 5DT6A 1IIWA 1I6AA 1B1HA 1TWYA 4G68B 3M3KA 3G3HA 4OEVA 5H8HA 1B46A 4NTLA 3BFTA 1LB9A 2HCAA 5I57B 1OQHA 3RPWA 3KBRA 3LSFB 4ZEIA 1RYXA 1MH4A 3KN3A 2QMXA 1HSJA 5CMBA 3FVOA 1XVYA 1USYE 3QK6A 3EQ1A 3O2AA 5CBSA 1IITA 1MRPA 4O3AA 1MY4A 4ELOA 2O51A 4R6HA 3LBSA 2YPNA 2DWHA 1O7TA 1SYHA 1PC3A 5EHMA 4M1VA 4QRZA 1R6ZA 5CMMA 3C36A 3VFJA 1B3LA 5DVFA 3S2VA 1MY0A 3PPRA 3ONMA 5BUUA 2AL5A 5FTIA 1IXGA 2HAVA 4G77A 4EQ7A 3Q25A 3N94A 3RGYA 2BJJX 3F11A 3PMXA 3HHFA 2HXWA 3ECRA 1PB9A 4NE4A 1EZ9A 1A54A 4TQUQ 1ATGA 1R1NA 4DXBA 1YTVA 2V84A 3IB2A 4QHQA 4C1UA 2HEUA 5KCJB 4LA9A 2YLNA 4U1ZA 4GL0A 5KZTA 2XD2A 4NWCA 1FTKA 4I8CA 3S9MC 4E0WA 3BFUA 4PFUA 3EHUA 4KQPA 3OEKA 3VVDA 5H8SA 1TFAA 4GVOA 2RC9A 1MXYA 3K6VA 5FHOA 3SEVA 2XX8A 4OXVA 2E0SA 1MXVA 1LGBC 3IO6A 5TPAB 3UP9A 1US5A 2V3TA 1Z7ME 5AA4A 3T66A 4YMAA 1B3FA 2FA7A 1XS5A 4MF3A 1JVXA 3IOVA 3O97A 1MQJA 1DTZA 2ZNUA 1D4NA 4XKQA 2R9JA 1DOTA 5AE4A 3EF7A 1ZKBA 1SW1A 3WAFA 5CI5A 4ZDMA 3CFLA 3A3UA 1P99A 5TP9A 1ZU0A 1XVXA 1B40A 4KPTA 4MBPA 4JWXA 1QKAA 3T22A 4GOTA 1MQDA 1B3HA 5H8NB 3TCHA 3E3KA 1YCJA 4OZ9A 3OEMA 5AA3A 1R9LA 2HFBA 1B0HA 3I5OA 4OEUA 5DEXA 1MS7A 5I58A 3WAEA 3IOUA 3MWBA 4GXSB 5H8QA 4WEPA 1B4ZA 3H03A 2XXRA 1FTJA 4U4SA 1A40A 4F18A 1T0KA 4KYSA 3MVXA 1GVCA 4ZECA 1IQ7A 1N76A 1JEVA 2F8DA 3L6HA 4QF9A 3A09A 1SYIA 3HV1A 3FXQA 5AA2A 3PMVA 4FJPA 3TEPA 2ALUA 1B5JA 2H99A 4TLMB 1P1QA 1B4HA 1ELJA 2RCBA 3VLUA 1PBPA 3MZ1A 2H98A 4LQ5A 5H8HB 1L5TA 1ZMGA 1JNFA 3R6UA 3TTKA 4EDPA 2Q2AA 3BKIB 4RPNA 4QSCA 3H4ZA 4ZEDA 5K2YA 2B65A 4XIGQ 3K2DA 3U92A 2QS2A 3CIJA 2VD2A 3LC8A 4H5GA 5B70A 3HCQA 3EPEA 1B7HA 2DE4A 4ZZEA 5ICTA 1AL3A 1SDXA 1B7UA 1OQGA 5FTHA 4QFPA 2OWSA 1UTHA 1HSLA 1LAHE 4F31B 3H6VA 3S4UA 4ND9A 5TU0A 1AH5A 2QSXA 3C4MA 1YAEA 2D3IA 4EF2A 3FV1A 3G7WA 1MXWA 4PQJA 4FEBA 1Y20A 3U8QA 1UIVA 4FATA 3S9EA 2QRYA 1EU8A 4C0RA 3OSQA 3IK6B 1MM6A 1ZIUA 3K00A 2DE2A 4ZEFA 3SDFA 4F3GA 1FQBA 1B3EA 1GTKA 3PD8A 4JWOA 2F5XA 4UACA 1LBCA 1FCKA 1PBQA 3Q26A 3RUMA 3SEXA 3KEIA 3O6HA 2QS1A 4LZ5A 3PPQA 1MPBA 3OOAA 3ZKLA 3VXBA 4GWOA 3K1MA 4FIMA 1FQDA 4F1VA 1UTBA 3K0VA 2QS4A 5L9OA 3IOWA 3ZS6A 3FGSA 5AA4B 1Y4CA 3TKDA 4LONB 3U93A 4HCYA 1DTGA 4IO6A 1B7ZA 1B5IA 3FVKA 1MY3A 4F1YA 2I0CA 4H6DA 1PDAA 4R2BA 4RYAA 5F7VA 5DVJA 4KI0E 3OO6A 4EUOA 2ONRA 3MW0A 3RT6B 5TP9B 5CRYA 3VDFA 1USYH 2Z23A 4JB7A 3K1NA 4MLQA 3PPNA 1UIUA 1IXIA 4O3CA 1POTA 5L8DA 4YKKA 3S9LC 1NH7A 3CFZA 2G93A 1LSTA 1XC1A 3K1PA
chains in the Genus database with same CATH superfamily
3D4GA 1KZ8A 4RXLA 1NUWA 1M5EA 1A8FA 2VP1A 4FEDA 2Q88A 4N15A 1FQAA 3IX1A 2AIXA 3C34A 2F97A 4PTKA 2PT1A 1QUIA 5DEXB 1IMCA 4FORA 2OWTA 3PTYA 3KSXA 5I58B 1NNTA 2I6EA 3MUQA 5H8QB 1XOCA 5HM4B 4PFIA 3TCGA 1GV8A 2H5YA 1Y3PA 3OMBA 4GQOA 1YXIA 4MLVA 4GXAA 1FPEA 1BLFA 2X7QA 4MJOA 3K02A 5ITOA 3OELA 4P47A 4UA8A 2P2AA 1I6BA 4WXJA 3DLNA 2AYSA 4OQOA 4BDMA 3E79A 5AA2B 1B9JA 4KFQA 3V5AA 5ESYA 3H7MA 3RPLB 4OHNA 2A5TA 1TXFA 2WKYA 3DM0A 1YPNA 1MXUA 1QVSA 4GD5A 2O1LA 2V25A 4JVCA 3PPOA 3TZAA 3BIGA 1Y3QA 4QFLA 3QXMA 4U2RA 1RKMA 2O7IA 4DXCA 2WEFA 5I2NA 1O64A 2XXQA 3FXBA 4PAIA 4BDRA 1SW4A 2REJA 2W7YA 5I7IA 1P1WA 3P7IA 4OANA 3FUZA 4DLDA 4GFRA 4OFOA 4OESA 3USDA 2V93A 2FYIA 3L6GA 4Q0CA 1FQFA 2UVGA 1UTHB 4ELQA 2RINA 4AQ4A 1CB6A 2UYEA 4KR5A 2JJKA 1D9YA 1MY2A 3SERA 4NF4A 2FBPA 3RTWB 1YZ0A 5AA1A 2OBGA 4H8JA 1EYJA 2ZYKA 1SBPA 4HW8A 4LZ7A 4IY6A 1S7YA 4G8HA 2E1SA 4N6DA 5K2XA 3HHGA 4H67A 1IMAA 4XXUA 3ZSFA 2O1MA 4NF6A 1I6QA 1B2HA 3CR9A 3MP8A 4TLLB 2O6AA 4AB6A 2XXXA 4U1OA 2AL4A 1FPKA 4TOZA 2THIA 3EHSA 2B3BA 4MHFA 4RA1A 4LUBA 2KLFA 3OO8A 4OMBA 3PGFA 2VOZA 5JK4A 1FBEA 1B32A 2HZKA 4O8MA 2Y7RA 4DCYA 3ROJA 3W15C 2P1SA 3DP4A 4F3SA 4Z7EA 3Q28A 4XEQA 1LBYA 2DVCA 4GX3A 5CC2A 4HCWA 2Y7IA 5EQ9A 4PFWA 3M8UA 2ZYOA 3PPPA 4N6PA 3TCFA 5J1DA 3KBZA 4HE0A 2REGA 4HXVA 4DCXA 3HFUA 4DE8A 5I56A 1UTBB 4GWZA 3N26A 1O63A 3FJMA 2ABHA 1N04A 3VLVA 4NAPA 3Q27A 3QAXA 2VT5A 1N84A 3MVYA 1D9QA 3MP6A 2XXVA 4DZ1A 1Y4TA 3MZBA 3M3FA 3TTMA 3G3JA 3SETA 4N91A 3M3LA 5KDTA 2OK2A 1VE4A 3E9XA 1H45A 2IA4A 3OD7A 5HBCA 4ZEBA 4I1DA 5FHNA 1QUJA 2O7UA 1D9VA 1FTOA 4O3BA 4THIA 1FJ6A 2QS3A 3FVGA 1WDNA 2UXAA 4FBPA 3MVZA 3FXUA 2Q74A 4JXIA 4QBAA 2G29A 2QL3A 3MJNA 3SZPA 4F3PA 1Y9UA 4P0IA 2X7PA 1US4A 5ET7A 3C35A 2I58A 1MH3A 4K3FA 3RNNA 2L5VA 3QMFA 5JTYA 2F3BA 4ZE9A 4GIZA 3FVNA 3MP1A 5IAIA 1POY1 4MIJA 4AB5A 3OENA 4POWA 1NL5A 1M5CA 2DP8A 3OSRA 3V89B 1INPA 4F2OA 2Z8FA 3W9VA 3MQ9A 1JW1A 3KC1A 1P1NA 4Z0IA 3B6QA 3IJXB 1JQFA 4XTCQ 3VVFA 3CG3A 2Z8DA 1MQGA 4H45A 3QUJA 4O7IA 3TYHA 3UN6A 2PT2A 4M4GA 3TUSA 2PFYA 2XA5A 2F7AA 4EXLA 4GLIA 2QMWA 3C33A 4NEDA 5T3JA 1B51A 3K6UA 4PCDA 2Y7WA 4C1TA 3OO9A 1SI0A 4KD5A 2A5TB 1IXCA 1SW5A 1CE2A 1FTAA 1SQYA 1SD3A 2Z22A 5I57A 1FBPA 1P1UA 2HAUA 1WODA 1LFGA 2XHDA 2GHBA 4H65A 4LQ2A 3K6WA 4YZZA 1B05A 2P3NA 4PAFA 1MY1A 3HSTA 5A5XA 3CRBA 3DP8A 5IGAA 1B3GA 1LBZA 2Y84A 3QSLA 3VVEA 1IUDA 4XKPA 1A8EA 4P1LA 1CNQA 1MDP1 2GHAA 2PVUA 3UORA 3IB0A 1FBDA 1B58A 5H8FA 4XKNA 3CI8A 4GRKA 1N0TA 2HPGA 1G0IA 4NMYA 1VFDA 3T93B 4OVTA 2Y7KA 4NF4B 3N5LA 2O84X 2I4BA 4ECFA 3TAJA 1B0LA 2ESNA 1J1NA 2UVIA 1PB7A 3PUXE 3JV9A 4XFEA 4QFOA 2ANJA 4P0GA 1NV2A 3ILUB 3MPLA 4HE1A 4P9KA 4JBZA 4DDDA 5LOMA 4NF6B 4JWYA 4R6KA 4BDLA 4E0XA 4H5FA 5DVIA 1P1OA 4PDDA 1OLAA 3TELA 3KJTA 3ILTB 4YAHX 1FQCA 2I3VA 4U4XA 2RCAA 2DS9A 3SKPA 2I48A 2Q8JA 4BDOA 4ZZAA 2F7CA 1LB8A 3KN8A 1IMEA 1NV4A 1DPPA 2YJPA 4KCDA 4NF0A 4MNCA 5L9MA 4P11A 1GGGA 3GLBA 3IO4A 1IEJA 3IFAA 1XT8A 2DDKA 2WYKA 2ZMBA 2UVJA 5I56B 1FPGA 3LV0A 4PE5B 5IZ3A 4RK9A 1Q9DA 1OIBA 4YB5A 5IKBA 1URDA 1N3XA 2QJEA 1HSEA 2P3VA 5ITPA 3PUYE 1WVJA 1LCFA 2F78A 4KYEA 2Q9TA 3TMGA 5CBRA 4I9DA 1FRPA 4F29A 4Q8RA 2D5WA 3O9PA 5KDTB 5LDZA 4YKJA 4NWDA 3THIA 3KSJA 4OETA 4MCOA 4ZE8A 1M5BA 3UGWA 4IO2A 3MC2A 1RDXA 4UABA 4IGRA 3FXRA 3RLFE 2O68A 4RK2A 3LUZA 4LVQA 1QJMA 3CHGA 5HPQA 4YMBA 2VD3A 2XD3A 3IOTA 2Q2CA 2HHMA 3E13X 1URGA 2LAOA 4N6KA 1RYOA 4AS5A 2I4CA 2PYYA 3SEYA 1FW0A 1B1XA 1BKAA 3TQWA 5JTYB 2ZNTA 1LCTA 2F36A 1A7LA 3LUYA 2O69A 2UVHA 4X9TA 2XXWA 1LAXA 4ISUA 5EHSA 3FJGA 1NH8A 2XXIA 2XXHA 1NKXA 1R9QA 1NUYA 2GRVA 1A99A 2KR0A 4QSEA 1AIVA 3FZVA 4O94A 4MH5A 5I59A 1MXZA 2PMSA 1NFTA 3K01A 3SESA 2OWZA 3RQTA 3GZGA 4F22A 1MPDA 3TTLA 2XWIA 4Q30B 3GYYA 1N3WA 3O6IA 4H8IA 3IORA 2XXKA 3BBRA 2FIEA 2NWJA 1A55A 4U22A 1IMBA 2ONSA 4KCCA 1IXHA 3N6TA 1MQHA 1DSNA 3CVGA 5I2KA 1H43A 1VFEA 1FTMA 5A5XB 1NUZA 3MBPA 5DYHA 2ZXTA 1OVTA 3PD9A 4F2QA 3HPIA 2DE3A 1D3KA 3FASA 4NF8A 1DCUA 3B50A 1MXXA 2UYFA 3JZJA 1JW4A 2F35A 1M5FA 2NOOA 4G8MA 4ELRA 5H8FB 2OX3A 3RTFB 3ODBA 4OFLA 3UIFA 3D4CA 4YB6A 1NI9A 4H0WA 5I84A 3EN3A 2XWOA 5DTBA 4OFJA 1SW2A 2H9BA 4OVSA 4G8NA 4EXKA 4KHZE 1EZPA 4NGUA 1Z7NE 4JVDA 5M2VA 2HQ0A 2PX1A 4RY1A 4ESXA 1QKBA 4OWDA 1URSA 1LFHA 5EYFA 1MQIA 3PUVE 3W9WA 4GBWA 4F1UA 1F9BA 4JSDA 3UK4A 2CZLA 3LSLA 4G68C 2DYXA 4R6YA 2FHYA 2NVUB 3NOHA 4PF6A 4P3LA 4F19A 1FQEA 4OENA 2ZYMA 2IEEA 2CZIA 3RT8A 1KWHA 4PFYA 3DELB 1QUKA 3CSBA 3R7XA 3T9UA 3H06B 4ZEKA 4OTEA 2OJTA 2I49A 3GXAA 4X48A 4ESWA 1B6HA 2M8CA 4OVRA 3U94A 1ZBMA 2ZYNA 3QUFA 5J16A 2XX9A 4GL8A 4WKMA 3O66A 3ZKKA 4HTGA 2PCRA 2FNCA 4JDFA 3U72A 1NNFA 2VGQA 2DXRA 4Q5TA 2XXTA 1JETA 5ELVA 1IZ1A 5IZ3B 3IB1A 3TFLA 4XKRA 5AA2D 4QFNA 4R9FA 1NNPA 1NV0A 2F34A 3MVWA 3LR1A 1VR5A 4YKIA 2VPOA 3GBBA 1MG1A 4LZ8A 5ISUA 1UQWA 3C31A 1QW0A 3I6VA 4H1XA 4H46A 4PF8A 2Z8EA 4DI3D 3Q29A 4KXPA 2CEXA 2ZZXA 2F3DA 4QXDA 2V3UA 2P0SA 3HN0A 2XXUA 1II5A 1Q35A 1BTJA 1Y1MA 2V3QA 2GFEA 4LATA 3FD3A 1SPIA 3KGCA 1DMBA 4R73A 3GBAA 1Q1KA 2I0BA 2R71A 3FATA 3PUZE 1ZLQA 3G3FA 2A5SA 3TTRA 3ISPA 3FV2A 1JVYA 5FHMA 1DPEA 2NXOA 1N7XA 1LBBA 4HS7A 1RDZA 1BIYA 4N4UA 1FPJA 4GF8A 1FBHA 2WYPA 5B7DA 4BLAA 1XI6A 3O29A 5CMKA 3RYDA 1AOVA 3JYRA 3T96B 4OVJA 3VE1B 1MM7A 1EH3A 1NV5A 2H4IA 3H6UA 3TQLA 4IO3A 4F39A 1H76A 4NF5A 4IB2A 2CZKA 4NG7A 4YB7A 4YKPA 1OLCA 2B4LA 4R9GA 2HZLA 3PUWE 5CM6A 3E4RA 2QPQA 4G68A 5I59B 3LSXA 3OO7A 5LTCA 1MPCA 1TT1A 4MMPA 5I5PA 2HXRA 1LLSA 4IY5A 2DXYA 4I62A 1IMDA 4BDQA 3G3IA 4RPOA 1DBZA 4RJZA 3R26A 4ONYA 4R72A 3C32A 3K6XA 1I69A 5L9SA 3IL1B 1NV1A 1FPBA 3EHTA 3S9NC 2RKMA 3H6WA 2Q89A 4PP0A 3SEWA 2XWKA 2X26A 4JVIA 5I2NB 3O6GA 4N81A 4R74A 2B4MA 1QULA 5I2KB 3K4UA 3VXCA 3I3VA 4ELPA 3CFXA 5F1QA 2DOJA 4LP2B 4R75A 1FTLA 1KA1A 3MAMA 2DVZA 3H6TA 2XX7A 3T1BA 1TFDA 3T9VA 4YU0A 4NF8B 5JEIA 3HO7A 1NV6A 3SEUA 4L17A 3MYUA 1DK4A 4FAJA 3KFMA 3U1OA 1NV3A 4NQ8A 4X1DA 4G4PA 1JW5A 3LSWA 2DWAA 3TODA 2ZZWA 3VV5A 4N07A 1LAGE 4U23A 2D21A 4QFKA 4DXUA 4IO5A 5KCJA 4EQ9A 1ZJLA 3O28A 2VPNA 2XXPA 2RC7A 1EYIA 2RC8A 3B7DA 3PU5A 2ONKE 3QYTA 1AMFA 1LFIA 4FECA 1ZTYA 2MKZA 2DQVA 1S50A 2GH9A 2H25A 1EYKA 4QSDA 1FBGA 3T0JA 2F6GA 3PMWA 2RF1A 1B5HA 2XWVA 3KZGA 1NNKA 2FIXA 3OXNA 5EQ7A 2R6GE 3IJOB 1SVXB 3T9XB 1NMUA 1N7WA 5TPAA 2VHAA 3G3GA 4OERA 3FJ7A 2Y7PA 4X1BA 2CMOA 1MDQA 4X04A 1PEBA 4YICA 4R2FA 3D1RA 4GBVA 4MFIA 1ANFA 2PBWA 3AXFA 2DSFA 2DWJA 2I3WA 3CSGA 5BWJA 3G3KA 4N13A 5ICQA 1K9ZA 4P8BA 4POXA 2Y5KA 3UA8A 4N8GA 4FE8A 4DIGA 3DP6A 4BDNA 1FBCA 4ZS9A 3TTNA 3IR1A 4JSOA 1GR2A 3H3GA 4U21A 3TPAA 1LAFE 3KJ7A 5DW8A 2BJIA 1SI1A 1B52A 3N6UA 2OCUA 4PETA 4I40A 2OLBA 5CMCA 5H8NA 4PFTA 4MEVA 3KOTA 1BP5A 2OZZA 1XHYA 4RNSA 2XXYA 5ET5A 4G2ZA 3B6WA 1JEUA 3QIMA 4G61A 4OYVA 3RN8A 3A3CA 3TDJA 1Y1ZA 2CZHA 4EQBA 2ZNSA 4OVPA 4PFBA 3VLWA 4KYDA 3MPKA 3V83A 3PV0E 1EZOA 4EF1A 1Y3NA 3CG1A 3KOSA 4F3BA 3KN7A 1OVBA 3IAZA 4IGTA 3FIRA 1M5DA 1FSAA 1FPLA 3V8XB 1VSOA 1S9TA 2F7BA 3MZ9A 4IO4A 3B6TA 1PB8A 4IO7A 2F6PA 1H44A 2NUVA 3RY3A 4WEDA 3KG2A 4LN5A 3A29A 2B3FA 2Q8MA 4NF5B 3T9HB 1OMPA 4O7MA 3C9HA 1H3DA 2DWIA 5DT6A 1IIWA 1I6AA 1B1HA 1TWYA 4P1EA 4GWUA 2KQZA 4G68B 3M3KA 3G3HA 4OEVA 5H8HA 2R8TA 1B46A 4NTLA 3BFTA 1LB9A 1FPDA 4NX1A 4X8RA 1AWBA 2HCAA 5I57B 1OQHA 4GWWA 3RPWA 3KBRA 3LSFB 4PBQA 4ZEIA 1RYXA 1MH4A 2QVRA 3KN3A 2QMXA 1HSJA 5CMBA 3FVOA 2WBBA 1XVYA 1USYE 3QK6A 3EQ1A 3O2AA 4MNIA 5CBSA 1IITA 1MRPA 4O3AA 1MY4A 4I3YA 4ELOA 2O51A 4R6HA 3LBSA 1NV7A 2YPNA 2DWHA 1O7TA 1SYHA 1PC3A 4NN3A 4MAGA 5EHMA 4M1VA 4QRZA 4PAKA 4HE2A 1R6ZA 5CMMA 3C36A 3VFJA 1B3LA 5DVFA 1LBXA 3S2VA 1MY0A 3PPRA 3ONMA 5BUUA 2AL5A 5FTIA 1IXGA 2HAVA 4G77A 4DI4B 5A5LA 4EQ7A 3Q25A 3N94A 3RGYA 2BJJX 3F11A 3PMXA 3HHFA 2HXWA 3ECRA 5IZ1A 1LBVA 1PB9A 4NE4A 2Y5LA 1EZ9A 1A54A 1FJ9A 4TQUQ 1ATGA 1R1NA 4DXBA 1YTVA 2V84A 3IB2A 4QHQA 4C1UA 2HEUA 5KCJB 4LA9A 2YLNA 2WBDA 4PDHA 4U1ZA 5I3SA 4GL0A 5KZTA 2XD2A 4NWCA 1FTKA 4I8CA 3S9MC 4N17A 4E0WA 5IZZA 3BFUA 4PFUA 3EHUA 4KQPA 3OEKA 3VVDA 5H8SA 1TFAA 4GVOA 2RC9A 1MXYA 3K6VA 5FHOA 3SEVA 2XX8A 4OXVA 1FBFA 2E0SA 1MXVA 1LGBC 4GWSA 3IO6A 5TPAB 3UP9A 1US5A 4PBHA 2V3TA 1Z7ME 5AA4A 3T66A 4YMAA 1B3FA 2FA7A 1XS5A 2QFLA 4MF3A 1JVXA 3IOVA 3O97A 1MQJA 1DTZA 2ZNUA 1D4NA 4XKQA 2R9JA 1DOTA 5AE4A 3EF7A 3E78A 1ZKBA 1SW1A 4P56A 3WAFA 5CI5A 4ZDMA 3CFLA 3A3UA 1P99A 5TP9A 1ZU0A 1XVXA 1B40A 4KPTA 4MBPA 4JWXA 1QKAA 3T22A 4GOTA 1MQDA 1B3HA 5H8NB 2FVZA 3TCHA 1VDWA 3E3KA 1YCJA 4OZ9A 2PFZA 3OEMA 5AA3A 1FPFA 1R9LA 2HFBA 1B0HA 3I5OA 4OEUA 5DEXA 1MS7A 4I3EA 5I58A 1K9YA 3WAEA 3IOUA 3MWBA 4GXSB 5H8QA 4WEPA 1B4ZA 4PC9A 3H03A 2XXRA 1FTJA 4U4SA 1G0HA 1A40A 4F18A 1T0KA 4N8YA 4KYSA 3MVXA 1GVCA 4ZECA 4GX4A 1IQ7A 1N76A 1JEVA 4GWYA 1FPIA 3MSTA 1RDYA 2F8DA 3L6HA 4QF9A 3A09A 1SYIA 3HV1A 3FXQA 5AA2A 3PMVA 4FJPA 3TEPA 2ALUA 5ET8A 3EKIA 1B5JA 2H99A 4TLMB 3RPLA 1P1QA 4GWXA 1B4HA 4PGNA 1ELJA 2RCBA 3VLUA 1PBPA 2WX9A 3MZ1A 2H98A 4LQ5A 5H8HB 1L5TA 1ZMGA 1JNFA 3R6UA 3TTKA 4AS4A 4EDPA 2Q2AA 4RPNA 3BKIB 2ZZVA 4QSCA 3H4ZA 4ZEDA 5K2YA 2B65A 4XIGQ 3K2DA 3U92A 2QS2A 5IM2A 3CIJA 2VD2A 3LC8A 4H5GA 5B70A 3HCQA 3EPEA 1B7HA 3BIHA 2DE4A 2QVVA 4OA4A 1LBWA 4ZZEA 5ICTA 1AL3A 1SDXA 1B7UA 1OQGA 5FTHA 5EYHA 4XF5A 5FBPA 4QFPA 2OWSA 1HSLA 1LAHE 1UTHA 3IFCA 4F31B 3H6VA 1NUXA 3S4UA 4ND9A 5TU0A 1AH5A 5ET6A 2QSXA 5F24A 3C4MA 1YAEA 1QGXA 2D3IA 1BK4A 4MNPA 4EF2A 3FV1A 3G7WA 1MXWA 4PQJA 4FEBA 4OVQA 5EYGA 3B8BA 1Y20A 3U8QA 1UIVA 4FATA 3S9EA 5EQAA 2QRYA 1EU8A 4C0RA 3OSQA 3IK6B 1MM6A 1ZIUA 3K00A 2DE2A 4ZEFA 3SDFA 4F3GA 1FQBA 1B3EA 1GTKA 3PD8A 4JWOA 2F5XA 4UACA 1LBCA 1FCKA 1PBQA 3Q26A 3RUMA 4MX6A 2GQ1A 3SEXA 3KEIA 3O6HA 2QVUA 2QS1A 4LZ5A 3PPQA 1MPBA 1LEVA 4IR8A 3OOAA 4GX6A 3ZKLA 4PFRA 3VXBA 4GWOA 3K1MA 4FIMA 1IMFA 1FQDA 4F1VA 1UTBA 3K0VA 2QS4A 5L9OA 3KC0A 3IOWA 2V4CA 3ZS6A 3FGSA 5AA4B 1JP4A 1Y4CA 3TKDA 4LONB 3U93A 4HCYA 1DTGA 4IO6A 1B7ZA 1B5IA 3FVKA 2CEYA 1MY3A 4F1YA 2I0CA 4H6DA 1PDAA 3U65A 4R2BA 4RYAA 5F7VA 5DVJA 4KI0E 3OO6A 4NHBA 4EUOA 2ONRA 3MW0A 4PGPA 3RT6B 5TP9B 5CRYA 3VDFA 1USYH 2Z23A 4JB7A 3K1NA 5EQ8A 1KA0A 4MLQA 3PPNA 1UIUA 1IXIA 4O3CA 1POTA 5L8DA 3FBPA 4YKKA 3S9LC 1NH7A 4PE3A 3CFZA 2G93A 1LSTA 1XC1A 1YYZA 3K1PA
chains in the Genus database with same CATH topology
3D4GA 4RXLA 1M5EA 1A8FA 2VP1A 4FEDA 2Q88A 1FQAA 3IX1A 2AIXA 3C34A 2F97A 2PT1A 1QUIA 5DEXB 4FORA 2OWTA 3KSXA 5I58B 1NNTA 2I6EA 3MUQA 5H8QB 1XOCA 5HM4B 3TCGA 1GV8A 2H5YA 1Y3PA 3OMBA 4GQOA 4MLVA 4GXAA 1BLFA 2X7QA 5ITOA 3K02A 3OELA 4UA8A 2P2AA 1I6BA 4WXJA 3DLNA 2AYSA 4OQOA 4BDMA 5AA2B 1B9JA 4KFQA 3V5AA 3H7MA 4OHNA 2A5TA 1TXFA 2WKYA 3DM0A 1YPNA 1MXUA 1QVSA 4GD5A 2O1LA 2V25A 3PPOA 3TZAA 1Y3QA 4QFLA 3QXMA 4U2RA 1RKMA 2O7IA 4DXCA 5I2NA 1O64A 2XXQA 4BDRA 1SW4A 2REJA 2W7YA 1P1WA 3P7IA 3FUZA 4DLDA 4GFRA 4OFOA 4OESA 3USDA 2V93A 2FYIA 3L6GA 4Q0CA 1FQFA 2UVGA 1UTHB 4ELQA 2RINA 4AQ4A 1CB6A 2UYEA 4KR5A 1D9YA 1MY2A 3SERA 4NF4A 3RTWB 5AA1A 2OBGA 4H8JA 2ZYKA 1SBPA 4HW8A 4LZ7A 4IY6A 1S7YA 4G8HA 2E1SA 5K2XA 3HHGA 4H67A 4XXUA 3ZSFA 2O1MA 4NF6A 1I6QA 1B2HA 3CR9A 3MP8A 4TLLB 2O6AA 4AB6A 2XXXA 4U1OA 2AL4A 4TOZA 2THIA 3EHSA 2B3BA 4RA1A 4LUBA 2KLFA 3OO8A 4OMBA 3PGFA 2VOZA 5JK4A 1B32A 2HZKA 2Y7RA 4DCYA 3W15C 2P1SA 3DP4A 4F3SA 4Z7EA 3Q28A 2DVCA 5CC2A 4HCWA 2Y7IA 4PFWA 3M8UA 2ZYOA 3PPPA 4N6PA 3TCFA 5J1DA 2REGA 4DCXA 4DE8A 5I56A 1UTBB 3N26A 1O63A 3FJMA 2ABHA 1N04A 3VLVA 3Q27A 3QAXA 1N84A 3MVYA 3MP6A 2XXVA 4DZ1A 1Y4TA 3MZBA 3M3FA 3TTMA 3G3JA 3SETA 3M3LA 5KDTA 2OK2A 1VE4A 3E9XA 1H45A 2IA4A 3OD7A 5HBCA 4ZEBA 4I1DA 5FHNA 1QUJA 2O7UA 1D9VA 1FTOA 4O3BA 4THIA 2QS3A 3FVGA 1WDNA 2UXAA 3MVZA 3FXUA 4JXIA 2G29A 2QL3A 3MJNA 4F3PA 1Y9UA 4P0IA 2X7PA 1US4A 3C35A 2I58A 1MH3A 4K3FA 3RNNA 5JTYA 4ZE9A 4GIZA 3FVNA 3MP1A 5IAIA 1POY1 4AB5A 3OENA 4POWA 1NL5A 1M5CA 2DP8A 3OSRA 3V89B 4F2OA 2Z8FA 3W9VA 3MQ9A 1JW1A 1P1NA 4Z0IA 3B6QA 3IJXB 1JQFA 4XTCQ 3VVFA 3CG3A 2Z8DA 1MQGA 3QUJA 3TYHA 3UN6A 2PT2A 4M4GA 3TUSA 2F7AA 4EXLA 4GLIA 2QMWA 3C33A 4NEDA 1B51A 3K6UA 2Y7WA 4C1TA 3OO9A 1SI0A 4KD5A 2A5TB 1IXCA 1SW5A 1CE2A 1SQYA 1SD3A 2Z22A 5I57A 1P1UA 2HAUA 1WODA 1LFGA 2XHDA 2GHBA 4H65A 4LQ2A 3K6WA 4YZZA 1B05A 1MY1A 3HSTA 5A5XA 3CRBA 3DP8A 1B3GA 2Y84A 3QSLA 3VVEA 1IUDA 4XKPA 1A8EA 1MDP1 2GHAA 2PVUA 3UORA 3IB0A 1B58A 5H8FA 4XKNA 3CI8A 4GRKA 1N0TA 4NMYA 1VFDA 3T93B 2Y7KA 4NF4B 3N5LA 2O84X 2I4BA 4ECFA 3TAJA 1B0LA 2ESNA 1J1NA 2UVIA 1PB7A 3PUXE 3JV9A 4QFOA 2ANJA 4P0GA 3ILUB 3MPLA 4JBZA 4DDDA 5LOMA 4NF6B 4JWYA 4R6KA 4BDLA 4E0XA 4H5FA 5DVIA 1P1OA 1OLAA 3TELA 3KJTA 3ILTB 4YAHX 1FQCA 2I3VA 4U4XA 2RCAA 2DS9A 3SKPA 2I48A 2Q8JA 4BDOA 4ZZAA 2F7CA 1LB8A 3KN8A 1DPPA 2YJPA 4KCDA 5L9MA 1GGGA 3GLBA 3IO4A 4P11A 1IEJA 1XT8A 2ZMBA 2UVJA 5I56B 4PE5B 4RK9A 1OIBA 4YB5A 5IKBA 1URDA 1N3XA 2QJEA 1HSEA 5ITPA 3PUYE 1WVJA 1LCFA 2F78A 4KYEA 2Q9TA 3TMGA 5CBRA 4I9DA 4F29A 4Q8RA 2D5WA 3O9PA 5KDTB 4YKJA 4NWDA 3THIA 3KSJA 4OETA 4ZE8A 1M5BA 3UGWA 4IO2A 3MC2A 4IGRA 3FXRA 3RLFE 2O68A 4RK2A 4LVQA 1QJMA 5HPQA 4YMBA 2VD3A 2XD3A 3IOTA 2Q2CA 3E13X 1URGA 2LAOA 1RYOA 2I4CA 2PYYA 3SEYA 1FW0A 1B1XA 1BKAA 3TQWA 5JTYB 2ZNTA 1LCTA 2F36A 1A7LA 3LUYA 2O69A 2UVHA 4X9TA 2XXWA 1LAXA 4ISUA 5EHSA 3FJGA 1NH8A 2XXIA 2XXHA 1NKXA 1R9QA 2GRVA 1A99A 4QSEA 1AIVA 3FZVA 4MH5A 5I59A 1MXZA 2PMSA 1NFTA 3K01A 3SESA 3RQTA 3GZGA 4F22A 1MPDA 3TTLA 4Q30B 1N3WA 3O6IA 4H8IA 3IORA 3BBRA 2NWJA 1A55A 4U22A 2ONSA 4KCCA 1IXHA 3N6TA 1MQHA 1DSNA 3CVGA 5I2KA 1H43A 1VFEA 1FTMA 5A5XB 3MBPA 5DYHA 2ZXTA 1OVTA 3PD9A 4F2QA 3HPIA 2DE3A 1D3KA 3FASA 4NF8A 1MXXA 2UYFA 3JZJA 1JW4A 2F35A 1M5FA 2NOOA 4G8MA 4ELRA 5H8FB 3RTFB 3ODBA 4OFLA 3UIFA 3D4CA 4YB6A 4H0WA 5I84A 3EN3A 5DTBA 4OFJA 1SW2A 2H9BA 4G8NA 4EXKA 4KHZE 1EZPA 1Z7NE 5M2VA 2HQ0A 2PX1A 4RY1A 4ESXA 1QKBA 4OWDA 1URSA 1LFHA 5EYFA 1MQIA 3PUVE 3W9WA 4F1UA 1F9BA 4JSDA 3UK4A 2CZLA 3LSLA 4G68C 2DYXA 4R6YA 2NVUB 4F19A 1FQEA 4OENA 2ZYMA 2IEEA 3RT8A 1KWHA 4PFYA 3DELB 1QUKA 3CSBA 3R7XA 3T9UA 3H06B 4ZEKA 4OTEA 2OJTA 2I49A 3GXAA 4X48A 4ESWA 1B6HA 2M8CA 3U94A 1ZBMA 2ZYNA 3QUFA 2XX9A 4GL8A 4WKMA 3O66A 3ZKKA 4HTGA 2FNCA 4JDFA 3U72A 1NNFA 2VGQA 2DXRA 4Q5TA 2XXTA 1JETA 5ELVA 1IZ1A 3IB1A 3TFLA 4XKRA 5AA2D 4QFNA 4R9FA 1NNPA 2F34A 3MVWA 3LR1A 1VR5A 4YKIA 3GBBA 1MG1A 4LZ8A 5ISUA 1UQWA 3C31A 1QW0A 3I6VA 4H1XA 2Z8EA 3Q29A 2V3UA 2P0SA 3HN0A 2XXUA 1II5A 1Q35A 1Y1MA 1BTJA 2V3QA 2GFEA 4LATA 3FD3A 3KGCA 1DMBA 4R73A 3GBAA 1Q1KA 2I0BA 2R71A 3FATA 3PUZE 1ZLQA 3G3FA 2A5SA 3TTRA 3FV2A 1JVYA 5FHMA 1DPEA 2NXOA 1N7XA 1LBBA 4HS7A 1BIYA 4GF8A 5B7DA 4BLAA 3O29A 5CMKA 1AOVA 3JYRA 3T96B 4OVJA 3VE1B 1MM7A 1EH3A 2H4IA 3H6UA 3TQLA 4IO3A 4F39A 1H76A 4NF5A 4IB2A 4YB7A 4YKPA 1OLCA 4R9GA 2HZLA 3PUWE 5CM6A 3E4RA 2QPQA 4G68A 5I59B 3LSXA 3OO7A 1MPCA 1TT1A 1LLSA 4IY5A 2DXYA 4I62A 4BDQA 3G3IA 4RPOA 4RJZA 3R26A 4ONYA 4R72A 3C32A 3K6XA 1I69A 5L9SA 3IL1B 3EHTA 3S9NC 2RKMA 3H6WA 2Q89A 4PP0A 3SEWA 2X26A 5I2NB 3O6GA 4R74A 1QULA 5I2KB 3K4UA 3VXCA 3I3VA 4ELPA 3CFXA 5F1QA 2DOJA 4LP2B 4R75A 1FTLA 3MAMA 2DVZA 3H6TA 2XX7A 1TFDA 3T9VA 4YU0A 4NF8B 5JEIA 3HO7A 3SEUA 4L17A 4FAJA 3KFMA 3U1OA 4X1DA 4G4PA 1JW5A 3LSWA 2DWAA 3TODA 3VV5A 4N07A 1LAGE 4U23A 2D21A 4QFKA 4DXUA 4IO5A 5KCJA 4EQ9A 1ZJLA 3O28A 2XXPA 2RC7A 2RC8A 3B7DA 3PU5A 2ONKE 3QYTA 1AMFA 1LFIA 4FECA 1ZTYA 2DQVA 1S50A 2GH9A 2H25A 4QSDA 2F6GA 3PMWA 2RF1A 1B5HA 3KZGA 1NNKA 3OXNA 2R6GE 3IJOB 1SVXB 3T9XB 1NMUA 1N7WA 5TPAA 2VHAA 3G3GA 4OERA 3FJ7A 2Y7PA 4X1BA 2CMOA 1MDQA 1PEBA 4YICA 4R2FA 4MFIA 1ANFA 2PBWA 3AXFA 2DSFA 2DWJA 2I3WA 3CSGA 5BWJA 3G3KA 4N13A 5ICQA 4POXA 3UA8A 4FE8A 4DIGA 3DP6A 4BDNA 4ZS9A 3TTNA 3IR1A 4JSOA 1GR2A 3H3GA 4U21A 3TPAA 1LAFE 3KJ7A 1SI1A 1B52A 3N6UA 2OCUA 4PETA 2OLBA 5CMCA 5H8NA 4PFTA 3KOTA 1BP5A 2OZZA 1XHYA 4RNSA 2XXYA 4G2ZA 3B6WA 1JEUA 3QIMA 4OYVA 3RN8A 3A3CA 3TDJA 1Y1ZA 4EQBA 2ZNSA 3VLWA 4KYDA 3MPKA 3V83A 3PV0E 1EZOA 4EF1A 1Y3NA 3CG1A 3KOSA 4F3BA 3KN7A 1OVBA 3IAZA 4IGTA 3FIRA 1M5DA 3V8XB 1VSOA 1S9TA 2F7BA 3MZ9A 4IO4A 3B6TA 1PB8A 4IO7A 2F6PA 1H44A 2NUVA 3RY3A 4WEDA 3KG2A 2B3FA 4NF5B 3T9HB 1OMPA 3C9HA 1H3DA 2DWIA 5DT6A 1IIWA 1I6AA 1B1HA 1TWYA 4G68B 3M3KA 3G3HA 4OEVA 5H8HA 1B46A 4NTLA 3BFTA 1LB9A 2HCAA 5I57B 1OQHA 3RPWA 3KBRA 3LSFB 4ZEIA 1RYXA 1MH4A 3KN3A 2QMXA 1HSJA 5CMBA 3FVOA 1XVYA 1USYE 3QK6A 3EQ1A 3O2AA 5CBSA 1IITA 1MRPA 4O3AA 1MY4A 4ELOA 2O51A 4R6HA 3LBSA 2YPNA 2DWHA 1O7TA 1SYHA 1PC3A 5EHMA 4M1VA 4QRZA 1R6ZA 5CMMA 3C36A 3VFJA 1B3LA 5DVFA 3S2VA 1MY0A 3PPRA 3ONMA 5BUUA 2AL5A 5FTIA 1IXGA 2HAVA 4G77A 4EQ7A 3Q25A 3N94A 3RGYA 2BJJX 3F11A 3PMXA 3HHFA 2HXWA 3ECRA 1PB9A 4NE4A 1EZ9A 1A54A 4TQUQ 1ATGA 1R1NA 4DXBA 1YTVA 2V84A 3IB2A 4QHQA 4C1UA 2HEUA 5KCJB 4LA9A 2YLNA 4U1ZA 4GL0A 5KZTA 2XD2A 4NWCA 1FTKA 4I8CA 3S9MC 4E0WA 3BFUA 4PFUA 3EHUA 4KQPA 3OEKA 3VVDA 5H8SA 1TFAA 4GVOA 2RC9A 1MXYA 3K6VA 5FHOA 3SEVA 2XX8A 4OXVA 2E0SA 1MXVA 1LGBC 3IO6A 5TPAB 3UP9A 1US5A 2V3TA 1Z7ME 5AA4A 3T66A 4YMAA 1B3FA 2FA7A 1XS5A 4MF3A 1JVXA 3IOVA 3O97A 1MQJA 1DTZA 2ZNUA 1D4NA 4XKQA 2R9JA 1DOTA 5AE4A 3EF7A 1ZKBA 1SW1A 3WAFA 5CI5A 4ZDMA 3CFLA 3A3UA 1P99A 5TP9A 1ZU0A 1XVXA 1B40A 4KPTA 4MBPA 4JWXA 1QKAA 3T22A 4GOTA 1MQDA 1B3HA 5H8NB 3TCHA 3E3KA 1YCJA 4OZ9A 3OEMA 5AA3A 1R9LA 2HFBA 1B0HA 3I5OA 4OEUA 5DEXA 1MS7A 5I58A 3WAEA 3IOUA 3MWBA 4GXSB 5H8QA 4WEPA 1B4ZA 3H03A 2XXRA 1FTJA 4U4SA 1A40A 4F18A 1T0KA 4KYSA 3MVXA 1GVCA 4ZECA 1IQ7A 1N76A 1JEVA 2F8DA 3L6HA 4QF9A 3A09A 1SYIA 3HV1A 3FXQA 5AA2A 3PMVA 4FJPA 3TEPA 2ALUA 1B5JA 2H99A 4TLMB 1P1QA 1B4HA 1ELJA 2RCBA 3VLUA 1PBPA 3MZ1A 2H98A 4LQ5A 5H8HB 1L5TA 1ZMGA 1JNFA 3R6UA 3TTKA 4EDPA 2Q2AA 3BKIB 4RPNA 4QSCA 3H4ZA 4ZEDA 5K2YA 2B65A 4XIGQ 3K2DA 3U92A 2QS2A 3CIJA 2VD2A 3LC8A 4H5GA 5B70A 3HCQA 3EPEA 1B7HA 2DE4A 4ZZEA 5ICTA 1AL3A 1SDXA 1B7UA 1OQGA 5FTHA 4QFPA 2OWSA 1UTHA 1HSLA 1LAHE 4F31B 3H6VA 3S4UA 4ND9A 5TU0A 1AH5A 2QSXA 3C4MA 1YAEA 2D3IA 4EF2A 3FV1A 3G7WA 1MXWA 4PQJA 4FEBA 1Y20A 3U8QA 1UIVA 4FATA 3S9EA 2QRYA 1EU8A 4C0RA 3OSQA 3IK6B 1MM6A 1ZIUA 3K00A 2DE2A 4ZEFA 3SDFA 4F3GA 1FQBA 1B3EA 1GTKA 3PD8A 4JWOA 2F5XA 4UACA 1LBCA 1FCKA 1PBQA 3Q26A 3RUMA 3SEXA 3KEIA 3O6HA 2QS1A 4LZ5A 3PPQA 1MPBA 3OOAA 3ZKLA 3VXBA 4GWOA 3K1MA 4FIMA 1FQDA 4F1VA 1UTBA 3K0VA 2QS4A 5L9OA 3IOWA 3ZS6A 3FGSA 5AA4B 1Y4CA 3TKDA 4LONB 3U93A 4HCYA 1DTGA 4IO6A 1B7ZA 1B5IA 3FVKA 1MY3A 4F1YA 2I0CA 4H6DA 1PDAA 4R2BA 4RYAA 5F7VA 5DVJA 4KI0E 3OO6A 4EUOA 2ONRA 3MW0A 3RT6B 5TP9B 5CRYA 3VDFA 1USYH 2Z23A 4JB7A 3K1NA 4MLQA 3PPNA 1UIUA 1IXIA 4O3CA 1POTA 5L8DA 4YKKA 3S9LC 1NH7A 3CFZA 2G93A 1LSTA 1XC1A 3K1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4G A;  4RXL A;  1M5E A;  1A8F A;  2VP1 A;  4FED A;  2Q88 A;  1FQA A;  3IX1 A;  2AIX A;  3C34 A;  2F97 A;  2PT1 A;  1QUI A;  5DEX B;  4FOR A;  2OWT A;  3KSX A;  5I58 B;  1NNT A;  2I6E A;  3MUQ A;  5H8Q B;  1XOC A;  5HM4 B;  3TCG A;  1GV8 A;  2H5Y A;  1Y3P A;  3OMB A;  4GQO A;  4MLV A;  4GXA A;  1BLF A;  2X7Q A;  5ITO A;  3K02 A;  3OEL A;  4UA8 A;  2P2A A;  1I6B A;  4WXJ A;  3DLN A;  2AYS A;  4OQO A;  4BDM A;  5AA2 B;  1B9J A;  4KFQ A;  3V5A A;  3H7M A;  4OHN A;  2A5T A;  1TXF A;  2WKY A;  3DM0 A;  1YPN A;  1MXU A;  1QVS A;  4GD5 A;  2O1L A;  2V25 A;  3PPO A;  3TZA A;  1Y3Q A;  4QFL A;  3QXM A;  4U2R A;  1RKM A;  2O7I A;  4DXC A;  5I2N A;  1O64 A;  2XXQ A;  4BDR A;  1SW4 A;  2REJ A;  2W7Y A;  1P1W A;  3P7I A;  3FUZ A;  4DLD A;  4GFR A;  4OFO A;  4OES A;  3USD A;  2V93 A;  2FYI A;  3L6G A;  4Q0C A;  1FQF A;  2UVG A;  1UTH B;  4ELQ A;  2RIN A;  4AQ4 A;  1CB6 A;  2UYE A;  4KR5 A;  1D9Y A;  1MY2 A;  3SER A;  4NF4 A;  3RTW B;  5AA1 A;  2OBG A;  4H8J A;  2ZYK A;  1SBP A;  4HW8 A;  4LZ7 A;  4IY6 A;  1S7Y A;  4G8H A;  2E1S A;  5K2X A;  3HHG A;  4H67 A;  4XXU A;  3ZSF A;  2O1M A;  4NF6 A;  1I6Q A;  1B2H A;  3CR9 A;  3MP8 A;  4TLL B;  2O6A A;  4AB6 A;  2XXX A;  4U1O A;  2AL4 A;  4TOZ A;  2THI A;  3EHS A;  2B3B A;  4RA1 A;  4LUB A;  2KLF A;  3OO8 A;  4OMB A;  3PGF A;  2VOZ A;  5JK4 A;  1B32 A;  2HZK A;  2Y7R A;  4DCY A;  3W15 C;  2P1S A;  3DP4 A;  4F3S A;  4Z7E A;  3Q28 A;  2DVC A;  5CC2 A;  4HCW A;  2Y7I A;  4PFW A;  3M8U A;  2ZYO A;  3PPP A;  4N6P A;  3TCF A;  5J1D A;  2REG A;  4DCX A;  4DE8 A;  5I56 A;  1UTB B;  3N26 A;  1O63 A;  3FJM A;  2ABH A;  1N04 A;  3VLV A;  3Q27 A;  3QAX A;  1N84 A;  3MVY A;  3MP6 A;  2XXV A;  4DZ1 A;  1Y4T A;  3MZB A;  3M3F A;  3TTM A;  3G3J A;  3SET A;  3M3L A;  5KDT A;  2OK2 A;  1VE4 A;  3E9X A;  1H45 A;  2IA4 A;  3OD7 A;  5HBC A;  4ZEB A;  4I1D A;  5FHN A;  1QUJ A;  2O7U A;  1D9V A;  1FTO A;  4O3B A;  4THI A;  2QS3 A;  3FVG A;  1WDN A;  2UXA A;  3MVZ A;  3FXU A;  4JXI A;  2G29 A;  2QL3 A;  3MJN A;  4F3P A;  1Y9U A;  4P0I A;  2X7P A;  1US4 A;  3C35 A;  2I58 A;  1MH3 A;  4K3F A;  3RNN A;  5JTY A;  4ZE9 A;  4GIZ A;  3FVN A;  3MP1 A;  5IAI A;  1POY 1;  4AB5 A;  3OEN A;  4POW A;  1NL5 A;  1M5C A;  2DP8 A;  3OSR A;  3V89 B;  4F2O A;  2Z8F A;  3W9V A;  3MQ9 A;  1JW1 A;  1P1N A;  4Z0I A;  3B6Q A;  3IJX B;  1JQF A;  4XTC Q;  3VVF A;  3CG3 A;  2Z8D A;  1MQG A;  3QUJ A;  3TYH A;  3UN6 A;  2PT2 A;  4M4G A;  3TUS A;  2F7A A;  4EXL A;  4GLI A;  2QMW A;  3C33 A;  4NED A;  1B51 A;  3K6U A;  2Y7W A;  4C1T A;  3OO9 A;  1SI0 A;  4KD5 A;  2A5T B;  1IXC A;  1SW5 A;  1CE2 A;  1SQY A;  1SD3 A;  2Z22 A;  5I57 A;  1P1U A;  2HAU A;  1WOD A;  1LFG A;  2XHD A;  2GHB A;  4H65 A;  4LQ2 A;  3K6W A;  4YZZ A;  1B05 A;  1MY1 A;  3HST A;  5A5X A;  3CRB A;  3DP8 A;  1B3G A;  2Y84 A;  3QSL A;  3VVE A;  1IUD A;  4XKP A;  1A8E A;  1MDP 1;  2GHA A;  2PVU A;  3UOR A;  3IB0 A;  1B58 A;  5H8F A;  4XKN A;  3CI8 A;  4GRK A;  1N0T A;  4NMY A;  1VFD A;  3T93 B;  2Y7K A;  4NF4 B;  3N5L A;  2O84 X;  2I4B A;  4ECF A;  3TAJ A;  1B0L A;  2ESN A;  1J1N A;  2UVI A;  1PB7 A;  3PUX E;  3JV9 A;  4QFO A;  2ANJ A;  4P0G A;  3ILU B;  3MPL A;  4JBZ A;  4DDD A;  5LOM A;  4NF6 B;  4JWY A;  4R6K A;  4BDL A;  4E0X A;  4H5F A;  5DVI A;  1P1O A;  1OLA A;  3TEL A;  3KJT A;  3ILT B;  4YAH X;  1FQC A;  2I3V A;  4U4X A;  2RCA A;  2DS9 A;  3SKP A;  2I48 A;  2Q8J A;  4BDO A;  4ZZA A;  2F7C A;  1LB8 A;  3KN8 A;  1DPP A;  2YJP A;  4KCD A;  5L9M A;  1GGG A;  3GLB A;  3IO4 A;  4P11 A;  1IEJ A;  1XT8 A;  2ZMB A;  2UVJ A;  5I56 B;  4PE5 B;  4RK9 A;  1OIB A;  4YB5 A;  5IKB A;  1URD A;  1N3X A;  2QJE A;  1HSE A;  5ITP A;  3PUY E;  1WVJ A;  1LCF A;  2F78 A;  4KYE A;  2Q9T A;  3TMG A;  5CBR A;  4I9D A;  4F29 A;  4Q8R A;  2D5W A;  3O9P A;  5KDT B;  4YKJ A;  4NWD A;  3THI A;  3KSJ A;  4OET A;  4ZE8 A;  1M5B A;  3UGW A;  4IO2 A;  3MC2 A;  4IGR A;  3FXR A;  3RLF E;  2O68 A;  4RK2 A;  4LVQ A;  1QJM A;  5HPQ A;  4YMB A;  2VD3 A;  2XD3 A;  3IOT A;  2Q2C A;  3E13 X;  1URG A;  2LAO A;  1RYO A;  2I4C A;  2PYY A;  3SEY A;  1FW0 A;  1B1X A;  1BKA A;  3TQW A;  5JTY B;  2ZNT A;  1LCT A;  2F36 A;  1A7L A;  3LUY A;  2O69 A;  2UVH A;  4X9T A;  2XXW A;  1LAX A;  4ISU A;  5EHS A;  3FJG A;  1NH8 A;  2XXI A;  2XXH A;  1NKX A;  1R9Q A;  2GRV A;  1A99 A;  4QSE A;  1AIV A;  3FZV A;  4MH5 A;  5I59 A;  1MXZ A;  2PMS A;  1NFT A;  3K01 A;  3SES A;  3RQT A;  3GZG A;  4F22 A;  1MPD A;  3TTL A;  4Q30 B;  1N3W A;  3O6I A;  4H8I A;  3IOR A;  3BBR A;  2NWJ A;  1A55 A;  4U22 A;  2ONS A;  4KCC A;  1IXH A;  3N6T A;  1MQH A;  1DSN A;  3CVG A;  5I2K A;  1H43 A;  1VFE A;  1FTM A;  5A5X B;  3MBP A;  5DYH A;  2ZXT A;  1OVT A;  3PD9 A;  4F2Q A;  3HPI A;  2DE3 A;  1D3K A;  3FAS A;  4NF8 A;  1MXX A;  2UYF A;  3JZJ A;  1JW4 A;  2F35 A;  1M5F A;  2NOO A;  4G8M A;  4ELR A;  5H8F B;  3RTF B;  3ODB A;  4OFL A;  3UIF A;  3D4C A;  4YB6 A;  4H0W A;  5I84 A;  3EN3 A;  5DTB A;  4OFJ A;  1SW2 A;  2H9B A;  4G8N A;  4EXK A;  4KHZ E;  1EZP A;  1Z7N E;  5M2V A;  2HQ0 A;  2PX1 A;  4RY1 A;  4ESX A;  1QKB A;  4OWD A;  1URS A;  1LFH A;  5EYF A;  1MQI A;  3PUV E;  3W9W A;  4F1U A;  1F9B A;  4JSD A;  3UK4 A;  2CZL A;  3LSL A;  4G68 C;  2DYX A;  4R6Y A;  2NVU B;  4F19 A;  1FQE A;  4OEN A;  2ZYM A;  2IEE A;  3RT8 A;  1KWH A;  4PFY A;  3DEL B;  1QUK A;  3CSB A;  3R7X A;  3T9U A;  3H06 B;  4ZEK A;  4OTE A;  2OJT A;  2I49 A;  3GXA A;  4X48 A;  4ESW A;  1B6H A;  2M8C A;  3U94 A;  1ZBM A;  2ZYN A;  3QUF A;  2XX9 A;  4GL8 A;  4WKM A;  3O66 A;  3ZKK A;  4HTG A;  2FNC A;  4JDF A;  3U72 A;  1NNF A;  2VGQ A;  2DXR A;  4Q5T A;  2XXT A;  1JET A;  5ELV A;  1IZ1 A;  3IB1 A;  3TFL A;  4XKR A;  5AA2 D;  4QFN A;  4R9F A;  1NNP A;  2F34 A;  3MVW A;  3LR1 A;  1VR5 A;  4YKI A;  3GBB A;  1MG1 A;  4LZ8 A;  5ISU A;  1UQW A;  3C31 A;  1QW0 A;  3I6V A;  4H1X A;  2Z8E A;  3Q29 A;  2V3U A;  2P0S A;  3HN0 A;  2XXU A;  1II5 A;  1Q35 A;  1Y1M A;  1BTJ A;  2V3Q A;  2GFE A;  4LAT A;  3FD3 A;  3KGC A;  1DMB A;  4R73 A;  3GBA A;  1Q1K A;  2I0B A;  2R71 A;  3FAT A;  3PUZ E;  1ZLQ A;  3G3F A;  2A5S A;  3TTR A;  3FV2 A;  1JVY A;  5FHM A;  1DPE A;  2NXO A;  1N7X A;  1LBB A;  4HS7 A;  1BIY A;  4GF8 A;  5B7D A;  4BLA A;  3O29 A;  5CMK A;  1AOV A;  3JYR A;  3T96 B;  4OVJ A;  3VE1 B;  1MM7 A;  1EH3 A;  2H4I A;  3H6U A;  3TQL A;  4IO3 A;  4F39 A;  1H76 A;  4NF5 A;  4IB2 A;  4YB7 A;  4YKP A;  1OLC A;  4R9G A;  2HZL A;  3PUW E;  5CM6 A;  3E4R A;  2QPQ A;  4G68 A;  5I59 B;  3LSX A;  3OO7 A;  1MPC A;  1TT1 A;  1LLS A;  4IY5 A;  2DXY A;  4I62 A;  4BDQ A;  3G3I A;  4RPO A;  4RJZ A;  3R26 A;  4ONY A;  4R72 A;  3C32 A;  3K6X A;  1I69 A;  5L9S A;  3IL1 B;  3EHT A;  3S9N C;  2RKM A;  3H6W A;  2Q89 A;  4PP0 A;  3SEW A;  2X26 A;  5I2N B;  3O6G A;  4R74 A;  1QUL A;  5I2K B;  3K4U A;  3VXC A;  3I3V A;  4ELP A;  3CFX A;  5F1Q A;  2DOJ A;  4LP2 B;  4R75 A;  1FTL A;  3MAM A;  2DVZ A;  3H6T A;  2XX7 A;  1TFD A;  3T9V A;  4YU0 A;  4NF8 B;  5JEI A;  3HO7 A;  3SEU A;  4L17 A;  4FAJ A;  3KFM A;  3U1O A;  4X1D A;  4G4P A;  1JW5 A;  3LSW A;  2DWA A;  3TOD A;  3VV5 A;  4N07 A;  1LAG E;  4U23 A;  2D21 A;  4QFK A;  4DXU A;  4IO5 A;  5KCJ A;  4EQ9 A;  1ZJL A;  3O28 A;  2XXP A;  2RC7 A;  2RC8 A;  3B7D A;  3PU5 A;  2ONK E;  3QYT A;  1AMF A;  1LFI A;  4FEC A;  1ZTY A;  2DQV A;  1S50 A;  2GH9 A;  2H25 A;  4QSD A;  2F6G A;  3PMW A;  2RF1 A;  1B5H A;  3KZG A;  1NNK A;  3OXN A;  2R6G E;  3IJO B;  1SVX B;  3T9X B;  1NMU A;  1N7W A;  5TPA A;  2VHA A;  3G3G A;  4OER A;  3FJ7 A;  2Y7P A;  4X1B A;  2CMO A;  1MDQ A;  1PEB A;  4YIC A;  4R2F A;  4MFI A;  1ANF A;  2PBW A;  3AXF A;  2DSF A;  2DWJ A;  2I3W A;  3CSG A;  5BWJ A;  3G3K A;  4N13 A;  5ICQ A;  4POX A;  3UA8 A;  4FE8 A;  4DIG A;  3DP6 A;  4BDN A;  4ZS9 A;  3TTN A;  3IR1 A;  4JSO A;  1GR2 A;  3H3G A;  4U21 A;  3TPA A;  1LAF E;  3KJ7 A;  1SI1 A;  1B52 A;  3N6U A;  2OCU A;  4PET A;  2OLB A;  5CMC A;  5H8N A;  4PFT A;  3KOT A;  1BP5 A;  2OZZ A;  1XHY A;  4RNS A;  2XXY A;  4G2Z A;  3B6W A;  1JEU A;  3QIM A;  4OYV A;  3RN8 A;  3A3C A;  3TDJ A;  1Y1Z A;  4EQB A;  2ZNS A;  3VLW A;  4KYD A;  3MPK A;  3V83 A;  3PV0 E;  1EZO A;  4EF1 A;  1Y3N A;  3CG1 A;  3KOS A;  4F3B A;  3KN7 A;  1OVB A;  3IAZ A;  4IGT A;  3FIR A;  1M5D A;  3V8X B;  1VSO A;  1S9T A;  2F7B A;  3MZ9 A;  4IO4 A;  3B6T A;  1PB8 A;  4IO7 A;  2F6P A;  1H44 A;  2NUV A;  3RY3 A;  4WED A;  3KG2 A;  2B3F A;  4NF5 B;  3T9H B;  1OMP A;  3C9H A;  1H3D A;  2DWI A;  5DT6 A;  1IIW A;  1I6A A;  1B1H A;  1TWY A;  4G68 B;  3M3K A;  3G3H A;  4OEV A;  5H8H A;  1B46 A;  4NTL A;  3BFT A;  1LB9 A;  2HCA A;  5I57 B;  1OQH A;  3RPW A;  3KBR A;  3LSF B;  4ZEI A;  1RYX A;  1MH4 A;  3KN3 A;  2QMX A;  1HSJ A;  5CMB A;  3FVO A;  1XVY A;  1USY E;  3QK6 A;  3EQ1 A;  3O2A A;  5CBS A;  1IIT A;  1MRP A;  4O3A A;  1MY4 A;  4ELO A;  2O51 A;  4R6H A;  3LBS A;  2YPN A;  2DWH A;  1O7T A;  1SYH A;  1PC3 A;  5EHM A;  4M1V A;  4QRZ A;  1R6Z A;  5CMM A;  3C36 A;  3VFJ A;  1B3L A;  5DVF A;  3S2V A;  1MY0 A;  3PPR A;  3ONM A;  5BUU A;  2AL5 A;  5FTI A;  1IXG A;  2HAV A;  4G77 A;  4EQ7 A;  3Q25 A;  3N94 A;  3RGY A;  2BJJ X;  3F11 A;  3PMX A;  3HHF A;  2HXW A;  3ECR A;  1PB9 A;  4NE4 A;  1EZ9 A;  1A54 A;  4TQU Q;  1ATG A;  1R1N A;  4DXB A;  1YTV A;  2V84 A;  3IB2 A;  4QHQ A;  4C1U A;  2HEU A;  5KCJ B;  4LA9 A;  2YLN A;  4U1Z A;  4GL0 A;  5KZT A;  2XD2 A;  4NWC A;  1FTK A;  4I8C A;  3S9M C;  4E0W A;  3BFU A;  4PFU A;  3EHU A;  4KQP A;  3OEK A;  3VVD A;  5H8S A;  1TFA A;  4GVO A;  2RC9 A;  1MXY A;  3K6V A;  5FHO A;  3SEV A;  2XX8 A;  4OXV A;  2E0S A;  1MXV A;  1LGB C;  3IO6 A;  5TPA B;  3UP9 A;  1US5 A;  2V3T A;  1Z7M E;  5AA4 A;  3T66 A;  4YMA A;  1B3F A;  2FA7 A;  1XS5 A;  4MF3 A;  1JVX A;  3IOV A;  3O97 A;  1MQJ A;  1DTZ A;  2ZNU A;  1D4N A;  4XKQ A;  2R9J A;  1DOT A;  5AE4 A;  3EF7 A;  1ZKB A;  1SW1 A;  3WAF A;  5CI5 A;  4ZDM A;  3CFL A;  3A3U A;  1P99 A;  5TP9 A;  1ZU0 A;  1XVX A;  1B40 A;  4KPT A;  4MBP A;  4JWX A;  1QKA A;  3T22 A;  4GOT A;  1MQD A;  1B3H A;  5H8N B;  3TCH A;  3E3K A;  1YCJ A;  4OZ9 A;  3OEM A;  5AA3 A;  1R9L A;  2HFB A;  1B0H A;  3I5O A;  4OEU A;  5DEX A;  1MS7 A;  5I58 A;  3WAE A;  3IOU A;  3MWB A;  4GXS B;  5H8Q A;  4WEP A;  1B4Z A;  3H03 A;  2XXR A;  1FTJ A;  4U4S A;  1A40 A;  4F18 A;  1T0K A;  4KYS A;  3MVX A;  1GVC A;  4ZEC A;  1IQ7 A;  1N76 A;  1JEV A;  2F8D A;  3L6H A;  4QF9 A;  3A09 A;  1SYI A;  3HV1 A;  3FXQ A;  5AA2 A;  3PMV A;  4FJP A;  3TEP A;  2ALU A;  1B5J A;  2H99 A;  4TLM B;  1P1Q A;  1B4H A;  1ELJ A;  2RCB A;  3VLU A;  1PBP A;  3MZ1 A;  2H98 A;  4LQ5 A;  5H8H B;  1L5T A;  1ZMG A;  1JNF A;  3R6U A;  3TTK A;  4EDP A;  2Q2A A;  3BKI B;  4RPN A;  4QSC A;  3H4Z A;  4ZED A;  5K2Y A;  2B65 A;  4XIG Q;  3K2D A;  3U92 A;  2QS2 A;  3CIJ A;  2VD2 A;  3LC8 A;  4H5G A;  5B70 A;  3HCQ A;  3EPE A;  1B7H A;  2DE4 A;  4ZZE A;  5ICT A;  1AL3 A;  1SDX A;  1B7U A;  1OQG A;  5FTH A;  4QFP A;  2OWS A;  1UTH A;  1HSL A;  1LAH E;  4F31 B;  3H6V A;  3S4U A;  4ND9 A;  5TU0 A;  1AH5 A;  2QSX A;  3C4M A;  1YAE A;  2D3I A;  4EF2 A;  3FV1 A;  3G7W A;  1MXW A;  4PQJ A;  4FEB A;  1Y20 A;  3U8Q A;  1UIV A;  4FAT A;  3S9E A;  2QRY A;  1EU8 A;  4C0R A;  3OSQ A;  3IK6 B;  1MM6 A;  1ZIU A;  3K00 A;  2DE2 A;  4ZEF A;  3SDF A;  4F3G A;  1FQB A;  1B3E A;  1GTK A;  3PD8 A;  4JWO A;  2F5X A;  4UAC A;  1LBC A;  1FCK A;  1PBQ A;  3Q26 A;  3RUM A;  3SEX A;  3KEI A;  3O6H A;  2QS1 A;  4LZ5 A;  3PPQ A;  1MPB A;  3OOA A;  3ZKL A;  3VXB A;  4GWO A;  3K1M A;  4FIM A;  1FQD A;  4F1V A;  1UTB A;  3K0V A;  2QS4 A;  5L9O A;  3IOW A;  3ZS6 A;  3FGS A;  5AA4 B;  1Y4C A;  3TKD A;  4LON B;  3U93 A;  4HCY A;  1DTG A;  4IO6 A;  1B7Z A;  1B5I A;  3FVK A;  1MY3 A;  4F1Y A;  2I0C A;  4H6D A;  1PDA A;  4R2B A;  4RYA A;  5F7V A;  5DVJ A;  4KI0 E;  3OO6 A;  4EUO A;  2ONR A;  3MW0 A;  3RT6 B;  5TP9 B;  5CRY A;  3VDF A;  1USY H;  2Z23 A;  4JB7 A;  3K1N A;  4MLQ A;  3PPN A;  1UIU A;  1IXI A;  4O3C A;  1POT A;  5L8D A;  4YKK A;  3S9L C;  1NH7 A;  3CFZ A;  2G93 A;  1LST A;  1XC1 A;  3K1P A; 
#chains in the Genus database with same CATH topology
 3D4G A;  1KZ8 A;  4RXL A;  1NUW A;  1M5E A;  1A8F A;  2VP1 A;  4FED A;  2Q88 A;  4N15 A;  1FQA A;  3IX1 A;  2AIX A;  3C34 A;  2F97 A;  4PTK A;  2PT1 A;  1QUI A;  5DEX B;  1IMC A;  4FOR A;  2OWT A;  3PTY A;  3KSX A;  5I58 B;  1NNT A;  2I6E A;  3MUQ A;  5H8Q B;  1XOC A;  5HM4 B;  4PFI A;  3TCG A;  1GV8 A;  2H5Y A;  1Y3P A;  3OMB A;  4GQO A;  1YXI A;  4MLV A;  4GXA A;  1FPE A;  1BLF A;  2X7Q A;  4MJO A;  3K02 A;  5ITO A;  3OEL A;  4P47 A;  4UA8 A;  2P2A A;  1I6B A;  4WXJ A;  3DLN A;  2AYS A;  4OQO A;  4BDM A;  3E79 A;  5AA2 B;  1B9J A;  4KFQ A;  3V5A A;  5ESY A;  3H7M A;  3RPL B;  4OHN A;  2A5T A;  1TXF A;  2WKY A;  3DM0 A;  1YPN A;  1MXU A;  1QVS A;  4GD5 A;  2O1L A;  2V25 A;  4JVC A;  3PPO A;  3TZA A;  3BIG A;  1Y3Q A;  4QFL A;  3QXM A;  4U2R A;  1RKM A;  2O7I A;  4DXC A;  2WEF A;  5I2N A;  1O64 A;  2XXQ A;  3FXB A;  4PAI A;  4BDR A;  1SW4 A;  2REJ A;  2W7Y A;  5I7I A;  1P1W A;  3P7I A;  4OAN A;  3FUZ A;  4DLD A;  4GFR A;  4OFO A;  4OES A;  3USD A;  2V93 A;  2FYI A;  3L6G A;  4Q0C A;  1FQF A;  2UVG A;  1UTH B;  4ELQ A;  2RIN A;  4AQ4 A;  1CB6 A;  2UYE A;  4KR5 A;  2JJK A;  1D9Y A;  1MY2 A;  3SER A;  4NF4 A;  2FBP A;  3RTW B;  1YZ0 A;  5AA1 A;  2OBG A;  4H8J A;  1EYJ A;  2ZYK A;  1SBP A;  4HW8 A;  4LZ7 A;  4IY6 A;  1S7Y A;  4G8H A;  2E1S A;  4N6D A;  5K2X A;  3HHG A;  4H67 A;  1IMA A;  4XXU A;  3ZSF A;  2O1M A;  4NF6 A;  1I6Q A;  1B2H A;  3CR9 A;  3MP8 A;  4TLL B;  2O6A A;  4AB6 A;  2XXX A;  4U1O A;  2AL4 A;  1FPK A;  4TOZ A;  2THI A;  3EHS A;  2B3B A;  4MHF A;  4RA1 A;  4LUB A;  2KLF A;  3OO8 A;  4OMB A;  3PGF A;  2VOZ A;  5JK4 A;  1FBE A;  1B32 A;  2HZK A;  4O8M A;  2Y7R A;  4DCY A;  3ROJ A;  3W15 C;  2P1S A;  3DP4 A;  4F3S A;  4Z7E A;  3Q28 A;  4XEQ A;  1LBY A;  2DVC A;  4GX3 A;  5CC2 A;  4HCW A;  2Y7I A;  5EQ9 A;  4PFW A;  3M8U A;  2ZYO A;  3PPP A;  4N6P A;  3TCF A;  5J1D A;  3KBZ A;  4HE0 A;  2REG A;  4HXV A;  4DCX A;  3HFU A;  4DE8 A;  5I56 A;  1UTB B;  4GWZ A;  3N26 A;  1O63 A;  3FJM A;  2ABH A;  1N04 A;  3VLV A;  4NAP A;  3Q27 A;  3QAX A;  2VT5 A;  1N84 A;  3MVY A;  1D9Q A;  3MP6 A;  2XXV A;  4DZ1 A;  1Y4T A;  3MZB A;  3M3F A;  3TTM A;  3G3J A;  3SET A;  4N91 A;  3M3L A;  5KDT A;  2OK2 A;  1VE4 A;  3E9X A;  1H45 A;  2IA4 A;  3OD7 A;  5HBC A;  4ZEB A;  4I1D A;  5FHN A;  1QUJ A;  2O7U A;  1D9V A;  1FTO A;  4O3B A;  4THI A;  1FJ6 A;  2QS3 A;  3FVG A;  1WDN A;  2UXA A;  4FBP A;  3MVZ A;  3FXU A;  2Q74 A;  4JXI A;  4QBA A;  2G29 A;  2QL3 A;  3MJN A;  3SZP A;  4F3P A;  1Y9U A;  4P0I A;  2X7P A;  1US4 A;  5ET7 A;  3C35 A;  2I58 A;  1MH3 A;  4K3F A;  3RNN A;  2L5V A;  3QMF A;  5JTY A;  2F3B A;  4ZE9 A;  4GIZ A;  3FVN A;  3MP1 A;  5IAI A;  1POY 1;  4MIJ A;  4AB5 A;  3OEN A;  4POW A;  1NL5 A;  1M5C A;  2DP8 A;  3OSR A;  3V89 B;  1INP A;  4F2O A;  2Z8F A;  3W9V A;  3MQ9 A;  1JW1 A;  3KC1 A;  1P1N A;  4Z0I A;  3B6Q A;  3IJX B;  1JQF A;  4XTC Q;  3VVF A;  3CG3 A;  2Z8D A;  1MQG A;  4H45 A;  3QUJ A;  4O7I A;  3TYH A;  3UN6 A;  2PT2 A;  4M4G A;  3TUS A;  2PFY A;  2XA5 A;  2F7A A;  4EXL A;  4GLI A;  2QMW A;  3C33 A;  4NED A;  5T3J A;  1B51 A;  3K6U A;  4PCD A;  2Y7W A;  4C1T A;  3OO9 A;  1SI0 A;  4KD5 A;  2A5T B;  1IXC A;  1SW5 A;  1CE2 A;  1FTA A;  1SQY A;  1SD3 A;  2Z22 A;  5I57 A;  1FBP A;  1P1U A;  2HAU A;  1WOD A;  1LFG A;  2XHD A;  2GHB A;  4H65 A;  4LQ2 A;  3K6W A;  4YZZ A;  1B05 A;  2P3N A;  4PAF A;  1MY1 A;  3HST A;  5A5X A;  3CRB A;  3DP8 A;  5IGA A;  1B3G A;  1LBZ A;  2Y84 A;  3QSL A;  3VVE A;  1IUD A;  4XKP A;  1A8E A;  4P1L A;  1CNQ A;  1MDP 1;  2GHA A;  2PVU A;  3UOR A;  3IB0 A;  1FBD A;  1B58 A;  5H8F A;  4XKN A;  3CI8 A;  4GRK A;  1N0T A;  2HPG A;  1G0I A;  4NMY A;  1VFD A;  3T93 B;  4OVT A;  2Y7K A;  4NF4 B;  3N5L A;  2O84 X;  2I4B A;  4ECF A;  3TAJ A;  1B0L A;  2ESN A;  1J1N A;  2UVI A;  1PB7 A;  3PUX E;  3JV9 A;  4XFE A;  4QFO A;  2ANJ A;  4P0G A;  1NV2 A;  3ILU B;  3MPL A;  4HE1 A;  4P9K A;  4JBZ A;  4DDD A;  5LOM A;  4NF6 B;  4JWY A;  4R6K A;  4BDL A;  4E0X A;  4H5F A;  5DVI A;  1P1O A;  4PDD A;  1OLA A;  3TEL A;  3KJT A;  3ILT B;  4YAH X;  1FQC A;  2I3V A;  4U4X A;  2RCA A;  2DS9 A;  3SKP A;  2I48 A;  2Q8J A;  4BDO A;  4ZZA A;  2F7C A;  1LB8 A;  3KN8 A;  1IME A;  1NV4 A;  1DPP A;  2YJP A;  4KCD A;  4NF0 A;  4MNC A;  5L9M A;  4P11 A;  1GGG A;  3GLB A;  3IO4 A;  1IEJ A;  3IFA A;  1XT8 A;  2DDK A;  2WYK A;  2ZMB A;  2UVJ A;  5I56 B;  1FPG A;  3LV0 A;  4PE5 B;  5IZ3 A;  4RK9 A;  1Q9D A;  1OIB A;  4YB5 A;  5IKB A;  1URD A;  1N3X A;  2QJE A;  1HSE A;  2P3V A;  5ITP A;  3PUY E;  1WVJ A;  1LCF A;  2F78 A;  4KYE A;  2Q9T A;  3TMG A;  5CBR A;  4I9D A;  1FRP A;  4F29 A;  4Q8R A;  2D5W A;  3O9P A;  5KDT B;  5LDZ A;  4YKJ A;  4NWD A;  3THI A;  3KSJ A;  4OET A;  4MCO A;  4ZE8 A;  1M5B A;  3UGW A;  4IO2 A;  3MC2 A;  1RDX A;  4UAB A;  4IGR A;  3FXR A;  3RLF E;  2O68 A;  4RK2 A;  3LUZ A;  4LVQ A;  1QJM A;  3CHG A;  5HPQ A;  4YMB A;  2VD3 A;  2XD3 A;  3IOT A;  2Q2C A;  2HHM A;  3E13 X;  1URG A;  2LAO A;  4N6K A;  1RYO A;  4AS5 A;  2I4C A;  2PYY A;  3SEY A;  1FW0 A;  1B1X A;  1BKA A;  3TQW A;  5JTY B;  2ZNT A;  1LCT A;  2F36 A;  1A7L A;  3LUY A;  2O69 A;  2UVH A;  4X9T A;  2XXW A;  1LAX A;  4ISU A;  5EHS A;  3FJG A;  1NH8 A;  2XXI A;  2XXH A;  1NKX A;  1R9Q A;  1NUY A;  2GRV A;  1A99 A;  2KR0 A;  4QSE A;  1AIV A;  3FZV A;  4O94 A;  4MH5 A;  5I59 A;  1MXZ A;  2PMS A;  1NFT A;  3K01 A;  3SES A;  2OWZ A;  3RQT A;  3GZG A;  4F22 A;  1MPD A;  3TTL A;  2XWI A;  4Q30 B;  3GYY A;  1N3W A;  3O6I A;  4H8I A;  3IOR A;  2XXK A;  3BBR A;  2FIE A;  2NWJ A;  1A55 A;  4U22 A;  1IMB A;  2ONS A;  4KCC A;  1IXH A;  3N6T A;  1MQH A;  1DSN A;  3CVG A;  5I2K A;  1H43 A;  1VFE A;  1FTM A;  5A5X B;  1NUZ A;  3MBP A;  5DYH A;  2ZXT A;  1OVT A;  3PD9 A;  4F2Q A;  3HPI A;  2DE3 A;  1D3K A;  3FAS A;  4NF8 A;  1DCU A;  3B50 A;  1MXX A;  2UYF A;  3JZJ A;  1JW4 A;  2F35 A;  1M5F A;  2NOO A;  4G8M A;  4ELR A;  5H8F B;  2OX3 A;  3RTF B;  3ODB A;  4OFL A;  3UIF A;  3D4C A;  4YB6 A;  1NI9 A;  4H0W A;  5I84 A;  3EN3 A;  2XWO A;  5DTB A;  4OFJ A;  1SW2 A;  2H9B A;  4OVS A;  4G8N A;  4EXK A;  4KHZ E;  1EZP A;  4NGU A;  1Z7N E;  4JVD A;  5M2V A;  2HQ0 A;  2PX1 A;  4RY1 A;  4ESX A;  1QKB A;  4OWD A;  1URS A;  1LFH A;  5EYF A;  1MQI A;  3PUV E;  3W9W A;  4GBW A;  4F1U A;  1F9B A;  4JSD A;  3UK4 A;  2CZL A;  3LSL A;  4G68 C;  2DYX A;  4R6Y A;  2FHY A;  2NVU B;  3NOH A;  4PF6 A;  4P3L A;  4F19 A;  1FQE A;  4OEN A;  2ZYM A;  2IEE A;  2CZI A;  3RT8 A;  1KWH A;  4PFY A;  3DEL B;  1QUK A;  3CSB A;  3R7X A;  3T9U A;  3H06 B;  4ZEK A;  4OTE A;  2OJT A;  2I49 A;  3GXA A;  4X48 A;  4ESW A;  1B6H A;  2M8C A;  4OVR A;  3U94 A;  1ZBM A;  2ZYN A;  3QUF A;  5J16 A;  2XX9 A;  4GL8 A;  4WKM A;  3O66 A;  3ZKK A;  4HTG A;  2PCR A;  2FNC A;  4JDF A;  3U72 A;  1NNF A;  2VGQ A;  2DXR A;  4Q5T A;  2XXT A;  1JET A;  5ELV A;  1IZ1 A;  5IZ3 B;  3IB1 A;  3TFL A;  4XKR A;  5AA2 D;  4QFN A;  4R9F A;  1NNP A;  1NV0 A;  2F34 A;  3MVW A;  3LR1 A;  1VR5 A;  4YKI A;  2VPO A;  3GBB A;  1MG1 A;  4LZ8 A;  5ISU A;  1UQW A;  3C31 A;  1QW0 A;  3I6V A;  4H1X A;  4H46 A;  4PF8 A;  2Z8E A;  4DI3 D;  3Q29 A;  4KXP A;  2CEX A;  2ZZX A;  2F3D A;  4QXD A;  2V3U A;  2P0S A;  3HN0 A;  2XXU A;  1II5 A;  1Q35 A;  1BTJ A;  1Y1M A;  2V3Q A;  2GFE A;  4LAT A;  3FD3 A;  1SPI A;  3KGC A;  1DMB A;  4R73 A;  3GBA A;  1Q1K A;  2I0B A;  2R71 A;  3FAT A;  3PUZ E;  1ZLQ A;  3G3F A;  2A5S A;  3TTR A;  3ISP A;  3FV2 A;  1JVY A;  5FHM A;  1DPE A;  2NXO A;  1N7X A;  1LBB A;  4HS7 A;  1RDZ A;  1BIY A;  4N4U A;  1FPJ A;  4GF8 A;  1FBH A;  2WYP A;  5B7D A;  4BLA A;  1XI6 A;  3O29 A;  5CMK A;  3RYD A;  1AOV A;  3JYR A;  3T96 B;  4OVJ A;  3VE1 B;  1MM7 A;  1EH3 A;  1NV5 A;  2H4I A;  3H6U A;  3TQL A;  4IO3 A;  4F39 A;  1H76 A;  4NF5 A;  4IB2 A;  2CZK A;  4NG7 A;  4YB7 A;  4YKP A;  1OLC A;  2B4L A;  4R9G A;  2HZL A;  3PUW E;  5CM6 A;  3E4R A;  2QPQ A;  4G68 A;  5I59 B;  3LSX A;  3OO7 A;  5LTC A;  1MPC A;  1TT1 A;  4MMP A;  5I5P A;  2HXR A;  1LLS A;  4IY5 A;  2DXY A;  4I62 A;  1IMD A;  4BDQ A;  3G3I A;  4RPO A;  1DBZ A;  4RJZ A;  3R26 A;  4ONY A;  4R72 A;  3C32 A;  3K6X A;  1I69 A;  5L9S A;  3IL1 B;  1NV1 A;  1FPB A;  3EHT A;  3S9N C;  2RKM A;  3H6W A;  2Q89 A;  4PP0 A;  3SEW A;  2XWK A;  2X26 A;  4JVI A;  5I2N B;  3O6G A;  4N81 A;  4R74 A;  2B4M A;  1QUL A;  5I2K B;  3K4U A;  3VXC A;  3I3V A;  4ELP A;  3CFX A;  5F1Q A;  2DOJ A;  4LP2 B;  4R75 A;  1FTL A;  1KA1 A;  3MAM A;  2DVZ A;  3H6T A;  2XX7 A;  3T1B A;  1TFD A;  3T9V A;  4YU0 A;  4NF8 B;  5JEI A;  3HO7 A;  1NV6 A;  3SEU A;  4L17 A;  3MYU A;  1DK4 A;  4FAJ A;  3KFM A;  3U1O A;  1NV3 A;  4NQ8 A;  4X1D A;  4G4P A;  1JW5 A;  3LSW A;  2DWA A;  3TOD A;  2ZZW A;  3VV5 A;  4N07 A;  1LAG E;  4U23 A;  2D21 A;  4QFK A;  4DXU A;  4IO5 A;  5KCJ A;  4EQ9 A;  1ZJL A;  3O28 A;  2VPN A;  2XXP A;  2RC7 A;  1EYI A;  2RC8 A;  3B7D A;  3PU5 A;  2ONK E;  3QYT A;  1AMF A;  1LFI A;  4FEC A;  1ZTY A;  2MKZ A;  2DQV A;  1S50 A;  2GH9 A;  2H25 A;  1EYK A;  4QSD A;  1FBG A;  3T0J A;  2F6G A;  3PMW A;  2RF1 A;  1B5H A;  2XWV A;  3KZG A;  1NNK A;  2FIX A;  3OXN A;  5EQ7 A;  2R6G E;  3IJO B;  1SVX B;  3T9X B;  1NMU A;  1N7W A;  5TPA A;  2VHA A;  3G3G A;  4OER A;  3FJ7 A;  2Y7P A;  4X1B A;  2CMO A;  1MDQ A;  4X04 A;  1PEB A;  4YIC A;  4R2F A;  3D1R A;  4GBV A;  4MFI A;  1ANF A;  2PBW A;  3AXF A;  2DSF A;  2DWJ A;  2I3W A;  3CSG A;  5BWJ A;  3G3K A;  4N13 A;  5ICQ A;  1K9Z A;  4P8B A;  4POX A;  2Y5K A;  3UA8 A;  4N8G A;  4FE8 A;  4DIG A;  3DP6 A;  4BDN A;  1FBC A;  4ZS9 A;  3TTN A;  3IR1 A;  4JSO A;  1GR2 A;  3H3G A;  4U21 A;  3TPA A;  1LAF E;  3KJ7 A;  5DW8 A;  2BJI A;  1SI1 A;  1B52 A;  3N6U A;  2OCU A;  4PET A;  4I40 A;  2OLB A;  5CMC A;  5H8N A;  4PFT A;  4MEV A;  3KOT A;  1BP5 A;  2OZZ A;  1XHY A;  4RNS A;  2XXY A;  5ET5 A;  4G2Z A;  3B6W A;  1JEU A;  3QIM A;  4G61 A;  4OYV A;  3RN8 A;  3A3C A;  3TDJ A;  1Y1Z A;  2CZH A;  4EQB A;  2ZNS A;  4OVP A;  4PFB A;  3VLW A;  4KYD A;  3MPK A;  3V83 A;  3PV0 E;  1EZO A;  4EF1 A;  1Y3N A;  3CG1 A;  3KOS A;  4F3B A;  3KN7 A;  1OVB A;  3IAZ A;  4IGT A;  3FIR A;  1M5D A;  1FSA A;  1FPL A;  3V8X B;  1VSO A;  1S9T A;  2F7B A;  3MZ9 A;  4IO4 A;  3B6T A;  1PB8 A;  4IO7 A;  2F6P A;  1H44 A;  2NUV A;  3RY3 A;  4WED A;  3KG2 A;  4LN5 A;  3A29 A;  2B3F A;  2Q8M A;  4NF5 B;  3T9H B;  1OMP A;  4O7M A;  3C9H A;  1H3D A;  2DWI A;  5DT6 A;  1IIW A;  1I6A A;  1B1H A;  1TWY A;  4P1E A;  4GWU A;  2KQZ A;  4G68 B;  3M3K A;  3G3H A;  4OEV A;  5H8H A;  2R8T A;  1B46 A;  4NTL A;  3BFT A;  1LB9 A;  1FPD A;  4NX1 A;  4X8R A;  1AWB A;  2HCA A;  5I57 B;  1OQH A;  4GWW A;  3RPW A;  3KBR A;  3LSF B;  4PBQ A;  4ZEI A;  1RYX A;  1MH4 A;  2QVR A;  3KN3 A;  2QMX A;  1HSJ A;  5CMB A;  3FVO A;  2WBB A;  1XVY A;  1USY E;  3QK6 A;  3EQ1 A;  3O2A A;  4MNI A;  5CBS A;  1IIT A;  1MRP A;  4O3A A;  1MY4 A;  4I3Y A;  4ELO A;  2O51 A;  4R6H A;  3LBS A;  1NV7 A;  2YPN A;  2DWH A;  1O7T A;  1SYH A;  1PC3 A;  4NN3 A;  4MAG A;  5EHM A;  4M1V A;  4QRZ A;  4PAK A;  4HE2 A;  1R6Z A;  5CMM A;  3C36 A;  3VFJ A;  1B3L A;  5DVF A;  1LBX A;  3S2V A;  1MY0 A;  3PPR A;  3ONM A;  5BUU A;  2AL5 A;  5FTI A;  1IXG A;  2HAV A;  4G77 A;  4DI4 B;  5A5L A;  4EQ7 A;  3Q25 A;  3N94 A;  3RGY A;  2BJJ X;  3F11 A;  3PMX A;  3HHF A;  2HXW A;  3ECR A;  5IZ1 A;  1LBV A;  1PB9 A;  4NE4 A;  2Y5L A;  1EZ9 A;  1A54 A;  1FJ9 A;  4TQU Q;  1ATG A;  1R1N A;  4DXB A;  1YTV A;  2V84 A;  3IB2 A;  4QHQ A;  4C1U A;  2HEU A;  5KCJ B;  4LA9 A;  2YLN A;  2WBD A;  4PDH A;  4U1Z A;  5I3S A;  4GL0 A;  5KZT A;  2XD2 A;  4NWC A;  1FTK A;  4I8C A;  3S9M C;  4N17 A;  4E0W A;  5IZZ A;  3BFU A;  4PFU A;  3EHU A;  4KQP A;  3OEK A;  3VVD A;  5H8S A;  1TFA A;  4GVO A;  2RC9 A;  1MXY A;  3K6V A;  5FHO A;  3SEV A;  2XX8 A;  4OXV A;  1FBF A;  2E0S A;  1MXV A;  1LGB C;  4GWS A;  3IO6 A;  5TPA B;  3UP9 A;  1US5 A;  4PBH A;  2V3T A;  1Z7M E;  5AA4 A;  3T66 A;  4YMA A;  1B3F A;  2FA7 A;  1XS5 A;  2QFL A;  4MF3 A;  1JVX A;  3IOV A;  3O97 A;  1MQJ A;  1DTZ A;  2ZNU A;  1D4N A;  4XKQ A;  2R9J A;  1DOT A;  5AE4 A;  3EF7 A;  3E78 A;  1ZKB A;  1SW1 A;  4P56 A;  3WAF A;  5CI5 A;  4ZDM A;  3CFL A;  3A3U A;  1P99 A;  5TP9 A;  1ZU0 A;  1XVX A;  1B40 A;  4KPT A;  4MBP A;  4JWX A;  1QKA A;  3T22 A;  4GOT A;  1MQD A;  1B3H A;  5H8N B;  2FVZ A;  3TCH A;  1VDW A;  3E3K A;  1YCJ A;  4OZ9 A;  2PFZ A;  3OEM A;  5AA3 A;  1FPF A;  1R9L A;  2HFB A;  1B0H A;  3I5O A;  4OEU A;  5DEX A;  1MS7 A;  4I3E A;  5I58 A;  1K9Y A;  3WAE A;  3IOU A;  3MWB A;  4GXS B;  5H8Q A;  4WEP A;  1B4Z A;  4PC9 A;  3H03 A;  2XXR A;  1FTJ A;  4U4S A;  1G0H A;  1A40 A;  4F18 A;  1T0K A;  4N8Y A;  4KYS A;  3MVX A;  1GVC A;  4ZEC A;  4GX4 A;  1IQ7 A;  1N76 A;  1JEV A;  4GWY A;  1FPI A;  3MST A;  1RDY A;  2F8D A;  3L6H A;  4QF9 A;  3A09 A;  1SYI A;  3HV1 A;  3FXQ A;  5AA2 A;  3PMV A;  4FJP A;  3TEP A;  2ALU A;  5ET8 A;  3EKI A;  1B5J A;  2H99 A;  4TLM B;  3RPL A;  1P1Q A;  4GWX A;  1B4H A;  4PGN A;  1ELJ A;  2RCB A;  3VLU A;  1PBP A;  2WX9 A;  3MZ1 A;  2H98 A;  4LQ5 A;  5H8H B;  1L5T A;  1ZMG A;  1JNF A;  3R6U A;  3TTK A;  4AS4 A;  4EDP A;  2Q2A A;  4RPN A;  3BKI B;  2ZZV A;  4QSC A;  3H4Z A;  4ZED A;  5K2Y A;  2B65 A;  4XIG Q;  3K2D A;  3U92 A;  2QS2 A;  5IM2 A;  3CIJ A;  2VD2 A;  3LC8 A;  4H5G A;  5B70 A;  3HCQ A;  3EPE A;  1B7H A;  3BIH A;  2DE4 A;  2QVV A;  4OA4 A;  1LBW A;  4ZZE A;  5ICT A;  1AL3 A;  1SDX A;  1B7U A;  1OQG A;  5FTH A;  5EYH A;  4XF5 A;  5FBP A;  4QFP A;  2OWS A;  1HSL A;  1LAH E;  1UTH A;  3IFC A;  4F31 B;  3H6V A;  1NUX A;  3S4U A;  4ND9 A;  5TU0 A;  1AH5 A;  5ET6 A;  2QSX A;  5F24 A;  3C4M A;  1YAE A;  1QGX A;  2D3I A;  1BK4 A;  4MNP A;  4EF2 A;  3FV1 A;  3G7W A;  1MXW A;  4PQJ A;  4FEB A;  4OVQ A;  5EYG A;  3B8B A;  1Y20 A;  3U8Q A;  1UIV A;  4FAT A;  3S9E A;  5EQA A;  2QRY A;  1EU8 A;  4C0R A;  3OSQ A;  3IK6 B;  1MM6 A;  1ZIU A;  3K00 A;  2DE2 A;  4ZEF A;  3SDF A;  4F3G A;  1FQB A;  1B3E A;  1GTK A;  3PD8 A;  4JWO A;  2F5X A;  4UAC A;  1LBC A;  1FCK A;  1PBQ A;  3Q26 A;  3RUM A;  4MX6 A;  2GQ1 A;  3SEX A;  3KEI A;  3O6H A;  2QVU A;  2QS1 A;  4LZ5 A;  3PPQ A;  1MPB A;  1LEV A;  4IR8 A;  3OOA A;  4GX6 A;  3ZKL A;  4PFR A;  3VXB A;  4GWO A;  3K1M A;  4FIM A;  1IMF A;  1FQD A;  4F1V A;  1UTB A;  3K0V A;  2QS4 A;  5L9O A;  3KC0 A;  3IOW A;  2V4C A;  3ZS6 A;  3FGS A;  5AA4 B;  1JP4 A;  1Y4C A;  3TKD A;  4LON B;  3U93 A;  4HCY A;  1DTG A;  4IO6 A;  1B7Z A;  1B5I A;  3FVK A;  2CEY A;  1MY3 A;  4F1Y A;  2I0C A;  4H6D A;  1PDA A;  3U65 A;  4R2B A;  4RYA A;  5F7V A;  5DVJ A;  4KI0 E;  3OO6 A;  4NHB A;  4EUO A;  2ONR A;  3MW0 A;  4PGP A;  3RT6 B;  5TP9 B;  5CRY A;  3VDF A;  1USY H;  2Z23 A;  4JB7 A;  3K1N A;  5EQ8 A;  1KA0 A;  4MLQ A;  3PPN A;  1UIU A;  1IXI A;  4O3C A;  1POT A;  5L8D A;  3FBP A;  4YKK A;  3S9L C;  1NH7 A;  4PE3 A;  3CFZ A;  2G93 A;  1LST A;  1XC1 A;  1YYZ A;  3K1P A; 
#chains in the Genus database with same CATH homology
 3D4G A;  4RXL A;  1M5E A;  1A8F A;  2VP1 A;  4FED A;  2Q88 A;  1FQA A;  3IX1 A;  2AIX A;  3C34 A;  2F97 A;  2PT1 A;  1QUI A;  5DEX B;  4FOR A;  2OWT A;  3KSX A;  5I58 B;  1NNT A;  2I6E A;  3MUQ A;  5H8Q B;  1XOC A;  5HM4 B;  3TCG A;  1GV8 A;  2H5Y A;  1Y3P A;  3OMB A;  4GQO A;  4MLV A;  4GXA A;  1BLF A;  2X7Q A;  5ITO A;  3K02 A;  3OEL A;  4UA8 A;  2P2A A;  1I6B A;  4WXJ A;  3DLN A;  2AYS A;  4OQO A;  4BDM A;  5AA2 B;  1B9J A;  4KFQ A;  3V5A A;  3H7M A;  4OHN A;  2A5T A;  1TXF A;  2WKY A;  3DM0 A;  1YPN A;  1MXU A;  1QVS A;  4GD5 A;  2O1L A;  2V25 A;  3PPO A;  3TZA A;  1Y3Q A;  4QFL A;  3QXM A;  4U2R A;  1RKM A;  2O7I A;  4DXC A;  5I2N A;  1O64 A;  2XXQ A;  4BDR A;  1SW4 A;  2REJ A;  2W7Y A;  1P1W A;  3P7I A;  3FUZ A;  4DLD A;  4GFR A;  4OFO A;  4OES A;  3USD A;  2V93 A;  2FYI A;  3L6G A;  4Q0C A;  1FQF A;  2UVG A;  1UTH B;  4ELQ A;  2RIN A;  4AQ4 A;  1CB6 A;  2UYE A;  4KR5 A;  1D9Y A;  1MY2 A;  3SER A;  4NF4 A;  3RTW B;  5AA1 A;  2OBG A;  4H8J A;  2ZYK A;  1SBP A;  4HW8 A;  4LZ7 A;  4IY6 A;  1S7Y A;  4G8H A;  2E1S A;  5K2X A;  3HHG A;  4H67 A;  4XXU A;  3ZSF A;  2O1M A;  4NF6 A;  1I6Q A;  1B2H A;  3CR9 A;  3MP8 A;  4TLL B;  2O6A A;  4AB6 A;  2XXX A;  4U1O A;  2AL4 A;  4TOZ A;  2THI A;  3EHS A;  2B3B A;  4RA1 A;  4LUB A;  2KLF A;  3OO8 A;  4OMB A;  3PGF A;  2VOZ A;  5JK4 A;  1B32 A;  2HZK A;  2Y7R A;  4DCY A;  3W15 C;  2P1S A;  3DP4 A;  4F3S A;  4Z7E A;  3Q28 A;  2DVC A;  5CC2 A;  4HCW A;  2Y7I A;  4PFW A;  3M8U A;  2ZYO A;  3PPP A;  4N6P A;  3TCF A;  5J1D A;  2REG A;  4DCX A;  4DE8 A;  5I56 A;  1UTB B;  3N26 A;  1O63 A;  3FJM A;  2ABH A;  1N04 A;  3VLV A;  3Q27 A;  3QAX A;  1N84 A;  3MVY A;  3MP6 A;  2XXV A;  4DZ1 A;  1Y4T A;  3MZB A;  3M3F A;  3TTM A;  3G3J A;  3SET A;  3M3L A;  5KDT A;  2OK2 A;  1VE4 A;  3E9X A;  1H45 A;  2IA4 A;  3OD7 A;  5HBC A;  4ZEB A;  4I1D A;  5FHN A;  1QUJ A;  2O7U A;  1D9V A;  1FTO A;  4O3B A;  4THI A;  2QS3 A;  3FVG A;  1WDN A;  2UXA A;  3MVZ A;  3FXU A;  4JXI A;  2G29 A;  2QL3 A;  3MJN A;  4F3P A;  1Y9U A;  4P0I A;  2X7P A;  1US4 A;  3C35 A;  2I58 A;  1MH3 A;  4K3F A;  3RNN A;  5JTY A;  4ZE9 A;  4GIZ A;  3FVN A;  3MP1 A;  5IAI A;  1POY 1;  4AB5 A;  3OEN A;  4POW A;  1NL5 A;  1M5C A;  2DP8 A;  3OSR A;  3V89 B;  4F2O A;  2Z8F A;  3W9V A;  3MQ9 A;  1JW1 A;  1P1N A;  4Z0I A;  3B6Q A;  3IJX B;  1JQF A;  4XTC Q;  3VVF A;  3CG3 A;  2Z8D A;  1MQG A;  3QUJ A;  3TYH A;  3UN6 A;  2PT2 A;  4M4G A;  3TUS A;  2F7A A;  4EXL A;  4GLI A;  2QMW A;  3C33 A;  4NED A;  1B51 A;  3K6U A;  2Y7W A;  4C1T A;  3OO9 A;  1SI0 A;  4KD5 A;  2A5T B;  1IXC A;  1SW5 A;  1CE2 A;  1SQY A;  1SD3 A;  2Z22 A;  5I57 A;  1P1U A;  2HAU A;  1WOD A;  1LFG A;  2XHD A;  2GHB A;  4H65 A;  4LQ2 A;  3K6W A;  4YZZ A;  1B05 A;  1MY1 A;  3HST A;  5A5X A;  3CRB A;  3DP8 A;  1B3G A;  2Y84 A;  3QSL A;  3VVE A;  1IUD A;  4XKP A;  1A8E A;  1MDP 1;  2GHA A;  2PVU A;  3UOR A;  3IB0 A;  1B58 A;  5H8F A;  4XKN A;  3CI8 A;  4GRK A;  1N0T A;  4NMY A;  1VFD A;  3T93 B;  2Y7K A;  4NF4 B;  3N5L A;  2O84 X;  2I4B A;  4ECF A;  3TAJ A;  1B0L A;  2ESN A;  1J1N A;  2UVI A;  1PB7 A;  3PUX E;  3JV9 A;  4QFO A;  2ANJ A;  4P0G A;  3ILU B;  3MPL A;  4JBZ A;  4DDD A;  5LOM A;  4NF6 B;  4JWY A;  4R6K A;  4BDL A;  4E0X A;  4H5F A;  5DVI A;  1P1O A;  1OLA A;  3TEL A;  3KJT A;  3ILT B;  4YAH X;  1FQC A;  2I3V A;  4U4X A;  2RCA A;  2DS9 A;  3SKP A;  2I48 A;  2Q8J A;  4BDO A;  4ZZA A;  2F7C A;  1LB8 A;  3KN8 A;  1DPP A;  2YJP A;  4KCD A;  5L9M A;  1GGG A;  3GLB A;  3IO4 A;  4P11 A;  1IEJ A;  1XT8 A;  2ZMB A;  2UVJ A;  5I56 B;  4PE5 B;  4RK9 A;  1OIB A;  4YB5 A;  5IKB A;  1URD A;  1N3X A;  2QJE A;  1HSE A;  5ITP A;  3PUY E;  1WVJ A;  1LCF A;  2F78 A;  4KYE A;  2Q9T A;  3TMG A;  5CBR A;  4I9D A;  4F29 A;  4Q8R A;  2D5W A;  3O9P A;  5KDT B;  4YKJ A;  4NWD A;  3THI A;  3KSJ A;  4OET A;  4ZE8 A;  1M5B A;  3UGW A;  4IO2 A;  3MC2 A;  4IGR A;  3FXR A;  3RLF E;  2O68 A;  4RK2 A;  4LVQ A;  1QJM A;  5HPQ A;  4YMB A;  2VD3 A;  2XD3 A;  3IOT A;  2Q2C A;  3E13 X;  1URG A;  2LAO A;  1RYO A;  2I4C A;  2PYY A;  3SEY A;  1FW0 A;  1B1X A;  1BKA A;  3TQW A;  5JTY B;  2ZNT A;  1LCT A;  2F36 A;  1A7L A;  3LUY A;  2O69 A;  2UVH A;  4X9T A;  2XXW A;  1LAX A;  4ISU A;  5EHS A;  3FJG A;  1NH8 A;  2XXI A;  2XXH A;  1NKX A;  1R9Q A;  2GRV A;  1A99 A;  4QSE A;  1AIV A;  3FZV A;  4MH5 A;  5I59 A;  1MXZ A;  2PMS A;  1NFT A;  3K01 A;  3SES A;  3RQT A;  3GZG A;  4F22 A;  1MPD A;  3TTL A;  4Q30 B;  1N3W A;  3O6I A;  4H8I A;  3IOR A;  3BBR A;  2NWJ A;  1A55 A;  4U22 A;  2ONS A;  4KCC A;  1IXH A;  3N6T A;  1MQH A;  1DSN A;  3CVG A;  5I2K A;  1H43 A;  1VFE A;  1FTM A;  5A5X B;  3MBP A;  5DYH A;  2ZXT A;  1OVT A;  3PD9 A;  4F2Q A;  3HPI A;  2DE3 A;  1D3K A;  3FAS A;  4NF8 A;  1MXX A;  2UYF A;  3JZJ A;  1JW4 A;  2F35 A;  1M5F A;  2NOO A;  4G8M A;  4ELR A;  5H8F B;  3RTF B;  3ODB A;  4OFL A;  3UIF A;  3D4C A;  4YB6 A;  4H0W A;  5I84 A;  3EN3 A;  5DTB A;  4OFJ A;  1SW2 A;  2H9B A;  4G8N A;  4EXK A;  4KHZ E;  1EZP A;  1Z7N E;  5M2V A;  2HQ0 A;  2PX1 A;  4RY1 A;  4ESX A;  1QKB A;  4OWD A;  1URS A;  1LFH A;  5EYF A;  1MQI A;  3PUV E;  3W9W A;  4F1U A;  1F9B A;  4JSD A;  3UK4 A;  2CZL A;  3LSL A;  4G68 C;  2DYX A;  4R6Y A;  2NVU B;  4F19 A;  1FQE A;  4OEN A;  2ZYM A;  2IEE A;  3RT8 A;  1KWH A;  4PFY A;  3DEL B;  1QUK A;  3CSB A;  3R7X A;  3T9U A;  3H06 B;  4ZEK A;  4OTE A;  2OJT A;  2I49 A;  3GXA A;  4X48 A;  4ESW A;  1B6H A;  2M8C A;  3U94 A;  1ZBM A;  2ZYN A;  3QUF A;  2XX9 A;  4GL8 A;  4WKM A;  3O66 A;  3ZKK A;  4HTG A;  2FNC A;  4JDF A;  3U72 A;  1NNF A;  2VGQ A;  2DXR A;  4Q5T A;  2XXT A;  1JET A;  5ELV A;  1IZ1 A;  3IB1 A;  3TFL A;  4XKR A;  5AA2 D;  4QFN A;  4R9F A;  1NNP A;  2F34 A;  3MVW A;  3LR1 A;  1VR5 A;  4YKI A;  3GBB A;  1MG1 A;  4LZ8 A;  5ISU A;  1UQW A;  3C31 A;  1QW0 A;  3I6V A;  4H1X A;  2Z8E A;  3Q29 A;  2V3U A;  2P0S A;  3HN0 A;  2XXU A;  1II5 A;  1Q35 A;  1Y1M A;  1BTJ A;  2V3Q A;  2GFE A;  4LAT A;  3FD3 A;  3KGC A;  1DMB A;  4R73 A;  3GBA A;  1Q1K A;  2I0B A;  2R71 A;  3FAT A;  3PUZ E;  1ZLQ A;  3G3F A;  2A5S A;  3TTR A;  3FV2 A;  1JVY A;  5FHM A;  1DPE A;  2NXO A;  1N7X A;  1LBB A;  4HS7 A;  1BIY A;  4GF8 A;  5B7D A;  4BLA A;  3O29 A;  5CMK A;  1AOV A;  3JYR A;  3T96 B;  4OVJ A;  3VE1 B;  1MM7 A;  1EH3 A;  2H4I A;  3H6U A;  3TQL A;  4IO3 A;  4F39 A;  1H76 A;  4NF5 A;  4IB2 A;  4YB7 A;  4YKP A;  1OLC A;  4R9G A;  2HZL A;  3PUW E;  5CM6 A;  3E4R A;  2QPQ A;  4G68 A;  5I59 B;  3LSX A;  3OO7 A;  1MPC A;  1TT1 A;  1LLS A;  4IY5 A;  2DXY A;  4I62 A;  4BDQ A;  3G3I A;  4RPO A;  4RJZ A;  3R26 A;  4ONY A;  4R72 A;  3C32 A;  3K6X A;  1I69 A;  5L9S A;  3IL1 B;  3EHT A;  3S9N C;  2RKM A;  3H6W A;  2Q89 A;  4PP0 A;  3SEW A;  2X26 A;  5I2N B;  3O6G A;  4R74 A;  1QUL A;  5I2K B;  3K4U A;  3VXC A;  3I3V A;  4ELP A;  3CFX A;  5F1Q A;  2DOJ A;  4LP2 B;  4R75 A;  1FTL A;  3MAM A;  2DVZ A;  3H6T A;  2XX7 A;  1TFD A;  3T9V A;  4YU0 A;  4NF8 B;  5JEI A;  3HO7 A;  3SEU A;  4L17 A;  4FAJ A;  3KFM A;  3U1O A;  4X1D A;  4G4P A;  1JW5 A;  3LSW A;  2DWA A;  3TOD A;  3VV5 A;  4N07 A;  1LAG E;  4U23 A;  2D21 A;  4QFK A;  4DXU A;  4IO5 A;  5KCJ A;  4EQ9 A;  1ZJL A;  3O28 A;  2XXP A;  2RC7 A;  2RC8 A;  3B7D A;  3PU5 A;  2ONK E;  3QYT A;  1AMF A;  1LFI A;  4FEC A;  1ZTY A;  2DQV A;  1S50 A;  2GH9 A;  2H25 A;  4QSD A;  2F6G A;  3PMW A;  2RF1 A;  1B5H A;  3KZG A;  1NNK A;  3OXN A;  2R6G E;  3IJO B;  1SVX B;  3T9X B;  1NMU A;  1N7W A;  5TPA A;  2VHA A;  3G3G A;  4OER A;  3FJ7 A;  2Y7P A;  4X1B A;  2CMO A;  1MDQ A;  1PEB A;  4YIC A;  4R2F A;  4MFI A;  1ANF A;  2PBW A;  3AXF A;  2DSF A;  2DWJ A;  2I3W A;  3CSG A;  5BWJ A;  3G3K A;  4N13 A;  5ICQ A;  4POX A;  3UA8 A;  4FE8 A;  4DIG A;  3DP6 A;  4BDN A;  4ZS9 A;  3TTN A;  3IR1 A;  4JSO A;  1GR2 A;  3H3G A;  4U21 A;  3TPA A;  1LAF E;  3KJ7 A;  1SI1 A;  1B52 A;  3N6U A;  2OCU A;  4PET A;  2OLB A;  5CMC A;  5H8N A;  4PFT A;  3KOT A;  1BP5 A;  2OZZ A;  1XHY A;  4RNS A;  2XXY A;  4G2Z A;  3B6W A;  1JEU A;  3QIM A;  4OYV A;  3RN8 A;  3A3C A;  3TDJ A;  1Y1Z A;  4EQB A;  2ZNS A;  3VLW A;  4KYD A;  3MPK A;  3V83 A;  3PV0 E;  1EZO A;  4EF1 A;  1Y3N A;  3CG1 A;  3KOS A;  4F3B A;  3KN7 A;  1OVB A;  3IAZ A;  4IGT A;  3FIR A;  1M5D A;  3V8X B;  1VSO A;  1S9T A;  2F7B A;  3MZ9 A;  4IO4 A;  3B6T A;  1PB8 A;  4IO7 A;  2F6P A;  1H44 A;  2NUV A;  3RY3 A;  4WED A;  3KG2 A;  2B3F A;  4NF5 B;  3T9H B;  1OMP A;  3C9H A;  1H3D A;  2DWI A;  5DT6 A;  1IIW A;  1I6A A;  1B1H A;  1TWY A;  4G68 B;  3M3K A;  3G3H A;  4OEV A;  5H8H A;  1B46 A;  4NTL A;  3BFT A;  1LB9 A;  2HCA A;  5I57 B;  1OQH A;  3RPW A;  3KBR A;  3LSF B;  4ZEI A;  1RYX A;  1MH4 A;  3KN3 A;  2QMX A;  1HSJ A;  5CMB A;  3FVO A;  1XVY A;  1USY E;  3QK6 A;  3EQ1 A;  3O2A A;  5CBS A;  1IIT A;  1MRP A;  4O3A A;  1MY4 A;  4ELO A;  2O51 A;  4R6H A;  3LBS A;  2YPN A;  2DWH A;  1O7T A;  1SYH A;  1PC3 A;  5EHM A;  4M1V A;  4QRZ A;  1R6Z A;  5CMM A;  3C36 A;  3VFJ A;  1B3L A;  5DVF A;  3S2V A;  1MY0 A;  3PPR A;  3ONM A;  5BUU A;  2AL5 A;  5FTI A;  1IXG A;  2HAV A;  4G77 A;  4EQ7 A;  3Q25 A;  3N94 A;  3RGY A;  2BJJ X;  3F11 A;  3PMX A;  3HHF A;  2HXW A;  3ECR A;  1PB9 A;  4NE4 A;  1EZ9 A;  1A54 A;  4TQU Q;  1ATG A;  1R1N A;  4DXB A;  1YTV A;  2V84 A;  3IB2 A;  4QHQ A;  4C1U A;  2HEU A;  5KCJ B;  4LA9 A;  2YLN A;  4U1Z A;  4GL0 A;  5KZT A;  2XD2 A;  4NWC A;  1FTK A;  4I8C A;  3S9M C;  4E0W A;  3BFU A;  4PFU A;  3EHU A;  4KQP A;  3OEK A;  3VVD A;  5H8S A;  1TFA A;  4GVO A;  2RC9 A;  1MXY A;  3K6V A;  5FHO A;  3SEV A;  2XX8 A;  4OXV A;  2E0S A;  1MXV A;  1LGB C;  3IO6 A;  5TPA B;  3UP9 A;  1US5 A;  2V3T A;  1Z7M E;  5AA4 A;  3T66 A;  4YMA A;  1B3F A;  2FA7 A;  1XS5 A;  4MF3 A;  1JVX A;  3IOV A;  3O97 A;  1MQJ A;  1DTZ A;  2ZNU A;  1D4N A;  4XKQ A;  2R9J A;  1DOT A;  5AE4 A;  3EF7 A;  1ZKB A;  1SW1 A;  3WAF A;  5CI5 A;  4ZDM A;  3CFL A;  3A3U A;  1P99 A;  5TP9 A;  1ZU0 A;  1XVX A;  1B40 A;  4KPT A;  4MBP A;  4JWX A;  1QKA A;  3T22 A;  4GOT A;  1MQD A;  1B3H A;  5H8N B;  3TCH A;  3E3K A;  1YCJ A;  4OZ9 A;  3OEM A;  5AA3 A;  1R9L A;  2HFB A;  1B0H A;  3I5O A;  4OEU A;  5DEX A;  1MS7 A;  5I58 A;  3WAE A;  3IOU A;  3MWB A;  4GXS B;  5H8Q A;  4WEP A;  1B4Z A;  3H03 A;  2XXR A;  1FTJ A;  4U4S A;  1A40 A;  4F18 A;  1T0K A;  4KYS A;  3MVX A;  1GVC A;  4ZEC A;  1IQ7 A;  1N76 A;  1JEV A;  2F8D A;  3L6H A;  4QF9 A;  3A09 A;  1SYI A;  3HV1 A;  3FXQ A;  5AA2 A;  3PMV A;  4FJP A;  3TEP A;  2ALU A;  1B5J A;  2H99 A;  4TLM B;  1P1Q A;  1B4H A;  1ELJ A;  2RCB A;  3VLU A;  1PBP A;  3MZ1 A;  2H98 A;  4LQ5 A;  5H8H B;  1L5T A;  1ZMG A;  1JNF A;  3R6U A;  3TTK A;  4EDP A;  2Q2A A;  3BKI B;  4RPN A;  4QSC A;  3H4Z A;  4ZED A;  5K2Y A;  2B65 A;  4XIG Q;  3K2D A;  3U92 A;  2QS2 A;  3CIJ A;  2VD2 A;  3LC8 A;  4H5G A;  5B70 A;  3HCQ A;  3EPE A;  1B7H A;  2DE4 A;  4ZZE A;  5ICT A;  1AL3 A;  1SDX A;  1B7U A;  1OQG A;  5FTH A;  4QFP A;  2OWS A;  1UTH A;  1HSL A;  1LAH E;  4F31 B;  3H6V A;  3S4U A;  4ND9 A;  5TU0 A;  1AH5 A;  2QSX A;  3C4M A;  1YAE A;  2D3I A;  4EF2 A;  3FV1 A;  3G7W A;  1MXW A;  4PQJ A;  4FEB A;  1Y20 A;  3U8Q A;  1UIV A;  4FAT A;  3S9E A;  2QRY A;  1EU8 A;  4C0R A;  3OSQ A;  3IK6 B;  1MM6 A;  1ZIU A;  3K00 A;  2DE2 A;  4ZEF A;  3SDF A;  4F3G A;  1FQB A;  1B3E A;  1GTK A;  3PD8 A;  4JWO A;  2F5X A;  4UAC A;  1LBC A;  1FCK A;  1PBQ A;  3Q26 A;  3RUM A;  3SEX A;  3KEI A;  3O6H A;  2QS1 A;  4LZ5 A;  3PPQ A;  1MPB A;  3OOA A;  3ZKL A;  3VXB A;  4GWO A;  3K1M A;  4FIM A;  1FQD A;  4F1V A;  1UTB A;  3K0V A;  2QS4 A;  5L9O A;  3IOW A;  3ZS6 A;  3FGS A;  5AA4 B;  1Y4C A;  3TKD A;  4LON B;  3U93 A;  4HCY A;  1DTG A;  4IO6 A;  1B7Z A;  1B5I A;  3FVK A;  1MY3 A;  4F1Y A;  2I0C A;  4H6D A;  1PDA A;  4R2B A;  4RYA A;  5F7V A;  5DVJ A;  4KI0 E;  3OO6 A;  4EUO A;  2ONR A;  3MW0 A;  3RT6 B;  5TP9 B;  5CRY A;  3VDF A;  1USY H;  2Z23 A;  4JB7 A;  3K1N A;  4MLQ A;  3PPN A;  1UIU A;  1IXI A;  4O3C A;  1POT A;  5L8D A;  4YKK A;  3S9L C;  1NH7 A;  3CFZ A;  2G93 A;  1LST A;  1XC1 A;  3K1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...