1N7XA

Human serum transferrin, n-lobe y45e mutant
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASELDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Serotransferrin
publication title THE POSITION OF ARGININE 124 CONTROLS THE RATE OF IRON RELEASE FROM THE N-LOBE OF HUMAN SERUM TRANSFERRIN. A STRUCTURAL STUDY
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2002-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n7xA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n7xA01
5IKBA 3TODA 1LBBA 4RK2A 1MQJA 5CRYA 2PMSA 3EHSA 1HSEA 4P0IA 3O6IA 4POWA 3H6UA 3KEIA 1YCJA 3T9UA 3PMXA 3VE1B 4ZECA 5A5XA 4GXAA 2A5SA 1NKXA 3O2AA 1MXUA 1DOTA 1B1XA 4ZE9A 2Y7WA 3H06B 5TP9B 4OETA 2M8CA 2Q89A 2V84A 4KD5A 1A7LA 1MRPA 1XVXA 2DWAA 3UN6A 4Z7EA 2OBGA 1MH3A 5H8FB 3TZAA 1FW0A 3WAEA 3M3FA 3DP8A 5HBCA 5ITOA 4JXIA 3Q26A 2D3IA 5H8QA 2V3UA 2ANJA 4FATA 1OQGA 1LLSA 2HZLA 5K2YA 3M3KA 2O7IA 3SERA 3FXQA 4OFJA 3Q29A 3ILUB 4M4GA 3DLNA 4MLQA 3KN7A 3LC8A 4TQUQ 5H8SA 3FXUA 2QMXA 1O64A 1P99A 5I58A 1N76A 2ZNTA 1SVXB 2THIA 2AIXA 3E9XA 4ND9A 1P1UA 3IJOB 2VD2A 1ZBMA 3TCGA 3B7DA 3MZ9A 2HEUA 1TFDA 4F3PA 3O28A 1ELJA 3MP1A 2DWHA 4KR5A 4DE8A 4OTEA 3SEVA 2E1SA 2UVIA 1XHYA 4Q5TA 1B3HA 1WDNA 1OQHA 4KCDA 4EDPA 2CMOA 3O66A 2Q8JA 1S50A 3KJTA 1B9JA 1Y3NA 4KHZE 1YAEA 4RJZA 2ONKE 3MVWA 4PFTA 2G93A 3FJGA 5H8HB 1MXYA 2H25A 3G3HA 4DXUA 4OERA 4NF6B 5KDTB 4JDFA 2XHDA 1ANFA 2I0CA 4BDNA 1PB9A 4RXLA 2XXYA 3C32A 3VLWA 1LFGA 1B5JA 1S7YA 1QJMA 4JWOA 2ZYMA 2DE4A 4EXKA 1B3FA 3CVGA 4GD5A 4GIZA 3PUVE 4ISUA 5TPAB 3MBPA 1PB8A 4YKIA 1LB9A 1VR5A 5I56A 1XT8A 4ZEBA 3H6TA 1IZ1A 1US5A 1ZIUA 2DP8A 4X9TA 4QFNA 4R75A 4KYSA 5CMKA 3T66A 1NNKA 1US4A 2V3TA 3OD7A 4LATA 3W15C 1B3LA 2FYIA 1M5CA 3G3FA 3EPEA 3KBRA 4PFYA 4F1VA 3QSLA 1IEJA 2GHAA 1FTKA 4GLIA 1Y1MA 2WKYA 3RNNA 4DLDA 1ATGA 2F34A 4LQ5A 3MP8A 2QSXA 3HHGA 3PGFA 1USYE 4ZEIA 1QUJA 4L17A 2Z8FA 4H6DA 2OK2A 4G77A 2VD3A 3H3GA 1N04A 5L9MA 2QPQA 4H1XA 4YB6A 4F2QA 4THIA 1SDXA 4PQJA 1CE2A 1TXFA 1GGGA 3Q25A 3EN3A 1USYH 1JQFA 4DCXA 1N3WA 2XX8A 4EUOA 3FJ7A 4C1TA 1Y20A 1N0TA 3MPLA 1SYHA 2B65A 3KJ7A 3LSWA 3VVDA 2XX9A 1MPBA 1RYXA 4BDMA 3TCHA 4ELRA 2NWJA 4ZEFA 4EQ7A 4U23A 3K0VA 4KI0E 5F1QA 4OZ9A 1SW1A 4IO4A 1SI0A 2B3FA 4KCCA 3UA8A 2IA4A 4G8HA 1OVTA 2CZLA 1II5A 4M1VA 2YLNA 4OMBA 2PVUA 4C0RA 5JK4A 2Q9TA 5ITPA 5L9SA 3PD8A 4QHQA 1PBQA 5DVIA 5I58B 3LUYA 3DP4A 3QYTA 4ELPA 4N07A 3K02A 4RY1A 1UIUA 4EQ9A 4AB5A 2HAUA 4JBZA 1SW4A 2RINA 1JW1A 4Z0IA 3MW0A 3UGWA 3LSLA 1T0KA 2QL3A 2OWTA 2QS4A 3IX1A 1LSTA 1GR2A 3MC2A 1VE4A 1DPPA 5TU0A 3C36A 1EZ9A 4GQOA 3IK6B 3D4CA 4I62A 3MJNA 4DZ1A 1B5HA 2DOJA 3C35A 3FVGA 2VHAA 5B70A 3QXMA 4YKPA 2X26A 5AA1A 1NH8A 3N5LA 2RC9A 3T9VA 1MQHA 1FQEA 4GWOA 3FVNA 2B3BA 4LUBA 3SEUA 5M2VA 2XX7A 1HSLA 1A8EA 1QKBA 3OO6A 1B0HA 4GF8A 3D4GA 4OVJA 1LCFA 3TELA 1LB8A 5KZTA 1UTHB 3PD9A 4EF2A 1MY3A 3CG1A 1OLCA 3RUMA 1MXWA 2A5TA 1JVYA 5I56B 2F8DA 1QKAA 5AA3A 4Q0CA 5EHSA 3O6GA 3MZ1A 4PETA 1JEVA 3TAJA 2HFBA 2NXOA 4YICA 1B5IA 1UQWA 5FHMA 1Y3QA 2I4CA 3DELB 4YZZA 1FQBA 4F3BA 1GVCA 5IAIA 4F19A 3VVEA 1EZPA 2QS2A 2BJJX 2OZZA 2FA7A 2RC8A 1MQDA 1PB7A 4NF8A 1M5FA 4XKQA 2ZMBA 2GHBA 4R6KA 5FHOA 1A99A 2F7BA 3ZSFA 1KWHA 4IO3A 4MBPA 1JETA 1H44A 1O7TA 3QK6A 1TFAA 1AIVA 3IB1A 3S9LC 1MQIA 1J1NA 1PC3A 4IO2A 5AA2B 4H65A 4R2FA 3ILTB 3PUZE 4NE4A 3SETA 3H7MA 4ZZAA 1MPDA 3PMVA 2F6GA 2Y84A 3ZS6A 2E0SA 3KSJA 1Y1ZA 1AOVA 2AL5A 2ONSA 3PPNA 3S2VA 4OWDA 1DSNA 3UORA 1QULA 3VXCA 5DYHA 2VOZA 5CMBA 3G3IA 1EZOA 3PUYE 2AL4A 1MY2A 2NOOA 1POTA 3EQ1A 2O51A 3PPRA 4KPTA 2H98A 4YB5A 3OO9A 3CI8A 2XXHA 3OXNA 3HPIA 1B4HA 3RGYA 1VSOA 4WXJA 3LBSA 4F22A 4ZS9A 3A3CA 4GL8A 4X1DA 1P1OA 3S9MC 4NF5A 4G68C 3M8UA 1MS7A 4HCYA 4P11A 3C9HA 1H76A 4HCWA 1SW2A 4DXBA 2QMWA 3H6VA 5FTIA 1RYOA 2Q2AA 2ZNUA 3RN8A 4F2OA 2XXRA 3VDFA 2GFEA 4ZEDA 2ABHA 3FD3A 1Z7ME 3KN3A 2ESNA 4FEBA 4YU0A 3KGCA 4GL0A 4R9GA 4RPOA 5FTHA 2H5YA 3K1NA 1N3XA 5L8DA 4G8NA 4FECA 3OO8A 3S4UA 3WAFA 3B6WA 3L6HA 3U93A 2FNCA 3M3LA 3RT6B 4FJPA 2RCBA 2UVHA 1M5DA 1JVXA 3I3VA 3CG3A 4OFOA 5HM4B 3FXRA 2F35A 2DQVA 2YPNA 4WEPA 4IGTA 3FZVA 4LZ5A 2V25A 3TQWA 2UXAA 4G68B 3OMBA 3V89B 1XS5A 1IITA 4XIGQ 1D9VA 4X48A 3TTNA 3PPOA 4XKNA 4MLVA 2NUVA 3IOVA 2Q88A 4NMYA 2HZKA 3V8XB 2Z22A 2PYYA 4TLLB 1LAXA 5AA2D 4E0WA 5EYFA 5ICQA 4LVQA 2F97A 3FUZA 2F5XA 4R72A 2O1LA 4NEDA 1JW5A 4AB6A 2GH9A 3HV1A 3TTKA 4AQ4A 3FATA 1H3DA 1ZJLA 1B6HA 3KSXA 4XTCQ 3I6VA 5CMMA 4OFLA 4ZE8A 1QUIA 3IO6A 5KCJB 2H99A 4H5FA 4NF4A 3RTFB 1R9LA 3EF7A 1Y9UA 4ZDMA 2HQ0A 3U1OA 3G7WA 4PFUA 2H4IA 3VV5A 4ESXA 3RQTA 2I3WA 5ELVA 5AA4A 1ZU0A 1B46A 2ONRA 3K6XA 5DTBA 3IR1A 4I1DA 3CFZA 4G8MA 1H45A 2W7YA 4PP0A 3OO7A 2UYEA 3TTLA 3IAZA 3CSGA 4MFIA 4JWXA 4IY6A 1XVYA 5A5XB 5JEIA 2Z23A 4FEDA 1R6ZA 3A3UA 4RPNA 3O6HA 3UIFA 3SEYA 3BFTA 3OSRA 3C33A 2QRYA 3W9VA 4UA8A 5I2KA 1B1HA 3ODBA 3U72A 4XKPA 3FV1A 4PFWA 4ECFA 3IL1B 3HO7A 1SYIA 4HS7A 1LGBC 4R9FA 3G3GA 1SQYA 1DMBA 4JWYA 3MVYA 5H8QB 2F7CA 3U8QA 1MDP1 4ESWA 3I5OA 4KYDA 4F39A 4KFQA 1DTZA 1TT1A 5DVJA 3VLUA 1IXIA 1LFHA 4QFPA 2LAOA 4LONB 1FQAA 3TQLA 3JZJA 3FASA 4QF9A 4XKRA 4FIMA 1VFDA 2O68A 3USDA 1AH5A 3ONMA 4OEVA 1SBPA 4GRKA 4U2RA 4GOTA 3S9EA 1LAGE 1D3KA 3HN0A 1QW0A 3TTMA 2UVGA 3B6TA 3KFMA 4IO7A 4RNSA 3TMGA 4XXUA 4C1UA 1MY1A 1D4NA 1N84A 1FCKA 1P1WA 2I3VA 3MQ9A 1FTJA 2HCAA 4ZEKA 2F7AA 3N6TA 4IY5A 3MVXA 3N6UA 3TUSA 4U4SA 1B3EA 3T9XB 4H5GA 4N6PA 4NWDA 2HXWA 3GBBA 3L6GA 2XD2A 3RY3A 1A54A 3OEKA 3EHUA 3LSFB 3DP6A 4O3CA 2Q2CA 5B7DA 2R9JA 1PBPA 2OWSA 3IORA 3SEWA 4X1BA 1IXCA 4R73A 3G3KA 3CRBA 2V93A 3W9WA 3LSXA 2PX1A 3KOTA 1OIBA 1Z7NE 2PBWA 2RF1A 3E4RA 1M5EA 4YAHX 5J1DA 3LR1A 4F18A 2ZYNA 4NF4B 2H9BA 1VFEA 4BDQA 1ZMGA 1BLFA 3RLFE 3ZKLA 2Y7KA 1H43A 5AA4B 3VLVA 1IIWA 4N13A 1POY1 1XOCA 4IGRA 2Z8EA 3KZGA 2NVUB 2UVJA 2I48A 2RCAA 4F29A 1BKAA 2OJTA 4YB7A 3JV9A 3O29A 1B7HA 1YTVA 2DS9A 3F11A 2QJEA 4YKKA 3CSBA 3THIA 2XXXA 4BDOA 4IO5A 1B0LA 2O1MA 3K01A 2OLBA 4RA1A 2P2AA 5LOMA 3ZKKA 2XD3A 5DT6A 1NL5A 1A40A 1MM7A 3TTRA 1B7UA 1R9QA 2ZNSA 5CI5A 4E0XA 3IJXB 4KYEA 2X7PA 1FQFA 3VVFA 3CIJA 3P7IA 4HW8A 3PMWA 5I84A 5JTYA 5ICTA 1I6QA 1LCTA 5FHNA 5CBSA 1B05A 2D5WA 4EF1A 3K1PA 2I0BA 1FQDA 4EXLA 3K6WA 1OLAA 2DVZA 3FIRA 1YPNA 3TYHA 3T9HB 2REGA 1UTBA 5EHMA 5CBRA 5L9OA 1P1NA 4QSEA 1Y4TA 4YKJA 4R6HA 3JYRA 1QUKA 3PUXE 2XXTA 3OEMA 1LAHE 2VGQA 4TLMB 1D9YA 1NMUA 5CMCA 3CFXA 1A55A 2GRVA 1FTLA 1FTMA 1P1QA 3A09A 3QUFA 1I6BA 3RT8A 4LP2B 1LFIA 2P0SA 2XXWA 2RC7A 3BKIB 1B2HA 4MF3A 2UYFA 4R2BA 4ELQA 1AMFA 1ZKBA 1SW5A 1HSJA 1URDA 3N94A 2ZXTA 4IB2A 1MXVA 2KLFA 5DEXA 5I59A 4F3SA 3SEXA 1Q35A 4K3FA 3OOAA 3EHTA 1F9BA 2A5TB 1GTKA 1LBCA 4QSCA 2XXVA 4BLAA 4DXCA 5BUUA 1MY0A 3T93B 3TPAA 3S9NC 1Y3PA 3IO4A 2I4BA 4LZ8A 3GLBA 2DE3A 2HAVA 5H8NA 3PPQA 4DCYA 3U94A 4OENA 3Q27A 1MXXA 3TEPA 1I6AA 1MM6A 4FORA 2PT1A 4UACA 5I2NA 3KG2A 1MG1A 1S9TA 3PV0E 1PEBA 1UTHA 3UP9A 1N7XA 4R74A 5I57A 3HSTA 1B4ZA 2I6EA 2IEEA 4OQOA 1DTGA 4G2ZA 1PDAA 1Y4CA 4HTGA 2ALUA 3IB2A 5BWJA 1AL3A 1URGA 1EU8A 4P0GA 5AE4A 2I49A 3OENA 5DVFA 3H03A 1BP5A 3R7XA 4NF8B 4R6YA 3FV2A 3MAMA 1B40A 1B58A 4NWCA 2G29A 1GV8A 3FVKA 3O97A 4I8CA 1SI1A 3K6UA 3FJMA 4EQBA 2P1SA 4QFLA 1OMPA 1WVJA 3MPKA 1Q1KA 1B51A 1MH4A 3IOTA 1FQCA 2V3QA 3TCFA 3KN8A 2VP1A 4QFOA 3VFJA 2R71A 4DDDA 3SESA 4OESA 2Y7IA 4F31B 3RTWB 1IQ7A 3PPPA 1WODA 3KOSA 1MXZA 3TDJA 3GZGA 3V5AA 1BTJA 5JTYB 3C31A 2O69A 4U21A 2PT2A 1TWYA 5AA2A 1JEUA 1XC1A 4U1ZA 4FAJA 4QFKA 2XXIA 2D21A 4ZZEA 5CM6A 2DWJA 1UTBB 3G3JA 3C4MA 3N26A 4NF5B 4NTLA 4O3BA 2XXUA 1NNFA 3C34A 4Q8RA 2RKMA 1LAFE 4WKMA 1UIVA 1A8FA 1JNFA 3B6QA 3R26A 1R1NA 2ZYOA 3MVZA 4U4XA 1L5TA 5TP9A 1CB6A 4PE5B 1DPEA 4Q30B 3DM0A 1SD3A 1ZTYA 3IOWA 4YMBA 4IO6A 4QRZA 1ZLQA 4FE8A 2QS3A 1JW4A 2OCUA 4LQ2A 1MY4A 5H8FA 1MPCA 1O63A 2O7UA 4H8JA 3BFUA 4LA9A 3UK4A 1B3GA 3AXFA 1B52A 3K6VA 2XXPA 4JB7A 5CC2A 1MQGA 4OXVA 4BDRA 4RYAA 4F1YA 4ELOA 4TOZA 4G4PA 2R6GE 3QUJA 1NH7A 4O3AA 4WEDA 5F7VA 1OVBA 4F3GA 3IB0A 1B32A 1NNPA 3T22A 3MP6A 4H8IA 3TKDA 3BBRA 5DEXB 5I59B 2QS1A 2I58A 4MH5A 4BDLA 4QSDA 4RK9A 4DIGA 2DYXA 2DWIA 2X7QA 5HPQA 2F78A 4KQPA 3H4ZA 4GVOA 1EH3A 5H8NB 4OHNA 4I9DA 3SKPA 3IOUA 3U92A 4U22A 4YMAA 3CFLA 3R6UA 1QVSA 2DXYA 2O6AA 3QAXA 3K1MA 2YJPA 3V83A 5H8HA 3RPWA 1MDQA 5I2NB 3E3KA 3K00A 4NF6A 5KDTA 2Y7PA 2Y7RA 1BIYA 3HCQA 3GXAA 5K2XA 5I57B 3ECRA 2ZYKA 3OSQA 2O84X 3MZBA 4G68A 2REJA 1B7ZA 4F1UA 2DXRA 4JSOA 2AYSA 3TFLA 3OELA 2DVCA 4H67A 1IXHA 5TPAA 4H0WA 4LZ7A 3VXBA 4POXA 1M5BA 1IXGA 3K2DA 3PUWE 3FGSA 5ISUA 3MUQA 2F36A 1I69A 4ONYA 4OEUA 3Q28A 1NFTA 2XXQA 3PU5A 1N7WA 3O9PA 4U1OA 2F6PA 3MWBA 5KCJA 4GXSB 2DE2A 4JSDA 3QIMA 3T96B 2Z8DA 3GBAA 1URSA 3CR9A 1IUDA 3E13X 4OYVA 3HHFA 1NNTA 3FVOA 4GFRA 3H6WA 2DSFA 5I2KB 1RKMA 3SDFA 3K4UA 1FTOA
chains in the Genus database with same CATH superfamily
5IKBA 3TODA 1LBBA 4RK2A 1MQJA 5CRYA 2PMSA 3EHSA 1HSEA 4P0IA 3O6IA 4POWA 3H6UA 3KEIA 1YCJA 3T9UA 3PMXA 3VE1B 4ZECA 2WX9A 5A5XA 4GXAA 4HXVA 2A5SA 1NKXA 3O2AA 1MXUA 1XI6A 3KC0A 1DOTA 1B1XA 4ZE9A 2Y7WA 3H06B 5TP9B 4I3EA 4OETA 2M8CA 2Q89A 2V84A 4KD5A 1A7LA 1MRPA 4I40A 1EYIA 1XVXA 2DWAA 3UN6A 3RPLB 1Q9DA 4Z7EA 2OBGA 1MH3A 5H8FB 3TZAA 1FW0A 3WAEA 3M3FA 3DP8A 5HBCA 5ITOA 4JXIA 3Q26A 2D3IA 5H8QA 4PGPA 2V3UA 2ANJA 4FATA 1OQGA 1LLSA 2HZLA 5K2YA 3M3KA 2O7IA 3SERA 3FXQA 4OFJA 3Q29A 3ILUB 4M4GA 3DLNA 4MLQA 3KN7A 3LC8A 4TQUQ 5H8SA 3FXUA 4GX4A 1FSAA 2QMXA 1O64A 4JVDA 1P99A 5I58A 1DCUA 1N76A 2ZNTA 1SVXB 2THIA 2AIXA 3E9XA 4ND9A 1P1UA 3IJOB 4PBQA 2VD2A 1ZBMA 3TCGA 3B7DA 3MZ9A 2HEUA 1TFDA 4F3PA 3O28A 1ELJA 3MP1A 2DWHA 4KR5A 4DE8A 4OTEA 5IM2A 3SEVA 2E1SA 2UVIA 1XHYA 1BK4A 4Q5TA 1B3HA 2GQ1A 1WDNA 1OQHA 4KCDA 5F24A 5LTCA 1DBZA 1RDXA 4EDPA 2CMOA 3O66A 2Q8JA 1S50A 4N17A 3IFAA 1DK4A 3KJTA 4XFEA 1B9JA 1Y3NA 4KHZE 5IZ3B 1YAEA 4RJZA 2ONKE 3MVWA 4PFTA 2G93A 3FJGA 5H8HB 1MXYA 2H25A 3G3HA 4DXUA 4OERA 4NF6B 2PFZA 5KDTB 5T3JA 4JDFA 2XHDA 1ANFA 2I0CA 4BDNA 1PB9A 4RXLA 2XXYA 3C32A 3VLWA 1LFGA 1B5JA 1S7YA 1QJMA 4JWOA 2ZYMA 2DE4A 4EXKA 4O7MA 1B3FA 3CVGA 4GD5A 4GIZA 3PUVE 1IMBA 4N8GA 4DI3D 4X04A 4ISUA 5TPAB 3MBPA 1PB8A 1FBEA 4YKIA 1LB9A 1VR5A 5I56A 1XT8A 4ZEBA 1KA1A 3H6TA 1IZ1A 2WEFA 1US5A 1ZIUA 2DP8A 5IZ1A 4X9TA 4QFNA 4R75A 2WYKA 4KYSA 5CMKA 3T66A 1NNKA 1US4A 2V3TA 3OD7A 4LATA 3W15C 1B3LA 2FYIA 1M5CA 3G3FA 3EPEA 3KBRA 4PFYA 2FBPA 4F1VA 3QSLA 1IEJA 2GHAA 1FTKA 4GLIA 1Y1MA 2WKYA 3RNNA 4DLDA 1ATGA 2F34A 4LQ5A 3MP8A 2V4CA 2QSXA 3HHGA 3E79A 3PGFA 1USYE 4ZEIA 1D9QA 1QUJA 4L17A 4QXDA 2Z8FA 1LBZA 4H6DA 2OK2A 4G77A 2VD3A 3H3GA 1N04A 5L9MA 2QPQA 4H1XA 2VPOA 4YB6A 4THIA 4NN3A 1SDXA 4F2QA 4PQJA 1CE2A 1TXFA 1GGGA 3Q25A 3EN3A 1USYH 4IR8A 1JQFA 4DCXA 4JVCA 5I3SA 1N3WA 2XX8A 4EUOA 3FJ7A 4HE1A 4C1TA 1Y20A 1N0TA 3MPLA 1SYHA 2B65A 3LUZA 3KJ7A 3LSWA 3VVDA 2XX9A 1MPBA 1RYXA 4BDMA 3TCHA 4ELRA 2NWJA 4ZEFA 4EQ7A 4U23A 3K0VA 4KI0E 5F1QA 4OZ9A 4GWUA 1FBPA 1SW1A 4IO4A 1SI0A 2B3FA 4KCCA 3UA8A 2IA4A 4G8HA 1OVTA 2CZLA 1II5A 4M1VA 2YLNA 4OMBA 1JP4A 2PVUA 4C0RA 5JK4A 2Q9TA 5ITPA 5L9SA 3PD8A 3PTYA 4QHQA 1PBQA 5DVIA 5I58B 3LUYA 3DP4A 3QYTA 4ELPA 4PDDA 4N07A 1NV0A 3K02A 4RY1A 1UIUA 4G61A 4EQ9A 4AB5A 2HAUA 4LN5A 4JBZA 1NUYA 1SW4A 2RINA 1JW1A 4Z0IA 2VT5A 4P56A 3MW0A 3UGWA 3LSLA 1T0KA 2QL3A 2OWTA 2QS4A 3IX1A 1LSTA 1GR2A 3MC2A 1VE4A 1NV7A 1DPPA 1FPJA 5TU0A 3C36A 4PTKA 1EZ9A 4GQOA 3IK6B 3D4CA 4I62A 3MJNA 4O8MA 4DZ1A 1B5HA 2DOJA 1FPEA 3C35A 3FVGA 2VHAA 5B70A 3QXMA 4YKPA 2X26A 4N6DA 5AA1A 1NH8A 3N5LA 2RC9A 2Y5KA 1NUWA 3T9VA 1MQHA 4MHFA 1FQEA 4GWOA 3FVNA 2B3BA 2ZZXA 4LUBA 3SEUA 4DI4B 5M2VA 2XX7A 1HSLA 4NAPA 1A8EA 1QKBA 3OO6A 1B0HA 4GF8A 3D4GA 4OVJA 1LCFA 3TELA 2DDKA 1LB8A 5KZTA 1UTHB 3PD9A 4EF2A 1MY3A 3CG1A 1FPFA 1OLCA 3RUMA 1MXWA 2A5TA 1JVYA 5I56B 2F8DA 1QKAA 5AA3A 4Q0CA 5EHSA 3O6GA 3MZ1A 4PETA 1RDYA 1JEVA 3TAJA 2HFBA 2NXOA 4YICA 1B5IA 5DW8A 1UQWA 5ET8A 5FHMA 1Y3QA 2I4CA 3DELB 4YZZA 5EYGA 1FQBA 4F3BA 1GVCA 5IAIA 4F19A 3VVEA 1EZPA 4XEQA 4N6KA 2QS2A 2BJJX 2PCRA 2OZZA 2FA7A 2RC8A 1MQDA 5ET7A 4MX6A 1PB7A 4NF8A 4OVRA 1M5FA 4XKQA 2ZMBA 2GHBA 4R6KA 5FHOA 1A99A 2F7BA 3ZSFA 1KWHA 4IO3A 4MBPA 1JETA 1H44A 1O7TA 3QK6A 1TFAA 1AIVA 3IB1A 3S9LC 4O7IA 1MQIA 1J1NA 1PC3A 4IO2A 5AA2B 4H65A 4R2FA 3ILTB 3PUZE 4MEVA 4OANA 3LV0A 4NE4A 3SETA 2Q74A 3H7MA 4ZZAA 4GWWA 4GWYA 2B4LA 1MPDA 4NHBA 3PMVA 2F6GA 4OVTA 2Y84A 4AS4A 3ZS6A 2E0SA 3KSJA 1Y1ZA 1AOVA 2AL5A 2ONSA 3PPNA 3S2VA 4OWDA 1DSNA 3UORA 1QULA 3VXCA 5DYHA 2VOZA 1LBYA 5CMBA 3G3IA 1EZOA 3PUYE 2AL4A 1MY2A 2NOOA 1POTA 2XWOA 3EQ1A 2O51A 3PPRA 4KPTA 2H98A 4YB5A 1NUZA 3OO9A 4OVQA 3CI8A 1IMFA 2XXHA 3OXNA 3HPIA 4PGNA 2FIXA 1B4HA 3RGYA 1VSOA 4PF6A 4WXJA 3LBSA 4F22A 4ZS9A 3A3CA 4GL8A 3KBZA 4X1DA 1P1OA 3S9MC 4NF5A 4G68C 1NV1A 1MS7A 3M8UA 2XXKA 4HCYA 4P11A 3C9HA 1H76A 4HCWA 1SW2A 4DXBA 2QMWA 3H6VA 5FTIA 1RYOA 2Q2AA 2ZNUA 3RN8A 4F2OA 2XXRA 3VDFA 2QVUA 2GFEA 4ZEDA 2ABHA 3FD3A 1Z7ME 3KN3A 2ESNA 3T0JA 4FEBA 4YU0A 4I3YA 3KGCA 4GL0A 4R9GA 2WYPA 4RPOA 5FTHA 2H5YA 3K1NA 1N3XA 1NV2A 5L8DA 4G8NA 4FECA 3OO8A 3S4UA 3WAFA 3B6WA 3L6HA 3U93A 2FNCA 3M3LA 3RT6B 4FJPA 2RCBA 2UVHA 1M5DA 1JVXA 3I3VA 3CG3A 4OFOA 5HM4B 3FXRA 4GWZA 3T1BA 2F35A 2DQVA 2YPNA 3B8BA 4WEPA 4IGTA 3FZVA 4LZ5A 2V25A 1FBGA 2CZIA 3TQWA 2QVVA 2UXAA 4G68B 3OMBA 3V89B 1XS5A 1IITA 4XIGQ 5EQ7A 3FXBA 1D9VA 4X48A 4GWXA 3PPOA 3TTNA 4XKNA 4MLVA 2NUVA 3IOVA 1SPIA 2Q88A 4NMYA 2HZKA 3V8XB 2Z22A 2PYYA 4TLLB 1LAXA 5AA2D 4E0WA 5EYFA 5ICQA 4LVQA 2F97A 3FUZA 5EYHA 2F5XA 4R72A 2O1LA 4NEDA 1JW5A 2BJIA 4AB6A 2GH9A 3HV1A 1NI9A 3TTKA 4AQ4A 3FATA 1H3DA 1ZJLA 1B6HA 3KSXA 4XTCQ 3I6VA 5CMMA 3U65A 4OFLA 4FBPA 1QUIA 3IO6A 4ZE8A 5KCJB 2H99A 4H5FA 4NF4A 3RTFB 1R9LA 3EF7A 1Y9UA 4ZDMA 2HQ0A 3U1OA 3G7WA 2XWKA 4PFUA 2H4IA 4H46A 4HE0A 3VV5A 4ESXA 3RQTA 2I3WA 5ELVA 3ROJA 5AA4A 1ZU0A 2XA5A 4NX1A 1B46A 2ONRA 3K6XA 1LBVA 2Q8MA 5DTBA 4OA4A 3IR1A 4I1DA 3CFZA 4G8MA 1H45A 2W7YA 4PP0A 4NF0A 2CZKA 3OO7A 2UYEA 3TTLA 3IAZA 3CSGA 4X8RA 4MFIA 4JWXA 4IY6A 1XVYA 5A5XB 5JEIA 2Z23A 4P3LA 4FEDA 1R6ZA 3A3UA 4RPNA 3O6HA 3UIFA 3SEYA 2R8TA 3BFTA 3OSRA 3C33A 3A29A 2QRYA 3W9VA 4UA8A 5I2KA 2F3BA 1B1HA 3ODBA 3U72A 2B4MA 4XKPA 3FV1A 4NGUA 4PFWA 4ECFA 3IL1B 3IFCA 3HO7A 1SYIA 4HS7A 4MNIA 4MAGA 1LGBC 4R9FA 3G3GA 1SQYA 1DMBA 4JWYA 3MVYA 1G0IA 5H8QB 2HXRA 2F7CA 3U8QA 1MDP1 2FHYA 3CHGA 4ESWA 3I5OA 4NQ8A 4KYDA 4F39A 4KFQA 5ESYA 1DTZA 1TT1A 5DVJA 3VLUA 1FPIA 1IXIA 1LFHA 4QFPA 2JJKA 2LAOA 4LONB 4GBWA 1FQAA 3TQLA 3JZJA 3FASA 4QF9A 4XKRA 4FIMA 1VFDA 2O68A 2ZZVA 3USDA 1AH5A 3ONMA 4OEVA 1SBPA 4GRKA 4U2RA 4GOTA 2CEXA 1FPBA 3S9EA 1EYKA 1LAGE 1D3KA 3HN0A 1QW0A 3TTMA 2UVGA 3B6TA 3KFMA 1IMCA 4IO7A 4RNSA 4N8YA 2Y5LA 3TMGA 4XXUA 4C1UA 4GX6A 5LDZA 1MY1A 2L5VA 1D4NA 1N84A 4GX3A 1FCKA 2F3DA 4NG7A 1P1WA 2I3VA 3MQ9A 1FTJA 2HCAA 4ZEKA 2F7AA 3N6TA 4IY5A 1KZ8A 3MVXA 3N6UA 3TUSA 4U4SA 1B3EA 3T9XB 4H5GA 4N6PA 4NWDA 2OWZA 2HXWA 3GBBA 3L6GA 2XD2A 3RY3A 1A54A 3OEKA 3EHUA 3LSFB 3DP6A 4O3CA 2Q2CA 5B7DA 2R9JA 1PBPA 2OWSA 3IORA 3SEWA 2OX3A 4OVSA 4X1BA 1IXCA 4R73A 3G3KA 3CRBA 2V93A 3W9WA 3LSXA 2PX1A 1FRPA 3KOTA 1OIBA 1Z7NE 2PBWA 2RF1A 1K9ZA 3E4RA 4PFIA 1M5EA 4YAHX 5J1DA 3LR1A 4F18A 2ZYNA 4NF4B 2H9BA 4P8BA 3NOHA 1VFEA 4BDQA 1ZMGA 1BLFA 3RLFE 3ZKLA 2Y7KA 1H43A 5AA4B 5ET5A 3VLVA 1IIWA 4N13A 1POY1 4PE3A 1XOCA 1FTAA 4IGRA 2Z8EA 3KZGA 2NVUB 2UVJA 2I48A 2RCAA 4F29A 1BKAA 2OJTA 3MYUA 4YB7A 1YXIA 3JV9A 3O29A 1B7HA 4PF8A 3RYDA 5I7IA 1YTVA 2DS9A 3F11A 5I5PA 2QJEA 2PFYA 3ISPA 4YKKA 1INPA 3CSBA 3THIA 1KA0A 2XXXA 4BDOA 4IO5A 1B0LA 2O1MA 3K01A 2OLBA 4RA1A 2P2AA 5LOMA 3ZKKA 2XD3A 4GBVA 5DT6A 1NL5A 4PC9A 1A40A 2MKZA 1MM7A 3TTRA 1B7UA 1R9QA 2KR0A 4MIJA 2ZNSA 5CI5A 4E0XA 3IJXB 4KYEA 2X7PA 4N81A 1FQFA 3VVFA 3CIJA 3P7IA 4HW8A 3PMWA 5I84A 5JTYA 5ICTA 1I6QA 1LCTA 4GWSA 5FHNA 5CBSA 1B05A 2D5WA 4EF1A 2ZZWA 3K1PA 5EQ8A 2I0BA 1FQDA 4EXLA 3K6WA 1YYZA 1OLAA 2DVZA 3FIRA 1YPNA 2HHMA 3TYHA 3T9HB 2REGA 2WBBA 1UTBA 5EHMA 5CBRA 5L9OA 1P1NA 1LEVA 4QSEA 2XWIA 1Y4TA 4YKJA 4R6HA 3JYRA 4OVPA 1QUKA 3PUXE 2XXTA 3OEMA 1LAHE 2VGQA 2FIEA 1CNQA 4TLMB 1D9YA 3BIHA 5EQAA 1NMUA 5CMCA 4HE2A 3CFXA 1A55A 2GRVA 1FTLA 1FTMA 1P1QA 3A09A 3QUFA 1I6BA 3RT8A 4P9KA 1LBWA 4LP2B 1LFIA 3QMFA 2P0SA 1FBDA 2XXWA 2RC7A 3BKIB 1VDWA 1B2HA 4MF3A 2UYFA 4R2BA 1FPKA 4ELQA 1AMFA 4MJOA 1ZKBA 1SW5A 1HSJA 1K9YA 1URDA 3SZPA 3N94A 1FPDA 2ZXTA 4IB2A 4O94A 1MXVA 2KLFA 5DEXA 5I59A 4F3SA 3SEXA 1Q35A 4K3FA 3OOAA 3EHTA 1F9BA 2A5TB 1FJ9A 1GTKA 1LBCA 4QSCA 2XXVA 4BLAA 4DXCA 5BUUA 1MY0A 3T93B 1AWBA 3TPAA 3S9NC 1Y3PA 3IO4A 5IZZA 3HFUA 2I4BA 4LZ8A 3GLBA 2DE3A 4MNPA 5ET6A 1FBCA 2HAVA 5H8NA 3PPQA 4KXPA 4DCYA 3U94A 4OENA 3Q27A 1MXXA 3TEPA 1I6AA 1MM6A 4FORA 2PT1A 4UACA 1NV3A 5I2NA 3KG2A 1MG1A 1S9TA 3PV0E 1PEBA 1UTHA 3UP9A 1N7XA 4R74A 5I57A 3HSTA 1B4ZA 2I6EA 2IEEA 4OQOA 1DTGA 4G2ZA 1PDAA 1Y4CA 4HTGA 2ALUA 3IB2A 5BWJA 1AL3A 1FPGA 1URGA 1EU8A 4P0GA 5AE4A 2I49A 3OENA 5DVFA 3H03A 1BP5A 3R7XA 4NF8B 4R6YA 3FV2A 3MAMA 1B40A 1B58A 4NWCA 2G29A 4MMPA 1GV8A 4P47A 3FVKA 3O97A 4I8CA 3E78A 2XWVA 1SI1A 3K6UA 3FJMA 4JVIA 4EQBA 2P1SA 4QFLA 1OMPA 1EYJA 1WVJA 3MPKA 5J16A 1Q1KA 4H45A 1B51A 1MH4A 3IOTA 1FQCA 3MSTA 2V3QA 3TCFA 3KN8A 3BIGA 2VP1A 4QFOA 3VFJA 2R71A 4DDDA 3SESA 4OESA 1G0HA 2Y7IA 4P1EA 4F31B 2QFLA 3RTWB 1IQ7A 3PPPA 1WODA 3KOSA 1MXZA 2QVRA 3TDJA 3GZGA 1LBXA 3V5AA 1BTJA 5JTYB 3C31A 2O69A 4U21A 2PT2A 1TWYA 5AA2A 1IMEA 1JEUA 1XC1A 4U1ZA 2P3VA 4FAJA 4QFKA 2XXIA 4QBAA 2D21A 4ZZEA 5CM6A 2DWJA 3KC1A 1UTBB 1YZ0A 3G3JA 3C4MA 3N26A 4NF5B 4NTLA 4O3BA 2XXUA 5A5LA 1NNFA 3C34A 2RKMA 1LAFE 4Q8RA 4WKMA 1UIVA 1A8FA 1JNFA 3B6QA 3R26A 4MNCA 1R1NA 2ZYOA 3MVZA 4U4XA 5IGAA 1IMDA 1L5TA 1NV5A 5TP9A 1CB6A 4PE5B 1DPEA 4MCOA 4Q30B 3DM0A 1SD3A 5EQ9A 1ZTYA 2KQZA 3IOWA 4YMBA 1NV6A 4IO6A 4QRZA 1ZLQA 4FE8A 3RPLA 2VPNA 2QS3A 1JW4A 2OCUA 4LQ2A 1MY4A 5H8FA 1MPCA 1O63A 4PAKA 2O7UA 4H8JA 3BFUA 4LA9A 3UK4A 1FJ6A 1B3GA 3AXFA 1B52A 4PBHA 3K6VA 5FBPA 4AS5A 2XXPA 4JB7A 1NV4A 3FBPA 4XF5A 5CC2A 1MQGA 4OXVA 4BDRA 4RYAA 4F1YA 4ELOA 4TOZA 4G4PA 2R6GE 3QUJA 1NH7A 4O3AA 4WEDA 5F7VA 1OVBA 4F3GA 3IB0A 1B32A 2P3NA 1NNPA 3T22A 2HPGA 3MP6A 4H8IA 3TKDA 3BBRA 5DEXB 5I59B 2QS1A 2I58A 4MH5A 1FBFA 4BDLA 4QSDA 4RK9A 4DIGA 2DYXA 2FVZA 2DWIA 2X7QA 5HPQA 1FBHA 2F78A 4KQPA 3H4ZA 4GVOA 1EH3A 5H8NB 4OHNA 5IZ3A 3B50A 4I9DA 4PDHA 3SKPA 3IOUA 3U92A 4U22A 4YMAA 3CFLA 3R6UA 1QVSA 2DXYA 2O6AA 3QAXA 3K1MA 2YJPA 3V83A 5H8HA 3RPWA 1MDQA 5I2NB 3E3KA 3K00A 4NF6A 5KDTA 2Y7PA 2Y7RA 1BIYA 3HCQA 3GXAA 5K2XA 4PFRA 5I57B 3ECRA 2ZYKA 2CEYA 3OSQA 1IMAA 2O84X 1RDZA 3MZBA 4G68A 4N4UA 2REJA 1B7ZA 2DXRA 4JSOA 4F1UA 2AYSA 4N15A 3TFLA 1NUXA 3OELA 1QGXA 4P1LA 2DVCA 4H67A 1IXHA 5TPAA 4H0WA 4LZ7A 4PAFA 4N91A 3VXBA 4POXA 1M5BA 1IXGA 4PCDA 4PAIA 3K2DA 2CZHA 3PUWE 3FGSA 5ISUA 3MUQA 2F36A 1I69A 3D1RA 4ONYA 4OEUA 3Q28A 1NFTA 2XXQA 3PU5A 2WBDA 1N7WA 3O9PA 4U1OA 2F6PA 3MWBA 5KCJA 4GXSB 2DE2A 4JSDA 3QIMA 3T96B 2Z8DA 3GBAA 4UABA 1URSA 3CR9A 3GYYA 1IUDA 3E13X 4OYVA 3HHFA 1NNTA 4PFBA 3FVOA 4GFRA 3H6WA 2DSFA 5I2KB 1RKMA 3SDFA 3K4UA 1FPLA 1FTOA 3EKIA
chains in the Genus database with same CATH topology
5IKBA 3TODA 1LBBA 4RK2A 1MQJA 5CRYA 2PMSA 3EHSA 1HSEA 4P0IA 3O6IA 4POWA 3H6UA 3KEIA 1YCJA 3T9UA 3PMXA 3VE1B 4ZECA 5A5XA 4GXAA 2A5SA 1NKXA 3O2AA 1MXUA 1DOTA 1B1XA 4ZE9A 2Y7WA 3H06B 5TP9B 4OETA 2M8CA 2Q89A 2V84A 4KD5A 1A7LA 1MRPA 1XVXA 2DWAA 3UN6A 4Z7EA 2OBGA 1MH3A 5H8FB 3TZAA 1FW0A 3WAEA 3M3FA 3DP8A 5HBCA 5ITOA 4JXIA 3Q26A 2D3IA 5H8QA 2V3UA 2ANJA 4FATA 1OQGA 1LLSA 2HZLA 5K2YA 3M3KA 2O7IA 3SERA 3FXQA 4OFJA 3Q29A 3ILUB 4M4GA 3DLNA 4MLQA 3KN7A 3LC8A 4TQUQ 5H8SA 3FXUA 2QMXA 1O64A 1P99A 5I58A 1N76A 2ZNTA 1SVXB 2THIA 2AIXA 3E9XA 4ND9A 1P1UA 3IJOB 2VD2A 1ZBMA 3TCGA 3B7DA 3MZ9A 2HEUA 1TFDA 4F3PA 3O28A 1ELJA 3MP1A 2DWHA 4KR5A 4DE8A 4OTEA 3SEVA 2E1SA 2UVIA 1XHYA 4Q5TA 1B3HA 1WDNA 1OQHA 4KCDA 4EDPA 2CMOA 3O66A 2Q8JA 1S50A 3KJTA 1B9JA 1Y3NA 4KHZE 1YAEA 4RJZA 2ONKE 3MVWA 4PFTA 2G93A 3FJGA 5H8HB 1MXYA 2H25A 3G3HA 4DXUA 4OERA 4NF6B 5KDTB 4JDFA 2XHDA 1ANFA 2I0CA 4BDNA 1PB9A 4RXLA 2XXYA 3C32A 3VLWA 1LFGA 1B5JA 1S7YA 1QJMA 4JWOA 2ZYMA 2DE4A 4EXKA 1B3FA 3CVGA 4GD5A 4GIZA 3PUVE 4ISUA 5TPAB 3MBPA 1PB8A 4YKIA 1LB9A 1VR5A 5I56A 1XT8A 4ZEBA 3H6TA 1IZ1A 1US5A 1ZIUA 2DP8A 4X9TA 4QFNA 4R75A 4KYSA 5CMKA 3T66A 1NNKA 1US4A 2V3TA 3OD7A 4LATA 3W15C 1B3LA 2FYIA 1M5CA 3G3FA 3EPEA 3KBRA 4PFYA 4F1VA 3QSLA 1IEJA 2GHAA 1FTKA 4GLIA 1Y1MA 2WKYA 3RNNA 4DLDA 1ATGA 2F34A 4LQ5A 3MP8A 2QSXA 3HHGA 3PGFA 1USYE 4ZEIA 1QUJA 4L17A 2Z8FA 4H6DA 2OK2A 4G77A 2VD3A 3H3GA 1N04A 5L9MA 2QPQA 4H1XA 4YB6A 4F2QA 4THIA 1SDXA 4PQJA 1CE2A 1TXFA 1GGGA 3Q25A 3EN3A 1USYH 1JQFA 4DCXA 1N3WA 2XX8A 4EUOA 3FJ7A 4C1TA 1Y20A 1N0TA 3MPLA 1SYHA 2B65A 3KJ7A 3LSWA 3VVDA 2XX9A 1MPBA 1RYXA 4BDMA 3TCHA 4ELRA 2NWJA 4ZEFA 4EQ7A 4U23A 3K0VA 4KI0E 5F1QA 4OZ9A 1SW1A 4IO4A 1SI0A 2B3FA 4KCCA 3UA8A 2IA4A 4G8HA 1OVTA 2CZLA 1II5A 4M1VA 2YLNA 4OMBA 2PVUA 4C0RA 5JK4A 2Q9TA 5ITPA 5L9SA 3PD8A 4QHQA 1PBQA 5DVIA 5I58B 3LUYA 3DP4A 3QYTA 4ELPA 4N07A 3K02A 4RY1A 1UIUA 4EQ9A 4AB5A 2HAUA 4JBZA 1SW4A 2RINA 1JW1A 4Z0IA 3MW0A 3UGWA 3LSLA 1T0KA 2QL3A 2OWTA 2QS4A 3IX1A 1LSTA 1GR2A 3MC2A 1VE4A 1DPPA 5TU0A 3C36A 1EZ9A 4GQOA 3IK6B 3D4CA 4I62A 3MJNA 4DZ1A 1B5HA 2DOJA 3C35A 3FVGA 2VHAA 5B70A 3QXMA 4YKPA 2X26A 5AA1A 1NH8A 3N5LA 2RC9A 3T9VA 1MQHA 1FQEA 4GWOA 3FVNA 2B3BA 4LUBA 3SEUA 5M2VA 2XX7A 1HSLA 1A8EA 1QKBA 3OO6A 1B0HA 4GF8A 3D4GA 4OVJA 1LCFA 3TELA 1LB8A 5KZTA 1UTHB 3PD9A 4EF2A 1MY3A 3CG1A 1OLCA 3RUMA 1MXWA 2A5TA 1JVYA 5I56B 2F8DA 1QKAA 5AA3A 4Q0CA 5EHSA 3O6GA 3MZ1A 4PETA 1JEVA 3TAJA 2HFBA 2NXOA 4YICA 1B5IA 1UQWA 5FHMA 1Y3QA 2I4CA 3DELB 4YZZA 1FQBA 4F3BA 1GVCA 5IAIA 4F19A 3VVEA 1EZPA 2QS2A 2BJJX 2OZZA 2FA7A 2RC8A 1MQDA 1PB7A 4NF8A 1M5FA 4XKQA 2ZMBA 2GHBA 4R6KA 5FHOA 1A99A 2F7BA 3ZSFA 1KWHA 4IO3A 4MBPA 1JETA 1H44A 1O7TA 3QK6A 1TFAA 1AIVA 3IB1A 3S9LC 1MQIA 1J1NA 1PC3A 4IO2A 5AA2B 4H65A 4R2FA 3ILTB 3PUZE 4NE4A 3SETA 3H7MA 4ZZAA 1MPDA 3PMVA 2F6GA 2Y84A 3ZS6A 2E0SA 3KSJA 1Y1ZA 1AOVA 2AL5A 2ONSA 3PPNA 3S2VA 4OWDA 1DSNA 3UORA 1QULA 3VXCA 5DYHA 2VOZA 5CMBA 3G3IA 1EZOA 3PUYE 2AL4A 1MY2A 2NOOA 1POTA 3EQ1A 2O51A 3PPRA 4KPTA 2H98A 4YB5A 3OO9A 3CI8A 2XXHA 3OXNA 3HPIA 1B4HA 3RGYA 1VSOA 4WXJA 3LBSA 4F22A 4ZS9A 3A3CA 4GL8A 4X1DA 1P1OA 3S9MC 4NF5A 4G68C 3M8UA 1MS7A 4HCYA 4P11A 3C9HA 1H76A 4HCWA 1SW2A 4DXBA 2QMWA 3H6VA 5FTIA 1RYOA 2Q2AA 2ZNUA 3RN8A 4F2OA 2XXRA 3VDFA 2GFEA 4ZEDA 2ABHA 3FD3A 1Z7ME 3KN3A 2ESNA 4FEBA 4YU0A 3KGCA 4GL0A 4R9GA 4RPOA 5FTHA 2H5YA 3K1NA 1N3XA 5L8DA 4G8NA 4FECA 3OO8A 3S4UA 3WAFA 3B6WA 3L6HA 3U93A 2FNCA 3M3LA 3RT6B 4FJPA 2RCBA 2UVHA 1M5DA 1JVXA 3I3VA 3CG3A 4OFOA 5HM4B 3FXRA 2F35A 2DQVA 2YPNA 4WEPA 4IGTA 3FZVA 4LZ5A 2V25A 3TQWA 2UXAA 4G68B 3OMBA 3V89B 1XS5A 1IITA 4XIGQ 1D9VA 4X48A 3TTNA 3PPOA 4XKNA 4MLVA 2NUVA 3IOVA 2Q88A 4NMYA 2HZKA 3V8XB 2Z22A 2PYYA 4TLLB 1LAXA 5AA2D 4E0WA 5EYFA 5ICQA 4LVQA 2F97A 3FUZA 2F5XA 4R72A 2O1LA 4NEDA 1JW5A 4AB6A 2GH9A 3HV1A 3TTKA 4AQ4A 3FATA 1H3DA 1ZJLA 1B6HA 3KSXA 4XTCQ 3I6VA 5CMMA 4OFLA 4ZE8A 1QUIA 3IO6A 5KCJB 2H99A 4H5FA 4NF4A 3RTFB 1R9LA 3EF7A 1Y9UA 4ZDMA 2HQ0A 3U1OA 3G7WA 4PFUA 2H4IA 3VV5A 4ESXA 3RQTA 2I3WA 5ELVA 5AA4A 1ZU0A 1B46A 2ONRA 3K6XA 5DTBA 3IR1A 4I1DA 3CFZA 4G8MA 1H45A 2W7YA 4PP0A 3OO7A 2UYEA 3TTLA 3IAZA 3CSGA 4MFIA 4JWXA 4IY6A 1XVYA 5A5XB 5JEIA 2Z23A 4FEDA 1R6ZA 3A3UA 4RPNA 3O6HA 3UIFA 3SEYA 3BFTA 3OSRA 3C33A 2QRYA 3W9VA 4UA8A 5I2KA 1B1HA 3ODBA 3U72A 4XKPA 3FV1A 4PFWA 4ECFA 3IL1B 3HO7A 1SYIA 4HS7A 1LGBC 4R9FA 3G3GA 1SQYA 1DMBA 4JWYA 3MVYA 5H8QB 2F7CA 3U8QA 1MDP1 4ESWA 3I5OA 4KYDA 4F39A 4KFQA 1DTZA 1TT1A 5DVJA 3VLUA 1IXIA 1LFHA 4QFPA 2LAOA 4LONB 1FQAA 3TQLA 3JZJA 3FASA 4QF9A 4XKRA 4FIMA 1VFDA 2O68A 3USDA 1AH5A 3ONMA 4OEVA 1SBPA 4GRKA 4U2RA 4GOTA 3S9EA 1LAGE 1D3KA 3HN0A 1QW0A 3TTMA 2UVGA 3B6TA 3KFMA 4IO7A 4RNSA 3TMGA 4XXUA 4C1UA 1MY1A 1D4NA 1N84A 1FCKA 1P1WA 2I3VA 3MQ9A 1FTJA 2HCAA 4ZEKA 2F7AA 3N6TA 4IY5A 3MVXA 3N6UA 3TUSA 4U4SA 1B3EA 3T9XB 4H5GA 4N6PA 4NWDA 2HXWA 3GBBA 3L6GA 2XD2A 3RY3A 1A54A 3OEKA 3EHUA 3LSFB 3DP6A 4O3CA 2Q2CA 5B7DA 2R9JA 1PBPA 2OWSA 3IORA 3SEWA 4X1BA 1IXCA 4R73A 3G3KA 3CRBA 2V93A 3W9WA 3LSXA 2PX1A 3KOTA 1OIBA 1Z7NE 2PBWA 2RF1A 3E4RA 1M5EA 4YAHX 5J1DA 3LR1A 4F18A 2ZYNA 4NF4B 2H9BA 1VFEA 4BDQA 1ZMGA 1BLFA 3RLFE 3ZKLA 2Y7KA 1H43A 5AA4B 3VLVA 1IIWA 4N13A 1POY1 1XOCA 4IGRA 2Z8EA 3KZGA 2NVUB 2UVJA 2I48A 2RCAA 4F29A 1BKAA 2OJTA 4YB7A 3JV9A 3O29A 1B7HA 1YTVA 2DS9A 3F11A 2QJEA 4YKKA 3CSBA 3THIA 2XXXA 4BDOA 4IO5A 1B0LA 2O1MA 3K01A 2OLBA 4RA1A 2P2AA 5LOMA 3ZKKA 2XD3A 5DT6A 1NL5A 1A40A 1MM7A 3TTRA 1B7UA 1R9QA 2ZNSA 5CI5A 4E0XA 3IJXB 4KYEA 2X7PA 1FQFA 3VVFA 3CIJA 3P7IA 4HW8A 3PMWA 5I84A 5JTYA 5ICTA 1I6QA 1LCTA 5FHNA 5CBSA 1B05A 2D5WA 4EF1A 3K1PA 2I0BA 1FQDA 4EXLA 3K6WA 1OLAA 2DVZA 3FIRA 1YPNA 3TYHA 3T9HB 2REGA 1UTBA 5EHMA 5CBRA 5L9OA 1P1NA 4QSEA 1Y4TA 4YKJA 4R6HA 3JYRA 1QUKA 3PUXE 2XXTA 3OEMA 1LAHE 2VGQA 4TLMB 1D9YA 1NMUA 5CMCA 3CFXA 1A55A 2GRVA 1FTLA 1FTMA 1P1QA 3A09A 3QUFA 1I6BA 3RT8A 4LP2B 1LFIA 2P0SA 2XXWA 2RC7A 3BKIB 1B2HA 4MF3A 2UYFA 4R2BA 4ELQA 1AMFA 1ZKBA 1SW5A 1HSJA 1URDA 3N94A 2ZXTA 4IB2A 1MXVA 2KLFA 5DEXA 5I59A 4F3SA 3SEXA 1Q35A 4K3FA 3OOAA 3EHTA 1F9BA 2A5TB 1GTKA 1LBCA 4QSCA 2XXVA 4BLAA 4DXCA 5BUUA 1MY0A 3T93B 3TPAA 3S9NC 1Y3PA 3IO4A 2I4BA 4LZ8A 3GLBA 2DE3A 2HAVA 5H8NA 3PPQA 4DCYA 3U94A 4OENA 3Q27A 1MXXA 3TEPA 1I6AA 1MM6A 4FORA 2PT1A 4UACA 5I2NA 3KG2A 1MG1A 1S9TA 3PV0E 1PEBA 1UTHA 3UP9A 1N7XA 4R74A 5I57A 3HSTA 1B4ZA 2I6EA 2IEEA 4OQOA 1DTGA 4G2ZA 1PDAA 1Y4CA 4HTGA 2ALUA 3IB2A 5BWJA 1AL3A 1URGA 1EU8A 4P0GA 5AE4A 2I49A 3OENA 5DVFA 3H03A 1BP5A 3R7XA 4NF8B 4R6YA 3FV2A 3MAMA 1B40A 1B58A 4NWCA 2G29A 1GV8A 3FVKA 3O97A 4I8CA 1SI1A 3K6UA 3FJMA 4EQBA 2P1SA 4QFLA 1OMPA 1WVJA 3MPKA 1Q1KA 1B51A 1MH4A 3IOTA 1FQCA 2V3QA 3TCFA 3KN8A 2VP1A 4QFOA 3VFJA 2R71A 4DDDA 3SESA 4OESA 2Y7IA 4F31B 3RTWB 1IQ7A 3PPPA 1WODA 3KOSA 1MXZA 3TDJA 3GZGA 3V5AA 1BTJA 5JTYB 3C31A 2O69A 4U21A 2PT2A 1TWYA 5AA2A 1JEUA 1XC1A 4U1ZA 4FAJA 4QFKA 2XXIA 2D21A 4ZZEA 5CM6A 2DWJA 1UTBB 3G3JA 3C4MA 3N26A 4NF5B 4NTLA 4O3BA 2XXUA 1NNFA 3C34A 4Q8RA 2RKMA 1LAFE 4WKMA 1UIVA 1A8FA 1JNFA 3B6QA 3R26A 1R1NA 2ZYOA 3MVZA 4U4XA 1L5TA 5TP9A 1CB6A 4PE5B 1DPEA 4Q30B 3DM0A 1SD3A 1ZTYA 3IOWA 4YMBA 4IO6A 4QRZA 1ZLQA 4FE8A 2QS3A 1JW4A 2OCUA 4LQ2A 1MY4A 5H8FA 1MPCA 1O63A 2O7UA 4H8JA 3BFUA 4LA9A 3UK4A 1B3GA 3AXFA 1B52A 3K6VA 2XXPA 4JB7A 5CC2A 1MQGA 4OXVA 4BDRA 4RYAA 4F1YA 4ELOA 4TOZA 4G4PA 2R6GE 3QUJA 1NH7A 4O3AA 4WEDA 5F7VA 1OVBA 4F3GA 3IB0A 1B32A 1NNPA 3T22A 3MP6A 4H8IA 3TKDA 3BBRA 5DEXB 5I59B 2QS1A 2I58A 4MH5A 4BDLA 4QSDA 4RK9A 4DIGA 2DYXA 2DWIA 2X7QA 5HPQA 2F78A 4KQPA 3H4ZA 4GVOA 1EH3A 5H8NB 4OHNA 4I9DA 3SKPA 3IOUA 3U92A 4U22A 4YMAA 3CFLA 3R6UA 1QVSA 2DXYA 2O6AA 3QAXA 3K1MA 2YJPA 3V83A 5H8HA 3RPWA 1MDQA 5I2NB 3E3KA 3K00A 4NF6A 5KDTA 2Y7PA 2Y7RA 1BIYA 3HCQA 3GXAA 5K2XA 5I57B 3ECRA 2ZYKA 3OSQA 2O84X 3MZBA 4G68A 2REJA 1B7ZA 4F1UA 2DXRA 4JSOA 2AYSA 3TFLA 3OELA 2DVCA 4H67A 1IXHA 5TPAA 4H0WA 4LZ7A 3VXBA 4POXA 1M5BA 1IXGA 3K2DA 3PUWE 3FGSA 5ISUA 3MUQA 2F36A 1I69A 4ONYA 4OEUA 3Q28A 1NFTA 2XXQA 3PU5A 1N7WA 3O9PA 4U1OA 2F6PA 3MWBA 5KCJA 4GXSB 2DE2A 4JSDA 3QIMA 3T96B 2Z8DA 3GBAA 1URSA 3CR9A 1IUDA 3E13X 4OYVA 3HHFA 1NNTA 3FVOA 4GFRA 3H6WA 2DSFA 5I2KB 1RKMA 3SDFA 3K4UA 1FTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IKB A;  3TOD A;  1LBB A;  4RK2 A;  1MQJ A;  5CRY A;  2PMS A;  3EHS A;  1HSE A;  4P0I A;  3O6I A;  4POW A;  3H6U A;  3KEI A;  1YCJ A;  3T9U A;  3PMX A;  3VE1 B;  4ZEC A;  5A5X A;  4GXA A;  2A5S A;  1NKX A;  3O2A A;  1MXU A;  1DOT A;  1B1X A;  4ZE9 A;  2Y7W A;  3H06 B;  5TP9 B;  4OET A;  2M8C A;  2Q89 A;  2V84 A;  4KD5 A;  1A7L A;  1MRP A;  1XVX A;  2DWA A;  3UN6 A;  4Z7E A;  2OBG A;  1MH3 A;  5H8F B;  3TZA A;  1FW0 A;  3WAE A;  3M3F A;  3DP8 A;  5HBC A;  5ITO A;  4JXI A;  3Q26 A;  2D3I A;  5H8Q A;  2V3U A;  2ANJ A;  4FAT A;  1OQG A;  1LLS A;  2HZL A;  5K2Y A;  3M3K A;  2O7I A;  3SER A;  3FXQ A;  4OFJ A;  3Q29 A;  3ILU B;  4M4G A;  3DLN A;  4MLQ A;  3KN7 A;  3LC8 A;  4TQU Q;  5H8S A;  3FXU A;  2QMX A;  1O64 A;  1P99 A;  5I58 A;  1N76 A;  2ZNT A;  1SVX B;  2THI A;  2AIX A;  3E9X A;  4ND9 A;  1P1U A;  3IJO B;  2VD2 A;  1ZBM A;  3TCG A;  3B7D A;  3MZ9 A;  2HEU A;  1TFD A;  4F3P A;  3O28 A;  1ELJ A;  3MP1 A;  2DWH A;  4KR5 A;  4DE8 A;  4OTE A;  3SEV A;  2E1S A;  2UVI A;  1XHY A;  4Q5T A;  1B3H A;  1WDN A;  1OQH A;  4KCD A;  4EDP A;  2CMO A;  3O66 A;  2Q8J A;  1S50 A;  3KJT A;  1B9J A;  1Y3N A;  4KHZ E;  1YAE A;  4RJZ A;  2ONK E;  3MVW A;  4PFT A;  2G93 A;  3FJG A;  5H8H B;  1MXY A;  2H25 A;  3G3H A;  4DXU A;  4OER A;  4NF6 B;  5KDT B;  4JDF A;  2XHD A;  1ANF A;  2I0C A;  4BDN A;  1PB9 A;  4RXL A;  2XXY A;  3C32 A;  3VLW A;  1LFG A;  1B5J A;  1S7Y A;  1QJM A;  4JWO A;  2ZYM A;  2DE4 A;  4EXK A;  1B3F A;  3CVG A;  4GD5 A;  4GIZ A;  3PUV E;  4ISU A;  5TPA B;  3MBP A;  1PB8 A;  4YKI A;  1LB9 A;  1VR5 A;  5I56 A;  1XT8 A;  4ZEB A;  3H6T A;  1IZ1 A;  1US5 A;  1ZIU A;  2DP8 A;  4X9T A;  4QFN A;  4R75 A;  4KYS A;  5CMK A;  3T66 A;  1NNK A;  1US4 A;  2V3T A;  3OD7 A;  4LAT A;  3W15 C;  1B3L A;  2FYI A;  1M5C A;  3G3F A;  3EPE A;  3KBR A;  4PFY A;  4F1V A;  3QSL A;  1IEJ A;  2GHA A;  1FTK A;  4GLI A;  1Y1M A;  2WKY A;  3RNN A;  4DLD A;  1ATG A;  2F34 A;  4LQ5 A;  3MP8 A;  2QSX A;  3HHG A;  3PGF A;  1USY E;  4ZEI A;  1QUJ A;  4L17 A;  2Z8F A;  4H6D A;  2OK2 A;  4G77 A;  2VD3 A;  3H3G A;  1N04 A;  5L9M A;  2QPQ A;  4H1X A;  4YB6 A;  4F2Q A;  4THI A;  1SDX A;  4PQJ A;  1CE2 A;  1TXF A;  1GGG A;  3Q25 A;  3EN3 A;  1USY H;  1JQF A;  4DCX A;  1N3W A;  2XX8 A;  4EUO A;  3FJ7 A;  4C1T A;  1Y20 A;  1N0T A;  3MPL A;  1SYH A;  2B65 A;  3KJ7 A;  3LSW A;  3VVD A;  2XX9 A;  1MPB A;  1RYX A;  4BDM A;  3TCH A;  4ELR A;  2NWJ A;  4ZEF A;  4EQ7 A;  4U23 A;  3K0V A;  4KI0 E;  5F1Q A;  4OZ9 A;  1SW1 A;  4IO4 A;  1SI0 A;  2B3F A;  4KCC A;  3UA8 A;  2IA4 A;  4G8H A;  1OVT A;  2CZL A;  1II5 A;  4M1V A;  2YLN A;  4OMB A;  2PVU A;  4C0R A;  5JK4 A;  2Q9T A;  5ITP A;  5L9S A;  3PD8 A;  4QHQ A;  1PBQ A;  5DVI A;  5I58 B;  3LUY A;  3DP4 A;  3QYT A;  4ELP A;  4N07 A;  3K02 A;  4RY1 A;  1UIU A;  4EQ9 A;  4AB5 A;  2HAU A;  4JBZ A;  1SW4 A;  2RIN A;  1JW1 A;  4Z0I A;  3MW0 A;  3UGW A;  3LSL A;  1T0K A;  2QL3 A;  2OWT A;  2QS4 A;  3IX1 A;  1LST A;  1GR2 A;  3MC2 A;  1VE4 A;  1DPP A;  5TU0 A;  3C36 A;  1EZ9 A;  4GQO A;  3IK6 B;  3D4C A;  4I62 A;  3MJN A;  4DZ1 A;  1B5H A;  2DOJ A;  3C35 A;  3FVG A;  2VHA A;  5B70 A;  3QXM A;  4YKP A;  2X26 A;  5AA1 A;  1NH8 A;  3N5L A;  2RC9 A;  3T9V A;  1MQH A;  1FQE A;  4GWO A;  3FVN A;  2B3B A;  4LUB A;  3SEU A;  5M2V A;  2XX7 A;  1HSL A;  1A8E A;  1QKB A;  3OO6 A;  1B0H A;  4GF8 A;  3D4G A;  4OVJ A;  1LCF A;  3TEL A;  1LB8 A;  5KZT A;  1UTH B;  3PD9 A;  4EF2 A;  1MY3 A;  3CG1 A;  1OLC A;  3RUM A;  1MXW A;  2A5T A;  1JVY A;  5I56 B;  2F8D A;  1QKA A;  5AA3 A;  4Q0C A;  5EHS A;  3O6G A;  3MZ1 A;  4PET A;  1JEV A;  3TAJ A;  2HFB A;  2NXO A;  4YIC A;  1B5I A;  1UQW A;  5FHM A;  1Y3Q A;  2I4C A;  3DEL B;  4YZZ A;  1FQB A;  4F3B A;  1GVC A;  5IAI A;  4F19 A;  3VVE A;  1EZP A;  2QS2 A;  2BJJ X;  2OZZ A;  2FA7 A;  2RC8 A;  1MQD A;  1PB7 A;  4NF8 A;  1M5F A;  4XKQ A;  2ZMB A;  2GHB A;  4R6K A;  5FHO A;  1A99 A;  2F7B A;  3ZSF A;  1KWH A;  4IO3 A;  4MBP A;  1JET A;  1H44 A;  1O7T A;  3QK6 A;  1TFA A;  1AIV A;  3IB1 A;  3S9L C;  1MQI A;  1J1N A;  1PC3 A;  4IO2 A;  5AA2 B;  4H65 A;  4R2F A;  3ILT B;  3PUZ E;  4NE4 A;  3SET A;  3H7M A;  4ZZA A;  1MPD A;  3PMV A;  2F6G A;  2Y84 A;  3ZS6 A;  2E0S A;  3KSJ A;  1Y1Z A;  1AOV A;  2AL5 A;  2ONS A;  3PPN A;  3S2V A;  4OWD A;  1DSN A;  3UOR A;  1QUL A;  3VXC A;  5DYH A;  2VOZ A;  5CMB A;  3G3I A;  1EZO A;  3PUY E;  2AL4 A;  1MY2 A;  2NOO A;  1POT A;  3EQ1 A;  2O51 A;  3PPR A;  4KPT A;  2H98 A;  4YB5 A;  3OO9 A;  3CI8 A;  2XXH A;  3OXN A;  3HPI A;  1B4H A;  3RGY A;  1VSO A;  4WXJ A;  3LBS A;  4F22 A;  4ZS9 A;  3A3C A;  4GL8 A;  4X1D A;  1P1O A;  3S9M C;  4NF5 A;  4G68 C;  3M8U A;  1MS7 A;  4HCY A;  4P11 A;  3C9H A;  1H76 A;  4HCW A;  1SW2 A;  4DXB A;  2QMW A;  3H6V A;  5FTI A;  1RYO A;  2Q2A A;  2ZNU A;  3RN8 A;  4F2O A;  2XXR A;  3VDF A;  2GFE A;  4ZED A;  2ABH A;  3FD3 A;  1Z7M E;  3KN3 A;  2ESN A;  4FEB A;  4YU0 A;  3KGC A;  4GL0 A;  4R9G A;  4RPO A;  5FTH A;  2H5Y A;  3K1N A;  1N3X A;  5L8D A;  4G8N A;  4FEC A;  3OO8 A;  3S4U A;  3WAF A;  3B6W A;  3L6H A;  3U93 A;  2FNC A;  3M3L A;  3RT6 B;  4FJP A;  2RCB A;  2UVH A;  1M5D A;  1JVX A;  3I3V A;  3CG3 A;  4OFO A;  5HM4 B;  3FXR A;  2F35 A;  2DQV A;  2YPN A;  4WEP A;  4IGT A;  3FZV A;  4LZ5 A;  2V25 A;  3TQW A;  2UXA A;  4G68 B;  3OMB A;  3V89 B;  1XS5 A;  1IIT A;  4XIG Q;  1D9V A;  4X48 A;  3TTN A;  3PPO A;  4XKN A;  4MLV A;  2NUV A;  3IOV A;  2Q88 A;  4NMY A;  2HZK A;  3V8X B;  2Z22 A;  2PYY A;  4TLL B;  1LAX A;  5AA2 D;  4E0W A;  5EYF A;  5ICQ A;  4LVQ A;  2F97 A;  3FUZ A;  2F5X A;  4R72 A;  2O1L A;  4NED A;  1JW5 A;  4AB6 A;  2GH9 A;  3HV1 A;  3TTK A;  4AQ4 A;  3FAT A;  1H3D A;  1ZJL A;  1B6H A;  3KSX A;  4XTC Q;  3I6V A;  5CMM A;  4OFL A;  4ZE8 A;  1QUI A;  3IO6 A;  5KCJ B;  2H99 A;  4H5F A;  4NF4 A;  3RTF B;  1R9L A;  3EF7 A;  1Y9U A;  4ZDM A;  2HQ0 A;  3U1O A;  3G7W A;  4PFU A;  2H4I A;  3VV5 A;  4ESX A;  3RQT A;  2I3W A;  5ELV A;  5AA4 A;  1ZU0 A;  1B46 A;  2ONR A;  3K6X A;  5DTB A;  3IR1 A;  4I1D A;  3CFZ A;  4G8M A;  1H45 A;  2W7Y A;  4PP0 A;  3OO7 A;  2UYE A;  3TTL A;  3IAZ A;  3CSG A;  4MFI A;  4JWX A;  4IY6 A;  1XVY A;  5A5X B;  5JEI A;  2Z23 A;  4FED A;  1R6Z A;  3A3U A;  4RPN A;  3O6H A;  3UIF A;  3SEY A;  3BFT A;  3OSR A;  3C33 A;  2QRY A;  3W9V A;  4UA8 A;  5I2K A;  1B1H A;  3ODB A;  3U72 A;  4XKP A;  3FV1 A;  4PFW A;  4ECF A;  3IL1 B;  3HO7 A;  1SYI A;  4HS7 A;  1LGB C;  4R9F A;  3G3G A;  1SQY A;  1DMB A;  4JWY A;  3MVY A;  5H8Q B;  2F7C A;  3U8Q A;  1MDP 1;  4ESW A;  3I5O A;  4KYD A;  4F39 A;  4KFQ A;  1DTZ A;  1TT1 A;  5DVJ A;  3VLU A;  1IXI A;  1LFH A;  4QFP A;  2LAO A;  4LON B;  1FQA A;  3TQL A;  3JZJ A;  3FAS A;  4QF9 A;  4XKR A;  4FIM A;  1VFD A;  2O68 A;  3USD A;  1AH5 A;  3ONM A;  4OEV A;  1SBP A;  4GRK A;  4U2R A;  4GOT A;  3S9E A;  1LAG E;  1D3K A;  3HN0 A;  1QW0 A;  3TTM A;  2UVG A;  3B6T A;  3KFM A;  4IO7 A;  4RNS A;  3TMG A;  4XXU A;  4C1U A;  1MY1 A;  1D4N A;  1N84 A;  1FCK A;  1P1W A;  2I3V A;  3MQ9 A;  1FTJ A;  2HCA A;  4ZEK A;  2F7A A;  3N6T A;  4IY5 A;  3MVX A;  3N6U A;  3TUS A;  4U4S A;  1B3E A;  3T9X B;  4H5G A;  4N6P A;  4NWD A;  2HXW A;  3GBB A;  3L6G A;  2XD2 A;  3RY3 A;  1A54 A;  3OEK A;  3EHU A;  3LSF B;  3DP6 A;  4O3C A;  2Q2C A;  5B7D A;  2R9J A;  1PBP A;  2OWS A;  3IOR A;  3SEW A;  4X1B A;  1IXC A;  4R73 A;  3G3K A;  3CRB A;  2V93 A;  3W9W A;  3LSX A;  2PX1 A;  3KOT A;  1OIB A;  1Z7N E;  2PBW A;  2RF1 A;  3E4R A;  1M5E A;  4YAH X;  5J1D A;  3LR1 A;  4F18 A;  2ZYN A;  4NF4 B;  2H9B A;  1VFE A;  4BDQ A;  1ZMG A;  1BLF A;  3RLF E;  3ZKL A;  2Y7K A;  1H43 A;  5AA4 B;  3VLV A;  1IIW A;  4N13 A;  1POY 1;  1XOC A;  4IGR A;  2Z8E A;  3KZG A;  2NVU B;  2UVJ A;  2I48 A;  2RCA A;  4F29 A;  1BKA A;  2OJT A;  4YB7 A;  3JV9 A;  3O29 A;  1B7H A;  1YTV A;  2DS9 A;  3F11 A;  2QJE A;  4YKK A;  3CSB A;  3THI A;  2XXX A;  4BDO A;  4IO5 A;  1B0L A;  2O1M A;  3K01 A;  2OLB A;  4RA1 A;  2P2A A;  5LOM A;  3ZKK A;  2XD3 A;  5DT6 A;  1NL5 A;  1A40 A;  1MM7 A;  3TTR A;  1B7U A;  1R9Q A;  2ZNS A;  5CI5 A;  4E0X A;  3IJX B;  4KYE A;  2X7P A;  1FQF A;  3VVF A;  3CIJ A;  3P7I A;  4HW8 A;  3PMW A;  5I84 A;  5JTY A;  5ICT A;  1I6Q A;  1LCT A;  5FHN A;  5CBS A;  1B05 A;  2D5W A;  4EF1 A;  3K1P A;  2I0B A;  1FQD A;  4EXL A;  3K6W A;  1OLA A;  2DVZ A;  3FIR A;  1YPN A;  3TYH A;  3T9H B;  2REG A;  1UTB A;  5EHM A;  5CBR A;  5L9O A;  1P1N A;  4QSE A;  1Y4T A;  4YKJ A;  4R6H A;  3JYR A;  1QUK A;  3PUX E;  2XXT A;  3OEM A;  1LAH E;  2VGQ A;  4TLM B;  1D9Y A;  1NMU A;  5CMC A;  3CFX A;  1A55 A;  2GRV A;  1FTL A;  1FTM A;  1P1Q A;  3A09 A;  3QUF A;  1I6B A;  3RT8 A;  4LP2 B;  1LFI A;  2P0S A;  2XXW A;  2RC7 A;  3BKI B;  1B2H A;  4MF3 A;  2UYF A;  4R2B A;  4ELQ A;  1AMF A;  1ZKB A;  1SW5 A;  1HSJ A;  1URD A;  3N94 A;  2ZXT A;  4IB2 A;  1MXV A;  2KLF A;  5DEX A;  5I59 A;  4F3S A;  3SEX A;  1Q35 A;  4K3F A;  3OOA A;  3EHT A;  1F9B A;  2A5T B;  1GTK A;  1LBC A;  4QSC A;  2XXV A;  4BLA A;  4DXC A;  5BUU A;  1MY0 A;  3T93 B;  3TPA A;  3S9N C;  1Y3P A;  3IO4 A;  2I4B A;  4LZ8 A;  3GLB A;  2DE3 A;  2HAV A;  5H8N A;  3PPQ A;  4DCY A;  3U94 A;  4OEN A;  3Q27 A;  1MXX A;  3TEP A;  1I6A A;  1MM6 A;  4FOR A;  2PT1 A;  4UAC A;  5I2N A;  3KG2 A;  1MG1 A;  1S9T A;  3PV0 E;  1PEB A;  1UTH A;  3UP9 A;  1N7X A;  4R74 A;  5I57 A;  3HST A;  1B4Z A;  2I6E A;  2IEE A;  4OQO A;  1DTG A;  4G2Z A;  1PDA A;  1Y4C A;  4HTG A;  2ALU A;  3IB2 A;  5BWJ A;  1AL3 A;  1URG A;  1EU8 A;  4P0G A;  5AE4 A;  2I49 A;  3OEN A;  5DVF A;  3H03 A;  1BP5 A;  3R7X A;  4NF8 B;  4R6Y A;  3FV2 A;  3MAM A;  1B40 A;  1B58 A;  4NWC A;  2G29 A;  1GV8 A;  3FVK A;  3O97 A;  4I8C A;  1SI1 A;  3K6U A;  3FJM A;  4EQB A;  2P1S A;  4QFL A;  1OMP A;  1WVJ A;  3MPK A;  1Q1K A;  1B51 A;  1MH4 A;  3IOT A;  1FQC A;  2V3Q A;  3TCF A;  3KN8 A;  2VP1 A;  4QFO A;  3VFJ A;  2R71 A;  4DDD A;  3SES A;  4OES A;  2Y7I A;  4F31 B;  3RTW B;  1IQ7 A;  3PPP A;  1WOD A;  3KOS A;  1MXZ A;  3TDJ A;  3GZG A;  3V5A A;  1BTJ A;  5JTY B;  3C31 A;  2O69 A;  4U21 A;  2PT2 A;  1TWY A;  5AA2 A;  1JEU A;  1XC1 A;  4U1Z A;  4FAJ A;  4QFK A;  2XXI A;  2D21 A;  4ZZE A;  5CM6 A;  2DWJ A;  1UTB B;  3G3J A;  3C4M A;  3N26 A;  4NF5 B;  4NTL A;  4O3B A;  2XXU A;  1NNF A;  3C34 A;  4Q8R A;  2RKM A;  1LAF E;  4WKM A;  1UIV A;  1A8F A;  1JNF A;  3B6Q A;  3R26 A;  1R1N A;  2ZYO A;  3MVZ A;  4U4X A;  1L5T A;  5TP9 A;  1CB6 A;  4PE5 B;  1DPE A;  4Q30 B;  3DM0 A;  1SD3 A;  1ZTY A;  3IOW A;  4YMB A;  4IO6 A;  4QRZ A;  1ZLQ A;  4FE8 A;  2QS3 A;  1JW4 A;  2OCU A;  4LQ2 A;  1MY4 A;  5H8F A;  1MPC A;  1O63 A;  2O7U A;  4H8J A;  3BFU A;  4LA9 A;  3UK4 A;  1B3G A;  3AXF A;  1B52 A;  3K6V A;  2XXP A;  4JB7 A;  5CC2 A;  1MQG A;  4OXV A;  4BDR A;  4RYA A;  4F1Y A;  4ELO A;  4TOZ A;  4G4P A;  2R6G E;  3QUJ A;  1NH7 A;  4O3A A;  4WED A;  5F7V A;  1OVB A;  4F3G A;  3IB0 A;  1B32 A;  1NNP A;  3T22 A;  3MP6 A;  4H8I A;  3TKD A;  3BBR A;  5DEX B;  5I59 B;  2QS1 A;  2I58 A;  4MH5 A;  4BDL A;  4QSD A;  4RK9 A;  4DIG A;  2DYX A;  2DWI A;  2X7Q A;  5HPQ A;  2F78 A;  4KQP A;  3H4Z A;  4GVO A;  1EH3 A;  5H8N B;  4OHN A;  4I9D A;  3SKP A;  3IOU A;  3U92 A;  4U22 A;  4YMA A;  3CFL A;  3R6U A;  1QVS A;  2DXY A;  2O6A A;  3QAX A;  3K1M A;  2YJP A;  3V83 A;  5H8H A;  3RPW A;  1MDQ A;  5I2N B;  3E3K A;  3K00 A;  4NF6 A;  5KDT A;  2Y7P A;  2Y7R A;  1BIY A;  3HCQ A;  3GXA A;  5K2X A;  5I57 B;  3ECR A;  2ZYK A;  3OSQ A;  2O84 X;  3MZB A;  4G68 A;  2REJ A;  1B7Z A;  4F1U A;  2DXR A;  4JSO A;  2AYS A;  3TFL A;  3OEL A;  2DVC A;  4H67 A;  1IXH A;  5TPA A;  4H0W A;  4LZ7 A;  3VXB A;  4POX A;  1M5B A;  1IXG A;  3K2D A;  3PUW E;  3FGS A;  5ISU A;  3MUQ A;  2F36 A;  1I69 A;  4ONY A;  4OEU A;  3Q28 A;  1NFT A;  2XXQ A;  3PU5 A;  1N7W A;  3O9P A;  4U1O A;  2F6P A;  3MWB A;  5KCJ A;  4GXS B;  2DE2 A;  4JSD A;  3QIM A;  3T96 B;  2Z8D A;  3GBA A;  1URS A;  3CR9 A;  1IUD A;  3E13 X;  4OYV A;  3HHF A;  1NNT A;  3FVO A;  4GFR A;  3H6W A;  2DSF A;  5I2K B;  1RKM A;  3SDF A;  3K4U A;  1FTO A; 
#chains in the Genus database with same CATH topology
 5IKB A;  3TOD A;  1LBB A;  4RK2 A;  1MQJ A;  5CRY A;  2PMS A;  3EHS A;  1HSE A;  4P0I A;  3O6I A;  4POW A;  3H6U A;  3KEI A;  1YCJ A;  3T9U A;  3PMX A;  3VE1 B;  4ZEC A;  2WX9 A;  5A5X A;  4GXA A;  4HXV A;  2A5S A;  1NKX A;  3O2A A;  1MXU A;  1XI6 A;  3KC0 A;  1DOT A;  1B1X A;  4ZE9 A;  2Y7W A;  3H06 B;  5TP9 B;  4I3E A;  4OET A;  2M8C A;  2Q89 A;  2V84 A;  4KD5 A;  1A7L A;  1MRP A;  4I40 A;  1EYI A;  1XVX A;  2DWA A;  3UN6 A;  3RPL B;  1Q9D A;  4Z7E A;  2OBG A;  1MH3 A;  5H8F B;  3TZA A;  1FW0 A;  3WAE A;  3M3F A;  3DP8 A;  5HBC A;  5ITO A;  4JXI A;  3Q26 A;  2D3I A;  5H8Q A;  4PGP A;  2V3U A;  2ANJ A;  4FAT A;  1OQG A;  1LLS A;  2HZL A;  5K2Y A;  3M3K A;  2O7I A;  3SER A;  3FXQ A;  4OFJ A;  3Q29 A;  3ILU B;  4M4G A;  3DLN A;  4MLQ A;  3KN7 A;  3LC8 A;  4TQU Q;  5H8S A;  3FXU A;  4GX4 A;  1FSA A;  2QMX A;  1O64 A;  4JVD A;  1P99 A;  5I58 A;  1DCU A;  1N76 A;  2ZNT A;  1SVX B;  2THI A;  2AIX A;  3E9X A;  4ND9 A;  1P1U A;  3IJO B;  4PBQ A;  2VD2 A;  1ZBM A;  3TCG A;  3B7D A;  3MZ9 A;  2HEU A;  1TFD A;  4F3P A;  3O28 A;  1ELJ A;  3MP1 A;  2DWH A;  4KR5 A;  4DE8 A;  4OTE A;  5IM2 A;  3SEV A;  2E1S A;  2UVI A;  1XHY A;  1BK4 A;  4Q5T A;  1B3H A;  2GQ1 A;  1WDN A;  1OQH A;  4KCD A;  5F24 A;  5LTC A;  1DBZ A;  1RDX A;  4EDP A;  2CMO A;  3O66 A;  2Q8J A;  1S50 A;  4N17 A;  3IFA A;  1DK4 A;  3KJT A;  4XFE A;  1B9J A;  1Y3N A;  4KHZ E;  5IZ3 B;  1YAE A;  4RJZ A;  2ONK E;  3MVW A;  4PFT A;  2G93 A;  3FJG A;  5H8H B;  1MXY A;  2H25 A;  3G3H A;  4DXU A;  4OER A;  4NF6 B;  2PFZ A;  5KDT B;  5T3J A;  4JDF A;  2XHD A;  1ANF A;  2I0C A;  4BDN A;  1PB9 A;  4RXL A;  2XXY A;  3C32 A;  3VLW A;  1LFG A;  1B5J A;  1S7Y A;  1QJM A;  4JWO A;  2ZYM A;  2DE4 A;  4EXK A;  4O7M A;  1B3F A;  3CVG A;  4GD5 A;  4GIZ A;  3PUV E;  1IMB A;  4N8G A;  4DI3 D;  4X04 A;  4ISU A;  5TPA B;  3MBP A;  1PB8 A;  1FBE A;  4YKI A;  1LB9 A;  1VR5 A;  5I56 A;  1XT8 A;  4ZEB A;  1KA1 A;  3H6T A;  1IZ1 A;  2WEF A;  1US5 A;  1ZIU A;  2DP8 A;  5IZ1 A;  4X9T A;  4QFN A;  4R75 A;  2WYK A;  4KYS A;  5CMK A;  3T66 A;  1NNK A;  1US4 A;  2V3T A;  3OD7 A;  4LAT A;  3W15 C;  1B3L A;  2FYI A;  1M5C A;  3G3F A;  3EPE A;  3KBR A;  4PFY A;  2FBP A;  4F1V A;  3QSL A;  1IEJ A;  2GHA A;  1FTK A;  4GLI A;  1Y1M A;  2WKY A;  3RNN A;  4DLD A;  1ATG A;  2F34 A;  4LQ5 A;  3MP8 A;  2V4C A;  2QSX A;  3HHG A;  3E79 A;  3PGF A;  1USY E;  4ZEI A;  1D9Q A;  1QUJ A;  4L17 A;  4QXD A;  2Z8F A;  1LBZ A;  4H6D A;  2OK2 A;  4G77 A;  2VD3 A;  3H3G A;  1N04 A;  5L9M A;  2QPQ A;  4H1X A;  2VPO A;  4YB6 A;  4THI A;  4NN3 A;  1SDX A;  4F2Q A;  4PQJ A;  1CE2 A;  1TXF A;  1GGG A;  3Q25 A;  3EN3 A;  1USY H;  4IR8 A;  1JQF A;  4DCX A;  4JVC A;  5I3S A;  1N3W A;  2XX8 A;  4EUO A;  3FJ7 A;  4HE1 A;  4C1T A;  1Y20 A;  1N0T A;  3MPL A;  1SYH A;  2B65 A;  3LUZ A;  3KJ7 A;  3LSW A;  3VVD A;  2XX9 A;  1MPB A;  1RYX A;  4BDM A;  3TCH A;  4ELR A;  2NWJ A;  4ZEF A;  4EQ7 A;  4U23 A;  3K0V A;  4KI0 E;  5F1Q A;  4OZ9 A;  4GWU A;  1FBP A;  1SW1 A;  4IO4 A;  1SI0 A;  2B3F A;  4KCC A;  3UA8 A;  2IA4 A;  4G8H A;  1OVT A;  2CZL A;  1II5 A;  4M1V A;  2YLN A;  4OMB A;  1JP4 A;  2PVU A;  4C0R A;  5JK4 A;  2Q9T A;  5ITP A;  5L9S A;  3PD8 A;  3PTY A;  4QHQ A;  1PBQ A;  5DVI A;  5I58 B;  3LUY A;  3DP4 A;  3QYT A;  4ELP A;  4PDD A;  4N07 A;  1NV0 A;  3K02 A;  4RY1 A;  1UIU A;  4G61 A;  4EQ9 A;  4AB5 A;  2HAU A;  4LN5 A;  4JBZ A;  1NUY A;  1SW4 A;  2RIN A;  1JW1 A;  4Z0I A;  2VT5 A;  4P56 A;  3MW0 A;  3UGW A;  3LSL A;  1T0K A;  2QL3 A;  2OWT A;  2QS4 A;  3IX1 A;  1LST A;  1GR2 A;  3MC2 A;  1VE4 A;  1NV7 A;  1DPP A;  1FPJ A;  5TU0 A;  3C36 A;  4PTK A;  1EZ9 A;  4GQO A;  3IK6 B;  3D4C A;  4I62 A;  3MJN A;  4O8M A;  4DZ1 A;  1B5H A;  2DOJ A;  1FPE A;  3C35 A;  3FVG A;  2VHA A;  5B70 A;  3QXM A;  4YKP A;  2X26 A;  4N6D A;  5AA1 A;  1NH8 A;  3N5L A;  2RC9 A;  2Y5K A;  1NUW A;  3T9V A;  1MQH A;  4MHF A;  1FQE A;  4GWO A;  3FVN A;  2B3B A;  2ZZX A;  4LUB A;  3SEU A;  4DI4 B;  5M2V A;  2XX7 A;  1HSL A;  4NAP A;  1A8E A;  1QKB A;  3OO6 A;  1B0H A;  4GF8 A;  3D4G A;  4OVJ A;  1LCF A;  3TEL A;  2DDK A;  1LB8 A;  5KZT A;  1UTH B;  3PD9 A;  4EF2 A;  1MY3 A;  3CG1 A;  1FPF A;  1OLC A;  3RUM A;  1MXW A;  2A5T A;  1JVY A;  5I56 B;  2F8D A;  1QKA A;  5AA3 A;  4Q0C A;  5EHS A;  3O6G A;  3MZ1 A;  4PET A;  1RDY A;  1JEV A;  3TAJ A;  2HFB A;  2NXO A;  4YIC A;  1B5I A;  5DW8 A;  1UQW A;  5ET8 A;  5FHM A;  1Y3Q A;  2I4C A;  3DEL B;  4YZZ A;  5EYG A;  1FQB A;  4F3B A;  1GVC A;  5IAI A;  4F19 A;  3VVE A;  1EZP A;  4XEQ A;  4N6K A;  2QS2 A;  2BJJ X;  2PCR A;  2OZZ A;  2FA7 A;  2RC8 A;  1MQD A;  5ET7 A;  4MX6 A;  1PB7 A;  4NF8 A;  4OVR A;  1M5F A;  4XKQ A;  2ZMB A;  2GHB A;  4R6K A;  5FHO A;  1A99 A;  2F7B A;  3ZSF A;  1KWH A;  4IO3 A;  4MBP A;  1JET A;  1H44 A;  1O7T A;  3QK6 A;  1TFA A;  1AIV A;  3IB1 A;  3S9L C;  4O7I A;  1MQI A;  1J1N A;  1PC3 A;  4IO2 A;  5AA2 B;  4H65 A;  4R2F A;  3ILT B;  3PUZ E;  4MEV A;  4OAN A;  3LV0 A;  4NE4 A;  3SET A;  2Q74 A;  3H7M A;  4ZZA A;  4GWW A;  4GWY A;  2B4L A;  1MPD A;  4NHB A;  3PMV A;  2F6G A;  4OVT A;  2Y84 A;  4AS4 A;  3ZS6 A;  2E0S A;  3KSJ A;  1Y1Z A;  1AOV A;  2AL5 A;  2ONS A;  3PPN A;  3S2V A;  4OWD A;  1DSN A;  3UOR A;  1QUL A;  3VXC A;  5DYH A;  2VOZ A;  1LBY A;  5CMB A;  3G3I A;  1EZO A;  3PUY E;  2AL4 A;  1MY2 A;  2NOO A;  1POT A;  2XWO A;  3EQ1 A;  2O51 A;  3PPR A;  4KPT A;  2H98 A;  4YB5 A;  1NUZ A;  3OO9 A;  4OVQ A;  3CI8 A;  1IMF A;  2XXH A;  3OXN A;  3HPI A;  4PGN A;  2FIX A;  1B4H A;  3RGY A;  1VSO A;  4PF6 A;  4WXJ A;  3LBS A;  4F22 A;  4ZS9 A;  3A3C A;  4GL8 A;  3KBZ A;  4X1D A;  1P1O A;  3S9M C;  4NF5 A;  4G68 C;  1NV1 A;  1MS7 A;  3M8U A;  2XXK A;  4HCY A;  4P11 A;  3C9H A;  1H76 A;  4HCW A;  1SW2 A;  4DXB A;  2QMW A;  3H6V A;  5FTI A;  1RYO A;  2Q2A A;  2ZNU A;  3RN8 A;  4F2O A;  2XXR A;  3VDF A;  2QVU A;  2GFE A;  4ZED A;  2ABH A;  3FD3 A;  1Z7M E;  3KN3 A;  2ESN A;  3T0J A;  4FEB A;  4YU0 A;  4I3Y A;  3KGC A;  4GL0 A;  4R9G A;  2WYP A;  4RPO A;  5FTH A;  2H5Y A;  3K1N A;  1N3X A;  1NV2 A;  5L8D A;  4G8N A;  4FEC A;  3OO8 A;  3S4U A;  3WAF A;  3B6W A;  3L6H A;  3U93 A;  2FNC A;  3M3L A;  3RT6 B;  4FJP A;  2RCB A;  2UVH A;  1M5D A;  1JVX A;  3I3V A;  3CG3 A;  4OFO A;  5HM4 B;  3FXR A;  4GWZ A;  3T1B A;  2F35 A;  2DQV A;  2YPN A;  3B8B A;  4WEP A;  4IGT A;  3FZV A;  4LZ5 A;  2V25 A;  1FBG A;  2CZI A;  3TQW A;  2QVV A;  2UXA A;  4G68 B;  3OMB A;  3V89 B;  1XS5 A;  1IIT A;  4XIG Q;  5EQ7 A;  3FXB A;  1D9V A;  4X48 A;  4GWX A;  3PPO A;  3TTN A;  4XKN A;  4MLV A;  2NUV A;  3IOV A;  1SPI A;  2Q88 A;  4NMY A;  2HZK A;  3V8X B;  2Z22 A;  2PYY A;  4TLL B;  1LAX A;  5AA2 D;  4E0W A;  5EYF A;  5ICQ A;  4LVQ A;  2F97 A;  3FUZ A;  5EYH A;  2F5X A;  4R72 A;  2O1L A;  4NED A;  1JW5 A;  2BJI A;  4AB6 A;  2GH9 A;  3HV1 A;  1NI9 A;  3TTK A;  4AQ4 A;  3FAT A;  1H3D A;  1ZJL A;  1B6H A;  3KSX A;  4XTC Q;  3I6V A;  5CMM A;  3U65 A;  4OFL A;  4FBP A;  1QUI A;  3IO6 A;  4ZE8 A;  5KCJ B;  2H99 A;  4H5F A;  4NF4 A;  3RTF B;  1R9L A;  3EF7 A;  1Y9U A;  4ZDM A;  2HQ0 A;  3U1O A;  3G7W A;  2XWK A;  4PFU A;  2H4I A;  4H46 A;  4HE0 A;  3VV5 A;  4ESX A;  3RQT A;  2I3W A;  5ELV A;  3ROJ A;  5AA4 A;  1ZU0 A;  2XA5 A;  4NX1 A;  1B46 A;  2ONR A;  3K6X A;  1LBV A;  2Q8M A;  5DTB A;  4OA4 A;  3IR1 A;  4I1D A;  3CFZ A;  4G8M A;  1H45 A;  2W7Y A;  4PP0 A;  4NF0 A;  2CZK A;  3OO7 A;  2UYE A;  3TTL A;  3IAZ A;  3CSG A;  4X8R A;  4MFI A;  4JWX A;  4IY6 A;  1XVY A;  5A5X B;  5JEI A;  2Z23 A;  4P3L A;  4FED A;  1R6Z A;  3A3U A;  4RPN A;  3O6H A;  3UIF A;  3SEY A;  2R8T A;  3BFT A;  3OSR A;  3C33 A;  3A29 A;  2QRY A;  3W9V A;  4UA8 A;  5I2K A;  2F3B A;  1B1H A;  3ODB A;  3U72 A;  2B4M A;  4XKP A;  3FV1 A;  4NGU A;  4PFW A;  4ECF A;  3IL1 B;  3IFC A;  3HO7 A;  1SYI A;  4HS7 A;  4MNI A;  4MAG A;  1LGB C;  4R9F A;  3G3G A;  1SQY A;  1DMB A;  4JWY A;  3MVY A;  1G0I A;  5H8Q B;  2HXR A;  2F7C A;  3U8Q A;  1MDP 1;  2FHY A;  3CHG A;  4ESW A;  3I5O A;  4NQ8 A;  4KYD A;  4F39 A;  4KFQ A;  5ESY A;  1DTZ A;  1TT1 A;  5DVJ A;  3VLU A;  1FPI A;  1IXI A;  1LFH A;  4QFP A;  2JJK A;  2LAO A;  4LON B;  4GBW A;  1FQA A;  3TQL A;  3JZJ A;  3FAS A;  4QF9 A;  4XKR A;  4FIM A;  1VFD A;  2O68 A;  2ZZV A;  3USD A;  1AH5 A;  3ONM A;  4OEV A;  1SBP A;  4GRK A;  4U2R A;  4GOT A;  2CEX A;  1FPB A;  3S9E A;  1EYK A;  1LAG E;  1D3K A;  3HN0 A;  1QW0 A;  3TTM A;  2UVG A;  3B6T A;  3KFM A;  1IMC A;  4IO7 A;  4RNS A;  4N8Y A;  2Y5L A;  3TMG A;  4XXU A;  4C1U A;  4GX6 A;  5LDZ A;  1MY1 A;  2L5V A;  1D4N A;  1N84 A;  4GX3 A;  1FCK A;  2F3D A;  4NG7 A;  1P1W A;  2I3V A;  3MQ9 A;  1FTJ A;  2HCA A;  4ZEK A;  2F7A A;  3N6T A;  4IY5 A;  1KZ8 A;  3MVX A;  3N6U A;  3TUS A;  4U4S A;  1B3E A;  3T9X B;  4H5G A;  4N6P A;  4NWD A;  2OWZ A;  2HXW A;  3GBB A;  3L6G A;  2XD2 A;  3RY3 A;  1A54 A;  3OEK A;  3EHU A;  3LSF B;  3DP6 A;  4O3C A;  2Q2C A;  5B7D A;  2R9J A;  1PBP A;  2OWS A;  3IOR A;  3SEW A;  2OX3 A;  4OVS A;  4X1B A;  1IXC A;  4R73 A;  3G3K A;  3CRB A;  2V93 A;  3W9W A;  3LSX A;  2PX1 A;  1FRP A;  3KOT A;  1OIB A;  1Z7N E;  2PBW A;  2RF1 A;  1K9Z A;  3E4R A;  4PFI A;  1M5E A;  4YAH X;  5J1D A;  3LR1 A;  4F18 A;  2ZYN A;  4NF4 B;  2H9B A;  4P8B A;  3NOH A;  1VFE A;  4BDQ A;  1ZMG A;  1BLF A;  3RLF E;  3ZKL A;  2Y7K A;  1H43 A;  5AA4 B;  5ET5 A;  3VLV A;  1IIW A;  4N13 A;  1POY 1;  4PE3 A;  1XOC A;  1FTA A;  4IGR A;  2Z8E A;  3KZG A;  2NVU B;  2UVJ A;  2I48 A;  2RCA A;  4F29 A;  1BKA A;  2OJT A;  3MYU A;  4YB7 A;  1YXI A;  3JV9 A;  3O29 A;  1B7H A;  4PF8 A;  3RYD A;  5I7I A;  1YTV A;  2DS9 A;  3F11 A;  5I5P A;  2QJE A;  2PFY A;  3ISP A;  4YKK A;  1INP A;  3CSB A;  3THI A;  1KA0 A;  2XXX A;  4BDO A;  4IO5 A;  1B0L A;  2O1M A;  3K01 A;  2OLB A;  4RA1 A;  2P2A A;  5LOM A;  3ZKK A;  2XD3 A;  4GBV A;  5DT6 A;  1NL5 A;  4PC9 A;  1A40 A;  2MKZ A;  1MM7 A;  3TTR A;  1B7U A;  1R9Q A;  2KR0 A;  4MIJ A;  2ZNS A;  5CI5 A;  4E0X A;  3IJX B;  4KYE A;  2X7P A;  4N81 A;  1FQF A;  3VVF A;  3CIJ A;  3P7I A;  4HW8 A;  3PMW A;  5I84 A;  5JTY A;  5ICT A;  1I6Q A;  1LCT A;  4GWS A;  5FHN A;  5CBS A;  1B05 A;  2D5W A;  4EF1 A;  2ZZW A;  3K1P A;  5EQ8 A;  2I0B A;  1FQD A;  4EXL A;  3K6W A;  1YYZ A;  1OLA A;  2DVZ A;  3FIR A;  1YPN A;  2HHM A;  3TYH A;  3T9H B;  2REG A;  2WBB A;  1UTB A;  5EHM A;  5CBR A;  5L9O A;  1P1N A;  1LEV A;  4QSE A;  2XWI A;  1Y4T A;  4YKJ A;  4R6H A;  3JYR A;  4OVP A;  1QUK A;  3PUX E;  2XXT A;  3OEM A;  1LAH E;  2VGQ A;  2FIE A;  1CNQ A;  4TLM B;  1D9Y A;  3BIH A;  5EQA A;  1NMU A;  5CMC A;  4HE2 A;  3CFX A;  1A55 A;  2GRV A;  1FTL A;  1FTM A;  1P1Q A;  3A09 A;  3QUF A;  1I6B A;  3RT8 A;  4P9K A;  1LBW A;  4LP2 B;  1LFI A;  3QMF A;  2P0S A;  1FBD A;  2XXW A;  2RC7 A;  3BKI B;  1VDW A;  1B2H A;  4MF3 A;  2UYF A;  4R2B A;  1FPK A;  4ELQ A;  1AMF A;  4MJO A;  1ZKB A;  1SW5 A;  1HSJ A;  1K9Y A;  1URD A;  3SZP A;  3N94 A;  1FPD A;  2ZXT A;  4IB2 A;  4O94 A;  1MXV A;  2KLF A;  5DEX A;  5I59 A;  4F3S A;  3SEX A;  1Q35 A;  4K3F A;  3OOA A;  3EHT A;  1F9B A;  2A5T B;  1FJ9 A;  1GTK A;  1LBC A;  4QSC A;  2XXV A;  4BLA A;  4DXC A;  5BUU A;  1MY0 A;  3T93 B;  1AWB A;  3TPA A;  3S9N C;  1Y3P A;  3IO4 A;  5IZZ A;  3HFU A;  2I4B A;  4LZ8 A;  3GLB A;  2DE3 A;  4MNP A;  5ET6 A;  1FBC A;  2HAV A;  5H8N A;  3PPQ A;  4KXP A;  4DCY A;  3U94 A;  4OEN A;  3Q27 A;  1MXX A;  3TEP A;  1I6A A;  1MM6 A;  4FOR A;  2PT1 A;  4UAC A;  1NV3 A;  5I2N A;  3KG2 A;  1MG1 A;  1S9T A;  3PV0 E;  1PEB A;  1UTH A;  3UP9 A;  1N7X A;  4R74 A;  5I57 A;  3HST A;  1B4Z A;  2I6E A;  2IEE A;  4OQO A;  1DTG A;  4G2Z A;  1PDA A;  1Y4C A;  4HTG A;  2ALU A;  3IB2 A;  5BWJ A;  1AL3 A;  1FPG A;  1URG A;  1EU8 A;  4P0G A;  5AE4 A;  2I49 A;  3OEN A;  5DVF A;  3H03 A;  1BP5 A;  3R7X A;  4NF8 B;  4R6Y A;  3FV2 A;  3MAM A;  1B40 A;  1B58 A;  4NWC A;  2G29 A;  4MMP A;  1GV8 A;  4P47 A;  3FVK A;  3O97 A;  4I8C A;  3E78 A;  2XWV A;  1SI1 A;  3K6U A;  3FJM A;  4JVI A;  4EQB A;  2P1S A;  4QFL A;  1OMP A;  1EYJ A;  1WVJ A;  3MPK A;  5J16 A;  1Q1K A;  4H45 A;  1B51 A;  1MH4 A;  3IOT A;  1FQC A;  3MST A;  2V3Q A;  3TCF A;  3KN8 A;  3BIG A;  2VP1 A;  4QFO A;  3VFJ A;  2R71 A;  4DDD A;  3SES A;  4OES A;  1G0H A;  2Y7I A;  4P1E A;  4F31 B;  2QFL A;  3RTW B;  1IQ7 A;  3PPP A;  1WOD A;  3KOS A;  1MXZ A;  2QVR A;  3TDJ A;  3GZG A;  1LBX A;  3V5A A;  1BTJ A;  5JTY B;  3C31 A;  2O69 A;  4U21 A;  2PT2 A;  1TWY A;  5AA2 A;  1IME A;  1JEU A;  1XC1 A;  4U1Z A;  2P3V A;  4FAJ A;  4QFK A;  2XXI A;  4QBA A;  2D21 A;  4ZZE A;  5CM6 A;  2DWJ A;  3KC1 A;  1UTB B;  1YZ0 A;  3G3J A;  3C4M A;  3N26 A;  4NF5 B;  4NTL A;  4O3B A;  2XXU A;  5A5L A;  1NNF A;  3C34 A;  2RKM A;  1LAF E;  4Q8R A;  4WKM A;  1UIV A;  1A8F A;  1JNF A;  3B6Q A;  3R26 A;  4MNC A;  1R1N A;  2ZYO A;  3MVZ A;  4U4X A;  5IGA A;  1IMD A;  1L5T A;  1NV5 A;  5TP9 A;  1CB6 A;  4PE5 B;  1DPE A;  4MCO A;  4Q30 B;  3DM0 A;  1SD3 A;  5EQ9 A;  1ZTY A;  2KQZ A;  3IOW A;  4YMB A;  1NV6 A;  4IO6 A;  4QRZ A;  1ZLQ A;  4FE8 A;  3RPL A;  2VPN A;  2QS3 A;  1JW4 A;  2OCU A;  4LQ2 A;  1MY4 A;  5H8F A;  1MPC A;  1O63 A;  4PAK A;  2O7U A;  4H8J A;  3BFU A;  4LA9 A;  3UK4 A;  1FJ6 A;  1B3G A;  3AXF A;  1B52 A;  4PBH A;  3K6V A;  5FBP A;  4AS5 A;  2XXP A;  4JB7 A;  1NV4 A;  3FBP A;  4XF5 A;  5CC2 A;  1MQG A;  4OXV A;  4BDR A;  4RYA A;  4F1Y A;  4ELO A;  4TOZ A;  4G4P A;  2R6G E;  3QUJ A;  1NH7 A;  4O3A A;  4WED A;  5F7V A;  1OVB A;  4F3G A;  3IB0 A;  1B32 A;  2P3N A;  1NNP A;  3T22 A;  2HPG A;  3MP6 A;  4H8I A;  3TKD A;  3BBR A;  5DEX B;  5I59 B;  2QS1 A;  2I58 A;  4MH5 A;  1FBF A;  4BDL A;  4QSD A;  4RK9 A;  4DIG A;  2DYX A;  2FVZ A;  2DWI A;  2X7Q A;  5HPQ A;  1FBH A;  2F78 A;  4KQP A;  3H4Z A;  4GVO A;  1EH3 A;  5H8N B;  4OHN A;  5IZ3 A;  3B50 A;  4I9D A;  4PDH A;  3SKP A;  3IOU A;  3U92 A;  4U22 A;  4YMA A;  3CFL A;  3R6U A;  1QVS A;  2DXY A;  2O6A A;  3QAX A;  3K1M A;  2YJP A;  3V83 A;  5H8H A;  3RPW A;  1MDQ A;  5I2N B;  3E3K A;  3K00 A;  4NF6 A;  5KDT A;  2Y7P A;  2Y7R A;  1BIY A;  3HCQ A;  3GXA A;  5K2X A;  4PFR A;  5I57 B;  3ECR A;  2ZYK A;  2CEY A;  3OSQ A;  1IMA A;  2O84 X;  1RDZ A;  3MZB A;  4G68 A;  4N4U A;  2REJ A;  1B7Z A;  2DXR A;  4JSO A;  4F1U A;  2AYS A;  4N15 A;  3TFL A;  1NUX A;  3OEL A;  1QGX A;  4P1L A;  2DVC A;  4H67 A;  1IXH A;  5TPA A;  4H0W A;  4LZ7 A;  4PAF A;  4N91 A;  3VXB A;  4POX A;  1M5B A;  1IXG A;  4PCD A;  4PAI A;  3K2D A;  2CZH A;  3PUW E;  3FGS A;  5ISU A;  3MUQ A;  2F36 A;  1I69 A;  3D1R A;  4ONY A;  4OEU A;  3Q28 A;  1NFT A;  2XXQ A;  3PU5 A;  2WBD A;  1N7W A;  3O9P A;  4U1O A;  2F6P A;  3MWB A;  5KCJ A;  4GXS B;  2DE2 A;  4JSD A;  3QIM A;  3T96 B;  2Z8D A;  3GBA A;  4UAB A;  1URS A;  3CR9 A;  3GYY A;  1IUD A;  3E13 X;  4OYV A;  3HHF A;  1NNT A;  4PFB A;  3FVO A;  4GFR A;  3H6W A;  2DSF A;  5I2K B;  1RKM A;  3SDF A;  3K4U A;  1FPL A;  1FTO A;  3EKI A; 
#chains in the Genus database with same CATH homology
 5IKB A;  3TOD A;  1LBB A;  4RK2 A;  1MQJ A;  5CRY A;  2PMS A;  3EHS A;  1HSE A;  4P0I A;  3O6I A;  4POW A;  3H6U A;  3KEI A;  1YCJ A;  3T9U A;  3PMX A;  3VE1 B;  4ZEC A;  5A5X A;  4GXA A;  2A5S A;  1NKX A;  3O2A A;  1MXU A;  1DOT A;  1B1X A;  4ZE9 A;  2Y7W A;  3H06 B;  5TP9 B;  4OET A;  2M8C A;  2Q89 A;  2V84 A;  4KD5 A;  1A7L A;  1MRP A;  1XVX A;  2DWA A;  3UN6 A;  4Z7E A;  2OBG A;  1MH3 A;  5H8F B;  3TZA A;  1FW0 A;  3WAE A;  3M3F A;  3DP8 A;  5HBC A;  5ITO A;  4JXI A;  3Q26 A;  2D3I A;  5H8Q A;  2V3U A;  2ANJ A;  4FAT A;  1OQG A;  1LLS A;  2HZL A;  5K2Y A;  3M3K A;  2O7I A;  3SER A;  3FXQ A;  4OFJ A;  3Q29 A;  3ILU B;  4M4G A;  3DLN A;  4MLQ A;  3KN7 A;  3LC8 A;  4TQU Q;  5H8S A;  3FXU A;  2QMX A;  1O64 A;  1P99 A;  5I58 A;  1N76 A;  2ZNT A;  1SVX B;  2THI A;  2AIX A;  3E9X A;  4ND9 A;  1P1U A;  3IJO B;  2VD2 A;  1ZBM A;  3TCG A;  3B7D A;  3MZ9 A;  2HEU A;  1TFD A;  4F3P A;  3O28 A;  1ELJ A;  3MP1 A;  2DWH A;  4KR5 A;  4DE8 A;  4OTE A;  3SEV A;  2E1S A;  2UVI A;  1XHY A;  4Q5T A;  1B3H A;  1WDN A;  1OQH A;  4KCD A;  4EDP A;  2CMO A;  3O66 A;  2Q8J A;  1S50 A;  3KJT A;  1B9J A;  1Y3N A;  4KHZ E;  1YAE A;  4RJZ A;  2ONK E;  3MVW A;  4PFT A;  2G93 A;  3FJG A;  5H8H B;  1MXY A;  2H25 A;  3G3H A;  4DXU A;  4OER A;  4NF6 B;  5KDT B;  4JDF A;  2XHD A;  1ANF A;  2I0C A;  4BDN A;  1PB9 A;  4RXL A;  2XXY A;  3C32 A;  3VLW A;  1LFG A;  1B5J A;  1S7Y A;  1QJM A;  4JWO A;  2ZYM A;  2DE4 A;  4EXK A;  1B3F A;  3CVG A;  4GD5 A;  4GIZ A;  3PUV E;  4ISU A;  5TPA B;  3MBP A;  1PB8 A;  4YKI A;  1LB9 A;  1VR5 A;  5I56 A;  1XT8 A;  4ZEB A;  3H6T A;  1IZ1 A;  1US5 A;  1ZIU A;  2DP8 A;  4X9T A;  4QFN A;  4R75 A;  4KYS A;  5CMK A;  3T66 A;  1NNK A;  1US4 A;  2V3T A;  3OD7 A;  4LAT A;  3W15 C;  1B3L A;  2FYI A;  1M5C A;  3G3F A;  3EPE A;  3KBR A;  4PFY A;  4F1V A;  3QSL A;  1IEJ A;  2GHA A;  1FTK A;  4GLI A;  1Y1M A;  2WKY A;  3RNN A;  4DLD A;  1ATG A;  2F34 A;  4LQ5 A;  3MP8 A;  2QSX A;  3HHG A;  3PGF A;  1USY E;  4ZEI A;  1QUJ A;  4L17 A;  2Z8F A;  4H6D A;  2OK2 A;  4G77 A;  2VD3 A;  3H3G A;  1N04 A;  5L9M A;  2QPQ A;  4H1X A;  4YB6 A;  4F2Q A;  4THI A;  1SDX A;  4PQJ A;  1CE2 A;  1TXF A;  1GGG A;  3Q25 A;  3EN3 A;  1USY H;  1JQF A;  4DCX A;  1N3W A;  2XX8 A;  4EUO A;  3FJ7 A;  4C1T A;  1Y20 A;  1N0T A;  3MPL A;  1SYH A;  2B65 A;  3KJ7 A;  3LSW A;  3VVD A;  2XX9 A;  1MPB A;  1RYX A;  4BDM A;  3TCH A;  4ELR A;  2NWJ A;  4ZEF A;  4EQ7 A;  4U23 A;  3K0V A;  4KI0 E;  5F1Q A;  4OZ9 A;  1SW1 A;  4IO4 A;  1SI0 A;  2B3F A;  4KCC A;  3UA8 A;  2IA4 A;  4G8H A;  1OVT A;  2CZL A;  1II5 A;  4M1V A;  2YLN A;  4OMB A;  2PVU A;  4C0R A;  5JK4 A;  2Q9T A;  5ITP A;  5L9S A;  3PD8 A;  4QHQ A;  1PBQ A;  5DVI A;  5I58 B;  3LUY A;  3DP4 A;  3QYT A;  4ELP A;  4N07 A;  3K02 A;  4RY1 A;  1UIU A;  4EQ9 A;  4AB5 A;  2HAU A;  4JBZ A;  1SW4 A;  2RIN A;  1JW1 A;  4Z0I A;  3MW0 A;  3UGW A;  3LSL A;  1T0K A;  2QL3 A;  2OWT A;  2QS4 A;  3IX1 A;  1LST A;  1GR2 A;  3MC2 A;  1VE4 A;  1DPP A;  5TU0 A;  3C36 A;  1EZ9 A;  4GQO A;  3IK6 B;  3D4C A;  4I62 A;  3MJN A;  4DZ1 A;  1B5H A;  2DOJ A;  3C35 A;  3FVG A;  2VHA A;  5B70 A;  3QXM A;  4YKP A;  2X26 A;  5AA1 A;  1NH8 A;  3N5L A;  2RC9 A;  3T9V A;  1MQH A;  1FQE A;  4GWO A;  3FVN A;  2B3B A;  4LUB A;  3SEU A;  5M2V A;  2XX7 A;  1HSL A;  1A8E A;  1QKB A;  3OO6 A;  1B0H A;  4GF8 A;  3D4G A;  4OVJ A;  1LCF A;  3TEL A;  1LB8 A;  5KZT A;  1UTH B;  3PD9 A;  4EF2 A;  1MY3 A;  3CG1 A;  1OLC A;  3RUM A;  1MXW A;  2A5T A;  1JVY A;  5I56 B;  2F8D A;  1QKA A;  5AA3 A;  4Q0C A;  5EHS A;  3O6G A;  3MZ1 A;  4PET A;  1JEV A;  3TAJ A;  2HFB A;  2NXO A;  4YIC A;  1B5I A;  1UQW A;  5FHM A;  1Y3Q A;  2I4C A;  3DEL B;  4YZZ A;  1FQB A;  4F3B A;  1GVC A;  5IAI A;  4F19 A;  3VVE A;  1EZP A;  2QS2 A;  2BJJ X;  2OZZ A;  2FA7 A;  2RC8 A;  1MQD A;  1PB7 A;  4NF8 A;  1M5F A;  4XKQ A;  2ZMB A;  2GHB A;  4R6K A;  5FHO A;  1A99 A;  2F7B A;  3ZSF A;  1KWH A;  4IO3 A;  4MBP A;  1JET A;  1H44 A;  1O7T A;  3QK6 A;  1TFA A;  1AIV A;  3IB1 A;  3S9L C;  1MQI A;  1J1N A;  1PC3 A;  4IO2 A;  5AA2 B;  4H65 A;  4R2F A;  3ILT B;  3PUZ E;  4NE4 A;  3SET A;  3H7M A;  4ZZA A;  1MPD A;  3PMV A;  2F6G A;  2Y84 A;  3ZS6 A;  2E0S A;  3KSJ A;  1Y1Z A;  1AOV A;  2AL5 A;  2ONS A;  3PPN A;  3S2V A;  4OWD A;  1DSN A;  3UOR A;  1QUL A;  3VXC A;  5DYH A;  2VOZ A;  5CMB A;  3G3I A;  1EZO A;  3PUY E;  2AL4 A;  1MY2 A;  2NOO A;  1POT A;  3EQ1 A;  2O51 A;  3PPR A;  4KPT A;  2H98 A;  4YB5 A;  3OO9 A;  3CI8 A;  2XXH A;  3OXN A;  3HPI A;  1B4H A;  3RGY A;  1VSO A;  4WXJ A;  3LBS A;  4F22 A;  4ZS9 A;  3A3C A;  4GL8 A;  4X1D A;  1P1O A;  3S9M C;  4NF5 A;  4G68 C;  3M8U A;  1MS7 A;  4HCY A;  4P11 A;  3C9H A;  1H76 A;  4HCW A;  1SW2 A;  4DXB A;  2QMW A;  3H6V A;  5FTI A;  1RYO A;  2Q2A A;  2ZNU A;  3RN8 A;  4F2O A;  2XXR A;  3VDF A;  2GFE A;  4ZED A;  2ABH A;  3FD3 A;  1Z7M E;  3KN3 A;  2ESN A;  4FEB A;  4YU0 A;  3KGC A;  4GL0 A;  4R9G A;  4RPO A;  5FTH A;  2H5Y A;  3K1N A;  1N3X A;  5L8D A;  4G8N A;  4FEC A;  3OO8 A;  3S4U A;  3WAF A;  3B6W A;  3L6H A;  3U93 A;  2FNC A;  3M3L A;  3RT6 B;  4FJP A;  2RCB A;  2UVH A;  1M5D A;  1JVX A;  3I3V A;  3CG3 A;  4OFO A;  5HM4 B;  3FXR A;  2F35 A;  2DQV A;  2YPN A;  4WEP A;  4IGT A;  3FZV A;  4LZ5 A;  2V25 A;  3TQW A;  2UXA A;  4G68 B;  3OMB A;  3V89 B;  1XS5 A;  1IIT A;  4XIG Q;  1D9V A;  4X48 A;  3TTN A;  3PPO A;  4XKN A;  4MLV A;  2NUV A;  3IOV A;  2Q88 A;  4NMY A;  2HZK A;  3V8X B;  2Z22 A;  2PYY A;  4TLL B;  1LAX A;  5AA2 D;  4E0W A;  5EYF A;  5ICQ A;  4LVQ A;  2F97 A;  3FUZ A;  2F5X A;  4R72 A;  2O1L A;  4NED A;  1JW5 A;  4AB6 A;  2GH9 A;  3HV1 A;  3TTK A;  4AQ4 A;  3FAT A;  1H3D A;  1ZJL A;  1B6H A;  3KSX A;  4XTC Q;  3I6V A;  5CMM A;  4OFL A;  4ZE8 A;  1QUI A;  3IO6 A;  5KCJ B;  2H99 A;  4H5F A;  4NF4 A;  3RTF B;  1R9L A;  3EF7 A;  1Y9U A;  4ZDM A;  2HQ0 A;  3U1O A;  3G7W A;  4PFU A;  2H4I A;  3VV5 A;  4ESX A;  3RQT A;  2I3W A;  5ELV A;  5AA4 A;  1ZU0 A;  1B46 A;  2ONR A;  3K6X A;  5DTB A;  3IR1 A;  4I1D A;  3CFZ A;  4G8M A;  1H45 A;  2W7Y A;  4PP0 A;  3OO7 A;  2UYE A;  3TTL A;  3IAZ A;  3CSG A;  4MFI A;  4JWX A;  4IY6 A;  1XVY A;  5A5X B;  5JEI A;  2Z23 A;  4FED A;  1R6Z A;  3A3U A;  4RPN A;  3O6H A;  3UIF A;  3SEY A;  3BFT A;  3OSR A;  3C33 A;  2QRY A;  3W9V A;  4UA8 A;  5I2K A;  1B1H A;  3ODB A;  3U72 A;  4XKP A;  3FV1 A;  4PFW A;  4ECF A;  3IL1 B;  3HO7 A;  1SYI A;  4HS7 A;  1LGB C;  4R9F A;  3G3G A;  1SQY A;  1DMB A;  4JWY A;  3MVY A;  5H8Q B;  2F7C A;  3U8Q A;  1MDP 1;  4ESW A;  3I5O A;  4KYD A;  4F39 A;  4KFQ A;  1DTZ A;  1TT1 A;  5DVJ A;  3VLU A;  1IXI A;  1LFH A;  4QFP A;  2LAO A;  4LON B;  1FQA A;  3TQL A;  3JZJ A;  3FAS A;  4QF9 A;  4XKR A;  4FIM A;  1VFD A;  2O68 A;  3USD A;  1AH5 A;  3ONM A;  4OEV A;  1SBP A;  4GRK A;  4U2R A;  4GOT A;  3S9E A;  1LAG E;  1D3K A;  3HN0 A;  1QW0 A;  3TTM A;  2UVG A;  3B6T A;  3KFM A;  4IO7 A;  4RNS A;  3TMG A;  4XXU A;  4C1U A;  1MY1 A;  1D4N A;  1N84 A;  1FCK A;  1P1W A;  2I3V A;  3MQ9 A;  1FTJ A;  2HCA A;  4ZEK A;  2F7A A;  3N6T A;  4IY5 A;  3MVX A;  3N6U A;  3TUS A;  4U4S A;  1B3E A;  3T9X B;  4H5G A;  4N6P A;  4NWD A;  2HXW A;  3GBB A;  3L6G A;  2XD2 A;  3RY3 A;  1A54 A;  3OEK A;  3EHU A;  3LSF B;  3DP6 A;  4O3C A;  2Q2C A;  5B7D A;  2R9J A;  1PBP A;  2OWS A;  3IOR A;  3SEW A;  4X1B A;  1IXC A;  4R73 A;  3G3K A;  3CRB A;  2V93 A;  3W9W A;  3LSX A;  2PX1 A;  3KOT A;  1OIB A;  1Z7N E;  2PBW A;  2RF1 A;  3E4R A;  1M5E A;  4YAH X;  5J1D A;  3LR1 A;  4F18 A;  2ZYN A;  4NF4 B;  2H9B A;  1VFE A;  4BDQ A;  1ZMG A;  1BLF A;  3RLF E;  3ZKL A;  2Y7K A;  1H43 A;  5AA4 B;  3VLV A;  1IIW A;  4N13 A;  1POY 1;  1XOC A;  4IGR A;  2Z8E A;  3KZG A;  2NVU B;  2UVJ A;  2I48 A;  2RCA A;  4F29 A;  1BKA A;  2OJT A;  4YB7 A;  3JV9 A;  3O29 A;  1B7H A;  1YTV A;  2DS9 A;  3F11 A;  2QJE A;  4YKK A;  3CSB A;  3THI A;  2XXX A;  4BDO A;  4IO5 A;  1B0L A;  2O1M A;  3K01 A;  2OLB A;  4RA1 A;  2P2A A;  5LOM A;  3ZKK A;  2XD3 A;  5DT6 A;  1NL5 A;  1A40 A;  1MM7 A;  3TTR A;  1B7U A;  1R9Q A;  2ZNS A;  5CI5 A;  4E0X A;  3IJX B;  4KYE A;  2X7P A;  1FQF A;  3VVF A;  3CIJ A;  3P7I A;  4HW8 A;  3PMW A;  5I84 A;  5JTY A;  5ICT A;  1I6Q A;  1LCT A;  5FHN A;  5CBS A;  1B05 A;  2D5W A;  4EF1 A;  3K1P A;  2I0B A;  1FQD A;  4EXL A;  3K6W A;  1OLA A;  2DVZ A;  3FIR A;  1YPN A;  3TYH A;  3T9H B;  2REG A;  1UTB A;  5EHM A;  5CBR A;  5L9O A;  1P1N A;  4QSE A;  1Y4T A;  4YKJ A;  4R6H A;  3JYR A;  1QUK A;  3PUX E;  2XXT A;  3OEM A;  1LAH E;  2VGQ A;  4TLM B;  1D9Y A;  1NMU A;  5CMC A;  3CFX A;  1A55 A;  2GRV A;  1FTL A;  1FTM A;  1P1Q A;  3A09 A;  3QUF A;  1I6B A;  3RT8 A;  4LP2 B;  1LFI A;  2P0S A;  2XXW A;  2RC7 A;  3BKI B;  1B2H A;  4MF3 A;  2UYF A;  4R2B A;  4ELQ A;  1AMF A;  1ZKB A;  1SW5 A;  1HSJ A;  1URD A;  3N94 A;  2ZXT A;  4IB2 A;  1MXV A;  2KLF A;  5DEX A;  5I59 A;  4F3S A;  3SEX A;  1Q35 A;  4K3F A;  3OOA A;  3EHT A;  1F9B A;  2A5T B;  1GTK A;  1LBC A;  4QSC A;  2XXV A;  4BLA A;  4DXC A;  5BUU A;  1MY0 A;  3T93 B;  3TPA A;  3S9N C;  1Y3P A;  3IO4 A;  2I4B A;  4LZ8 A;  3GLB A;  2DE3 A;  2HAV A;  5H8N A;  3PPQ A;  4DCY A;  3U94 A;  4OEN A;  3Q27 A;  1MXX A;  3TEP A;  1I6A A;  1MM6 A;  4FOR A;  2PT1 A;  4UAC A;  5I2N A;  3KG2 A;  1MG1 A;  1S9T A;  3PV0 E;  1PEB A;  1UTH A;  3UP9 A;  1N7X A;  4R74 A;  5I57 A;  3HST A;  1B4Z A;  2I6E A;  2IEE A;  4OQO A;  1DTG A;  4G2Z A;  1PDA A;  1Y4C A;  4HTG A;  2ALU A;  3IB2 A;  5BWJ A;  1AL3 A;  1URG A;  1EU8 A;  4P0G A;  5AE4 A;  2I49 A;  3OEN A;  5DVF A;  3H03 A;  1BP5 A;  3R7X A;  4NF8 B;  4R6Y A;  3FV2 A;  3MAM A;  1B40 A;  1B58 A;  4NWC A;  2G29 A;  1GV8 A;  3FVK A;  3O97 A;  4I8C A;  1SI1 A;  3K6U A;  3FJM A;  4EQB A;  2P1S A;  4QFL A;  1OMP A;  1WVJ A;  3MPK A;  1Q1K A;  1B51 A;  1MH4 A;  3IOT A;  1FQC A;  2V3Q A;  3TCF A;  3KN8 A;  2VP1 A;  4QFO A;  3VFJ A;  2R71 A;  4DDD A;  3SES A;  4OES A;  2Y7I A;  4F31 B;  3RTW B;  1IQ7 A;  3PPP A;  1WOD A;  3KOS A;  1MXZ A;  3TDJ A;  3GZG A;  3V5A A;  1BTJ A;  5JTY B;  3C31 A;  2O69 A;  4U21 A;  2PT2 A;  1TWY A;  5AA2 A;  1JEU A;  1XC1 A;  4U1Z A;  4FAJ A;  4QFK A;  2XXI A;  2D21 A;  4ZZE A;  5CM6 A;  2DWJ A;  1UTB B;  3G3J A;  3C4M A;  3N26 A;  4NF5 B;  4NTL A;  4O3B A;  2XXU A;  1NNF A;  3C34 A;  4Q8R A;  2RKM A;  1LAF E;  4WKM A;  1UIV A;  1A8F A;  1JNF A;  3B6Q A;  3R26 A;  1R1N A;  2ZYO A;  3MVZ A;  4U4X A;  1L5T A;  5TP9 A;  1CB6 A;  4PE5 B;  1DPE A;  4Q30 B;  3DM0 A;  1SD3 A;  1ZTY A;  3IOW A;  4YMB A;  4IO6 A;  4QRZ A;  1ZLQ A;  4FE8 A;  2QS3 A;  1JW4 A;  2OCU A;  4LQ2 A;  1MY4 A;  5H8F A;  1MPC A;  1O63 A;  2O7U A;  4H8J A;  3BFU A;  4LA9 A;  3UK4 A;  1B3G A;  3AXF A;  1B52 A;  3K6V A;  2XXP A;  4JB7 A;  5CC2 A;  1MQG A;  4OXV A;  4BDR A;  4RYA A;  4F1Y A;  4ELO A;  4TOZ A;  4G4P A;  2R6G E;  3QUJ A;  1NH7 A;  4O3A A;  4WED A;  5F7V A;  1OVB A;  4F3G A;  3IB0 A;  1B32 A;  1NNP A;  3T22 A;  3MP6 A;  4H8I A;  3TKD A;  3BBR A;  5DEX B;  5I59 B;  2QS1 A;  2I58 A;  4MH5 A;  4BDL A;  4QSD A;  4RK9 A;  4DIG A;  2DYX A;  2DWI A;  2X7Q A;  5HPQ A;  2F78 A;  4KQP A;  3H4Z A;  4GVO A;  1EH3 A;  5H8N B;  4OHN A;  4I9D A;  3SKP A;  3IOU A;  3U92 A;  4U22 A;  4YMA A;  3CFL A;  3R6U A;  1QVS A;  2DXY A;  2O6A A;  3QAX A;  3K1M A;  2YJP A;  3V83 A;  5H8H A;  3RPW A;  1MDQ A;  5I2N B;  3E3K A;  3K00 A;  4NF6 A;  5KDT A;  2Y7P A;  2Y7R A;  1BIY A;  3HCQ A;  3GXA A;  5K2X A;  5I57 B;  3ECR A;  2ZYK A;  3OSQ A;  2O84 X;  3MZB A;  4G68 A;  2REJ A;  1B7Z A;  4F1U A;  2DXR A;  4JSO A;  2AYS A;  3TFL A;  3OEL A;  2DVC A;  4H67 A;  1IXH A;  5TPA A;  4H0W A;  4LZ7 A;  3VXB A;  4POX A;  1M5B A;  1IXG A;  3K2D A;  3PUW E;  3FGS A;  5ISU A;  3MUQ A;  2F36 A;  1I69 A;  4ONY A;  4OEU A;  3Q28 A;  1NFT A;  2XXQ A;  3PU5 A;  1N7W A;  3O9P A;  4U1O A;  2F6P A;  3MWB A;  5KCJ A;  4GXS B;  2DE2 A;  4JSD A;  3QIM A;  3T96 B;  2Z8D A;  3GBA A;  1URS A;  3CR9 A;  1IUD A;  3E13 X;  4OYV A;  3HHF A;  1NNT A;  3FVO A;  4GFR A;  3H6W A;  2DSF A;  5I2K B;  1RKM A;  3SDF A;  3K4U A;  1FTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...