2HZLA

Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
334
structure length
334
Chain Sequence
VTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP-T family sorbitol/mannitol transporter, periplasmic bin
publication title Crystal structures of an Extracytoplasmic Solute Receptor from a TRAP transporter in its open and closed forms reveal a helix-swapped dimer requiring a cation for alpha-keto acid binding.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Ligand binding, transport protein
total genus 124
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hzlA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hzlA01
3U93A 5CMMA 1M5EA 1I6AA 3H03A 2WYKA 4GLIA 4G4PA 4DXBA 2R6GE 4NF4B 1SBPA 4GF8A 1DTGA 3D4GA 3HCQA 3TEPA 3PV0E 2GRVA 4F22A 1A8EA 2XXYA 1MPDA 3CFXA 5CI5A 4YKKA 1A55A 4PFBA 3MPLA 1YTVA 5H8SA 4H8JA 5I2KB 1F9BA 1LBBA 1O63A 2DWAA 1B9JA 5I56B 2DE4A 3GBBA 4FJPA 3CG1A 2RCBA 4ELPA 3BFTA 1QKAA 3A3UA 2NOOA 4GIZA 4NWDA 4NWCA 2YJPA 2F36A 3KN8A 1NNPA 4BDMA 4XKQA 4XKPA 4G8HA 1P99A 1TFDA 2HPGA 5DT6A 3M3KA 3K6WA 4HW8A 1H43A 3H6VA 1RYOA 3BBRA 3S9NC 3RUMA 4MNIA 2PT1A 3B7DA 2UYFA 2XX7A 3ONMA 5I59A 2OBGA 4G68A 4OFOA 1P1NA 3IL1B 5ICQA 1LAHE 4QRZA 3ILTB 3SEUA 2I0CA 4QSDA 3T22A 1FQCA 4NTLA 4QFLA 3VFJA 5I58A 1D9YA 2CEYA 1I69A 1NNTA 1H76A 4RK9A 4OVPA 1RYXA 4ZZAA 5IM2A 4OESA 3IO4A 4ISUA 5A5XA 4R74A 4RJZA 5LOMA 1IXCA 2NVUB 2XHDA 2HZKA 1ATGA 4RXLA 4DXUA 1ZKBA 1LAXA 4F31B 4O8MA 4JWXA 2F35A 4QSCA 2VPNA 4EXKA 2XWOA 1MY3A 5AA4A 3QXMA 5TP9A 2PYYA 2CZLA 3DM0A 4OVRA 1MQIA 3KN3A 4RNSA 3UGWA 4IY5A 4N15A 3FXBA 1OLAA 3HPIA 4MH5A 3ZKLA 4NE4A 5KZTA 3A3CA 4H67A 4GVOA 4LZ8A 3KOSA 1B1XA 4PF6A 3OO6A 2P0SA 1LFGA 4YICA 3TKDA 2B65A 4YAHX 1PEBA 4PE3A 2A5TB 4P11A 2Q88A 1OLCA 2RINA 4WEPA 3S9LC 3MUQA 4NQ8A 4DXCA 4G68C 3RPWA 3Q29A 2B3FA 4F1VA 1LAFE 3CFZA 2Y7KA 2P1SA 2V3UA 3G7WA 4ESXA 3TTRA 3SDFA 5I84A 5AE4A 1IITA 4KYSA 3IOWA 4N13A 4OVJA 4R6HA 4R9GA 2I6EA 2FYIA 4DCXA 3VE1B 4OFLA 3TTLA 4ZS9A 4OERA 1SW1A 1MXXA 4MBPA 4P47A 2DXYA 3U72A 3OO8A 3FZVA 1IZ1A 1II5A 1TT1A 3SESA 5CMBA 2Q89A 3C36A 1NNKA 4O3BA 1US4A 2B3BA 4LP2B 3CSGA 2RKMA 3GLBA 1MDP1 4LQ5A 1SI0A 2RF1A 3EQ1A 2QS2A 1SW4A 4OVTA 4TLLB 4JXIA 4H5GA 3CRBA 2CEXA 1FTOA 4NG7A 3LUYA 2I58A 4RA1A 1QW0A 4DIGA 4FORA 3PPRA 2XXVA 4IGTA 3RN8A 1MM6A 1VSOA 4NF6B 3LR1A 1MXWA 1US5A 4YKPA 2H99A 1IXIA 2O7IA 1B52A 1TWYA 3PMVA 3K01A 4XTCQ 4MLQA 5HM4B 1PDAA 4MF3A 2QS1A 1NNFA 1O7TA 2VHAA 2DQVA 4OEVA 3M3FA 3TQWA 2Q2AA 5FHMA 5I5PA 1CE2A 1SDXA 4ELRA 2ZYKA 2F97A 1MY4A 1HSJA 3S9EA 1NMUA 5CBSA 4JWYA 2ZZVA 4YB6A 4Z0IA 4QFPA 3O97A 2A5SA 4XKNA 3R7XA 1VE4A 1DPEA 4ZZEA 4OZ9A 4LN5A 2NWJA 1MPCA 1S50A 2I49A 3I6VA 1GGGA 1M5FA 2O1MA 3VLUA 3C33A 5CMCA 5AA2A 1DOTA 4FATA 1SI1A 5KCJB 4ZEIA 4HTGA 2VPOA 2REGA 1NKXA 2Y7PA 2AL5A 2H5YA 4ND9A 4X1BA 4R73A 2QPQA 4MCOA 5H8NA 1TFAA 1MDQA 1SYIA 4MNCA 2Z23A 3K1PA 3HN0A 3PU5A 1LAGE 3ILUB 2PFZA 3DP8A 2ZZXA 3L6GA 4YKIA 3U65A 4LATA 3USDA 2HEUA 2THIA 4Q30B 1D4NA 3MBPA 2DYXA 3CI8A 3K02A 5DEXA 1NL5A 3U94A 3IOTA 4WKMA 1MM7A 5I7IA 4OENA 4ZEDA 4PQJA 4TOZA 2O84X 2XXPA 1N7WA 1YAEA 4PE5B 5EHMA 4BDQA 2P2AA 1JNFA 3IB1A 3T9UA 4KHZE 1OVTA 3C9HA 1P1QA 4QSEA 3UN6A 1Q1KA 3OEKA 1Y1MA 4U1OA 4PDHA 4GWOA 3EPEA 2PVUA 1SW2A 3G3IA 3T9HB 5AA3A 3FV2A 4NAPA 3KJTA 1SD3A 2IA4A 5H8QA 4IO5A 4RK2A 1LCTA 2UXAA 1IEJA 2Y7WA 1JEUA 2UVGA 3U92A 4PAFA 2D3IA 2F7BA 3RY3A 2O6AA 1POTA 4OEUA 3GZGA 3G3JA 1UTHA 2ZNUA 5I59B 1ANFA 1URDA 3M3LA 5I57A 4G68B 1EZOA 3E4RA 3H6UA 3FVGA 1N3WA 2F5XA 3K4UA 4MMPA 2DWHA 1JW5A 1P1WA 4ZE9A 4N8YA 2Y7RA 3S2VA 1MXUA 4PFTA 4FE8A 4XKRA 4HCWA 4QFKA 4LQ2A 5I58B 2R71A 4P56A 4G77A 4N6DA 3QK6A 1JEVA 3PPNA 1B3FA 3PUVE 4PGPA 4R9FA 2BJJX 1ZTYA 3N6TA 4DLDA 2ONSA 5A5XB 1RKMA 3DLNA 1JW1A 2O7UA 2DE3A 1B7HA 1B3LA 4YMAA 1LCFA 5B7DA 3MVXA 2I0BA 3HO7A 5JEIA 1B40A 3FD3A 4HS7A 1A54A 3T66A 3OD7A 1SW5A 3E13X 2I3WA 1B46A 5JTYA 1B5IA 5AA4B 4DI3D 3TQLA 2O69A 3IK6B 4C0RA 4FEBA 3TUSA 4OXVA 1N84A 3I3VA 1M5DA 2DWJA 4GOTA 4MEVA 1B32A 2E1SA 1FQFA 2H25A 4KD5A 4JSDA 4OVQA 3PMWA 4Z7EA 3QSLA 4I1DA 3SETA 1B0HA 3H3GA 4H65A 4IO7A 1USYH 2XXHA 1DTZA 3L6HA 1B58A 1KWHA 1R6ZA 1PB9A 4IY6A 5IKBA 3SKPA 4AB6A 2F78A 1YPNA 5DVJA 1B7ZA 4FECA 3SEXA 3RNNA 1SYHA 3EHSA 3LSXA 3TFLA 1BP5A 2QMXA 3FJGA 4YU0A 3H4ZA 1UIVA 3TELA 3ZSFA 2WYPA 1IXGA 3TDJA 2ZXTA 2PT2A 4KR5A 4QFNA 2O1LA 3O6IA 3PPOA 1D9VA 3TCGA 3OXNA 4PETA 3KBRA 2HAVA 4NF5A 5L9OA 2F7AA 3IORA 3O9PA 4O3AA 3VXBA 2DWIA 2QS3A 1QUKA 4H6DA 3MW0A 3C31A 2VOZA 4G2ZA 3W9WA 5TPAA 4EUOA 1QVSA 3SEYA 3UA8A 3QIMA 4MLVA 3CIJA 4P0IA 4X04A 1LGBC 4GFRA 4KFQA 3T96B 2PFYA 4QF9A 2GHAA 3WAFA 1MY1A 1P1UA 1LSTA 4K3FA 2XXXA 4P0GA 5IAIA 2OZZA 5F7VA 3PPPA 5ICTA 1A99A 1Y4TA 4E0WA 4PDDA 4PFUA 4BDLA 1GV8A 3B6TA 4LONB 1BTJA 3C32A 4IB2A 4PAKA 2HAUA 4R75A 1R1NA 4O7MA 5ELVA 3IB0A 4N17A 4PFIA 3MC2A 3THIA 2WKYA 3QUJA 3IO6A 1MS7A 2OLBA 2XWVA 2FNCA 3IX1A 3VV5A 1I6BA 4X8RA 4WXJA 4JB7A 2V84A 3FJMA 4AQ4A 5B70A 2ZMBA 3H6WA 3Q28A 1Z7ME 4XXUA 3N94A 1AH5A 1IUDA 3TAJA 5AA1A 5H8HA 4M1VA 5ITOA 3EF7A 4IO2A 2V3QA 2XXKA 3PUZE 3W9VA 3A09A 2DS9A 1Y4CA 1O64A 2W7YA 1SVXB 2DVZA 5BWJA 1LB9A 2D5WA 3G3KA 2X7PA 4MX6A 4I8CA 4MFIA 2QL3A 5JK4A 3FVOA 2HXWA 1EZ9A 4FIMA 2GFEA 4F39A 4PFYA 3K6UA 1GR2A 4ZEBA 1XT8A 5J1DA 5L9SA 4FEDA 2ESNA 4C1UA 2V25A 2ONRA 3KG2A 1FW0A 5H8NB 4PC9A 2ABHA 1Q35A 1ZJLA 1OMPA 1MH3A 1UIUA 4NHBA 4THIA 3VXCA 1B0LA 1HSEA 4BDRA 1I6QA 4NMYA 3FXRA 2ALUA 3QUFA 5I2NB 3R26A 2XX8A 3IJXB 2PMSA 4EQ9A 4RPNA 3VVFA 4XFEA 5DEXB 3V83A 1XVXA 5BUUA 3MP8A 4PBQA 3UK4A 4POXA 3PUWE 4ZECA 3FATA 4M4GA 2I4CA 2G29A 2X26A 1OIBA 3EHTA 4P3LA 3MVZA 4PP0A 3ECRA 3ZKKA 4UA8A 1LFHA 4DZ1A 4BDOA 3MVWA 4R2FA 5ISUA 4ZDMA 2D21A 5H8QB 4N8GA 4X1DA 1S9TA 3Q26A 2FA7A 5K2YA 4RY1A 4MIJA 4P9KA 2I48A 3QYTA 3SEWA 4KCDA 4GQOA 2QMWA 2Y84A 1UTHB 3HHGA 2UVJA 3OSRA 5DVIA 3DP6A 1J1NA 5I57B 4GXAA 2DE2A 4H5FA 4F1UA 1JQFA 2Q9TA 2V93A 2ZYNA 3UORA 2ZYOA 3H7MA 2Q8JA 5H8FA 2RC7A 3KFMA 1H44A 3N26A 4QHQA 2VP1A 3T93B 2IEEA 2I3VA 3TTMA 4OQOA 1H3DA 3TZAA 3PUXE 5M2VA 3K2DA 1IXHA 4PCDA 5LTCA 1B4ZA 4EF2A 2VGQA 3PPQA 3V89B 4GXSB 3PMXA 3IB2A 1MQJA 1N04A 2E0SA 5AA2D 2R9JA 3VLVA 4N6PA 4DE8A 4POWA 4N4UA 1IQ7A 3E9XA 5JTYB 1OQGA 1GTKA 4F2OA 1BLFA 2OWSA 3TTNA 3ODBA 3PUYE 2UVIA 2DOJA 3O29A 4N91A 4YB7A 2HZLA 5CMKA 3V5AA 3OEMA 1L5TA 4NF8A 1B3EA 2OJTA 3TMGA 1URGA 5TU0A 5CM6A 1FCKA 4OWDA 2V3TA 2VD3A 4DI4B 4R72A 3LSFB 3GXAA 3IOVA 2VD2A 3OO9A 3K00A 1ZIUA 2I4BA 3O6GA 3RQTA 3M8UA 1BKAA 2XA5A 3CVGA 4NF0A 1CB6A 4ESWA 4YZZA 3F11A 4E0XA 3E3KA 2XX9A 4KI0E 4F1YA 5CBRA 5HPQA 1AIVA 5K2XA 3OENA 1NH7A 3QAXA 4XF5A 1P1OA 1VR5A 2XXIA 1XVYA 1FTKA 1USYE 4F3SA 2WX9A 4NF5B 2LAOA 2Q2CA 3G3GA 4MNPA 2XXTA 1UTBA 3MQ9A 1B3GA 3FVNA 2PX1A 5TPAB 4NN3A 4U2RA 1B05A 1FQDA 2KLFA 3EN3A 1LBCA 4F18A 1FQBA 1MXYA 2HCAA 1FTMA 1B5JA 5TP9B 4MAGA 1QUIA 3EHUA 2HQ0A 4F3GA 3TYHA 2OWTA 3HHFA 2OCUA 1B6HA 4X48A 4YKJA 1XC1A 2DXRA 1Y3QA 1B1HA 3GYYA 1PBPA 4Q8RA 4P1LA 4YMBA 4BLAA 4QFOA 2Z8DA 1EU8A 1YCJA 3KSJA 3RLFE 3UP9A 4EDPA 1PBQA 4G8NA 3FXQA 3KJ7A 4U23A 4HCYA 3K1NA 4KYDA 3TCFA 3Q27A 4EQ7A 1Y1ZA 4TLMB 4OANA 3P7IA 4XEQA 3B6QA 3UIFA 4Q0CA 1MY2A 4F3BA 4O94A 1DSNA 3OMBA 4PF8A 3MWBA 4LZ7A 5H8HB 3AXFA 4F2QA 1VFEA 3FV1A 2XWKA 2GH9A 5FHNA 1XOCA 3CSBA 4LUBA 1ZMGA 3RT6B 3FGSA 1AL3A 5DVFA 3DP4A 1ZU0A 3RTFB 1JVYA 1M5BA 4IO6A 1AMFA 4F29A 4RPOA 3CG3A 4OHNA 2Z22A 1M5CA 1N0TA 3K6VA 2H9BA 5KDTA 3O66A 3KSXA 2GHBA 3MZ9A 1MQHA 1IIWA 2QRYA 2M8CA 2H98A 3TTKA 4NF4A 4DDDA 3IOUA 3CR9A 4NGUA 2DVCA 2RC8A 1B3HA 3BFUA 1TXFA 3WAEA 3FVKA 4ONYA 5DYHA 3O28A 3TCHA 2DSFA 4LA9A 1QULA 3K6XA 4JBZA 3MP6A 4XIGQ 1QUJA 3VDFA 2REJA 3N5LA 1MPBA 5I2KA 4OMBA 4KYEA 4PAIA 3JYRA 4U1ZA 1MRPA 1PB8A 2NXOA 5I56A 4GRKA 3W15C 3SEVA 2Y7IA 3LBSA 1MQDA 1S7YA 4H8IA 2ZZWA 4H0WA 1WVJA 4OYVA 3VVDA 2QS4A 3K0VA 1POY1 4X9TA 1MQGA 4Q5TA 3IAZA 3KOTA 2NUVA 1PC3A 5IZZA 1LB8A 4IO4A 1QKBA 4ELOA 4JWOA 3T9VA 4LZ5A 4PBHA 4ZEKA 2HFBA 1FTJA 4OETA 1A8FA 3S4UA 3U8QA 1H45A 4MHFA 4U22A 3FASA 5DTBA 2ANJA 1B51A 4R6KA 1MG1A 4R2BA 1B2HA 5H8FB 2XXQA 5AA2B 4H1XA 3U1OA 1URSA 2F8DA 3B6WA 3TPAA 3V8XB 1SQYA 3S9MC 3MVYA 2XWIA 4KCCA 1ZLQA 4RYAA 2Z8FA 1XHYA 2G93A 4IGRA 4UABA 4YB5A 4FAJA 3PGFA 1B4HA 1DMBA 1GVCA 2XXUA 3K1MA 3KEIA 4ZEFA 3MAMA 3H6TA 1LLSA 1MH4A 2XD3A 3C34A 5CC2A 4P1EA 4WEDA 5CRYA 1Y3NA 3FJ7A 1MXZA 2ZNTA 1Z7NE 3PD9A 2Z8EA 4U4SA 1MY0A 3O2AA 4NX1A 3LC8A 1T0KA 3DELB 4ECFA 4I62A 4AB5A 4PFRA 2XD2A 2RC9A 3OELA 2XXRA 1R9QA 4NF8B 4GL8A 1OVBA 2UVHA 3RGYA 2RCAA 4JDFA 3MZ1A 3B50A 3MPKA 1LFIA 4U21A 2XXWA 1NFTA 3RTWB 2QSXA 4UACA 2A5TA 3OO7A 3SERA 5EHSA 5ITPA 3JZJA 3OOAA 2O68A 3LSLA 2ONKE 4OFJA 5L8DA 1Y20A 4TQUQ 1MXVA 1JETA 2AIXA 1DPPA 3FXUA 1JW4A 1A7LA 1HSLA 3G3FA 4O3CA 1WDNA 2F6GA 1FQEA 1JVXA 3OSQA 1ZBMA 4P8BA 1QJMA 1UQWA 2PBWA 4ELQA 1XS5A 1EZPA 4EQBA 5F1QA 1ELJA 3I5OA 4NEDA 4EF1A 4F19A 3KGCA 2V4CA 1AOVA 1UTBB 4C1TA 2ZYMA 1BIYA 2ZNSA 2DP8A 4OTEA 3HSTA 5IGAA 4EXLA 3T9XB 3RT8A 1B7UA 4LVQA 1N7XA 2F7CA 3IJOB 3KN7A 2YLNA 5I2NA 3KZGA 3PD8A 4IO3A 1OQHA 5L9MA 4I9DA 4U4XA 4PGNA 4DCYA 3VVEA 4KPTA 2AL4A 2F34A 3FIRA 3CFLA 4NF6A 4G8MA 5FTIA 1N3XA 1EH3A 3R6UA 2OK2A 4N07A 2QJEA 5HBCA 2UYEA 4OVSA 2YPNA 4BDNA 2F6PA 4N6KA 1A40A 3ZS6A 4KQPA 1R9LA 1FQAA 1NH8A 3G3HA 2H4IA 3O6HA 3FUZA 3Q25A 1FTLA 3HV1A 4PFWA 3C35A 5EYFA 2CMOA 3MJNA 3GBAA 1Y9UA 2X7QA 3TODA 2AYSA 3VLWA 4GL0A 2O51A 1WODA 5FHOA 4OA4A 3IR1A 1PB7A 3LSWA 4ZE8A 3BKIB 4GD5A 4JSOA 3H06B 1B5HA 5KCJA 3MZBA 1VFDA 3D4CA 4F3PA 1D3KA 3C4MA 3N6UA 4R6YA 4L17A 5KDTB 3MP1A 3JV9A 1Y3PA 5FTHA 1N76A
chains in the Genus database with same CATH superfamily
3U93A 5CMMA 1M5EA 1I6AA 3H03A 2WYKA 4GLIA 4G4PA 4DXBA 2R6GE 4NF4B 1SBPA 4GF8A 4GWUA 1DTGA 3PTYA 3D4GA 3HCQA 3TEPA 3PV0E 2GRVA 4F22A 1A8EA 2XXYA 1MPDA 5ET5A 3CFXA 5CI5A 4YKKA 1A55A 4PFBA 3MPLA 1YTVA 5H8SA 4H8JA 1K9YA 5I2KB 1F9BA 1LBBA 1NV7A 1O63A 2DWAA 1B9JA 3ROJA 5I56B 2DE4A 3GBBA 4FJPA 3CG1A 2RCBA 4ELPA 3BFTA 1QKAA 3A3UA 2NOOA 4GIZA 4NWDA 4NWCA 2YJPA 2F36A 3KN8A 1NNPA 4BDMA 4XKQA 4XKPA 4G8HA 1P99A 1TFDA 2HPGA 5DT6A 3M3KA 3K6WA 4HW8A 1G0HA 2GQ1A 1H43A 3H6VA 1RYOA 3BBRA 3S9NC 4QBAA 3RUMA 4MNIA 2PT1A 2QVVA 3B7DA 2UYFA 2XX7A 3ONMA 5I59A 4AS4A 2OBGA 4G68A 4JVCA 4OFOA 1P1NA 3IL1B 5ICQA 5IZ1A 1LAHE 4QRZA 3ILTB 3SEUA 2I0CA 4QSDA 3T22A 3ISPA 1FQCA 4NTLA 4HE1A 4QFLA 3VFJA 1FPLA 5I58A 1D9YA 2CEYA 2F3BA 1I69A 1NNTA 1K9ZA 1H76A 4RK9A 4OVPA 1RYXA 4ZZAA 5IM2A 4OESA 3IO4A 4ISUA 5A5XA 4R74A 4RJZA 5LOMA 1IXCA 2NVUB 3A29A 2XHDA 3NOHA 5IZ3A 2HZKA 1ATGA 4RXLA 4DXUA 1ZKBA 1LAXA 4O8MA 4F31B 4JWXA 2F35A 4QSCA 2VPNA 2XWOA 4EXKA 1MY3A 5AA4A 3QXMA 1IMCA 5TP9A 2PYYA 2CZLA 3DM0A 4OVRA 1MQIA 3KN3A 4IR8A 1YYZA 4RNSA 3UGWA 4IY5A 4N15A 3FXBA 3BIGA 1OLAA 3HPIA 4MH5A 3ZKLA 4NE4A 5KZTA 5EQAA 3A3CA 4H67A 4GVOA 4LZ8A 3KOSA 1B1XA 4PF6A 3OO6A 2P0SA 1LFGA 4YICA 1FBCA 1FBFA 3TKDA 2B65A 4YAHX 1NI9A 1PEBA 4PE3A 2A5TB 4P11A 2Q88A 1OLCA 2RINA 3IFAA 4WEPA 3S9LC 3RYDA 1SPIA 3MUQA 4NQ8A 4DXCA 1KA0A 4G68C 3RPWA 3Q29A 2B3FA 4F1VA 1LAFE 3SZPA 3CFZA 2Y7KA 2P1SA 4KXPA 2V3UA 3G7WA 4ESXA 3TTRA 5ET6A 3SDFA 3B8BA 1RDZA 5AE4A 1IITA 5I84A 4KYSA 3IOWA 4N13A 4OVJA 4R6HA 4R9GA 2I6EA 2FYIA 1LBXA 5LDZA 4DCXA 3VE1B 4OFLA 3TTLA 4ZS9A 2FHYA 4OERA 1SW1A 1MXXA 4MBPA 4P47A 2DXYA 3U72A 2CZHA 3OO8A 3FZVA 1IZ1A 1II5A 1TT1A 3SESA 5CMBA 2Q89A 3C36A 1NNKA 4O3BA 1US4A 2B3BA 4LP2B 3CSGA 2RKMA 3GLBA 1MDP1 4LQ5A 1SI0A 2RF1A 3EQ1A 2QS2A 1SW4A 4OVTA 4HXVA 4TLLB 4JXIA 4H5GA 2CEXA 3CRBA 1FTOA 4NG7A 3E78A 3LUYA 2I58A 4RA1A 1QW0A 4DIGA 4FORA 3PPRA 2XXVA 4IGTA 3RN8A 1MM6A 1VSOA 4NF6B 3LR1A 1MXWA 1US5A 4YKPA 2H99A 1IXIA 2O7IA 1B52A 1TWYA 3PMVA 4I3YA 3K01A 4XTCQ 4MLQA 5HM4B 1PDAA 4MF3A 1IMBA 2QS1A 1NNFA 1O7TA 2VHAA 2DQVA 4OEVA 3M3FA 5EQ7A 3TQWA 2Q2AA 5FHMA 2MKZA 5I5PA 1CE2A 1FJ6A 1SDXA 4ELRA 2ZYKA 2F97A 1MY4A 1HSJA 3S9EA 1NMUA 5CBSA 4JWYA 2ZZVA 4YB6A 4Z0IA 4QFPA 3O97A 2A5SA 4XKNA 3R7XA 1VE4A 4GWSA 1DPEA 4ZZEA 4OZ9A 4LN5A 2NWJA 1MPCA 1S50A 2I49A 3I6VA 1GGGA 1M5FA 2O1MA 3VLUA 3C33A 5CMCA 5AA2A 1DOTA 4FATA 1SI1A 5KCJB 4ZEIA 4HTGA 4I40A 2VPOA 2REGA 1NKXA 2Y7PA 2AL5A 2H5YA 4ND9A 2Y5KA 4X1BA 4R73A 2QPQA 4MCOA 5H8NA 1TFAA 1MDQA 1SYIA 4MNCA 2Z23A 3K1PA 3HN0A 3PU5A 4FBPA 1LAGE 2PFZA 3ILUB 3DP8A 2ZZXA 3L6GA 4YKIA 3U65A 4LATA 3USDA 2HEUA 2R8TA 2THIA 4Q30B 1D4NA 3MBPA 2DYXA 3CI8A 3K02A 5DEXA 1NL5A 3U94A 3IOTA 4WKMA 1MM7A 5I7IA 4OENA 3LV0A 4ZEDA 4PQJA 4TOZA 2O84X 2XXPA 1N7WA 1YAEA 4PE5B 5EHMA 4BDQA 2P2AA 1JNFA 3IB1A 3T9UA 4KHZE 1OVTA 3C9HA 1P1QA 4QSEA 3UN6A 1Q1KA 3OEKA 1Y1MA 4U1OA 4PDHA 4GWOA 3EPEA 2PVUA 1SW2A 3G3IA 4NAPA 3T9HB 3FV2A 5AA3A 3KJTA 1SD3A 1LEVA 2IA4A 5H8QA 4IO5A 4RK2A 1EYJA 1LCTA 2UXAA 1IEJA 2Y7WA 1JEUA 2UVGA 3U92A 3MSTA 4PAFA 4H46A 2D3IA 2F7BA 3RY3A 2O6AA 1POTA 4OEUA 3GZGA 3G3JA 3QMFA 1UTHA 2ZNUA 5I59B 1ANFA 1URDA 3M3LA 5I57A 4G68B 1EZOA 2PCRA 3E4RA 3H6UA 2WBBA 3FVGA 1N3WA 2F5XA 3K4UA 4MMPA 2DWHA 1JW5A 1P1WA 4N8YA 4ZE9A 2Y7RA 3S2VA 1MXUA 4PFTA 4FE8A 4XKRA 4HCWA 4QFKA 4LQ2A 5I58B 2R71A 4P56A 4G77A 1DCUA 4N6DA 3QK6A 1JEVA 3PPNA 1B3FA 3PUVE 4PGPA 4R9FA 2OX3A 2BJJX 1ZTYA 3N6TA 4DLDA 1FPJA 2ONSA 5A5XB 1RKMA 3DLNA 1FBPA 1JW1A 2O7UA 2DE3A 1B7HA 1B3LA 5IZ3B 4YMAA 1LCFA 5B7DA 3MVXA 2I0BA 3HO7A 5JEIA 1B40A 3FD3A 4HS7A 1A54A 4GBWA 3T66A 3OD7A 1SW5A 3E13X 2I3WA 1B46A 5JTYA 1B5IA 5AA4B 4DI3D 3TQLA 2O69A 3IK6B 4C0RA 4FEBA 1CNQA 3TUSA 4OXVA 1N84A 3I3VA 1M5DA 2DWJA 2HXRA 4GOTA 4MEVA 1B32A 2E1SA 1FQFA 2H25A 4KD5A 4JSDA 4OVQA 3PMWA 4Z7EA 3QSLA 4I1DA 3SETA 1B0HA 3H3GA 4H65A 2WEFA 4IO7A 1USYH 2XXHA 1DTZA 3L6HA 1B58A 1KWHA 1R6ZA 1PB9A 4IY6A 5IKBA 3SKPA 4AB6A 2F78A 1YPNA 5DVJA 1B7ZA 4FECA 3SEXA 3RNNA 1SYHA 3EHSA 3LSXA 3TFLA 1BP5A 2QMXA 3FJGA 4YU0A 3H4ZA 1UIVA 3TELA 3ZSFA 2WYPA 1IXGA 3TDJA 2ZXTA 2PT2A 4KR5A 4QFNA 1NV6A 2O1LA 3O6IA 3PPOA 1D9VA 3TCGA 1NV3A 3OXNA 4PETA 3KBRA 2FIXA 2HAVA 1NUXA 4NF5A 5L9OA 1INPA 2F7AA 3IORA 3O9PA 4O3AA 3VXBA 2BJIA 2DWIA 2WBDA 2QS3A 1QUKA 4H6DA 2DDKA 3MW0A 3C31A 2QVRA 2VOZA 4G2ZA 2F3DA 5TPAA 3W9WA 3IFCA 1QVSA 4EUOA 3SEYA 3UA8A 3QIMA 4MLVA 3CIJA 4P0IA 4X04A 1LGBC 4GFRA 1NV2A 4KFQA 3T96B 2PFYA 4QF9A 2GHAA 3WAFA 1MY1A 4GWWA 1P1UA 1LSTA 4K3FA 2XXXA 4P0GA 5IAIA 2OZZA 1Q9DA 5F7VA 3PPPA 5ICTA 1A99A 1Y4TA 4PDDA 4E0WA 4PFUA 4BDLA 1GV8A 1AWBA 3B6TA 4LONB 1BTJA 3C32A 4IB2A 1IMDA 1LBYA 3KC0A 4PAKA 2HAUA 5ET8A 5FBPA 4R75A 1IMAA 1R1NA 4O7MA 5ELVA 3IB0A 4N17A 4PFIA 3MC2A 3THIA 2WKYA 3QUJA 3IO6A 1MS7A 2OLBA 2XWVA 2FNCA 3IX1A 3VV5A 1I6BA 4X8RA 1RDYA 4WXJA 4JB7A 2V84A 3FJMA 4AQ4A 5B70A 2ZMBA 3H6WA 3Q28A 1IMEA 4GWZA 1Z7ME 4XXUA 3N94A 1AH5A 1IUDA 3TAJA 5AA1A 5H8HA 4M1VA 5ITOA 3EF7A 4IO2A 2V3QA 2XXKA 3PUZE 4HE0A 3W9VA 3A09A 2DS9A 1Y4CA 1O64A 2W7YA 1SVXB 2DVZA 5BWJA 1LB9A 2D5WA 3G3KA 2X7PA 4MX6A 4I8CA 4MFIA 2QL3A 5JK4A 3FVOA 2HXWA 1EZ9A 4FIMA 4GX3A 2GFEA 4F39A 4PFYA 3K6UA 1GR2A 4ZEBA 5J16A 1XT8A 5J1DA 5L9SA 4JVDA 4FEDA 2ESNA 4C1UA 1FBEA 2V25A 2ONRA 3KG2A 1G0IA 1FW0A 5H8NB 4PC9A 2ABHA 1Q35A 1ZJLA 1OMPA 1MH3A 5A5LA 1UIUA 4NHBA 3KC1A 4THIA 3VXCA 1B0LA 1HSEA 4BDRA 1I6QA 4NMYA 3FXRA 1NUYA 2ALUA 3QUFA 5I2NB 3R26A 2XX8A 3IJXB 2PMSA 4EQ9A 4RPNA 4XFEA 3VVFA 5DEXB 2HHMA 3V83A 1XVXA 5BUUA 3MP8A 4PBQA 3UK4A 4POXA 3PUWE 4ZECA 3FATA 5EYHA 4M4GA 2I4CA 2G29A 2X26A 1OIBA 3EHTA 4P3LA 3MVZA 4PP0A 3ECRA 3ZKKA 4UA8A 1LFHA 4DZ1A 4BDOA 3EKIA 3MVWA 4R2FA 5ISUA 4MJOA 4ZDMA 2D21A 5H8QB 4N8GA 4X1DA 1S9TA 3Q26A 2FA7A 5K2YA 4RY1A 4MIJA 4P9KA 2I48A 3QYTA 1XI6A 3SEWA 1FBGA 4KCDA 4GQOA 2QMWA 2Y84A 1UTHB 3HHGA 2UVJA 3OSRA 5DVIA 3DP6A 1J1NA 5I57B 4GXAA 2DE2A 4H5FA 4F1UA 1JQFA 2CZIA 2Q9TA 2V93A 2ZYNA 3UORA 2FIEA 2ZYOA 3H7MA 2Q8JA 4H45A 5H8FA 2RC7A 3KFMA 1H44A 5F24A 3N26A 4QHQA 2VP1A 3HFUA 4PTKA 3T93B 2IEEA 2I3VA 3TTMA 4OQOA 1H3DA 3TZAA 3PUXE 2QFLA 5M2VA 3K2DA 1IXHA 2Y5LA 4PCDA 1YZ0A 5LTCA 1B4ZA 4EF2A 2VGQA 1FBHA 3PPQA 3V89B 4GXSB 3PMXA 3IB2A 1MQJA 1N04A 2E0SA 5AA2D 2R9JA 3VLVA 4N6PA 4DE8A 4POWA 4N4UA 1IQ7A 3E9XA 5JTYB 1OQGA 1GTKA 5EYGA 4F2OA 1BLFA 2OWSA 3TTNA 2KR0A 3ODBA 3PUYE 2UVIA 2FBPA 2DOJA 3O29A 4N91A 4YB7A 2HZLA 5CMKA 3V5AA 3OEMA 1L5TA 4NF8A 1B3EA 2OJTA 3TMGA 1URGA 5TU0A 5CM6A 1FCKA 4OWDA 3E79A 2V3TA 2VD3A 4DI4B 4R72A 3LSFB 3GXAA 3IOVA 2VD2A 3OO9A 3K00A 1ZIUA 2I4BA 3O6GA 2JJKA 3RQTA 3M8UA 1BKAA 2XA5A 3CVGA 4NF0A 1CB6A 4ESWA 4YZZA 3F11A 4E0XA 3E3KA 2XX9A 4KI0E 4AS5A 4F1YA 5CBRA 1VDWA 5HPQA 1AIVA 5K2XA 3OENA 1NH7A 3QAXA 4XF5A 4G61A 1P1OA 1VR5A 2XXIA 1XVYA 1NV1A 1FTKA 3RPLA 1USYE 4F3SA 2WX9A 4NF5B 1FRPA 1FJ9A 2LAOA 2Q2CA 3T0JA 3G3GA 4MNPA 2XXTA 1NV5A 1FSAA 1UTBA 3MQ9A 1B3GA 3FVNA 2PX1A 4NN3A 5TPAB 4U2RA 1B05A 1FQDA 3MYUA 1FPGA 2KLFA 3EN3A 1LBCA 4F18A 1FQBA 3CHGA 1MXYA 2HCAA 1FTMA 1B5JA 1NV0A 5TP9B 1FBDA 4MAGA 1QUIA 3EHUA 1EYIA 2HQ0A 4F3GA 3TYHA 2OWTA 3HHFA 2OCUA 1B6HA 4X48A 4YKJA 1XC1A 2DXRA 1Y3QA 1B1HA 3GYYA 1PBPA 1FPDA 4Q8RA 4P1LA 4YMBA 4BLAA 4QFOA 2Z8DA 1EU8A 1YCJA 3KSJA 2L5VA 3RLFE 3UP9A 4EDPA 1PBQA 4G8NA 3FXQA 3KJ7A 4U23A 4HCYA 3K1NA 4KYDA 3TCFA 3Q27A 4EQ7A 1Y1ZA 4TLMB 4OANA 3P7IA 4XEQA 3B6QA 3UIFA 4Q0CA 1MY2A 4F3BA 4O94A 1DSNA 2CZKA 3OMBA 4GBVA 4PF8A 3MWBA 4LZ7A 5H8HB 3AXFA 4F2QA 1VFEA 2XWKA 3FV1A 2GH9A 5FHNA 1XOCA 3CSBA 1D9QA 4LUBA 1ZMGA 3RT6B 3FGSA 1AL3A 5DVFA 3DP4A 1ZU0A 3RTFB 4GX6A 1BK4A 1JVYA 2FVZA 1IMFA 1M5BA 4IO6A 1AMFA 4F29A 4RPOA 3CG3A 4OHNA 2Z22A 1M5CA 1N0TA 3K6VA 2H9BA 5KDTA 3O66A 3KSXA 4I3EA 2GHBA 3MZ9A 1MQHA 1IIWA 3FBPA 1FPBA 1NV4A 2QRYA 2M8CA 2H98A 1RDXA 3TTKA 4NF4A 4DDDA 3IOUA 2VT5A 3CR9A 4NGUA 2DVCA 2RC8A 1B3HA 3BFUA 1TXFA 3WAEA 3FVKA 5ESYA 4ONYA 5DYHA 3O28A 3TCHA 2DSFA 4LA9A 1QULA 3K6XA 4JBZA 3MP6A 4XIGQ 1QUJA 3VDFA 2REJA 3N5LA 1MPBA 1QGXA 5I2KA 4OMBA 4KYEA 4PAIA 3JYRA 4U1ZA 1MRPA 1PB8A 2NXOA 5I56A 4GRKA 3W15C 3SEVA 2Y7IA 5DW8A 3LBSA 1MQDA 1S7YA 5EQ9A 4H8IA 2QVUA 5EQ8A 2ZZWA 4H0WA 1WVJA 4OYVA 3VVDA 2QS4A 3K0VA 1POY1 4X9TA 1MQGA 4Q5TA 3IAZA 3KOTA 2NUVA 1PC3A 3KBZA 5IZZA 1LB8A 4IO4A 1QKBA 4ELOA 1NUWA 4JWOA 3T9VA 4LZ5A 4PBHA 1DBZA 4ZEKA 2HFBA 1FTJA 4OETA 1A8FA 3S4UA 3U8QA 1H45A 4MHFA 1DK4A 4U22A 3FASA 5DTBA 2ANJA 1B51A 4R6KA 1MG1A 4R2BA 1B2HA 5H8FB 2XXQA 1EYKA 5AA2B 3LUZA 4H1XA 3U1OA 1URSA 2F8DA 1NUZA 3B6WA 3TPAA 3V8XB 1SQYA 3S9MC 3MVYA 2P3NA 2XWIA 4KCCA 1ZLQA 4RYAA 2Z8FA 1XHYA 2G93A 4IGRA 4UABA 5T3JA 4YB5A 4GX4A 4FAJA 5I3SA 3PGFA 1B4HA 1DMBA 1GVCA 2XXUA 3K1MA 3KEIA 4ZEFA 3MAMA 3H6TA 2OWZA 1LLSA 1MH4A 2XD3A 3C34A 5CC2A 4P1EA 4WEDA 1LBVA 5CRYA 1Y3NA 3FJ7A 1MXZA 2ZNTA 1Z7NE 3PD9A 2Z8EA 4U4SA 1MY0A 3D1RA 3O2AA 4NX1A 3LC8A 1T0KA 3DELB 4ECFA 4I62A 4AB5A 4PFRA 2XD2A 2B4LA 2RC9A 3OELA 2XXRA 1R9QA 4NF8B 4GL8A 1OVBA 2UVHA 3RGYA 2RCAA 4JDFA 3MZ1A 3B50A 3MPKA 1LFIA 2P3VA 4U21A 2XXWA 1NFTA 3RTWB 2Q74A 2QSXA 4UACA 2A5TA 3OO7A 3SERA 5EHSA 4JVIA 5ITPA 3JZJA 3OOAA 2O68A 3LSLA 2ONKE 4OFJA 5L8DA 1Y20A 4TQUQ 1FPFA 1MXVA 1JETA 2AIXA 1DPPA 3FXUA 1JW4A 4HE2A 1A7LA 1HSLA 3G3FA 4O3CA 1WDNA 2F6GA 1FQEA 1JVXA 3RPLB 3OSQA 1ZBMA 4P8BA 1QJMA 1UQWA 2PBWA 4ELQA 1XS5A 1EZPA 4EQBA 5F1QA 1ELJA 3I5OA 4NEDA 4EF1A 4F19A 3KGCA 2V4CA 3BIHA 1LBZA 4GWXA 1AOVA 1UTBB 4C1TA 2ZYMA 1BIYA 1KA1A 2ZNSA 2DP8A 4OTEA 3HSTA 5IGAA 2B4MA 4EXLA 3T9XB 3RT8A 1B7UA 4LVQA 1N7XA 2F7CA 3IJOB 4O7IA 3KN7A 5ET7A 2YLNA 5I2NA 1JP4A 3KZGA 1LBWA 3PD8A 4IO3A 1OQHA 1FTAA 1KZ8A 5L9MA 4I9DA 4U4XA 4PGNA 4DCYA 3VVEA 4KPTA 2AL4A 2F34A 3FIRA 3CFLA 1YXIA 4NF6A 4G8MA 5FTIA 1N3XA 1EH3A 3R6UA 2OK2A 4N07A 2QJEA 5HBCA 2UYEA 4OVSA 2YPNA 4BDNA 2F6PA 4N6KA 1A40A 3ZS6A 4KQPA 1R9LA 2Q8MA 1FQAA 1NH8A 3G3HA 2H4IA 3O6HA 3FUZA 3Q25A 1FTLA 3HV1A 4PFWA 1FPEA 3C35A 5EYFA 2CMOA 3MJNA 3GBAA 1Y9UA 3T1BA 2X7QA 3TODA 2AYSA 3VLWA 4GL0A 2O51A 4GWYA 1FPKA 1WODA 4OA4A 5FHOA 3IR1A 1PB7A 3LSWA 4ZE8A 3BKIB 4GD5A 4JSOA 3H06B 2KQZA 1B5HA 5KCJA 4N81A 3MZBA 1VFDA 3D4CA 4F3PA 1D3KA 3C4MA 3N6UA 4R6YA 1FPIA 4L17A 5KDTB 3MP1A 3JV9A 1Y3PA 4QXDA 5FTHA 1N76A
chains in the Genus database with same CATH topology
3U93A 5CMMA 1M5EA 1I6AA 3H03A 2WYKA 4GLIA 4G4PA 4DXBA 2R6GE 4NF4B 1SBPA 4GF8A 4GWUA 1DTGA 3PTYA 3D4GA 3HCQA 3TEPA 3PV0E 2GRVA 4F22A 1A8EA 2XXYA 1MPDA 5ET5A 3CFXA 5CI5A 4YKKA 1A55A 4PFBA 3MPLA 1YTVA 5H8SA 4H8JA 1K9YA 5I2KB 1F9BA 1LBBA 1NV7A 1O63A 2DWAA 1B9JA 3ROJA 5I56B 2DE4A 3GBBA 4FJPA 3CG1A 2RCBA 4ELPA 3BFTA 1QKAA 3A3UA 2NOOA 4GIZA 4NWDA 4NWCA 2YJPA 2F36A 3KN8A 1NNPA 4BDMA 4XKQA 4XKPA 4G8HA 1P99A 1TFDA 2HPGA 5DT6A 3M3KA 3K6WA 4HW8A 1G0HA 2GQ1A 1H43A 3H6VA 1RYOA 3BBRA 3S9NC 4QBAA 3RUMA 4MNIA 2PT1A 3B7DA 2QVVA 2UYFA 2XX7A 3ONMA 5I59A 4AS4A 2OBGA 4G68A 4JVCA 4OFOA 1P1NA 3IL1B 5ICQA 5IZ1A 1LAHE 4QRZA 3ILTB 3SEUA 2I0CA 4QSDA 3T22A 3ISPA 1FQCA 4NTLA 4HE1A 4QFLA 3VFJA 1FPLA 5I58A 1D9YA 2CEYA 2F3BA 1I69A 1NNTA 1K9ZA 1H76A 4RK9A 4OVPA 1RYXA 4ZZAA 5IM2A 4OESA 3IO4A 4ISUA 5A5XA 4R74A 4RJZA 5LOMA 1IXCA 2NVUB 3A29A 2XHDA 3NOHA 5IZ3A 2HZKA 1ATGA 4RXLA 4DXUA 1ZKBA 1LAXA 4F31B 4O8MA 4JWXA 2F35A 4QSCA 2VPNA 4EXKA 2XWOA 1MY3A 5AA4A 3QXMA 5TP9A 1IMCA 2PYYA 2CZLA 3DM0A 4OVRA 1MQIA 3KN3A 4IR8A 4RNSA 1YYZA 3UGWA 4IY5A 4N15A 3FXBA 3BIGA 1OLAA 3HPIA 4MH5A 3ZKLA 4NE4A 5KZTA 5EQAA 3A3CA 4H67A 4GVOA 4LZ8A 3KOSA 1B1XA 4PF6A 3OO6A 2P0SA 1LFGA 4YICA 3TKDA 1FBCA 1FBFA 2B65A 4YAHX 1NI9A 1PEBA 4PE3A 2A5TB 4P11A 2Q88A 1OLCA 2RINA 4WEPA 3IFAA 3S9LC 3RYDA 1SPIA 3MUQA 4NQ8A 4DXCA 4G68C 3RPWA 1KA0A 3Q29A 2B3FA 4F1VA 1LAFE 3SZPA 3CFZA 2Y7KA 2P1SA 4KXPA 2V3UA 3G7WA 4ESXA 3TTRA 5ET6A 3SDFA 3B8BA 5I84A 5AE4A 1IITA 1RDZA 4KYSA 3IOWA 4N13A 4OVJA 4R6HA 4R9GA 2I6EA 2FYIA 1LBXA 5LDZA 4DCXA 3VE1B 4OFLA 3TTLA 4ZS9A 2FHYA 4OERA 1SW1A 1MXXA 4MBPA 4P47A 2DXYA 3U72A 2CZHA 3OO8A 3FZVA 1IZ1A 1II5A 1TT1A 3SESA 5CMBA 2Q89A 3C36A 1NNKA 4O3BA 1US4A 2B3BA 4LP2B 3CSGA 2RKMA 3GLBA 1MDP1 4LQ5A 1SI0A 2RF1A 3EQ1A 2QS2A 1SW4A 4OVTA 4TLLB 4HXVA 4JXIA 4H5GA 3CRBA 2CEXA 1FTOA 4NG7A 3E78A 3LUYA 2I58A 4RA1A 1QW0A 4DIGA 4FORA 3PPRA 2XXVA 4IGTA 3RN8A 1MM6A 1VSOA 4NF6B 3LR1A 1MXWA 1US5A 4YKPA 2H99A 1IXIA 2O7IA 1B52A 1TWYA 3PMVA 4I3YA 3K01A 4XTCQ 4MLQA 5HM4B 1PDAA 4MF3A 1IMBA 2QS1A 1NNFA 1O7TA 2VHAA 2DQVA 4OEVA 3M3FA 5EQ7A 3TQWA 2Q2AA 5FHMA 2MKZA 5I5PA 1CE2A 1SDXA 1FJ6A 4ELRA 2ZYKA 2F97A 1MY4A 1HSJA 3S9EA 1NMUA 5CBSA 4JWYA 2ZZVA 4YB6A 4Z0IA 4QFPA 3O97A 2A5SA 4XKNA 3R7XA 1VE4A 4GWSA 1DPEA 4ZZEA 4OZ9A 4LN5A 2NWJA 1MPCA 1S50A 2I49A 3I6VA 1GGGA 1M5FA 2O1MA 3VLUA 3C33A 5CMCA 5AA2A 1DOTA 4FATA 1SI1A 5KCJB 4ZEIA 4HTGA 4I40A 2VPOA 2REGA 1NKXA 2Y7PA 2AL5A 2H5YA 4ND9A 2Y5KA 4X1BA 4R73A 2QPQA 4MCOA 5H8NA 1TFAA 1MDQA 1SYIA 4MNCA 2Z23A 3K1PA 3HN0A 3PU5A 4FBPA 1LAGE 3ILUB 2PFZA 3DP8A 2ZZXA 3L6GA 4YKIA 3U65A 4LATA 3USDA 2HEUA 2R8TA 2THIA 4Q30B 1D4NA 3MBPA 2DYXA 3CI8A 3K02A 5DEXA 1NL5A 3U94A 3IOTA 4WKMA 1MM7A 5I7IA 4OENA 4ZEDA 3LV0A 4PQJA 4TOZA 2O84X 2XXPA 1N7WA 1YAEA 4PE5B 5EHMA 4BDQA 2P2AA 1JNFA 3IB1A 3T9UA 4KHZE 1OVTA 3C9HA 1P1QA 4QSEA 3UN6A 1Q1KA 3OEKA 1Y1MA 4U1OA 4PDHA 4GWOA 3EPEA 2PVUA 1SW2A 3G3IA 3T9HB 5AA3A 3FV2A 4NAPA 3KJTA 1SD3A 1LEVA 2IA4A 5H8QA 4IO5A 4RK2A 1EYJA 1LCTA 2UXAA 1IEJA 2Y7WA 1JEUA 2UVGA 3U92A 3MSTA 4PAFA 4H46A 2D3IA 2F7BA 3RY3A 2O6AA 1POTA 4OEUA 3GZGA 3G3JA 3QMFA 1UTHA 2ZNUA 5I59B 1ANFA 1URDA 3M3LA 5I57A 4G68B 1EZOA 2PCRA 3E4RA 3H6UA 3FVGA 2WBBA 1N3WA 2F5XA 3K4UA 4MMPA 2DWHA 1JW5A 1P1WA 4ZE9A 4N8YA 2Y7RA 3S2VA 1MXUA 4PFTA 4FE8A 4XKRA 4HCWA 4QFKA 4LQ2A 5I58B 2R71A 4P56A 4G77A 1DCUA 4N6DA 3QK6A 1JEVA 3PPNA 1B3FA 3PUVE 4PGPA 4R9FA 2OX3A 2BJJX 1ZTYA 3N6TA 4DLDA 1FPJA 2ONSA 5A5XB 1RKMA 3DLNA 1FBPA 1JW1A 2O7UA 2DE3A 1B7HA 1B3LA 5IZ3B 4YMAA 1LCFA 5B7DA 3MVXA 2I0BA 3HO7A 5JEIA 1B40A 3FD3A 4HS7A 1A54A 4GBWA 3T66A 3OD7A 1SW5A 3E13X 2I3WA 1B46A 5JTYA 1B5IA 5AA4B 4DI3D 3TQLA 2O69A 3IK6B 4C0RA 4FEBA 3TUSA 1CNQA 4OXVA 1N84A 3I3VA 1M5DA 2DWJA 2HXRA 4GOTA 4MEVA 1B32A 2E1SA 1FQFA 2H25A 4KD5A 4JSDA 4OVQA 3PMWA 4Z7EA 3QSLA 4I1DA 3SETA 1B0HA 3H3GA 4H65A 2WEFA 4IO7A 1USYH 2XXHA 1DTZA 3L6HA 1B58A 1KWHA 1R6ZA 1PB9A 4IY6A 5IKBA 3SKPA 4AB6A 2F78A 1YPNA 5DVJA 1B7ZA 4FECA 3SEXA 3RNNA 1SYHA 3EHSA 3LSXA 3TFLA 1BP5A 2QMXA 3FJGA 4YU0A 3H4ZA 1UIVA 3TELA 3ZSFA 2WYPA 1IXGA 3TDJA 2ZXTA 2PT2A 4KR5A 4QFNA 1NV6A 2O1LA 3O6IA 3PPOA 1D9VA 3TCGA 1NV3A 3OXNA 4PETA 3KBRA 2FIXA 2HAVA 1NUXA 4NF5A 5L9OA 2F7AA 1INPA 3IORA 3O9PA 4O3AA 3VXBA 2BJIA 2DWIA 2WBDA 2QS3A 1QUKA 4H6DA 2DDKA 3MW0A 3C31A 2QVRA 2VOZA 4G2ZA 3W9WA 5TPAA 2F3DA 4EUOA 1QVSA 3IFCA 3SEYA 3UA8A 3QIMA 4MLVA 3CIJA 4P0IA 4X04A 1LGBC 4GFRA 1NV2A 4KFQA 3T96B 2PFYA 4QF9A 2GHAA 3WAFA 1MY1A 4GWWA 1P1UA 1LSTA 4K3FA 2XXXA 4P0GA 5IAIA 2OZZA 5F7VA 1Q9DA 3PPPA 5ICTA 1A99A 1Y4TA 4E0WA 4PDDA 4PFUA 4BDLA 1GV8A 1AWBA 3B6TA 4LONB 1BTJA 3C32A 4IB2A 1IMDA 1LBYA 3KC0A 4PAKA 2HAUA 5ET8A 5FBPA 4R75A 1IMAA 1R1NA 4O7MA 5ELVA 3IB0A 4N17A 4PFIA 3MC2A 3THIA 2WKYA 3QUJA 3IO6A 1MS7A 2OLBA 2XWVA 2FNCA 3IX1A 3VV5A 1I6BA 4X8RA 1RDYA 4WXJA 4JB7A 2V84A 3FJMA 4AQ4A 5B70A 2ZMBA 3H6WA 3Q28A 1IMEA 4GWZA 1Z7ME 4XXUA 3N94A 1AH5A 1IUDA 3TAJA 5AA1A 5H8HA 4M1VA 5ITOA 3EF7A 4IO2A 2V3QA 2XXKA 3PUZE 3W9VA 4HE0A 3A09A 2DS9A 1Y4CA 1O64A 2W7YA 1SVXB 2DVZA 5BWJA 1LB9A 2D5WA 3G3KA 2X7PA 4MX6A 4I8CA 4MFIA 2QL3A 5JK4A 3FVOA 2HXWA 1EZ9A 4FIMA 4GX3A 2GFEA 4F39A 4PFYA 3K6UA 1GR2A 4ZEBA 5J16A 1XT8A 5J1DA 5L9SA 4JVDA 4FEDA 2ESNA 4C1UA 1FBEA 2V25A 2ONRA 3KG2A 1G0IA 1FW0A 5H8NB 4PC9A 2ABHA 1Q35A 1ZJLA 1OMPA 1MH3A 5A5LA 1UIUA 4NHBA 3KC1A 4THIA 3VXCA 1B0LA 1HSEA 4BDRA 1I6QA 4NMYA 3FXRA 2ALUA 1NUYA 3QUFA 5I2NB 3R26A 2XX8A 3IJXB 2PMSA 4EQ9A 4RPNA 3VVFA 4XFEA 5DEXB 2HHMA 3V83A 1XVXA 5BUUA 3MP8A 4PBQA 3UK4A 4POXA 3PUWE 4ZECA 3FATA 5EYHA 4M4GA 2I4CA 2G29A 2X26A 1OIBA 3EHTA 4P3LA 3MVZA 4PP0A 3ECRA 3ZKKA 4UA8A 1LFHA 4DZ1A 4BDOA 3EKIA 3MVWA 4R2FA 5ISUA 4ZDMA 4MJOA 2D21A 5H8QB 4N8GA 4X1DA 1S9TA 3Q26A 2FA7A 5K2YA 4RY1A 4MIJA 4P9KA 2I48A 3QYTA 1XI6A 3SEWA 1FBGA 4KCDA 4GQOA 2QMWA 2Y84A 1UTHB 3HHGA 2UVJA 3OSRA 5DVIA 3DP6A 1J1NA 5I57B 4GXAA 2DE2A 4H5FA 4F1UA 1JQFA 2Q9TA 2CZIA 2V93A 2ZYNA 3UORA 2FIEA 2ZYOA 3H7MA 2Q8JA 4H45A 5H8FA 2RC7A 3KFMA 1H44A 5F24A 3N26A 4QHQA 2VP1A 3HFUA 4PTKA 3T93B 2IEEA 2I3VA 3TTMA 4OQOA 1H3DA 3TZAA 3PUXE 2QFLA 5M2VA 3K2DA 1IXHA 2Y5LA 4PCDA 1YZ0A 5LTCA 1B4ZA 4EF2A 2VGQA 1FBHA 3PPQA 3V89B 4GXSB 3PMXA 3IB2A 1MQJA 1N04A 2E0SA 5AA2D 2R9JA 3VLVA 4N6PA 4DE8A 4POWA 4N4UA 1IQ7A 3E9XA 5JTYB 1OQGA 1GTKA 5EYGA 4F2OA 1BLFA 2OWSA 3TTNA 2KR0A 3ODBA 3PUYE 2UVIA 2FBPA 2DOJA 3O29A 4N91A 4YB7A 2HZLA 5CMKA 3V5AA 3OEMA 1L5TA 4NF8A 1B3EA 2OJTA 3TMGA 1URGA 5TU0A 5CM6A 1FCKA 4OWDA 3E79A 2V3TA 2VD3A 4DI4B 4R72A 3LSFB 3GXAA 3IOVA 2VD2A 3OO9A 3K00A 1ZIUA 2I4BA 3O6GA 2JJKA 3RQTA 3M8UA 1BKAA 2XA5A 3CVGA 4NF0A 1CB6A 4ESWA 4YZZA 3F11A 4E0XA 3E3KA 2XX9A 4KI0E 4AS5A 4F1YA 5CBRA 1VDWA 5HPQA 1AIVA 5K2XA 3OENA 1NH7A 3QAXA 4XF5A 4G61A 1P1OA 1VR5A 2XXIA 1XVYA 1NV1A 1FTKA 3RPLA 1USYE 4F3SA 2WX9A 4NF5B 1FRPA 1FJ9A 2LAOA 2Q2CA 3T0JA 3G3GA 4MNPA 2XXTA 1NV5A 1FSAA 1UTBA 3MQ9A 1B3GA 3FVNA 2PX1A 5TPAB 4NN3A 4U2RA 1B05A 1FQDA 3MYUA 1FPGA 2KLFA 3EN3A 1LBCA 4F18A 1FQBA 3CHGA 1MXYA 2HCAA 1FTMA 1B5JA 1NV0A 5TP9B 1FBDA 4MAGA 1QUIA 3EHUA 1EYIA 2HQ0A 4F3GA 3TYHA 2OWTA 3HHFA 2OCUA 1B6HA 4X48A 4YKJA 1XC1A 2DXRA 1Y3QA 1B1HA 3GYYA 1PBPA 1FPDA 4Q8RA 4P1LA 4YMBA 4BLAA 4QFOA 2Z8DA 1EU8A 1YCJA 3KSJA 2L5VA 3RLFE 3UP9A 4EDPA 1PBQA 4G8NA 3FXQA 3KJ7A 4U23A 4HCYA 3K1NA 4KYDA 3TCFA 3Q27A 4EQ7A 1Y1ZA 4TLMB 4OANA 3P7IA 4XEQA 3B6QA 3UIFA 4Q0CA 1MY2A 4F3BA 4O94A 1DSNA 3OMBA 2CZKA 4GBVA 4PF8A 3MWBA 4LZ7A 5H8HB 3AXFA 4F2QA 1VFEA 3FV1A 2XWKA 2GH9A 5FHNA 1XOCA 3CSBA 1D9QA 4LUBA 1ZMGA 3RT6B 3FGSA 1AL3A 5DVFA 3DP4A 1ZU0A 3RTFB 4GX6A 1BK4A 1JVYA 2FVZA 1M5BA 1IMFA 4IO6A 1AMFA 4F29A 4RPOA 3CG3A 4OHNA 2Z22A 1M5CA 1N0TA 3K6VA 2H9BA 5KDTA 3O66A 3KSXA 4I3EA 2GHBA 3MZ9A 1MQHA 1IIWA 3FBPA 1FPBA 1NV4A 2QRYA 2M8CA 2H98A 1RDXA 3TTKA 4NF4A 4DDDA 3IOUA 3CR9A 2VT5A 4NGUA 2DVCA 2RC8A 1B3HA 3BFUA 1TXFA 3WAEA 3FVKA 5ESYA 4ONYA 5DYHA 3O28A 3TCHA 2DSFA 4LA9A 1QULA 3K6XA 4JBZA 3MP6A 4XIGQ 1QUJA 3VDFA 2REJA 3N5LA 1MPBA 1QGXA 5I2KA 4OMBA 4KYEA 4PAIA 3JYRA 4U1ZA 1MRPA 1PB8A 2NXOA 5I56A 4GRKA 3W15C 3SEVA 2Y7IA 5DW8A 3LBSA 1MQDA 1S7YA 5EQ9A 4H8IA 2QVUA 5EQ8A 2ZZWA 4H0WA 1WVJA 4OYVA 3VVDA 2QS4A 3K0VA 1POY1 4X9TA 1MQGA 4Q5TA 3IAZA 3KOTA 2NUVA 1PC3A 3KBZA 5IZZA 1LB8A 4IO4A 1QKBA 4ELOA 1NUWA 4JWOA 3T9VA 4LZ5A 4PBHA 1DBZA 4ZEKA 2HFBA 1FTJA 4OETA 1A8FA 3S4UA 3U8QA 1H45A 4MHFA 1DK4A 4U22A 3FASA 5DTBA 2ANJA 1B51A 4R6KA 1MG1A 4R2BA 1B2HA 5H8FB 2XXQA 1EYKA 5AA2B 3LUZA 4H1XA 3U1OA 1URSA 2F8DA 1NUZA 3B6WA 3TPAA 3V8XB 1SQYA 3S9MC 3MVYA 2P3NA 2XWIA 4KCCA 1ZLQA 4RYAA 2Z8FA 1XHYA 2G93A 4IGRA 4UABA 5T3JA 4YB5A 4GX4A 4FAJA 5I3SA 3PGFA 1B4HA 1DMBA 1GVCA 2XXUA 3K1MA 3KEIA 4ZEFA 3MAMA 3H6TA 2OWZA 1LLSA 1MH4A 2XD3A 3C34A 5CC2A 4P1EA 4WEDA 1LBVA 5CRYA 1Y3NA 3FJ7A 1MXZA 2ZNTA 1Z7NE 3PD9A 2Z8EA 4U4SA 1MY0A 3D1RA 3O2AA 4NX1A 3LC8A 1T0KA 3DELB 4ECFA 4I62A 4AB5A 4PFRA 2XD2A 2B4LA 2RC9A 3OELA 2XXRA 1R9QA 4NF8B 4GL8A 1OVBA 2UVHA 3RGYA 2RCAA 4JDFA 3MZ1A 3B50A 3MPKA 1LFIA 2P3VA 4U21A 2XXWA 1NFTA 3RTWB 2Q74A 2QSXA 4UACA 2A5TA 3OO7A 3SERA 5EHSA 4JVIA 5ITPA 3JZJA 3OOAA 2O68A 3LSLA 2ONKE 4OFJA 5L8DA 1Y20A 4TQUQ 1FPFA 1MXVA 1JETA 2AIXA 1DPPA 3FXUA 1JW4A 4HE2A 1A7LA 1HSLA 3G3FA 4O3CA 1WDNA 2F6GA 1FQEA 1JVXA 3RPLB 3OSQA 1ZBMA 4P8BA 1QJMA 1UQWA 2PBWA 4ELQA 1XS5A 1EZPA 4EQBA 5F1QA 1ELJA 3I5OA 4NEDA 4EF1A 4F19A 3KGCA 2V4CA 3BIHA 1LBZA 1AOVA 4GWXA 1UTBB 4C1TA 2ZYMA 1BIYA 1KA1A 2ZNSA 2DP8A 4OTEA 3HSTA 5IGAA 2B4MA 4EXLA 3T9XB 3RT8A 1B7UA 4LVQA 1N7XA 2F7CA 3IJOB 4O7IA 3KN7A 5ET7A 2YLNA 5I2NA 1JP4A 3KZGA 3PD8A 1LBWA 4IO3A 1OQHA 1FTAA 1KZ8A 5L9MA 4I9DA 4U4XA 4PGNA 4DCYA 3VVEA 4KPTA 2AL4A 2F34A 3FIRA 3CFLA 4NF6A 1YXIA 4G8MA 5FTIA 1N3XA 1EH3A 3R6UA 2OK2A 4N07A 2QJEA 5HBCA 2UYEA 4OVSA 2YPNA 4BDNA 2F6PA 4N6KA 1A40A 3ZS6A 4KQPA 1R9LA 2Q8MA 1FQAA 1NH8A 3G3HA 2H4IA 3O6HA 3FUZA 3Q25A 1FTLA 3HV1A 4PFWA 1FPEA 3C35A 5EYFA 2CMOA 3MJNA 3GBAA 1Y9UA 3T1BA 2X7QA 3TODA 2AYSA 3VLWA 4GL0A 2O51A 4GWYA 1FPKA 1WODA 5FHOA 4OA4A 3IR1A 1PB7A 3LSWA 4ZE8A 3BKIB 4GD5A 4JSOA 3H06B 2KQZA 1B5HA 5KCJA 4N81A 3MZBA 1VFDA 3D4CA 4F3PA 1D3KA 3C4MA 3N6UA 4R6YA 1FPIA 4L17A 5KDTB 3MP1A 3JV9A 1Y3PA 4QXDA 5FTHA 1N76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U93 A;  5CMM A;  1M5E A;  1I6A A;  3H03 A;  2WYK A;  4GLI A;  4G4P A;  4DXB A;  2R6G E;  4NF4 B;  1SBP A;  4GF8 A;  1DTG A;  3D4G A;  3HCQ A;  3TEP A;  3PV0 E;  2GRV A;  4F22 A;  1A8E A;  2XXY A;  1MPD A;  3CFX A;  5CI5 A;  4YKK A;  1A55 A;  4PFB A;  3MPL A;  1YTV A;  5H8S A;  4H8J A;  5I2K B;  1F9B A;  1LBB A;  1O63 A;  2DWA A;  1B9J A;  5I56 B;  2DE4 A;  3GBB A;  4FJP A;  3CG1 A;  2RCB A;  4ELP A;  3BFT A;  1QKA A;  3A3U A;  2NOO A;  4GIZ A;  4NWD A;  4NWC A;  2YJP A;  2F36 A;  3KN8 A;  1NNP A;  4BDM A;  4XKQ A;  4XKP A;  4G8H A;  1P99 A;  1TFD A;  2HPG A;  5DT6 A;  3M3K A;  3K6W A;  4HW8 A;  1H43 A;  3H6V A;  1RYO A;  3BBR A;  3S9N C;  3RUM A;  4MNI A;  2PT1 A;  3B7D A;  2UYF A;  2XX7 A;  3ONM A;  5I59 A;  2OBG A;  4G68 A;  4OFO A;  1P1N A;  3IL1 B;  5ICQ A;  1LAH E;  4QRZ A;  3ILT B;  3SEU A;  2I0C A;  4QSD A;  3T22 A;  1FQC A;  4NTL A;  4QFL A;  3VFJ A;  5I58 A;  1D9Y A;  2CEY A;  1I69 A;  1NNT A;  1H76 A;  4RK9 A;  4OVP A;  1RYX A;  4ZZA A;  5IM2 A;  4OES A;  3IO4 A;  4ISU A;  5A5X A;  4R74 A;  4RJZ A;  5LOM A;  1IXC A;  2NVU B;  2XHD A;  2HZK A;  1ATG A;  4RXL A;  4DXU A;  1ZKB A;  1LAX A;  4F31 B;  4O8M A;  4JWX A;  2F35 A;  4QSC A;  2VPN A;  4EXK A;  2XWO A;  1MY3 A;  5AA4 A;  3QXM A;  5TP9 A;  2PYY A;  2CZL A;  3DM0 A;  4OVR A;  1MQI A;  3KN3 A;  4RNS A;  3UGW A;  4IY5 A;  4N15 A;  3FXB A;  1OLA A;  3HPI A;  4MH5 A;  3ZKL A;  4NE4 A;  5KZT A;  3A3C A;  4H67 A;  4GVO A;  4LZ8 A;  3KOS A;  1B1X A;  4PF6 A;  3OO6 A;  2P0S A;  1LFG A;  4YIC A;  3TKD A;  2B65 A;  4YAH X;  1PEB A;  4PE3 A;  2A5T B;  4P11 A;  2Q88 A;  1OLC A;  2RIN A;  4WEP A;  3S9L C;  3MUQ A;  4NQ8 A;  4DXC A;  4G68 C;  3RPW A;  3Q29 A;  2B3F A;  4F1V A;  1LAF E;  3CFZ A;  2Y7K A;  2P1S A;  2V3U A;  3G7W A;  4ESX A;  3TTR A;  3SDF A;  5I84 A;  5AE4 A;  1IIT A;  4KYS A;  3IOW A;  4N13 A;  4OVJ A;  4R6H A;  4R9G A;  2I6E A;  2FYI A;  4DCX A;  3VE1 B;  4OFL A;  3TTL A;  4ZS9 A;  4OER A;  1SW1 A;  1MXX A;  4MBP A;  4P47 A;  2DXY A;  3U72 A;  3OO8 A;  3FZV A;  1IZ1 A;  1II5 A;  1TT1 A;  3SES A;  5CMB A;  2Q89 A;  3C36 A;  1NNK A;  4O3B A;  1US4 A;  2B3B A;  4LP2 B;  3CSG A;  2RKM A;  3GLB A;  1MDP 1;  4LQ5 A;  1SI0 A;  2RF1 A;  3EQ1 A;  2QS2 A;  1SW4 A;  4OVT A;  4TLL B;  4JXI A;  4H5G A;  3CRB A;  2CEX A;  1FTO A;  4NG7 A;  3LUY A;  2I58 A;  4RA1 A;  1QW0 A;  4DIG A;  4FOR A;  3PPR A;  2XXV A;  4IGT A;  3RN8 A;  1MM6 A;  1VSO A;  4NF6 B;  3LR1 A;  1MXW A;  1US5 A;  4YKP A;  2H99 A;  1IXI A;  2O7I A;  1B52 A;  1TWY A;  3PMV A;  3K01 A;  4XTC Q;  4MLQ A;  5HM4 B;  1PDA A;  4MF3 A;  2QS1 A;  1NNF A;  1O7T A;  2VHA A;  2DQV A;  4OEV A;  3M3F A;  3TQW A;  2Q2A A;  5FHM A;  5I5P A;  1CE2 A;  1SDX A;  4ELR A;  2ZYK A;  2F97 A;  1MY4 A;  1HSJ A;  3S9E A;  1NMU A;  5CBS A;  4JWY A;  2ZZV A;  4YB6 A;  4Z0I A;  4QFP A;  3O97 A;  2A5S A;  4XKN A;  3R7X A;  1VE4 A;  1DPE A;  4ZZE A;  4OZ9 A;  4LN5 A;  2NWJ A;  1MPC A;  1S50 A;  2I49 A;  3I6V A;  1GGG A;  1M5F A;  2O1M A;  3VLU A;  3C33 A;  5CMC A;  5AA2 A;  1DOT A;  4FAT A;  1SI1 A;  5KCJ B;  4ZEI A;  4HTG A;  2VPO A;  2REG A;  1NKX A;  2Y7P A;  2AL5 A;  2H5Y A;  4ND9 A;  4X1B A;  4R73 A;  2QPQ A;  4MCO A;  5H8N A;  1TFA A;  1MDQ A;  1SYI A;  4MNC A;  2Z23 A;  3K1P A;  3HN0 A;  3PU5 A;  1LAG E;  3ILU B;  2PFZ A;  3DP8 A;  2ZZX A;  3L6G A;  4YKI A;  3U65 A;  4LAT A;  3USD A;  2HEU A;  2THI A;  4Q30 B;  1D4N A;  3MBP A;  2DYX A;  3CI8 A;  3K02 A;  5DEX A;  1NL5 A;  3U94 A;  3IOT A;  4WKM A;  1MM7 A;  5I7I A;  4OEN A;  4ZED A;  4PQJ A;  4TOZ A;  2O84 X;  2XXP A;  1N7W A;  1YAE A;  4PE5 B;  5EHM A;  4BDQ A;  2P2A A;  1JNF A;  3IB1 A;  3T9U A;  4KHZ E;  1OVT A;  3C9H A;  1P1Q A;  4QSE A;  3UN6 A;  1Q1K A;  3OEK A;  1Y1M A;  4U1O A;  4PDH A;  4GWO A;  3EPE A;  2PVU A;  1SW2 A;  3G3I A;  3T9H B;  5AA3 A;  3FV2 A;  4NAP A;  3KJT A;  1SD3 A;  2IA4 A;  5H8Q A;  4IO5 A;  4RK2 A;  1LCT A;  2UXA A;  1IEJ A;  2Y7W A;  1JEU A;  2UVG A;  3U92 A;  4PAF A;  2D3I A;  2F7B A;  3RY3 A;  2O6A A;  1POT A;  4OEU A;  3GZG A;  3G3J A;  1UTH A;  2ZNU A;  5I59 B;  1ANF A;  1URD A;  3M3L A;  5I57 A;  4G68 B;  1EZO A;  3E4R A;  3H6U A;  3FVG A;  1N3W A;  2F5X A;  3K4U A;  4MMP A;  2DWH A;  1JW5 A;  1P1W A;  4ZE9 A;  4N8Y A;  2Y7R A;  3S2V A;  1MXU A;  4PFT A;  4FE8 A;  4XKR A;  4HCW A;  4QFK A;  4LQ2 A;  5I58 B;  2R71 A;  4P56 A;  4G77 A;  4N6D A;  3QK6 A;  1JEV A;  3PPN A;  1B3F A;  3PUV E;  4PGP A;  4R9F A;  2BJJ X;  1ZTY A;  3N6T A;  4DLD A;  2ONS A;  5A5X B;  1RKM A;  3DLN A;  1JW1 A;  2O7U A;  2DE3 A;  1B7H A;  1B3L A;  4YMA A;  1LCF A;  5B7D A;  3MVX A;  2I0B A;  3HO7 A;  5JEI A;  1B40 A;  3FD3 A;  4HS7 A;  1A54 A;  3T66 A;  3OD7 A;  1SW5 A;  3E13 X;  2I3W A;  1B46 A;  5JTY A;  1B5I A;  5AA4 B;  4DI3 D;  3TQL A;  2O69 A;  3IK6 B;  4C0R A;  4FEB A;  3TUS A;  4OXV A;  1N84 A;  3I3V A;  1M5D A;  2DWJ A;  4GOT A;  4MEV A;  1B32 A;  2E1S A;  1FQF A;  2H25 A;  4KD5 A;  4JSD A;  4OVQ A;  3PMW A;  4Z7E A;  3QSL A;  4I1D A;  3SET A;  1B0H A;  3H3G A;  4H65 A;  4IO7 A;  1USY H;  2XXH A;  1DTZ A;  3L6H A;  1B58 A;  1KWH A;  1R6Z A;  1PB9 A;  4IY6 A;  5IKB A;  3SKP A;  4AB6 A;  2F78 A;  1YPN A;  5DVJ A;  1B7Z A;  4FEC A;  3SEX A;  3RNN A;  1SYH A;  3EHS A;  3LSX A;  3TFL A;  1BP5 A;  2QMX A;  3FJG A;  4YU0 A;  3H4Z A;  1UIV A;  3TEL A;  3ZSF A;  2WYP A;  1IXG A;  3TDJ A;  2ZXT A;  2PT2 A;  4KR5 A;  4QFN A;  2O1L A;  3O6I A;  3PPO A;  1D9V A;  3TCG A;  3OXN A;  4PET A;  3KBR A;  2HAV A;  4NF5 A;  5L9O A;  2F7A A;  3IOR A;  3O9P A;  4O3A A;  3VXB A;  2DWI A;  2QS3 A;  1QUK A;  4H6D A;  3MW0 A;  3C31 A;  2VOZ A;  4G2Z A;  3W9W A;  5TPA A;  4EUO A;  1QVS A;  3SEY A;  3UA8 A;  3QIM A;  4MLV A;  3CIJ A;  4P0I A;  4X04 A;  1LGB C;  4GFR A;  4KFQ A;  3T96 B;  2PFY A;  4QF9 A;  2GHA A;  3WAF A;  1MY1 A;  1P1U A;  1LST A;  4K3F A;  2XXX A;  4P0G A;  5IAI A;  2OZZ A;  5F7V A;  3PPP A;  5ICT A;  1A99 A;  1Y4T A;  4E0W A;  4PDD A;  4PFU A;  4BDL A;  1GV8 A;  3B6T A;  4LON B;  1BTJ A;  3C32 A;  4IB2 A;  4PAK A;  2HAU A;  4R75 A;  1R1N A;  4O7M A;  5ELV A;  3IB0 A;  4N17 A;  4PFI A;  3MC2 A;  3THI A;  2WKY A;  3QUJ A;  3IO6 A;  1MS7 A;  2OLB A;  2XWV A;  2FNC A;  3IX1 A;  3VV5 A;  1I6B A;  4X8R A;  4WXJ A;  4JB7 A;  2V84 A;  3FJM A;  4AQ4 A;  5B70 A;  2ZMB A;  3H6W A;  3Q28 A;  1Z7M E;  4XXU A;  3N94 A;  1AH5 A;  1IUD A;  3TAJ A;  5AA1 A;  5H8H A;  4M1V A;  5ITO A;  3EF7 A;  4IO2 A;  2V3Q A;  2XXK A;  3PUZ E;  3W9V A;  3A09 A;  2DS9 A;  1Y4C A;  1O64 A;  2W7Y A;  1SVX B;  2DVZ A;  5BWJ A;  1LB9 A;  2D5W A;  3G3K A;  2X7P A;  4MX6 A;  4I8C A;  4MFI A;  2QL3 A;  5JK4 A;  3FVO A;  2HXW A;  1EZ9 A;  4FIM A;  2GFE A;  4F39 A;  4PFY A;  3K6U A;  1GR2 A;  4ZEB A;  1XT8 A;  5J1D A;  5L9S A;  4FED A;  2ESN A;  4C1U A;  2V25 A;  2ONR A;  3KG2 A;  1FW0 A;  5H8N B;  4PC9 A;  2ABH A;  1Q35 A;  1ZJL A;  1OMP A;  1MH3 A;  1UIU A;  4NHB A;  4THI A;  3VXC A;  1B0L A;  1HSE A;  4BDR A;  1I6Q A;  4NMY A;  3FXR A;  2ALU A;  3QUF A;  5I2N B;  3R26 A;  2XX8 A;  3IJX B;  2PMS A;  4EQ9 A;  4RPN A;  3VVF A;  4XFE A;  5DEX B;  3V83 A;  1XVX A;  5BUU A;  3MP8 A;  4PBQ A;  3UK4 A;  4POX A;  3PUW E;  4ZEC A;  3FAT A;  4M4G A;  2I4C A;  2G29 A;  2X26 A;  1OIB A;  3EHT A;  4P3L A;  3MVZ A;  4PP0 A;  3ECR A;  3ZKK A;  4UA8 A;  1LFH A;  4DZ1 A;  4BDO A;  3MVW A;  4R2F A;  5ISU A;  4ZDM A;  2D21 A;  5H8Q B;  4N8G A;  4X1D A;  1S9T A;  3Q26 A;  2FA7 A;  5K2Y A;  4RY1 A;  4MIJ A;  4P9K A;  2I48 A;  3QYT A;  3SEW A;  4KCD A;  4GQO A;  2QMW A;  2Y84 A;  1UTH B;  3HHG A;  2UVJ A;  3OSR A;  5DVI A;  3DP6 A;  1J1N A;  5I57 B;  4GXA A;  2DE2 A;  4H5F A;  4F1U A;  1JQF A;  2Q9T A;  2V93 A;  2ZYN A;  3UOR A;  2ZYO A;  3H7M A;  2Q8J A;  5H8F A;  2RC7 A;  3KFM A;  1H44 A;  3N26 A;  4QHQ A;  2VP1 A;  3T93 B;  2IEE A;  2I3V A;  3TTM A;  4OQO A;  1H3D A;  3TZA A;  3PUX E;  5M2V A;  3K2D A;  1IXH A;  4PCD A;  5LTC A;  1B4Z A;  4EF2 A;  2VGQ A;  3PPQ A;  3V89 B;  4GXS B;  3PMX A;  3IB2 A;  1MQJ A;  1N04 A;  2E0S A;  5AA2 D;  2R9J A;  3VLV A;  4N6P A;  4DE8 A;  4POW A;  4N4U A;  1IQ7 A;  3E9X A;  5JTY B;  1OQG A;  1GTK A;  4F2O A;  1BLF A;  2OWS A;  3TTN A;  3ODB A;  3PUY E;  2UVI A;  2DOJ A;  3O29 A;  4N91 A;  4YB7 A;  2HZL A;  5CMK A;  3V5A A;  3OEM A;  1L5T A;  4NF8 A;  1B3E A;  2OJT A;  3TMG A;  1URG A;  5TU0 A;  5CM6 A;  1FCK A;  4OWD A;  2V3T A;  2VD3 A;  4DI4 B;  4R72 A;  3LSF B;  3GXA A;  3IOV A;  2VD2 A;  3OO9 A;  3K00 A;  1ZIU A;  2I4B A;  3O6G A;  3RQT A;  3M8U A;  1BKA A;  2XA5 A;  3CVG A;  4NF0 A;  1CB6 A;  4ESW A;  4YZZ A;  3F11 A;  4E0X A;  3E3K A;  2XX9 A;  4KI0 E;  4F1Y A;  5CBR A;  5HPQ A;  1AIV A;  5K2X A;  3OEN A;  1NH7 A;  3QAX A;  4XF5 A;  1P1O A;  1VR5 A;  2XXI A;  1XVY A;  1FTK A;  1USY E;  4F3S A;  2WX9 A;  4NF5 B;  2LAO A;  2Q2C A;  3G3G A;  4MNP A;  2XXT A;  1UTB A;  3MQ9 A;  1B3G A;  3FVN A;  2PX1 A;  5TPA B;  4NN3 A;  4U2R A;  1B05 A;  1FQD A;  2KLF A;  3EN3 A;  1LBC A;  4F18 A;  1FQB A;  1MXY A;  2HCA A;  1FTM A;  1B5J A;  5TP9 B;  4MAG A;  1QUI A;  3EHU A;  2HQ0 A;  4F3G A;  3TYH A;  2OWT A;  3HHF A;  2OCU A;  1B6H A;  4X48 A;  4YKJ A;  1XC1 A;  2DXR A;  1Y3Q A;  1B1H A;  3GYY A;  1PBP A;  4Q8R A;  4P1L A;  4YMB A;  4BLA A;  4QFO A;  2Z8D A;  1EU8 A;  1YCJ A;  3KSJ A;  3RLF E;  3UP9 A;  4EDP A;  1PBQ A;  4G8N A;  3FXQ A;  3KJ7 A;  4U23 A;  4HCY A;  3K1N A;  4KYD A;  3TCF A;  3Q27 A;  4EQ7 A;  1Y1Z A;  4TLM B;  4OAN A;  3P7I A;  4XEQ A;  3B6Q A;  3UIF A;  4Q0C A;  1MY2 A;  4F3B A;  4O94 A;  1DSN A;  3OMB A;  4PF8 A;  3MWB A;  4LZ7 A;  5H8H B;  3AXF A;  4F2Q A;  1VFE A;  3FV1 A;  2XWK A;  2GH9 A;  5FHN A;  1XOC A;  3CSB A;  4LUB A;  1ZMG A;  3RT6 B;  3FGS A;  1AL3 A;  5DVF A;  3DP4 A;  1ZU0 A;  3RTF B;  1JVY A;  1M5B A;  4IO6 A;  1AMF A;  4F29 A;  4RPO A;  3CG3 A;  4OHN A;  2Z22 A;  1M5C A;  1N0T A;  3K6V A;  2H9B A;  5KDT A;  3O66 A;  3KSX A;  2GHB A;  3MZ9 A;  1MQH A;  1IIW A;  2QRY A;  2M8C A;  2H98 A;  3TTK A;  4NF4 A;  4DDD A;  3IOU A;  3CR9 A;  4NGU A;  2DVC A;  2RC8 A;  1B3H A;  3BFU A;  1TXF A;  3WAE A;  3FVK A;  4ONY A;  5DYH A;  3O28 A;  3TCH A;  2DSF A;  4LA9 A;  1QUL A;  3K6X A;  4JBZ A;  3MP6 A;  4XIG Q;  1QUJ A;  3VDF A;  2REJ A;  3N5L A;  1MPB A;  5I2K A;  4OMB A;  4KYE A;  4PAI A;  3JYR A;  4U1Z A;  1MRP A;  1PB8 A;  2NXO A;  5I56 A;  4GRK A;  3W15 C;  3SEV A;  2Y7I A;  3LBS A;  1MQD A;  1S7Y A;  4H8I A;  2ZZW A;  4H0W A;  1WVJ A;  4OYV A;  3VVD A;  2QS4 A;  3K0V A;  1POY 1;  4X9T A;  1MQG A;  4Q5T A;  3IAZ A;  3KOT A;  2NUV A;  1PC3 A;  5IZZ A;  1LB8 A;  4IO4 A;  1QKB A;  4ELO A;  4JWO A;  3T9V A;  4LZ5 A;  4PBH A;  4ZEK A;  2HFB A;  1FTJ A;  4OET A;  1A8F A;  3S4U A;  3U8Q A;  1H45 A;  4MHF A;  4U22 A;  3FAS A;  5DTB A;  2ANJ A;  1B51 A;  4R6K A;  1MG1 A;  4R2B A;  1B2H A;  5H8F B;  2XXQ A;  5AA2 B;  4H1X A;  3U1O A;  1URS A;  2F8D A;  3B6W A;  3TPA A;  3V8X B;  1SQY A;  3S9M C;  3MVY A;  2XWI A;  4KCC A;  1ZLQ A;  4RYA A;  2Z8F A;  1XHY A;  2G93 A;  4IGR A;  4UAB A;  4YB5 A;  4FAJ A;  3PGF A;  1B4H A;  1DMB A;  1GVC A;  2XXU A;  3K1M A;  3KEI A;  4ZEF A;  3MAM A;  3H6T A;  1LLS A;  1MH4 A;  2XD3 A;  3C34 A;  5CC2 A;  4P1E A;  4WED A;  5CRY A;  1Y3N A;  3FJ7 A;  1MXZ A;  2ZNT A;  1Z7N E;  3PD9 A;  2Z8E A;  4U4S A;  1MY0 A;  3O2A A;  4NX1 A;  3LC8 A;  1T0K A;  3DEL B;  4ECF A;  4I62 A;  4AB5 A;  4PFR A;  2XD2 A;  2RC9 A;  3OEL A;  2XXR A;  1R9Q A;  4NF8 B;  4GL8 A;  1OVB A;  2UVH A;  3RGY A;  2RCA A;  4JDF A;  3MZ1 A;  3B50 A;  3MPK A;  1LFI A;  4U21 A;  2XXW A;  1NFT A;  3RTW B;  2QSX A;  4UAC A;  2A5T A;  3OO7 A;  3SER A;  5EHS A;  5ITP A;  3JZJ A;  3OOA A;  2O68 A;  3LSL A;  2ONK E;  4OFJ A;  5L8D A;  1Y20 A;  4TQU Q;  1MXV A;  1JET A;  2AIX A;  1DPP A;  3FXU A;  1JW4 A;  1A7L A;  1HSL A;  3G3F A;  4O3C A;  1WDN A;  2F6G A;  1FQE A;  1JVX A;  3OSQ A;  1ZBM A;  4P8B A;  1QJM A;  1UQW A;  2PBW A;  4ELQ A;  1XS5 A;  1EZP A;  4EQB A;  5F1Q A;  1ELJ A;  3I5O A;  4NED A;  4EF1 A;  4F19 A;  3KGC A;  2V4C A;  1AOV A;  1UTB B;  4C1T A;  2ZYM A;  1BIY A;  2ZNS A;  2DP8 A;  4OTE A;  3HST A;  5IGA A;  4EXL A;  3T9X B;  3RT8 A;  1B7U A;  4LVQ A;  1N7X A;  2F7C A;  3IJO B;  3KN7 A;  2YLN A;  5I2N A;  3KZG A;  3PD8 A;  4IO3 A;  1OQH A;  5L9M A;  4I9D A;  4U4X A;  4PGN A;  4DCY A;  3VVE A;  4KPT A;  2AL4 A;  2F34 A;  3FIR A;  3CFL A;  4NF6 A;  4G8M A;  5FTI A;  1N3X A;  1EH3 A;  3R6U A;  2OK2 A;  4N07 A;  2QJE A;  5HBC A;  2UYE A;  4OVS A;  2YPN A;  4BDN A;  2F6P A;  4N6K A;  1A40 A;  3ZS6 A;  4KQP A;  1R9L A;  1FQA A;  1NH8 A;  3G3H A;  2H4I A;  3O6H A;  3FUZ A;  3Q25 A;  1FTL A;  3HV1 A;  4PFW A;  3C35 A;  5EYF A;  2CMO A;  3MJN A;  3GBA A;  1Y9U A;  2X7Q A;  3TOD A;  2AYS A;  3VLW A;  4GL0 A;  2O51 A;  1WOD A;  5FHO A;  4OA4 A;  3IR1 A;  1PB7 A;  3LSW A;  4ZE8 A;  3BKI B;  4GD5 A;  4JSO A;  3H06 B;  1B5H A;  5KCJ A;  3MZB A;  1VFD A;  3D4C A;  4F3P A;  1D3K A;  3C4M A;  3N6U A;  4R6Y A;  4L17 A;  5KDT B;  3MP1 A;  3JV9 A;  1Y3P A;  5FTH A;  1N76 A; 
#chains in the Genus database with same CATH topology
 3U93 A;  5CMM A;  1M5E A;  1I6A A;  3H03 A;  2WYK A;  4GLI A;  4G4P A;  4DXB A;  2R6G E;  4NF4 B;  1SBP A;  4GF8 A;  4GWU A;  1DTG A;  3PTY A;  3D4G A;  3HCQ A;  3TEP A;  3PV0 E;  2GRV A;  4F22 A;  1A8E A;  2XXY A;  1MPD A;  5ET5 A;  3CFX A;  5CI5 A;  4YKK A;  1A55 A;  4PFB A;  3MPL A;  1YTV A;  5H8S A;  4H8J A;  1K9Y A;  5I2K B;  1F9B A;  1LBB A;  1NV7 A;  1O63 A;  2DWA A;  1B9J A;  3ROJ A;  5I56 B;  2DE4 A;  3GBB A;  4FJP A;  3CG1 A;  2RCB A;  4ELP A;  3BFT A;  1QKA A;  3A3U A;  2NOO A;  4GIZ A;  4NWD A;  4NWC A;  2YJP A;  2F36 A;  3KN8 A;  1NNP A;  4BDM A;  4XKQ A;  4XKP A;  4G8H A;  1P99 A;  1TFD A;  2HPG A;  5DT6 A;  3M3K A;  3K6W A;  4HW8 A;  1G0H A;  2GQ1 A;  1H43 A;  3H6V A;  1RYO A;  3BBR A;  3S9N C;  4QBA A;  3RUM A;  4MNI A;  2PT1 A;  2QVV A;  3B7D A;  2UYF A;  2XX7 A;  3ONM A;  5I59 A;  4AS4 A;  2OBG A;  4G68 A;  4JVC A;  4OFO A;  1P1N A;  3IL1 B;  5ICQ A;  5IZ1 A;  1LAH E;  4QRZ A;  3ILT B;  3SEU A;  2I0C A;  4QSD A;  3T22 A;  3ISP A;  1FQC A;  4NTL A;  4HE1 A;  4QFL A;  3VFJ A;  1FPL A;  5I58 A;  1D9Y A;  2CEY A;  2F3B A;  1I69 A;  1NNT A;  1K9Z A;  1H76 A;  4RK9 A;  4OVP A;  1RYX A;  4ZZA A;  5IM2 A;  4OES A;  3IO4 A;  4ISU A;  5A5X A;  4R74 A;  4RJZ A;  5LOM A;  1IXC A;  2NVU B;  3A29 A;  2XHD A;  3NOH A;  5IZ3 A;  2HZK A;  1ATG A;  4RXL A;  4DXU A;  1ZKB A;  1LAX A;  4O8M A;  4F31 B;  4JWX A;  2F35 A;  4QSC A;  2VPN A;  2XWO A;  4EXK A;  1MY3 A;  5AA4 A;  3QXM A;  1IMC A;  5TP9 A;  2PYY A;  2CZL A;  3DM0 A;  4OVR A;  1MQI A;  3KN3 A;  4IR8 A;  1YYZ A;  4RNS A;  3UGW A;  4IY5 A;  4N15 A;  3FXB A;  3BIG A;  1OLA A;  3HPI A;  4MH5 A;  3ZKL A;  4NE4 A;  5KZT A;  5EQA A;  3A3C A;  4H67 A;  4GVO A;  4LZ8 A;  3KOS A;  1B1X A;  4PF6 A;  3OO6 A;  2P0S A;  1LFG A;  4YIC A;  1FBC A;  1FBF A;  3TKD A;  2B65 A;  4YAH X;  1NI9 A;  1PEB A;  4PE3 A;  2A5T B;  4P11 A;  2Q88 A;  1OLC A;  2RIN A;  3IFA A;  4WEP A;  3S9L C;  3RYD A;  1SPI A;  3MUQ A;  4NQ8 A;  4DXC A;  1KA0 A;  4G68 C;  3RPW A;  3Q29 A;  2B3F A;  4F1V A;  1LAF E;  3SZP A;  3CFZ A;  2Y7K A;  2P1S A;  4KXP A;  2V3U A;  3G7W A;  4ESX A;  3TTR A;  5ET6 A;  3SDF A;  3B8B A;  1RDZ A;  5AE4 A;  1IIT A;  5I84 A;  4KYS A;  3IOW A;  4N13 A;  4OVJ A;  4R6H A;  4R9G A;  2I6E A;  2FYI A;  1LBX A;  5LDZ A;  4DCX A;  3VE1 B;  4OFL A;  3TTL A;  4ZS9 A;  2FHY A;  4OER A;  1SW1 A;  1MXX A;  4MBP A;  4P47 A;  2DXY A;  3U72 A;  2CZH A;  3OO8 A;  3FZV A;  1IZ1 A;  1II5 A;  1TT1 A;  3SES A;  5CMB A;  2Q89 A;  3C36 A;  1NNK A;  4O3B A;  1US4 A;  2B3B A;  4LP2 B;  3CSG A;  2RKM A;  3GLB A;  1MDP 1;  4LQ5 A;  1SI0 A;  2RF1 A;  3EQ1 A;  2QS2 A;  1SW4 A;  4OVT A;  4HXV A;  4TLL B;  4JXI A;  4H5G A;  2CEX A;  3CRB A;  1FTO A;  4NG7 A;  3E78 A;  3LUY A;  2I58 A;  4RA1 A;  1QW0 A;  4DIG A;  4FOR A;  3PPR A;  2XXV A;  4IGT A;  3RN8 A;  1MM6 A;  1VSO A;  4NF6 B;  3LR1 A;  1MXW A;  1US5 A;  4YKP A;  2H99 A;  1IXI A;  2O7I A;  1B52 A;  1TWY A;  3PMV A;  4I3Y A;  3K01 A;  4XTC Q;  4MLQ A;  5HM4 B;  1PDA A;  4MF3 A;  1IMB A;  2QS1 A;  1NNF A;  1O7T A;  2VHA A;  2DQV A;  4OEV A;  3M3F A;  5EQ7 A;  3TQW A;  2Q2A A;  5FHM A;  2MKZ A;  5I5P A;  1CE2 A;  1FJ6 A;  1SDX A;  4ELR A;  2ZYK A;  2F97 A;  1MY4 A;  1HSJ A;  3S9E A;  1NMU A;  5CBS A;  4JWY A;  2ZZV A;  4YB6 A;  4Z0I A;  4QFP A;  3O97 A;  2A5S A;  4XKN A;  3R7X A;  1VE4 A;  4GWS A;  1DPE A;  4ZZE A;  4OZ9 A;  4LN5 A;  2NWJ A;  1MPC A;  1S50 A;  2I49 A;  3I6V A;  1GGG A;  1M5F A;  2O1M A;  3VLU A;  3C33 A;  5CMC A;  5AA2 A;  1DOT A;  4FAT A;  1SI1 A;  5KCJ B;  4ZEI A;  4HTG A;  4I40 A;  2VPO A;  2REG A;  1NKX A;  2Y7P A;  2AL5 A;  2H5Y A;  4ND9 A;  2Y5K A;  4X1B A;  4R73 A;  2QPQ A;  4MCO A;  5H8N A;  1TFA A;  1MDQ A;  1SYI A;  4MNC A;  2Z23 A;  3K1P A;  3HN0 A;  3PU5 A;  4FBP A;  1LAG E;  2PFZ A;  3ILU B;  3DP8 A;  2ZZX A;  3L6G A;  4YKI A;  3U65 A;  4LAT A;  3USD A;  2HEU A;  2R8T A;  2THI A;  4Q30 B;  1D4N A;  3MBP A;  2DYX A;  3CI8 A;  3K02 A;  5DEX A;  1NL5 A;  3U94 A;  3IOT A;  4WKM A;  1MM7 A;  5I7I A;  4OEN A;  3LV0 A;  4ZED A;  4PQJ A;  4TOZ A;  2O84 X;  2XXP A;  1N7W A;  1YAE A;  4PE5 B;  5EHM A;  4BDQ A;  2P2A A;  1JNF A;  3IB1 A;  3T9U A;  4KHZ E;  1OVT A;  3C9H A;  1P1Q A;  4QSE A;  3UN6 A;  1Q1K A;  3OEK A;  1Y1M A;  4U1O A;  4PDH A;  4GWO A;  3EPE A;  2PVU A;  1SW2 A;  3G3I A;  4NAP A;  3T9H B;  3FV2 A;  5AA3 A;  3KJT A;  1SD3 A;  1LEV A;  2IA4 A;  5H8Q A;  4IO5 A;  4RK2 A;  1EYJ A;  1LCT A;  2UXA A;  1IEJ A;  2Y7W A;  1JEU A;  2UVG A;  3U92 A;  3MST A;  4PAF A;  4H46 A;  2D3I A;  2F7B A;  3RY3 A;  2O6A A;  1POT A;  4OEU A;  3GZG A;  3G3J A;  3QMF A;  1UTH A;  2ZNU A;  5I59 B;  1ANF A;  1URD A;  3M3L A;  5I57 A;  4G68 B;  1EZO A;  2PCR A;  3E4R A;  3H6U A;  2WBB A;  3FVG A;  1N3W A;  2F5X A;  3K4U A;  4MMP A;  2DWH A;  1JW5 A;  1P1W A;  4N8Y A;  4ZE9 A;  2Y7R A;  3S2V A;  1MXU A;  4PFT A;  4FE8 A;  4XKR A;  4HCW A;  4QFK A;  4LQ2 A;  5I58 B;  2R71 A;  4P56 A;  4G77 A;  1DCU A;  4N6D A;  3QK6 A;  1JEV A;  3PPN A;  1B3F A;  3PUV E;  4PGP A;  4R9F A;  2OX3 A;  2BJJ X;  1ZTY A;  3N6T A;  4DLD A;  1FPJ A;  2ONS A;  5A5X B;  1RKM A;  3DLN A;  1FBP A;  1JW1 A;  2O7U A;  2DE3 A;  1B7H A;  1B3L A;  5IZ3 B;  4YMA A;  1LCF A;  5B7D A;  3MVX A;  2I0B A;  3HO7 A;  5JEI A;  1B40 A;  3FD3 A;  4HS7 A;  1A54 A;  4GBW A;  3T66 A;  3OD7 A;  1SW5 A;  3E13 X;  2I3W A;  1B46 A;  5JTY A;  1B5I A;  5AA4 B;  4DI3 D;  3TQL A;  2O69 A;  3IK6 B;  4C0R A;  4FEB A;  1CNQ A;  3TUS A;  4OXV A;  1N84 A;  3I3V A;  1M5D A;  2DWJ A;  2HXR A;  4GOT A;  4MEV A;  1B32 A;  2E1S A;  1FQF A;  2H25 A;  4KD5 A;  4JSD A;  4OVQ A;  3PMW A;  4Z7E A;  3QSL A;  4I1D A;  3SET A;  1B0H A;  3H3G A;  4H65 A;  2WEF A;  4IO7 A;  1USY H;  2XXH A;  1DTZ A;  3L6H A;  1B58 A;  1KWH A;  1R6Z A;  1PB9 A;  4IY6 A;  5IKB A;  3SKP A;  4AB6 A;  2F78 A;  1YPN A;  5DVJ A;  1B7Z A;  4FEC A;  3SEX A;  3RNN A;  1SYH A;  3EHS A;  3LSX A;  3TFL A;  1BP5 A;  2QMX A;  3FJG A;  4YU0 A;  3H4Z A;  1UIV A;  3TEL A;  3ZSF A;  2WYP A;  1IXG A;  3TDJ A;  2ZXT A;  2PT2 A;  4KR5 A;  4QFN A;  1NV6 A;  2O1L A;  3O6I A;  3PPO A;  1D9V A;  3TCG A;  1NV3 A;  3OXN A;  4PET A;  3KBR A;  2FIX A;  2HAV A;  1NUX A;  4NF5 A;  5L9O A;  1INP A;  2F7A A;  3IOR A;  3O9P A;  4O3A A;  3VXB A;  2BJI A;  2DWI A;  2WBD A;  2QS3 A;  1QUK A;  4H6D A;  2DDK A;  3MW0 A;  3C31 A;  2QVR A;  2VOZ A;  4G2Z A;  2F3D A;  5TPA A;  3W9W A;  3IFC A;  1QVS A;  4EUO A;  3SEY A;  3UA8 A;  3QIM A;  4MLV A;  3CIJ A;  4P0I A;  4X04 A;  1LGB C;  4GFR A;  1NV2 A;  4KFQ A;  3T96 B;  2PFY A;  4QF9 A;  2GHA A;  3WAF A;  1MY1 A;  4GWW A;  1P1U A;  1LST A;  4K3F A;  2XXX A;  4P0G A;  5IAI A;  2OZZ A;  1Q9D A;  5F7V A;  3PPP A;  5ICT A;  1A99 A;  1Y4T A;  4PDD A;  4E0W A;  4PFU A;  4BDL A;  1GV8 A;  1AWB A;  3B6T A;  4LON B;  1BTJ A;  3C32 A;  4IB2 A;  1IMD A;  1LBY A;  3KC0 A;  4PAK A;  2HAU A;  5ET8 A;  5FBP A;  4R75 A;  1IMA A;  1R1N A;  4O7M A;  5ELV A;  3IB0 A;  4N17 A;  4PFI A;  3MC2 A;  3THI A;  2WKY A;  3QUJ A;  3IO6 A;  1MS7 A;  2OLB A;  2XWV A;  2FNC A;  3IX1 A;  3VV5 A;  1I6B A;  4X8R A;  1RDY A;  4WXJ A;  4JB7 A;  2V84 A;  3FJM A;  4AQ4 A;  5B70 A;  2ZMB A;  3H6W A;  3Q28 A;  1IME A;  4GWZ A;  1Z7M E;  4XXU A;  3N94 A;  1AH5 A;  1IUD A;  3TAJ A;  5AA1 A;  5H8H A;  4M1V A;  5ITO A;  3EF7 A;  4IO2 A;  2V3Q A;  2XXK A;  3PUZ E;  4HE0 A;  3W9V A;  3A09 A;  2DS9 A;  1Y4C A;  1O64 A;  2W7Y A;  1SVX B;  2DVZ A;  5BWJ A;  1LB9 A;  2D5W A;  3G3K A;  2X7P A;  4MX6 A;  4I8C A;  4MFI A;  2QL3 A;  5JK4 A;  3FVO A;  2HXW A;  1EZ9 A;  4FIM A;  4GX3 A;  2GFE A;  4F39 A;  4PFY A;  3K6U A;  1GR2 A;  4ZEB A;  5J16 A;  1XT8 A;  5J1D A;  5L9S A;  4JVD A;  4FED A;  2ESN A;  4C1U A;  1FBE A;  2V25 A;  2ONR A;  3KG2 A;  1G0I A;  1FW0 A;  5H8N B;  4PC9 A;  2ABH A;  1Q35 A;  1ZJL A;  1OMP A;  1MH3 A;  5A5L A;  1UIU A;  4NHB A;  3KC1 A;  4THI A;  3VXC A;  1B0L A;  1HSE A;  4BDR A;  1I6Q A;  4NMY A;  3FXR A;  1NUY A;  2ALU A;  3QUF A;  5I2N B;  3R26 A;  2XX8 A;  3IJX B;  2PMS A;  4EQ9 A;  4RPN A;  4XFE A;  3VVF A;  5DEX B;  2HHM A;  3V83 A;  1XVX A;  5BUU A;  3MP8 A;  4PBQ A;  3UK4 A;  4POX A;  3PUW E;  4ZEC A;  3FAT A;  5EYH A;  4M4G A;  2I4C A;  2G29 A;  2X26 A;  1OIB A;  3EHT A;  4P3L A;  3MVZ A;  4PP0 A;  3ECR A;  3ZKK A;  4UA8 A;  1LFH A;  4DZ1 A;  4BDO A;  3EKI A;  3MVW A;  4R2F A;  5ISU A;  4MJO A;  4ZDM A;  2D21 A;  5H8Q B;  4N8G A;  4X1D A;  1S9T A;  3Q26 A;  2FA7 A;  5K2Y A;  4RY1 A;  4MIJ A;  4P9K A;  2I48 A;  3QYT A;  1XI6 A;  3SEW A;  1FBG A;  4KCD A;  4GQO A;  2QMW A;  2Y84 A;  1UTH B;  3HHG A;  2UVJ A;  3OSR A;  5DVI A;  3DP6 A;  1J1N A;  5I57 B;  4GXA A;  2DE2 A;  4H5F A;  4F1U A;  1JQF A;  2CZI A;  2Q9T A;  2V93 A;  2ZYN A;  3UOR A;  2FIE A;  2ZYO A;  3H7M A;  2Q8J A;  4H45 A;  5H8F A;  2RC7 A;  3KFM A;  1H44 A;  5F24 A;  3N26 A;  4QHQ A;  2VP1 A;  3HFU A;  4PTK A;  3T93 B;  2IEE A;  2I3V A;  3TTM A;  4OQO A;  1H3D A;  3TZA A;  3PUX E;  2QFL A;  5M2V A;  3K2D A;  1IXH A;  2Y5L A;  4PCD A;  1YZ0 A;  5LTC A;  1B4Z A;  4EF2 A;  2VGQ A;  1FBH A;  3PPQ A;  3V89 B;  4GXS B;  3PMX A;  3IB2 A;  1MQJ A;  1N04 A;  2E0S A;  5AA2 D;  2R9J A;  3VLV A;  4N6P A;  4DE8 A;  4POW A;  4N4U A;  1IQ7 A;  3E9X A;  5JTY B;  1OQG A;  1GTK A;  5EYG A;  4F2O A;  1BLF A;  2OWS A;  3TTN A;  2KR0 A;  3ODB A;  3PUY E;  2UVI A;  2FBP A;  2DOJ A;  3O29 A;  4N91 A;  4YB7 A;  2HZL A;  5CMK A;  3V5A A;  3OEM A;  1L5T A;  4NF8 A;  1B3E A;  2OJT A;  3TMG A;  1URG A;  5TU0 A;  5CM6 A;  1FCK A;  4OWD A;  3E79 A;  2V3T A;  2VD3 A;  4DI4 B;  4R72 A;  3LSF B;  3GXA A;  3IOV A;  2VD2 A;  3OO9 A;  3K00 A;  1ZIU A;  2I4B A;  3O6G A;  2JJK A;  3RQT A;  3M8U A;  1BKA A;  2XA5 A;  3CVG A;  4NF0 A;  1CB6 A;  4ESW A;  4YZZ A;  3F11 A;  4E0X A;  3E3K A;  2XX9 A;  4KI0 E;  4AS5 A;  4F1Y A;  5CBR A;  1VDW A;  5HPQ A;  1AIV A;  5K2X A;  3OEN A;  1NH7 A;  3QAX A;  4XF5 A;  4G61 A;  1P1O A;  1VR5 A;  2XXI A;  1XVY A;  1NV1 A;  1FTK A;  3RPL A;  1USY E;  4F3S A;  2WX9 A;  4NF5 B;  1FRP A;  1FJ9 A;  2LAO A;  2Q2C A;  3T0J A;  3G3G A;  4MNP A;  2XXT A;  1NV5 A;  1FSA A;  1UTB A;  3MQ9 A;  1B3G A;  3FVN A;  2PX1 A;  4NN3 A;  5TPA B;  4U2R A;  1B05 A;  1FQD A;  3MYU A;  1FPG A;  2KLF A;  3EN3 A;  1LBC A;  4F18 A;  1FQB A;  3CHG A;  1MXY A;  2HCA A;  1FTM A;  1B5J A;  1NV0 A;  5TP9 B;  1FBD A;  4MAG A;  1QUI A;  3EHU A;  1EYI A;  2HQ0 A;  4F3G A;  3TYH A;  2OWT A;  3HHF A;  2OCU A;  1B6H A;  4X48 A;  4YKJ A;  1XC1 A;  2DXR A;  1Y3Q A;  1B1H A;  3GYY A;  1PBP A;  1FPD A;  4Q8R A;  4P1L A;  4YMB A;  4BLA A;  4QFO A;  2Z8D A;  1EU8 A;  1YCJ A;  3KSJ A;  2L5V A;  3RLF E;  3UP9 A;  4EDP A;  1PBQ A;  4G8N A;  3FXQ A;  3KJ7 A;  4U23 A;  4HCY A;  3K1N A;  4KYD A;  3TCF A;  3Q27 A;  4EQ7 A;  1Y1Z A;  4TLM B;  4OAN A;  3P7I A;  4XEQ A;  3B6Q A;  3UIF A;  4Q0C A;  1MY2 A;  4F3B A;  4O94 A;  1DSN A;  2CZK A;  3OMB A;  4GBV A;  4PF8 A;  3MWB A;  4LZ7 A;  5H8H B;  3AXF A;  4F2Q A;  1VFE A;  2XWK A;  3FV1 A;  2GH9 A;  5FHN A;  1XOC A;  3CSB A;  1D9Q A;  4LUB A;  1ZMG A;  3RT6 B;  3FGS A;  1AL3 A;  5DVF A;  3DP4 A;  1ZU0 A;  3RTF B;  4GX6 A;  1BK4 A;  1JVY A;  2FVZ A;  1IMF A;  1M5B A;  4IO6 A;  1AMF A;  4F29 A;  4RPO A;  3CG3 A;  4OHN A;  2Z22 A;  1M5C A;  1N0T A;  3K6V A;  2H9B A;  5KDT A;  3O66 A;  3KSX A;  4I3E A;  2GHB A;  3MZ9 A;  1MQH A;  1IIW A;  3FBP A;  1FPB A;  1NV4 A;  2QRY A;  2M8C A;  2H98 A;  1RDX A;  3TTK A;  4NF4 A;  4DDD A;  3IOU A;  2VT5 A;  3CR9 A;  4NGU A;  2DVC A;  2RC8 A;  1B3H A;  3BFU A;  1TXF A;  3WAE A;  3FVK A;  5ESY A;  4ONY A;  5DYH A;  3O28 A;  3TCH A;  2DSF A;  4LA9 A;  1QUL A;  3K6X A;  4JBZ A;  3MP6 A;  4XIG Q;  1QUJ A;  3VDF A;  2REJ A;  3N5L A;  1MPB A;  1QGX A;  5I2K A;  4OMB A;  4KYE A;  4PAI A;  3JYR A;  4U1Z A;  1MRP A;  1PB8 A;  2NXO A;  5I56 A;  4GRK A;  3W15 C;  3SEV A;  2Y7I A;  5DW8 A;  3LBS A;  1MQD A;  1S7Y A;  5EQ9 A;  4H8I A;  2QVU A;  5EQ8 A;  2ZZW A;  4H0W A;  1WVJ A;  4OYV A;  3VVD A;  2QS4 A;  3K0V A;  1POY 1;  4X9T A;  1MQG A;  4Q5T A;  3IAZ A;  3KOT A;  2NUV A;  1PC3 A;  3KBZ A;  5IZZ A;  1LB8 A;  4IO4 A;  1QKB A;  4ELO A;  1NUW A;  4JWO A;  3T9V A;  4LZ5 A;  4PBH A;  1DBZ A;  4ZEK A;  2HFB A;  1FTJ A;  4OET A;  1A8F A;  3S4U A;  3U8Q A;  1H45 A;  4MHF A;  1DK4 A;  4U22 A;  3FAS A;  5DTB A;  2ANJ A;  1B51 A;  4R6K A;  1MG1 A;  4R2B A;  1B2H A;  5H8F B;  2XXQ A;  1EYK A;  5AA2 B;  3LUZ A;  4H1X A;  3U1O A;  1URS A;  2F8D A;  1NUZ A;  3B6W A;  3TPA A;  3V8X B;  1SQY A;  3S9M C;  3MVY A;  2P3N A;  2XWI A;  4KCC A;  1ZLQ A;  4RYA A;  2Z8F A;  1XHY A;  2G93 A;  4IGR A;  4UAB A;  5T3J A;  4YB5 A;  4GX4 A;  4FAJ A;  5I3S A;  3PGF A;  1B4H A;  1DMB A;  1GVC A;  2XXU A;  3K1M A;  3KEI A;  4ZEF A;  3MAM A;  3H6T A;  2OWZ A;  1LLS A;  1MH4 A;  2XD3 A;  3C34 A;  5CC2 A;  4P1E A;  4WED A;  1LBV A;  5CRY A;  1Y3N A;  3FJ7 A;  1MXZ A;  2ZNT A;  1Z7N E;  3PD9 A;  2Z8E A;  4U4S A;  1MY0 A;  3D1R A;  3O2A A;  4NX1 A;  3LC8 A;  1T0K A;  3DEL B;  4ECF A;  4I62 A;  4AB5 A;  4PFR A;  2XD2 A;  2B4L A;  2RC9 A;  3OEL A;  2XXR A;  1R9Q A;  4NF8 B;  4GL8 A;  1OVB A;  2UVH A;  3RGY A;  2RCA A;  4JDF A;  3MZ1 A;  3B50 A;  3MPK A;  1LFI A;  2P3V A;  4U21 A;  2XXW A;  1NFT A;  3RTW B;  2Q74 A;  2QSX A;  4UAC A;  2A5T A;  3OO7 A;  3SER A;  5EHS A;  4JVI A;  5ITP A;  3JZJ A;  3OOA A;  2O68 A;  3LSL A;  2ONK E;  4OFJ A;  5L8D A;  1Y20 A;  4TQU Q;  1FPF A;  1MXV A;  1JET A;  2AIX A;  1DPP A;  3FXU A;  1JW4 A;  4HE2 A;  1A7L A;  1HSL A;  3G3F A;  4O3C A;  1WDN A;  2F6G A;  1FQE A;  1JVX A;  3RPL B;  3OSQ A;  1ZBM A;  4P8B A;  1QJM A;  1UQW A;  2PBW A;  4ELQ A;  1XS5 A;  1EZP A;  4EQB A;  5F1Q A;  1ELJ A;  3I5O A;  4NED A;  4EF1 A;  4F19 A;  3KGC A;  2V4C A;  3BIH A;  1LBZ A;  4GWX A;  1AOV A;  1UTB B;  4C1T A;  2ZYM A;  1BIY A;  1KA1 A;  2ZNS A;  2DP8 A;  4OTE A;  3HST A;  5IGA A;  2B4M A;  4EXL A;  3T9X B;  3RT8 A;  1B7U A;  4LVQ A;  1N7X A;  2F7C A;  3IJO B;  4O7I A;  3KN7 A;  5ET7 A;  2YLN A;  5I2N A;  1JP4 A;  3KZG A;  1LBW A;  3PD8 A;  4IO3 A;  1OQH A;  1FTA A;  1KZ8 A;  5L9M A;  4I9D A;  4U4X A;  4PGN A;  4DCY A;  3VVE A;  4KPT A;  2AL4 A;  2F34 A;  3FIR A;  3CFL A;  1YXI A;  4NF6 A;  4G8M A;  5FTI A;  1N3X A;  1EH3 A;  3R6U A;  2OK2 A;  4N07 A;  2QJE A;  5HBC A;  2UYE A;  4OVS A;  2YPN A;  4BDN A;  2F6P A;  4N6K A;  1A40 A;  3ZS6 A;  4KQP A;  1R9L A;  2Q8M A;  1FQA A;  1NH8 A;  3G3H A;  2H4I A;  3O6H A;  3FUZ A;  3Q25 A;  1FTL A;  3HV1 A;  4PFW A;  1FPE A;  3C35 A;  5EYF A;  2CMO A;  3MJN A;  3GBA A;  1Y9U A;  3T1B A;  2X7Q A;  3TOD A;  2AYS A;  3VLW A;  4GL0 A;  2O51 A;  4GWY A;  1FPK A;  1WOD A;  4OA4 A;  5FHO A;  3IR1 A;  1PB7 A;  3LSW A;  4ZE8 A;  3BKI B;  4GD5 A;  4JSO A;  3H06 B;  2KQZ A;  1B5H A;  5KCJ A;  4N81 A;  3MZB A;  1VFD A;  3D4C A;  4F3P A;  1D3K A;  3C4M A;  3N6U A;  4R6Y A;  1FPI A;  4L17 A;  5KDT B;  3MP1 A;  3JV9 A;  1Y3P A;  4QXD A;  5FTH A;  1N76 A; 
#chains in the Genus database with same CATH homology
 3U93 A;  5CMM A;  1M5E A;  1I6A A;  3H03 A;  2WYK A;  4GLI A;  4G4P A;  4DXB A;  2R6G E;  4NF4 B;  1SBP A;  4GF8 A;  4GWU A;  1DTG A;  3PTY A;  3D4G A;  3HCQ A;  3TEP A;  3PV0 E;  2GRV A;  4F22 A;  1A8E A;  2XXY A;  1MPD A;  5ET5 A;  3CFX A;  5CI5 A;  4YKK A;  1A55 A;  4PFB A;  3MPL A;  1YTV A;  5H8S A;  4H8J A;  1K9Y A;  5I2K B;  1F9B A;  1LBB A;  1NV7 A;  1O63 A;  2DWA A;  1B9J A;  3ROJ A;  5I56 B;  2DE4 A;  3GBB A;  4FJP A;  3CG1 A;  2RCB A;  4ELP A;  3BFT A;  1QKA A;  3A3U A;  2NOO A;  4GIZ A;  4NWD A;  4NWC A;  2YJP A;  2F36 A;  3KN8 A;  1NNP A;  4BDM A;  4XKQ A;  4XKP A;  4G8H A;  1P99 A;  1TFD A;  2HPG A;  5DT6 A;  3M3K A;  3K6W A;  4HW8 A;  1G0H A;  2GQ1 A;  1H43 A;  3H6V A;  1RYO A;  3BBR A;  3S9N C;  4QBA A;  3RUM A;  4MNI A;  2PT1 A;  3B7D A;  2QVV A;  2UYF A;  2XX7 A;  3ONM A;  5I59 A;  4AS4 A;  2OBG A;  4G68 A;  4JVC A;  4OFO A;  1P1N A;  3IL1 B;  5ICQ A;  5IZ1 A;  1LAH E;  4QRZ A;  3ILT B;  3SEU A;  2I0C A;  4QSD A;  3T22 A;  3ISP A;  1FQC A;  4NTL A;  4HE1 A;  4QFL A;  3VFJ A;  1FPL A;  5I58 A;  1D9Y A;  2CEY A;  2F3B A;  1I69 A;  1NNT A;  1K9Z A;  1H76 A;  4RK9 A;  4OVP A;  1RYX A;  4ZZA A;  5IM2 A;  4OES A;  3IO4 A;  4ISU A;  5A5X A;  4R74 A;  4RJZ A;  5LOM A;  1IXC A;  2NVU B;  3A29 A;  2XHD A;  3NOH A;  5IZ3 A;  2HZK A;  1ATG A;  4RXL A;  4DXU A;  1ZKB A;  1LAX A;  4F31 B;  4O8M A;  4JWX A;  2F35 A;  4QSC A;  2VPN A;  4EXK A;  2XWO A;  1MY3 A;  5AA4 A;  3QXM A;  5TP9 A;  1IMC A;  2PYY A;  2CZL A;  3DM0 A;  4OVR A;  1MQI A;  3KN3 A;  4IR8 A;  4RNS A;  1YYZ A;  3UGW A;  4IY5 A;  4N15 A;  3FXB A;  3BIG A;  1OLA A;  3HPI A;  4MH5 A;  3ZKL A;  4NE4 A;  5KZT A;  5EQA A;  3A3C A;  4H67 A;  4GVO A;  4LZ8 A;  3KOS A;  1B1X A;  4PF6 A;  3OO6 A;  2P0S A;  1LFG A;  4YIC A;  3TKD A;  1FBC A;  1FBF A;  2B65 A;  4YAH X;  1NI9 A;  1PEB A;  4PE3 A;  2A5T B;  4P11 A;  2Q88 A;  1OLC A;  2RIN A;  4WEP A;  3IFA A;  3S9L C;  3RYD A;  1SPI A;  3MUQ A;  4NQ8 A;  4DXC A;  4G68 C;  3RPW A;  1KA0 A;  3Q29 A;  2B3F A;  4F1V A;  1LAF E;  3SZP A;  3CFZ A;  2Y7K A;  2P1S A;  4KXP A;  2V3U A;  3G7W A;  4ESX A;  3TTR A;  5ET6 A;  3SDF A;  3B8B A;  5I84 A;  5AE4 A;  1IIT A;  1RDZ A;  4KYS A;  3IOW A;  4N13 A;  4OVJ A;  4R6H A;  4R9G A;  2I6E A;  2FYI A;  1LBX A;  5LDZ A;  4DCX A;  3VE1 B;  4OFL A;  3TTL A;  4ZS9 A;  2FHY A;  4OER A;  1SW1 A;  1MXX A;  4MBP A;  4P47 A;  2DXY A;  3U72 A;  2CZH A;  3OO8 A;  3FZV A;  1IZ1 A;  1II5 A;  1TT1 A;  3SES A;  5CMB A;  2Q89 A;  3C36 A;  1NNK A;  4O3B A;  1US4 A;  2B3B A;  4LP2 B;  3CSG A;  2RKM A;  3GLB A;  1MDP 1;  4LQ5 A;  1SI0 A;  2RF1 A;  3EQ1 A;  2QS2 A;  1SW4 A;  4OVT A;  4TLL B;  4HXV A;  4JXI A;  4H5G A;  3CRB A;  2CEX A;  1FTO A;  4NG7 A;  3E78 A;  3LUY A;  2I58 A;  4RA1 A;  1QW0 A;  4DIG A;  4FOR A;  3PPR A;  2XXV A;  4IGT A;  3RN8 A;  1MM6 A;  1VSO A;  4NF6 B;  3LR1 A;  1MXW A;  1US5 A;  4YKP A;  2H99 A;  1IXI A;  2O7I A;  1B52 A;  1TWY A;  3PMV A;  4I3Y A;  3K01 A;  4XTC Q;  4MLQ A;  5HM4 B;  1PDA A;  4MF3 A;  1IMB A;  2QS1 A;  1NNF A;  1O7T A;  2VHA A;  2DQV A;  4OEV A;  3M3F A;  5EQ7 A;  3TQW A;  2Q2A A;  5FHM A;  2MKZ A;  5I5P A;  1CE2 A;  1SDX A;  1FJ6 A;  4ELR A;  2ZYK A;  2F97 A;  1MY4 A;  1HSJ A;  3S9E A;  1NMU A;  5CBS A;  4JWY A;  2ZZV A;  4YB6 A;  4Z0I A;  4QFP A;  3O97 A;  2A5S A;  4XKN A;  3R7X A;  1VE4 A;  4GWS A;  1DPE A;  4ZZE A;  4OZ9 A;  4LN5 A;  2NWJ A;  1MPC A;  1S50 A;  2I49 A;  3I6V A;  1GGG A;  1M5F A;  2O1M A;  3VLU A;  3C33 A;  5CMC A;  5AA2 A;  1DOT A;  4FAT A;  1SI1 A;  5KCJ B;  4ZEI A;  4HTG A;  4I40 A;  2VPO A;  2REG A;  1NKX A;  2Y7P A;  2AL5 A;  2H5Y A;  4ND9 A;  2Y5K A;  4X1B A;  4R73 A;  2QPQ A;  4MCO A;  5H8N A;  1TFA A;  1MDQ A;  1SYI A;  4MNC A;  2Z23 A;  3K1P A;  3HN0 A;  3PU5 A;  4FBP A;  1LAG E;  3ILU B;  2PFZ A;  3DP8 A;  2ZZX A;  3L6G A;  4YKI A;  3U65 A;  4LAT A;  3USD A;  2HEU A;  2R8T A;  2THI A;  4Q30 B;  1D4N A;  3MBP A;  2DYX A;  3CI8 A;  3K02 A;  5DEX A;  1NL5 A;  3U94 A;  3IOT A;  4WKM A;  1MM7 A;  5I7I A;  4OEN A;  4ZED A;  3LV0 A;  4PQJ A;  4TOZ A;  2O84 X;  2XXP A;  1N7W A;  1YAE A;  4PE5 B;  5EHM A;  4BDQ A;  2P2A A;  1JNF A;  3IB1 A;  3T9U A;  4KHZ E;  1OVT A;  3C9H A;  1P1Q A;  4QSE A;  3UN6 A;  1Q1K A;  3OEK A;  1Y1M A;  4U1O A;  4PDH A;  4GWO A;  3EPE A;  2PVU A;  1SW2 A;  3G3I A;  3T9H B;  5AA3 A;  3FV2 A;  4NAP A;  3KJT A;  1SD3 A;  1LEV A;  2IA4 A;  5H8Q A;  4IO5 A;  4RK2 A;  1EYJ A;  1LCT A;  2UXA A;  1IEJ A;  2Y7W A;  1JEU A;  2UVG A;  3U92 A;  3MST A;  4PAF A;  4H46 A;  2D3I A;  2F7B A;  3RY3 A;  2O6A A;  1POT A;  4OEU A;  3GZG A;  3G3J A;  3QMF A;  1UTH A;  2ZNU A;  5I59 B;  1ANF A;  1URD A;  3M3L A;  5I57 A;  4G68 B;  1EZO A;  2PCR A;  3E4R A;  3H6U A;  3FVG A;  2WBB A;  1N3W A;  2F5X A;  3K4U A;  4MMP A;  2DWH A;  1JW5 A;  1P1W A;  4ZE9 A;  4N8Y A;  2Y7R A;  3S2V A;  1MXU A;  4PFT A;  4FE8 A;  4XKR A;  4HCW A;  4QFK A;  4LQ2 A;  5I58 B;  2R71 A;  4P56 A;  4G77 A;  1DCU A;  4N6D A;  3QK6 A;  1JEV A;  3PPN A;  1B3F A;  3PUV E;  4PGP A;  4R9F A;  2OX3 A;  2BJJ X;  1ZTY A;  3N6T A;  4DLD A;  1FPJ A;  2ONS A;  5A5X B;  1RKM A;  3DLN A;  1FBP A;  1JW1 A;  2O7U A;  2DE3 A;  1B7H A;  1B3L A;  5IZ3 B;  4YMA A;  1LCF A;  5B7D A;  3MVX A;  2I0B A;  3HO7 A;  5JEI A;  1B40 A;  3FD3 A;  4HS7 A;  1A54 A;  4GBW A;  3T66 A;  3OD7 A;  1SW5 A;  3E13 X;  2I3W A;  1B46 A;  5JTY A;  1B5I A;  5AA4 B;  4DI3 D;  3TQL A;  2O69 A;  3IK6 B;  4C0R A;  4FEB A;  3TUS A;  1CNQ A;  4OXV A;  1N84 A;  3I3V A;  1M5D A;  2DWJ A;  2HXR A;  4GOT A;  4MEV A;  1B32 A;  2E1S A;  1FQF A;  2H25 A;  4KD5 A;  4JSD A;  4OVQ A;  3PMW A;  4Z7E A;  3QSL A;  4I1D A;  3SET A;  1B0H A;  3H3G A;  4H65 A;  2WEF A;  4IO7 A;  1USY H;  2XXH A;  1DTZ A;  3L6H A;  1B58 A;  1KWH A;  1R6Z A;  1PB9 A;  4IY6 A;  5IKB A;  3SKP A;  4AB6 A;  2F78 A;  1YPN A;  5DVJ A;  1B7Z A;  4FEC A;  3SEX A;  3RNN A;  1SYH A;  3EHS A;  3LSX A;  3TFL A;  1BP5 A;  2QMX A;  3FJG A;  4YU0 A;  3H4Z A;  1UIV A;  3TEL A;  3ZSF A;  2WYP A;  1IXG A;  3TDJ A;  2ZXT A;  2PT2 A;  4KR5 A;  4QFN A;  1NV6 A;  2O1L A;  3O6I A;  3PPO A;  1D9V A;  3TCG A;  1NV3 A;  3OXN A;  4PET A;  3KBR A;  2FIX A;  2HAV A;  1NUX A;  4NF5 A;  5L9O A;  2F7A A;  1INP A;  3IOR A;  3O9P A;  4O3A A;  3VXB A;  2BJI A;  2DWI A;  2WBD A;  2QS3 A;  1QUK A;  4H6D A;  2DDK A;  3MW0 A;  3C31 A;  2QVR A;  2VOZ A;  4G2Z A;  3W9W A;  5TPA A;  2F3D A;  4EUO A;  1QVS A;  3IFC A;  3SEY A;  3UA8 A;  3QIM A;  4MLV A;  3CIJ A;  4P0I A;  4X04 A;  1LGB C;  4GFR A;  1NV2 A;  4KFQ A;  3T96 B;  2PFY A;  4QF9 A;  2GHA A;  3WAF A;  1MY1 A;  4GWW A;  1P1U A;  1LST A;  4K3F A;  2XXX A;  4P0G A;  5IAI A;  2OZZ A;  5F7V A;  1Q9D A;  3PPP A;  5ICT A;  1A99 A;  1Y4T A;  4E0W A;  4PDD A;  4PFU A;  4BDL A;  1GV8 A;  1AWB A;  3B6T A;  4LON B;  1BTJ A;  3C32 A;  4IB2 A;  1IMD A;  1LBY A;  3KC0 A;  4PAK A;  2HAU A;  5ET8 A;  5FBP A;  4R75 A;  1IMA A;  1R1N A;  4O7M A;  5ELV A;  3IB0 A;  4N17 A;  4PFI A;  3MC2 A;  3THI A;  2WKY A;  3QUJ A;  3IO6 A;  1MS7 A;  2OLB A;  2XWV A;  2FNC A;  3IX1 A;  3VV5 A;  1I6B A;  4X8R A;  1RDY A;  4WXJ A;  4JB7 A;  2V84 A;  3FJM A;  4AQ4 A;  5B70 A;  2ZMB A;  3H6W A;  3Q28 A;  1IME A;  4GWZ A;  1Z7M E;  4XXU A;  3N94 A;  1AH5 A;  1IUD A;  3TAJ A;  5AA1 A;  5H8H A;  4M1V A;  5ITO A;  3EF7 A;  4IO2 A;  2V3Q A;  2XXK A;  3PUZ E;  3W9V A;  4HE0 A;  3A09 A;  2DS9 A;  1Y4C A;  1O64 A;  2W7Y A;  1SVX B;  2DVZ A;  5BWJ A;  1LB9 A;  2D5W A;  3G3K A;  2X7P A;  4MX6 A;  4I8C A;  4MFI A;  2QL3 A;  5JK4 A;  3FVO A;  2HXW A;  1EZ9 A;  4FIM A;  4GX3 A;  2GFE A;  4F39 A;  4PFY A;  3K6U A;  1GR2 A;  4ZEB A;  5J16 A;  1XT8 A;  5J1D A;  5L9S A;  4JVD A;  4FED A;  2ESN A;  4C1U A;  1FBE A;  2V25 A;  2ONR A;  3KG2 A;  1G0I A;  1FW0 A;  5H8N B;  4PC9 A;  2ABH A;  1Q35 A;  1ZJL A;  1OMP A;  1MH3 A;  5A5L A;  1UIU A;  4NHB A;  3KC1 A;  4THI A;  3VXC A;  1B0L A;  1HSE A;  4BDR A;  1I6Q A;  4NMY A;  3FXR A;  2ALU A;  1NUY A;  3QUF A;  5I2N B;  3R26 A;  2XX8 A;  3IJX B;  2PMS A;  4EQ9 A;  4RPN A;  3VVF A;  4XFE A;  5DEX B;  2HHM A;  3V83 A;  1XVX A;  5BUU A;  3MP8 A;  4PBQ A;  3UK4 A;  4POX A;  3PUW E;  4ZEC A;  3FAT A;  5EYH A;  4M4G A;  2I4C A;  2G29 A;  2X26 A;  1OIB A;  3EHT A;  4P3L A;  3MVZ A;  4PP0 A;  3ECR A;  3ZKK A;  4UA8 A;  1LFH A;  4DZ1 A;  4BDO A;  3EKI A;  3MVW A;  4R2F A;  5ISU A;  4ZDM A;  4MJO A;  2D21 A;  5H8Q B;  4N8G A;  4X1D A;  1S9T A;  3Q26 A;  2FA7 A;  5K2Y A;  4RY1 A;  4MIJ A;  4P9K A;  2I48 A;  3QYT A;  1XI6 A;  3SEW A;  1FBG A;  4KCD A;  4GQO A;  2QMW A;  2Y84 A;  1UTH B;  3HHG A;  2UVJ A;  3OSR A;  5DVI A;  3DP6 A;  1J1N A;  5I57 B;  4GXA A;  2DE2 A;  4H5F A;  4F1U A;  1JQF A;  2Q9T A;  2CZI A;  2V93 A;  2ZYN A;  3UOR A;  2FIE A;  2ZYO A;  3H7M A;  2Q8J A;  4H45 A;  5H8F A;  2RC7 A;  3KFM A;  1H44 A;  5F24 A;  3N26 A;  4QHQ A;  2VP1 A;  3HFU A;  4PTK A;  3T93 B;  2IEE A;  2I3V A;  3TTM A;  4OQO A;  1H3D A;  3TZA A;  3PUX E;  2QFL A;  5M2V A;  3K2D A;  1IXH A;  2Y5L A;  4PCD A;  1YZ0 A;  5LTC A;  1B4Z A;  4EF2 A;  2VGQ A;  1FBH A;  3PPQ A;  3V89 B;  4GXS B;  3PMX A;  3IB2 A;  1MQJ A;  1N04 A;  2E0S A;  5AA2 D;  2R9J A;  3VLV A;  4N6P A;  4DE8 A;  4POW A;  4N4U A;  1IQ7 A;  3E9X A;  5JTY B;  1OQG A;  1GTK A;  5EYG A;  4F2O A;  1BLF A;  2OWS A;  3TTN A;  2KR0 A;  3ODB A;  3PUY E;  2UVI A;  2FBP A;  2DOJ A;  3O29 A;  4N91 A;  4YB7 A;  2HZL A;  5CMK A;  3V5A A;  3OEM A;  1L5T A;  4NF8 A;  1B3E A;  2OJT A;  3TMG A;  1URG A;  5TU0 A;  5CM6 A;  1FCK A;  4OWD A;  3E79 A;  2V3T A;  2VD3 A;  4DI4 B;  4R72 A;  3LSF B;  3GXA A;  3IOV A;  2VD2 A;  3OO9 A;  3K00 A;  1ZIU A;  2I4B A;  3O6G A;  2JJK A;  3RQT A;  3M8U A;  1BKA A;  2XA5 A;  3CVG A;  4NF0 A;  1CB6 A;  4ESW A;  4YZZ A;  3F11 A;  4E0X A;  3E3K A;  2XX9 A;  4KI0 E;  4AS5 A;  4F1Y A;  5CBR A;  1VDW A;  5HPQ A;  1AIV A;  5K2X A;  3OEN A;  1NH7 A;  3QAX A;  4XF5 A;  4G61 A;  1P1O A;  1VR5 A;  2XXI A;  1XVY A;  1NV1 A;  1FTK A;  3RPL A;  1USY E;  4F3S A;  2WX9 A;  4NF5 B;  1FRP A;  1FJ9 A;  2LAO A;  2Q2C A;  3T0J A;  3G3G A;  4MNP A;  2XXT A;  1NV5 A;  1FSA A;  1UTB A;  3MQ9 A;  1B3G A;  3FVN A;  2PX1 A;  5TPA B;  4NN3 A;  4U2R A;  1B05 A;  1FQD A;  3MYU A;  1FPG A;  2KLF A;  3EN3 A;  1LBC A;  4F18 A;  1FQB A;  3CHG A;  1MXY A;  2HCA A;  1FTM A;  1B5J A;  1NV0 A;  5TP9 B;  1FBD A;  4MAG A;  1QUI A;  3EHU A;  1EYI A;  2HQ0 A;  4F3G A;  3TYH A;  2OWT A;  3HHF A;  2OCU A;  1B6H A;  4X48 A;  4YKJ A;  1XC1 A;  2DXR A;  1Y3Q A;  1B1H A;  3GYY A;  1PBP A;  1FPD A;  4Q8R A;  4P1L A;  4YMB A;  4BLA A;  4QFO A;  2Z8D A;  1EU8 A;  1YCJ A;  3KSJ A;  2L5V A;  3RLF E;  3UP9 A;  4EDP A;  1PBQ A;  4G8N A;  3FXQ A;  3KJ7 A;  4U23 A;  4HCY A;  3K1N A;  4KYD A;  3TCF A;  3Q27 A;  4EQ7 A;  1Y1Z A;  4TLM B;  4OAN A;  3P7I A;  4XEQ A;  3B6Q A;  3UIF A;  4Q0C A;  1MY2 A;  4F3B A;  4O94 A;  1DSN A;  3OMB A;  2CZK A;  4GBV A;  4PF8 A;  3MWB A;  4LZ7 A;  5H8H B;  3AXF A;  4F2Q A;  1VFE A;  3FV1 A;  2XWK A;  2GH9 A;  5FHN A;  1XOC A;  3CSB A;  1D9Q A;  4LUB A;  1ZMG A;  3RT6 B;  3FGS A;  1AL3 A;  5DVF A;  3DP4 A;  1ZU0 A;  3RTF B;  4GX6 A;  1BK4 A;  1JVY A;  2FVZ A;  1M5B A;  1IMF A;  4IO6 A;  1AMF A;  4F29 A;  4RPO A;  3CG3 A;  4OHN A;  2Z22 A;  1M5C A;  1N0T A;  3K6V A;  2H9B A;  5KDT A;  3O66 A;  3KSX A;  4I3E A;  2GHB A;  3MZ9 A;  1MQH A;  1IIW A;  3FBP A;  1FPB A;  1NV4 A;  2QRY A;  2M8C A;  2H98 A;  1RDX A;  3TTK A;  4NF4 A;  4DDD A;  3IOU A;  3CR9 A;  2VT5 A;  4NGU A;  2DVC A;  2RC8 A;  1B3H A;  3BFU A;  1TXF A;  3WAE A;  3FVK A;  5ESY A;  4ONY A;  5DYH A;  3O28 A;  3TCH A;  2DSF A;  4LA9 A;  1QUL A;  3K6X A;  4JBZ A;  3MP6 A;  4XIG Q;  1QUJ A;  3VDF A;  2REJ A;  3N5L A;  1MPB A;  1QGX A;  5I2K A;  4OMB A;  4KYE A;  4PAI A;  3JYR A;  4U1Z A;  1MRP A;  1PB8 A;  2NXO A;  5I56 A;  4GRK A;  3W15 C;  3SEV A;  2Y7I A;  5DW8 A;  3LBS A;  1MQD A;  1S7Y A;  5EQ9 A;  4H8I A;  2QVU A;  5EQ8 A;  2ZZW A;  4H0W A;  1WVJ A;  4OYV A;  3VVD A;  2QS4 A;  3K0V A;  1POY 1;  4X9T A;  1MQG A;  4Q5T A;  3IAZ A;  3KOT A;  2NUV A;  1PC3 A;  3KBZ A;  5IZZ A;  1LB8 A;  4IO4 A;  1QKB A;  4ELO A;  1NUW A;  4JWO A;  3T9V A;  4LZ5 A;  4PBH A;  1DBZ A;  4ZEK A;  2HFB A;  1FTJ A;  4OET A;  1A8F A;  3S4U A;  3U8Q A;  1H45 A;  4MHF A;  1DK4 A;  4U22 A;  3FAS A;  5DTB A;  2ANJ A;  1B51 A;  4R6K A;  1MG1 A;  4R2B A;  1B2H A;  5H8F B;  2XXQ A;  1EYK A;  5AA2 B;  3LUZ A;  4H1X A;  3U1O A;  1URS A;  2F8D A;  1NUZ A;  3B6W A;  3TPA A;  3V8X B;  1SQY A;  3S9M C;  3MVY A;  2P3N A;  2XWI A;  4KCC A;  1ZLQ A;  4RYA A;  2Z8F A;  1XHY A;  2G93 A;  4IGR A;  4UAB A;  5T3J A;  4YB5 A;  4GX4 A;  4FAJ A;  5I3S A;  3PGF A;  1B4H A;  1DMB A;  1GVC A;  2XXU A;  3K1M A;  3KEI A;  4ZEF A;  3MAM A;  3H6T A;  2OWZ A;  1LLS A;  1MH4 A;  2XD3 A;  3C34 A;  5CC2 A;  4P1E A;  4WED A;  1LBV A;  5CRY A;  1Y3N A;  3FJ7 A;  1MXZ A;  2ZNT A;  1Z7N E;  3PD9 A;  2Z8E A;  4U4S A;  1MY0 A;  3D1R A;  3O2A A;  4NX1 A;  3LC8 A;  1T0K A;  3DEL B;  4ECF A;  4I62 A;  4AB5 A;  4PFR A;  2XD2 A;  2B4L A;  2RC9 A;  3OEL A;  2XXR A;  1R9Q A;  4NF8 B;  4GL8 A;  1OVB A;  2UVH A;  3RGY A;  2RCA A;  4JDF A;  3MZ1 A;  3B50 A;  3MPK A;  1LFI A;  2P3V A;  4U21 A;  2XXW A;  1NFT A;  3RTW B;  2Q74 A;  2QSX A;  4UAC A;  2A5T A;  3OO7 A;  3SER A;  5EHS A;  4JVI A;  5ITP A;  3JZJ A;  3OOA A;  2O68 A;  3LSL A;  2ONK E;  4OFJ A;  5L8D A;  1Y20 A;  4TQU Q;  1FPF A;  1MXV A;  1JET A;  2AIX A;  1DPP A;  3FXU A;  1JW4 A;  4HE2 A;  1A7L A;  1HSL A;  3G3F A;  4O3C A;  1WDN A;  2F6G A;  1FQE A;  1JVX A;  3RPL B;  3OSQ A;  1ZBM A;  4P8B A;  1QJM A;  1UQW A;  2PBW A;  4ELQ A;  1XS5 A;  1EZP A;  4EQB A;  5F1Q A;  1ELJ A;  3I5O A;  4NED A;  4EF1 A;  4F19 A;  3KGC A;  2V4C A;  3BIH A;  1LBZ A;  1AOV A;  4GWX A;  1UTB B;  4C1T A;  2ZYM A;  1BIY A;  1KA1 A;  2ZNS A;  2DP8 A;  4OTE A;  3HST A;  5IGA A;  2B4M A;  4EXL A;  3T9X B;  3RT8 A;  1B7U A;  4LVQ A;  1N7X A;  2F7C A;  3IJO B;  4O7I A;  3KN7 A;  5ET7 A;  2YLN A;  5I2N A;  1JP4 A;  3KZG A;  3PD8 A;  1LBW A;  4IO3 A;  1OQH A;  1FTA A;  1KZ8 A;  5L9M A;  4I9D A;  4U4X A;  4PGN A;  4DCY A;  3VVE A;  4KPT A;  2AL4 A;  2F34 A;  3FIR A;  3CFL A;  4NF6 A;  1YXI A;  4G8M A;  5FTI A;  1N3X A;  1EH3 A;  3R6U A;  2OK2 A;  4N07 A;  2QJE A;  5HBC A;  2UYE A;  4OVS A;  2YPN A;  4BDN A;  2F6P A;  4N6K A;  1A40 A;  3ZS6 A;  4KQP A;  1R9L A;  2Q8M A;  1FQA A;  1NH8 A;  3G3H A;  2H4I A;  3O6H A;  3FUZ A;  3Q25 A;  1FTL A;  3HV1 A;  4PFW A;  1FPE A;  3C35 A;  5EYF A;  2CMO A;  3MJN A;  3GBA A;  1Y9U A;  3T1B A;  2X7Q A;  3TOD A;  2AYS A;  3VLW A;  4GL0 A;  2O51 A;  4GWY A;  1FPK A;  1WOD A;  5FHO A;  4OA4 A;  3IR1 A;  1PB7 A;  3LSW A;  4ZE8 A;  3BKI B;  4GD5 A;  4JSO A;  3H06 B;  2KQZ A;  1B5H A;  5KCJ A;  4N81 A;  3MZB A;  1VFD A;  3D4C A;  4F3P A;  1D3K A;  3C4M A;  3N6U A;  4R6Y A;  1FPI A;  4L17 A;  5KDT B;  3MP1 A;  3JV9 A;  1Y3P A;  4QXD A;  5FTH A;  1N76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...