2HZLA

Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
334
structure length
334
Chain Sequence
VTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding, transport protein
molecule keywords TRAP-T family sorbitol/mannitol transporter, periplasmic bin
publication title Crystal structures of an Extracytoplasmic Solute Receptor from a TRAP transporter in its open and closed forms reveal a helix-swapped dimer requiring a cation for alpha-keto acid binding.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
total genus 124
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hzlA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hzlA01
4MAGA 3RT8A 1P1WA 3IAZA 1EZ9A 3PUZE 3C33A 3UA8A 2F35A 5ITOA 4ECFA 3MZBA 1Y3NA 3OMBA 3PPOA 3DELB 1R9QA 1ATGA 2AL4A 4F3GA 1LBCA 4KD5A 3CIJA 1WODA 4ELOA 4ZS9A 5A5XB 4P9KA 4F18A 3Q27A 3OO6A 3EN3A 1EU8A 3RTFB 3H3GA 3KOTA 4IO7A 3FD3A 1H44A 4PBQA 5AA2B 4OHNA 3VVFA 3AXFA 3K4UA 4MNIA 3G3JA 4YKPA 1B52A 1BTJA 4Q8RA 4OVSA 3TCFA 4X8RA 1QVSA 3U72A 1NH8A 4MFIA 2HZLA 4FIMA 4G8HA 1MM6A 4U1OA 1US4A 4ZE8A 1DMBA 1B4HA 4KQPA 5L9SA 1SI1A 1LCTA 2OWSA 2GH9A 4O7MA 3F11A 1TFDA 1MQIA 4IGRA 4XKRA 3FVNA 2H99A 1MY4A 1N3WA 2FA7A 4NQ8A 4JBZA 1JW4A 4GL8A 3B7DA 2H4IA 3B6QA 1POY1 1M5CA 4G77A 1LFHA 5A5XA 3IB0A 3KJ7A 4QF9A 5I84A 4H8IA 3TTNA 5KCJB 1R6ZA 3HN0A 5CMCA 3K1PA 4PBHA 3U65A 3O6IA 4MIJA 2I48A 4Z0IA 4H8JA 3LSXA 4YU0A 2DOJA 1II5A 3TEPA 4PFUA 4PETA 3Q29A 4UA8A 4PE3A 4NEDA 4OVRA 2RC8A 4JB7A 4QFLA 3OELA 3LUYA 3BBRA 1DOTA 1MXXA 3MP6A 1HSEA 3CVGA 3UIFA 1DPPA 3OO9A 1TT1A 1P1OA 2YPNA 2Z8FA 2GHBA 4N8YA 5FTIA 4PFRA 3ZKLA 4FECA 1H45A 3HPIA 3QUJA 4PGNA 4BLAA 5I58B 4UABA 1LAXA 1AMFA 4RY1A 1POTA 5CBRA 4PE5B 3QUFA 4YAHX 4DXBA 2V25A 3C35A 4BDNA 3RT6B 2Q89A 1MDQA 1QW0A 4EQBA 1R9LA 1JEUA 4JWYA 5KCJA 5AA2D 3VLVA 3TTMA 1B6HA 1N04A 1MQGA 1B1HA 4X48A 2PVUA 2PX1A 1TWYA 2I4CA 3DP6A 2RCBA 3PPPA 2DP8A 2R9JA 3GXAA 2BJJX 3PU5A 3LSFB 3OD7A 3OENA 1AOVA 3FGSA 4THIA 2F8DA 3H4ZA 4I62A 4G68B 3T9UA 4R9GA 4IO2A 3K01A 2Q2CA 2AYSA 4Q5TA 3IORA 1JVYA 4RPOA 5L9MA 1A54A 1XS5A 1VSOA 4QFOA 3GYYA 1Y1ZA 2XXPA 2XA5A 1MG1A 1KWHA 4MBPA 3UGWA 1JQFA 4PFTA 3ZKKA 2XXXA 1YPNA 2B65A 2OZZA 2XXQA 1HSJA 3THIA 3C36A 3TQLA 5HBCA 4M4GA 2WYPA 3KG2A 2ZYNA 1UQWA 3MP8A 4R73A 3CR9A 2Y84A 1VE4A 2XX8A 2O6AA 3TELA 5ICTA 4Q30B 3SESA 5HPQA 5DT6A 3FATA 1US5A 2DVZA 1ZKBA 3SERA 1IXIA 1UIVA 3FVOA 4N4UA 3EHSA 1ZTYA 2QS1A 3FZVA 4LVQA 1EH3A 3ZS6A 2PYYA 4QFKA 3RY3A 3OOAA 1UTBB 1NH7A 3C34A 3O29A 1B32A 2HXWA 4O8MA 2I3WA 1LSTA 4G2ZA 2ZXTA 4HS7A 2P2AA 4QSEA 3UORA 3EQ1A 3IK6B 2R71A 1FTMA 5I2KB 1Z7NE 2QSXA 4F1YA 2XWIA 5CBSA 4N13A 4Z7EA 3M8UA 3OEKA 3L6HA 2NXOA 4IO5A 3HCQA 4R75A 2IA4A 1QUJA 3MQ9A 1QKBA 2O51A 2F5XA 2GHAA 3T93B 4NWCA 3T96B 4LA9A 5BUUA 1A7LA 1FTOA 3E4RA 3K6XA 3FJMA 4DE8A 1T0KA 3KFMA 2OK2A 2REJA 3N6UA 4DCYA 4FEBA 2VPNA 4U22A 1M5BA 5JEIA 4H1XA 4R2FA 2G93A 4YMBA 2H5YA 2X7QA 4AB5A 3RNNA 2FYIA 3SEXA 3O97A 1PB9A 4F3BA 1P1NA 3FIRA 5AA3A 1MPBA 3ILUB 3ILTB 1BP5A 4PDHA 3GLBA 4JXIA 1RYOA 1MY1A 4Q0CA 1R1NA 2V4CA 1XHYA 1B0LA 1ANFA 2F34A 4N91A 4PP0A 4MHFA 5H8NB 3MPLA 1URDA 3A3CA 3FJ7A 5I2KA 4YZZA 1N76A 2HPGA 5LTCA 4PAIA 4OVPA 1VR5A 3QAXA 1Y1MA 4ESWA 4ND9A 3IOUA 1LGBC 4X1DA 4YKJA 4N17A 1PBPA 5B7DA 1J1NA 3TUSA 2KLFA 3QIMA 4N6DA 1GGGA 3MZ9A 3DP4A 5JTYB 2DE4A 2OWTA 1TFAA 1MY2A 3H03A 4O3BA 3TQWA 2XWKA 3MWBA 4ZEDA 1GV8A 4GRKA 3HO7A 4ZZEA 1LB9A 5AA4B 2QS2A 4NF4B 3MUQA 3IX1A 1LBBA 1LAGE 2PBWA 4LN5A 2V84A 5I59B 2PFYA 3ONMA 1DTZA 3CG1A 1B3GA 2O1LA 3RGYA 4HW8A 1AH5A 4F39A 4EQ7A 5H8NA 1IUDA 3N94A 1A8EA 5FHMA 4POXA 3U8QA 2D3IA 2F36A 4F2OA 3RLFE 3K00A 1FQAA 2DXRA 1ZIUA 3TZAA 2V3UA 2QS4A 2HZKA 2VHAA 3V5AA 2LAOA 3G3GA 2PT2A 3K6WA 3B6WA 1I6AA 1CE2A 4OZ9A 3QSLA 4U2RA 5JTYA 4YB5A 4XKNA 4PFYA 5H8QA 4LZ8A 5TPAA 5TP9A 4AB6A 2OBGA 3FASA 4ZEIA 4LONB 5AA4A 4NF4A 1ZBMA 5I2NB 4BDLA 4RK9A 2Z8DA 1SDXA 1S7YA 3KZGA 3PGFA 5ITPA 1O7TA 3FXQA 4LZ5A 1M5FA 4I8CA 3KN7A 3QYTA 4TOZA 1A99A 1B5IA 3L6GA 5I59A 3W15C 3N5LA 4X1BA 2XXKA 2B3BA 2PFZA 2I0BA 4JDFA 2XXIA 3SDFA 2Q88A 2NUVA 4LZ7A 3SEYA 2F97A 4ZEFA 3TTLA 5H8SA 5DEXB 1B9JA 4GIZA 1GTKA 5AA2A 2UXAA 3OXNA 2XXWA 3OO8A 4RA1A 4ISUA 3RTWB 5H8HB 2RC7A 2XX7A 1MS7A 4X9TA 2ESNA 3R26A 1LFIA 3JYRA 1MXUA 3I3VA 4QFNA 1MQHA 3TYHA 5CRYA 2IEEA 2Z8EA 3A3UA 4R9FA 2F7BA 4ZDMA 2DWIA 1B1XA 1NKXA 1NMUA 4OENA 4LP2B 2UVJA 1JVXA 4L17A 4EXLA 3TCHA 1N3XA 2Q8JA 2A5SA 4KCCA 1IEJA 5I2NA 1PB7A 4MNPA 1N7WA 2QJEA 2NWJA 1A40A 1YAEA 1O64A 1I6BA 1B58A 4IO3A 2R6GE 3FV2A 1SW2A 5KDTB 3K02A 4I1DA 3V83A 5DTBA 1D9VA 4HCWA 4OYVA 3MJNA 4PFWA 2XD3A 2ZNSA 3MBPA 1A55A 3H6TA 3IOWA 3MAMA 1QUKA 4ELQA 1AIVA 3FXUA 4PFIA 4FJPA 4OVQA 2DWAA 4FATA 2HAUA 1FQEA 4K3FA 4MEVA 2O7UA 5I56B 4KCDA 3VFJA 1FTKA 3PMVA 2F78A 2CZLA 1SW4A 4NWDA 2QPQA 1SW1A 4GL0A 3BKIB 4ZEKA 5FHOA 4U21A 3LR1A 4PAKA 3CSGA 4YB6A 2HCAA 1B3LA 5JK4A 2O1MA 4BDQA 1NL5A 3SEWA 5CC2A 3N26A 5I58A 5DVIA 4IO6A 5M2VA 4RPNA 3PUVE 1B5HA 1JW5A 3TFLA 3IB1A 1XVYA 3RN8A 4XXUA 3K6UA 5KDTA 5F1QA 4MX6A 3UK4A 4GQOA 2HEUA 2VOZA 1FTLA 1IIWA 4TLLB 3KN3A 3E3KA 4WEDA 2VD3A 1D9YA 1B2HA 3O6HA 4G68C 4U1ZA 5IAIA 5EYFA 3DM0A 1N0TA 1ZU0A 4PAFA 5I57B 1YCJA 3PV0E 3D4GA 1NNPA 4GFRA 1MDP1 4GF8A 3VVDA 4P8BA 4ELPA 5I56A 1FQDA 3KSXA 3K1NA 1Y9UA 2Y7IA 2ZZXA 1YTVA 1O63A 3GBAA 5DVFA 4G68A 4O3AA 1I69A 2GFEA 4P56A 4QFPA 3PMWA 3OO7A 2P0SA 4OVTA 1SVXB 1B4ZA 4WEPA 3EHTA 2XXYA 3HHGA 4R74A 1OQGA 3S4UA 1MY3A 2DXYA 4OXVA 4FEDA 2O69A 5ELVA 3BFTA 2ZZWA 2V3TA 4H5GA 1OLAA 1Z7ME 3HHFA 2XXVA 4XKPA 1MXVA 1Q35A 4NF8B 2A5TB 4G4PA 3C4MA 1MQDA 2Z23A 2RCAA 2AL5A 4R6YA 4FE8A 3BFUA 1IXHA 4OFOA 5EHSA 1ELJA 2O84X 5I7IA 4OTEA 3MPKA 5J1DA 2VD2A 4OVJA 4RNSA 4F2QA 5CMMA 5I57A 2XXHA 3CG3A 4UACA 4BDRA 1SW5A 3E13X 2I49A 3W9VA 1D3KA 1MRPA 2ONKE 1XT8A 5AA1A 1MM7A 1D4NA 4EXKA 3VXBA 4HCYA 2DSFA 2AIXA 4H65A 2XXUA 3PPNA 3S9LC 1FQFA 4IY5A 3KEIA 4OESA 1LAFE 1WVJA 4EF1A 3H6VA 1UTBA 1Y3PA 4OERA 2DWJA 2CEXA 3VV5A 3JV9A 4JWOA 5FTHA 3IR1A 3S9NC 1AL3A 1B7UA 1IZ1A 1I6QA 1MPCA 1OLCA 3MVXA 3N6TA 3FUZA 5K2XA 2H98A 4IB2A 3FJGA 3CFXA 4DLDA 4P0GA 3ZSFA 3CFLA 3USDA 3V8XB 3GZGA 4RXLA 3M3FA 3PPQA 4PDDA 3M3LA 2THIA 3U94A 3TDJA 4NF8A 5I5PA 1H43A 3C9HA 4C1UA 3TTKA 3TPAA 4GVOA 2CMOA 3GBBA 1DSNA 5CMBA 1PB8A 4PF6A 2B3FA 3FXBA 2F7CA 4M1VA 4JSDA 4NN3A 2VPOA 5ICQA 2OCUA 4H6DA 3G3HA 4WKMA 2Q2AA 3S9MC 2ALUA 3Q28A 3I5OA 4OA4A 2PMSA 3G3IA 3B50A 1SI0A 1SQYA 1CB6A 3KBRA 2RINA 3HSTA 2NOOA 4FORA 4KI0E 3QK6A 4KYSA 3TAJA 1FW0A 3VXCA 1FCKA 2UVHA 4KR5A 1BKAA 3WAFA 3D4CA 4E0XA 4C0RA 3OEMA 2W7YA 3R7XA 4DXCA 2I58A 1EZPA 2DE2A 3Q25A 3MVWA 2QMXA 4NGUA 1XVXA 4XF5A 1QUIA 4OWDA 4P3LA 3S2VA 1TXFA 2DQVA 3TODA 1MY0A 1B05A 4XIGQ 5CMKA 1OIBA 4JWXA 2YJPA 1RYXA 3TCGA 4POWA 2FNCA 3TMGA 4C1TA 2D21A 1XC1A 4R6KA 2UVIA 5IKBA 3QXMA 5BWJA 1DPEA 1N84A 1URSA 4DIGA 4OETA 4N6KA 4NG7A 2REGA 1XOCA 5IZZA 1MXZA 3IOVA 4RJZA 1LFGA 5CM6A 3KGCA 2HQ0A 1LAHE 1Y4TA 1B3HA 3O66A 2UYEA 4KPTA 4PGPA 3E9XA 4TLMB 3IO6A 4KYEA 2E1SA 4F1VA 2VP1A 1Y20A 1GR2A 3JZJA 1P1QA 4R6HA 3O6GA 1PEBA 1A8FA 2E0SA 3H6WA 3SEUA 3MVZA 4KHZE 4ONYA 4DZ1A 2HFBA 2V93A 2ZZVA 1M5DA 2UVGA 4LATA 1PBQA 4YMAA 1SYHA 1B7HA 2Y7PA 4P0IA 1MXWA 3KOSA 4NE4A 4LQ2A 2ZYMA 4RK2A 4MCOA 2M8CA 3K0VA 1OMPA 3T22A 3U1OA 4N6PA 4BDMA 5DVJA 3I6VA 3RQTA 3VLWA 4LUBA 3LSWA 1B7ZA 4PCDA 3OSQA 4LQ5A 1B40A 1URGA 3U92A 3MZ1A 1VFEA 3EHUA 3KSJA 3CRBA 5ISUA 4IO4A 2Y7RA 1BIYA 1WDNA 4DXUA 5LOMA 1L5TA 3ECRA 3UP9A 2F6GA 4F3PA 4U4SA 3FV1A 3CI8A 1F9BA 4ZZAA 2OLBA 4P1LA 5H8FB 3G3KA 1B3EA 4TQUQ 3PUWE 1IXCA 2ZNTA 3PMXA 2XX9A 3VVEA 4NMYA 4NF5B 3MP1A 3Q26A 4U23A 1FQCA 1MH3A 4RYAA 2I6EA 4OFJA 4PQJA 3O28A 5K2YA 4EQ9A 1S50A 4DI4B 2ABHA 1FQBA 5DEXA 3VE1B 4EF2A 3FVKA 2I3VA 4JSOA 4GOTA 3MC2A 4P47A 4MF3A 1LCFA 3KN8A 3VDFA 5H8HA 3DLNA 4GXAA 3HV1A 2WKYA 2F6PA 1PDAA 3K1MA 2QS3A 1HSLA 1JNFA 1B51A 4N15A 4QSDA 4XKQA 4P11A 2O68A 5DYHA 5IGAA 1QULA 4OQOA 4MMPA 4FAJA 1QJMA 4YB7A 4F22A 4OFLA 4KFQA 3P7IA 3O2AA 4G8NA 3UN6A 1ZJLA 1USYE 3W9WA 5H8FA 3IB2A 2RC9A 3MVYA 1LB8A 1OVBA 2DWHA 1MH4A 4OEUA 4ZECA 4PF8A 4YICA 4NF5A 3S9EA 4NF0A 4MLQA 3T66A 2DS9A 3T9VA 4X04A 1Q1KA 4DCXA 4GLIA 2UYFA 1IITA 3K2DA 2H9BA 3G7WA 3O9PA 1H76A 2QL3A 3PD8A 4IY6A 1JW1A 4EUOA 4F31B 3LC8A 3CSBA 1P1UA 1SBPA 2YLNA 1B46A 1MPDA 2Y7KA 4AQ4A 2PT1A 1JEVA 2QRYA 5L9OA 3IO4A 1MXYA 4ELRA 3RUMA 4ESXA 4P1EA 1ZMGA 1IQ7A 2XXTA 2I4BA 5TU0A 4ZE9A 3K6VA 4XTCQ 2RKMA 5IM2A 3EPEA 5F7VA 4GWOA 3IJXB 3VLUA 4H5FA 1EZOA 4R2BA 5FHNA 3SKPA 2Z22A 1DTGA 2V3QA 2DE3A 3ODBA 2WX9A 3B6TA 4NHBA 3PUYE 2X7PA 4N8GA 3IJOB 3A09A 2ZYKA 3H7MA 3H6UA 4OMBA 2NVUB 3LBSA 4NF6B 2Q9TA 2OJTA 4MH5A 4DDDA 3WAEA 4ZEBA 4WXJA 1Y3QA 1OVTA 3TKDA 1NFTA 4MLVA 2G29A 3V89B 2VGQA 1H3DA 3LSLA 1MQJA 4G8MA 1USYH 3CFZA 1B3FA 4PFBA 4IGTA 3U93A 4R72A 2I0CA 3FVGA 3H06B 1Y4CA 2X26A 3PPRA 2F7AA 4QRZA 4DI3D 2DYXA 4EDPA 2D5WA 3EF7A 4QHQA 2XXRA 2XWVA 2GRVA 4F29A 1VFDA 2Y7WA 2ZNUA 2RF1A 1UTHB 3SEVA 4YKKA 1NNFA 3RPWA 1NNKA 3MW0A 3OSRA 1LLSA 4YKIA 4KYDA 2XHDA 1SD3A 4I9DA 4HTGA 1B5JA 4NX1A 2ONSA 2H25A 5L8DA 2CEYA 2WYKA 2XWOA 1M5EA 3DP8A 4F19A 3M3KA 1N7XA 4NF6A 5HM4B 2A5TA 3IOTA 1UIUA 4H0WA 4F3SA 4PC9A 4F1UA 4OEVA 3TTRA 1GVCA 1BLFA 4U4XA 3SETA 4GXSB 4O94A 1ZLQA 3T9XB 1S9TA 4BDOA 4OANA 1FTJA 3IL1B 5CI5A 1B0HA 3KJTA 4QSCA 4O3CA 4H67A 5B70A 2P1SA 2ZYOA 4GD5A 1NNTA 2O7IA 4XEQA 1PC3A 3FXRA 3C32A 4N07A 3C31A 1QKAA 2ANJA 3PD9A 1OQHA 2XD2A 3T9HB 4MNCA 1UTHA 5KZTA 2QMWA 3PUXE 3G3FA 4XFEA 2HAVA 5EHMA 2DVCA 1IXGA 1P99A 5H8QB 1JETA 1SYIA 5TPAB 5TP9B 4NAPA 1RKMA 5AE4A 2ZMBA 4NTLA 3R6UA 2ONRA 4E0WA
chains in the Genus database with same CATH superfamily
4MAGA 1FPEA 3RT8A 1P1WA 3IAZA 3BIGA 1EZ9A 3PUZE 3C33A 4GBVA 3UA8A 2F35A 5ITOA 4ECFA 3MZBA 1Y3NA 3OMBA 1KA0A 3PPOA 3DELB 1R9QA 1ATGA 2AL4A 4F3GA 1LBCA 1QGXA 4KD5A 3CIJA 1WODA 4ELOA 4ZS9A 5A5XB 4P9KA 4F18A 3Q27A 3OO6A 3EN3A 2FIEA 1FBCA 1EU8A 3RTFB 3H3GA 3KOTA 4IO7A 3FD3A 1H44A 4PBQA 5AA2B 4OHNA 3VVFA 3AXFA 3K4UA 4MNIA 3G3JA 4YKPA 1B52A 1BTJA 4Q8RA 4OVSA 3TCFA 1NI9A 4X8RA 1QVSA 3U72A 1NH8A 4MFIA 2HZLA 4FIMA 4G8HA 1MM6A 4U1OA 1US4A 3RYDA 3QMFA 4ZE8A 1DMBA 1B4HA 4KQPA 4O7IA 3ISPA 5L9SA 1SI1A 1LCTA 3KC0A 2OWSA 2GH9A 4O7MA 3F11A 1TFDA 1MQIA 4IGRA 4XKRA 3FVNA 2H99A 5ET8A 1MY4A 1N3WA 2FA7A 4NQ8A 4JBZA 1JW4A 4GL8A 3B7DA 2H4IA 1EYIA 3B6QA 1POY1 1M5CA 4QBAA 4G77A 1LFHA 5EYGA 2F3BA 5A5XA 3IB0A 3KJ7A 4QF9A 5I84A 4H8IA 3TTNA 5KCJB 1R6ZA 2Q74A 3HN0A 5CMCA 2OX3A 5EQ8A 3K1PA 4PBHA 3U65A 3O6IA 1FSAA 4MIJA 2I48A 4Z0IA 4H8JA 3LSXA 4YU0A 2DOJA 1II5A 3TEPA 4GWXA 4PFUA 4PETA 3Q29A 4UA8A 4PE3A 4NEDA 4JVCA 4OVRA 1BK4A 2RC8A 4JB7A 4QFLA 3OELA 3LUYA 3BBRA 1DOTA 1MXXA 4GX4A 3MP6A 1HSEA 3CVGA 3UIFA 1DPPA 3OO9A 1TT1A 1P1OA 2YPNA 2Z8FA 2GHBA 4N8YA 5FTIA 4PFRA 3ZKLA 4FECA 1H45A 3HPIA 3QUJA 4PGNA 1YXIA 2FIXA 4BLAA 5I58B 1FPLA 4MJOA 4UABA 1LAXA 1AMFA 4RY1A 1POTA 2R8TA 1KZ8A 5CBRA 4PE5B 3QUFA 4YAHX 4DXBA 2V25A 3C35A 4BDNA 3RT6B 2Q89A 1MDQA 1QW0A 4EQBA 1R9LA 1FPBA 1JEUA 4JWYA 5KCJA 5AA2D 3VLVA 3TTMA 1B6HA 1N04A 1MQGA 1FPJA 2CZKA 1B1HA 4X48A 2PVUA 2PX1A 1TWYA 2I4CA 5IZ1A 3DP6A 2RCBA 3PPPA 2DP8A 2R9JA 3GXAA 2BJJX 3PU5A 4GX6A 3LSFB 3OD7A 4QXDA 3OENA 1AOVA 3FGSA 4THIA 2F8DA 2QFLA 3H4ZA 4I62A 4G68B 3T9UA 4R9GA 4IO2A 2FBPA 3K01A 2Q2CA 2AYSA 4Q5TA 4G61A 3IORA 1JVYA 4RPOA 5L9MA 3SZPA 1A54A 1RDZA 1XS5A 1VSOA 4QFOA 3GYYA 1Y1ZA 2XXPA 1LBVA 2XA5A 1CNQA 1MG1A 1KWHA 4MBPA 3UGWA 1JQFA 4PFTA 3ZKKA 2XXXA 1YPNA 2B65A 2OZZA 2XXQA 1HSJA 1IMDA 3THIA 3C36A 3TQLA 5HBCA 4M4GA 2WYPA 3KG2A 2ZYNA 1UQWA 3MP8A 4R73A 3CR9A 2Y84A 1VE4A 1Q9DA 2XX8A 2O6AA 5IZ3A 3TELA 5ICTA 4Q30B 3SESA 5HPQA 5DT6A 3FATA 1US5A 2DVZA 1ZKBA 3SERA 1IXIA 1UIVA 3FVOA 4N4UA 3EHSA 1ZTYA 2QS1A 3FZVA 4LVQA 1EH3A 3ZS6A 2PYYA 4GWUA 2HHMA 4QFKA 3KBZA 3RY3A 3OOAA 1LBZA 1UTBB 1NH7A 3C34A 3O29A 1B32A 2HXWA 4O8MA 2I3WA 1LSTA 4G2ZA 2ZXTA 4HS7A 3E78A 2P2AA 4QSEA 3UORA 3EQ1A 3IK6B 2R71A 3LUZA 1FTMA 5I2KB 1Z7NE 2QSXA 4F1YA 2XWIA 5CBSA 4N13A 4Z7EA 3M8UA 3OEKA 3L6HA 2NXOA 4IO5A 3HCQA 4R75A 2IA4A 2CZHA 1QUJA 3MQ9A 1QKBA 2O51A 2F5XA 2KQZA 2GHAA 3T93B 4NWCA 3T96B 4LA9A 5BUUA 1A7LA 1FTOA 3E4RA 3K6XA 3FJMA 4DE8A 1T0KA 3KFMA 2OK2A 1LBYA 4HXVA 2REJA 3N6UA 4DCYA 1G0HA 4FEBA 2VPNA 4U22A 1M5BA 5JEIA 4H1XA 4R2FA 2G93A 3ROJA 4YMBA 2H5YA 1INPA 2X7QA 1NV5A 4AB5A 3RNNA 2FYIA 2VT5A 1IMCA 3SEXA 3PTYA 3O97A 1PB9A 2Y5LA 4F3BA 1P1NA 3FIRA 5AA3A 1MPBA 4HE2A 5T3JA 3ILUB 3ILTB 3IFCA 1BP5A 4PDHA 3GLBA 4JXIA 1RYOA 1MY1A 4Q0CA 1R1NA 2V4CA 1XHYA 1B0LA 1ANFA 2F34A 4N91A 1D9QA 4PP0A 4MHFA 5H8NB 3MPLA 1URDA 1RDXA 3A3CA 1JP4A 2HXRA 3FJ7A 5I2KA 4YZZA 2B4MA 1N76A 2HPGA 5LTCA 4PAIA 4OVPA 1VR5A 3QAXA 1Y1MA 4ESWA 4ND9A 3IOUA 1LGBC 4X1DA 4YKJA 4N17A 1PBPA 5B7DA 1J1NA 3TUSA 2KLFA 3QIMA 4N6DA 1GGGA 3MZ9A 3DP4A 5JTYB 2DE4A 2OWTA 1TFAA 1MY2A 3H03A 4O3BA 3TQWA 2XWKA 3MWBA 4ZEDA 1GV8A 4GRKA 3HO7A 4ZZEA 1LB9A 2BJIA 5AA4B 2QS2A 4NF4B 3MUQA 3IX1A 1FBEA 1LBBA 1LAGE 2PBWA 4LN5A 2V84A 5I59B 2PFYA 3ONMA 1DTZA 3CG1A 1B3GA 2O1LA 3RGYA 4HW8A 1AH5A 1FTAA 4F39A 4EQ7A 5H8NA 1FBPA 1IUDA 3N94A 1A8EA 1FJ9A 5FHMA 4POXA 3U8QA 4GBWA 2D3IA 2F36A 4F2OA 3RLFE 3K00A 4PTKA 1FQAA 2DXRA 1ZIUA 2WEFA 3TZAA 2V3UA 2QS4A 2HZKA 2VHAA 3RPLA 3V5AA 2LAOA 3G3GA 2PT2A 3K6WA 3B6WA 1I6AA 1CE2A 4OZ9A 3QSLA 4U2RA 5JTYA 4YB5A 4XKNA 4PFYA 5H8QA 4LZ8A 5TPAA 5TP9A 4AB6A 3B8BA 2OBGA 2PCRA 3LV0A 3FASA 4ZEIA 4LONB 5AA4A 4NF4A 1ZBMA 2OWZA 5I2NB 5I3SA 4BDLA 4RK9A 2Z8DA 1SDXA 1S7YA 3KZGA 3PGFA 5ITPA 1O7TA 3FXQA 4LZ5A 1M5FA 4I8CA 3KN7A 3QYTA 4TOZA 1A99A 1B5IA 3L6GA 5I59A 3W15C 3N5LA 2XXKA 4X1BA 5LDZA 2B3BA 2PFZA 2I0BA 4JDFA 2XXIA 3SDFA 2Q88A 2NUVA 4LZ7A 1YYZA 4KXPA 3SEYA 2F97A 4ZEFA 3TTLA 1DK4A 5H8SA 5DEXB 1B9JA 4GIZA 1GTKA 4HE0A 5AA2A 2UXAA 3OXNA 2XXWA 3OO8A 5EQAA 4RA1A 4ISUA 3RTWB 5H8HB 2RC7A 2XX7A 1MS7A 4X9TA 2ESNA 3R26A 1LFIA 3JYRA 1MXUA 1NV2A 3I3VA 4H45A 4QFNA 2B4LA 1MQHA 3TYHA 5CRYA 2IEEA 2Z8EA 3A3UA 4R9FA 2F7BA 4ZDMA 2DWIA 5F24A 1B1XA 1FPFA 1NKXA 1NMUA 4OENA 4LP2B 2UVJA 1JVXA 1FBHA 4L17A 4EXLA 2MKZA 1N3XA 2Q8JA 3TCHA 2A5SA 4KCCA 1IEJA 5I2NA 2CZIA 1PB7A 4MNPA 1N7WA 2QJEA 2NWJA 1A40A 1YZ0A 1YAEA 1O64A 1I6BA 1B58A 4IO3A 2R6GE 3FV2A 1SW2A 2WBDA 5KDTB 3K02A 1LBXA 4I1DA 3V83A 5DTBA 1D9VA 4HCWA 4OYVA 3MJNA 4PFWA 5EQ7A 2XD3A 1FBDA 2ZNSA 3MBPA 1NUYA 1A55A 3H6TA 3IOWA 3MAMA 1QUKA 4ELQA 1AIVA 3FXUA 4PFIA 4FJPA 4OVQA 2DWAA 4FATA 2HAUA 1FQEA 4K3FA 4MEVA 2O7UA 1DBZA 5I56B 4KCDA 3VFJA 1FTKA 3PMVA 2F78A 2CZLA 1SW4A 4NWDA 2QPQA 1SW1A 4GL0A 3BKIB 5ET7A 4ZEKA 5FHOA 4U21A 3LR1A 4PAKA 1NV0A 1AWBA 3CSGA 4YB6A 2HCAA 1B3LA 5JK4A 2O1MA 4BDQA 1NL5A 2QVRA 3SEWA 5CC2A 1IMBA 3N26A 5I58A 5DVIA 4IO6A 5M2VA 4H46A 3PUVE 4RPNA 1B5HA 2Q8MA 1JW5A 3TFLA 3IB1A 1XVYA 3RN8A 4XXUA 3K6UA 5KDTA 5F1QA 4MX6A 3UK4A 4GQOA 2HEUA 2VOZA 1FTLA 5FBPA 1IIWA 4TLLB 3KN3A 3E3KA 4WEDA 2VD3A 4GWZA 1D9YA 1B2HA 3O6HA 4G68C 4U1ZA 5IAIA 5EYFA 3DM0A 1N0TA 1ZU0A 4PAFA 5I57B 1YCJA 3PV0E 3D4GA 1NNPA 4GFRA 5ET6A 1MDP1 3D1RA 4GF8A 4P8BA 1K9YA 3VVDA 4ELPA 5I56A 1FQDA 3KSXA 3K1NA 1Y9UA 2Y7IA 2ZZXA 1YTVA 1O63A 3GBAA 5DVFA 4G68A 4O3AA 3EKIA 1I69A 2GFEA 4P56A 4QFPA 3PMWA 3OO7A 2P0SA 4OVTA 1SVXB 1B4ZA 4WEPA 3EHTA 2XXYA 1SPIA 3HHGA 4R74A 1OQGA 3S4UA 1MY3A 1IMAA 4GWYA 2DXYA 4OXVA 4FEDA 2O69A 5ELVA 3BFTA 2ZZWA 2V3TA 4H5GA 1K9ZA 1OLAA 1Z7ME 2XXVA 3HHFA 4XKPA 1MXVA 1Q35A 4NF8B 2A5TB 4G4PA 3C4MA 1MQDA 2Z23A 5EQ9A 2RCAA 2AL5A 4R6YA 4FE8A 2Y5KA 3BFUA 1NUWA 1IXHA 4OFOA 5EHSA 1ELJA 2O84X 5I7IA 4OTEA 3MPKA 5EYHA 5J1DA 2VD2A 4OVJA 4RNSA 4F2QA 5CMMA 5I57A 2XXHA 3CG3A 4UACA 4BDRA 1SW5A 3E13X 2I49A 3W9VA 1D3KA 1MRPA 2ONKE 1XT8A 5AA1A 1MM7A 1D4NA 1FPGA 4EXKA 3VXBA 4HCYA 2DDKA 2DSFA 2AIXA 4H65A 2XXUA 3PPNA 3S9LC 1FQFA 4IY5A 3KEIA 4OESA 1LAFE 1WVJA 4EF1A 3H6VA 2FVZA 1UTBA 3T1BA 1Y3PA 4OERA 2DWJA 2CEXA 3VV5A 3JV9A 2WBBA 4JWOA 5FTHA 3IR1A 3S9NC 1AL3A 1B7UA 1IZ1A 1I6QA 1MPCA 1OLCA 3MVXA 3N6TA 3FUZA 5K2XA 2H98A 4IB2A 3FJGA 3CFXA 4DLDA 4FBPA 4P0GA 3ZSFA 3CFLA 3USDA 3V8XB 3GZGA 4RXLA 3M3FA 3PPQA 4PDDA 3M3LA 2THIA 3U94A 3TDJA 4NF8A 5I5PA 1H43A 3C9HA 4C1UA 3TTKA 3TPAA 4GVOA 2CMOA 3GBBA 1DSNA 5CMBA 1PB8A 4PF6A 2B3FA 3FXBA 2F7CA 4M1VA 2P3NA 4JSDA 4NN3A 2VPOA 5ICQA 2OCUA 4H6DA 3G3HA 4N81A 4WKMA 2Q2AA 3S9MC 2ALUA 5DW8A 3Q28A 3I5OA 1LEVA 4OA4A 2PMSA 3G3IA 3B50A 1SI0A 1SQYA 1CB6A 3KC1A 3KBRA 3T0JA 2RINA 3HSTA 2NOOA 4FORA 4KI0E 3CHGA 3QK6A 4KYSA 3TAJA 1FW0A 3VXCA 1FCKA 2UVHA 3E79A 4KR5A 1BKAA 3WAFA 3D4CA 4E0XA 4C0RA 3OEMA 2W7YA 3R7XA 4DXCA 2I58A 1EZPA 2DE2A 3Q25A 3MVWA 2QMXA 4NGUA 1XVXA 4XF5A 1QUIA 4P3LA 4OWDA 3S2VA 1TXFA 2DQVA 3TODA 1MY0A 4GWWA 1G0IA 1B05A 4XIGQ 5CMKA 1OIBA 4JWXA 2YJPA 1RYXA 3TCGA 4POWA 2FNCA 3TMGA 4C1TA 2D21A 1XC1A 4R6KA 2UVIA 1FPKA 5IKBA 3QXMA 5BWJA 1DPEA 1N84A 1URSA 4DIGA 4N6KA 4OETA 4NG7A 2REGA 1XOCA 5IZZA 1FPIA 1MXZA 3IOVA 4RJZA 1LFGA 5CM6A 3KGCA 2HQ0A 2QVUA 1LAHE 1Y4TA 1FJ6A 1B3HA 3O66A 2UYEA 4KPTA 4PGPA 4AS4A 3E9XA 4TLMB 3IO6A 4KYEA 2E1SA 4F1VA 2VP1A 1Y20A 4HE1A 1GR2A 3JZJA 1P1QA 4R6HA 3O6GA 1PEBA 3FBPA 3A29A 1A8FA 2E0SA 3H6WA 3SEUA 3MVZA 4KHZE 4ONYA 4DZ1A 1IMFA 2HFBA 2V93A 2ZZVA 1M5DA 2UVGA 4LATA 1PBQA 4YMAA 1SYHA 1B7HA 2Y7PA 4P0IA 1MXWA 3KOSA 4NE4A 1NV7A 4LQ2A 2ZYMA 4RK2A 4MCOA 1VDWA 2M8CA 3K0VA 4I3EA 1OMPA 3T22A 3U1OA 4N6PA 4BDMA 5DVJA 3I6VA 3RQTA 3VLWA 1NV4A 4LUBA 3LSWA 1B7ZA 4PCDA 3OSQA 4LQ5A 1B40A 1URGA 3U92A 3MZ1A 1VFEA 3EHUA 3KSJA 3CRBA 1DCUA 5J16A 5ISUA 4IO4A 2Y7RA 1BIYA 1WDNA 4DXUA 5LOMA 1L5TA 3ECRA 3UP9A 2F6GA 4F3PA 4U4SA 3FV1A 3CI8A 3HFUA 1F9BA 4ZZAA 4IR8A 2OLBA 4P1LA 5H8FB 2FHYA 3G3KA 1B3EA 4TQUQ 3PUWE 1IXCA 5A5LA 2ZNTA 3PMXA 2XX9A 3VVEA 4NMYA 4NF5B 3MYUA 3MP1A 3Q26A 4U23A 1NUXA 1FQCA 1RDYA 1MH3A 4RYAA 2I6EA 4OFJA 4PQJA 3O28A 5K2YA 4EQ9A 1S50A 4DI4B 2ABHA 1FQBA 5DEXA 3VE1B 4EF2A 3FVKA 2I3VA 4JSOA 4GOTA 3MC2A 4P47A 1LBWA 4MF3A 1LCFA 3KN8A 3VDFA 5H8HA 3DLNA 4GXAA 3HV1A 2WKYA 2F6PA 1PDAA 3K1MA 2QS3A 1HSLA 1JNFA 1B51A 4N15A 4QSDA 1IMEA 4XKQA 4P11A 2O68A 5DYHA 5IZ3B 5ESYA 5IGAA 1QULA 4MMPA 4OQOA 3MSTA 4FAJA 1QJMA 4YB7A 4F22A 1FBFA 4OFLA 4KFQA 2F3DA 3P7IA 3O2AA 4G8NA 3UN6A 1ZJLA 1USYE 3W9WA 5H8FA 3IB2A 2RC9A 3MVYA 1LB8A 1OVBA 2DWHA 1MH4A 4OEUA 4ZECA 4PF8A 4YICA 4NF5A 3S9EA 4NF0A 4MLQA 3T66A 2DS9A 4X04A 3T9VA 1Q1KA 4DCXA 4GLIA 2UYFA 3BIHA 1IITA 3K2DA 2H9BA 3G7WA 3O9PA 1H76A 2QL3A 3PD8A 4IY6A 1JW1A 4EUOA 4F31B 3LC8A 3CSBA 1P1UA 1SBPA 2YLNA 1B46A 1MPDA 2Y7KA 4AQ4A 2PT1A 1JEVA 2QRYA 5L9OA 3IO4A 1MXYA 4ELRA 3RUMA 4ESXA 4P1EA 1ZMGA 1IQ7A 2XXTA 2I4BA 5TU0A 4ZE9A 1EYKA 3K6VA 4XTCQ 2RKMA 5IM2A 3EPEA 5F7VA 4GWOA 3IJXB 3VLUA 4H5FA 1EZOA 4R2BA 4AS5A 5FHNA 3SKPA 2Z22A 1DTGA 2V3QA 2DE3A 3ODBA 2WX9A 3B6TA 4NHBA 3PUYE 2X7PA 4N8GA 3IJOB 3A09A 2ZYKA 3H7MA 3H6UA 4OMBA 1FRPA 2NVUB 3LBSA 4NF6B 2Q9TA 4JVDA 2OJTA 4MH5A 4DDDA 3WAEA 4ZEBA 4WXJA 1Y3QA 1OVTA 5ET5A 3TKDA 1FBGA 1NFTA 4MLVA 2G29A 3V89B 2VGQA 1H3DA 3LSLA 1NUZA 1MQJA 4G8MA 1USYH 3CFZA 1B3FA 4PFBA 4IGTA 3U93A 4R72A 2I0CA 3FVGA 3H06B 1Y4CA 2L5VA 2X26A 2JJKA 3PPRA 2F7AA 4QRZA 4DI3D 2DYXA 4EDPA 2D5WA 3EF7A 3NOHA 1KA1A 4QHQA 2XXRA 2XWVA 2GRVA 4F29A 1VFDA 2Y7WA 2ZNUA 2RF1A 1UTHB 3SEVA 4YKKA 1NNFA 3RPWA 1NNKA 3MW0A 3OSRA 1LLSA 4YKIA 4KYDA 4I40A 2XHDA 4GX3A 2KR0A 1SD3A 4I9DA 4HTGA 1B5JA 4NX1A 1FPDA 2ONSA 2H25A 2CEYA 5L8DA 2WYKA 1NV3A 2XWOA 1M5EA 3DP8A 1NV6A 4F19A 3M3KA 1N7XA 1XI6A 4NF6A 2P3VA 1NV1A 5HM4B 1EYJA 4JVIA 2A5TA 3IOTA 1UIUA 4I3YA 4H0WA 4F3SA 4PC9A 4F1UA 4OEVA 1GVCA 3TTRA 1BLFA 4U4XA 3SETA 4GXSB 4O94A 1ZLQA 4GWSA 3T9XB 1S9TA 4BDOA 4OANA 1FTJA 3IL1B 5CI5A 1B0HA 3KJTA 4QSCA 4O3CA 4H67A 5B70A 2P1SA 2ZYOA 4GD5A 1NNTA 2O7IA 3IFAA 4XEQA 1PC3A 3FXRA 3RPLB 3C32A 4N07A 3C31A 1QKAA 2ANJA 3PD9A 1OQHA 2XD2A 3T9HB 4MNCA 1UTHA 5KZTA 2QMWA 3PUXE 3G3FA 4XFEA 2HAVA 5EHMA 2DVCA 1IXGA 2GQ1A 1P99A 5H8QB 1JETA 1SYIA 2QVVA 5TPAB 5TP9B 4NAPA 1RKMA 5AE4A 2ZMBA 4NTLA 3R6UA 2ONRA 4E0WA
chains in the Genus database with same CATH topology
4MAGA 1FPEA 3RT8A 1P1WA 3IAZA 3BIGA 1EZ9A 3PUZE 3C33A 4GBVA 3UA8A 2F35A 5ITOA 4ECFA 3MZBA 1Y3NA 3OMBA 3PPOA 1KA0A 3DELB 1R9QA 1ATGA 2AL4A 4F3GA 1LBCA 1QGXA 4KD5A 3CIJA 1WODA 4ELOA 4ZS9A 5A5XB 4P9KA 4F18A 3Q27A 3OO6A 3EN3A 2FIEA 1FBCA 1EU8A 3RTFB 3H3GA 3KOTA 4IO7A 3FD3A 1H44A 4PBQA 5AA2B 4OHNA 3VVFA 3AXFA 3K4UA 4MNIA 3G3JA 4YKPA 1B52A 1BTJA 4Q8RA 4OVSA 3TCFA 1NI9A 4X8RA 1QVSA 3U72A 1NH8A 4MFIA 2HZLA 4FIMA 4G8HA 1MM6A 4U1OA 1US4A 3RYDA 4ZE8A 3QMFA 1DMBA 1B4HA 4KQPA 4O7IA 3ISPA 5L9SA 1SI1A 1LCTA 3KC0A 2OWSA 2GH9A 4O7MA 3F11A 1TFDA 1MQIA 4IGRA 4XKRA 3FVNA 2H99A 5ET8A 1MY4A 1N3WA 2FA7A 4NQ8A 4JBZA 1JW4A 4GL8A 3B7DA 2H4IA 1EYIA 3B6QA 1POY1 1M5CA 4QBAA 4G77A 1LFHA 5EYGA 5A5XA 2F3BA 3IB0A 3KJ7A 4QF9A 5I84A 4H8IA 3TTNA 5KCJB 1R6ZA 2Q74A 3HN0A 5CMCA 2OX3A 5EQ8A 3K1PA 4PBHA 3U65A 3O6IA 1FSAA 4MIJA 2I48A 4Z0IA 4H8JA 3LSXA 4YU0A 2DOJA 1II5A 3TEPA 4PFUA 4GWXA 4PETA 3Q29A 4UA8A 4PE3A 4NEDA 4JVCA 4OVRA 1BK4A 2RC8A 4JB7A 4QFLA 3OELA 3LUYA 3BBRA 1DOTA 1MXXA 4GX4A 3MP6A 1HSEA 3CVGA 3UIFA 1DPPA 3OO9A 1TT1A 1P1OA 2YPNA 2Z8FA 2GHBA 4N8YA 5FTIA 4PFRA 3ZKLA 4FECA 1H45A 3HPIA 3QUJA 4PGNA 1YXIA 2FIXA 4BLAA 5I58B 1FPLA 4MJOA 4UABA 1LAXA 1AMFA 4RY1A 1POTA 2R8TA 5CBRA 1KZ8A 4PE5B 3QUFA 4YAHX 4DXBA 2V25A 3C35A 4BDNA 3RT6B 2Q89A 1MDQA 1QW0A 4EQBA 1R9LA 1FPBA 1JEUA 4JWYA 5KCJA 5AA2D 3VLVA 3TTMA 1B6HA 1N04A 1MQGA 1FPJA 2CZKA 1B1HA 4X48A 2PVUA 2PX1A 1TWYA 2I4CA 5IZ1A 3DP6A 2RCBA 3PPPA 2DP8A 2R9JA 3GXAA 2BJJX 3PU5A 4GX6A 3LSFB 3OD7A 4QXDA 3OENA 1AOVA 3FGSA 4THIA 2F8DA 2QFLA 3H4ZA 4I62A 4G68B 3T9UA 4R9GA 4IO2A 2FBPA 3K01A 2Q2CA 2AYSA 4Q5TA 4G61A 3IORA 1JVYA 4RPOA 5L9MA 3SZPA 1A54A 1RDZA 1XS5A 1VSOA 4QFOA 3GYYA 1Y1ZA 2XXPA 1LBVA 2XA5A 1CNQA 1MG1A 1KWHA 4MBPA 3UGWA 1JQFA 4PFTA 3ZKKA 2XXXA 1YPNA 2B65A 2OZZA 2XXQA 1HSJA 1IMDA 3THIA 3C36A 3TQLA 5HBCA 4M4GA 2WYPA 3KG2A 2ZYNA 1UQWA 3MP8A 4R73A 3CR9A 2Y84A 1VE4A 1Q9DA 2XX8A 2O6AA 5IZ3A 3TELA 5ICTA 4Q30B 3SESA 5HPQA 5DT6A 3FATA 1US5A 2DVZA 1ZKBA 3SERA 1IXIA 1UIVA 3FVOA 4N4UA 3EHSA 1ZTYA 2QS1A 3FZVA 4LVQA 1EH3A 3ZS6A 2PYYA 4GWUA 2HHMA 4QFKA 3KBZA 3RY3A 3OOAA 1LBZA 1UTBB 1NH7A 3C34A 3O29A 1B32A 2HXWA 4O8MA 2I3WA 1LSTA 4G2ZA 2ZXTA 4HS7A 3E78A 2P2AA 4QSEA 3UORA 3EQ1A 3IK6B 2R71A 3LUZA 1FTMA 5I2KB 1Z7NE 2QSXA 4F1YA 2XWIA 5CBSA 4N13A 4Z7EA 3M8UA 3OEKA 3L6HA 2NXOA 4IO5A 3HCQA 4R75A 2IA4A 2CZHA 1QUJA 3MQ9A 1QKBA 2O51A 2F5XA 2KQZA 2GHAA 3T93B 4NWCA 3T96B 4LA9A 5BUUA 1A7LA 1FTOA 3E4RA 3K6XA 3FJMA 4DE8A 1T0KA 3KFMA 2OK2A 1LBYA 4HXVA 2REJA 3N6UA 4DCYA 1G0HA 4FEBA 2VPNA 4U22A 1M5BA 5JEIA 4H1XA 4R2FA 2G93A 3ROJA 4YMBA 2H5YA 1INPA 2X7QA 4AB5A 1NV5A 3RNNA 2FYIA 3SEXA 1IMCA 2VT5A 3PTYA 3O97A 1PB9A 2Y5LA 4F3BA 1P1NA 3FIRA 5AA3A 1MPBA 4HE2A 5T3JA 3ILUB 3ILTB 3IFCA 1BP5A 4PDHA 3GLBA 4JXIA 1RYOA 1MY1A 4Q0CA 1R1NA 2V4CA 1XHYA 1B0LA 1ANFA 2F34A 4N91A 1D9QA 4PP0A 4MHFA 5H8NB 3MPLA 1URDA 3A3CA 1RDXA 1JP4A 2HXRA 3FJ7A 5I2KA 4YZZA 2B4MA 1N76A 2HPGA 5LTCA 4PAIA 4OVPA 1VR5A 3QAXA 1Y1MA 4ESWA 4ND9A 3IOUA 1LGBC 4X1DA 4YKJA 4N17A 1PBPA 5B7DA 1J1NA 3TUSA 2KLFA 3QIMA 4N6DA 1GGGA 3MZ9A 3DP4A 5JTYB 2DE4A 2OWTA 1TFAA 1MY2A 3H03A 4O3BA 3TQWA 2XWKA 3MWBA 4ZEDA 1GV8A 4GRKA 3HO7A 4ZZEA 1LB9A 2BJIA 5AA4B 2QS2A 4NF4B 3MUQA 3IX1A 1FBEA 1LBBA 1LAGE 2PBWA 4LN5A 2V84A 5I59B 2PFYA 3ONMA 1DTZA 3CG1A 1B3GA 2O1LA 3RGYA 4HW8A 1AH5A 4F39A 1FTAA 4EQ7A 5H8NA 1FBPA 1IUDA 3N94A 1A8EA 1FJ9A 5FHMA 4POXA 3U8QA 4GBWA 2D3IA 2F36A 4F2OA 3RLFE 3K00A 4PTKA 1FQAA 2DXRA 1ZIUA 2WEFA 3TZAA 2V3UA 2QS4A 2HZKA 2VHAA 3RPLA 3V5AA 2LAOA 3G3GA 2PT2A 3K6WA 3B6WA 1I6AA 1CE2A 4OZ9A 3QSLA 4U2RA 5JTYA 4YB5A 4XKNA 4PFYA 5H8QA 4LZ8A 5TPAA 5TP9A 4AB6A 3B8BA 2OBGA 2PCRA 3LV0A 3FASA 4ZEIA 4LONB 5AA4A 4NF4A 1ZBMA 5I2NB 2OWZA 5I3SA 4BDLA 4RK9A 2Z8DA 1SDXA 1S7YA 3KZGA 3PGFA 5ITPA 1O7TA 3FXQA 4LZ5A 1M5FA 4I8CA 3KN7A 3QYTA 4TOZA 1A99A 1B5IA 3L6GA 5I59A 3W15C 3N5LA 4X1BA 2XXKA 5LDZA 2B3BA 2PFZA 2I0BA 4JDFA 2XXIA 3SDFA 2Q88A 2NUVA 4LZ7A 1YYZA 4KXPA 3SEYA 2F97A 4ZEFA 3TTLA 1DK4A 5H8SA 5DEXB 1B9JA 4GIZA 1GTKA 4HE0A 5AA2A 2UXAA 3OXNA 2XXWA 3OO8A 5EQAA 4RA1A 4ISUA 3RTWB 5H8HB 2RC7A 2XX7A 1MS7A 4X9TA 2ESNA 3R26A 1LFIA 3JYRA 1MXUA 1NV2A 3I3VA 4H45A 4QFNA 2B4LA 1MQHA 3TYHA 5CRYA 2IEEA 2Z8EA 3A3UA 4R9FA 2F7BA 4ZDMA 2DWIA 5F24A 1B1XA 1FPFA 1NKXA 1NMUA 4OENA 4LP2B 2UVJA 1JVXA 4L17A 1FBHA 4EXLA 3TCHA 1N3XA 2Q8JA 2MKZA 2A5SA 4KCCA 1IEJA 5I2NA 2CZIA 1PB7A 4MNPA 1N7WA 2QJEA 2NWJA 1A40A 1YZ0A 1YAEA 1O64A 1I6BA 1B58A 4IO3A 2R6GE 3FV2A 1SW2A 2WBDA 5KDTB 3K02A 1LBXA 4I1DA 3V83A 5DTBA 1D9VA 4HCWA 4OYVA 3MJNA 4PFWA 5EQ7A 2XD3A 2ZNSA 3MBPA 1FBDA 1NUYA 1A55A 3H6TA 3IOWA 3MAMA 1QUKA 4ELQA 1AIVA 3FXUA 4PFIA 4FJPA 4OVQA 2DWAA 4FATA 2HAUA 1FQEA 4K3FA 4MEVA 2O7UA 1DBZA 5I56B 4KCDA 3VFJA 1FTKA 3PMVA 2F78A 2CZLA 1SW4A 4NWDA 2QPQA 1SW1A 4GL0A 3BKIB 5ET7A 4ZEKA 5FHOA 4U21A 3LR1A 4PAKA 1NV0A 1AWBA 3CSGA 4YB6A 2HCAA 1B3LA 5JK4A 2O1MA 4BDQA 1NL5A 2QVRA 3SEWA 5CC2A 1IMBA 3N26A 5I58A 5DVIA 4IO6A 5M2VA 4RPNA 3PUVE 4H46A 1B5HA 2Q8MA 1JW5A 3TFLA 3IB1A 1XVYA 3RN8A 4XXUA 3K6UA 5KDTA 5F1QA 4MX6A 3UK4A 4GQOA 2HEUA 2VOZA 1FTLA 5FBPA 1IIWA 4TLLB 3KN3A 3E3KA 4WEDA 2VD3A 4GWZA 1D9YA 1B2HA 3O6HA 4G68C 4U1ZA 5IAIA 5EYFA 3DM0A 1N0TA 1ZU0A 4PAFA 5I57B 1YCJA 3PV0E 3D4GA 1NNPA 4GFRA 5ET6A 1MDP1 4GF8A 3VVDA 3D1RA 1K9YA 4P8BA 4ELPA 5I56A 1FQDA 3KSXA 3K1NA 1Y9UA 2Y7IA 2ZZXA 1YTVA 1O63A 3GBAA 5DVFA 4G68A 4O3AA 3EKIA 1I69A 2GFEA 4P56A 4QFPA 3PMWA 3OO7A 2P0SA 4OVTA 1SVXB 1B4ZA 4WEPA 3EHTA 2XXYA 1SPIA 3HHGA 4R74A 1OQGA 3S4UA 1MY3A 1IMAA 4GWYA 2DXYA 4OXVA 4FEDA 2O69A 5ELVA 3BFTA 2ZZWA 2V3TA 4H5GA 1OLAA 1Z7ME 3HHFA 2XXVA 1K9ZA 4XKPA 1MXVA 1Q35A 4NF8B 2A5TB 4G4PA 3C4MA 1MQDA 2Z23A 5EQ9A 2RCAA 2AL5A 4R6YA 4FE8A 3BFUA 2Y5KA 1NUWA 1IXHA 4OFOA 5EHSA 1ELJA 2O84X 5I7IA 4OTEA 3MPKA 5J1DA 5EYHA 2VD2A 4OVJA 4RNSA 4F2QA 5CMMA 5I57A 2XXHA 3CG3A 4UACA 4BDRA 1SW5A 3E13X 2I49A 3W9VA 1D3KA 1MRPA 2ONKE 1XT8A 5AA1A 1MM7A 1D4NA 4EXKA 1FPGA 3VXBA 4HCYA 2DDKA 2DSFA 2AIXA 4H65A 2XXUA 3PPNA 3S9LC 1FQFA 4IY5A 3KEIA 4OESA 1LAFE 1WVJA 4EF1A 3H6VA 2FVZA 1UTBA 3T1BA 1Y3PA 4OERA 2DWJA 2CEXA 3VV5A 3JV9A 4JWOA 2WBBA 5FTHA 3IR1A 3S9NC 1AL3A 1B7UA 1IZ1A 1I6QA 1MPCA 1OLCA 3MVXA 3N6TA 3FUZA 5K2XA 2H98A 4IB2A 3FJGA 3CFXA 4DLDA 4FBPA 4P0GA 3ZSFA 3CFLA 3USDA 3V8XB 3GZGA 4RXLA 3M3FA 3PPQA 4PDDA 3M3LA 2THIA 3U94A 3TDJA 4NF8A 5I5PA 1H43A 3C9HA 4C1UA 3TTKA 3TPAA 4GVOA 2CMOA 3GBBA 1DSNA 5CMBA 1PB8A 4PF6A 2B3FA 3FXBA 2F7CA 4M1VA 2P3NA 4JSDA 4NN3A 2VPOA 5ICQA 2OCUA 4H6DA 3G3HA 4N81A 4WKMA 2Q2AA 3S9MC 2ALUA 5DW8A 3Q28A 3I5OA 1LEVA 4OA4A 2PMSA 3G3IA 3B50A 1SI0A 1SQYA 1CB6A 3KC1A 3KBRA 3T0JA 2RINA 3HSTA 2NOOA 4FORA 4KI0E 3CHGA 3QK6A 4KYSA 3TAJA 1FW0A 3VXCA 1FCKA 2UVHA 3E79A 4KR5A 1BKAA 3WAFA 3D4CA 4E0XA 4C0RA 3OEMA 2W7YA 3R7XA 4DXCA 2I58A 1EZPA 2DE2A 3Q25A 3MVWA 2QMXA 4NGUA 1XVXA 4XF5A 1QUIA 4OWDA 4P3LA 3S2VA 1TXFA 2DQVA 3TODA 1MY0A 4GWWA 1G0IA 1B05A 4XIGQ 5CMKA 1OIBA 4JWXA 2YJPA 1RYXA 3TCGA 4POWA 2FNCA 3TMGA 4C1TA 2D21A 1XC1A 4R6KA 2UVIA 1FPKA 5IKBA 3QXMA 5BWJA 1DPEA 1N84A 1URSA 4DIGA 4OETA 4N6KA 4NG7A 2REGA 1XOCA 5IZZA 1MXZA 1FPIA 3IOVA 4RJZA 1LFGA 5CM6A 3KGCA 2HQ0A 2QVUA 1LAHE 1Y4TA 1FJ6A 1B3HA 3O66A 2UYEA 4KPTA 4PGPA 4AS4A 3E9XA 4TLMB 3IO6A 4KYEA 2E1SA 4F1VA 2VP1A 1Y20A 4HE1A 1GR2A 3JZJA 1P1QA 4R6HA 3O6GA 1PEBA 3FBPA 3A29A 1A8FA 2E0SA 3H6WA 3SEUA 3MVZA 4KHZE 4ONYA 4DZ1A 1IMFA 2HFBA 2V93A 2ZZVA 1M5DA 2UVGA 4LATA 1PBQA 4YMAA 1SYHA 1B7HA 2Y7PA 4P0IA 1MXWA 3KOSA 4NE4A 1NV7A 4LQ2A 2ZYMA 4RK2A 4MCOA 1VDWA 2M8CA 3K0VA 4I3EA 1OMPA 3T22A 3U1OA 4N6PA 4BDMA 5DVJA 3I6VA 3RQTA 3VLWA 1NV4A 4LUBA 3LSWA 1B7ZA 4PCDA 3OSQA 4LQ5A 1B40A 1URGA 3U92A 3MZ1A 1VFEA 3EHUA 3KSJA 3CRBA 1DCUA 5J16A 5ISUA 4IO4A 2Y7RA 1BIYA 1WDNA 4DXUA 5LOMA 1L5TA 3ECRA 3UP9A 2F6GA 4F3PA 4U4SA 3FV1A 3CI8A 3HFUA 1F9BA 4ZZAA 4IR8A 2OLBA 4P1LA 5H8FB 2FHYA 3G3KA 1B3EA 4TQUQ 3PUWE 1IXCA 5A5LA 2ZNTA 3PMXA 2XX9A 3VVEA 4NMYA 4NF5B 3MYUA 3MP1A 3Q26A 4U23A 1NUXA 1FQCA 1RDYA 1MH3A 4RYAA 2I6EA 4OFJA 4PQJA 3O28A 5K2YA 4EQ9A 1S50A 4DI4B 2ABHA 1FQBA 5DEXA 3VE1B 4EF2A 3FVKA 2I3VA 4JSOA 4GOTA 3MC2A 4P47A 1LBWA 4MF3A 1LCFA 3KN8A 3VDFA 5H8HA 3DLNA 4GXAA 3HV1A 2WKYA 2F6PA 1PDAA 3K1MA 2QS3A 1HSLA 1JNFA 1B51A 4N15A 4QSDA 1IMEA 4XKQA 4P11A 2O68A 5DYHA 5IZ3B 5ESYA 5IGAA 1QULA 4OQOA 4MMPA 3MSTA 4FAJA 1QJMA 4YB7A 4F22A 1FBFA 4OFLA 4KFQA 2F3DA 3P7IA 3O2AA 4G8NA 3UN6A 1ZJLA 1USYE 3W9WA 5H8FA 3IB2A 2RC9A 3MVYA 1LB8A 1OVBA 2DWHA 1MH4A 4OEUA 4ZECA 4PF8A 4YICA 4NF5A 3S9EA 4NF0A 4MLQA 3T66A 2DS9A 3T9VA 4X04A 1Q1KA 4DCXA 4GLIA 2UYFA 3BIHA 1IITA 3K2DA 2H9BA 3G7WA 3O9PA 1H76A 2QL3A 3PD8A 4IY6A 1JW1A 4EUOA 4F31B 3LC8A 3CSBA 1P1UA 1SBPA 2YLNA 1B46A 1MPDA 2Y7KA 4AQ4A 2PT1A 1JEVA 2QRYA 5L9OA 3IO4A 1MXYA 4ELRA 3RUMA 4ESXA 4P1EA 1ZMGA 1IQ7A 2XXTA 2I4BA 5TU0A 4ZE9A 1EYKA 3K6VA 4XTCQ 2RKMA 5IM2A 3EPEA 5F7VA 4GWOA 3IJXB 3VLUA 4H5FA 1EZOA 4R2BA 4AS5A 5FHNA 3SKPA 2Z22A 1DTGA 2V3QA 2DE3A 3ODBA 2WX9A 3B6TA 4NHBA 3PUYE 2X7PA 4N8GA 3IJOB 3A09A 2ZYKA 3H7MA 3H6UA 4OMBA 1FRPA 2NVUB 3LBSA 4NF6B 2Q9TA 4JVDA 2OJTA 4MH5A 4DDDA 3WAEA 4ZEBA 4WXJA 1Y3QA 1OVTA 5ET5A 3TKDA 1FBGA 1NFTA 4MLVA 2G29A 3V89B 2VGQA 1H3DA 3LSLA 1NUZA 1MQJA 4G8MA 1USYH 3CFZA 1B3FA 4PFBA 4IGTA 3U93A 4R72A 2I0CA 3FVGA 3H06B 1Y4CA 2L5VA 2X26A 2JJKA 3PPRA 2F7AA 4QRZA 4DI3D 2DYXA 4EDPA 2D5WA 3EF7A 3NOHA 1KA1A 4QHQA 2XXRA 2XWVA 2GRVA 4F29A 1VFDA 2Y7WA 2ZNUA 2RF1A 1UTHB 3SEVA 4YKKA 1NNFA 3RPWA 1NNKA 3MW0A 3OSRA 1LLSA 4YKIA 4KYDA 4I40A 2XHDA 4GX3A 2KR0A 1SD3A 4I9DA 4HTGA 1B5JA 4NX1A 1FPDA 2ONSA 2H25A 5L8DA 2CEYA 2WYKA 1NV3A 2XWOA 1M5EA 3DP8A 1NV6A 4F19A 3M3KA 1N7XA 4NF6A 1XI6A 2P3VA 5HM4B 1NV1A 1EYJA 4JVIA 2A5TA 3IOTA 1UIUA 4I3YA 4H0WA 4F3SA 4PC9A 4F1UA 4OEVA 3TTRA 1GVCA 1BLFA 4U4XA 3SETA 4GXSB 4O94A 1ZLQA 4GWSA 3T9XB 1S9TA 4BDOA 4OANA 1FTJA 3IL1B 5CI5A 1B0HA 3KJTA 4QSCA 4O3CA 4H67A 5B70A 2P1SA 2ZYOA 4GD5A 1NNTA 2O7IA 3IFAA 4XEQA 1PC3A 3FXRA 3RPLB 3C32A 4N07A 3C31A 1QKAA 2ANJA 3PD9A 1OQHA 2XD2A 3T9HB 4MNCA 1UTHA 5KZTA 2QMWA 3PUXE 3G3FA 4XFEA 2HAVA 5EHMA 2DVCA 1IXGA 2GQ1A 1P99A 5H8QB 1JETA 1SYIA 2QVVA 5TPAB 5TP9B 4NAPA 1RKMA 5AE4A 2ZMBA 4NTLA 3R6UA 2ONRA 4E0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAG A;  3RT8 A;  1P1W A;  3IAZ A;  1EZ9 A;  3PUZ E;  3C33 A;  3UA8 A;  2F35 A;  5ITO A;  4ECF A;  3MZB A;  1Y3N A;  3OMB A;  3PPO A;  3DEL B;  1R9Q A;  1ATG A;  2AL4 A;  4F3G A;  1LBC A;  4KD5 A;  3CIJ A;  1WOD A;  4ELO A;  4ZS9 A;  5A5X B;  4P9K A;  4F18 A;  3Q27 A;  3OO6 A;  3EN3 A;  1EU8 A;  3RTF B;  3H3G A;  3KOT A;  4IO7 A;  3FD3 A;  1H44 A;  4PBQ A;  5AA2 B;  4OHN A;  3VVF A;  3AXF A;  3K4U A;  4MNI A;  3G3J A;  4YKP A;  1B52 A;  1BTJ A;  4Q8R A;  4OVS A;  3TCF A;  4X8R A;  1QVS A;  3U72 A;  1NH8 A;  4MFI A;  2HZL A;  4FIM A;  4G8H A;  1MM6 A;  4U1O A;  1US4 A;  4ZE8 A;  1DMB A;  1B4H A;  4KQP A;  5L9S A;  1SI1 A;  1LCT A;  2OWS A;  2GH9 A;  4O7M A;  3F11 A;  1TFD A;  1MQI A;  4IGR A;  4XKR A;  3FVN A;  2H99 A;  1MY4 A;  1N3W A;  2FA7 A;  4NQ8 A;  4JBZ A;  1JW4 A;  4GL8 A;  3B7D A;  2H4I A;  3B6Q A;  1POY 1;  1M5C A;  4G77 A;  1LFH A;  5A5X A;  3IB0 A;  3KJ7 A;  4QF9 A;  5I84 A;  4H8I A;  3TTN A;  5KCJ B;  1R6Z A;  3HN0 A;  5CMC A;  3K1P A;  4PBH A;  3U65 A;  3O6I A;  4MIJ A;  2I48 A;  4Z0I A;  4H8J A;  3LSX A;  4YU0 A;  2DOJ A;  1II5 A;  3TEP A;  4PFU A;  4PET A;  3Q29 A;  4UA8 A;  4PE3 A;  4NED A;  4OVR A;  2RC8 A;  4JB7 A;  4QFL A;  3OEL A;  3LUY A;  3BBR A;  1DOT A;  1MXX A;  3MP6 A;  1HSE A;  3CVG A;  3UIF A;  1DPP A;  3OO9 A;  1TT1 A;  1P1O A;  2YPN A;  2Z8F A;  2GHB A;  4N8Y A;  5FTI A;  4PFR A;  3ZKL A;  4FEC A;  1H45 A;  3HPI A;  3QUJ A;  4PGN A;  4BLA A;  5I58 B;  4UAB A;  1LAX A;  1AMF A;  4RY1 A;  1POT A;  5CBR A;  4PE5 B;  3QUF A;  4YAH X;  4DXB A;  2V25 A;  3C35 A;  4BDN A;  3RT6 B;  2Q89 A;  1MDQ A;  1QW0 A;  4EQB A;  1R9L A;  1JEU A;  4JWY A;  5KCJ A;  5AA2 D;  3VLV A;  3TTM A;  1B6H A;  1N04 A;  1MQG A;  1B1H A;  4X48 A;  2PVU A;  2PX1 A;  1TWY A;  2I4C A;  3DP6 A;  2RCB A;  3PPP A;  2DP8 A;  2R9J A;  3GXA A;  2BJJ X;  3PU5 A;  3LSF B;  3OD7 A;  3OEN A;  1AOV A;  3FGS A;  4THI A;  2F8D A;  3H4Z A;  4I62 A;  4G68 B;  3T9U A;  4R9G A;  4IO2 A;  3K01 A;  2Q2C A;  2AYS A;  4Q5T A;  3IOR A;  1JVY A;  4RPO A;  5L9M A;  1A54 A;  1XS5 A;  1VSO A;  4QFO A;  3GYY A;  1Y1Z A;  2XXP A;  2XA5 A;  1MG1 A;  1KWH A;  4MBP A;  3UGW A;  1JQF A;  4PFT A;  3ZKK A;  2XXX A;  1YPN A;  2B65 A;  2OZZ A;  2XXQ A;  1HSJ A;  3THI A;  3C36 A;  3TQL A;  5HBC A;  4M4G A;  2WYP A;  3KG2 A;  2ZYN A;  1UQW A;  3MP8 A;  4R73 A;  3CR9 A;  2Y84 A;  1VE4 A;  2XX8 A;  2O6A A;  3TEL A;  5ICT A;  4Q30 B;  3SES A;  5HPQ A;  5DT6 A;  3FAT A;  1US5 A;  2DVZ A;  1ZKB A;  3SER A;  1IXI A;  1UIV A;  3FVO A;  4N4U A;  3EHS A;  1ZTY A;  2QS1 A;  3FZV A;  4LVQ A;  1EH3 A;  3ZS6 A;  2PYY A;  4QFK A;  3RY3 A;  3OOA A;  1UTB B;  1NH7 A;  3C34 A;  3O29 A;  1B32 A;  2HXW A;  4O8M A;  2I3W A;  1LST A;  4G2Z A;  2ZXT A;  4HS7 A;  2P2A A;  4QSE A;  3UOR A;  3EQ1 A;  3IK6 B;  2R71 A;  1FTM A;  5I2K B;  1Z7N E;  2QSX A;  4F1Y A;  2XWI A;  5CBS A;  4N13 A;  4Z7E A;  3M8U A;  3OEK A;  3L6H A;  2NXO A;  4IO5 A;  3HCQ A;  4R75 A;  2IA4 A;  1QUJ A;  3MQ9 A;  1QKB A;  2O51 A;  2F5X A;  2GHA A;  3T93 B;  4NWC A;  3T96 B;  4LA9 A;  5BUU A;  1A7L A;  1FTO A;  3E4R A;  3K6X A;  3FJM A;  4DE8 A;  1T0K A;  3KFM A;  2OK2 A;  2REJ A;  3N6U A;  4DCY A;  4FEB A;  2VPN A;  4U22 A;  1M5B A;  5JEI A;  4H1X A;  4R2F A;  2G93 A;  4YMB A;  2H5Y A;  2X7Q A;  4AB5 A;  3RNN A;  2FYI A;  3SEX A;  3O97 A;  1PB9 A;  4F3B A;  1P1N A;  3FIR A;  5AA3 A;  1MPB A;  3ILU B;  3ILT B;  1BP5 A;  4PDH A;  3GLB A;  4JXI A;  1RYO A;  1MY1 A;  4Q0C A;  1R1N A;  2V4C A;  1XHY A;  1B0L A;  1ANF A;  2F34 A;  4N91 A;  4PP0 A;  4MHF A;  5H8N B;  3MPL A;  1URD A;  3A3C A;  3FJ7 A;  5I2K A;  4YZZ A;  1N76 A;  2HPG A;  5LTC A;  4PAI A;  4OVP A;  1VR5 A;  3QAX A;  1Y1M A;  4ESW A;  4ND9 A;  3IOU A;  1LGB C;  4X1D A;  4YKJ A;  4N17 A;  1PBP A;  5B7D A;  1J1N A;  3TUS A;  2KLF A;  3QIM A;  4N6D A;  1GGG A;  3MZ9 A;  3DP4 A;  5JTY B;  2DE4 A;  2OWT A;  1TFA A;  1MY2 A;  3H03 A;  4O3B A;  3TQW A;  2XWK A;  3MWB A;  4ZED A;  1GV8 A;  4GRK A;  3HO7 A;  4ZZE A;  1LB9 A;  5AA4 B;  2QS2 A;  4NF4 B;  3MUQ A;  3IX1 A;  1LBB A;  1LAG E;  2PBW A;  4LN5 A;  2V84 A;  5I59 B;  2PFY A;  3ONM A;  1DTZ A;  3CG1 A;  1B3G A;  2O1L A;  3RGY A;  4HW8 A;  1AH5 A;  4F39 A;  4EQ7 A;  5H8N A;  1IUD A;  3N94 A;  1A8E A;  5FHM A;  4POX A;  3U8Q A;  2D3I A;  2F36 A;  4F2O A;  3RLF E;  3K00 A;  1FQA A;  2DXR A;  1ZIU A;  3TZA A;  2V3U A;  2QS4 A;  2HZK A;  2VHA A;  3V5A A;  2LAO A;  3G3G A;  2PT2 A;  3K6W A;  3B6W A;  1I6A A;  1CE2 A;  4OZ9 A;  3QSL A;  4U2R A;  5JTY A;  4YB5 A;  4XKN A;  4PFY A;  5H8Q A;  4LZ8 A;  5TPA A;  5TP9 A;  4AB6 A;  2OBG A;  3FAS A;  4ZEI A;  4LON B;  5AA4 A;  4NF4 A;  1ZBM A;  5I2N B;  4BDL A;  4RK9 A;  2Z8D A;  1SDX A;  1S7Y A;  3KZG A;  3PGF A;  5ITP A;  1O7T A;  3FXQ A;  4LZ5 A;  1M5F A;  4I8C A;  3KN7 A;  3QYT A;  4TOZ A;  1A99 A;  1B5I A;  3L6G A;  5I59 A;  3W15 C;  3N5L A;  4X1B A;  2XXK A;  2B3B A;  2PFZ A;  2I0B A;  4JDF A;  2XXI A;  3SDF A;  2Q88 A;  2NUV A;  4LZ7 A;  3SEY A;  2F97 A;  4ZEF A;  3TTL A;  5H8S A;  5DEX B;  1B9J A;  4GIZ A;  1GTK A;  5AA2 A;  2UXA A;  3OXN A;  2XXW A;  3OO8 A;  4RA1 A;  4ISU A;  3RTW B;  5H8H B;  2RC7 A;  2XX7 A;  1MS7 A;  4X9T A;  2ESN A;  3R26 A;  1LFI A;  3JYR A;  1MXU A;  3I3V A;  4QFN A;  1MQH A;  3TYH A;  5CRY A;  2IEE A;  2Z8E A;  3A3U A;  4R9F A;  2F7B A;  4ZDM A;  2DWI A;  1B1X A;  1NKX A;  1NMU A;  4OEN A;  4LP2 B;  2UVJ A;  1JVX A;  4L17 A;  4EXL A;  3TCH A;  1N3X A;  2Q8J A;  2A5S A;  4KCC A;  1IEJ A;  5I2N A;  1PB7 A;  4MNP A;  1N7W A;  2QJE A;  2NWJ A;  1A40 A;  1YAE A;  1O64 A;  1I6B A;  1B58 A;  4IO3 A;  2R6G E;  3FV2 A;  1SW2 A;  5KDT B;  3K02 A;  4I1D A;  3V83 A;  5DTB A;  1D9V A;  4HCW A;  4OYV A;  3MJN A;  4PFW A;  2XD3 A;  2ZNS A;  3MBP A;  1A55 A;  3H6T A;  3IOW A;  3MAM A;  1QUK A;  4ELQ A;  1AIV A;  3FXU A;  4PFI A;  4FJP A;  4OVQ A;  2DWA A;  4FAT A;  2HAU A;  1FQE A;  4K3F A;  4MEV A;  2O7U A;  5I56 B;  4KCD A;  3VFJ A;  1FTK A;  3PMV A;  2F78 A;  2CZL A;  1SW4 A;  4NWD A;  2QPQ A;  1SW1 A;  4GL0 A;  3BKI B;  4ZEK A;  5FHO A;  4U21 A;  3LR1 A;  4PAK A;  3CSG A;  4YB6 A;  2HCA A;  1B3L A;  5JK4 A;  2O1M A;  4BDQ A;  1NL5 A;  3SEW A;  5CC2 A;  3N26 A;  5I58 A;  5DVI A;  4IO6 A;  5M2V A;  4RPN A;  3PUV E;  1B5H A;  1JW5 A;  3TFL A;  3IB1 A;  1XVY A;  3RN8 A;  4XXU A;  3K6U A;  5KDT A;  5F1Q A;  4MX6 A;  3UK4 A;  4GQO A;  2HEU A;  2VOZ A;  1FTL A;  1IIW A;  4TLL B;  3KN3 A;  3E3K A;  4WED A;  2VD3 A;  1D9Y A;  1B2H A;  3O6H A;  4G68 C;  4U1Z A;  5IAI A;  5EYF A;  3DM0 A;  1N0T A;  1ZU0 A;  4PAF A;  5I57 B;  1YCJ A;  3PV0 E;  3D4G A;  1NNP A;  4GFR A;  1MDP 1;  4GF8 A;  3VVD A;  4P8B A;  4ELP A;  5I56 A;  1FQD A;  3KSX A;  3K1N A;  1Y9U A;  2Y7I A;  2ZZX A;  1YTV A;  1O63 A;  3GBA A;  5DVF A;  4G68 A;  4O3A A;  1I69 A;  2GFE A;  4P56 A;  4QFP A;  3PMW A;  3OO7 A;  2P0S A;  4OVT A;  1SVX B;  1B4Z A;  4WEP A;  3EHT A;  2XXY A;  3HHG A;  4R74 A;  1OQG A;  3S4U A;  1MY3 A;  2DXY A;  4OXV A;  4FED A;  2O69 A;  5ELV A;  3BFT A;  2ZZW A;  2V3T A;  4H5G A;  1OLA A;  1Z7M E;  3HHF A;  2XXV A;  4XKP A;  1MXV A;  1Q35 A;  4NF8 B;  2A5T B;  4G4P A;  3C4M A;  1MQD A;  2Z23 A;  2RCA A;  2AL5 A;  4R6Y A;  4FE8 A;  3BFU A;  1IXH A;  4OFO A;  5EHS A;  1ELJ A;  2O84 X;  5I7I A;  4OTE A;  3MPK A;  5J1D A;  2VD2 A;  4OVJ A;  4RNS A;  4F2Q A;  5CMM A;  5I57 A;  2XXH A;  3CG3 A;  4UAC A;  4BDR A;  1SW5 A;  3E13 X;  2I49 A;  3W9V A;  1D3K A;  1MRP A;  2ONK E;  1XT8 A;  5AA1 A;  1MM7 A;  1D4N A;  4EXK A;  3VXB A;  4HCY A;  2DSF A;  2AIX A;  4H65 A;  2XXU A;  3PPN A;  3S9L C;  1FQF A;  4IY5 A;  3KEI A;  4OES A;  1LAF E;  1WVJ A;  4EF1 A;  3H6V A;  1UTB A;  1Y3P A;  4OER A;  2DWJ A;  2CEX A;  3VV5 A;  3JV9 A;  4JWO A;  5FTH A;  3IR1 A;  3S9N C;  1AL3 A;  1B7U A;  1IZ1 A;  1I6Q A;  1MPC A;  1OLC A;  3MVX A;  3N6T A;  3FUZ A;  5K2X A;  2H98 A;  4IB2 A;  3FJG A;  3CFX A;  4DLD A;  4P0G A;  3ZSF A;  3CFL A;  3USD A;  3V8X B;  3GZG A;  4RXL A;  3M3F A;  3PPQ A;  4PDD A;  3M3L A;  2THI A;  3U94 A;  3TDJ A;  4NF8 A;  5I5P A;  1H43 A;  3C9H A;  4C1U A;  3TTK A;  3TPA A;  4GVO A;  2CMO A;  3GBB A;  1DSN A;  5CMB A;  1PB8 A;  4PF6 A;  2B3F A;  3FXB A;  2F7C A;  4M1V A;  4JSD A;  4NN3 A;  2VPO A;  5ICQ A;  2OCU A;  4H6D A;  3G3H A;  4WKM A;  2Q2A A;  3S9M C;  2ALU A;  3Q28 A;  3I5O A;  4OA4 A;  2PMS A;  3G3I A;  3B50 A;  1SI0 A;  1SQY A;  1CB6 A;  3KBR A;  2RIN A;  3HST A;  2NOO A;  4FOR A;  4KI0 E;  3QK6 A;  4KYS A;  3TAJ A;  1FW0 A;  3VXC A;  1FCK A;  2UVH A;  4KR5 A;  1BKA A;  3WAF A;  3D4C A;  4E0X A;  4C0R A;  3OEM A;  2W7Y A;  3R7X A;  4DXC A;  2I58 A;  1EZP A;  2DE2 A;  3Q25 A;  3MVW A;  2QMX A;  4NGU A;  1XVX A;  4XF5 A;  1QUI A;  4OWD A;  4P3L A;  3S2V A;  1TXF A;  2DQV A;  3TOD A;  1MY0 A;  1B05 A;  4XIG Q;  5CMK A;  1OIB A;  4JWX A;  2YJP A;  1RYX A;  3TCG A;  4POW A;  2FNC A;  3TMG A;  4C1T A;  2D21 A;  1XC1 A;  4R6K A;  2UVI A;  5IKB A;  3QXM A;  5BWJ A;  1DPE A;  1N84 A;  1URS A;  4DIG A;  4OET A;  4N6K A;  4NG7 A;  2REG A;  1XOC A;  5IZZ A;  1MXZ A;  3IOV A;  4RJZ A;  1LFG A;  5CM6 A;  3KGC A;  2HQ0 A;  1LAH E;  1Y4T A;  1B3H A;  3O66 A;  2UYE A;  4KPT A;  4PGP A;  3E9X A;  4TLM B;  3IO6 A;  4KYE A;  2E1S A;  4F1V A;  2VP1 A;  1Y20 A;  1GR2 A;  3JZJ A;  1P1Q A;  4R6H A;  3O6G A;  1PEB A;  1A8F A;  2E0S A;  3H6W A;  3SEU A;  3MVZ A;  4KHZ E;  4ONY A;  4DZ1 A;  2HFB A;  2V93 A;  2ZZV A;  1M5D A;  2UVG A;  4LAT A;  1PBQ A;  4YMA A;  1SYH A;  1B7H A;  2Y7P A;  4P0I A;  1MXW A;  3KOS A;  4NE4 A;  4LQ2 A;  2ZYM A;  4RK2 A;  4MCO A;  2M8C A;  3K0V A;  1OMP A;  3T22 A;  3U1O A;  4N6P A;  4BDM A;  5DVJ A;  3I6V A;  3RQT A;  3VLW A;  4LUB A;  3LSW A;  1B7Z A;  4PCD A;  3OSQ A;  4LQ5 A;  1B40 A;  1URG A;  3U92 A;  3MZ1 A;  1VFE A;  3EHU A;  3KSJ A;  3CRB A;  5ISU A;  4IO4 A;  2Y7R A;  1BIY A;  1WDN A;  4DXU A;  5LOM A;  1L5T A;  3ECR A;  3UP9 A;  2F6G A;  4F3P A;  4U4S A;  3FV1 A;  3CI8 A;  1F9B A;  4ZZA A;  2OLB A;  4P1L A;  5H8F B;  3G3K A;  1B3E A;  4TQU Q;  3PUW E;  1IXC A;  2ZNT A;  3PMX A;  2XX9 A;  3VVE A;  4NMY A;  4NF5 B;  3MP1 A;  3Q26 A;  4U23 A;  1FQC A;  1MH3 A;  4RYA A;  2I6E A;  4OFJ A;  4PQJ A;  3O28 A;  5K2Y A;  4EQ9 A;  1S50 A;  4DI4 B;  2ABH A;  1FQB A;  5DEX A;  3VE1 B;  4EF2 A;  3FVK A;  2I3V A;  4JSO A;  4GOT A;  3MC2 A;  4P47 A;  4MF3 A;  1LCF A;  3KN8 A;  3VDF A;  5H8H A;  3DLN A;  4GXA A;  3HV1 A;  2WKY A;  2F6P A;  1PDA A;  3K1M A;  2QS3 A;  1HSL A;  1JNF A;  1B51 A;  4N15 A;  4QSD A;  4XKQ A;  4P11 A;  2O68 A;  5DYH A;  5IGA A;  1QUL A;  4OQO A;  4MMP A;  4FAJ A;  1QJM A;  4YB7 A;  4F22 A;  4OFL A;  4KFQ A;  3P7I A;  3O2A A;  4G8N A;  3UN6 A;  1ZJL A;  1USY E;  3W9W A;  5H8F A;  3IB2 A;  2RC9 A;  3MVY A;  1LB8 A;  1OVB A;  2DWH A;  1MH4 A;  4OEU A;  4ZEC A;  4PF8 A;  4YIC A;  4NF5 A;  3S9E A;  4NF0 A;  4MLQ A;  3T66 A;  2DS9 A;  3T9V A;  4X04 A;  1Q1K A;  4DCX A;  4GLI A;  2UYF A;  1IIT A;  3K2D A;  2H9B A;  3G7W A;  3O9P A;  1H76 A;  2QL3 A;  3PD8 A;  4IY6 A;  1JW1 A;  4EUO A;  4F31 B;  3LC8 A;  3CSB A;  1P1U A;  1SBP A;  2YLN A;  1B46 A;  1MPD A;  2Y7K A;  4AQ4 A;  2PT1 A;  1JEV A;  2QRY A;  5L9O A;  3IO4 A;  1MXY A;  4ELR A;  3RUM A;  4ESX A;  4P1E A;  1ZMG A;  1IQ7 A;  2XXT A;  2I4B A;  5TU0 A;  4ZE9 A;  3K6V A;  4XTC Q;  2RKM A;  5IM2 A;  3EPE A;  5F7V A;  4GWO A;  3IJX B;  3VLU A;  4H5F A;  1EZO A;  4R2B A;  5FHN A;  3SKP A;  2Z22 A;  1DTG A;  2V3Q A;  2DE3 A;  3ODB A;  2WX9 A;  3B6T A;  4NHB A;  3PUY E;  2X7P A;  4N8G A;  3IJO B;  3A09 A;  2ZYK A;  3H7M A;  3H6U A;  4OMB A;  2NVU B;  3LBS A;  4NF6 B;  2Q9T A;  2OJT A;  4MH5 A;  4DDD A;  3WAE A;  4ZEB A;  4WXJ A;  1Y3Q A;  1OVT A;  3TKD A;  1NFT A;  4MLV A;  2G29 A;  3V89 B;  2VGQ A;  1H3D A;  3LSL A;  1MQJ A;  4G8M A;  1USY H;  3CFZ A;  1B3F A;  4PFB A;  4IGT A;  3U93 A;  4R72 A;  2I0C A;  3FVG A;  3H06 B;  1Y4C A;  2X26 A;  3PPR A;  2F7A A;  4QRZ A;  4DI3 D;  2DYX A;  4EDP A;  2D5W A;  3EF7 A;  4QHQ A;  2XXR A;  2XWV A;  2GRV A;  4F29 A;  1VFD A;  2Y7W A;  2ZNU A;  2RF1 A;  1UTH B;  3SEV A;  4YKK A;  1NNF A;  3RPW A;  1NNK A;  3MW0 A;  3OSR A;  1LLS A;  4YKI A;  4KYD A;  2XHD A;  1SD3 A;  4I9D A;  4HTG A;  1B5J A;  4NX1 A;  2ONS A;  2H25 A;  5L8D A;  2CEY A;  2WYK A;  2XWO A;  1M5E A;  3DP8 A;  4F19 A;  3M3K A;  1N7X A;  4NF6 A;  5HM4 B;  2A5T A;  3IOT A;  1UIU A;  4H0W A;  4F3S A;  4PC9 A;  4F1U A;  4OEV A;  3TTR A;  1GVC A;  1BLF A;  4U4X A;  3SET A;  4GXS B;  4O94 A;  1ZLQ A;  3T9X B;  1S9T A;  4BDO A;  4OAN A;  1FTJ A;  3IL1 B;  5CI5 A;  1B0H A;  3KJT A;  4QSC A;  4O3C A;  4H67 A;  5B70 A;  2P1S A;  2ZYO A;  4GD5 A;  1NNT A;  2O7I A;  4XEQ A;  1PC3 A;  3FXR A;  3C32 A;  4N07 A;  3C31 A;  1QKA A;  2ANJ A;  3PD9 A;  1OQH A;  2XD2 A;  3T9H B;  4MNC A;  1UTH A;  5KZT A;  2QMW A;  3PUX E;  3G3F A;  4XFE A;  2HAV A;  5EHM A;  2DVC A;  1IXG A;  1P99 A;  5H8Q B;  1JET A;  1SYI A;  5TPA B;  5TP9 B;  4NAP A;  1RKM A;  5AE4 A;  2ZMB A;  4NTL A;  3R6U A;  2ONR A;  4E0W A; 
#chains in the Genus database with same CATH topology
 4MAG A;  1FPE A;  3RT8 A;  1P1W A;  3IAZ A;  3BIG A;  1EZ9 A;  3PUZ E;  3C33 A;  4GBV A;  3UA8 A;  2F35 A;  5ITO A;  4ECF A;  3MZB A;  1Y3N A;  3OMB A;  1KA0 A;  3PPO A;  3DEL B;  1R9Q A;  1ATG A;  2AL4 A;  4F3G A;  1LBC A;  1QGX A;  4KD5 A;  3CIJ A;  1WOD A;  4ELO A;  4ZS9 A;  5A5X B;  4P9K A;  4F18 A;  3Q27 A;  3OO6 A;  3EN3 A;  2FIE A;  1FBC A;  1EU8 A;  3RTF B;  3H3G A;  3KOT A;  4IO7 A;  3FD3 A;  1H44 A;  4PBQ A;  5AA2 B;  4OHN A;  3VVF A;  3AXF A;  3K4U A;  4MNI A;  3G3J A;  4YKP A;  1B52 A;  1BTJ A;  4Q8R A;  4OVS A;  3TCF A;  1NI9 A;  4X8R A;  1QVS A;  3U72 A;  1NH8 A;  4MFI A;  2HZL A;  4FIM A;  4G8H A;  1MM6 A;  4U1O A;  1US4 A;  3RYD A;  3QMF A;  4ZE8 A;  1DMB A;  1B4H A;  4KQP A;  4O7I A;  3ISP A;  5L9S A;  1SI1 A;  1LCT A;  3KC0 A;  2OWS A;  2GH9 A;  4O7M A;  3F11 A;  1TFD A;  1MQI A;  4IGR A;  4XKR A;  3FVN A;  2H99 A;  5ET8 A;  1MY4 A;  1N3W A;  2FA7 A;  4NQ8 A;  4JBZ A;  1JW4 A;  4GL8 A;  3B7D A;  2H4I A;  1EYI A;  3B6Q A;  1POY 1;  1M5C A;  4QBA A;  4G77 A;  1LFH A;  5EYG A;  2F3B A;  5A5X A;  3IB0 A;  3KJ7 A;  4QF9 A;  5I84 A;  4H8I A;  3TTN A;  5KCJ B;  1R6Z A;  2Q74 A;  3HN0 A;  5CMC A;  2OX3 A;  5EQ8 A;  3K1P A;  4PBH A;  3U65 A;  3O6I A;  1FSA A;  4MIJ A;  2I48 A;  4Z0I A;  4H8J A;  3LSX A;  4YU0 A;  2DOJ A;  1II5 A;  3TEP A;  4GWX A;  4PFU A;  4PET A;  3Q29 A;  4UA8 A;  4PE3 A;  4NED A;  4JVC A;  4OVR A;  1BK4 A;  2RC8 A;  4JB7 A;  4QFL A;  3OEL A;  3LUY A;  3BBR A;  1DOT A;  1MXX A;  4GX4 A;  3MP6 A;  1HSE A;  3CVG A;  3UIF A;  1DPP A;  3OO9 A;  1TT1 A;  1P1O A;  2YPN A;  2Z8F A;  2GHB A;  4N8Y A;  5FTI A;  4PFR A;  3ZKL A;  4FEC A;  1H45 A;  3HPI A;  3QUJ A;  4PGN A;  1YXI A;  2FIX A;  4BLA A;  5I58 B;  1FPL A;  4MJO A;  4UAB A;  1LAX A;  1AMF A;  4RY1 A;  1POT A;  2R8T A;  1KZ8 A;  5CBR A;  4PE5 B;  3QUF A;  4YAH X;  4DXB A;  2V25 A;  3C35 A;  4BDN A;  3RT6 B;  2Q89 A;  1MDQ A;  1QW0 A;  4EQB A;  1R9L A;  1FPB A;  1JEU A;  4JWY A;  5KCJ A;  5AA2 D;  3VLV A;  3TTM A;  1B6H A;  1N04 A;  1MQG A;  1FPJ A;  2CZK A;  1B1H A;  4X48 A;  2PVU A;  2PX1 A;  1TWY A;  2I4C A;  5IZ1 A;  3DP6 A;  2RCB A;  3PPP A;  2DP8 A;  2R9J A;  3GXA A;  2BJJ X;  3PU5 A;  4GX6 A;  3LSF B;  3OD7 A;  4QXD A;  3OEN A;  1AOV A;  3FGS A;  4THI A;  2F8D A;  2QFL A;  3H4Z A;  4I62 A;  4G68 B;  3T9U A;  4R9G A;  4IO2 A;  2FBP A;  3K01 A;  2Q2C A;  2AYS A;  4Q5T A;  4G61 A;  3IOR A;  1JVY A;  4RPO A;  5L9M A;  3SZP A;  1A54 A;  1RDZ A;  1XS5 A;  1VSO A;  4QFO A;  3GYY A;  1Y1Z A;  2XXP A;  1LBV A;  2XA5 A;  1CNQ A;  1MG1 A;  1KWH A;  4MBP A;  3UGW A;  1JQF A;  4PFT A;  3ZKK A;  2XXX A;  1YPN A;  2B65 A;  2OZZ A;  2XXQ A;  1HSJ A;  1IMD A;  3THI A;  3C36 A;  3TQL A;  5HBC A;  4M4G A;  2WYP A;  3KG2 A;  2ZYN A;  1UQW A;  3MP8 A;  4R73 A;  3CR9 A;  2Y84 A;  1VE4 A;  1Q9D A;  2XX8 A;  2O6A A;  5IZ3 A;  3TEL A;  5ICT A;  4Q30 B;  3SES A;  5HPQ A;  5DT6 A;  3FAT A;  1US5 A;  2DVZ A;  1ZKB A;  3SER A;  1IXI A;  1UIV A;  3FVO A;  4N4U A;  3EHS A;  1ZTY A;  2QS1 A;  3FZV A;  4LVQ A;  1EH3 A;  3ZS6 A;  2PYY A;  4GWU A;  2HHM A;  4QFK A;  3KBZ A;  3RY3 A;  3OOA A;  1LBZ A;  1UTB B;  1NH7 A;  3C34 A;  3O29 A;  1B32 A;  2HXW A;  4O8M A;  2I3W A;  1LST A;  4G2Z A;  2ZXT A;  4HS7 A;  3E78 A;  2P2A A;  4QSE A;  3UOR A;  3EQ1 A;  3IK6 B;  2R71 A;  3LUZ A;  1FTM A;  5I2K B;  1Z7N E;  2QSX A;  4F1Y A;  2XWI A;  5CBS A;  4N13 A;  4Z7E A;  3M8U A;  3OEK A;  3L6H A;  2NXO A;  4IO5 A;  3HCQ A;  4R75 A;  2IA4 A;  2CZH A;  1QUJ A;  3MQ9 A;  1QKB A;  2O51 A;  2F5X A;  2KQZ A;  2GHA A;  3T93 B;  4NWC A;  3T96 B;  4LA9 A;  5BUU A;  1A7L A;  1FTO A;  3E4R A;  3K6X A;  3FJM A;  4DE8 A;  1T0K A;  3KFM A;  2OK2 A;  1LBY A;  4HXV A;  2REJ A;  3N6U A;  4DCY A;  1G0H A;  4FEB A;  2VPN A;  4U22 A;  1M5B A;  5JEI A;  4H1X A;  4R2F A;  2G93 A;  3ROJ A;  4YMB A;  2H5Y A;  1INP A;  2X7Q A;  1NV5 A;  4AB5 A;  3RNN A;  2FYI A;  2VT5 A;  1IMC A;  3SEX A;  3PTY A;  3O97 A;  1PB9 A;  2Y5L A;  4F3B A;  1P1N A;  3FIR A;  5AA3 A;  1MPB A;  4HE2 A;  5T3J A;  3ILU B;  3ILT B;  3IFC A;  1BP5 A;  4PDH A;  3GLB A;  4JXI A;  1RYO A;  1MY1 A;  4Q0C A;  1R1N A;  2V4C A;  1XHY A;  1B0L A;  1ANF A;  2F34 A;  4N91 A;  1D9Q A;  4PP0 A;  4MHF A;  5H8N B;  3MPL A;  1URD A;  1RDX A;  3A3C A;  1JP4 A;  2HXR A;  3FJ7 A;  5I2K A;  4YZZ A;  2B4M A;  1N76 A;  2HPG A;  5LTC A;  4PAI A;  4OVP A;  1VR5 A;  3QAX A;  1Y1M A;  4ESW A;  4ND9 A;  3IOU A;  1LGB C;  4X1D A;  4YKJ A;  4N17 A;  1PBP A;  5B7D A;  1J1N A;  3TUS A;  2KLF A;  3QIM A;  4N6D A;  1GGG A;  3MZ9 A;  3DP4 A;  5JTY B;  2DE4 A;  2OWT A;  1TFA A;  1MY2 A;  3H03 A;  4O3B A;  3TQW A;  2XWK A;  3MWB A;  4ZED A;  1GV8 A;  4GRK A;  3HO7 A;  4ZZE A;  1LB9 A;  2BJI A;  5AA4 B;  2QS2 A;  4NF4 B;  3MUQ A;  3IX1 A;  1FBE A;  1LBB A;  1LAG E;  2PBW A;  4LN5 A;  2V84 A;  5I59 B;  2PFY A;  3ONM A;  1DTZ A;  3CG1 A;  1B3G A;  2O1L A;  3RGY A;  4HW8 A;  1AH5 A;  1FTA A;  4F39 A;  4EQ7 A;  5H8N A;  1FBP A;  1IUD A;  3N94 A;  1A8E A;  1FJ9 A;  5FHM A;  4POX A;  3U8Q A;  4GBW A;  2D3I A;  2F36 A;  4F2O A;  3RLF E;  3K00 A;  4PTK A;  1FQA A;  2DXR A;  1ZIU A;  2WEF A;  3TZA A;  2V3U A;  2QS4 A;  2HZK A;  2VHA A;  3RPL A;  3V5A A;  2LAO A;  3G3G A;  2PT2 A;  3K6W A;  3B6W A;  1I6A A;  1CE2 A;  4OZ9 A;  3QSL A;  4U2R A;  5JTY A;  4YB5 A;  4XKN A;  4PFY A;  5H8Q A;  4LZ8 A;  5TPA A;  5TP9 A;  4AB6 A;  3B8B A;  2OBG A;  2PCR A;  3LV0 A;  3FAS A;  4ZEI A;  4LON B;  5AA4 A;  4NF4 A;  1ZBM A;  2OWZ A;  5I2N B;  5I3S A;  4BDL A;  4RK9 A;  2Z8D A;  1SDX A;  1S7Y A;  3KZG A;  3PGF A;  5ITP A;  1O7T A;  3FXQ A;  4LZ5 A;  1M5F A;  4I8C A;  3KN7 A;  3QYT A;  4TOZ A;  1A99 A;  1B5I A;  3L6G A;  5I59 A;  3W15 C;  3N5L A;  2XXK A;  4X1B A;  5LDZ A;  2B3B A;  2PFZ A;  2I0B A;  4JDF A;  2XXI A;  3SDF A;  2Q88 A;  2NUV A;  4LZ7 A;  1YYZ A;  4KXP A;  3SEY A;  2F97 A;  4ZEF A;  3TTL A;  1DK4 A;  5H8S A;  5DEX B;  1B9J A;  4GIZ A;  1GTK A;  4HE0 A;  5AA2 A;  2UXA A;  3OXN A;  2XXW A;  3OO8 A;  5EQA A;  4RA1 A;  4ISU A;  3RTW B;  5H8H B;  2RC7 A;  2XX7 A;  1MS7 A;  4X9T A;  2ESN A;  3R26 A;  1LFI A;  3JYR A;  1MXU A;  1NV2 A;  3I3V A;  4H45 A;  4QFN A;  2B4L A;  1MQH A;  3TYH A;  5CRY A;  2IEE A;  2Z8E A;  3A3U A;  4R9F A;  2F7B A;  4ZDM A;  2DWI A;  5F24 A;  1B1X A;  1FPF A;  1NKX A;  1NMU A;  4OEN A;  4LP2 B;  2UVJ A;  1JVX A;  1FBH A;  4L17 A;  4EXL A;  2MKZ A;  1N3X A;  2Q8J A;  3TCH A;  2A5S A;  4KCC A;  1IEJ A;  5I2N A;  2CZI A;  1PB7 A;  4MNP A;  1N7W A;  2QJE A;  2NWJ A;  1A40 A;  1YZ0 A;  1YAE A;  1O64 A;  1I6B A;  1B58 A;  4IO3 A;  2R6G E;  3FV2 A;  1SW2 A;  2WBD A;  5KDT B;  3K02 A;  1LBX A;  4I1D A;  3V83 A;  5DTB A;  1D9V A;  4HCW A;  4OYV A;  3MJN A;  4PFW A;  5EQ7 A;  2XD3 A;  1FBD A;  2ZNS A;  3MBP A;  1NUY A;  1A55 A;  3H6T A;  3IOW A;  3MAM A;  1QUK A;  4ELQ A;  1AIV A;  3FXU A;  4PFI A;  4FJP A;  4OVQ A;  2DWA A;  4FAT A;  2HAU A;  1FQE A;  4K3F A;  4MEV A;  2O7U A;  1DBZ A;  5I56 B;  4KCD A;  3VFJ A;  1FTK A;  3PMV A;  2F78 A;  2CZL A;  1SW4 A;  4NWD A;  2QPQ A;  1SW1 A;  4GL0 A;  3BKI B;  5ET7 A;  4ZEK A;  5FHO A;  4U21 A;  3LR1 A;  4PAK A;  1NV0 A;  1AWB A;  3CSG A;  4YB6 A;  2HCA A;  1B3L A;  5JK4 A;  2O1M A;  4BDQ A;  1NL5 A;  2QVR A;  3SEW A;  5CC2 A;  1IMB A;  3N26 A;  5I58 A;  5DVI A;  4IO6 A;  5M2V A;  4H46 A;  3PUV E;  4RPN A;  1B5H A;  2Q8M A;  1JW5 A;  3TFL A;  3IB1 A;  1XVY A;  3RN8 A;  4XXU A;  3K6U A;  5KDT A;  5F1Q A;  4MX6 A;  3UK4 A;  4GQO A;  2HEU A;  2VOZ A;  1FTL A;  5FBP A;  1IIW A;  4TLL B;  3KN3 A;  3E3K A;  4WED A;  2VD3 A;  4GWZ A;  1D9Y A;  1B2H A;  3O6H A;  4G68 C;  4U1Z A;  5IAI A;  5EYF A;  3DM0 A;  1N0T A;  1ZU0 A;  4PAF A;  5I57 B;  1YCJ A;  3PV0 E;  3D4G A;  1NNP A;  4GFR A;  5ET6 A;  1MDP 1;  3D1R A;  4GF8 A;  4P8B A;  1K9Y A;  3VVD A;  4ELP A;  5I56 A;  1FQD A;  3KSX A;  3K1N A;  1Y9U A;  2Y7I A;  2ZZX A;  1YTV A;  1O63 A;  3GBA A;  5DVF A;  4G68 A;  4O3A A;  3EKI A;  1I69 A;  2GFE A;  4P56 A;  4QFP A;  3PMW A;  3OO7 A;  2P0S A;  4OVT A;  1SVX B;  1B4Z A;  4WEP A;  3EHT A;  2XXY A;  1SPI A;  3HHG A;  4R74 A;  1OQG A;  3S4U A;  1MY3 A;  1IMA A;  4GWY A;  2DXY A;  4OXV A;  4FED A;  2O69 A;  5ELV A;  3BFT A;  2ZZW A;  2V3T A;  4H5G A;  1K9Z A;  1OLA A;  1Z7M E;  2XXV A;  3HHF A;  4XKP A;  1MXV A;  1Q35 A;  4NF8 B;  2A5T B;  4G4P A;  3C4M A;  1MQD A;  2Z23 A;  5EQ9 A;  2RCA A;  2AL5 A;  4R6Y A;  4FE8 A;  2Y5K A;  3BFU A;  1NUW A;  1IXH A;  4OFO A;  5EHS A;  1ELJ A;  2O84 X;  5I7I A;  4OTE A;  3MPK A;  5EYH A;  5J1D A;  2VD2 A;  4OVJ A;  4RNS A;  4F2Q A;  5CMM A;  5I57 A;  2XXH A;  3CG3 A;  4UAC A;  4BDR A;  1SW5 A;  3E13 X;  2I49 A;  3W9V A;  1D3K A;  1MRP A;  2ONK E;  1XT8 A;  5AA1 A;  1MM7 A;  1D4N A;  1FPG A;  4EXK A;  3VXB A;  4HCY A;  2DDK A;  2DSF A;  2AIX A;  4H65 A;  2XXU A;  3PPN A;  3S9L C;  1FQF A;  4IY5 A;  3KEI A;  4OES A;  1LAF E;  1WVJ A;  4EF1 A;  3H6V A;  2FVZ A;  1UTB A;  3T1B A;  1Y3P A;  4OER A;  2DWJ A;  2CEX A;  3VV5 A;  3JV9 A;  2WBB A;  4JWO A;  5FTH A;  3IR1 A;  3S9N C;  1AL3 A;  1B7U A;  1IZ1 A;  1I6Q A;  1MPC A;  1OLC A;  3MVX A;  3N6T A;  3FUZ A;  5K2X A;  2H98 A;  4IB2 A;  3FJG A;  3CFX A;  4DLD A;  4FBP A;  4P0G A;  3ZSF A;  3CFL A;  3USD A;  3V8X B;  3GZG A;  4RXL A;  3M3F A;  3PPQ A;  4PDD A;  3M3L A;  2THI A;  3U94 A;  3TDJ A;  4NF8 A;  5I5P A;  1H43 A;  3C9H A;  4C1U A;  3TTK A;  3TPA A;  4GVO A;  2CMO A;  3GBB A;  1DSN A;  5CMB A;  1PB8 A;  4PF6 A;  2B3F A;  3FXB A;  2F7C A;  4M1V A;  2P3N A;  4JSD A;  4NN3 A;  2VPO A;  5ICQ A;  2OCU A;  4H6D A;  3G3H A;  4N81 A;  4WKM A;  2Q2A A;  3S9M C;  2ALU A;  5DW8 A;  3Q28 A;  3I5O A;  1LEV A;  4OA4 A;  2PMS A;  3G3I A;  3B50 A;  1SI0 A;  1SQY A;  1CB6 A;  3KC1 A;  3KBR A;  3T0J A;  2RIN A;  3HST A;  2NOO A;  4FOR A;  4KI0 E;  3CHG A;  3QK6 A;  4KYS A;  3TAJ A;  1FW0 A;  3VXC A;  1FCK A;  2UVH A;  3E79 A;  4KR5 A;  1BKA A;  3WAF A;  3D4C A;  4E0X A;  4C0R A;  3OEM A;  2W7Y A;  3R7X A;  4DXC A;  2I58 A;  1EZP A;  2DE2 A;  3Q25 A;  3MVW A;  2QMX A;  4NGU A;  1XVX A;  4XF5 A;  1QUI A;  4P3L A;  4OWD A;  3S2V A;  1TXF A;  2DQV A;  3TOD A;  1MY0 A;  4GWW A;  1G0I A;  1B05 A;  4XIG Q;  5CMK A;  1OIB A;  4JWX A;  2YJP A;  1RYX A;  3TCG A;  4POW A;  2FNC A;  3TMG A;  4C1T A;  2D21 A;  1XC1 A;  4R6K A;  2UVI A;  1FPK A;  5IKB A;  3QXM A;  5BWJ A;  1DPE A;  1N84 A;  1URS A;  4DIG A;  4N6K A;  4OET A;  4NG7 A;  2REG A;  1XOC A;  5IZZ A;  1FPI A;  1MXZ A;  3IOV A;  4RJZ A;  1LFG A;  5CM6 A;  3KGC A;  2HQ0 A;  2QVU A;  1LAH E;  1Y4T A;  1FJ6 A;  1B3H A;  3O66 A;  2UYE A;  4KPT A;  4PGP A;  4AS4 A;  3E9X A;  4TLM B;  3IO6 A;  4KYE A;  2E1S A;  4F1V A;  2VP1 A;  1Y20 A;  4HE1 A;  1GR2 A;  3JZJ A;  1P1Q A;  4R6H A;  3O6G A;  1PEB A;  3FBP A;  3A29 A;  1A8F A;  2E0S A;  3H6W A;  3SEU A;  3MVZ A;  4KHZ E;  4ONY A;  4DZ1 A;  1IMF A;  2HFB A;  2V93 A;  2ZZV A;  1M5D A;  2UVG A;  4LAT A;  1PBQ A;  4YMA A;  1SYH A;  1B7H A;  2Y7P A;  4P0I A;  1MXW A;  3KOS A;  4NE4 A;  1NV7 A;  4LQ2 A;  2ZYM A;  4RK2 A;  4MCO A;  1VDW A;  2M8C A;  3K0V A;  4I3E A;  1OMP A;  3T22 A;  3U1O A;  4N6P A;  4BDM A;  5DVJ A;  3I6V A;  3RQT A;  3VLW A;  1NV4 A;  4LUB A;  3LSW A;  1B7Z A;  4PCD A;  3OSQ A;  4LQ5 A;  1B40 A;  1URG A;  3U92 A;  3MZ1 A;  1VFE A;  3EHU A;  3KSJ A;  3CRB A;  1DCU A;  5J16 A;  5ISU A;  4IO4 A;  2Y7R A;  1BIY A;  1WDN A;  4DXU A;  5LOM A;  1L5T A;  3ECR A;  3UP9 A;  2F6G A;  4F3P A;  4U4S A;  3FV1 A;  3CI8 A;  3HFU A;  1F9B A;  4ZZA A;  4IR8 A;  2OLB A;  4P1L A;  5H8F B;  2FHY A;  3G3K A;  1B3E A;  4TQU Q;  3PUW E;  1IXC A;  5A5L A;  2ZNT A;  3PMX A;  2XX9 A;  3VVE A;  4NMY A;  4NF5 B;  3MYU A;  3MP1 A;  3Q26 A;  4U23 A;  1NUX A;  1FQC A;  1RDY A;  1MH3 A;  4RYA A;  2I6E A;  4OFJ A;  4PQJ A;  3O28 A;  5K2Y A;  4EQ9 A;  1S50 A;  4DI4 B;  2ABH A;  1FQB A;  5DEX A;  3VE1 B;  4EF2 A;  3FVK A;  2I3V A;  4JSO A;  4GOT A;  3MC2 A;  4P47 A;  1LBW A;  4MF3 A;  1LCF A;  3KN8 A;  3VDF A;  5H8H A;  3DLN A;  4GXA A;  3HV1 A;  2WKY A;  2F6P A;  1PDA A;  3K1M A;  2QS3 A;  1HSL A;  1JNF A;  1B51 A;  4N15 A;  4QSD A;  1IME A;  4XKQ A;  4P11 A;  2O68 A;  5DYH A;  5IZ3 B;  5ESY A;  5IGA A;  1QUL A;  4MMP A;  4OQO A;  3MST A;  4FAJ A;  1QJM A;  4YB7 A;  4F22 A;  1FBF A;  4OFL A;  4KFQ A;  2F3D A;  3P7I A;  3O2A A;  4G8N A;  3UN6 A;  1ZJL A;  1USY E;  3W9W A;  5H8F A;  3IB2 A;  2RC9 A;  3MVY A;  1LB8 A;  1OVB A;  2DWH A;  1MH4 A;  4OEU A;  4ZEC A;  4PF8 A;  4YIC A;  4NF5 A;  3S9E A;  4NF0 A;  4MLQ A;  3T66 A;  2DS9 A;  4X04 A;  3T9V A;  1Q1K A;  4DCX A;  4GLI A;  2UYF A;  3BIH A;  1IIT A;  3K2D A;  2H9B A;  3G7W A;  3O9P A;  1H76 A;  2QL3 A;  3PD8 A;  4IY6 A;  1JW1 A;  4EUO A;  4F31 B;  3LC8 A;  3CSB A;  1P1U A;  1SBP A;  2YLN A;  1B46 A;  1MPD A;  2Y7K A;  4AQ4 A;  2PT1 A;  1JEV A;  2QRY A;  5L9O A;  3IO4 A;  1MXY A;  4ELR A;  3RUM A;  4ESX A;  4P1E A;  1ZMG A;  1IQ7 A;  2XXT A;  2I4B A;  5TU0 A;  4ZE9 A;  1EYK A;  3K6V A;  4XTC Q;  2RKM A;  5IM2 A;  3EPE A;  5F7V A;  4GWO A;  3IJX B;  3VLU A;  4H5F A;  1EZO A;  4R2B A;  4AS5 A;  5FHN A;  3SKP A;  2Z22 A;  1DTG A;  2V3Q A;  2DE3 A;  3ODB A;  2WX9 A;  3B6T A;  4NHB A;  3PUY E;  2X7P A;  4N8G A;  3IJO B;  3A09 A;  2ZYK A;  3H7M A;  3H6U A;  4OMB A;  1FRP A;  2NVU B;  3LBS A;  4NF6 B;  2Q9T A;  4JVD A;  2OJT A;  4MH5 A;  4DDD A;  3WAE A;  4ZEB A;  4WXJ A;  1Y3Q A;  1OVT A;  5ET5 A;  3TKD A;  1FBG A;  1NFT A;  4MLV A;  2G29 A;  3V89 B;  2VGQ A;  1H3D A;  3LSL A;  1NUZ A;  1MQJ A;  4G8M A;  1USY H;  3CFZ A;  1B3F A;  4PFB A;  4IGT A;  3U93 A;  4R72 A;  2I0C A;  3FVG A;  3H06 B;  1Y4C A;  2L5V A;  2X26 A;  2JJK A;  3PPR A;  2F7A A;  4QRZ A;  4DI3 D;  2DYX A;  4EDP A;  2D5W A;  3EF7 A;  3NOH A;  1KA1 A;  4QHQ A;  2XXR A;  2XWV A;  2GRV A;  4F29 A;  1VFD A;  2Y7W A;  2ZNU A;  2RF1 A;  1UTH B;  3SEV A;  4YKK A;  1NNF A;  3RPW A;  1NNK A;  3MW0 A;  3OSR A;  1LLS A;  4YKI A;  4KYD A;  4I40 A;  2XHD A;  4GX3 A;  2KR0 A;  1SD3 A;  4I9D A;  4HTG A;  1B5J A;  4NX1 A;  1FPD A;  2ONS A;  2H25 A;  2CEY A;  5L8D A;  2WYK A;  1NV3 A;  2XWO A;  1M5E A;  3DP8 A;  1NV6 A;  4F19 A;  3M3K A;  1N7X A;  1XI6 A;  4NF6 A;  2P3V A;  1NV1 A;  5HM4 B;  1EYJ A;  4JVI A;  2A5T A;  3IOT A;  1UIU A;  4I3Y A;  4H0W A;  4F3S A;  4PC9 A;  4F1U A;  4OEV A;  1GVC A;  3TTR A;  1BLF A;  4U4X A;  3SET A;  4GXS B;  4O94 A;  1ZLQ A;  4GWS A;  3T9X B;  1S9T A;  4BDO A;  4OAN A;  1FTJ A;  3IL1 B;  5CI5 A;  1B0H A;  3KJT A;  4QSC A;  4O3C A;  4H67 A;  5B70 A;  2P1S A;  2ZYO A;  4GD5 A;  1NNT A;  2O7I A;  3IFA A;  4XEQ A;  1PC3 A;  3FXR A;  3RPL B;  3C32 A;  4N07 A;  3C31 A;  1QKA A;  2ANJ A;  3PD9 A;  1OQH A;  2XD2 A;  3T9H B;  4MNC A;  1UTH A;  5KZT A;  2QMW A;  3PUX E;  3G3F A;  4XFE A;  2HAV A;  5EHM A;  2DVC A;  1IXG A;  2GQ1 A;  1P99 A;  5H8Q B;  1JET A;  1SYI A;  2QVV A;  5TPA B;  5TP9 B;  4NAP A;  1RKM A;  5AE4 A;  2ZMB A;  4NTL A;  3R6U A;  2ONR A;  4E0W A; 
#chains in the Genus database with same CATH homology
 4MAG A;  1FPE A;  3RT8 A;  1P1W A;  3IAZ A;  3BIG A;  1EZ9 A;  3PUZ E;  3C33 A;  4GBV A;  3UA8 A;  2F35 A;  5ITO A;  4ECF A;  3MZB A;  1Y3N A;  3OMB A;  3PPO A;  1KA0 A;  3DEL B;  1R9Q A;  1ATG A;  2AL4 A;  4F3G A;  1LBC A;  1QGX A;  4KD5 A;  3CIJ A;  1WOD A;  4ELO A;  4ZS9 A;  5A5X B;  4P9K A;  4F18 A;  3Q27 A;  3OO6 A;  3EN3 A;  2FIE A;  1FBC A;  1EU8 A;  3RTF B;  3H3G A;  3KOT A;  4IO7 A;  3FD3 A;  1H44 A;  4PBQ A;  5AA2 B;  4OHN A;  3VVF A;  3AXF A;  3K4U A;  4MNI A;  3G3J A;  4YKP A;  1B52 A;  1BTJ A;  4Q8R A;  4OVS A;  3TCF A;  1NI9 A;  4X8R A;  1QVS A;  3U72 A;  1NH8 A;  4MFI A;  2HZL A;  4FIM A;  4G8H A;  1MM6 A;  4U1O A;  1US4 A;  3RYD A;  4ZE8 A;  3QMF A;  1DMB A;  1B4H A;  4KQP A;  4O7I A;  3ISP A;  5L9S A;  1SI1 A;  1LCT A;  3KC0 A;  2OWS A;  2GH9 A;  4O7M A;  3F11 A;  1TFD A;  1MQI A;  4IGR A;  4XKR A;  3FVN A;  2H99 A;  5ET8 A;  1MY4 A;  1N3W A;  2FA7 A;  4NQ8 A;  4JBZ A;  1JW4 A;  4GL8 A;  3B7D A;  2H4I A;  1EYI A;  3B6Q A;  1POY 1;  1M5C A;  4QBA A;  4G77 A;  1LFH A;  5EYG A;  5A5X A;  2F3B A;  3IB0 A;  3KJ7 A;  4QF9 A;  5I84 A;  4H8I A;  3TTN A;  5KCJ B;  1R6Z A;  2Q74 A;  3HN0 A;  5CMC A;  2OX3 A;  5EQ8 A;  3K1P A;  4PBH A;  3U65 A;  3O6I A;  1FSA A;  4MIJ A;  2I48 A;  4Z0I A;  4H8J A;  3LSX A;  4YU0 A;  2DOJ A;  1II5 A;  3TEP A;  4PFU A;  4GWX A;  4PET A;  3Q29 A;  4UA8 A;  4PE3 A;  4NED A;  4JVC A;  4OVR A;  1BK4 A;  2RC8 A;  4JB7 A;  4QFL A;  3OEL A;  3LUY A;  3BBR A;  1DOT A;  1MXX A;  4GX4 A;  3MP6 A;  1HSE A;  3CVG A;  3UIF A;  1DPP A;  3OO9 A;  1TT1 A;  1P1O A;  2YPN A;  2Z8F A;  2GHB A;  4N8Y A;  5FTI A;  4PFR A;  3ZKL A;  4FEC A;  1H45 A;  3HPI A;  3QUJ A;  4PGN A;  1YXI A;  2FIX A;  4BLA A;  5I58 B;  1FPL A;  4MJO A;  4UAB A;  1LAX A;  1AMF A;  4RY1 A;  1POT A;  2R8T A;  5CBR A;  1KZ8 A;  4PE5 B;  3QUF A;  4YAH X;  4DXB A;  2V25 A;  3C35 A;  4BDN A;  3RT6 B;  2Q89 A;  1MDQ A;  1QW0 A;  4EQB A;  1R9L A;  1FPB A;  1JEU A;  4JWY A;  5KCJ A;  5AA2 D;  3VLV A;  3TTM A;  1B6H A;  1N04 A;  1MQG A;  1FPJ A;  2CZK A;  1B1H A;  4X48 A;  2PVU A;  2PX1 A;  1TWY A;  2I4C A;  5IZ1 A;  3DP6 A;  2RCB A;  3PPP A;  2DP8 A;  2R9J A;  3GXA A;  2BJJ X;  3PU5 A;  4GX6 A;  3LSF B;  3OD7 A;  4QXD A;  3OEN A;  1AOV A;  3FGS A;  4THI A;  2F8D A;  2QFL A;  3H4Z A;  4I62 A;  4G68 B;  3T9U A;  4R9G A;  4IO2 A;  2FBP A;  3K01 A;  2Q2C A;  2AYS A;  4Q5T A;  4G61 A;  3IOR A;  1JVY A;  4RPO A;  5L9M A;  3SZP A;  1A54 A;  1RDZ A;  1XS5 A;  1VSO A;  4QFO A;  3GYY A;  1Y1Z A;  2XXP A;  1LBV A;  2XA5 A;  1CNQ A;  1MG1 A;  1KWH A;  4MBP A;  3UGW A;  1JQF A;  4PFT A;  3ZKK A;  2XXX A;  1YPN A;  2B65 A;  2OZZ A;  2XXQ A;  1HSJ A;  1IMD A;  3THI A;  3C36 A;  3TQL A;  5HBC A;  4M4G A;  2WYP A;  3KG2 A;  2ZYN A;  1UQW A;  3MP8 A;  4R73 A;  3CR9 A;  2Y84 A;  1VE4 A;  1Q9D A;  2XX8 A;  2O6A A;  5IZ3 A;  3TEL A;  5ICT A;  4Q30 B;  3SES A;  5HPQ A;  5DT6 A;  3FAT A;  1US5 A;  2DVZ A;  1ZKB A;  3SER A;  1IXI A;  1UIV A;  3FVO A;  4N4U A;  3EHS A;  1ZTY A;  2QS1 A;  3FZV A;  4LVQ A;  1EH3 A;  3ZS6 A;  2PYY A;  4GWU A;  2HHM A;  4QFK A;  3KBZ A;  3RY3 A;  3OOA A;  1LBZ A;  1UTB B;  1NH7 A;  3C34 A;  3O29 A;  1B32 A;  2HXW A;  4O8M A;  2I3W A;  1LST A;  4G2Z A;  2ZXT A;  4HS7 A;  3E78 A;  2P2A A;  4QSE A;  3UOR A;  3EQ1 A;  3IK6 B;  2R71 A;  3LUZ A;  1FTM A;  5I2K B;  1Z7N E;  2QSX A;  4F1Y A;  2XWI A;  5CBS A;  4N13 A;  4Z7E A;  3M8U A;  3OEK A;  3L6H A;  2NXO A;  4IO5 A;  3HCQ A;  4R75 A;  2IA4 A;  2CZH A;  1QUJ A;  3MQ9 A;  1QKB A;  2O51 A;  2F5X A;  2KQZ A;  2GHA A;  3T93 B;  4NWC A;  3T96 B;  4LA9 A;  5BUU A;  1A7L A;  1FTO A;  3E4R A;  3K6X A;  3FJM A;  4DE8 A;  1T0K A;  3KFM A;  2OK2 A;  1LBY A;  4HXV A;  2REJ A;  3N6U A;  4DCY A;  1G0H A;  4FEB A;  2VPN A;  4U22 A;  1M5B A;  5JEI A;  4H1X A;  4R2F A;  2G93 A;  3ROJ A;  4YMB A;  2H5Y A;  1INP A;  2X7Q A;  4AB5 A;  1NV5 A;  3RNN A;  2FYI A;  3SEX A;  1IMC A;  2VT5 A;  3PTY A;  3O97 A;  1PB9 A;  2Y5L A;  4F3B A;  1P1N A;  3FIR A;  5AA3 A;  1MPB A;  4HE2 A;  5T3J A;  3ILU B;  3ILT B;  3IFC A;  1BP5 A;  4PDH A;  3GLB A;  4JXI A;  1RYO A;  1MY1 A;  4Q0C A;  1R1N A;  2V4C A;  1XHY A;  1B0L A;  1ANF A;  2F34 A;  4N91 A;  1D9Q A;  4PP0 A;  4MHF A;  5H8N B;  3MPL A;  1URD A;  3A3C A;  1RDX A;  1JP4 A;  2HXR A;  3FJ7 A;  5I2K A;  4YZZ A;  2B4M A;  1N76 A;  2HPG A;  5LTC A;  4PAI A;  4OVP A;  1VR5 A;  3QAX A;  1Y1M A;  4ESW A;  4ND9 A;  3IOU A;  1LGB C;  4X1D A;  4YKJ A;  4N17 A;  1PBP A;  5B7D A;  1J1N A;  3TUS A;  2KLF A;  3QIM A;  4N6D A;  1GGG A;  3MZ9 A;  3DP4 A;  5JTY B;  2DE4 A;  2OWT A;  1TFA A;  1MY2 A;  3H03 A;  4O3B A;  3TQW A;  2XWK A;  3MWB A;  4ZED A;  1GV8 A;  4GRK A;  3HO7 A;  4ZZE A;  1LB9 A;  2BJI A;  5AA4 B;  2QS2 A;  4NF4 B;  3MUQ A;  3IX1 A;  1FBE A;  1LBB A;  1LAG E;  2PBW A;  4LN5 A;  2V84 A;  5I59 B;  2PFY A;  3ONM A;  1DTZ A;  3CG1 A;  1B3G A;  2O1L A;  3RGY A;  4HW8 A;  1AH5 A;  4F39 A;  1FTA A;  4EQ7 A;  5H8N A;  1FBP A;  1IUD A;  3N94 A;  1A8E A;  1FJ9 A;  5FHM A;  4POX A;  3U8Q A;  4GBW A;  2D3I A;  2F36 A;  4F2O A;  3RLF E;  3K00 A;  4PTK A;  1FQA A;  2DXR A;  1ZIU A;  2WEF A;  3TZA A;  2V3U A;  2QS4 A;  2HZK A;  2VHA A;  3RPL A;  3V5A A;  2LAO A;  3G3G A;  2PT2 A;  3K6W A;  3B6W A;  1I6A A;  1CE2 A;  4OZ9 A;  3QSL A;  4U2R A;  5JTY A;  4YB5 A;  4XKN A;  4PFY A;  5H8Q A;  4LZ8 A;  5TPA A;  5TP9 A;  4AB6 A;  3B8B A;  2OBG A;  2PCR A;  3LV0 A;  3FAS A;  4ZEI A;  4LON B;  5AA4 A;  4NF4 A;  1ZBM A;  5I2N B;  2OWZ A;  5I3S A;  4BDL A;  4RK9 A;  2Z8D A;  1SDX A;  1S7Y A;  3KZG A;  3PGF A;  5ITP A;  1O7T A;  3FXQ A;  4LZ5 A;  1M5F A;  4I8C A;  3KN7 A;  3QYT A;  4TOZ A;  1A99 A;  1B5I A;  3L6G A;  5I59 A;  3W15 C;  3N5L A;  4X1B A;  2XXK A;  5LDZ A;  2B3B A;  2PFZ A;  2I0B A;  4JDF A;  2XXI A;  3SDF A;  2Q88 A;  2NUV A;  4LZ7 A;  1YYZ A;  4KXP A;  3SEY A;  2F97 A;  4ZEF A;  3TTL A;  1DK4 A;  5H8S A;  5DEX B;  1B9J A;  4GIZ A;  1GTK A;  4HE0 A;  5AA2 A;  2UXA A;  3OXN A;  2XXW A;  3OO8 A;  5EQA A;  4RA1 A;  4ISU A;  3RTW B;  5H8H B;  2RC7 A;  2XX7 A;  1MS7 A;  4X9T A;  2ESN A;  3R26 A;  1LFI A;  3JYR A;  1MXU A;  1NV2 A;  3I3V A;  4H45 A;  4QFN A;  2B4L A;  1MQH A;  3TYH A;  5CRY A;  2IEE A;  2Z8E A;  3A3U A;  4R9F A;  2F7B A;  4ZDM A;  2DWI A;  5F24 A;  1B1X A;  1FPF A;  1NKX A;  1NMU A;  4OEN A;  4LP2 B;  2UVJ A;  1JVX A;  4L17 A;  1FBH A;  4EXL A;  3TCH A;  1N3X A;  2Q8J A;  2MKZ A;  2A5S A;  4KCC A;  1IEJ A;  5I2N A;  2CZI A;  1PB7 A;  4MNP A;  1N7W A;  2QJE A;  2NWJ A;  1A40 A;  1YZ0 A;  1YAE A;  1O64 A;  1I6B A;  1B58 A;  4IO3 A;  2R6G E;  3FV2 A;  1SW2 A;  2WBD A;  5KDT B;  3K02 A;  1LBX A;  4I1D A;  3V83 A;  5DTB A;  1D9V A;  4HCW A;  4OYV A;  3MJN A;  4PFW A;  5EQ7 A;  2XD3 A;  2ZNS A;  3MBP A;  1FBD A;  1NUY A;  1A55 A;  3H6T A;  3IOW A;  3MAM A;  1QUK A;  4ELQ A;  1AIV A;  3FXU A;  4PFI A;  4FJP A;  4OVQ A;  2DWA A;  4FAT A;  2HAU A;  1FQE A;  4K3F A;  4MEV A;  2O7U A;  1DBZ A;  5I56 B;  4KCD A;  3VFJ A;  1FTK A;  3PMV A;  2F78 A;  2CZL A;  1SW4 A;  4NWD A;  2QPQ A;  1SW1 A;  4GL0 A;  3BKI B;  5ET7 A;  4ZEK A;  5FHO A;  4U21 A;  3LR1 A;  4PAK A;  1NV0 A;  1AWB A;  3CSG A;  4YB6 A;  2HCA A;  1B3L A;  5JK4 A;  2O1M A;  4BDQ A;  1NL5 A;  2QVR A;  3SEW A;  5CC2 A;  1IMB A;  3N26 A;  5I58 A;  5DVI A;  4IO6 A;  5M2V A;  4RPN A;  3PUV E;  4H46 A;  1B5H A;  2Q8M A;  1JW5 A;  3TFL A;  3IB1 A;  1XVY A;  3RN8 A;  4XXU A;  3K6U A;  5KDT A;  5F1Q A;  4MX6 A;  3UK4 A;  4GQO A;  2HEU A;  2VOZ A;  1FTL A;  5FBP A;  1IIW A;  4TLL B;  3KN3 A;  3E3K A;  4WED A;  2VD3 A;  4GWZ A;  1D9Y A;  1B2H A;  3O6H A;  4G68 C;  4U1Z A;  5IAI A;  5EYF A;  3DM0 A;  1N0T A;  1ZU0 A;  4PAF A;  5I57 B;  1YCJ A;  3PV0 E;  3D4G A;  1NNP A;  4GFR A;  5ET6 A;  1MDP 1;  4GF8 A;  3VVD A;  3D1R A;  1K9Y A;  4P8B A;  4ELP A;  5I56 A;  1FQD A;  3KSX A;  3K1N A;  1Y9U A;  2Y7I A;  2ZZX A;  1YTV A;  1O63 A;  3GBA A;  5DVF A;  4G68 A;  4O3A A;  3EKI A;  1I69 A;  2GFE A;  4P56 A;  4QFP A;  3PMW A;  3OO7 A;  2P0S A;  4OVT A;  1SVX B;  1B4Z A;  4WEP A;  3EHT A;  2XXY A;  1SPI A;  3HHG A;  4R74 A;  1OQG A;  3S4U A;  1MY3 A;  1IMA A;  4GWY A;  2DXY A;  4OXV A;  4FED A;  2O69 A;  5ELV A;  3BFT A;  2ZZW A;  2V3T A;  4H5G A;  1OLA A;  1Z7M E;  3HHF A;  2XXV A;  1K9Z A;  4XKP A;  1MXV A;  1Q35 A;  4NF8 B;  2A5T B;  4G4P A;  3C4M A;  1MQD A;  2Z23 A;  5EQ9 A;  2RCA A;  2AL5 A;  4R6Y A;  4FE8 A;  3BFU A;  2Y5K A;  1NUW A;  1IXH A;  4OFO A;  5EHS A;  1ELJ A;  2O84 X;  5I7I A;  4OTE A;  3MPK A;  5J1D A;  5EYH A;  2VD2 A;  4OVJ A;  4RNS A;  4F2Q A;  5CMM A;  5I57 A;  2XXH A;  3CG3 A;  4UAC A;  4BDR A;  1SW5 A;  3E13 X;  2I49 A;  3W9V A;  1D3K A;  1MRP A;  2ONK E;  1XT8 A;  5AA1 A;  1MM7 A;  1D4N A;  4EXK A;  1FPG A;  3VXB A;  4HCY A;  2DDK A;  2DSF A;  2AIX A;  4H65 A;  2XXU A;  3PPN A;  3S9L C;  1FQF A;  4IY5 A;  3KEI A;  4OES A;  1LAF E;  1WVJ A;  4EF1 A;  3H6V A;  2FVZ A;  1UTB A;  3T1B A;  1Y3P A;  4OER A;  2DWJ A;  2CEX A;  3VV5 A;  3JV9 A;  4JWO A;  2WBB A;  5FTH A;  3IR1 A;  3S9N C;  1AL3 A;  1B7U A;  1IZ1 A;  1I6Q A;  1MPC A;  1OLC A;  3MVX A;  3N6T A;  3FUZ A;  5K2X A;  2H98 A;  4IB2 A;  3FJG A;  3CFX A;  4DLD A;  4FBP A;  4P0G A;  3ZSF A;  3CFL A;  3USD A;  3V8X B;  3GZG A;  4RXL A;  3M3F A;  3PPQ A;  4PDD A;  3M3L A;  2THI A;  3U94 A;  3TDJ A;  4NF8 A;  5I5P A;  1H43 A;  3C9H A;  4C1U A;  3TTK A;  3TPA A;  4GVO A;  2CMO A;  3GBB A;  1DSN A;  5CMB A;  1PB8 A;  4PF6 A;  2B3F A;  3FXB A;  2F7C A;  4M1V A;  2P3N A;  4JSD A;  4NN3 A;  2VPO A;  5ICQ A;  2OCU A;  4H6D A;  3G3H A;  4N81 A;  4WKM A;  2Q2A A;  3S9M C;  2ALU A;  5DW8 A;  3Q28 A;  3I5O A;  1LEV A;  4OA4 A;  2PMS A;  3G3I A;  3B50 A;  1SI0 A;  1SQY A;  1CB6 A;  3KC1 A;  3KBR A;  3T0J A;  2RIN A;  3HST A;  2NOO A;  4FOR A;  4KI0 E;  3CHG A;  3QK6 A;  4KYS A;  3TAJ A;  1FW0 A;  3VXC A;  1FCK A;  2UVH A;  3E79 A;  4KR5 A;  1BKA A;  3WAF A;  3D4C A;  4E0X A;  4C0R A;  3OEM A;  2W7Y A;  3R7X A;  4DXC A;  2I58 A;  1EZP A;  2DE2 A;  3Q25 A;  3MVW A;  2QMX A;  4NGU A;  1XVX A;  4XF5 A;  1QUI A;  4OWD A;  4P3L A;  3S2V A;  1TXF A;  2DQV A;  3TOD A;  1MY0 A;  4GWW A;  1G0I A;  1B05 A;  4XIG Q;  5CMK A;  1OIB A;  4JWX A;  2YJP A;  1RYX A;  3TCG A;  4POW A;  2FNC A;  3TMG A;  4C1T A;  2D21 A;  1XC1 A;  4R6K A;  2UVI A;  1FPK A;  5IKB A;  3QXM A;  5BWJ A;  1DPE A;  1N84 A;  1URS A;  4DIG A;  4OET A;  4N6K A;  4NG7 A;  2REG A;  1XOC A;  5IZZ A;  1MXZ A;  1FPI A;  3IOV A;  4RJZ A;  1LFG A;  5CM6 A;  3KGC A;  2HQ0 A;  2QVU A;  1LAH E;  1Y4T A;  1FJ6 A;  1B3H A;  3O66 A;  2UYE A;  4KPT A;  4PGP A;  4AS4 A;  3E9X A;  4TLM B;  3IO6 A;  4KYE A;  2E1S A;  4F1V A;  2VP1 A;  1Y20 A;  4HE1 A;  1GR2 A;  3JZJ A;  1P1Q A;  4R6H A;  3O6G A;  1PEB A;  3FBP A;  3A29 A;  1A8F A;  2E0S A;  3H6W A;  3SEU A;  3MVZ A;  4KHZ E;  4ONY A;  4DZ1 A;  1IMF A;  2HFB A;  2V93 A;  2ZZV A;  1M5D A;  2UVG A;  4LAT A;  1PBQ A;  4YMA A;  1SYH A;  1B7H A;  2Y7P A;  4P0I A;  1MXW A;  3KOS A;  4NE4 A;  1NV7 A;  4LQ2 A;  2ZYM A;  4RK2 A;  4MCO A;  1VDW A;  2M8C A;  3K0V A;  4I3E A;  1OMP A;  3T22 A;  3U1O A;  4N6P A;  4BDM A;  5DVJ A;  3I6V A;  3RQT A;  3VLW A;  1NV4 A;  4LUB A;  3LSW A;  1B7Z A;  4PCD A;  3OSQ A;  4LQ5 A;  1B40 A;  1URG A;  3U92 A;  3MZ1 A;  1VFE A;  3EHU A;  3KSJ A;  3CRB A;  1DCU A;  5J16 A;  5ISU A;  4IO4 A;  2Y7R A;  1BIY A;  1WDN A;  4DXU A;  5LOM A;  1L5T A;  3ECR A;  3UP9 A;  2F6G A;  4F3P A;  4U4S A;  3FV1 A;  3CI8 A;  3HFU A;  1F9B A;  4ZZA A;  4IR8 A;  2OLB A;  4P1L A;  5H8F B;  2FHY A;  3G3K A;  1B3E A;  4TQU Q;  3PUW E;  1IXC A;  5A5L A;  2ZNT A;  3PMX A;  2XX9 A;  3VVE A;  4NMY A;  4NF5 B;  3MYU A;  3MP1 A;  3Q26 A;  4U23 A;  1NUX A;  1FQC A;  1RDY A;  1MH3 A;  4RYA A;  2I6E A;  4OFJ A;  4PQJ A;  3O28 A;  5K2Y A;  4EQ9 A;  1S50 A;  4DI4 B;  2ABH A;  1FQB A;  5DEX A;  3VE1 B;  4EF2 A;  3FVK A;  2I3V A;  4JSO A;  4GOT A;  3MC2 A;  4P47 A;  1LBW A;  4MF3 A;  1LCF A;  3KN8 A;  3VDF A;  5H8H A;  3DLN A;  4GXA A;  3HV1 A;  2WKY A;  2F6P A;  1PDA A;  3K1M A;  2QS3 A;  1HSL A;  1JNF A;  1B51 A;  4N15 A;  4QSD A;  1IME A;  4XKQ A;  4P11 A;  2O68 A;  5DYH A;  5IZ3 B;  5ESY A;  5IGA A;  1QUL A;  4OQO A;  4MMP A;  3MST A;  4FAJ A;  1QJM A;  4YB7 A;  4F22 A;  1FBF A;  4OFL A;  4KFQ A;  2F3D A;  3P7I A;  3O2A A;  4G8N A;  3UN6 A;  1ZJL A;  1USY E;  3W9W A;  5H8F A;  3IB2 A;  2RC9 A;  3MVY A;  1LB8 A;  1OVB A;  2DWH A;  1MH4 A;  4OEU A;  4ZEC A;  4PF8 A;  4YIC A;  4NF5 A;  3S9E A;  4NF0 A;  4MLQ A;  3T66 A;  2DS9 A;  3T9V A;  4X04 A;  1Q1K A;  4DCX A;  4GLI A;  2UYF A;  3BIH A;  1IIT A;  3K2D A;  2H9B A;  3G7W A;  3O9P A;  1H76 A;  2QL3 A;  3PD8 A;  4IY6 A;  1JW1 A;  4EUO A;  4F31 B;  3LC8 A;  3CSB A;  1P1U A;  1SBP A;  2YLN A;  1B46 A;  1MPD A;  2Y7K A;  4AQ4 A;  2PT1 A;  1JEV A;  2QRY A;  5L9O A;  3IO4 A;  1MXY A;  4ELR A;  3RUM A;  4ESX A;  4P1E A;  1ZMG A;  1IQ7 A;  2XXT A;  2I4B A;  5TU0 A;  4ZE9 A;  1EYK A;  3K6V A;  4XTC Q;  2RKM A;  5IM2 A;  3EPE A;  5F7V A;  4GWO A;  3IJX B;  3VLU A;  4H5F A;  1EZO A;  4R2B A;  4AS5 A;  5FHN A;  3SKP A;  2Z22 A;  1DTG A;  2V3Q A;  2DE3 A;  3ODB A;  2WX9 A;  3B6T A;  4NHB A;  3PUY E;  2X7P A;  4N8G A;  3IJO B;  3A09 A;  2ZYK A;  3H7M A;  3H6U A;  4OMB A;  1FRP A;  2NVU B;  3LBS A;  4NF6 B;  2Q9T A;  4JVD A;  2OJT A;  4MH5 A;  4DDD A;  3WAE A;  4ZEB A;  4WXJ A;  1Y3Q A;  1OVT A;  5ET5 A;  3TKD A;  1FBG A;  1NFT A;  4MLV A;  2G29 A;  3V89 B;  2VGQ A;  1H3D A;  3LSL A;  1NUZ A;  1MQJ A;  4G8M A;  1USY H;  3CFZ A;  1B3F A;  4PFB A;  4IGT A;  3U93 A;  4R72 A;  2I0C A;  3FVG A;  3H06 B;  1Y4C A;  2L5V A;  2X26 A;  2JJK A;  3PPR A;  2F7A A;  4QRZ A;  4DI3 D;  2DYX A;  4EDP A;  2D5W A;  3EF7 A;  3NOH A;  1KA1 A;  4QHQ A;  2XXR A;  2XWV A;  2GRV A;  4F29 A;  1VFD A;  2Y7W A;  2ZNU A;  2RF1 A;  1UTH B;  3SEV A;  4YKK A;  1NNF A;  3RPW A;  1NNK A;  3MW0 A;  3OSR A;  1LLS A;  4YKI A;  4KYD A;  4I40 A;  2XHD A;  4GX3 A;  2KR0 A;  1SD3 A;  4I9D A;  4HTG A;  1B5J A;  4NX1 A;  1FPD A;  2ONS A;  2H25 A;  5L8D A;  2CEY A;  2WYK A;  1NV3 A;  2XWO A;  1M5E A;  3DP8 A;  1NV6 A;  4F19 A;  3M3K A;  1N7X A;  4NF6 A;  1XI6 A;  2P3V A;  5HM4 B;  1NV1 A;  1EYJ A;  4JVI A;  2A5T A;  3IOT A;  1UIU A;  4I3Y A;  4H0W A;  4F3S A;  4PC9 A;  4F1U A;  4OEV A;  3TTR A;  1GVC A;  1BLF A;  4U4X A;  3SET A;  4GXS B;  4O94 A;  1ZLQ A;  4GWS A;  3T9X B;  1S9T A;  4BDO A;  4OAN A;  1FTJ A;  3IL1 B;  5CI5 A;  1B0H A;  3KJT A;  4QSC A;  4O3C A;  4H67 A;  5B70 A;  2P1S A;  2ZYO A;  4GD5 A;  1NNT A;  2O7I A;  3IFA A;  4XEQ A;  1PC3 A;  3FXR A;  3RPL B;  3C32 A;  4N07 A;  3C31 A;  1QKA A;  2ANJ A;  3PD9 A;  1OQH A;  2XD2 A;  3T9H B;  4MNC A;  1UTH A;  5KZT A;  2QMW A;  3PUX E;  3G3F A;  4XFE A;  2HAV A;  5EHM A;  2DVC A;  1IXG A;  2GQ1 A;  1P99 A;  5H8Q B;  1JET A;  1SYI A;  2QVV A;  5TPA B;  5TP9 B;  4NAP A;  1RKM A;  5AE4 A;  2ZMB A;  4NTL A;  3R6U A;  2ONR A;  4E0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...