2HZLA

Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
334
structure length
334
Chain Sequence
VTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an Extracytoplasmic Solute Receptor from a TRAP transporter in its open and closed forms reveal a helix-swapped dimer requiring a cation for alpha-keto acid binding.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Ligand binding, transport protein
molecule keywords TRAP-T family sorbitol/mannitol transporter, periplasmic bin
total genus 124
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hzlA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hzlA01
4RYAA 5ICQA 4MH5A 4XEQA 4MMPA 1B4HA 2I49A 4NQ8A 2ZYKA 2BJJX 3K2DA 3O28A 1QW0A 2O6AA 4N07A 3RNNA 3OSRA 4NWDA 1TFAA 4GOTA 5H8FB 4U4SA 4XKRA 1B7ZA 3MZ9A 1N3WA 4YKKA 4NF6B 4IGTA 3FIRA 3IOTA 3MVZA 1LAGE 3H4ZA 4NTLA 1OMPA 3ILUB 4PBHA 1JW4A 3OD7A 4R72A 2UXAA 4O3AA 2O1LA 3T9UA 3FVOA 4PFUA 2F6PA 2D5WA 1DPPA 3HO7A 4ISUA 2UVJA 4BDNA 3PPNA 4YU0A 1POY1 2XXHA 4OYVA 2NVUB 3K6UA 3WAEA 5AA2B 2WX9A 1MH3A 2I4CA 2Q2AA 2DYXA 3PPRA 2XWIA 2PBWA 5I59B 2ESNA 2I58A 2V4CA 3TTNA 4R2BA 3N6UA 1DTGA 1D9VA 2OJTA 4E0WA 5M2VA 5AA4A 1SW2A 3MWBA 2DXRA 3SKPA 5JTYB 1ELJA 4G68C 4QFPA 4OEUA 2VOZA 3TCGA 3FVGA 2Y7KA 4I9DA 1L5TA 3MVWA 1WDNA 1Z7NE 2PMSA 4LQ2A 4ZZAA 2H9BA 1KWHA 1HSEA 2YJPA 2O69A 4LN5A 1TFDA 5CMKA 2QSXA 3CFXA 3C33A 1P1UA 3K1MA 5KDTB 3D4GA 3SEYA 1DSNA 3IOUA 2VGQA 3DP4A 3OO9A 4OVQA 3IJOB 2HQ0A 2PFZA 3VVFA 4O3CA 2WYPA 2ZYNA 3PMXA 1QKAA 4H5GA 2O7IA 3TZAA 1Y4TA 5I59A 2HZLA 3MP1A 5DVIA 4OESA 4MX6A 3IOWA 5CRYA 1SVXB 3VLVA 1MY2A 3C35A 3O2AA 2ZMBA 4HCYA 2DWHA 4YICA 3K01A 3VXBA 3KBRA 3MJNA 3PPQA 3LBSA 3UN6A 4QFKA 1UIVA 3T66A 1DTZA 5I2NB 3DLNA 5AA1A 2HEUA 2XX8A 5LOMA 4PDDA 2ZNTA 1M5DA 1YCJA 2G93A 2B3FA 4BDLA 3MVYA 3CIJA 4LZ8A 4LZ7A 3IX1A 1XOCA 5I5PA 4ZDMA 2O1MA 1H45A 4ZEKA 4Z7EA 3G3GA 4NF4A 4LUBA 5B70A 2CMOA 1P1NA 1DMBA 3BFUA 4G4PA 1B3FA 1MY4A 4C1TA 4BDRA 2PT2A 3VVEA 3Q25A 2H25A 1JQFA 1GVCA 1MXXA 2XX9A 1AMFA 4F18A 2XXPA 3VLWA 1MPCA 3FGSA 5CBRA 4IO4A 1QUKA 3N6TA 3B6WA 4PFRA 1SYIA 4OZ9A 1ZIUA 3O6GA 1I6QA 4F2QA 4U4XA 2QS1A 5ITOA 1MS7A 2THIA 2HPGA 2PT1A 2G29A 1Y3PA 4FATA 3DP8A 4OFJA 3V83A 1SW5A 3FASA 3GZGA 2ZZWA 1URSA 4X1DA 3CI8A 5ICTA 3S2VA 1PB7A 3SEXA 4OVSA 1NNPA 2QL3A 2XD3A 3HV1A 1B6HA 3IB0A 2Q2CA 3KFMA 4H8JA 2ONKE 5CI5A 4ZS9A 5EHMA 2P1SA 4RA1A 3HHFA 4RPNA 5F1QA 3FVNA 1SBPA 4H8IA 4U2RA 3HHGA 3MPKA 3KG2A 3MVXA 4OHNA 3LSFB 3FJGA 1I6AA 1LBBA 1EU8A 1LSTA 2HXWA 3PPPA 2UYEA 4MF3A 3D4CA 4AB5A 1MXZA 1D4NA 4ZECA 1IIWA 2Z22A 4YKPA 1NNTA 4ECFA 3T9HB 5L8DA 2P2AA 2X7PA 4KYDA 2I6EA 1POTA 3SEVA 1P1WA 1H3DA 5IKBA 1UIUA 3KN7A 1BTJA 4R6YA 2I0CA 4ELQA 4MNPA 2VPOA 4M1VA 4YAHX 1RKMA 1LB9A 4DXBA 4THIA 2RC8A 3U93A 3CG3A 3RY3A 4ELOA 2QRYA 1T0KA 1US5A 5IAIA 1B2HA 4X48A 4PBQA 2YLNA 3MZ1A 1FTLA 4GF8A 1UTHB 1N0TA 3I3VA 4X9TA 3TQWA 2Z8EA 5J1DA 4ZEIA 1URDA 3G3KA 4QSEA 3EHSA 5H8NB 1FQCA 2GRVA 4LZ5A 3VLUA 3ZKKA 1N7XA 1HSJA 4PAKA 3TKDA 1SI0A 1FQFA 3OO8A 2GHAA 3FV2A 3OEKA 3U1OA 3TTKA 4RY1A 2UVIA 3ZS6A 2OCUA 3K4UA 3C9HA 1XVYA 1B5JA 2ONSA 3JYRA 4OVTA 4OQOA 1PBQA 4KCDA 4X8RA 3G3HA 1FTOA 1NL5A 4PAFA 3E3KA 4U1OA 4ONYA 1VFDA 5AA3A 1OLCA 1CB6A 3OO7A 3KGCA 4NX1A 1B3GA 4ZEDA 4G8MA 4PF8A 4XFEA 1P1QA 3MZBA 4XTCQ 2ONRA 3LC8A 3BFTA 5I2NA 4NF0A 1P99A 4PETA 4PFTA 4U1ZA 1XT8A 1B7UA 5TU0A 4IO2A 3QK6A 3K1NA 2F78A 3C31A 1MQDA 4N13A 3JZJA 1MXVA 1EZ9A 4AB6A 4PDHA 3OOAA 2V3QA 3EQ1A 5H8SA 3USDA 2H98A 3O97A 3A3CA 4PFYA 1FTKA 4MNIA 3O9PA 1H76A 3Q26A 1WVJA 1O64A 4EDPA 4H0WA 4JDFA 5IM2A 4R73A 4X1BA 1USYH 3H6UA 3LSWA 1LAXA 3B7DA 3ONMA 3ZKLA 5TP9A 1FQEA 2AL4A 5H8NA 4TQUQ 1N7WA 3A09A 2I3VA 4P1LA 2LAOA 1XS5A 3H6WA 1IXGA 1B58A 1N3XA 1FQDA 3C4MA 1MPBA 3SDFA 4DZ1A 4N8GA 1JW5A 2DP8A 1EZOA 4TLLB 2QS2A 2DE4A 4ZE8A 4OA4A 1ZBMA 1JVXA 1MQGA 1BP5A 1B05A 4NAPA 4KFQA 2Y7WA 3ECRA 2QS3A 1LB8A 2DE2A 2F7BA 3M3KA 1ZTYA 1R9QA 2F34A 4L17A 1RYXA 3FD3A 3QIMA 1VR5A 4FORA 4DDDA 1XVXA 5IZZA 4R2FA 3VDFA 2YPNA 1O63A 4EQ7A 3PU5A 3K6VA 2RCAA 1XC1A 2R9JA 3PMVA 2ZXTA 5I56B 2XXKA 3G3FA 2AL5A 4F2OA 4KI0E 5AA2A 2IA4A 5KCJB 2ANJA 4N4UA 5ITPA 3E4RA 1MXYA 4P3LA 1S50A 3UORA 1H44A 1FQAA 4DCYA 1B4ZA 2FA7A 1AOVA 4HW8A 4RPOA 3LSXA 3C34A 3KSXA 4DIGA 1IUDA 1MXWA 5TP9B 3GBBA 1MM6A 4XIGQ 2UYFA 4NF6A 4GL0A 3R26A 4KQPA 2ZYOA 3OENA 1B51A 2E0SA 1LGBC 2QS4A 1IITA 3VFJA 4ZEFA 4N91A 3O6HA 2F5XA 4JBZA 4MAGA 2DSFA 5A5XB 4JWXA 4F3GA 1DPEA 3S9MC 4YMBA 1LFHA 1IZ1A 5JEIA 1R1NA 4POWA 3KSJA 4E0XA 3THIA 1UQWA 4HCWA 3EF7A 3G7WA 2F6GA 5ISUA 5EYFA 3CVGA 1NMUA 4G68B 1SW1A 2OLBA 4RXLA 5F7VA 4P9KA 1B0HA 1MM7A 3RQTA 4XKNA 4DI4B 1ZU0A 3PMWA 3U72A 3UGWA 1D9YA 1IXHA 1JETA 2PX1A 5CM6A 3O6IA 1VFEA 1I6BA 4NGUA 3KZGA 2XXQA 5I58B 4EF2A 1ZMGA 3PUXE 4QF9A 3CFLA 3V5AA 4JWYA 1QKBA 1A7LA 1M5EA 5KCJA 3SERA 1OQHA 1A8FA 1FTJA 3KN8A 3C36A 4XKQA 3PV0E 4OFLA 1ZJLA 5H8HB 4GIZA 2F8DA 4O7MA 4F1UA 1A40A 1Y9UA 1TXFA 2P0SA 3S4UA 4LP2B 3O29A 4N6DA 4ELRA 3L6GA 4DXUA 4OVPA 3B6TA 4M4GA 3KJ7A 1PC3A 3KOSA 2O68A 1B52A 4OVJA 5DVJA 1OVBA 1H43A 2REGA 1MXUA 1JEVA 1N04A 3T96B 3F11A 2RINA 4F3SA 4MEVA 4R74A 1I69A 1QVSA 4MBPA 2XXWA 4FEDA 4FAJA 3FXRA 1ZKBA 3M3FA 2XXUA 5BWJA 3TQLA 1A8EA 5K2XA 3S9EA 2HFBA 2A5TB 5JK4A 2F36A 1SDXA 1A99A 1LLSA 4GXSB 1JEUA 3IB2A 5JTYA 4QRZA 2DWIA 4XKPA 3TCHA 4QFNA 1N76A 4C0RA 1MY3A 4LVQA 4PQJA 5L9SA 5I57B 4DLDA 3EHTA 3ILTB 4F29A 1B46A 1PB8A 2OWSA 3PPOA 5AA4B 3GLBA 4RK9A 4FECA 3AXFA 4KD5A 1Y1MA 4AQ4A 2Q9TA 4GQOA 3B50A 1P1OA 3W9VA 2I3WA 2F97A 5DEXB 4HS7A 3SEUA 3TTMA 1Q1KA 4GLIA 5FTHA 3W9WA 4NHBA 1FCKA 2NWJA 1GTKA 1B32A 2HAVA 1SW4A 5CMCA 4PE3A 4G77A 1TWYA 1US4A 3CRBA 4PFBA 3Q28A 3QYTA 1RYOA 3H3GA 3SESA 2Z23A 4MCOA 5AA2D 3QAXA 1B1XA 3FXUA 2RCBA 5L9MA 3TYHA 4MHFA 1SI1A 4OFOA 3V89B 3TTLA 1S7YA 5CC2A 2RC9A 3RPWA 3DM0A 4QHQA 2V25A 5CMBA 2I4BA 4R75A 4F22A 4YMAA 1Y1ZA 4KYSA 4F3PA 5H8FA 4Q0CA 4R6KA 4GL8A 4OANA 2XD2A 1LCFA 2FYIA 2D3IA 2Y7IA 3MP8A 3M3LA 4PGNA 5I7IA 4NF4B 1NNFA 3ZSFA 3TMGA 1MH4A 3B6QA 1N84A 4H6DA 2PFYA 3EPEA 3WAFA 2H4IA 3N26A 1UTHA 1OQGA 4OMBA 4PE5B 4U21A 4PFWA 4FJPA 5CBSA 3IL1B 3MAMA 4MFIA 2XXXA 2DVCA 2GHBA 1MQJA 4JWOA 4U22A 3RT6B 4C1UA 2RC7A 3P7IA 4PAIA 1Y4CA 2HCAA 2ZYMA 2VD2A 4MLQA 4P0IA 1VSOA 4IO7A 3EHUA 5DEXA 1QULA 4WEDA 2Y84A 4NWCA 4EQBA 5L9OA 1QUIA 2ZNUA 3IO4A 4JSOA 4R9FA 3QSLA 2O7UA 1JW1A 3IOVA 3G3IA 3IR1A 2XWKA 2ZZXA 1JVYA 5I57A 1B3LA 5KDTA 1B7HA 1GGGA 1II5A 2OZZA 4NF5B 4H1XA 5I2KB 1PBPA 4G8HA 4OERA 5K2YA 1M5FA 2XXYA 2QPQA 1IEJA 4ND9A 3T9XB 3VE1B 3S9NC 3MBPA 3PD8A 2DXYA 3MC2A 3VXCA 4U23A 1R9LA 3CSBA 2NUVA 2IEEA 3H06B 4FEBA 3K6XA 4GD5A 5DTBA 2XXTA 2RF1A 1B0LA 5TPAA 3VV5A 1NH7A 5LTCA 3UIFA 2VPNA 4BDQA 1XHYA 3JV9A 3RUMA 4NN3A 3OO6A 3FJ7A 4YKJA 4JSDA 3V8XB 3QXMA 1MDQA 4PFIA 5FHOA 5H8QA 1EH3A 4YB6A 4FE8A 3Q27A 3E13X 2AIXA 3PUZE 3RGYA 2I48A 4LATA 2XX7A 3MQ9A 4P11A 3T22A 1OIBA 2E1SA 2VD3A 4G8NA 3LSLA 3LUYA 3HCQA 3FXQA 1PEBA 3L6HA 4F39A 4K3FA 4F1YA 1CE2A 3H6TA 1AIVA 4NEDA 4ZE9A 3H7MA 1AH5A 3R7XA 4R6HA 2XXRA 2FNCA 3KN3A 4Q5TA 3TUSA 2PVUA 5I58A 1J1NA 1MDP1 4IO3A 2B3BA 3FXBA 2QJEA 4MNCA 4Q8RA 4HTGA 1B5HA 4OXVA 2CEYA 2O51A 3R6UA 3TDJA 1B1HA 1IQ7A 3Q29A 1OLAA 4Q30B 5DT6A 4IO6A 1MQHA 3IAZA 3IO6A 2Z8FA 4O94A 5A5XA 1USYE 3K0VA 4I1DA 3PD9A 1FQBA 2ALUA 4OWDA 4DXCA 2UVHA 3IK6B 4NG7A 1O7TA 1R6ZA 5DYHA 3CG1A 2Z8DA 4TLMB 3TFLA 3PUVE 4JXIA 2ABHA 5TPAB 4BDMA 1Y20A 3QUFA 4IB2A 2XWOA 4XF5A 4N17A 5BUUA 1QUJA 1IXCA 1NH8A 4PP0A 3UA8A 1SD3A 2Q88A 1A54A 1HSLA 3QUJA 1Y3NA 4RNSA 4QSDA 1OVTA 4O8MA 1AL3A 4Z0IA 4WKMA 5I56A 1YPNA 2XXIA 4I62A 3H6VA 3PGFA 4P0GA 3OMBA 1UTBB 4YB7A 3I6VA 1YTVA 3FUZA 5I2KA 2WKYA 3PUWE 2I0BA 3RLFE 4RJZA 4WEPA 1PDAA 3HSTA 4UACA 3IORA 4GFRA 5H8QB 4MLVA 3RT8A 2WYKA 4LONB 5HBCA 4EUOA 1YAEA 3OSQA 4OENA 5EHSA 4OTEA 3IB1A 3MP6A 1S9TA 3TAJA 3RTFB 3GYYA 1GR2A 1B40A 4UA8A 1ATGA 3KEIA 1WODA 4QFLA 1URGA 2V84A 3H03A 4YB5A 3CR9A 4H65A 4ESWA 4FIMA 3TELA 2UVGA 4WXJA 1QJMA 1DOTA 3SETA 2B65A 3C32A 2R6GE 2XHDA 3OEMA 2VHAA 4OETA 2X26A 2Q8JA 3G3JA 2XA5A 3UK4A 2O84X 4KCCA 3T9VA 3RTWB 4NF8A 1TT1A 4NF5A 1LBCA 5HM4B 2DS9A 3EN3A 1ANFA 1MPDA 3TCFA 3K1PA 2H5YA 3RN8A 2M8CA 1MY0A 1MY1A 4LQ5A 3MUQA 4QFOA 4GRKA 1LAFE 1ZLQA 3T93B 3CSGA 4KYEA 2V93A 4X04A 2H99A 3TODA 4H5FA 2F7CA 1FTMA 4OVRA 4P47A 4DCXA 2D21A 3UP9A 4R9GA 1Q35A 2NXOA 4GXAA 1MQIA 2REJA 3W15C 2RKMA 5FHNA 1PB9A 3TEPA 3CFZA 2HZKA 5IGAA 2ZNSA 3TTRA 4PGPA 2V3TA 4PC9A 3FV1A 4N8YA 4ZZEA 4RK2A 1Y3QA 2HAUA 3FATA 2DVZA 2W7YA 3FJMA 1MG1A 4NE4A 3U94A 4NF8B 1LFIA 4EXKA 4P1EA 1B3HA 1M5BA 4N15A 3GBAA 4H67A 2ZZVA 5B7DA 3K00A 1LCTA 3MPLA 2F7AA 3N5LA 5CMMA 2A5TA 2R71A 3N94A 3A3UA 2PYYA 1BLFA 2KLFA 1B3EA 3IJXB 3K02A 1FW0A 3KJTA 2OK2A 2DOJA 1MRPA 2CEXA 1F9BA 3VVDA 1IXIA 4YKIA 4BLAA 1M5CA 2F35A 1SYHA 3HPIA 1EZPA 3FZVA 4P8BA 4F19A 2V3UA 4BDOA 1A55A 3BBRA 4N6KA 1GV8A 3M8UA 3LR1A 1BIYA 2A5SA 3E9XA 2VP1A 2QMWA 3FVKA 4ELPA 2NOOA 1B5IA 1NKXA 4EXLA 1VE4A 4KR5A 3S9LC 4ESXA 2XWVA 2Y7RA 4NMYA 4TOZA 3TPAA 4DI3D 3U65A 3OXNA 3KOTA 3O66A 4P56A 4I8CA 4F1VA 2AYSA 4LA9A 2GH9A 5H8HA 1UTBA 3SEWA 1NNKA 3OELA 4QSCA 5ELVA 3ODBA 4EF1A 4G2ZA 4OEVA 4N6PA 5AE4A 1B9JA 4YZZA 1LFGA 3PUYE 4O3BA 2DWAA 4KHZE 5I84A 4GWOA 3GXAA 3BKIB 4XXUA 4EQ9A 4F3BA 5HPQA 2DQVA 2Q89A 2OWTA 5FHMA 2XXVA 3DELB 2DWJA 2X7QA 1SQYA 3K6WA 3U8QA 4KPTA 2GFEA 4PCDA 2OBGA 3MW0A 4IY6A 1D3KA 4GVOA 4PF6A 4IGRA 1BKAA 4DE8A 1NFTA 5KZTA 5FTIA 4JB7A 3I5OA 1Z7ME 3DP6A 2QMXA 1LAHE 4UABA 1JNFA 2CZLA 4IY5A 4IO5A 3HN0A 2Y7PA 4MIJA 4G68A 3U92A 5DVFA 2DE3A 4POXA 4ZEBA 4F31B
chains in the Genus database with same CATH superfamily
4RYAA 5ICQA 4MH5A 1IMAA 4XEQA 4MMPA 3IFAA 1B4HA 2I49A 4NQ8A 2ZYKA 2BJJX 1G0IA 3K2DA 3O28A 1QW0A 2O6AA 4N07A 3RNNA 3OSRA 4NWDA 1TFAA 4GOTA 3CHGA 5H8FB 3BIHA 4U4SA 4XKRA 1B7ZA 3MZ9A 1N3WA 4YKKA 4NF6B 4IGTA 3FIRA 3IOTA 3MVZA 1LAGE 3H4ZA 2DDKA 4NTLA 1OMPA 3IFCA 3ILUB 4PBHA 1JW4A 3OD7A 4R72A 2UXAA 4O3AA 2Q74A 2O1LA 3T9UA 3FVOA 4PFUA 2F6PA 2D5WA 1DPPA 3HO7A 5EYHA 4ISUA 2UVJA 4BDNA 3PPNA 4YU0A 1POY1 2XXHA 4OYVA 2NVUB 3K6UA 3WAEA 1LBYA 5AA2B 2WX9A 1MH3A 2I4CA 1NV6A 2QVUA 2CZHA 2Q2AA 2DYXA 3PPRA 2XWIA 2FBPA 2PBWA 5I59B 2ESNA 2I58A 2V4CA 3TTNA 4R2BA 3N6UA 1DTGA 1D9VA 2OJTA 4E0WA 5M2VA 5AA4A 1SW2A 3MWBA 2DXRA 3SKPA 5JTYB 1FTAA 4HXVA 1ELJA 4G68C 4QFPA 4OEUA 2VOZA 1LBVA 3TCGA 3FVGA 2Y7KA 4I9DA 1L5TA 3MVWA 1WDNA 1Z7NE 2PMSA 4LQ2A 4ZZAA 2H9BA 1KWHA 1HSEA 2YJPA 2O69A 4LN5A 1TFDA 5CMKA 2QSXA 3CFXA 3C33A 1P1UA 3K1MA 5KDTB 3D4GA 3SEYA 4JVIA 1DSNA 3IOUA 2VGQA 3DP4A 3OO9A 4OVQA 3IJOB 2HQ0A 2PFZA 3VVFA 3A29A 4O3CA 2WYPA 2ZYNA 3PMXA 1QKAA 4H5GA 2O7IA 3TZAA 4G61A 1Y4TA 5I59A 2HZLA 3MP1A 5DVIA 4OESA 4MX6A 3IOWA 5CRYA 1NUXA 1SVXB 3VLVA 1MY2A 2QVRA 3C35A 3O2AA 2ZMBA 4HCYA 2QFLA 2DWHA 4YICA 3K01A 3VXBA 3KBRA 3MJNA 3PPQA 3LBSA 3UN6A 4QFKA 1UIVA 3T66A 1DTZA 5I2NB 3DLNA 5AA1A 2HEUA 2XX8A 5LOMA 4PDDA 2ZNTA 1M5DA 1YCJA 1BK4A 2G93A 2B3FA 4BDLA 1SPIA 3MVYA 3CIJA 1FPJA 4LZ8A 4LZ7A 3IX1A 1XOCA 5I5PA 1CNQA 4ZDMA 2O1MA 1H45A 4ZEKA 4GWZA 4Z7EA 1RDXA 3G3GA 4NF4A 4LUBA 5B70A 1K9ZA 1P1NA 2CMOA 1DMBA 1XI6A 3BFUA 4G4PA 1B3FA 1MY4A 4C1TA 4BDRA 2PT2A 3VVEA 3Q25A 2H25A 1JQFA 2Q8MA 1GVCA 1MXXA 2XX9A 1AMFA 4F18A 2XXPA 3VLWA 1MPCA 3FGSA 5CBRA 4IO4A 1QUKA 3N6TA 3B6WA 4PFRA 2WEFA 1SYIA 4OZ9A 1ZIUA 3O6GA 1I6QA 4F2QA 4U4XA 2QS1A 5ITOA 1MS7A 2HPGA 2THIA 2PT1A 2PCRA 2G29A 1Y3PA 3DP8A 4OFJA 4FATA 3V83A 1SW5A 3FASA 3GZGA 2ZZWA 1URSA 4X1DA 3CI8A 5ICTA 3S2VA 1PB7A 5FBPA 3SEXA 4OVSA 1NNPA 2QL3A 1IMFA 2XD3A 3HV1A 1B6HA 3IB0A 2Q2CA 3KFMA 4H8JA 5F24A 2ONKE 5CI5A 4ZS9A 5EHMA 2P1SA 4RA1A 3HHFA 4RPNA 5F1QA 3FVNA 1SBPA 4H8IA 4U2RA 3HHGA 3MPKA 3BIGA 3KG2A 3MVXA 2B4LA 4OHNA 3LSFB 3FJGA 1I6AA 1LBBA 1EU8A 1LSTA 2HXWA 3PPPA 2UYEA 4MF3A 3D4CA 4HE0A 4AB5A 5ET5A 1MXZA 1D4NA 4ZECA 1IIWA 3HFUA 2Z22A 4YKPA 1NNTA 4ECFA 3T9HB 5L8DA 2P2AA 2X7PA 4KYDA 2I6EA 4IR8A 1POTA 3SEVA 1P1WA 1H3DA 5IKBA 1UIUA 5ET8A 3KN7A 1NV1A 1BTJA 1NV7A 4R6YA 2I0CA 4ELQA 4MNPA 1NUZA 2VPOA 4M1VA 4YAHX 1RKMA 1LB9A 4DXBA 1YXIA 5J16A 2F3BA 4THIA 2RC8A 3U93A 3CG3A 3RY3A 4ELOA 2QRYA 1T0KA 1US5A 4GX4A 5IAIA 1B2HA 4X48A 4QBAA 4PBQA 2YLNA 3MZ1A 1FTLA 4GF8A 1UTHB 1N0TA 3I3VA 4X9TA 3TQWA 2Z8EA 5J1DA 4ZEIA 1URDA 3G3KA 4QSEA 3EHSA 5H8NB 1FQCA 2GRVA 2JJKA 4LZ5A 3VLUA 3ZKKA 1N7XA 1HSJA 4PAKA 3TKDA 1SI0A 1FQFA 3OO8A 2GHAA 3FV2A 3OEKA 3U1OA 3TTKA 4RY1A 1QGXA 2UVIA 3ZS6A 2OCUA 3K4UA 3C9HA 1XVYA 1B5JA 2ONSA 3JYRA 4OVTA 4OQOA 1PBQA 4KCDA 4X8RA 2R8TA 3G3HA 1FTOA 1NL5A 5EQ9A 4PAFA 3E3KA 2KQZA 4U1OA 4ONYA 1VFDA 5AA3A 1OLCA 1CB6A 3OO7A 3KGCA 4NX1A 1B3GA 4G8MA 4ZEDA 4PF8A 4XFEA 1P1QA 3MZBA 4XTCQ 2ONRA 2OX3A 3LC8A 3BFTA 4NF0A 5I2NA 1P99A 4PETA 4PFTA 4U1ZA 1XT8A 1B7UA 5TU0A 4IO2A 3QK6A 2VT5A 3K1NA 2F78A 3C31A 1MQDA 1FPEA 4N13A 1DCUA 3JZJA 1MXVA 1EZ9A 4AB6A 4PDHA 3OOAA 2V3QA 3EQ1A 5H8SA 4GWUA 3USDA 2H98A 3O97A 3A3CA 4PFYA 1FTKA 4MNIA 3O9PA 1H76A 3Q26A 1WVJA 1O64A 2WBBA 4EDPA 4H0WA 1IMEA 4JDFA 5IM2A 4R73A 4X1BA 1USYH 3H6UA 3LSWA 1LAXA 3B7DA 3ONMA 3ZKLA 5TP9A 1FQEA 2AL4A 5H8NA 4TQUQ 1N7WA 3A09A 2I3VA 4P1LA 2LAOA 1XS5A 3H6WA 3E78A 1IXGA 1B58A 1N3XA 1FQDA 3C4MA 1FPLA 1MPBA 4N8GA 3SDFA 4DZ1A 1FBFA 1JW5A 2DP8A 1EZOA 4TLLB 2QS2A 2DE4A 4ZE8A 4OA4A 1ZBMA 1JVXA 1MQGA 2QVVA 1BP5A 1B05A 4NAPA 4KFQA 2Y7WA 3ECRA 2QS3A 1LB8A 3T1BA 2DE2A 2F7BA 4AS4A 3M3KA 1ZTYA 1R9QA 1FPDA 2F34A 4L17A 1RYXA 3FD3A 3QIMA 1VR5A 4FORA 4DDDA 1XVXA 5IZZA 4R2FA 3VDFA 2YPNA 1O63A 4EQ7A 3PU5A 2CZKA 3K6VA 2RCAA 1VDWA 1XC1A 5EYGA 2R9JA 4KXPA 3PMVA 2ZXTA 5I56B 2XXKA 3G3FA 2AL5A 4F2OA 4KI0E 5AA2A 2IA4A 5KCJB 2ANJA 4N4UA 5ITPA 3E4RA 1MXYA 4P3LA 1S50A 3UORA 1H44A 1FQAA 4DCYA 1B4ZA 3E79A 2FA7A 1AOVA 4HW8A 4RPOA 3LSXA 3C34A 3KSXA 4DIGA 1IUDA 1MXWA 5TP9B 3GBBA 1NV3A 1MM6A 4XIGQ 2UYFA 4NF6A 4GL0A 3R26A 4KQPA 2ZYOA 3OENA 1FBPA 1B51A 2E0SA 2HHMA 1LGBC 2QS4A 1IITA 3VFJA 4ZEFA 4N91A 3O6HA 2F5XA 1FBEA 4JBZA 4MAGA 2DSFA 5A5XB 4JWXA 4F3GA 1DPEA 3S9MC 4GBWA 4YMBA 1LFHA 1IZ1A 5JEIA 1R1NA 4POWA 3KSJA 4E0XA 3THIA 1UQWA 4HCWA 3EF7A 1NV0A 3G7WA 2F6GA 5ISUA 5EYFA 3CVGA 1NMUA 4G68B 1SW1A 2MKZA 1NUWA 2OLBA 4RXLA 5F7VA 1IMBA 4P9KA 1B0HA 1MM7A 3RQTA 4XKNA 4DI4B 1ZU0A 3PMWA 3U72A 3UGWA 1D9YA 1IXHA 1YZ0A 1JETA 2OWZA 2PX1A 5CM6A 3O6IA 1VFEA 4MJOA 1I6BA 4NGUA 3KZGA 2XXQA 5I58B 5T3JA 4EF2A 1ZMGA 3PUXE 4QF9A 3CFLA 3V5AA 4JWYA 1QKBA 1FSAA 1A7LA 1M5EA 5KCJA 3SERA 1OQHA 3LV0A 1A8FA 3RPLA 1FTJA 3KN8A 3C36A 4XKQA 3PV0E 3D1RA 1KZ8A 4OFLA 1Q9DA 1ZJLA 5H8HB 5I3SA 4GIZA 2F8DA 4O7MA 4F1UA 1A40A 1Y9UA 1TXFA 2P0SA 3S4UA 1NV4A 4LP2B 4PTKA 3O29A 4N6DA 1AWBA 4ELRA 3L6GA 4DXUA 4OVPA 3B6TA 4M4GA 1KA1A 3KJ7A 1PC3A 3KOSA 2O68A 1B52A 4OVJA 5DVJA 1OVBA 1H43A 2REGA 1MXUA 1JEVA 1N04A 5ET6A 1EYJA 3T96B 3F11A 2RINA 4F3SA 4MEVA 4R74A 3MSTA 4QXDA 1I69A 1QVSA 3MYUA 4MBPA 2XXWA 4FEDA 4FAJA 3FXRA 1ZKBA 3M3FA 2XXUA 4N81A 5BWJA 3TQLA 1A8EA 5K2XA 3S9EA 2HFBA 2A5TB 2Y5KA 5JK4A 2F36A 1SDXA 1A99A 1LLSA 5EQAA 4GWWA 4GXSB 1JEUA 3IB2A 5JTYA 4QRZA 2DWIA 4XKPA 3TCHA 4QFNA 1N76A 4C0RA 1IMCA 1MY3A 4LVQA 4PQJA 5L9SA 5I57B 4DLDA 3EHTA 3ILTB 4F29A 1B46A 1PB8A 2OWSA 3PPOA 5AA4B 3GLBA 4RK9A 4FECA 3AXFA 4KD5A 3KBZA 1Y1MA 4AQ4A 2FHYA 2Q9TA 4GQOA 3B50A 1P1OA 2WBDA 3W9VA 2I3WA 2F97A 5DEXB 4HS7A 3SEUA 3TTMA 1Q1KA 4GLIA 5FTHA 3W9WA 4NHBA 1FCKA 2NWJA 1GTKA 1B32A 2HAVA 1SW4A 4PE3A 5CMCA 4G77A 1TWYA 1US4A 3CRBA 4PFBA 3Q28A 3QYTA 1RYOA 3H3GA 3SESA 1EYKA 2Z23A 2Y5LA 4MCOA 5AA2D 3QAXA 1B1XA 3FXUA 2RCBA 4MHFA 5L9MA 3TYHA 1FBCA 1SI1A 4OFOA 3V89B 3TTLA 1S7YA 5CC2A 2RC9A 3RPWA 3DM0A 4QHQA 3B8BA 2V25A 5CMBA 2I4BA 4R75A 4F22A 4YMAA 1Y1ZA 4KYSA 4F3PA 5H8FA 4Q0CA 4R6KA 4GL8A 4OANA 2FIXA 2XD2A 1G0HA 1LCFA 2FYIA 2D3IA 2Y7IA 3MP8A 3M3LA 4PGNA 5I7IA 4NF4B 1NNFA 3ZSFA 3TMGA 1MH4A 5EQ7A 3B6QA 3KC1A 1N84A 2PFYA 4H6DA 3EPEA 3WAFA 5ET7A 2H4IA 3N26A 1UTHA 1OQGA 4OMBA 1NUYA 4PE5B 4U21A 4PFWA 1NI9A 4FJPA 5CBSA 3IL1B 3MAMA 4MFIA 2XXXA 2DVCA 2GHBA 2KR0A 1MQJA 3ISPA 4JWOA 4U22A 3RT6B 4C1UA 2RC7A 4I3YA 3P7IA 4PAIA 1FPIA 1Y4CA 3QMFA 2HCAA 2ZYMA 4F31B 2VD2A 4MLQA 2B4MA 4P0IA 1INPA 1VSOA 4IO7A 3EHUA 5DEXA 1QULA 4GX6A 4WEDA 2Y84A 4NWCA 4EQBA 1D9QA 5L9OA 1QUIA 2ZNUA 3IO4A 4JSOA 4R9FA 3QSLA 2CZIA 2O7UA 1JW1A 3IOVA 3G3IA 3IR1A 2XWKA 2ZZXA 1JVYA 5I57A 1B3LA 5KDTA 1B7HA 1GGGA 1II5A 2OZZA 4NF5B 4H1XA 5I2KB 1PBPA 4G8HA 4OERA 5K2YA 1M5FA 2XXYA 2QPQA 1IEJA 4ND9A 3T9XB 3VE1B 3S9NC 3MBPA 2FVZA 3PD8A 2DXYA 3MC2A 3VXCA 4U23A 1R9LA 3CSBA 2NUVA 2IEEA 3H06B 4FEBA 3K6XA 4GD5A 5DTBA 2XXTA 2RF1A 1B0LA 5TPAA 3VV5A 1NH7A 5LTCA 3UIFA 2VPNA 4BDQA 1XHYA 3JV9A 1YYZA 3RUMA 4NN3A 3OO6A 3FJ7A 4YKJA 4JSDA 3V8XB 3QXMA 3EKIA 1MDQA 4PFIA 5FHOA 5H8QA 1EH3A 4YB6A 3RPLB 4FE8A 3Q27A 3E13X 2AIXA 3PUZE 3RGYA 2I48A 4LATA 1LBXA 1IMDA 2XX7A 3MQ9A 4P11A 1OIBA 2E1SA 2VD3A 4G8NA 3T22A 3LSLA 3LUYA 3HCQA 3FXQA 1PEBA 3L6HA 4F39A 4K3FA 4F1YA 2F3DA 1CE2A 3H6TA 1AIVA 4NEDA 4ZE9A 3H7MA 1AH5A 4H45A 3R7XA 4R6HA 2XXRA 2FNCA 3KN3A 4Q5TA 3TUSA 2PVUA 5I58A 1J1NA 1MDP1 4IO3A 2B3BA 3FXBA 1K9YA 2QJEA 4MNCA 4Q8RA 4HTGA 1B5HA 4HE1A 4OXVA 2CEYA 2O51A 3R6UA 3TDJA 1B1HA 1KA0A 1IQ7A 2FIEA 3Q29A 1OLAA 4Q30B 5DT6A 1DK4A 4IO6A 1MQHA 3IAZA 1FBGA 3IO6A 2Z8FA 4O94A 5A5XA 1USYE 3K0VA 4I1DA 3PD9A 1FQBA 2ALUA 1RDZA 4OWDA 4DXCA 2UVHA 3IK6B 4NG7A 1O7TA 1R6ZA 4JVCA 5DYHA 3CG1A 2Z8DA 4TLMB 3TFLA 3PUVE 4JXIA 2ABHA 5TPAB 4BDMA 1Y20A 3QUFA 2XWOA 4IB2A 4XF5A 4N17A 5BUUA 1QUJA 1IXCA 2GQ1A 1NH8A 4PP0A 3UA8A 3KC0A 1SD3A 2Q88A 1A54A 1HSLA 3QUJA 1Y3NA 4RNSA 4QSDA 1OVTA 5IZ1A 4I3EA 4O8MA 1AL3A 4Z0IA 4WKMA 5I56A 1YPNA 2XXIA 4I62A 3H6VA 3PGFA 2P3VA 4P0GA 3OMBA 1UTBB 4YB7A 3I6VA 1YTVA 1FPFA 3FUZA 5I2KA 2WKYA 3PUWE 2I0BA 3RLFE 4HE2A 5EQ8A 4RJZA 4WEPA 1PDAA 1LBZA 3HSTA 1LEVA 4UACA 5IZ3B 3IORA 4GFRA 5H8QB 4MLVA 3RT8A 2WYKA 4LONB 4GX3A 5HBCA 4EUOA 1YAEA 3OSQA 4OENA 5EHSA 4GBVA 4OTEA 3IB1A 3MP6A 1S9TA 3TAJA 3PTYA 3RTFB 3GYYA 1B40A 4UA8A 1FBDA 1ATGA 3KEIA 1WODA 1NV2A 4QFLA 1URGA 2V84A 3H03A 4YB5A 3CR9A 4H65A 4ESWA 4FIMA 3TELA 2UVGA 4WXJA 1QJMA 1DOTA 3SETA 2B65A 1FPKA 1FJ6A 3C32A 3RYDA 2R6GE 2XHDA 4I40A 3OEMA 2VHAA 4OETA 2X26A 2Q8JA 3G3JA 2XA5A 3UK4A 2O84X 4KCCA 3T9VA 3RTWB 4NF8A 1TT1A 4NF5A 1LBCA 5HM4B 2DS9A 3EN3A 5ESYA 1ANFA 1MPDA 3TCFA 3K1PA 2H5YA 3RN8A 2M8CA 1MY0A 1MY1A 4LQ5A 4QFOA 3MUQA 4GRKA 1LAFE 1ZLQA 3T93B 3CSGA 4KYEA 2V93A 1FBHA 4X04A 2H99A 3TODA 4H5FA 2F7CA 1FTMA 4OVRA 4P47A 4DCXA 2D21A 3UP9A 4R9GA 1Q35A 2NXOA 4GXAA 1MQIA 2REJA 3ROJA 3W15C 2RKMA 5FHNA 1PB9A 3TEPA 3CFZA 1NV5A 1EYIA 2HZKA 5IGAA 2ZNSA 3TTRA 4PGPA 2V3TA 4PC9A 3FV1A 4N8YA 4ZZEA 5DW8A 4RK2A 1Y3QA 2HAUA 3FATA 2DVZA 2W7YA 3FJMA 1JP4A 1MG1A 4NE4A 3U94A 4NF8B 1LFIA 4EXKA 4P1EA 1B3HA 1M5BA 1RDYA 4N15A 3GBAA 4H67A 2ZZVA 5B7DA 3LUZA 3K00A 1LCTA 3MPLA 2F7AA 3N5LA 5CMMA 2A5TA 2R71A 3N94A 3T0JA 4FBPA 1DBZA 3A3UA 4O7IA 2PYYA 1BLFA 2KLFA 1B3EA 3IJXB 3K02A 1FW0A 3KJTA 2OK2A 5A5LA 2DOJA 1MRPA 2CEXA 1F9BA 3VVDA 1IXIA 4YKIA 4BLAA 1M5CA 2F35A 1LBWA 1SYHA 3HPIA 1EZPA 3FZVA 4P8BA 4F19A 2V3UA 4BDOA 1A55A 3BBRA 4N6KA 3NOHA 1GV8A 3M8UA 3LR1A 1BIYA 2A5SA 3E9XA 2VP1A 2QMWA 3FVKA 4ELPA 2NOOA 1B5IA 1NKXA 4EXLA 1VE4A 4GWXA 5IZ3A 4KR5A 3S9LC 4ESXA 2XWVA 2BJIA 2Y7RA 4NMYA 4TOZA 3TPAA 4DI3D 3U65A 3OXNA 3KOTA 3O66A 4P56A 4I8CA 4F1VA 2AYSA 4LA9A 2GH9A 4H46A 5H8HA 1UTBA 3SEWA 1NNKA 3OELA 3FBPA 4AS5A 4QSCA 5ELVA 4GWSA 3ODBA 1FJ9A 4G2ZA 4EF1A 4OEVA 4N6PA 5AE4A 1B9JA 4YZZA 1LFGA 3PUYE 4O3BA 2DWAA 4KHZE 5I84A 4GWOA 3GXAA 5LDZA 3BKIB 4XXUA 4EQ9A 1FPGA 4F3BA 5HPQA 2DQVA 2Q89A 2OWTA 5FHMA 2XXVA 3DELB 2DWJA 2X7QA 1SQYA 3K6WA 4KPTA 3U8QA 2HXRA 2GFEA 2OBGA 3MW0A 4IY6A 4PCDA 1D3KA 4GVOA 4PF6A 4IGRA 1BKAA 4DE8A 1NFTA 5KZTA 5FTIA 2L5VA 4JB7A 3I5OA 1Z7ME 3DP6A 1FRPA 2QMXA 1LAHE 4GWYA 4UABA 1JNFA 2CZLA 4IY5A 1FPBA 4IO5A 3HN0A 2Y7PA 4MIJA 4G68A 3U92A 5DVFA 3SZPA 2P3NA 2DE3A 4POXA 4JVDA 4ZEBA 1GR2A
chains in the Genus database with same CATH topology
4RYAA 5ICQA 4MH5A 1IMAA 4XEQA 4MMPA 3IFAA 1B4HA 2I49A 4NQ8A 2ZYKA 2BJJX 1G0IA 3K2DA 3O28A 1QW0A 2O6AA 4N07A 3RNNA 3OSRA 4NWDA 1TFAA 4GOTA 3CHGA 5H8FB 3BIHA 4U4SA 4XKRA 1B7ZA 3MZ9A 1N3WA 4YKKA 4NF6B 4IGTA 3FIRA 3IOTA 3MVZA 1LAGE 3H4ZA 4NTLA 2DDKA 1OMPA 3ILUB 3IFCA 4PBHA 1JW4A 3OD7A 4R72A 2UXAA 4O3AA 2Q74A 2O1LA 3T9UA 3FVOA 4PFUA 2F6PA 2D5WA 1DPPA 3HO7A 5EYHA 4ISUA 2UVJA 4BDNA 3PPNA 4YU0A 1POY1 2XXHA 4OYVA 2NVUB 3K6UA 3WAEA 1LBYA 5AA2B 2WX9A 1MH3A 2I4CA 1NV6A 2QVUA 2CZHA 2Q2AA 2DYXA 3PPRA 2XWIA 2FBPA 2PBWA 5I59B 2ESNA 2I58A 2V4CA 3TTNA 4R2BA 3N6UA 1DTGA 1D9VA 2OJTA 4E0WA 5M2VA 5AA4A 1SW2A 3MWBA 2DXRA 3SKPA 5JTYB 1FTAA 4HXVA 1ELJA 4G68C 4QFPA 4OEUA 2VOZA 3TCGA 1LBVA 3FVGA 2Y7KA 4I9DA 1L5TA 3MVWA 1WDNA 1Z7NE 2PMSA 4LQ2A 4ZZAA 2H9BA 1KWHA 1HSEA 2YJPA 2O69A 4LN5A 1TFDA 5CMKA 2QSXA 3CFXA 3C33A 1P1UA 3K1MA 5KDTB 3D4GA 3SEYA 4JVIA 1DSNA 3IOUA 2VGQA 3DP4A 3OO9A 4OVQA 3IJOB 2HQ0A 2PFZA 3VVFA 3A29A 4O3CA 2WYPA 2ZYNA 3PMXA 1QKAA 4H5GA 2O7IA 3TZAA 4G61A 1Y4TA 5I59A 2HZLA 3MP1A 5DVIA 4OESA 4MX6A 3IOWA 5CRYA 1NUXA 1SVXB 3VLVA 1MY2A 3C35A 3O2AA 2QVRA 2ZMBA 4HCYA 2QFLA 2DWHA 4YICA 3K01A 3VXBA 3KBRA 3MJNA 3PPQA 3LBSA 3UN6A 4QFKA 1UIVA 3T66A 1DTZA 5I2NB 3DLNA 5AA1A 2HEUA 2XX8A 5LOMA 4PDDA 2ZNTA 1M5DA 1YCJA 1BK4A 2G93A 2B3FA 4BDLA 1SPIA 3MVYA 3CIJA 1FPJA 4LZ8A 4LZ7A 3IX1A 1XOCA 5I5PA 1CNQA 4ZDMA 2O1MA 1H45A 4ZEKA 4GWZA 4Z7EA 1RDXA 3G3GA 4NF4A 4LUBA 5B70A 2CMOA 1P1NA 1K9ZA 1DMBA 1XI6A 3BFUA 4G4PA 1B3FA 1MY4A 4C1TA 4BDRA 2PT2A 3VVEA 3Q25A 2H25A 1JQFA 2Q8MA 1GVCA 1MXXA 2XX9A 1AMFA 4F18A 2XXPA 3VLWA 1MPCA 3FGSA 5CBRA 4IO4A 1QUKA 3N6TA 3B6WA 4PFRA 2WEFA 1SYIA 4OZ9A 1ZIUA 3O6GA 1I6QA 4F2QA 4U4XA 2QS1A 5ITOA 1MS7A 2THIA 2HPGA 2PT1A 2PCRA 2G29A 1Y3PA 4FATA 3DP8A 4OFJA 3V83A 1SW5A 3FASA 3GZGA 2ZZWA 1URSA 4X1DA 3CI8A 5ICTA 3S2VA 1PB7A 5FBPA 3SEXA 4OVSA 1NNPA 2QL3A 1IMFA 2XD3A 3HV1A 1B6HA 3IB0A 2Q2CA 3KFMA 4H8JA 5F24A 2ONKE 5CI5A 4ZS9A 5EHMA 2P1SA 4RA1A 3HHFA 4RPNA 5F1QA 3FVNA 1SBPA 4H8IA 4U2RA 3HHGA 3MPKA 3BIGA 3KG2A 3MVXA 2B4LA 4OHNA 3LSFB 3FJGA 1I6AA 1LBBA 1EU8A 1LSTA 2HXWA 3PPPA 2UYEA 4MF3A 3D4CA 4HE0A 4AB5A 5ET5A 1MXZA 1D4NA 4ZECA 1IIWA 3HFUA 2Z22A 4YKPA 1NNTA 4ECFA 3T9HB 5L8DA 2P2AA 2X7PA 4KYDA 2I6EA 4IR8A 1POTA 3SEVA 1P1WA 1H3DA 5IKBA 1UIUA 5ET8A 3KN7A 1NV1A 1BTJA 1NV7A 4R6YA 2I0CA 4ELQA 4MNPA 1NUZA 2VPOA 4M1VA 4YAHX 1RKMA 1LB9A 4DXBA 1YXIA 5J16A 2F3BA 4THIA 2RC8A 3U93A 3CG3A 3RY3A 4ELOA 2QRYA 1T0KA 1US5A 4GX4A 5IAIA 1B2HA 4X48A 4PBQA 4QBAA 2YLNA 3MZ1A 1FTLA 4GF8A 1UTHB 1N0TA 3I3VA 4X9TA 3TQWA 2Z8EA 5J1DA 4ZEIA 1URDA 3G3KA 4QSEA 3EHSA 5H8NB 1FQCA 2GRVA 2JJKA 4LZ5A 3VLUA 3ZKKA 1N7XA 1HSJA 4PAKA 3TKDA 1SI0A 1FQFA 3OO8A 2GHAA 3FV2A 3OEKA 3U1OA 3TTKA 4RY1A 1QGXA 2UVIA 3ZS6A 2OCUA 3K4UA 3C9HA 1XVYA 1B5JA 2ONSA 3JYRA 4OVTA 4OQOA 1PBQA 4KCDA 4X8RA 2R8TA 3G3HA 1FTOA 1NL5A 5EQ9A 4PAFA 3E3KA 2KQZA 4U1OA 4ONYA 1VFDA 5AA3A 1OLCA 1CB6A 3OO7A 3KGCA 4NX1A 1B3GA 4ZEDA 4G8MA 4PF8A 4XFEA 1P1QA 3MZBA 4XTCQ 2ONRA 2OX3A 3LC8A 3BFTA 5I2NA 4NF0A 1P99A 4PETA 4PFTA 4U1ZA 1XT8A 1B7UA 5TU0A 4IO2A 3QK6A 2VT5A 3K1NA 2F78A 3C31A 1MQDA 1FPEA 4N13A 1DCUA 3JZJA 1MXVA 1EZ9A 4AB6A 4PDHA 3OOAA 2V3QA 3EQ1A 5H8SA 4GWUA 3USDA 2H98A 3O97A 3A3CA 4PFYA 1FTKA 4MNIA 3O9PA 1H76A 3Q26A 1WVJA 1O64A 2WBBA 4EDPA 4H0WA 1IMEA 4JDFA 5IM2A 4R73A 4X1BA 1USYH 3H6UA 3LSWA 1LAXA 3B7DA 3ONMA 3ZKLA 5TP9A 1FQEA 2AL4A 5H8NA 4TQUQ 1N7WA 3A09A 2I3VA 4P1LA 2LAOA 1XS5A 3H6WA 3E78A 1IXGA 1B58A 1N3XA 1FQDA 3C4MA 1FPLA 1MPBA 3SDFA 4DZ1A 4N8GA 1FBFA 1JW5A 2DP8A 1EZOA 4TLLB 2QS2A 2DE4A 4ZE8A 4OA4A 1ZBMA 1JVXA 1MQGA 2QVVA 1BP5A 1B05A 4NAPA 4KFQA 2Y7WA 3ECRA 2QS3A 1LB8A 3T1BA 2DE2A 2F7BA 4AS4A 3M3KA 1ZTYA 1R9QA 1FPDA 2F34A 4L17A 1RYXA 3FD3A 3QIMA 1VR5A 4FORA 4DDDA 1XVXA 5IZZA 4R2FA 3VDFA 2YPNA 1O63A 4EQ7A 3PU5A 2CZKA 3K6VA 2RCAA 1VDWA 1XC1A 5EYGA 2R9JA 4KXPA 3PMVA 2ZXTA 5I56B 2XXKA 3G3FA 2AL5A 4F2OA 4KI0E 5AA2A 2IA4A 5KCJB 2ANJA 5ITPA 4N4UA 3E4RA 1MXYA 4P3LA 1S50A 3UORA 1H44A 1FQAA 4DCYA 1B4ZA 3E79A 2FA7A 1AOVA 4HW8A 4RPOA 3LSXA 3C34A 3KSXA 4DIGA 1IUDA 1MXWA 5TP9B 3GBBA 1NV3A 1MM6A 4XIGQ 2UYFA 4NF6A 4GL0A 3R26A 4KQPA 2ZYOA 3OENA 1FBPA 1B51A 2E0SA 2HHMA 1LGBC 2QS4A 1IITA 3VFJA 4ZEFA 4N91A 3O6HA 2F5XA 1FBEA 4JBZA 4MAGA 2DSFA 5A5XB 4JWXA 4F3GA 1DPEA 3S9MC 4GBWA 4YMBA 1LFHA 1IZ1A 5JEIA 1R1NA 4POWA 3KSJA 4E0XA 3THIA 1UQWA 4HCWA 3EF7A 1NV0A 3G7WA 2F6GA 5ISUA 5EYFA 3CVGA 1NMUA 4G68B 1SW1A 2MKZA 1NUWA 2OLBA 4RXLA 5F7VA 1IMBA 4P9KA 1B0HA 1MM7A 3RQTA 4XKNA 4DI4B 1ZU0A 3PMWA 3U72A 3UGWA 1D9YA 1IXHA 1YZ0A 1JETA 2PX1A 2OWZA 5CM6A 3O6IA 1VFEA 4MJOA 1I6BA 4NGUA 3KZGA 2XXQA 5I58B 5T3JA 4EF2A 1ZMGA 3PUXE 4QF9A 3CFLA 3V5AA 4JWYA 1QKBA 1FSAA 1A7LA 1M5EA 5KCJA 3SERA 1OQHA 3LV0A 1A8FA 3RPLA 1FTJA 3KN8A 3C36A 4XKQA 3PV0E 3D1RA 1KZ8A 4OFLA 1Q9DA 1ZJLA 5H8HB 5I3SA 4GIZA 2F8DA 4O7MA 4F1UA 1A40A 1Y9UA 1TXFA 2P0SA 3S4UA 1NV4A 4LP2B 4PTKA 3O29A 4N6DA 1AWBA 4ELRA 3L6GA 4DXUA 4OVPA 3B6TA 4M4GA 1KA1A 3KJ7A 1PC3A 3KOSA 2O68A 1B52A 4OVJA 5DVJA 1OVBA 1H43A 2REGA 1MXUA 1JEVA 1N04A 5ET6A 1EYJA 3T96B 3F11A 2RINA 4F3SA 4MEVA 4R74A 3MSTA 4QXDA 1I69A 1QVSA 3MYUA 4MBPA 2XXWA 4FEDA 4FAJA 3FXRA 1ZKBA 3M3FA 2XXUA 5BWJA 4N81A 3TQLA 1A8EA 5K2XA 3S9EA 2HFBA 2A5TB 2Y5KA 5JK4A 2F36A 1SDXA 1A99A 1LLSA 5EQAA 4GWWA 4GXSB 1JEUA 3IB2A 5JTYA 4QRZA 2DWIA 4XKPA 3TCHA 4QFNA 1N76A 4C0RA 1IMCA 1MY3A 4LVQA 4PQJA 5L9SA 5I57B 4DLDA 3EHTA 3ILTB 4F29A 1B46A 1PB8A 2OWSA 3PPOA 5AA4B 3GLBA 4RK9A 4FECA 3AXFA 4KD5A 3KBZA 1Y1MA 4AQ4A 2FHYA 2Q9TA 4GQOA 3B50A 1P1OA 2WBDA 3W9VA 2I3WA 2F97A 5DEXB 4HS7A 3SEUA 3TTMA 1Q1KA 4GLIA 5FTHA 3W9WA 4NHBA 1FCKA 2NWJA 1GTKA 1B32A 2HAVA 1SW4A 5CMCA 4PE3A 4G77A 1TWYA 1US4A 3CRBA 3Q28A 4PFBA 3QYTA 1RYOA 3H3GA 3SESA 1EYKA 2Z23A 2Y5LA 4MCOA 5AA2D 3QAXA 1B1XA 3FXUA 2RCBA 5L9MA 3TYHA 4MHFA 1FBCA 1SI1A 4OFOA 3V89B 3TTLA 1S7YA 5CC2A 2RC9A 3RPWA 3DM0A 4QHQA 3B8BA 2V25A 5CMBA 2I4BA 4R75A 4F22A 4YMAA 1Y1ZA 4KYSA 4F3PA 5H8FA 4Q0CA 4R6KA 4GL8A 4OANA 2FIXA 2XD2A 1G0HA 1LCFA 2FYIA 2D3IA 2Y7IA 3MP8A 3M3LA 4PGNA 5I7IA 4NF4B 1NNFA 3ZSFA 3TMGA 1MH4A 5EQ7A 3B6QA 3KC1A 1N84A 4H6DA 2PFYA 3EPEA 3WAFA 5ET7A 2H4IA 3N26A 1UTHA 1OQGA 4OMBA 1NUYA 4PE5B 4U21A 4PFWA 1NI9A 4FJPA 5CBSA 3IL1B 3MAMA 4MFIA 2XXXA 2DVCA 2GHBA 2KR0A 1MQJA 3ISPA 4JWOA 4U22A 3RT6B 4C1UA 2RC7A 4I3YA 3P7IA 4PAIA 1FPIA 1Y4CA 3QMFA 2HCAA 2ZYMA 2VD2A 4MLQA 2B4MA 4P0IA 1INPA 1VSOA 4IO7A 3EHUA 5DEXA 1QULA 4GX6A 4WEDA 2Y84A 4NWCA 4EQBA 1D9QA 5L9OA 1QUIA 2ZNUA 3IO4A 4JSOA 4R9FA 3QSLA 2O7UA 2CZIA 1JW1A 3IOVA 3G3IA 3IR1A 2XWKA 2ZZXA 1JVYA 5I57A 1B3LA 5KDTA 1B7HA 1GGGA 1II5A 2OZZA 4NF5B 4H1XA 5I2KB 1PBPA 4G8HA 4OERA 5K2YA 1M5FA 2XXYA 2QPQA 1IEJA 4ND9A 3T9XB 3VE1B 3S9NC 3MBPA 2FVZA 3PD8A 2DXYA 3MC2A 3VXCA 4U23A 1R9LA 3CSBA 2NUVA 2IEEA 3H06B 4FEBA 3K6XA 4GD5A 5DTBA 2XXTA 2RF1A 1B0LA 5TPAA 3VV5A 1NH7A 5LTCA 3UIFA 2VPNA 4BDQA 1XHYA 3JV9A 1YYZA 3RUMA 4NN3A 3OO6A 3FJ7A 4YKJA 4JSDA 3V8XB 3QXMA 3EKIA 1MDQA 4PFIA 5FHOA 5H8QA 1EH3A 4YB6A 3RPLB 4FE8A 3Q27A 3E13X 2AIXA 3PUZE 3RGYA 2I48A 4LATA 1LBXA 1IMDA 2XX7A 3MQ9A 4P11A 3T22A 1OIBA 2E1SA 2VD3A 4G8NA 3LSLA 3LUYA 3HCQA 3FXQA 1PEBA 3L6HA 4F39A 4K3FA 4F1YA 2F3DA 1CE2A 3H6TA 1AIVA 4NEDA 4ZE9A 3H7MA 1AH5A 4H45A 3R7XA 4R6HA 2XXRA 2FNCA 3KN3A 4Q5TA 3TUSA 2PVUA 5I58A 1J1NA 1MDP1 4IO3A 2B3BA 3FXBA 1K9YA 2QJEA 4MNCA 4Q8RA 4HTGA 1B5HA 4HE1A 4OXVA 2CEYA 2O51A 3R6UA 3TDJA 1B1HA 1KA0A 1IQ7A 2FIEA 3Q29A 1OLAA 4Q30B 5DT6A 1DK4A 4IO6A 1MQHA 3IAZA 1FBGA 3IO6A 2Z8FA 4O94A 5A5XA 1USYE 3K0VA 4I1DA 3PD9A 1FQBA 2ALUA 1RDZA 4OWDA 4DXCA 2UVHA 3IK6B 4NG7A 1O7TA 1R6ZA 4JVCA 5DYHA 3CG1A 2Z8DA 4TLMB 3TFLA 3PUVE 4JXIA 2ABHA 5TPAB 4BDMA 1Y20A 3QUFA 4IB2A 2XWOA 4XF5A 4N17A 5BUUA 1QUJA 1IXCA 2GQ1A 1NH8A 4PP0A 3UA8A 3KC0A 1SD3A 2Q88A 1A54A 1HSLA 3QUJA 1Y3NA 4RNSA 4QSDA 1OVTA 5IZ1A 4I3EA 4O8MA 1AL3A 4Z0IA 4WKMA 5I56A 1YPNA 2XXIA 4I62A 3H6VA 3PGFA 2P3VA 4P0GA 3OMBA 1UTBB 4YB7A 3I6VA 1YTVA 1FPFA 3FUZA 5I2KA 2WKYA 3PUWE 2I0BA 3RLFE 4HE2A 5EQ8A 4RJZA 4WEPA 1PDAA 1LBZA 3HSTA 1LEVA 4UACA 5IZ3B 3IORA 4GFRA 5H8QB 4MLVA 3RT8A 2WYKA 4LONB 4GX3A 5HBCA 4EUOA 1YAEA 3OSQA 4OENA 5EHSA 4GBVA 4OTEA 3IB1A 3MP6A 1S9TA 3TAJA 3PTYA 3RTFB 1GR2A 3GYYA 1B40A 4UA8A 1FBDA 1ATGA 3KEIA 1WODA 1NV2A 4QFLA 1URGA 2V84A 3H03A 4YB5A 3CR9A 4H65A 4ESWA 4FIMA 3TELA 2UVGA 4WXJA 1QJMA 1DOTA 3SETA 2B65A 1FPKA 1FJ6A 3C32A 3RYDA 2R6GE 2XHDA 4I40A 3OEMA 2VHAA 4OETA 2X26A 2Q8JA 3G3JA 2XA5A 3UK4A 2O84X 4KCCA 3T9VA 3RTWB 4NF8A 1TT1A 4NF5A 1LBCA 5HM4B 2DS9A 3EN3A 5ESYA 1ANFA 1MPDA 3TCFA 3K1PA 2H5YA 3RN8A 2M8CA 1MY0A 1MY1A 4LQ5A 3MUQA 4QFOA 4GRKA 1LAFE 1ZLQA 3T93B 3CSGA 4KYEA 2V93A 1FBHA 4X04A 2H99A 3TODA 4H5FA 2F7CA 1FTMA 4OVRA 4P47A 4DCXA 2D21A 3UP9A 4R9GA 1Q35A 2NXOA 4GXAA 1MQIA 2REJA 3ROJA 3W15C 2RKMA 5FHNA 1PB9A 3TEPA 3CFZA 1NV5A 1EYIA 2HZKA 5IGAA 2ZNSA 3TTRA 4PGPA 2V3TA 4PC9A 3FV1A 4N8YA 4ZZEA 5DW8A 4RK2A 1Y3QA 2HAUA 3FATA 2DVZA 2W7YA 3FJMA 1JP4A 1MG1A 4NE4A 3U94A 4NF8B 1LFIA 4EXKA 4P1EA 1B3HA 1M5BA 1RDYA 4N15A 3GBAA 4H67A 2ZZVA 5B7DA 3LUZA 3K00A 1LCTA 3MPLA 2F7AA 3N5LA 5CMMA 2A5TA 2R71A 3N94A 3T0JA 4FBPA 1DBZA 3A3UA 4O7IA 2PYYA 1BLFA 2KLFA 1B3EA 3IJXB 3K02A 1FW0A 3KJTA 2OK2A 5A5LA 2DOJA 1MRPA 2CEXA 1F9BA 3VVDA 1IXIA 4YKIA 4BLAA 1M5CA 2F35A 1LBWA 1SYHA 3HPIA 1EZPA 3FZVA 4P8BA 4F19A 2V3UA 4BDOA 1A55A 3BBRA 4N6KA 3NOHA 1GV8A 3M8UA 3LR1A 1BIYA 2A5SA 3E9XA 2VP1A 2QMWA 3FVKA 4ELPA 2NOOA 1B5IA 1NKXA 4EXLA 1VE4A 4GWXA 5IZ3A 4KR5A 3S9LC 4ESXA 2XWVA 2BJIA 2Y7RA 4NMYA 4TOZA 3TPAA 4DI3D 3U65A 3OXNA 3KOTA 3O66A 4P56A 4I8CA 4F1VA 2AYSA 4LA9A 2GH9A 4H46A 5H8HA 1UTBA 3SEWA 1NNKA 3OELA 3FBPA 4AS5A 4QSCA 5ELVA 4GWSA 3ODBA 4EF1A 4G2ZA 1FJ9A 4OEVA 4N6PA 5AE4A 1B9JA 4YZZA 1LFGA 3PUYE 4O3BA 2DWAA 4KHZE 5I84A 4GWOA 3GXAA 5LDZA 3BKIB 4XXUA 4EQ9A 4F3BA 5HPQA 1FPGA 2DQVA 2Q89A 2OWTA 5FHMA 2XXVA 3DELB 2DWJA 2X7QA 1SQYA 3K6WA 3U8QA 4KPTA 2HXRA 2GFEA 2OBGA 3MW0A 4IY6A 4PCDA 1D3KA 4GVOA 4PF6A 4IGRA 1BKAA 4DE8A 1NFTA 5KZTA 5FTIA 2L5VA 4JB7A 3I5OA 1Z7ME 3DP6A 1FRPA 2QMXA 1LAHE 4GWYA 4UABA 1JNFA 2CZLA 4IY5A 1FPBA 4IO5A 3HN0A 2Y7PA 4MIJA 4G68A 3U92A 5DVFA 3SZPA 2P3NA 2DE3A 4POXA 4JVDA 4ZEBA 4F31B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RYA A;  5ICQ A;  4MH5 A;  4XEQ A;  4MMP A;  1B4H A;  2I49 A;  4NQ8 A;  2ZYK A;  2BJJ X;  3K2D A;  3O28 A;  1QW0 A;  2O6A A;  4N07 A;  3RNN A;  3OSR A;  4NWD A;  1TFA A;  4GOT A;  5H8F B;  4U4S A;  4XKR A;  1B7Z A;  3MZ9 A;  1N3W A;  4YKK A;  4NF6 B;  4IGT A;  3FIR A;  3IOT A;  3MVZ A;  1LAG E;  3H4Z A;  4NTL A;  1OMP A;  3ILU B;  4PBH A;  1JW4 A;  3OD7 A;  4R72 A;  2UXA A;  4O3A A;  2O1L A;  3T9U A;  3FVO A;  4PFU A;  2F6P A;  2D5W A;  1DPP A;  3HO7 A;  4ISU A;  2UVJ A;  4BDN A;  3PPN A;  4YU0 A;  1POY 1;  2XXH A;  4OYV A;  2NVU B;  3K6U A;  3WAE A;  5AA2 B;  2WX9 A;  1MH3 A;  2I4C A;  2Q2A A;  2DYX A;  3PPR A;  2XWI A;  2PBW A;  5I59 B;  2ESN A;  2I58 A;  2V4C A;  3TTN A;  4R2B A;  3N6U A;  1DTG A;  1D9V A;  2OJT A;  4E0W A;  5M2V A;  5AA4 A;  1SW2 A;  3MWB A;  2DXR A;  3SKP A;  5JTY B;  1ELJ A;  4G68 C;  4QFP A;  4OEU A;  2VOZ A;  3TCG A;  3FVG A;  2Y7K A;  4I9D A;  1L5T A;  3MVW A;  1WDN A;  1Z7N E;  2PMS A;  4LQ2 A;  4ZZA A;  2H9B A;  1KWH A;  1HSE A;  2YJP A;  2O69 A;  4LN5 A;  1TFD A;  5CMK A;  2QSX A;  3CFX A;  3C33 A;  1P1U A;  3K1M A;  5KDT B;  3D4G A;  3SEY A;  1DSN A;  3IOU A;  2VGQ A;  3DP4 A;  3OO9 A;  4OVQ A;  3IJO B;  2HQ0 A;  2PFZ A;  3VVF A;  4O3C A;  2WYP A;  2ZYN A;  3PMX A;  1QKA A;  4H5G A;  2O7I A;  3TZA A;  1Y4T A;  5I59 A;  2HZL A;  3MP1 A;  5DVI A;  4OES A;  4MX6 A;  3IOW A;  5CRY A;  1SVX B;  3VLV A;  1MY2 A;  3C35 A;  3O2A A;  2ZMB A;  4HCY A;  2DWH A;  4YIC A;  3K01 A;  3VXB A;  3KBR A;  3MJN A;  3PPQ A;  3LBS A;  3UN6 A;  4QFK A;  1UIV A;  3T66 A;  1DTZ A;  5I2N B;  3DLN A;  5AA1 A;  2HEU A;  2XX8 A;  5LOM A;  4PDD A;  2ZNT A;  1M5D A;  1YCJ A;  2G93 A;  2B3F A;  4BDL A;  3MVY A;  3CIJ A;  4LZ8 A;  4LZ7 A;  3IX1 A;  1XOC A;  5I5P A;  4ZDM A;  2O1M A;  1H45 A;  4ZEK A;  4Z7E A;  3G3G A;  4NF4 A;  4LUB A;  5B70 A;  2CMO A;  1P1N A;  1DMB A;  3BFU A;  4G4P A;  1B3F A;  1MY4 A;  4C1T A;  4BDR A;  2PT2 A;  3VVE A;  3Q25 A;  2H25 A;  1JQF A;  1GVC A;  1MXX A;  2XX9 A;  1AMF A;  4F18 A;  2XXP A;  3VLW A;  1MPC A;  3FGS A;  5CBR A;  4IO4 A;  1QUK A;  3N6T A;  3B6W A;  4PFR A;  1SYI A;  4OZ9 A;  1ZIU A;  3O6G A;  1I6Q A;  4F2Q A;  4U4X A;  2QS1 A;  5ITO A;  1MS7 A;  2THI A;  2HPG A;  2PT1 A;  2G29 A;  1Y3P A;  4FAT A;  3DP8 A;  4OFJ A;  3V83 A;  1SW5 A;  3FAS A;  3GZG A;  2ZZW A;  1URS A;  4X1D A;  3CI8 A;  5ICT A;  3S2V A;  1PB7 A;  3SEX A;  4OVS A;  1NNP A;  2QL3 A;  2XD3 A;  3HV1 A;  1B6H A;  3IB0 A;  2Q2C A;  3KFM A;  4H8J A;  2ONK E;  5CI5 A;  4ZS9 A;  5EHM A;  2P1S A;  4RA1 A;  3HHF A;  4RPN A;  5F1Q A;  3FVN A;  1SBP A;  4H8I A;  4U2R A;  3HHG A;  3MPK A;  3KG2 A;  3MVX A;  4OHN A;  3LSF B;  3FJG A;  1I6A A;  1LBB A;  1EU8 A;  1LST A;  2HXW A;  3PPP A;  2UYE A;  4MF3 A;  3D4C A;  4AB5 A;  1MXZ A;  1D4N A;  4ZEC A;  1IIW A;  2Z22 A;  4YKP A;  1NNT A;  4ECF A;  3T9H B;  5L8D A;  2P2A A;  2X7P A;  4KYD A;  2I6E A;  1POT A;  3SEV A;  1P1W A;  1H3D A;  5IKB A;  1UIU A;  3KN7 A;  1BTJ A;  4R6Y A;  2I0C A;  4ELQ A;  4MNP A;  2VPO A;  4M1V A;  4YAH X;  1RKM A;  1LB9 A;  4DXB A;  4THI A;  2RC8 A;  3U93 A;  3CG3 A;  3RY3 A;  4ELO A;  2QRY A;  1T0K A;  1US5 A;  5IAI A;  1B2H A;  4X48 A;  4PBQ A;  2YLN A;  3MZ1 A;  1FTL A;  4GF8 A;  1UTH B;  1N0T A;  3I3V A;  4X9T A;  3TQW A;  2Z8E A;  5J1D A;  4ZEI A;  1URD A;  3G3K A;  4QSE A;  3EHS A;  5H8N B;  1FQC A;  2GRV A;  4LZ5 A;  3VLU A;  3ZKK A;  1N7X A;  1HSJ A;  4PAK A;  3TKD A;  1SI0 A;  1FQF A;  3OO8 A;  2GHA A;  3FV2 A;  3OEK A;  3U1O A;  3TTK A;  4RY1 A;  2UVI A;  3ZS6 A;  2OCU A;  3K4U A;  3C9H A;  1XVY A;  1B5J A;  2ONS A;  3JYR A;  4OVT A;  4OQO A;  1PBQ A;  4KCD A;  4X8R A;  3G3H A;  1FTO A;  1NL5 A;  4PAF A;  3E3K A;  4U1O A;  4ONY A;  1VFD A;  5AA3 A;  1OLC A;  1CB6 A;  3OO7 A;  3KGC A;  4NX1 A;  1B3G A;  4ZED A;  4G8M A;  4PF8 A;  4XFE A;  1P1Q A;  3MZB A;  4XTC Q;  2ONR A;  3LC8 A;  3BFT A;  5I2N A;  4NF0 A;  1P99 A;  4PET A;  4PFT A;  4U1Z A;  1XT8 A;  1B7U A;  5TU0 A;  4IO2 A;  3QK6 A;  3K1N A;  2F78 A;  3C31 A;  1MQD A;  4N13 A;  3JZJ A;  1MXV A;  1EZ9 A;  4AB6 A;  4PDH A;  3OOA A;  2V3Q A;  3EQ1 A;  5H8S A;  3USD A;  2H98 A;  3O97 A;  3A3C A;  4PFY A;  1FTK A;  4MNI A;  3O9P A;  1H76 A;  3Q26 A;  1WVJ A;  1O64 A;  4EDP A;  4H0W A;  4JDF A;  5IM2 A;  4R73 A;  4X1B A;  1USY H;  3H6U A;  3LSW A;  1LAX A;  3B7D A;  3ONM A;  3ZKL A;  5TP9 A;  1FQE A;  2AL4 A;  5H8N A;  4TQU Q;  1N7W A;  3A09 A;  2I3V A;  4P1L A;  2LAO A;  1XS5 A;  3H6W A;  1IXG A;  1B58 A;  1N3X A;  1FQD A;  3C4M A;  1MPB A;  3SDF A;  4DZ1 A;  4N8G A;  1JW5 A;  2DP8 A;  1EZO A;  4TLL B;  2QS2 A;  2DE4 A;  4ZE8 A;  4OA4 A;  1ZBM A;  1JVX A;  1MQG A;  1BP5 A;  1B05 A;  4NAP A;  4KFQ A;  2Y7W A;  3ECR A;  2QS3 A;  1LB8 A;  2DE2 A;  2F7B A;  3M3K A;  1ZTY A;  1R9Q A;  2F34 A;  4L17 A;  1RYX A;  3FD3 A;  3QIM A;  1VR5 A;  4FOR A;  4DDD A;  1XVX A;  5IZZ A;  4R2F A;  3VDF A;  2YPN A;  1O63 A;  4EQ7 A;  3PU5 A;  3K6V A;  2RCA A;  1XC1 A;  2R9J A;  3PMV A;  2ZXT A;  5I56 B;  2XXK A;  3G3F A;  2AL5 A;  4F2O A;  4KI0 E;  5AA2 A;  2IA4 A;  5KCJ B;  2ANJ A;  4N4U A;  5ITP A;  3E4R A;  1MXY A;  4P3L A;  1S50 A;  3UOR A;  1H44 A;  1FQA A;  4DCY A;  1B4Z A;  2FA7 A;  1AOV A;  4HW8 A;  4RPO A;  3LSX A;  3C34 A;  3KSX A;  4DIG A;  1IUD A;  1MXW A;  5TP9 B;  3GBB A;  1MM6 A;  4XIG Q;  2UYF A;  4NF6 A;  4GL0 A;  3R26 A;  4KQP A;  2ZYO A;  3OEN A;  1B51 A;  2E0S A;  1LGB C;  2QS4 A;  1IIT A;  3VFJ A;  4ZEF A;  4N91 A;  3O6H A;  2F5X A;  4JBZ A;  4MAG A;  2DSF A;  5A5X B;  4JWX A;  4F3G A;  1DPE A;  3S9M C;  4YMB A;  1LFH A;  1IZ1 A;  5JEI A;  1R1N A;  4POW A;  3KSJ A;  4E0X A;  3THI A;  1UQW A;  4HCW A;  3EF7 A;  3G7W A;  2F6G A;  5ISU A;  5EYF A;  3CVG A;  1NMU A;  4G68 B;  1SW1 A;  2OLB A;  4RXL A;  5F7V A;  4P9K A;  1B0H A;  1MM7 A;  3RQT A;  4XKN A;  4DI4 B;  1ZU0 A;  3PMW A;  3U72 A;  3UGW A;  1D9Y A;  1IXH A;  1JET A;  2PX1 A;  5CM6 A;  3O6I A;  1VFE A;  1I6B A;  4NGU A;  3KZG A;  2XXQ A;  5I58 B;  4EF2 A;  1ZMG A;  3PUX E;  4QF9 A;  3CFL A;  3V5A A;  4JWY A;  1QKB A;  1A7L A;  1M5E A;  5KCJ A;  3SER A;  1OQH A;  1A8F A;  1FTJ A;  3KN8 A;  3C36 A;  4XKQ A;  3PV0 E;  4OFL A;  1ZJL A;  5H8H B;  4GIZ A;  2F8D A;  4O7M A;  4F1U A;  1A40 A;  1Y9U A;  1TXF A;  2P0S A;  3S4U A;  4LP2 B;  3O29 A;  4N6D A;  4ELR A;  3L6G A;  4DXU A;  4OVP A;  3B6T A;  4M4G A;  3KJ7 A;  1PC3 A;  3KOS A;  2O68 A;  1B52 A;  4OVJ A;  5DVJ A;  1OVB A;  1H43 A;  2REG A;  1MXU A;  1JEV A;  1N04 A;  3T96 B;  3F11 A;  2RIN A;  4F3S A;  4MEV A;  4R74 A;  1I69 A;  1QVS A;  4MBP A;  2XXW A;  4FED A;  4FAJ A;  3FXR A;  1ZKB A;  3M3F A;  2XXU A;  5BWJ A;  3TQL A;  1A8E A;  5K2X A;  3S9E A;  2HFB A;  2A5T B;  5JK4 A;  2F36 A;  1SDX A;  1A99 A;  1LLS A;  4GXS B;  1JEU A;  3IB2 A;  5JTY A;  4QRZ A;  2DWI A;  4XKP A;  3TCH A;  4QFN A;  1N76 A;  4C0R A;  1MY3 A;  4LVQ A;  4PQJ A;  5L9S A;  5I57 B;  4DLD A;  3EHT A;  3ILT B;  4F29 A;  1B46 A;  1PB8 A;  2OWS A;  3PPO A;  5AA4 B;  3GLB A;  4RK9 A;  4FEC A;  3AXF A;  4KD5 A;  1Y1M A;  4AQ4 A;  2Q9T A;  4GQO A;  3B50 A;  1P1O A;  3W9V A;  2I3W A;  2F97 A;  5DEX B;  4HS7 A;  3SEU A;  3TTM A;  1Q1K A;  4GLI A;  5FTH A;  3W9W A;  4NHB A;  1FCK A;  2NWJ A;  1GTK A;  1B32 A;  2HAV A;  1SW4 A;  5CMC A;  4PE3 A;  4G77 A;  1TWY A;  1US4 A;  3CRB A;  4PFB A;  3Q28 A;  3QYT A;  1RYO A;  3H3G A;  3SES A;  2Z23 A;  4MCO A;  5AA2 D;  3QAX A;  1B1X A;  3FXU A;  2RCB A;  5L9M A;  3TYH A;  4MHF A;  1SI1 A;  4OFO A;  3V89 B;  3TTL A;  1S7Y A;  5CC2 A;  2RC9 A;  3RPW A;  3DM0 A;  4QHQ A;  2V25 A;  5CMB A;  2I4B A;  4R75 A;  4F22 A;  4YMA A;  1Y1Z A;  4KYS A;  4F3P A;  5H8F A;  4Q0C A;  4R6K A;  4GL8 A;  4OAN A;  2XD2 A;  1LCF A;  2FYI A;  2D3I A;  2Y7I A;  3MP8 A;  3M3L A;  4PGN A;  5I7I A;  4NF4 B;  1NNF A;  3ZSF A;  3TMG A;  1MH4 A;  3B6Q A;  1N84 A;  4H6D A;  2PFY A;  3EPE A;  3WAF A;  2H4I A;  3N26 A;  1UTH A;  1OQG A;  4OMB A;  4PE5 B;  4U21 A;  4PFW A;  4FJP A;  5CBS A;  3IL1 B;  3MAM A;  4MFI A;  2XXX A;  2DVC A;  2GHB A;  1MQJ A;  4JWO A;  4U22 A;  3RT6 B;  4C1U A;  2RC7 A;  3P7I A;  4PAI A;  1Y4C A;  2HCA A;  2ZYM A;  2VD2 A;  4MLQ A;  4P0I A;  1VSO A;  4IO7 A;  3EHU A;  5DEX A;  1QUL A;  4WED A;  2Y84 A;  4NWC A;  4EQB A;  5L9O A;  1QUI A;  2ZNU A;  3IO4 A;  4JSO A;  4R9F A;  3QSL A;  2O7U A;  1JW1 A;  3IOV A;  3G3I A;  3IR1 A;  2XWK A;  2ZZX A;  1JVY A;  5I57 A;  1B3L A;  5KDT A;  1B7H A;  1GGG A;  1II5 A;  2OZZ A;  4NF5 B;  4H1X A;  5I2K B;  1PBP A;  4G8H A;  4OER A;  5K2Y A;  1M5F A;  2XXY A;  2QPQ A;  1IEJ A;  4ND9 A;  3T9X B;  3VE1 B;  3S9N C;  3MBP A;  3PD8 A;  2DXY A;  3MC2 A;  3VXC A;  4U23 A;  1R9L A;  3CSB A;  2NUV A;  2IEE A;  3H06 B;  4FEB A;  3K6X A;  4GD5 A;  5DTB A;  2XXT A;  2RF1 A;  1B0L A;  5TPA A;  3VV5 A;  1NH7 A;  5LTC A;  3UIF A;  2VPN A;  4BDQ A;  1XHY A;  3JV9 A;  3RUM A;  4NN3 A;  3OO6 A;  3FJ7 A;  4YKJ A;  4JSD A;  3V8X B;  3QXM A;  1MDQ A;  4PFI A;  5FHO A;  5H8Q A;  1EH3 A;  4YB6 A;  4FE8 A;  3Q27 A;  3E13 X;  2AIX A;  3PUZ E;  3RGY A;  2I48 A;  4LAT A;  2XX7 A;  3MQ9 A;  4P11 A;  3T22 A;  1OIB A;  2E1S A;  2VD3 A;  4G8N A;  3LSL A;  3LUY A;  3HCQ A;  3FXQ A;  1PEB A;  3L6H A;  4F39 A;  4K3F A;  4F1Y A;  1CE2 A;  3H6T A;  1AIV A;  4NED A;  4ZE9 A;  3H7M A;  1AH5 A;  3R7X A;  4R6H A;  2XXR A;  2FNC A;  3KN3 A;  4Q5T A;  3TUS A;  2PVU A;  5I58 A;  1J1N A;  1MDP 1;  4IO3 A;  2B3B A;  3FXB A;  2QJE A;  4MNC A;  4Q8R A;  4HTG A;  1B5H A;  4OXV A;  2CEY A;  2O51 A;  3R6U A;  3TDJ A;  1B1H A;  1IQ7 A;  3Q29 A;  1OLA A;  4Q30 B;  5DT6 A;  4IO6 A;  1MQH A;  3IAZ A;  3IO6 A;  2Z8F A;  4O94 A;  5A5X A;  1USY E;  3K0V A;  4I1D A;  3PD9 A;  1FQB A;  2ALU A;  4OWD A;  4DXC A;  2UVH A;  3IK6 B;  4NG7 A;  1O7T A;  1R6Z A;  5DYH A;  3CG1 A;  2Z8D A;  4TLM B;  3TFL A;  3PUV E;  4JXI A;  2ABH A;  5TPA B;  4BDM A;  1Y20 A;  3QUF A;  4IB2 A;  2XWO A;  4XF5 A;  4N17 A;  5BUU A;  1QUJ A;  1IXC A;  1NH8 A;  4PP0 A;  3UA8 A;  1SD3 A;  2Q88 A;  1A54 A;  1HSL A;  3QUJ A;  1Y3N A;  4RNS A;  4QSD A;  1OVT A;  4O8M A;  1AL3 A;  4Z0I A;  4WKM A;  5I56 A;  1YPN A;  2XXI A;  4I62 A;  3H6V A;  3PGF A;  4P0G A;  3OMB A;  1UTB B;  4YB7 A;  3I6V A;  1YTV A;  3FUZ A;  5I2K A;  2WKY A;  3PUW E;  2I0B A;  3RLF E;  4RJZ A;  4WEP A;  1PDA A;  3HST A;  4UAC A;  3IOR A;  4GFR A;  5H8Q B;  4MLV A;  3RT8 A;  2WYK A;  4LON B;  5HBC A;  4EUO A;  1YAE A;  3OSQ A;  4OEN A;  5EHS A;  4OTE A;  3IB1 A;  3MP6 A;  1S9T A;  3TAJ A;  3RTF B;  3GYY A;  1GR2 A;  1B40 A;  4UA8 A;  1ATG A;  3KEI A;  1WOD A;  4QFL A;  1URG A;  2V84 A;  3H03 A;  4YB5 A;  3CR9 A;  4H65 A;  4ESW A;  4FIM A;  3TEL A;  2UVG A;  4WXJ A;  1QJM A;  1DOT A;  3SET A;  2B65 A;  3C32 A;  2R6G E;  2XHD A;  3OEM A;  2VHA A;  4OET A;  2X26 A;  2Q8J A;  3G3J A;  2XA5 A;  3UK4 A;  2O84 X;  4KCC A;  3T9V A;  3RTW B;  4NF8 A;  1TT1 A;  4NF5 A;  1LBC A;  5HM4 B;  2DS9 A;  3EN3 A;  1ANF A;  1MPD A;  3TCF A;  3K1P A;  2H5Y A;  3RN8 A;  2M8C A;  1MY0 A;  1MY1 A;  4LQ5 A;  3MUQ A;  4QFO A;  4GRK A;  1LAF E;  1ZLQ A;  3T93 B;  3CSG A;  4KYE A;  2V93 A;  4X04 A;  2H99 A;  3TOD A;  4H5F A;  2F7C A;  1FTM A;  4OVR A;  4P47 A;  4DCX A;  2D21 A;  3UP9 A;  4R9G A;  1Q35 A;  2NXO A;  4GXA A;  1MQI A;  2REJ A;  3W15 C;  2RKM A;  5FHN A;  1PB9 A;  3TEP A;  3CFZ A;  2HZK A;  5IGA A;  2ZNS A;  3TTR A;  4PGP A;  2V3T A;  4PC9 A;  3FV1 A;  4N8Y A;  4ZZE A;  4RK2 A;  1Y3Q A;  2HAU A;  3FAT A;  2DVZ A;  2W7Y A;  3FJM A;  1MG1 A;  4NE4 A;  3U94 A;  4NF8 B;  1LFI A;  4EXK A;  4P1E A;  1B3H A;  1M5B A;  4N15 A;  3GBA A;  4H67 A;  2ZZV A;  5B7D A;  3K00 A;  1LCT A;  3MPL A;  2F7A A;  3N5L A;  5CMM A;  2A5T A;  2R71 A;  3N94 A;  3A3U A;  2PYY A;  1BLF A;  2KLF A;  1B3E A;  3IJX B;  3K02 A;  1FW0 A;  3KJT A;  2OK2 A;  2DOJ A;  1MRP A;  2CEX A;  1F9B A;  3VVD A;  1IXI A;  4YKI A;  4BLA A;  1M5C A;  2F35 A;  1SYH A;  3HPI A;  1EZP A;  3FZV A;  4P8B A;  4F19 A;  2V3U A;  4BDO A;  1A55 A;  3BBR A;  4N6K A;  1GV8 A;  3M8U A;  3LR1 A;  1BIY A;  2A5S A;  3E9X A;  2VP1 A;  2QMW A;  3FVK A;  4ELP A;  2NOO A;  1B5I A;  1NKX A;  4EXL A;  1VE4 A;  4KR5 A;  3S9L C;  4ESX A;  2XWV A;  2Y7R A;  4NMY A;  4TOZ A;  3TPA A;  4DI3 D;  3U65 A;  3OXN A;  3KOT A;  3O66 A;  4P56 A;  4I8C A;  4F1V A;  2AYS A;  4LA9 A;  2GH9 A;  5H8H A;  1UTB A;  3SEW A;  1NNK A;  3OEL A;  4QSC A;  5ELV A;  3ODB A;  4EF1 A;  4G2Z A;  4OEV A;  4N6P A;  5AE4 A;  1B9J A;  4YZZ A;  1LFG A;  3PUY E;  4O3B A;  2DWA A;  4KHZ E;  5I84 A;  4GWO A;  3GXA A;  3BKI B;  4XXU A;  4EQ9 A;  4F3B A;  5HPQ A;  2DQV A;  2Q89 A;  2OWT A;  5FHM A;  2XXV A;  3DEL B;  2DWJ A;  2X7Q A;  1SQY A;  3K6W A;  3U8Q A;  4KPT A;  2GFE A;  4PCD A;  2OBG A;  3MW0 A;  4IY6 A;  1D3K A;  4GVO A;  4PF6 A;  4IGR A;  1BKA A;  4DE8 A;  1NFT A;  5KZT A;  5FTI A;  4JB7 A;  3I5O A;  1Z7M E;  3DP6 A;  2QMX A;  1LAH E;  4UAB A;  1JNF A;  2CZL A;  4IY5 A;  4IO5 A;  3HN0 A;  2Y7P A;  4MIJ A;  4G68 A;  3U92 A;  5DVF A;  2DE3 A;  4POX A;  4ZEB A;  4F31 B; 
#chains in the Genus database with same CATH topology
 4RYA A;  5ICQ A;  4MH5 A;  1IMA A;  4XEQ A;  4MMP A;  3IFA A;  1B4H A;  2I49 A;  4NQ8 A;  2ZYK A;  2BJJ X;  1G0I A;  3K2D A;  3O28 A;  1QW0 A;  2O6A A;  4N07 A;  3RNN A;  3OSR A;  4NWD A;  1TFA A;  4GOT A;  3CHG A;  5H8F B;  3BIH A;  4U4S A;  4XKR A;  1B7Z A;  3MZ9 A;  1N3W A;  4YKK A;  4NF6 B;  4IGT A;  3FIR A;  3IOT A;  3MVZ A;  1LAG E;  3H4Z A;  2DDK A;  4NTL A;  1OMP A;  3IFC A;  3ILU B;  4PBH A;  1JW4 A;  3OD7 A;  4R72 A;  2UXA A;  4O3A A;  2Q74 A;  2O1L A;  3T9U A;  3FVO A;  4PFU A;  2F6P A;  2D5W A;  1DPP A;  3HO7 A;  5EYH A;  4ISU A;  2UVJ A;  4BDN A;  3PPN A;  4YU0 A;  1POY 1;  2XXH A;  4OYV A;  2NVU B;  3K6U A;  3WAE A;  1LBY A;  5AA2 B;  2WX9 A;  1MH3 A;  2I4C A;  1NV6 A;  2QVU A;  2CZH A;  2Q2A A;  2DYX A;  3PPR A;  2XWI A;  2FBP A;  2PBW A;  5I59 B;  2ESN A;  2I58 A;  2V4C A;  3TTN A;  4R2B A;  3N6U A;  1DTG A;  1D9V A;  2OJT A;  4E0W A;  5M2V A;  5AA4 A;  1SW2 A;  3MWB A;  2DXR A;  3SKP A;  5JTY B;  1FTA A;  4HXV A;  1ELJ A;  4G68 C;  4QFP A;  4OEU A;  2VOZ A;  1LBV A;  3TCG A;  3FVG A;  2Y7K A;  4I9D A;  1L5T A;  3MVW A;  1WDN A;  1Z7N E;  2PMS A;  4LQ2 A;  4ZZA A;  2H9B A;  1KWH A;  1HSE A;  2YJP A;  2O69 A;  4LN5 A;  1TFD A;  5CMK A;  2QSX A;  3CFX A;  3C33 A;  1P1U A;  3K1M A;  5KDT B;  3D4G A;  3SEY A;  4JVI A;  1DSN A;  3IOU A;  2VGQ A;  3DP4 A;  3OO9 A;  4OVQ A;  3IJO B;  2HQ0 A;  2PFZ A;  3VVF A;  3A29 A;  4O3C A;  2WYP A;  2ZYN A;  3PMX A;  1QKA A;  4H5G A;  2O7I A;  3TZA A;  4G61 A;  1Y4T A;  5I59 A;  2HZL A;  3MP1 A;  5DVI A;  4OES A;  4MX6 A;  3IOW A;  5CRY A;  1NUX A;  1SVX B;  3VLV A;  1MY2 A;  2QVR A;  3C35 A;  3O2A A;  2ZMB A;  4HCY A;  2QFL A;  2DWH A;  4YIC A;  3K01 A;  3VXB A;  3KBR A;  3MJN A;  3PPQ A;  3LBS A;  3UN6 A;  4QFK A;  1UIV A;  3T66 A;  1DTZ A;  5I2N B;  3DLN A;  5AA1 A;  2HEU A;  2XX8 A;  5LOM A;  4PDD A;  2ZNT A;  1M5D A;  1YCJ A;  1BK4 A;  2G93 A;  2B3F A;  4BDL A;  1SPI A;  3MVY A;  3CIJ A;  1FPJ A;  4LZ8 A;  4LZ7 A;  3IX1 A;  1XOC A;  5I5P A;  1CNQ A;  4ZDM A;  2O1M A;  1H45 A;  4ZEK A;  4GWZ A;  4Z7E A;  1RDX A;  3G3G A;  4NF4 A;  4LUB A;  5B70 A;  1K9Z A;  1P1N A;  2CMO A;  1DMB A;  1XI6 A;  3BFU A;  4G4P A;  1B3F A;  1MY4 A;  4C1T A;  4BDR A;  2PT2 A;  3VVE A;  3Q25 A;  2H25 A;  1JQF A;  2Q8M A;  1GVC A;  1MXX A;  2XX9 A;  1AMF A;  4F18 A;  2XXP A;  3VLW A;  1MPC A;  3FGS A;  5CBR A;  4IO4 A;  1QUK A;  3N6T A;  3B6W A;  4PFR A;  2WEF A;  1SYI A;  4OZ9 A;  1ZIU A;  3O6G A;  1I6Q A;  4F2Q A;  4U4X A;  2QS1 A;  5ITO A;  1MS7 A;  2HPG A;  2THI A;  2PT1 A;  2PCR A;  2G29 A;  1Y3P A;  3DP8 A;  4OFJ A;  4FAT A;  3V83 A;  1SW5 A;  3FAS A;  3GZG A;  2ZZW A;  1URS A;  4X1D A;  3CI8 A;  5ICT A;  3S2V A;  1PB7 A;  5FBP A;  3SEX A;  4OVS A;  1NNP A;  2QL3 A;  1IMF A;  2XD3 A;  3HV1 A;  1B6H A;  3IB0 A;  2Q2C A;  3KFM A;  4H8J A;  5F24 A;  2ONK E;  5CI5 A;  4ZS9 A;  5EHM A;  2P1S A;  4RA1 A;  3HHF A;  4RPN A;  5F1Q A;  3FVN A;  1SBP A;  4H8I A;  4U2R A;  3HHG A;  3MPK A;  3BIG A;  3KG2 A;  3MVX A;  2B4L A;  4OHN A;  3LSF B;  3FJG A;  1I6A A;  1LBB A;  1EU8 A;  1LST A;  2HXW A;  3PPP A;  2UYE A;  4MF3 A;  3D4C A;  4HE0 A;  4AB5 A;  5ET5 A;  1MXZ A;  1D4N A;  4ZEC A;  1IIW A;  3HFU A;  2Z22 A;  4YKP A;  1NNT A;  4ECF A;  3T9H B;  5L8D A;  2P2A A;  2X7P A;  4KYD A;  2I6E A;  4IR8 A;  1POT A;  3SEV A;  1P1W A;  1H3D A;  5IKB A;  1UIU A;  5ET8 A;  3KN7 A;  1NV1 A;  1BTJ A;  1NV7 A;  4R6Y A;  2I0C A;  4ELQ A;  4MNP A;  1NUZ A;  2VPO A;  4M1V A;  4YAH X;  1RKM A;  1LB9 A;  4DXB A;  1YXI A;  5J16 A;  2F3B A;  4THI A;  2RC8 A;  3U93 A;  3CG3 A;  3RY3 A;  4ELO A;  2QRY A;  1T0K A;  1US5 A;  4GX4 A;  5IAI A;  1B2H A;  4X48 A;  4QBA A;  4PBQ A;  2YLN A;  3MZ1 A;  1FTL A;  4GF8 A;  1UTH B;  1N0T A;  3I3V A;  4X9T A;  3TQW A;  2Z8E A;  5J1D A;  4ZEI A;  1URD A;  3G3K A;  4QSE A;  3EHS A;  5H8N B;  1FQC A;  2GRV A;  2JJK A;  4LZ5 A;  3VLU A;  3ZKK A;  1N7X A;  1HSJ A;  4PAK A;  3TKD A;  1SI0 A;  1FQF A;  3OO8 A;  2GHA A;  3FV2 A;  3OEK A;  3U1O A;  3TTK A;  4RY1 A;  1QGX A;  2UVI A;  3ZS6 A;  2OCU A;  3K4U A;  3C9H A;  1XVY A;  1B5J A;  2ONS A;  3JYR A;  4OVT A;  4OQO A;  1PBQ A;  4KCD A;  4X8R A;  2R8T A;  3G3H A;  1FTO A;  1NL5 A;  5EQ9 A;  4PAF A;  3E3K A;  2KQZ A;  4U1O A;  4ONY A;  1VFD A;  5AA3 A;  1OLC A;  1CB6 A;  3OO7 A;  3KGC A;  4NX1 A;  1B3G A;  4G8M A;  4ZED A;  4PF8 A;  4XFE A;  1P1Q A;  3MZB A;  4XTC Q;  2ONR A;  2OX3 A;  3LC8 A;  3BFT A;  4NF0 A;  5I2N A;  1P99 A;  4PET A;  4PFT A;  4U1Z A;  1XT8 A;  1B7U A;  5TU0 A;  4IO2 A;  3QK6 A;  2VT5 A;  3K1N A;  2F78 A;  3C31 A;  1MQD A;  1FPE A;  4N13 A;  1DCU A;  3JZJ A;  1MXV A;  1EZ9 A;  4AB6 A;  4PDH A;  3OOA A;  2V3Q A;  3EQ1 A;  5H8S A;  4GWU A;  3USD A;  2H98 A;  3O97 A;  3A3C A;  4PFY A;  1FTK A;  4MNI A;  3O9P A;  1H76 A;  3Q26 A;  1WVJ A;  1O64 A;  2WBB A;  4EDP A;  4H0W A;  1IME A;  4JDF A;  5IM2 A;  4R73 A;  4X1B A;  1USY H;  3H6U A;  3LSW A;  1LAX A;  3B7D A;  3ONM A;  3ZKL A;  5TP9 A;  1FQE A;  2AL4 A;  5H8N A;  4TQU Q;  1N7W A;  3A09 A;  2I3V A;  4P1L A;  2LAO A;  1XS5 A;  3H6W A;  3E78 A;  1IXG A;  1B58 A;  1N3X A;  1FQD A;  3C4M A;  1FPL A;  1MPB A;  4N8G A;  3SDF A;  4DZ1 A;  1FBF A;  1JW5 A;  2DP8 A;  1EZO A;  4TLL B;  2QS2 A;  2DE4 A;  4ZE8 A;  4OA4 A;  1ZBM A;  1JVX A;  1MQG A;  2QVV A;  1BP5 A;  1B05 A;  4NAP A;  4KFQ A;  2Y7W A;  3ECR A;  2QS3 A;  1LB8 A;  3T1B A;  2DE2 A;  2F7B A;  4AS4 A;  3M3K A;  1ZTY A;  1R9Q A;  1FPD A;  2F34 A;  4L17 A;  1RYX A;  3FD3 A;  3QIM A;  1VR5 A;  4FOR A;  4DDD A;  1XVX A;  5IZZ A;  4R2F A;  3VDF A;  2YPN A;  1O63 A;  4EQ7 A;  3PU5 A;  2CZK A;  3K6V A;  2RCA A;  1VDW A;  1XC1 A;  5EYG A;  2R9J A;  4KXP A;  3PMV A;  2ZXT A;  5I56 B;  2XXK A;  3G3F A;  2AL5 A;  4F2O A;  4KI0 E;  5AA2 A;  2IA4 A;  5KCJ B;  2ANJ A;  4N4U A;  5ITP A;  3E4R A;  1MXY A;  4P3L A;  1S50 A;  3UOR A;  1H44 A;  1FQA A;  4DCY A;  1B4Z A;  3E79 A;  2FA7 A;  1AOV A;  4HW8 A;  4RPO A;  3LSX A;  3C34 A;  3KSX A;  4DIG A;  1IUD A;  1MXW A;  5TP9 B;  3GBB A;  1NV3 A;  1MM6 A;  4XIG Q;  2UYF A;  4NF6 A;  4GL0 A;  3R26 A;  4KQP A;  2ZYO A;  3OEN A;  1FBP A;  1B51 A;  2E0S A;  2HHM A;  1LGB C;  2QS4 A;  1IIT A;  3VFJ A;  4ZEF A;  4N91 A;  3O6H A;  2F5X A;  1FBE A;  4JBZ A;  4MAG A;  2DSF A;  5A5X B;  4JWX A;  4F3G A;  1DPE A;  3S9M C;  4GBW A;  4YMB A;  1LFH A;  1IZ1 A;  5JEI A;  1R1N A;  4POW A;  3KSJ A;  4E0X A;  3THI A;  1UQW A;  4HCW A;  3EF7 A;  1NV0 A;  3G7W A;  2F6G A;  5ISU A;  5EYF A;  3CVG A;  1NMU A;  4G68 B;  1SW1 A;  2MKZ A;  1NUW A;  2OLB A;  4RXL A;  5F7V A;  1IMB A;  4P9K A;  1B0H A;  1MM7 A;  3RQT A;  4XKN A;  4DI4 B;  1ZU0 A;  3PMW A;  3U72 A;  3UGW A;  1D9Y A;  1IXH A;  1YZ0 A;  1JET A;  2OWZ A;  2PX1 A;  5CM6 A;  3O6I A;  1VFE A;  4MJO A;  1I6B A;  4NGU A;  3KZG A;  2XXQ A;  5I58 B;  5T3J A;  4EF2 A;  1ZMG A;  3PUX E;  4QF9 A;  3CFL A;  3V5A A;  4JWY A;  1QKB A;  1FSA A;  1A7L A;  1M5E A;  5KCJ A;  3SER A;  1OQH A;  3LV0 A;  1A8F A;  3RPL A;  1FTJ A;  3KN8 A;  3C36 A;  4XKQ A;  3PV0 E;  3D1R A;  1KZ8 A;  4OFL A;  1Q9D A;  1ZJL A;  5H8H B;  5I3S A;  4GIZ A;  2F8D A;  4O7M A;  4F1U A;  1A40 A;  1Y9U A;  1TXF A;  2P0S A;  3S4U A;  1NV4 A;  4LP2 B;  4PTK A;  3O29 A;  4N6D A;  1AWB A;  4ELR A;  3L6G A;  4DXU A;  4OVP A;  3B6T A;  4M4G A;  1KA1 A;  3KJ7 A;  1PC3 A;  3KOS A;  2O68 A;  1B52 A;  4OVJ A;  5DVJ A;  1OVB A;  1H43 A;  2REG A;  1MXU A;  1JEV A;  1N04 A;  5ET6 A;  1EYJ A;  3T96 B;  3F11 A;  2RIN A;  4F3S A;  4MEV A;  4R74 A;  3MST A;  4QXD A;  1I69 A;  1QVS A;  3MYU A;  4MBP A;  2XXW A;  4FED A;  4FAJ A;  3FXR A;  1ZKB A;  3M3F A;  2XXU A;  4N81 A;  5BWJ A;  3TQL A;  1A8E A;  5K2X A;  3S9E A;  2HFB A;  2A5T B;  2Y5K A;  5JK4 A;  2F36 A;  1SDX A;  1A99 A;  1LLS A;  5EQA A;  4GWW A;  4GXS B;  1JEU A;  3IB2 A;  5JTY A;  4QRZ A;  2DWI A;  4XKP A;  3TCH A;  4QFN A;  1N76 A;  4C0R A;  1IMC A;  1MY3 A;  4LVQ A;  4PQJ A;  5L9S A;  5I57 B;  4DLD A;  3EHT A;  3ILT B;  4F29 A;  1B46 A;  1PB8 A;  2OWS A;  3PPO A;  5AA4 B;  3GLB A;  4RK9 A;  4FEC A;  3AXF A;  4KD5 A;  3KBZ A;  1Y1M A;  4AQ4 A;  2FHY A;  2Q9T A;  4GQO A;  3B50 A;  1P1O A;  2WBD A;  3W9V A;  2I3W A;  2F97 A;  5DEX B;  4HS7 A;  3SEU A;  3TTM A;  1Q1K A;  4GLI A;  5FTH A;  3W9W A;  4NHB A;  1FCK A;  2NWJ A;  1GTK A;  1B32 A;  2HAV A;  1SW4 A;  4PE3 A;  5CMC A;  4G77 A;  1TWY A;  1US4 A;  3CRB A;  4PFB A;  3Q28 A;  3QYT A;  1RYO A;  3H3G A;  3SES A;  1EYK A;  2Z23 A;  2Y5L A;  4MCO A;  5AA2 D;  3QAX A;  1B1X A;  3FXU A;  2RCB A;  4MHF A;  5L9M A;  3TYH A;  1FBC A;  1SI1 A;  4OFO A;  3V89 B;  3TTL A;  1S7Y A;  5CC2 A;  2RC9 A;  3RPW A;  3DM0 A;  4QHQ A;  3B8B A;  2V25 A;  5CMB A;  2I4B A;  4R75 A;  4F22 A;  4YMA A;  1Y1Z A;  4KYS A;  4F3P A;  5H8F A;  4Q0C A;  4R6K A;  4GL8 A;  4OAN A;  2FIX A;  2XD2 A;  1G0H A;  1LCF A;  2FYI A;  2D3I A;  2Y7I A;  3MP8 A;  3M3L A;  4PGN A;  5I7I A;  4NF4 B;  1NNF A;  3ZSF A;  3TMG A;  1MH4 A;  5EQ7 A;  3B6Q A;  3KC1 A;  1N84 A;  2PFY A;  4H6D A;  3EPE A;  3WAF A;  5ET7 A;  2H4I A;  3N26 A;  1UTH A;  1OQG A;  4OMB A;  1NUY A;  4PE5 B;  4U21 A;  4PFW A;  1NI9 A;  4FJP A;  5CBS A;  3IL1 B;  3MAM A;  4MFI A;  2XXX A;  2DVC A;  2GHB A;  2KR0 A;  1MQJ A;  3ISP A;  4JWO A;  4U22 A;  3RT6 B;  4C1U A;  2RC7 A;  4I3Y A;  3P7I A;  4PAI A;  1FPI A;  1Y4C A;  3QMF A;  2HCA A;  2ZYM A;  4F31 B;  2VD2 A;  4MLQ A;  2B4M A;  4P0I A;  1INP A;  1VSO A;  4IO7 A;  3EHU A;  5DEX A;  1QUL A;  4GX6 A;  4WED A;  2Y84 A;  4NWC A;  4EQB A;  1D9Q A;  5L9O A;  1QUI A;  2ZNU A;  3IO4 A;  4JSO A;  4R9F A;  3QSL A;  2CZI A;  2O7U A;  1JW1 A;  3IOV A;  3G3I A;  3IR1 A;  2XWK A;  2ZZX A;  1JVY A;  5I57 A;  1B3L A;  5KDT A;  1B7H A;  1GGG A;  1II5 A;  2OZZ A;  4NF5 B;  4H1X A;  5I2K B;  1PBP A;  4G8H A;  4OER A;  5K2Y A;  1M5F A;  2XXY A;  2QPQ A;  1IEJ A;  4ND9 A;  3T9X B;  3VE1 B;  3S9N C;  3MBP A;  2FVZ A;  3PD8 A;  2DXY A;  3MC2 A;  3VXC A;  4U23 A;  1R9L A;  3CSB A;  2NUV A;  2IEE A;  3H06 B;  4FEB A;  3K6X A;  4GD5 A;  5DTB A;  2XXT A;  2RF1 A;  1B0L A;  5TPA A;  3VV5 A;  1NH7 A;  5LTC A;  3UIF A;  2VPN A;  4BDQ A;  1XHY A;  3JV9 A;  1YYZ A;  3RUM A;  4NN3 A;  3OO6 A;  3FJ7 A;  4YKJ A;  4JSD A;  3V8X B;  3QXM A;  3EKI A;  1MDQ A;  4PFI A;  5FHO A;  5H8Q A;  1EH3 A;  4YB6 A;  3RPL B;  4FE8 A;  3Q27 A;  3E13 X;  2AIX A;  3PUZ E;  3RGY A;  2I48 A;  4LAT A;  1LBX A;  1IMD A;  2XX7 A;  3MQ9 A;  4P11 A;  1OIB A;  2E1S A;  2VD3 A;  4G8N A;  3T22 A;  3LSL A;  3LUY A;  3HCQ A;  3FXQ A;  1PEB A;  3L6H A;  4F39 A;  4K3F A;  4F1Y A;  2F3D A;  1CE2 A;  3H6T A;  1AIV A;  4NED A;  4ZE9 A;  3H7M A;  1AH5 A;  4H45 A;  3R7X A;  4R6H A;  2XXR A;  2FNC A;  3KN3 A;  4Q5T A;  3TUS A;  2PVU A;  5I58 A;  1J1N A;  1MDP 1;  4IO3 A;  2B3B A;  3FXB A;  1K9Y A;  2QJE A;  4MNC A;  4Q8R A;  4HTG A;  1B5H A;  4HE1 A;  4OXV A;  2CEY A;  2O51 A;  3R6U A;  3TDJ A;  1B1H A;  1KA0 A;  1IQ7 A;  2FIE A;  3Q29 A;  1OLA A;  4Q30 B;  5DT6 A;  1DK4 A;  4IO6 A;  1MQH A;  3IAZ A;  1FBG A;  3IO6 A;  2Z8F A;  4O94 A;  5A5X A;  1USY E;  3K0V A;  4I1D A;  3PD9 A;  1FQB A;  2ALU A;  1RDZ A;  4OWD A;  4DXC A;  2UVH A;  3IK6 B;  4NG7 A;  1O7T A;  1R6Z A;  4JVC A;  5DYH A;  3CG1 A;  2Z8D A;  4TLM B;  3TFL A;  3PUV E;  4JXI A;  2ABH A;  5TPA B;  4BDM A;  1Y20 A;  3QUF A;  2XWO A;  4IB2 A;  4XF5 A;  4N17 A;  5BUU A;  1QUJ A;  1IXC A;  2GQ1 A;  1NH8 A;  4PP0 A;  3UA8 A;  3KC0 A;  1SD3 A;  2Q88 A;  1A54 A;  1HSL A;  3QUJ A;  1Y3N A;  4RNS A;  4QSD A;  1OVT A;  5IZ1 A;  4I3E A;  4O8M A;  1AL3 A;  4Z0I A;  4WKM A;  5I56 A;  1YPN A;  2XXI A;  4I62 A;  3H6V A;  3PGF A;  2P3V A;  4P0G A;  3OMB A;  1UTB B;  4YB7 A;  3I6V A;  1YTV A;  1FPF A;  3FUZ A;  5I2K A;  2WKY A;  3PUW E;  2I0B A;  3RLF E;  4HE2 A;  5EQ8 A;  4RJZ A;  4WEP A;  1PDA A;  1LBZ A;  3HST A;  1LEV A;  4UAC A;  5IZ3 B;  3IOR A;  4GFR A;  5H8Q B;  4MLV A;  3RT8 A;  2WYK A;  4LON B;  4GX3 A;  5HBC A;  4EUO A;  1YAE A;  3OSQ A;  4OEN A;  5EHS A;  4GBV A;  4OTE A;  3IB1 A;  3MP6 A;  1S9T A;  3TAJ A;  3PTY A;  3RTF B;  3GYY A;  1B40 A;  4UA8 A;  1FBD A;  1ATG A;  3KEI A;  1WOD A;  1NV2 A;  4QFL A;  1URG A;  2V84 A;  3H03 A;  4YB5 A;  3CR9 A;  4H65 A;  4ESW A;  4FIM A;  3TEL A;  2UVG A;  4WXJ A;  1QJM A;  1DOT A;  3SET A;  2B65 A;  1FPK A;  1FJ6 A;  3C32 A;  3RYD A;  2R6G E;  2XHD A;  4I40 A;  3OEM A;  2VHA A;  4OET A;  2X26 A;  2Q8J A;  3G3J A;  2XA5 A;  3UK4 A;  2O84 X;  4KCC A;  3T9V A;  3RTW B;  4NF8 A;  1TT1 A;  4NF5 A;  1LBC A;  5HM4 B;  2DS9 A;  3EN3 A;  5ESY A;  1ANF A;  1MPD A;  3TCF A;  3K1P A;  2H5Y A;  3RN8 A;  2M8C A;  1MY0 A;  1MY1 A;  4LQ5 A;  4QFO A;  3MUQ A;  4GRK A;  1LAF E;  1ZLQ A;  3T93 B;  3CSG A;  4KYE A;  2V93 A;  1FBH A;  4X04 A;  2H99 A;  3TOD A;  4H5F A;  2F7C A;  1FTM A;  4OVR A;  4P47 A;  4DCX A;  2D21 A;  3UP9 A;  4R9G A;  1Q35 A;  2NXO A;  4GXA A;  1MQI A;  2REJ A;  3ROJ A;  3W15 C;  2RKM A;  5FHN A;  1PB9 A;  3TEP A;  3CFZ A;  1NV5 A;  1EYI A;  2HZK A;  5IGA A;  2ZNS A;  3TTR A;  4PGP A;  2V3T A;  4PC9 A;  3FV1 A;  4N8Y A;  4ZZE A;  5DW8 A;  4RK2 A;  1Y3Q A;  2HAU A;  3FAT A;  2DVZ A;  2W7Y A;  3FJM A;  1JP4 A;  1MG1 A;  4NE4 A;  3U94 A;  4NF8 B;  1LFI A;  4EXK A;  4P1E A;  1B3H A;  1M5B A;  1RDY A;  4N15 A;  3GBA A;  4H67 A;  2ZZV A;  5B7D A;  3LUZ A;  3K00 A;  1LCT A;  3MPL A;  2F7A A;  3N5L A;  5CMM A;  2A5T A;  2R71 A;  3N94 A;  3T0J A;  4FBP A;  1DBZ A;  3A3U A;  4O7I A;  2PYY A;  1BLF A;  2KLF A;  1B3E A;  3IJX B;  3K02 A;  1FW0 A;  3KJT A;  2OK2 A;  5A5L A;  2DOJ A;  1MRP A;  2CEX A;  1F9B A;  3VVD A;  1IXI A;  4YKI A;  4BLA A;  1M5C A;  2F35 A;  1LBW A;  1SYH A;  3HPI A;  1EZP A;  3FZV A;  4P8B A;  4F19 A;  2V3U A;  4BDO A;  1A55 A;  3BBR A;  4N6K A;  3NOH A;  1GV8 A;  3M8U A;  3LR1 A;  1BIY A;  2A5S A;  3E9X A;  2VP1 A;  2QMW A;  3FVK A;  4ELP A;  2NOO A;  1B5I A;  1NKX A;  4EXL A;  1VE4 A;  4GWX A;  5IZ3 A;  4KR5 A;  3S9L C;  4ESX A;  2XWV A;  2BJI A;  2Y7R A;  4NMY A;  4TOZ A;  3TPA A;  4DI3 D;  3U65 A;  3OXN A;  3KOT A;  3O66 A;  4P56 A;  4I8C A;  4F1V A;  2AYS A;  4LA9 A;  2GH9 A;  4H46 A;  5H8H A;  1UTB A;  3SEW A;  1NNK A;  3OEL A;  3FBP A;  4AS5 A;  4QSC A;  5ELV A;  4GWS A;  3ODB A;  1FJ9 A;  4G2Z A;  4EF1 A;  4OEV A;  4N6P A;  5AE4 A;  1B9J A;  4YZZ A;  1LFG A;  3PUY E;  4O3B A;  2DWA A;  4KHZ E;  5I84 A;  4GWO A;  3GXA A;  5LDZ A;  3BKI B;  4XXU A;  4EQ9 A;  1FPG A;  4F3B A;  5HPQ A;  2DQV A;  2Q89 A;  2OWT A;  5FHM A;  2XXV A;  3DEL B;  2DWJ A;  2X7Q A;  1SQY A;  3K6W A;  4KPT A;  3U8Q A;  2HXR A;  2GFE A;  2OBG A;  3MW0 A;  4IY6 A;  4PCD A;  1D3K A;  4GVO A;  4PF6 A;  4IGR A;  1BKA A;  4DE8 A;  1NFT A;  5KZT A;  5FTI A;  2L5V A;  4JB7 A;  3I5O A;  1Z7M E;  3DP6 A;  1FRP A;  2QMX A;  1LAH E;  4GWY A;  4UAB A;  1JNF A;  2CZL A;  4IY5 A;  1FPB A;  4IO5 A;  3HN0 A;  2Y7P A;  4MIJ A;  4G68 A;  3U92 A;  5DVF A;  3SZP A;  2P3N A;  2DE3 A;  4POX A;  4JVD A;  4ZEB A;  1GR2 A; 
#chains in the Genus database with same CATH homology
 4RYA A;  5ICQ A;  4MH5 A;  1IMA A;  4XEQ A;  4MMP A;  3IFA A;  1B4H A;  2I49 A;  4NQ8 A;  2ZYK A;  2BJJ X;  1G0I A;  3K2D A;  3O28 A;  1QW0 A;  2O6A A;  4N07 A;  3RNN A;  3OSR A;  4NWD A;  1TFA A;  4GOT A;  3CHG A;  5H8F B;  3BIH A;  4U4S A;  4XKR A;  1B7Z A;  3MZ9 A;  1N3W A;  4YKK A;  4NF6 B;  4IGT A;  3FIR A;  3IOT A;  3MVZ A;  1LAG E;  3H4Z A;  4NTL A;  2DDK A;  1OMP A;  3ILU B;  3IFC A;  4PBH A;  1JW4 A;  3OD7 A;  4R72 A;  2UXA A;  4O3A A;  2Q74 A;  2O1L A;  3T9U A;  3FVO A;  4PFU A;  2F6P A;  2D5W A;  1DPP A;  3HO7 A;  5EYH A;  4ISU A;  2UVJ A;  4BDN A;  3PPN A;  4YU0 A;  1POY 1;  2XXH A;  4OYV A;  2NVU B;  3K6U A;  3WAE A;  1LBY A;  5AA2 B;  2WX9 A;  1MH3 A;  2I4C A;  1NV6 A;  2QVU A;  2CZH A;  2Q2A A;  2DYX A;  3PPR A;  2XWI A;  2FBP A;  2PBW A;  5I59 B;  2ESN A;  2I58 A;  2V4C A;  3TTN A;  4R2B A;  3N6U A;  1DTG A;  1D9V A;  2OJT A;  4E0W A;  5M2V A;  5AA4 A;  1SW2 A;  3MWB A;  2DXR A;  3SKP A;  5JTY B;  1FTA A;  4HXV A;  1ELJ A;  4G68 C;  4QFP A;  4OEU A;  2VOZ A;  3TCG A;  1LBV A;  3FVG A;  2Y7K A;  4I9D A;  1L5T A;  3MVW A;  1WDN A;  1Z7N E;  2PMS A;  4LQ2 A;  4ZZA A;  2H9B A;  1KWH A;  1HSE A;  2YJP A;  2O69 A;  4LN5 A;  1TFD A;  5CMK A;  2QSX A;  3CFX A;  3C33 A;  1P1U A;  3K1M A;  5KDT B;  3D4G A;  3SEY A;  4JVI A;  1DSN A;  3IOU A;  2VGQ A;  3DP4 A;  3OO9 A;  4OVQ A;  3IJO B;  2HQ0 A;  2PFZ A;  3VVF A;  3A29 A;  4O3C A;  2WYP A;  2ZYN A;  3PMX A;  1QKA A;  4H5G A;  2O7I A;  3TZA A;  4G61 A;  1Y4T A;  5I59 A;  2HZL A;  3MP1 A;  5DVI A;  4OES A;  4MX6 A;  3IOW A;  5CRY A;  1NUX A;  1SVX B;  3VLV A;  1MY2 A;  3C35 A;  3O2A A;  2QVR A;  2ZMB A;  4HCY A;  2QFL A;  2DWH A;  4YIC A;  3K01 A;  3VXB A;  3KBR A;  3MJN A;  3PPQ A;  3LBS A;  3UN6 A;  4QFK A;  1UIV A;  3T66 A;  1DTZ A;  5I2N B;  3DLN A;  5AA1 A;  2HEU A;  2XX8 A;  5LOM A;  4PDD A;  2ZNT A;  1M5D A;  1YCJ A;  1BK4 A;  2G93 A;  2B3F A;  4BDL A;  1SPI A;  3MVY A;  3CIJ A;  1FPJ A;  4LZ8 A;  4LZ7 A;  3IX1 A;  1XOC A;  5I5P A;  1CNQ A;  4ZDM A;  2O1M A;  1H45 A;  4ZEK A;  4GWZ A;  4Z7E A;  1RDX A;  3G3G A;  4NF4 A;  4LUB A;  5B70 A;  2CMO A;  1P1N A;  1K9Z A;  1DMB A;  1XI6 A;  3BFU A;  4G4P A;  1B3F A;  1MY4 A;  4C1T A;  4BDR A;  2PT2 A;  3VVE A;  3Q25 A;  2H25 A;  1JQF A;  2Q8M A;  1GVC A;  1MXX A;  2XX9 A;  1AMF A;  4F18 A;  2XXP A;  3VLW A;  1MPC A;  3FGS A;  5CBR A;  4IO4 A;  1QUK A;  3N6T A;  3B6W A;  4PFR A;  2WEF A;  1SYI A;  4OZ9 A;  1ZIU A;  3O6G A;  1I6Q A;  4F2Q A;  4U4X A;  2QS1 A;  5ITO A;  1MS7 A;  2THI A;  2HPG A;  2PT1 A;  2PCR A;  2G29 A;  1Y3P A;  4FAT A;  3DP8 A;  4OFJ A;  3V83 A;  1SW5 A;  3FAS A;  3GZG A;  2ZZW A;  1URS A;  4X1D A;  3CI8 A;  5ICT A;  3S2V A;  1PB7 A;  5FBP A;  3SEX A;  4OVS A;  1NNP A;  2QL3 A;  1IMF A;  2XD3 A;  3HV1 A;  1B6H A;  3IB0 A;  2Q2C A;  3KFM A;  4H8J A;  5F24 A;  2ONK E;  5CI5 A;  4ZS9 A;  5EHM A;  2P1S A;  4RA1 A;  3HHF A;  4RPN A;  5F1Q A;  3FVN A;  1SBP A;  4H8I A;  4U2R A;  3HHG A;  3MPK A;  3BIG A;  3KG2 A;  3MVX A;  2B4L A;  4OHN A;  3LSF B;  3FJG A;  1I6A A;  1LBB A;  1EU8 A;  1LST A;  2HXW A;  3PPP A;  2UYE A;  4MF3 A;  3D4C A;  4HE0 A;  4AB5 A;  5ET5 A;  1MXZ A;  1D4N A;  4ZEC A;  1IIW A;  3HFU A;  2Z22 A;  4YKP A;  1NNT A;  4ECF A;  3T9H B;  5L8D A;  2P2A A;  2X7P A;  4KYD A;  2I6E A;  4IR8 A;  1POT A;  3SEV A;  1P1W A;  1H3D A;  5IKB A;  1UIU A;  5ET8 A;  3KN7 A;  1NV1 A;  1BTJ A;  1NV7 A;  4R6Y A;  2I0C A;  4ELQ A;  4MNP A;  1NUZ A;  2VPO A;  4M1V A;  4YAH X;  1RKM A;  1LB9 A;  4DXB A;  1YXI A;  5J16 A;  2F3B A;  4THI A;  2RC8 A;  3U93 A;  3CG3 A;  3RY3 A;  4ELO A;  2QRY A;  1T0K A;  1US5 A;  4GX4 A;  5IAI A;  1B2H A;  4X48 A;  4PBQ A;  4QBA A;  2YLN A;  3MZ1 A;  1FTL A;  4GF8 A;  1UTH B;  1N0T A;  3I3V A;  4X9T A;  3TQW A;  2Z8E A;  5J1D A;  4ZEI A;  1URD A;  3G3K A;  4QSE A;  3EHS A;  5H8N B;  1FQC A;  2GRV A;  2JJK A;  4LZ5 A;  3VLU A;  3ZKK A;  1N7X A;  1HSJ A;  4PAK A;  3TKD A;  1SI0 A;  1FQF A;  3OO8 A;  2GHA A;  3FV2 A;  3OEK A;  3U1O A;  3TTK A;  4RY1 A;  1QGX A;  2UVI A;  3ZS6 A;  2OCU A;  3K4U A;  3C9H A;  1XVY A;  1B5J A;  2ONS A;  3JYR A;  4OVT A;  4OQO A;  1PBQ A;  4KCD A;  4X8R A;  2R8T A;  3G3H A;  1FTO A;  1NL5 A;  5EQ9 A;  4PAF A;  3E3K A;  2KQZ A;  4U1O A;  4ONY A;  1VFD A;  5AA3 A;  1OLC A;  1CB6 A;  3OO7 A;  3KGC A;  4NX1 A;  1B3G A;  4ZED A;  4G8M A;  4PF8 A;  4XFE A;  1P1Q A;  3MZB A;  4XTC Q;  2ONR A;  2OX3 A;  3LC8 A;  3BFT A;  5I2N A;  4NF0 A;  1P99 A;  4PET A;  4PFT A;  4U1Z A;  1XT8 A;  1B7U A;  5TU0 A;  4IO2 A;  3QK6 A;  2VT5 A;  3K1N A;  2F78 A;  3C31 A;  1MQD A;  1FPE A;  4N13 A;  1DCU A;  3JZJ A;  1MXV A;  1EZ9 A;  4AB6 A;  4PDH A;  3OOA A;  2V3Q A;  3EQ1 A;  5H8S A;  4GWU A;  3USD A;  2H98 A;  3O97 A;  3A3C A;  4PFY A;  1FTK A;  4MNI A;  3O9P A;  1H76 A;  3Q26 A;  1WVJ A;  1O64 A;  2WBB A;  4EDP A;  4H0W A;  1IME A;  4JDF A;  5IM2 A;  4R73 A;  4X1B A;  1USY H;  3H6U A;  3LSW A;  1LAX A;  3B7D A;  3ONM A;  3ZKL A;  5TP9 A;  1FQE A;  2AL4 A;  5H8N A;  4TQU Q;  1N7W A;  3A09 A;  2I3V A;  4P1L A;  2LAO A;  1XS5 A;  3H6W A;  3E78 A;  1IXG A;  1B58 A;  1N3X A;  1FQD A;  3C4M A;  1FPL A;  1MPB A;  3SDF A;  4DZ1 A;  4N8G A;  1FBF A;  1JW5 A;  2DP8 A;  1EZO A;  4TLL B;  2QS2 A;  2DE4 A;  4ZE8 A;  4OA4 A;  1ZBM A;  1JVX A;  1MQG A;  2QVV A;  1BP5 A;  1B05 A;  4NAP A;  4KFQ A;  2Y7W A;  3ECR A;  2QS3 A;  1LB8 A;  3T1B A;  2DE2 A;  2F7B A;  4AS4 A;  3M3K A;  1ZTY A;  1R9Q A;  1FPD A;  2F34 A;  4L17 A;  1RYX A;  3FD3 A;  3QIM A;  1VR5 A;  4FOR A;  4DDD A;  1XVX A;  5IZZ A;  4R2F A;  3VDF A;  2YPN A;  1O63 A;  4EQ7 A;  3PU5 A;  2CZK A;  3K6V A;  2RCA A;  1VDW A;  1XC1 A;  5EYG A;  2R9J A;  4KXP A;  3PMV A;  2ZXT A;  5I56 B;  2XXK A;  3G3F A;  2AL5 A;  4F2O A;  4KI0 E;  5AA2 A;  2IA4 A;  5KCJ B;  2ANJ A;  5ITP A;  4N4U A;  3E4R A;  1MXY A;  4P3L A;  1S50 A;  3UOR A;  1H44 A;  1FQA A;  4DCY A;  1B4Z A;  3E79 A;  2FA7 A;  1AOV A;  4HW8 A;  4RPO A;  3LSX A;  3C34 A;  3KSX A;  4DIG A;  1IUD A;  1MXW A;  5TP9 B;  3GBB A;  1NV3 A;  1MM6 A;  4XIG Q;  2UYF A;  4NF6 A;  4GL0 A;  3R26 A;  4KQP A;  2ZYO A;  3OEN A;  1FBP A;  1B51 A;  2E0S A;  2HHM A;  1LGB C;  2QS4 A;  1IIT A;  3VFJ A;  4ZEF A;  4N91 A;  3O6H A;  2F5X A;  1FBE A;  4JBZ A;  4MAG A;  2DSF A;  5A5X B;  4JWX A;  4F3G A;  1DPE A;  3S9M C;  4GBW A;  4YMB A;  1LFH A;  1IZ1 A;  5JEI A;  1R1N A;  4POW A;  3KSJ A;  4E0X A;  3THI A;  1UQW A;  4HCW A;  3EF7 A;  1NV0 A;  3G7W A;  2F6G A;  5ISU A;  5EYF A;  3CVG A;  1NMU A;  4G68 B;  1SW1 A;  2MKZ A;  1NUW A;  2OLB A;  4RXL A;  5F7V A;  1IMB A;  4P9K A;  1B0H A;  1MM7 A;  3RQT A;  4XKN A;  4DI4 B;  1ZU0 A;  3PMW A;  3U72 A;  3UGW A;  1D9Y A;  1IXH A;  1YZ0 A;  1JET A;  2PX1 A;  2OWZ A;  5CM6 A;  3O6I A;  1VFE A;  4MJO A;  1I6B A;  4NGU A;  3KZG A;  2XXQ A;  5I58 B;  5T3J A;  4EF2 A;  1ZMG A;  3PUX E;  4QF9 A;  3CFL A;  3V5A A;  4JWY A;  1QKB A;  1FSA A;  1A7L A;  1M5E A;  5KCJ A;  3SER A;  1OQH A;  3LV0 A;  1A8F A;  3RPL A;  1FTJ A;  3KN8 A;  3C36 A;  4XKQ A;  3PV0 E;  3D1R A;  1KZ8 A;  4OFL A;  1Q9D A;  1ZJL A;  5H8H B;  5I3S A;  4GIZ A;  2F8D A;  4O7M A;  4F1U A;  1A40 A;  1Y9U A;  1TXF A;  2P0S A;  3S4U A;  1NV4 A;  4LP2 B;  4PTK A;  3O29 A;  4N6D A;  1AWB A;  4ELR A;  3L6G A;  4DXU A;  4OVP A;  3B6T A;  4M4G A;  1KA1 A;  3KJ7 A;  1PC3 A;  3KOS A;  2O68 A;  1B52 A;  4OVJ A;  5DVJ A;  1OVB A;  1H43 A;  2REG A;  1MXU A;  1JEV A;  1N04 A;  5ET6 A;  1EYJ A;  3T96 B;  3F11 A;  2RIN A;  4F3S A;  4MEV A;  4R74 A;  3MST A;  4QXD A;  1I69 A;  1QVS A;  3MYU A;  4MBP A;  2XXW A;  4FED A;  4FAJ A;  3FXR A;  1ZKB A;  3M3F A;  2XXU A;  5BWJ A;  4N81 A;  3TQL A;  1A8E A;  5K2X A;  3S9E A;  2HFB A;  2A5T B;  2Y5K A;  5JK4 A;  2F36 A;  1SDX A;  1A99 A;  1LLS A;  5EQA A;  4GWW A;  4GXS B;  1JEU A;  3IB2 A;  5JTY A;  4QRZ A;  2DWI A;  4XKP A;  3TCH A;  4QFN A;  1N76 A;  4C0R A;  1IMC A;  1MY3 A;  4LVQ A;  4PQJ A;  5L9S A;  5I57 B;  4DLD A;  3EHT A;  3ILT B;  4F29 A;  1B46 A;  1PB8 A;  2OWS A;  3PPO A;  5AA4 B;  3GLB A;  4RK9 A;  4FEC A;  3AXF A;  4KD5 A;  3KBZ A;  1Y1M A;  4AQ4 A;  2FHY A;  2Q9T A;  4GQO A;  3B50 A;  1P1O A;  2WBD A;  3W9V A;  2I3W A;  2F97 A;  5DEX B;  4HS7 A;  3SEU A;  3TTM A;  1Q1K A;  4GLI A;  5FTH A;  3W9W A;  4NHB A;  1FCK A;  2NWJ A;  1GTK A;  1B32 A;  2HAV A;  1SW4 A;  5CMC A;  4PE3 A;  4G77 A;  1TWY A;  1US4 A;  3CRB A;  3Q28 A;  4PFB A;  3QYT A;  1RYO A;  3H3G A;  3SES A;  1EYK A;  2Z23 A;  2Y5L A;  4MCO A;  5AA2 D;  3QAX A;  1B1X A;  3FXU A;  2RCB A;  5L9M A;  3TYH A;  4MHF A;  1FBC A;  1SI1 A;  4OFO A;  3V89 B;  3TTL A;  1S7Y A;  5CC2 A;  2RC9 A;  3RPW A;  3DM0 A;  4QHQ A;  3B8B A;  2V25 A;  5CMB A;  2I4B A;  4R75 A;  4F22 A;  4YMA A;  1Y1Z A;  4KYS A;  4F3P A;  5H8F A;  4Q0C A;  4R6K A;  4GL8 A;  4OAN A;  2FIX A;  2XD2 A;  1G0H A;  1LCF A;  2FYI A;  2D3I A;  2Y7I A;  3MP8 A;  3M3L A;  4PGN A;  5I7I A;  4NF4 B;  1NNF A;  3ZSF A;  3TMG A;  1MH4 A;  5EQ7 A;  3B6Q A;  3KC1 A;  1N84 A;  4H6D A;  2PFY A;  3EPE A;  3WAF A;  5ET7 A;  2H4I A;  3N26 A;  1UTH A;  1OQG A;  4OMB A;  1NUY A;  4PE5 B;  4U21 A;  4PFW A;  1NI9 A;  4FJP A;  5CBS A;  3IL1 B;  3MAM A;  4MFI A;  2XXX A;  2DVC A;  2GHB A;  2KR0 A;  1MQJ A;  3ISP A;  4JWO A;  4U22 A;  3RT6 B;  4C1U A;  2RC7 A;  4I3Y A;  3P7I A;  4PAI A;  1FPI A;  1Y4C A;  3QMF A;  2HCA A;  2ZYM A;  2VD2 A;  4MLQ A;  2B4M A;  4P0I A;  1INP A;  1VSO A;  4IO7 A;  3EHU A;  5DEX A;  1QUL A;  4GX6 A;  4WED A;  2Y84 A;  4NWC A;  4EQB A;  1D9Q A;  5L9O A;  1QUI A;  2ZNU A;  3IO4 A;  4JSO A;  4R9F A;  3QSL A;  2O7U A;  2CZI A;  1JW1 A;  3IOV A;  3G3I A;  3IR1 A;  2XWK A;  2ZZX A;  1JVY A;  5I57 A;  1B3L A;  5KDT A;  1B7H A;  1GGG A;  1II5 A;  2OZZ A;  4NF5 B;  4H1X A;  5I2K B;  1PBP A;  4G8H A;  4OER A;  5K2Y A;  1M5F A;  2XXY A;  2QPQ A;  1IEJ A;  4ND9 A;  3T9X B;  3VE1 B;  3S9N C;  3MBP A;  2FVZ A;  3PD8 A;  2DXY A;  3MC2 A;  3VXC A;  4U23 A;  1R9L A;  3CSB A;  2NUV A;  2IEE A;  3H06 B;  4FEB A;  3K6X A;  4GD5 A;  5DTB A;  2XXT A;  2RF1 A;  1B0L A;  5TPA A;  3VV5 A;  1NH7 A;  5LTC A;  3UIF A;  2VPN A;  4BDQ A;  1XHY A;  3JV9 A;  1YYZ A;  3RUM A;  4NN3 A;  3OO6 A;  3FJ7 A;  4YKJ A;  4JSD A;  3V8X B;  3QXM A;  3EKI A;  1MDQ A;  4PFI A;  5FHO A;  5H8Q A;  1EH3 A;  4YB6 A;  3RPL B;  4FE8 A;  3Q27 A;  3E13 X;  2AIX A;  3PUZ E;  3RGY A;  2I48 A;  4LAT A;  1LBX A;  1IMD A;  2XX7 A;  3MQ9 A;  4P11 A;  3T22 A;  1OIB A;  2E1S A;  2VD3 A;  4G8N A;  3LSL A;  3LUY A;  3HCQ A;  3FXQ A;  1PEB A;  3L6H A;  4F39 A;  4K3F A;  4F1Y A;  2F3D A;  1CE2 A;  3H6T A;  1AIV A;  4NED A;  4ZE9 A;  3H7M A;  1AH5 A;  4H45 A;  3R7X A;  4R6H A;  2XXR A;  2FNC A;  3KN3 A;  4Q5T A;  3TUS A;  2PVU A;  5I58 A;  1J1N A;  1MDP 1;  4IO3 A;  2B3B A;  3FXB A;  1K9Y A;  2QJE A;  4MNC A;  4Q8R A;  4HTG A;  1B5H A;  4HE1 A;  4OXV A;  2CEY A;  2O51 A;  3R6U A;  3TDJ A;  1B1H A;  1KA0 A;  1IQ7 A;  2FIE A;  3Q29 A;  1OLA A;  4Q30 B;  5DT6 A;  1DK4 A;  4IO6 A;  1MQH A;  3IAZ A;  1FBG A;  3IO6 A;  2Z8F A;  4O94 A;  5A5X A;  1USY E;  3K0V A;  4I1D A;  3PD9 A;  1FQB A;  2ALU A;  1RDZ A;  4OWD A;  4DXC A;  2UVH A;  3IK6 B;  4NG7 A;  1O7T A;  1R6Z A;  4JVC A;  5DYH A;  3CG1 A;  2Z8D A;  4TLM B;  3TFL A;  3PUV E;  4JXI A;  2ABH A;  5TPA B;  4BDM A;  1Y20 A;  3QUF A;  4IB2 A;  2XWO A;  4XF5 A;  4N17 A;  5BUU A;  1QUJ A;  1IXC A;  2GQ1 A;  1NH8 A;  4PP0 A;  3UA8 A;  3KC0 A;  1SD3 A;  2Q88 A;  1A54 A;  1HSL A;  3QUJ A;  1Y3N A;  4RNS A;  4QSD A;  1OVT A;  5IZ1 A;  4I3E A;  4O8M A;  1AL3 A;  4Z0I A;  4WKM A;  5I56 A;  1YPN A;  2XXI A;  4I62 A;  3H6V A;  3PGF A;  2P3V A;  4P0G A;  3OMB A;  1UTB B;  4YB7 A;  3I6V A;  1YTV A;  1FPF A;  3FUZ A;  5I2K A;  2WKY A;  3PUW E;  2I0B A;  3RLF E;  4HE2 A;  5EQ8 A;  4RJZ A;  4WEP A;  1PDA A;  1LBZ A;  3HST A;  1LEV A;  4UAC A;  5IZ3 B;  3IOR A;  4GFR A;  5H8Q B;  4MLV A;  3RT8 A;  2WYK A;  4LON B;  4GX3 A;  5HBC A;  4EUO A;  1YAE A;  3OSQ A;  4OEN A;  5EHS A;  4GBV A;  4OTE A;  3IB1 A;  3MP6 A;  1S9T A;  3TAJ A;  3PTY A;  3RTF B;  1GR2 A;  3GYY A;  1B40 A;  4UA8 A;  1FBD A;  1ATG A;  3KEI A;  1WOD A;  1NV2 A;  4QFL A;  1URG A;  2V84 A;  3H03 A;  4YB5 A;  3CR9 A;  4H65 A;  4ESW A;  4FIM A;  3TEL A;  2UVG A;  4WXJ A;  1QJM A;  1DOT A;  3SET A;  2B65 A;  1FPK A;  1FJ6 A;  3C32 A;  3RYD A;  2R6G E;  2XHD A;  4I40 A;  3OEM A;  2VHA A;  4OET A;  2X26 A;  2Q8J A;  3G3J A;  2XA5 A;  3UK4 A;  2O84 X;  4KCC A;  3T9V A;  3RTW B;  4NF8 A;  1TT1 A;  4NF5 A;  1LBC A;  5HM4 B;  2DS9 A;  3EN3 A;  5ESY A;  1ANF A;  1MPD A;  3TCF A;  3K1P A;  2H5Y A;  3RN8 A;  2M8C A;  1MY0 A;  1MY1 A;  4LQ5 A;  3MUQ A;  4QFO A;  4GRK A;  1LAF E;  1ZLQ A;  3T93 B;  3CSG A;  4KYE A;  2V93 A;  1FBH A;  4X04 A;  2H99 A;  3TOD A;  4H5F A;  2F7C A;  1FTM A;  4OVR A;  4P47 A;  4DCX A;  2D21 A;  3UP9 A;  4R9G A;  1Q35 A;  2NXO A;  4GXA A;  1MQI A;  2REJ A;  3ROJ A;  3W15 C;  2RKM A;  5FHN A;  1PB9 A;  3TEP A;  3CFZ A;  1NV5 A;  1EYI A;  2HZK A;  5IGA A;  2ZNS A;  3TTR A;  4PGP A;  2V3T A;  4PC9 A;  3FV1 A;  4N8Y A;  4ZZE A;  5DW8 A;  4RK2 A;  1Y3Q A;  2HAU A;  3FAT A;  2DVZ A;  2W7Y A;  3FJM A;  1JP4 A;  1MG1 A;  4NE4 A;  3U94 A;  4NF8 B;  1LFI A;  4EXK A;  4P1E A;  1B3H A;  1M5B A;  1RDY A;  4N15 A;  3GBA A;  4H67 A;  2ZZV A;  5B7D A;  3LUZ A;  3K00 A;  1LCT A;  3MPL A;  2F7A A;  3N5L A;  5CMM A;  2A5T A;  2R71 A;  3N94 A;  3T0J A;  4FBP A;  1DBZ A;  3A3U A;  4O7I A;  2PYY A;  1BLF A;  2KLF A;  1B3E A;  3IJX B;  3K02 A;  1FW0 A;  3KJT A;  2OK2 A;  5A5L A;  2DOJ A;  1MRP A;  2CEX A;  1F9B A;  3VVD A;  1IXI A;  4YKI A;  4BLA A;  1M5C A;  2F35 A;  1LBW A;  1SYH A;  3HPI A;  1EZP A;  3FZV A;  4P8B A;  4F19 A;  2V3U A;  4BDO A;  1A55 A;  3BBR A;  4N6K A;  3NOH A;  1GV8 A;  3M8U A;  3LR1 A;  1BIY A;  2A5S A;  3E9X A;  2VP1 A;  2QMW A;  3FVK A;  4ELP A;  2NOO A;  1B5I A;  1NKX A;  4EXL A;  1VE4 A;  4GWX A;  5IZ3 A;  4KR5 A;  3S9L C;  4ESX A;  2XWV A;  2BJI A;  2Y7R A;  4NMY A;  4TOZ A;  3TPA A;  4DI3 D;  3U65 A;  3OXN A;  3KOT A;  3O66 A;  4P56 A;  4I8C A;  4F1V A;  2AYS A;  4LA9 A;  2GH9 A;  4H46 A;  5H8H A;  1UTB A;  3SEW A;  1NNK A;  3OEL A;  3FBP A;  4AS5 A;  4QSC A;  5ELV A;  4GWS A;  3ODB A;  4EF1 A;  4G2Z A;  1FJ9 A;  4OEV A;  4N6P A;  5AE4 A;  1B9J A;  4YZZ A;  1LFG A;  3PUY E;  4O3B A;  2DWA A;  4KHZ E;  5I84 A;  4GWO A;  3GXA A;  5LDZ A;  3BKI B;  4XXU A;  4EQ9 A;  4F3B A;  5HPQ A;  1FPG A;  2DQV A;  2Q89 A;  2OWT A;  5FHM A;  2XXV A;  3DEL B;  2DWJ A;  2X7Q A;  1SQY A;  3K6W A;  3U8Q A;  4KPT A;  2HXR A;  2GFE A;  2OBG A;  3MW0 A;  4IY6 A;  4PCD A;  1D3K A;  4GVO A;  4PF6 A;  4IGR A;  1BKA A;  4DE8 A;  1NFT A;  5KZT A;  5FTI A;  2L5V A;  4JB7 A;  3I5O A;  1Z7M E;  3DP6 A;  1FRP A;  2QMX A;  1LAH E;  4GWY A;  4UAB A;  1JNF A;  2CZL A;  4IY5 A;  1FPB A;  4IO5 A;  3HN0 A;  2Y7P A;  4MIJ A;  4G68 A;  3U92 A;  5DVF A;  3SZP A;  2P3N A;  2DE3 A;  4POX A;  4JVD A;  4ZEB A;  4F31 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...