2HZLA

Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
334
structure length
334
Chain Sequence
VTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an Extracytoplasmic Solute Receptor from a TRAP transporter in its open and closed forms reveal a helix-swapped dimer requiring a cation for alpha-keto acid binding.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Ligand binding, transport protein
molecule keywords TRAP-T family sorbitol/mannitol transporter, periplasmic bin
total genus 124
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hzlA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hzlA01
2GH9A 2XXQA 1SYIA 2D5WA 3HSTA 4OESA 3R6UA 5HBCA 1XC1A 4NAPA 1SW2A 3L6GA 4YKKA 4OTEA 1B4ZA 3C31A 2ZNTA 5LOMA 4NF5B 1A55A 1B58A 1O64A 3O6IA 3U1OA 2PMSA 4O94A 4XTCQ 3IO4A 1ZKBA 4N07A 2P1SA 4N15A 4OVRA 1IUDA 3EF7A 1EZOA 4NG7A 3IX1A 1PEBA 3FVNA 1JETA 2V93A 4IO7A 2G93A 2PYYA 2XWIA 3UIFA 5BWJA 2V3TA 3T9UA 4GXAA 4PBQA 4R72A 5DVFA 4RXLA 3K02A 2QMWA 4N17A 3RUMA 3S2VA 3MBPA 2DS9A 3IK6B 4H5FA 4HW8A 2XXKA 3MPLA 1J1NA 4FJPA 3C9HA 1MM7A 1PB7A 5L9MA 4PC9A 1LCTA 3SESA 5H8NB 4PE5B 2Q8JA 1OIBA 3KOSA 3IR1A 4C1UA 4DXBA 4YMBA 5I2NA 4WEPA 1FQFA 4PFBA 2ZNUA 3U8QA 2W7YA 4N8GA 2HCAA 2F6PA 1DTGA 4P47A 3VXCA 3VLWA 1KWHA 4YICA 2XHDA 2ZYMA 5TU0A 4E0XA 4MH5A 4ELOA 1XS5A 3RNNA 4EQBA 4JWOA 2DXYA 1MXWA 3LBSA 4OHNA 3PUZE 3TPAA 3OO7A 4RNSA 4NF0A 5LTCA 4GXSB 2XXPA 4UACA 1Y4CA 4F1VA 3K6WA 1Z7ME 4GRKA 4R6KA 4F31B 2Z22A 4H65A 3MAMA 4NGUA 4OQOA 1S9TA 3QXMA 5DYHA 1NH7A 3PUXE 3TZAA 2OZZA 3FXRA 3RTWB 1VSOA 1B5IA 5L9SA 3FXBA 4HCYA 1M5DA 3UGWA 3KJTA 3KEIA 3SEVA 1YCJA 3PPPA 2O7IA 2VHAA 3JYRA 3D4GA 5DVJA 4ZEDA 1Y3NA 4MCOA 4NF8B 1B3EA 4LUBA 2I0BA 3CFZA 1SW1A 4POXA 1OQHA 1SI1A 4EDPA 1M5EA 3FV1A 4WXJA 1NNPA 3IOVA 5TPAA 5TP9A 1OLCA 3IORA 4R9GA 1LB8A 4GVOA 4QFOA 1CE2A 2I6EA 1N0TA 3K6UA 3CRBA 3U92A 3IOWA 5BUUA 1GVCA 4NHBA 3OO6A 3KOTA 4P11A 1R6ZA 1DMBA 2DWHA 1LFIA 4JWXA 4DIGA 4OVJA 4MHFA 2M8CA 3KSXA 4N4UA 1MY2A 2V3QA 4KHZE 4G8NA 4P9KA 3OOAA 4X1DA 4ONYA 4MF3A 4YKPA 1MQDA 4O8MA 2V25A 4TOZA 5CBSA 4NE4A 1GR2A 3MVXA 1H43A 1FQCA 1MDQA 4IO2A 4NQ8A 4X9TA 4F39A 3TCHA 4BDLA 1FQBA 5EYFA 2O69A 3H6VA 3D4CA 4LQ2A 4QSDA 4AB6A 2F8DA 4KYSA 1B51A 2QPQA 4MNPA 3C33A 1ZTYA 2Y7WA 3DP4A 4IO5A 3ECRA 4NF5A 2QJEA 4U23A 1MY1A 4F3BA 2AYSA 4OFLA 1JEUA 1B40A 3CFXA 3R26A 4IO6A 3OSRA 2Z8EA 4DCXA 1JQFA 5ICTA 2YPNA 2O6AA 4ELPA 3PMVA 2QMXA 2OWSA 3GXAA 3GBAA 4XEQA 4ZS9A 3VLVA 3IOTA 4M4GA 4GL8A 3RT8A 1B52A 3Q27A 3V83A 4Z7EA 4QF9A 1O7TA 4OVTA 1UTBB 5ITPA 1N7XA 2Y7IA 2HZKA 4QFNA 3HHFA 3SDFA 3MP1A 2F35A 3ILTB 1B3LA 2XXHA 3V89B 2WKYA 5I2KA 5I58A 4PFIA 3RY3A 3SKPA 2O1LA 4YKIA 1NNFA 3Q26A 2VOZA 2DYXA 3QUFA 1BP5A 4O3AA 3Q28A 2I4CA 4P0IA 1OMPA 4I9DA 3FATA 3I5OA 4F29A 3IJOB 2UVJA 3RGYA 4PFTA 3MVWA 4NF6B 3OO8A 3UN6A 5B7DA 1VR5A 5CMCA 3A3CA 1FTJA 1S7YA 3B6WA 2XD2A 4F2OA 1QKAA 4GWOA 1XT8A 4RK9A 1II5A 3O66A 4GOTA 5I2KB 4YMAA 3VLUA 2DSFA 5KDTA 4PAFA 3U65A 3FZVA 1A8FA 3Q25A 1TT1A 3FJ7A 1NKXA 3DLNA 1URDA 2Y7PA 4G77A 1AOVA 2XXWA 4XKQA 1D4NA 3MW0A 1B5JA 4P1LA 4KPTA 2R71A 3W9VA 4FORA 1A7LA 4U2RA 2ZZVA 4N6PA 3T93B 4LVQA 3FASA 5FHOA 1ZIUA 4U4XA 1ANFA 1A40A 4ELQA 2H99A 4AB5A 1P1WA 2QS4A 3TCGA 1Y3QA 4NX1A 3KSJA 3A3UA 4RY1A 3E3KA 3BBRA 4H8JA 4P3LA 1I6BA 3TFLA 1IXIA 2ZNSA 4FIMA 3TAJA 5FTHA 4X04A 3ZS6A 1IXHA 2D3IA 1M5CA 4PP0A 4NEDA 4DI3D 1TWYA 4MNIA 4C0RA 2X7QA 2XXTA 5H8HA 4DI4B 1L5TA 4OXVA 1B0HA 2D21A 3PMXA 4IO3A 1H45A 1LAGE 5AA1A 2REJA 5DEXA 2QSXA 3MJNA 1B7UA 3GLBA 3FVKA 3CFLA 5CC2A 1SW4A 4MIJA 1VFEA 2GRVA 1N04A 5KZTA 1MQIA 1I6AA 1SYHA 3Q29A 3CIJA 2H25A 2PVUA 2RC7A 4LATA 3C32A 2NXOA 4JXIA 3RT6B 5I56B 3ODBA 1FCKA 1DOTA 3GZGA 3VV5A 1HSJA 2OWTA 3T22A 1MRPA 1D9VA 2I49A 2RC9A 4OWDA 1AIVA 4R2BA 1MXYA 1RYXA 4I62A 2E0SA 1ZU0A 1HSEA 1A99A 1MY4A 3M3FA 3RN8A 1TXFA 5FHNA 4G8MA 2F97A 4FECA 1MH4A 3HO7A 3K1PA 2NUVA 3P7IA 1NH8A 3G3GA 3IAZA 3QUJA 2PT1A 3PPNA 4BDMA 3C34A 2DWIA 1YPNA 1ZBMA 2ONSA 2ZYKA 3OMBA 4Z0IA 1WDNA 1B0LA 2DQVA 2LAOA 3V5AA 1MQJA 2Z8FA 4ESWA 4P56A 1M5FA 4OEUA 1T0KA 4G4PA 1I6QA 4RPOA 2GFEA 2XA5A 3BFUA 4XXUA 2H4IA 3FJGA 1QW0A 1Y9UA 3IB1A 5IZZA 1RKMA 3KGCA 1ATGA 2XWOA 1FQDA 4YKJA 1D3KA 4P0GA 3PPQA 4QFLA 1BKAA 1LB9A 2F34A 4EXKA 4G68A 1IZ1A 2XX9A 4RYAA 3AXFA 3FVGA 5JTYB 3R7XA 2Z8DA 1ZMGA 4LZ5A 1B6HA 4JSDA 3I3VA 3G3JA 2CEYA 2Q2AA 4PGPA 5I7IA 4MAGA 2ZZXA 1LBBA 2G29A 3DP6A 2ZMBA 4IGTA 2UVGA 1MXUA 1P1QA 3MPKA 1N84A 3TTLA 1M5BA 2VGQA 3TTMA 3THIA 1MPCA 2Q89A 3CSGA 3RLFE 2DWJA 4IO4A 1USYH 1S50A 4DDDA 3B50A 1WODA 2UYFA 1QUIA 2PT2A 2V4CA 2F6GA 4F3PA 4PFUA 5JEIA 5IAIA 3N94A 4R73A 3H3GA 4TLLB 3LSWA 1NNKA 4MEVA 1D9YA 5K2XA 3CSBA 3KBRA 2ESNA 1FTOA 1FW0A 5L8DA 4PFYA 1Q1KA 3MZ9A 2ZYOA 1Y1MA 3T9VA 4F3SA 3MZBA 5L9OA 4GF8A 4ZE8A 2DWAA 2NWJA 1B5HA 4N8YA 5AA4A 3O6HA 1F9BA 3KFMA 3SEYA 5DT6A 2V3UA 4H6DA 4TLMB 1R9QA 4KQPA 1HSLA 1MQGA 5I84A 2ANJA 3VVDA 2I48A 1A54A 4E0WA 1UIUA 3C36A 2V84A 3BKIB 3TKDA 1UQWA 4NMYA 4EUOA 4F1YA 3ZSFA 1SI0A 2WYKA 5F7VA 2H5YA 2WX9A 3TTNA 1IXCA 4EQ9A 3T9HB 4QFPA 3OD7A 1PB9A 3H06B 3G3HA 3TTRA 3TQLA 3KN8A 3M8UA 2DOJA 3N6UA 2HFBA 4Q0CA 1N7WA 1JW1A 2PFYA 4H0WA 4JB7A 5EHSA 3O6GA 2GHAA 3HHGA 1EH3A 1DSNA 5AA2A 4GFRA 2HQ0A 4YB6A 2B65A 4R6YA 3T96B 3W15C 5H8NA 2VD3A 1B46A 3UA8A 4NWDA 1MDP1 5I56A 3L6HA 3KZGA 3IO6A 1Y20A 3RPWA 5FHMA 1ELJA 1LGBC 5KDTB 2XXRA 5A5XA 1P1NA 4IB2A 5ITOA 4XIGQ 2VD2A 2A5TA 3K1MA 4MLVA 1FTMA 1Q35A 1AH5A 4PCDA 4NWCA 3CG1A 2A5TB 1LFGA 5H8QB 3JZJA 3BFTA 2IEEA 4KCDA 4LZ8A 1OQGA 3B6QA 4NTLA 4ISUA 2HAUA 2OCUA 4Q8RA 3E13X 3B7DA 3TODA 3U93A 1IXGA 3KG2A 4QSEA 3K6VA 2NVUB 3IB2A 2CEXA 3DP8A 3EQ1A 1BLFA 4F3GA 2I3VA 2IA4A 4K3FA 1IIWA 1UTHB 2ONRA 3M3LA 1DPPA 3N26A 1SW5A 2REGA 1NL5A 1N76A 4ZEKA 1I69A 1TFAA 3OO9A 3KN3A 3HPIA 4NF4B 3MVYA 4RPNA 4O3BA 4YZZA 1B3GA 3S9LC 3PUWE 4U1ZA 4OYVA 3PUVE 4WKMA 4N6DA 4WEDA 1B05A 1POTA 2O84X 1R1NA 4DXCA 3VVEA 3S4UA 1B7HA 4L17A 4PDDA 4ZEIA 1YAEA 1XOCA 1Y1ZA 1EZ9A 2ZZWA 4PE3A 3FXQA 4THIA 2F36A 2PX1A 3VE1B 1LAFE 4NN3A 5DEXB 2ONKE 5CMKA 2F7CA 4RA1A 4MX6A 3VFJA 4G2ZA 5DTBA 1B2HA 2RCBA 4R2FA 3E9XA 1H44A 3N5LA 4ZDMA 3IJXB 4KD5A 2CMOA 2ABHA 4OFOA 5JTYA 2HXWA 1PDAA 2NOOA 1B7ZA 4BDOA 3RTFB 1MXZA 3A09A 2PFZA 4H1XA 1US5A 4IY6A 4U1OA 3PD8A 3TQWA 5I57A 3SEUA 3T66A 2O51A 3EHUA 1P99A 2XX7A 3EHTA 3MP6A 3FD3A 4GLIA 4X1BA 4R75A 4JSOA 4MBPA 2F7BA 4OVQA 4KI0E 1LBCA 2Z23A 3EHSA 1LAXA 2I4BA 3UORA 3G3FA 4GL0A 1EZPA 2XXYA 3MUQA 4AQ4A 1LLSA 4XF5A 1SD3A 4ELRA 1POY1 3PD9A 5CI5A 4RJZA 4NF4A 4H5GA 3OEMA 2RCAA 3SERA 3C4MA 4QRZA 1QVSA 2YLNA 5I57B 1US4A 3KN7A 1VE4A 3O9PA 3SEWA 1Y4TA 2XWKA 4JDFA 2RC8A 5AA2B 4DXUA 1B1XA 3QK6A 4G68C 4BDNA 4MNCA 1NNTA 2OBGA 1FTLA 2XXUA 4F2QA 4KFQA 2KLFA 2DP8A 2AIXA 4IY5A 5I59A 2QRYA 3I6VA 2QS1A 2Y7KA 2UVIA 4PAKA 4OENA 2DVCA 3H03A 4LQ5A 2QS2A 2R6GE 5EHMA 4EF1A 1OLAA 1OVTA 5KCJB 2DE2A 3B6TA 1OVBA 4XFEA 2O68A 3S9EA 4G68B 2B3BA 1Y3PA 3S9NC 1O63A 1TFDA 4F18A 4GQOA 4OERA 2H9BA 5F1QA 2DE4A 3UK4A 1YTVA 4KCCA 4LN5A 1FQAA 3K4UA 3UP9A 1XVXA 3IB0A 5ISUA 2QS3A 5DVIA 2BJJX 3PMWA 4JWYA 5K2YA 1AMFA 4HS7A 3H6UA 2O7UA 1MY0A 1LFHA 3OENA 4ECFA 4POWA 1IITA 1DPEA 4OANA 4U21A 2HPGA 3CG3A 5H8SA 4KR5A 4ZEFA 4N13A 2ALUA 1NMUA 4ESXA 4NF6A 1PB8A 5H8HB 1URGA 3CVGA 4BLAA 5H8FA 3TELA 2OLBA 4DE8A 2DVZA 4QSCA 4LP2B 4DZ1A 4XKNA 3PPRA 4GIZA 1R9LA 1LAHE 3O28A 1PC3A 5CBRA 4P1EA 1CB6A 1PBQA 3K2DA 1B3FA 3OXNA 1XHYA 4PF8A 1JVYA 1QJMA 1MPBA 3OSQA 4PETA 1MXVA 5CRYA 4OZ9A 1B32A 1P1OA 4YU0A 3PU5A 1B9JA 1LCFA 1A8EA 3HN0A 1JW4A 3K00A 1PBPA 1UIVA 5I2NB 3LUYA 4PBHA 4FE8A 5FTIA 5A5XB 2ZYNA 4QFKA 4OA4A 4FATA 2FA7A 2P0SA 1B3HA 2FNCA 3FGSA 4Q5TA 2AL4A 3JV9A 2UVHA 3H6WA 4OFJA 1QUKA 4KYDA 4ZECA 4O7MA 3TDJA 1SDXA 4M1VA 4H8IA 4FEDA 3VXBA 2ZXTA 3C35A 2THIA 2VP1A 2PBWA 4R6HA 2GHBA 3V8XB 1UTBA 4O3CA 4X8RA 3LSLA 3PPOA 3ILUB 2I0CA 4JBZA 2E1SA 3U94A 1GTKA 4LZ7A 5ELVA 5I59B 4UABA 3ONMA 1UTHA 4DCYA 4G8HA 3KJ7A 3O97A 2R9JA 4U4SA 5CMMA 1N3XA 5I5PA 3E4RA 3HV1A 4ZE9A 3S9MC 3MWBA 2X26A 2H98A 1LSTA 1DTZA 4I1DA 3K6XA 5IKBA 2Q9TA 4NF8A 3H6TA 4X48A 1AL3A 3PGFA 1MM6A 3EPEA 5JK4A 2X7PA 3VDFA 1N3WA 3CR9A 2VPOA 3MP8A 2CZLA 4DLDA 4OVPA 3LSXA 4FAJA 3N6TA 2UYEA 5AA3A 5AE4A 4N6KA 4PQJA 4MLQA 4RK2A 2XXVA 4ZEBA 3K1NA 4YB7A 4LA9A 2A5SA 2XD3A 2RINA 3GYYA 4PFRA 3RQTA 2I3WA 3QAXA 1ZJLA 1MXXA 3SETA 4FEBA 1EU8A 4GD5A 4Q30B 2F7AA 2XWVA 3VVFA 5ICQA 1SBPA 3FJMA 3FXUA 1GGGA 4F22A 2I58A 3ZKLA 4C1TA 1ZLQA 4PFWA 3MC2A 1NFTA 1RYOA 3K0VA 1H76A 4ND9A 5B70A 3U72A 1USYE 3OEKA 1GV8A 3MZ1A 1BIYA 1MS7A 2RKMA 3TEPA 4EXLA 3MQ9A 5KCJA 3QYTA 3G7WA 4HCWA 2WYPA 1H3DA 4YAHX 3FVOA 1P1UA 4HTGA 3SEXA 2YJPA 3LR1A 5IM2A 4EF2A 2DE3A 2B3FA 1IEJA 3PV0E 5HM4B 3ZKKA 5H8FB 3TCFA 3IL1B 5CM6A 1WVJA 2XX8A 1QKBA 1JW5A 3TMGA 1B4HA 4MFIA 3FV2A 3CI8A 1FQEA 2HZLA 5AA2D 3WAEA 1MG1A 1B1HA 3PUYE 2Q2CA 3WAFA 5J1DA 3H7MA 4KYEA 3TTKA 2QL3A 3QIMA 3OELA 3H4ZA 4U22A 4ZZEA 3DELB 1SVXB 3TUSA 3HCQA 5I58B 4PDHA 3T9XB 2AL5A 3QSLA 3W9WA 3G3IA 2O1MA 4QHQA 4ZZAA 2HAVA 3MVZA 1MY3A 3O2AA 2DXRA 3F11A 2RF1A 5H8QA 1FTKA 2FYIA 4OVSA 4MMPA 2VPNA 1Z7NE 3K01A 4PF6A 3G3KA 1QUJA 1SQYA 3M3KA 3GBBA 4P8BA 4F19A 2HEUA 3EN3A 4OMBA 4TQUQ 2XXIA 4XKRA 5TP9B 2OJTA 5TPAB 1BTJA 4F1UA 4XKPA 1VFDA 4OETA 4EQ7A 3IOUA 4BDQA 3USDA 4H67A 1URSA 1XVYA 2F5XA 5M2VA 3LC8A 4IGRA 3FIRA 2OK2A 3DM0A 2UXAA 3O29A 4YB5A 4R9FA 1MPDA 4PAIA 1JNFA 4N91A 5AA4B 2Y7RA 2XXXA 3FUZA 3LSFB 1MH3A 2P2AA 4PGNA 2Q88A 4UA8A 4LONB 5CMBA 4I8CA 4R74A 5HPQA 1IQ7A 1MQHA 1JEVA 4OEVA 1JVXA 3TYHA 5IGAA 4BDRA 2F78A 1QULA 2Y84A
chains in the Genus database with same CATH superfamily
2GH9A 2XXQA 1SYIA 2D5WA 3HSTA 1EYIA 4OESA 3R6UA 2WBBA 3T0JA 2L5VA 1XC1A 5HBCA 4NAPA 1SW2A 3L6GA 4YKKA 4OTEA 1B4ZA 3C31A 2ZNTA 5LOMA 4NF5B 1A55A 1B58A 1O64A 3O6IA 3U1OA 2PMSA 4O94A 4XTCQ 3IO4A 1ZKBA 4N07A 2P1SA 4N15A 4OVRA 1IUDA 3EF7A 3EKIA 1EZOA 2P3NA 4NG7A 3IX1A 1PEBA 3FVNA 1JETA 2V93A 4IO7A 2G93A 2PYYA 2XWIA 3UIFA 5BWJA 2V3TA 3T9UA 4GXAA 4PBQA 4R72A 5DVFA 4RXLA 3K02A 2QMWA 4N17A 3RUMA 3S2VA 3MBPA 2DS9A 3QMFA 2XXKA 3IK6B 4H5FA 4HW8A 3MPLA 1J1NA 4FJPA 3C9HA 1MM7A 1INPA 1PB7A 5L9MA 4PC9A 1LCTA 3SESA 5H8NB 4PE5B 2Q8JA 1OIBA 3KOSA 3IR1A 4C1UA 4DXBA 4YMBA 5I2NA 4WEPA 1FQFA 4PFBA 2ZNUA 3U8QA 2W7YA 4N8GA 2HCAA 2F6PA 1DTGA 4P47A 3VXCA 3VLWA 2QFLA 1KWHA 4YICA 2XHDA 2ZYMA 5TU0A 4E0XA 4MH5A 4ELOA 1XS5A 3RNNA 4EQBA 4JWOA 2DXYA 1MXWA 3LBSA 4OHNA 3PUZE 3TPAA 3OO7A 4RNSA 5LDZA 4NF0A 5LTCA 4GXSB 2XXPA 4UACA 1Y4CA 4F1VA 5IZ3A 3K6WA 1Z7ME 4GRKA 4R6KA 4F31B 2Z22A 4H65A 3MAMA 4GX3A 4NGUA 4OQOA 1S9TA 3QXMA 5DYHA 1NH7A 3PUXE 3TZAA 3MSTA 2OZZA 3FXRA 1FRPA 3RTWB 1NUWA 1VSOA 1B5IA 5L9SA 1AWBA 3FXBA 4HCYA 1Q9DA 1M5DA 4QBAA 3UGWA 3KJTA 3KEIA 3SEVA 1YCJA 3PPPA 2O7IA 2VHAA 3JYRA 3D4GA 5DVJA 1FPEA 4ZEDA 1Y3NA 4MCOA 4NF8B 1B3EA 4LUBA 4HE0A 2I0BA 3CFZA 1SW1A 4POXA 1NV3A 1OQHA 1SI1A 4EDPA 1M5EA 3FV1A 2DDKA 4WXJA 1NNPA 1YZ0A 3IOVA 4GX6A 5TPAA 5TP9A 1OLCA 3IORA 4R9GA 1LB8A 4GVOA 4QFOA 1CE2A 2I6EA 3SZPA 1N0TA 3K6UA 3CRBA 4HXVA 3U92A 3IOWA 5BUUA 4NHBA 1GVCA 2R8TA 3OO6A 3KOTA 4P11A 1R6ZA 1DMBA 1RDYA 2DWHA 1LFIA 1XI6A 4JWXA 4DIGA 4OVJA 4MHFA 2M8CA 3KSXA 4N4UA 1MY2A 1FPBA 2V3QA 4KHZE 4G8NA 4P9KA 3OOAA 4X1DA 4ONYA 4MF3A 4YKPA 1MQDA 4O8MA 2V25A 4TOZA 5CBSA 4NE4A 1GR2A 3MVXA 1H43A 4MJOA 1FQCA 1MDQA 4IO2A 4NQ8A 4X9TA 4F39A 3TCHA 4BDLA 1FQBA 5EYFA 2O69A 3H6VA 3D4CA 4HE1A 4LQ2A 4QSDA 4AB6A 2F8DA 4KYSA 1B51A 2QPQA 4MNPA 3C33A 1ZTYA 3KBZA 2Y7WA 1CNQA 3DP4A 4IO5A 3ECRA 4NF5A 2QJEA 4U23A 1MY1A 4F3BA 2AYSA 4OFLA 1JEUA 1FBHA 1B40A 3CFXA 3R26A 4IO6A 3OSRA 2Z8EA 4DCXA 1JQFA 5ICTA 1EYKA 1NV2A 2YPNA 2O6AA 4ELPA 3PMVA 4G61A 2QMXA 2OWSA 3GXAA 3GBAA 4XEQA 4ZS9A 1LBXA 3VLVA 3IOTA 4M4GA 1SPIA 4GL8A 3RT8A 1B52A 3Q27A 3V83A 4QF9A 4Z7EA 1O7TA 1K9ZA 4OVTA 1UTBB 5ITPA 1N7XA 2Y7IA 2HZKA 4QFNA 3HHFA 3SDFA 3MP1A 2F35A 3ILTB 1B3LA 2XXHA 2JJKA 3V89B 2WKYA 5I2KA 4PFIA 5I58A 3RY3A 3SKPA 2O1LA 2B4MA 4YKIA 1FPIA 1NNFA 3Q26A 2VOZA 2DYXA 3QUFA 1BP5A 4O3AA 3Q28A 2I4CA 4P0IA 1OMPA 4I9DA 3FATA 3I5OA 4F29A 3IJOB 3RGYA 2UVJA 2CZHA 4PFTA 3MVWA 4NF6B 3OO8A 3UN6A 5B7DA 1VR5A 1IMFA 5CMCA 3A3CA 1FTJA 1S7YA 3B6WA 1FPFA 2XD2A 4F2OA 1QKAA 4GWOA 1XT8A 4RK9A 1II5A 3O66A 4GOTA 5I2KB 4YMAA 3VLUA 2DSFA 2GQ1A 5KDTA 1NI9A 4PAFA 3U65A 3FZVA 1A8FA 1FPGA 3Q25A 1TT1A 3FJ7A 1NKXA 3DLNA 1URDA 3HFUA 2Y7PA 4GWYA 4G77A 1AOVA 2XXWA 4XKQA 1D4NA 3MW0A 1B5JA 2KQZA 4P1LA 4KPTA 2R71A 3W9VA 4FORA 1A7LA 4U2RA 3T1BA 2ZZVA 4N6PA 3T93B 4LVQA 3FASA 5FHOA 1ZIUA 1KA0A 4U4XA 1ANFA 1A40A 4ELQA 2H99A 4AB5A 1P1WA 2QS4A 3TCGA 1Y3QA 4NX1A 3KSJA 3A3UA 4RY1A 3E3KA 3BBRA 4H8JA 4P3LA 1I6BA 3TFLA 2WEFA 1IXIA 2ZNSA 4FIMA 3TAJA 4X04A 5FTHA 3ZS6A 1IXHA 2D3IA 1M5CA 4PP0A 4NEDA 2F3BA 4DI3D 1TWYA 2VT5A 3B8BA 4MNIA 4C0RA 2X7QA 2XXTA 5H8HA 4DI4B 5EQ9A 1L5TA 4OXVA 1B0HA 2D21A 3PMXA 4IO3A 1H45A 1LAGE 5AA1A 2REJA 5DEXA 2QSXA 3MJNA 1B7UA 3GLBA 3FVKA 3CFLA 4MIJA 1SW4A 5CC2A 1VFEA 2GRVA 1N04A 5KZTA 1MQIA 3A29A 1I6AA 1SYHA 3Q29A 3CIJA 2H25A 2PVUA 2FBPA 3MYUA 2RC7A 4LATA 3C32A 2NXOA 4JXIA 3RT6B 5I56B 3ODBA 1FCKA 1DOTA 3GZGA 3VV5A 4JVDA 2WBDA 1HSJA 2OWTA 3T22A 1MRPA 1D9VA 2I49A 1NUYA 2RC9A 4OWDA 1AIVA 3LUZA 5J16A 4R2BA 1MXYA 1RYXA 4I62A 2E0SA 1ZU0A 1HSEA 1A99A 1MY4A 1IMDA 3M3FA 3RN8A 1TXFA 5FHNA 4G8MA 2F97A 4FECA 1MH4A 3HO7A 3K1PA 2NUVA 1FBCA 3P7IA 1NH8A 3G3GA 3IAZA 3QUJA 2PT1A 3PPNA 1FBPA 4BDMA 3C34A 2DWIA 1YPNA 1ZBMA 2ONSA 2ZYKA 3OMBA 5ET6A 4Z0IA 1WDNA 1B0LA 4IR8A 2DQVA 2LAOA 3V5AA 1MQJA 2Z8FA 4ESWA 4P56A 1M5FA 4OEUA 1T0KA 3D1RA 2Y5KA 4G4PA 1I6QA 1FPKA 4RPOA 1QGXA 2Q74A 2GFEA 2XA5A 3BFUA 2P3VA 4XXUA 2H4IA 3FJGA 1QW0A 1Y9UA 3IB1A 5IZZA 1RKMA 3KGCA 1ATGA 2XWOA 1FQDA 1JP4A 4YKJA 1D3KA 4P0GA 3PPQA 4I40A 4QFLA 1BKAA 1LB9A 2F34A 4EXKA 4G68A 2FVZA 1IZ1A 2XX9A 4RYAA 3AXFA 3FVGA 5JTYB 3R7XA 2Z8DA 1ZMGA 2FIEA 4LZ5A 1B6HA 4JSDA 3I3VA 5DW8A 4GBWA 3G3JA 2CEYA 2Q2AA 4PGPA 4GBVA 5I7IA 4MAGA 2ZZXA 1LBBA 2G29A 3DP6A 2ZMBA 3RYDA 4IGTA 2UVGA 1MXUA 1P1QA 3MPKA 1N84A 3TTLA 1M5BA 2VGQA 3TTMA 3THIA 1MPCA 2Q89A 3CSGA 3RLFE 2DWJA 4IO4A 1USYH 1FBDA 1S50A 4DDDA 3B50A 1WODA 2UYFA 1QUIA 2PT2A 2V4CA 2F6GA 4F3PA 4PFUA 5JEIA 5IAIA 3N94A 4R73A 1FPJA 3H3GA 4TLLB 3LSWA 1NNKA 1LBZA 4MEVA 1D9YA 5K2XA 3CSBA 3KBRA 2ESNA 1FTOA 1FW0A 5L8DA 4PFYA 1Q1KA 3MZ9A 4GX4A 2ZYOA 1Y1MA 2PCRA 3T9VA 4F3SA 3MZBA 5L9OA 4GF8A 4ZE8A 2DWAA 2NWJA 1B5HA 4N8YA 5AA4A 3O6HA 1F9BA 3KFMA 5DT6A 4TLMB 2V3UA 4H6DA 3SEYA 1R9QA 4KQPA 1HSLA 1MQGA 5I84A 2ANJA 3VVDA 2I48A 1A54A 4E0WA 1UIUA 3C36A 5T3JA 2V84A 3BKIB 3TKDA 1UQWA 4NMYA 4EUOA 4F1YA 3ZSFA 1SI0A 2WYKA 5F7VA 2H5YA 2WX9A 3TTNA 1IXCA 4EQ9A 3T9HB 5IZ1A 4QFPA 3OD7A 1PB9A 3H06B 3G3HA 3TTRA 3TQLA 3KN8A 3M8UA 2DOJA 3N6UA 2HFBA 4Q0CA 1N7WA 1JW1A 2PFYA 4H0WA 4JB7A 5EHSA 3O6GA 3ROJA 4H46A 2GHAA 3HHGA 1EH3A 1DSNA 5AA2A 4GFRA 2HQ0A 4YB6A 2B65A 2Y5LA 4R6YA 3T96B 3W15C 5H8NA 2VD3A 1B46A 3UA8A 4NWDA 1MDP1 5I56A 3L6HA 3KZGA 3IO6A 1Y20A 3RPWA 5FHMA 5I3SA 1ELJA 1LGBC 2QVRA 5KDTB 2XXRA 5A5XA 1P1NA 4IB2A 5ITOA 1NV1A 3KC1A 4XIGQ 2VD2A 2A5TA 3K1MA 4MLVA 1FTMA 1Q35A 1AH5A 4PCDA 4NWCA 1NV0A 3CG1A 2OWZA 2A5TB 1LFGA 5H8QB 3IFAA 3JZJA 3BFTA 2IEEA 4KCDA 4LZ8A 3IFCA 1OQGA 3B6QA 4NTLA 2FHYA 4ISUA 2HAUA 2OCUA 4Q8RA 3E13X 3B7DA 3TODA 3U93A 1IXGA 2KR0A 3KG2A 4QSEA 3K6VA 2NVUB 3IB2A 2CEXA 3DP8A 3EQ1A 1BLFA 4F3GA 2I3VA 2IA4A 4K3FA 1IIWA 1UTHB 2ONRA 3M3LA 1DPPA 3N26A 1SW5A 2REGA 1NL5A 1N76A 4ZEKA 1I69A 1TFAA 3OO9A 3KN3A 4H45A 3HPIA 4JVIA 4NF4B 1NUXA 3MVYA 4RPNA 4O3BA 4YZZA 1B3GA 3S9LC 3PUWE 4U1ZA 4OYVA 3PUVE 4WKMA 4N6DA 5ET7A 4WEDA 1B05A 1POTA 2CZKA 2O84X 1R1NA 4DXCA 3VVEA 3S4UA 1B7HA 4L17A 4O7IA 4PDDA 4ZEIA 1YAEA 1XOCA 1Y1ZA 1FJ9A 1EZ9A 2ZZWA 4PE3A 3FXQA 4THIA 2F36A 3NOHA 2PX1A 5EYGA 3VE1B 1LAFE 4NN3A 5DEXB 1FPDA 2ONKE 5CMKA 2F7CA 4RA1A 4MX6A 3VFJA 1FJ6A 4G2ZA 5DTBA 4FBPA 1B2HA 2RCBA 4R2FA 3E9XA 1H44A 3N5LA 4I3YA 4ZDMA 3IJXB 4KD5A 2CMOA 1IMEA 2ABHA 4OFOA 5JTYA 2HXWA 1PDAA 2NOOA 1FTAA 1B7ZA 4BDOA 3RTFB 1MXZA 3KC0A 3A09A 2PFZA 2FIXA 4H1XA 1US5A 4IY6A 4U1OA 3PD8A 3TQWA 5I57A 3SEUA 3T66A 2O51A 1DK4A 3EHUA 1P99A 2XX7A 3EHTA 3MP6A 3FD3A 4GLIA 4X1BA 4R75A 4JSOA 4MBPA 2F7BA 4OVQA 4KI0E 1LBCA 3LV0A 2Z23A 1NV7A 3EHSA 1LAXA 2CZIA 2I4BA 3UORA 3G3FA 4GL0A 1EZPA 2XXYA 3MUQA 4AQ4A 1LLSA 5EYHA 4XF5A 1SD3A 4ELRA 1POY1 5EQAA 3PD9A 5CI5A 4RJZA 4NF4A 4H5GA 3OEMA 2RCAA 3SERA 3C4MA 4QRZA 1LEVA 1QVSA 2YLNA 5I57B 1US4A 3KN7A 1VE4A 3O9PA 3SEWA 5IZ3B 1DBZA 1Y4TA 2XWKA 4JDFA 4PTKA 2RC8A 5AA2B 4DXUA 1B1XA 3QK6A 4G68C 4BDNA 4MNCA 1NNTA 2OBGA 4GWWA 1FTLA 3RPLB 2XXUA 4F2QA 4KFQA 2KLFA 2DP8A 2AIXA 4IY5A 5I59A 2QRYA 3I6VA 2HHMA 2QS1A 2Y7KA 2UVIA 4PAKA 4OENA 2DVCA 3H03A 4JVCA 4LQ5A 2QS2A 3CHGA 1G0IA 4GWSA 2R6GE 5EHMA 4EF1A 1OLAA 1OVTA 5KCJB 2DE2A 3B6TA 1OVBA 4XFEA 3PTYA 2O68A 3S9EA 1NV5A 4G68B 2B3BA 1Y3PA 3S9NC 1O63A 1KA1A 1TFDA 4F18A 4GQOA 4OERA 2H9BA 5F1QA 2DE4A 3UK4A 1YTVA 4KCCA 4LN5A 1FQAA 3K4UA 3UP9A 1XVXA 3IB0A 5ISUA 2QS3A 5DVIA 2BJJX 3PMWA 4JWYA 5K2YA 1AMFA 4HS7A 3H6UA 2O7UA 4GWUA 1G0HA 1MY0A 1LFHA 3OENA 4ECFA 4POWA 1IITA 1DPEA 4OANA 4U21A 2HPGA 3CG3A 5H8SA 4KR5A 4ZEFA 2QVUA 4N13A 2ALUA 5F24A 1NMUA 4ESXA 4NF6A 1PB8A 1NV4A 5H8HB 1URGA 3CVGA 4BLAA 1DCUA 5H8FA 3TELA 2OLBA 4DE8A 2DVZA 4QSCA 4LP2B 4DZ1A 4XKNA 3PPRA 4GIZA 1R9LA 1LAHE 3O28A 1PC3A 4KXPA 5CBRA 4P1EA 1CB6A 1IMAA 1PBQA 3K2DA 1B3FA 2F3DA 3OXNA 1K9YA 1XHYA 4PF8A 2QVVA 1JVYA 1QJMA 1MPBA 3OSQA 4PETA 1MXVA 4HE2A 5CRYA 4OZ9A 1B32A 1P1OA 4YU0A 3PU5A 1B9JA 1LCFA 1A8EA 3HN0A 1JW4A 3K00A 1IMBA 1PBPA 1UIVA 5I2NB 3LUYA 4N81A 4PBHA 4FE8A 2Q8MA 5FTIA 5A5XB 2ZYNA 4QFKA 4OA4A 4FATA 2FA7A 2P0SA 1B3HA 2FNCA 3FGSA 4Q5TA 2AL4A 3JV9A 2MKZA 2UVHA 3H6WA 4OFJA 1QUKA 4KYDA 4ZECA 1LBVA 4O7MA 3TDJA 1SDXA 4M1VA 4H8IA 4FEDA 3VXBA 2ZXTA 3C35A 2THIA 2VP1A 2PBWA 4R6HA 2GHBA 3BIGA 3V8XB 1UTBA 4O3CA 4I3EA 4X8RA 3LSLA 3PPOA 3ILUB 2I0CA 4JBZA 2E1SA 5ET8A 3U94A 1GTKA 2HXRA 4LZ7A 5ET5A 5ELVA 1D9QA 5I59B 4UABA 3ONMA 1UTHA 4DCYA 3E78A 4G8HA 3KJ7A 3O97A 2R9JA 4U4SA 5CMMA 1N3XA 5I5PA 3E4RA 3HV1A 4ZE9A 3S9MC 3MWBA 2X26A 2H98A 1LSTA 1DTZA 4I1DA 3K6XA 5IKBA 2Q9TA 4AS5A 4NF8A 3H6TA 4X48A 1AL3A 3PGFA 1MM6A 3EPEA 5JK4A 2X7PA 3VDFA 1N3WA 1RDZA 3CR9A 2VPOA 3MP8A 2CZLA 4DLDA 4OVPA 3LSXA 1NUZA 4FAJA 3N6TA 2UYEA 5AA3A 5AE4A 4N6KA 4PQJA 4MLQA 4RK2A 2XXVA 4ZEBA 1EYJA 3K1NA 4YB7A 4LA9A 2A5SA 1FBFA 2XD3A 2RINA 3GYYA 4PFRA 3RQTA 2I3WA 3QAXA 1ZJLA 1MXXA 4QXDA 3SETA 1BK4A 4FEBA 1EU8A 4GD5A 4Q30B 1FBEA 2F7AA 2XWVA 3VVFA 5ICQA 1SBPA 3FJMA 3FXUA 3ISPA 1GGGA 4F22A 1FSAA 2I58A 3ZKLA 4C1TA 1ZLQA 4PFWA 3MC2A 1NFTA 1RYOA 3K0VA 1H76A 4ND9A 5B70A 3U72A 1USYE 4AS4A 3OEKA 1GV8A 3MZ1A 1LBYA 1BIYA 2BJIA 1MS7A 2RKMA 3TEPA 4EXLA 3MQ9A 5KCJA 3QYTA 3G7WA 4HCWA 2WYPA 1H3DA 4YAHX 3FVOA 1P1UA 4HTGA 3SEXA 2YJPA 3LR1A 5IM2A 4EF2A 2DE3A 2B3FA 1IEJA 1KZ8A 3PV0E 3FBPA 5HM4B 3ZKKA 5H8FB 3TCFA 3IL1B 5CM6A 1WVJA 2XX8A 1QKBA 1JW5A 3TMGA 3BIHA 1B4HA 4MFIA 3FV2A 3CI8A 1FQEA 1FBGA 2HZLA 5AA2D 5EQ7A 5FBPA 3WAEA 1MG1A 1B1HA 3PUYE 2Q2CA 3WAFA 5J1DA 3H7MA 4KYEA 3TTKA 2QL3A 3QIMA 3OELA 3H4ZA 4U22A 4ZZEA 3DELB 1SVXB 3TUSA 3HCQA 5I58B 4PDHA 3T9XB 2AL5A 3QSLA 3W9WA 3G3IA 2O1MA 4QHQA 4ZZAA 2HAVA 3MVZA 1YXIA 1MY3A 3O2AA 2DXRA 3F11A 2RF1A 5H8QA 1FTKA 2FYIA 1RDXA 4OVSA 5EQ8A 4MMPA 2VPNA 1Z7NE 3K01A 4PF6A 3G3KA 1QUJA 1SQYA 3M3KA 3GBBA 4P8BA 4F19A 2HEUA 3EN3A 2B4LA 4OMBA 4TQUQ 1VDWA 2XXIA 4XKRA 5TP9B 2OJTA 5TPAB 1BTJA 3E79A 4F1UA 4XKPA 1VFDA 4OETA 3RPLA 4EQ7A 3IOUA 4BDQA 3USDA 4GWZA 4GWXA 4H67A 5A5LA 1URSA 1XVYA 2F5XA 5M2VA 3LC8A 4IGRA 3FIRA 2OK2A 3DM0A 2UXAA 1IMCA 3O29A 4YB5A 4R9FA 1MPDA 4PAIA 1JNFA 4N91A 5AA4B 2Y7RA 2XXXA 2OX3A 3FUZA 1NV6A 3LSFB 1MH3A 2P2AA 1FPLA 4PGNA 2Q88A 4UA8A 4LONB 5CMBA 4I8CA 4R74A 5HPQA 1IQ7A 1MQHA 1JEVA 4OEVA 1JVXA 3TYHA 5IGAA 5ESYA 1YYZA 1LBWA 4BDRA 2F78A 1QULA 2Y84A
chains in the Genus database with same CATH topology
2GH9A 2XXQA 1SYIA 2D5WA 3HSTA 1EYIA 4OESA 3R6UA 2WBBA 3T0JA 5HBCA 1XC1A 2L5VA 4NAPA 1SW2A 3L6GA 4YKKA 4OTEA 1B4ZA 3C31A 2ZNTA 5LOMA 4NF5B 1A55A 1B58A 1O64A 3O6IA 3U1OA 2PMSA 4O94A 4XTCQ 3IO4A 1ZKBA 4N07A 2P1SA 4N15A 4OVRA 1IUDA 3EF7A 3EKIA 1EZOA 2P3NA 4NG7A 3IX1A 1PEBA 3FVNA 1JETA 2V93A 4IO7A 2G93A 2PYYA 2XWIA 3UIFA 5BWJA 2V3TA 3T9UA 4GXAA 4PBQA 4R72A 5DVFA 4RXLA 3K02A 2QMWA 4N17A 3RUMA 3S2VA 3MBPA 2DS9A 3QMFA 3IK6B 4H5FA 4HW8A 2XXKA 3MPLA 1J1NA 4FJPA 3C9HA 1MM7A 1PB7A 5L9MA 1INPA 4PC9A 1LCTA 3SESA 5H8NB 4PE5B 2Q8JA 1OIBA 3KOSA 3IR1A 4C1UA 4DXBA 4YMBA 5I2NA 4WEPA 1FQFA 4PFBA 2ZNUA 3U8QA 2W7YA 4N8GA 2HCAA 2F6PA 1DTGA 4P47A 3VXCA 3VLWA 2QFLA 1KWHA 4YICA 2XHDA 2ZYMA 5TU0A 4E0XA 4MH5A 4ELOA 1XS5A 3RNNA 4EQBA 4JWOA 2DXYA 1MXWA 3LBSA 4OHNA 3PUZE 3TPAA 3OO7A 4RNSA 5LDZA 4NF0A 5LTCA 4GXSB 2XXPA 4UACA 1Y4CA 4F1VA 5IZ3A 3K6WA 1Z7ME 4GRKA 4R6KA 4F31B 2Z22A 4H65A 3MAMA 4GX3A 4NGUA 4OQOA 1S9TA 3QXMA 5DYHA 1NH7A 3PUXE 3TZAA 3MSTA 2OZZA 3FXRA 1FRPA 3RTWB 1NUWA 1VSOA 1B5IA 5L9SA 1AWBA 3FXBA 4HCYA 1Q9DA 1M5DA 4QBAA 3UGWA 3KJTA 3KEIA 3SEVA 1YCJA 3PPPA 2O7IA 2VHAA 3JYRA 3D4GA 5DVJA 1FPEA 4ZEDA 1Y3NA 4MCOA 4NF8B 1B3EA 4LUBA 4HE0A 2I0BA 3CFZA 1SW1A 4POXA 1NV3A 1OQHA 1SI1A 4EDPA 1M5EA 3FV1A 4WXJA 2DDKA 1NNPA 1YZ0A 3IOVA 5TPAA 5TP9A 4GX6A 1OLCA 3IORA 4R9GA 1LB8A 4GVOA 4QFOA 1CE2A 2I6EA 3SZPA 1N0TA 3K6UA 3CRBA 4HXVA 3U92A 3IOWA 5BUUA 1GVCA 4NHBA 2R8TA 3OO6A 3KOTA 4P11A 1R6ZA 1DMBA 2DWHA 1RDYA 1LFIA 1XI6A 4JWXA 4DIGA 4OVJA 4MHFA 2M8CA 3KSXA 4N4UA 1MY2A 1FPBA 2V3QA 4KHZE 4G8NA 4P9KA 3OOAA 4X1DA 4ONYA 4MF3A 4YKPA 1MQDA 4O8MA 2V25A 4TOZA 5CBSA 4NE4A 1GR2A 3MVXA 1H43A 4MJOA 1FQCA 1MDQA 4IO2A 4NQ8A 4X9TA 4F39A 3TCHA 4BDLA 1FQBA 5EYFA 2O69A 3H6VA 3D4CA 4LQ2A 4HE1A 4QSDA 4AB6A 2F8DA 4KYSA 1B51A 2QPQA 4MNPA 3C33A 1ZTYA 3KBZA 2Y7WA 1CNQA 3DP4A 4IO5A 3ECRA 4NF5A 2QJEA 4U23A 1MY1A 4F3BA 2AYSA 4OFLA 1JEUA 1B40A 1FBHA 3CFXA 3R26A 4IO6A 3OSRA 2Z8EA 4DCXA 1JQFA 5ICTA 1EYKA 2YPNA 1NV2A 2O6AA 4ELPA 3PMVA 4G61A 2QMXA 2OWSA 3GXAA 3GBAA 4XEQA 4ZS9A 1LBXA 3VLVA 3IOTA 4M4GA 1SPIA 4GL8A 3RT8A 1B52A 3Q27A 3V83A 4Z7EA 4QF9A 1O7TA 1K9ZA 4OVTA 1UTBB 5ITPA 1N7XA 2Y7IA 2HZKA 4QFNA 3HHFA 3SDFA 3MP1A 2F35A 3ILTB 1B3LA 2XXHA 2JJKA 3V89B 2WKYA 5I2KA 5I58A 4PFIA 3RY3A 3SKPA 2O1LA 2B4MA 4YKIA 1FPIA 1NNFA 3Q26A 2VOZA 2DYXA 3QUFA 1BP5A 4O3AA 3Q28A 2I4CA 4P0IA 1OMPA 4I9DA 3FATA 3I5OA 4F29A 3IJOB 2UVJA 2CZHA 3RGYA 4PFTA 3MVWA 4NF6B 3OO8A 3UN6A 5B7DA 1VR5A 1IMFA 5CMCA 3A3CA 1FTJA 1S7YA 3B6WA 1FPFA 2XD2A 4F2OA 1QKAA 4GWOA 1XT8A 4RK9A 1II5A 3O66A 4GOTA 5I2KB 4YMAA 3VLUA 2DSFA 2GQ1A 5KDTA 1NI9A 4PAFA 3U65A 3FZVA 1A8FA 3Q25A 1FPGA 1TT1A 3FJ7A 1NKXA 3DLNA 1URDA 3HFUA 2Y7PA 4GWYA 4G77A 1AOVA 2XXWA 4XKQA 1D4NA 3MW0A 1B5JA 2KQZA 4P1LA 4KPTA 2R71A 3W9VA 4FORA 1A7LA 4U2RA 3T1BA 2ZZVA 4N6PA 3T93B 4LVQA 3FASA 5FHOA 1ZIUA 1KA0A 4U4XA 1ANFA 1A40A 4ELQA 2H99A 4AB5A 1P1WA 2QS4A 3TCGA 1Y3QA 4NX1A 3KSJA 3A3UA 4RY1A 3E3KA 3BBRA 4H8JA 4P3LA 1I6BA 3TFLA 2WEFA 1IXIA 2ZNSA 4FIMA 3TAJA 5FTHA 4X04A 3ZS6A 1IXHA 2D3IA 1M5CA 4PP0A 4NEDA 2F3BA 4DI3D 1TWYA 2VT5A 3B8BA 4MNIA 4C0RA 2X7QA 2XXTA 5H8HA 4DI4B 5EQ9A 1L5TA 4OXVA 1B0HA 2D21A 3PMXA 4IO3A 1H45A 1LAGE 5AA1A 2REJA 5DEXA 2QSXA 3MJNA 1B7UA 3GLBA 3FVKA 3CFLA 5CC2A 1SW4A 4MIJA 1VFEA 2GRVA 1N04A 5KZTA 1MQIA 3A29A 1I6AA 1SYHA 3Q29A 3CIJA 2H25A 2PVUA 2FBPA 3MYUA 2RC7A 4LATA 3C32A 2NXOA 4JXIA 3RT6B 5I56B 3ODBA 1FCKA 1DOTA 3GZGA 3VV5A 4JVDA 2WBDA 1HSJA 2OWTA 3T22A 1MRPA 1D9VA 2I49A 2RC9A 4OWDA 1NUYA 1AIVA 3LUZA 5J16A 4R2BA 1MXYA 1RYXA 4I62A 2E0SA 1ZU0A 1HSEA 1A99A 1MY4A 1IMDA 3M3FA 3RN8A 1TXFA 5FHNA 4G8MA 2F97A 4FECA 1MH4A 3HO7A 3K1PA 2NUVA 1FBCA 3P7IA 1NH8A 3G3GA 3IAZA 3QUJA 2PT1A 3PPNA 1FBPA 4BDMA 3C34A 2DWIA 1YPNA 1ZBMA 2ONSA 2ZYKA 3OMBA 5ET6A 4Z0IA 1WDNA 1B0LA 4IR8A 2DQVA 2LAOA 3V5AA 1MQJA 2Z8FA 4ESWA 4P56A 1M5FA 4OEUA 1T0KA 3D1RA 2Y5KA 4G4PA 1I6QA 1FPKA 4RPOA 1QGXA 2Q74A 2GFEA 2XA5A 3BFUA 2P3VA 4XXUA 2H4IA 3FJGA 1QW0A 1Y9UA 3IB1A 5IZZA 1RKMA 3KGCA 1ATGA 2XWOA 1FQDA 1JP4A 4YKJA 1D3KA 4P0GA 3PPQA 4I40A 4QFLA 1BKAA 1LB9A 2F34A 4EXKA 4G68A 2FVZA 1IZ1A 2XX9A 4RYAA 3AXFA 3FVGA 5JTYB 3R7XA 2Z8DA 1ZMGA 4LZ5A 2FIEA 1B6HA 4JSDA 3I3VA 5DW8A 4GBWA 3G3JA 2CEYA 2Q2AA 4PGPA 4GBVA 5I7IA 4MAGA 2ZZXA 1LBBA 2G29A 3DP6A 2ZMBA 3RYDA 4IGTA 2UVGA 1MXUA 1P1QA 3MPKA 1N84A 3TTLA 1M5BA 2VGQA 3TTMA 3THIA 1MPCA 2Q89A 3CSGA 3RLFE 2DWJA 4IO4A 1USYH 1FBDA 1S50A 4DDDA 3B50A 1WODA 2UYFA 1QUIA 2PT2A 2V4CA 2F6GA 4F3PA 4PFUA 5JEIA 5IAIA 3N94A 4R73A 3H3GA 1FPJA 4TLLB 3LSWA 1NNKA 1LBZA 4MEVA 1D9YA 5K2XA 3CSBA 3KBRA 2ESNA 1FTOA 1FW0A 5L8DA 4PFYA 1Q1KA 3MZ9A 4GX4A 2ZYOA 1Y1MA 2PCRA 3T9VA 4F3SA 3MZBA 5L9OA 4GF8A 4ZE8A 2DWAA 2NWJA 1B5HA 4N8YA 5AA4A 3O6HA 1F9BA 3KFMA 3SEYA 5DT6A 2V3UA 4H6DA 4TLMB 1R9QA 4KQPA 1HSLA 1MQGA 5I84A 2ANJA 3VVDA 2I48A 1A54A 4E0WA 1UIUA 3C36A 5T3JA 2V84A 3BKIB 3TKDA 1UQWA 4NMYA 4EUOA 4F1YA 3ZSFA 1SI0A 2WYKA 5F7VA 2H5YA 2WX9A 3TTNA 1IXCA 4EQ9A 3T9HB 5IZ1A 4QFPA 3OD7A 1PB9A 3H06B 3G3HA 3TTRA 3TQLA 3KN8A 3M8UA 2DOJA 3N6UA 2HFBA 4Q0CA 1N7WA 1JW1A 2PFYA 4H0WA 4JB7A 5EHSA 3O6GA 3ROJA 4H46A 2GHAA 3HHGA 1EH3A 1DSNA 5AA2A 4GFRA 2HQ0A 4YB6A 2B65A 2Y5LA 4R6YA 3T96B 3W15C 5H8NA 2VD3A 1B46A 3UA8A 4NWDA 1MDP1 5I56A 3L6HA 3KZGA 3IO6A 1Y20A 3RPWA 5FHMA 5I3SA 1ELJA 1LGBC 5KDTB 2QVRA 2XXRA 5A5XA 1P1NA 4IB2A 5ITOA 1NV1A 3KC1A 4XIGQ 2VD2A 2A5TA 3K1MA 4MLVA 1FTMA 1Q35A 1AH5A 4PCDA 4NWCA 1NV0A 3CG1A 2OWZA 2A5TB 1LFGA 5H8QB 3IFAA 3JZJA 3BFTA 2IEEA 4KCDA 4LZ8A 3IFCA 1OQGA 3B6QA 4NTLA 2FHYA 4ISUA 2HAUA 2OCUA 4Q8RA 3E13X 3B7DA 3TODA 3U93A 1IXGA 3KG2A 4QSEA 2KR0A 3K6VA 2NVUB 3IB2A 2CEXA 3DP8A 3EQ1A 1BLFA 4F3GA 2I3VA 2IA4A 4K3FA 1IIWA 1UTHB 2ONRA 3M3LA 1DPPA 3N26A 1SW5A 2REGA 1NL5A 1N76A 4ZEKA 1I69A 1TFAA 3OO9A 3KN3A 4H45A 3HPIA 4JVIA 4NF4B 3MVYA 1NUXA 4RPNA 4O3BA 4YZZA 1B3GA 3S9LC 3PUWE 4U1ZA 4OYVA 3PUVE 4WKMA 4N6DA 5ET7A 4WEDA 1B05A 1POTA 2CZKA 2O84X 1R1NA 4DXCA 3VVEA 3S4UA 1B7HA 4L17A 4O7IA 4PDDA 4ZEIA 1YAEA 1XOCA 1Y1ZA 1FJ9A 1EZ9A 2ZZWA 4PE3A 3FXQA 4THIA 2F36A 3NOHA 2PX1A 5EYGA 3VE1B 1LAFE 4NN3A 5DEXB 1FPDA 2ONKE 5CMKA 2F7CA 4RA1A 4MX6A 3VFJA 1FJ6A 4G2ZA 5DTBA 4FBPA 1B2HA 2RCBA 4R2FA 3E9XA 1H44A 3N5LA 4I3YA 4ZDMA 3IJXB 4KD5A 2CMOA 1IMEA 2ABHA 4OFOA 5JTYA 2HXWA 1PDAA 2NOOA 1FTAA 1B7ZA 4BDOA 3RTFB 1MXZA 3KC0A 3A09A 2PFZA 2FIXA 4H1XA 1US5A 4IY6A 4U1OA 3PD8A 3TQWA 5I57A 3SEUA 3T66A 2O51A 1DK4A 3EHUA 1P99A 2XX7A 3EHTA 3MP6A 3FD3A 4GLIA 4X1BA 4R75A 4JSOA 4MBPA 2F7BA 4OVQA 4KI0E 1LBCA 3LV0A 2Z23A 1NV7A 3EHSA 1LAXA 2CZIA 2I4BA 3UORA 3G3FA 4GL0A 1EZPA 2XXYA 3MUQA 4AQ4A 1LLSA 5EYHA 4XF5A 1SD3A 4ELRA 1POY1 5EQAA 3PD9A 5CI5A 4RJZA 4NF4A 4H5GA 3OEMA 2RCAA 3SERA 3C4MA 4QRZA 1LEVA 1QVSA 2YLNA 5I57B 1US4A 3KN7A 1VE4A 3O9PA 3SEWA 5IZ3B 1DBZA 1Y4TA 2XWKA 4JDFA 4PTKA 2RC8A 5AA2B 4DXUA 1B1XA 3QK6A 4G68C 4BDNA 4MNCA 1NNTA 2OBGA 4GWWA 1FTLA 3RPLB 2XXUA 4F2QA 4KFQA 2KLFA 2DP8A 2AIXA 4IY5A 5I59A 2QRYA 3I6VA 2HHMA 2QS1A 2Y7KA 2UVIA 4PAKA 4OENA 2DVCA 3H03A 4JVCA 4LQ5A 2QS2A 3CHGA 1G0IA 4GWSA 2R6GE 5EHMA 4EF1A 1OLAA 1OVTA 5KCJB 2DE2A 3B6TA 1OVBA 4XFEA 3PTYA 2O68A 3S9EA 1NV5A 4G68B 2B3BA 1Y3PA 3S9NC 1O63A 1TFDA 4F18A 1KA1A 4GQOA 4OERA 2H9BA 5F1QA 2DE4A 3UK4A 1YTVA 4KCCA 4LN5A 1FQAA 3K4UA 3UP9A 1XVXA 3IB0A 5ISUA 2QS3A 5DVIA 2BJJX 3PMWA 4JWYA 5K2YA 1AMFA 4HS7A 3H6UA 2O7UA 4GWUA 1MY0A 1G0HA 1LFHA 3OENA 4ECFA 4POWA 1IITA 1DPEA 4OANA 4U21A 2HPGA 3CG3A 5H8SA 4KR5A 4ZEFA 2QVUA 4N13A 2ALUA 5F24A 1NMUA 4ESXA 4NF6A 1PB8A 1NV4A 5H8HB 1URGA 3CVGA 4BLAA 1DCUA 5H8FA 3TELA 2OLBA 4DE8A 2DVZA 4QSCA 4LP2B 4DZ1A 4XKNA 3PPRA 4GIZA 1R9LA 1LAHE 3O28A 1PC3A 4KXPA 5CBRA 1CB6A 4P1EA 1IMAA 1PBQA 3K2DA 1B3FA 2F3DA 3OXNA 1K9YA 1XHYA 4PF8A 2QVVA 1JVYA 1QJMA 1MPBA 3OSQA 4PETA 1MXVA 4HE2A 5CRYA 4OZ9A 1B32A 1P1OA 4YU0A 3PU5A 1B9JA 1LCFA 1A8EA 3HN0A 1JW4A 3K00A 1IMBA 1PBPA 1UIVA 5I2NB 3LUYA 4N81A 4PBHA 4FE8A 2Q8MA 5FTIA 5A5XB 2ZYNA 4QFKA 4OA4A 4FATA 2FA7A 2P0SA 1B3HA 2FNCA 3FGSA 4Q5TA 2AL4A 3JV9A 2MKZA 2UVHA 3H6WA 4OFJA 1QUKA 4KYDA 4ZECA 1LBVA 4O7MA 3TDJA 1SDXA 4M1VA 4H8IA 4FEDA 3VXBA 2ZXTA 3C35A 2THIA 2VP1A 2PBWA 4R6HA 2GHBA 3BIGA 3V8XB 1UTBA 4O3CA 4I3EA 4X8RA 3LSLA 3PPOA 3ILUB 2I0CA 4JBZA 2E1SA 3U94A 5ET8A 1GTKA 4LZ7A 2HXRA 5ET5A 5ELVA 1D9QA 5I59B 4UABA 3ONMA 1UTHA 4DCYA 3E78A 4G8HA 3KJ7A 3O97A 2R9JA 4U4SA 5CMMA 1N3XA 5I5PA 3E4RA 3HV1A 4ZE9A 3S9MC 3MWBA 2X26A 2H98A 1LSTA 1DTZA 4I1DA 3K6XA 5IKBA 2Q9TA 4AS5A 4NF8A 3H6TA 4X48A 1AL3A 3PGFA 1MM6A 3EPEA 5JK4A 2X7PA 3VDFA 1N3WA 1RDZA 3CR9A 2VPOA 3MP8A 2CZLA 4DLDA 4OVPA 3LSXA 1NUZA 4FAJA 3N6TA 2UYEA 5AA3A 5AE4A 4N6KA 4PQJA 4MLQA 4RK2A 2XXVA 4ZEBA 1EYJA 3K1NA 4YB7A 4LA9A 2A5SA 1FBFA 2XD3A 2RINA 3GYYA 4PFRA 3RQTA 2I3WA 3QAXA 1ZJLA 1MXXA 4QXDA 3SETA 4FEBA 1BK4A 1EU8A 4GD5A 4Q30B 1FBEA 2F7AA 2XWVA 3VVFA 5ICQA 1SBPA 3FJMA 3FXUA 3ISPA 1GGGA 4F22A 1FSAA 2I58A 3ZKLA 4C1TA 1ZLQA 4PFWA 3MC2A 1NFTA 1RYOA 3K0VA 1H76A 4ND9A 5B70A 3U72A 1USYE 4AS4A 3OEKA 1GV8A 3MZ1A 1LBYA 1BIYA 2BJIA 1MS7A 2RKMA 3TEPA 4EXLA 3MQ9A 5KCJA 3QYTA 3G7WA 4HCWA 2WYPA 1H3DA 4YAHX 3FVOA 1P1UA 4HTGA 3SEXA 2YJPA 3LR1A 5IM2A 4EF2A 2DE3A 2B3FA 1IEJA 3PV0E 5HM4B 1KZ8A 3FBPA 3ZKKA 5H8FB 3TCFA 3IL1B 5CM6A 1WVJA 2XX8A 1QKBA 1JW5A 3TMGA 3BIHA 1B4HA 4MFIA 3FV2A 3CI8A 1FQEA 1FBGA 2HZLA 5AA2D 5EQ7A 5FBPA 3WAEA 1MG1A 1B1HA 3PUYE 2Q2CA 3WAFA 5J1DA 3H7MA 4KYEA 3TTKA 2QL3A 3QIMA 3OELA 3H4ZA 4U22A 4ZZEA 3DELB 1SVXB 3TUSA 3HCQA 5I58B 4PDHA 3T9XB 2AL5A 3QSLA 3W9WA 3G3IA 2O1MA 4QHQA 4ZZAA 2HAVA 3MVZA 1YXIA 1MY3A 3O2AA 2DXRA 3F11A 2RF1A 5H8QA 1FTKA 2FYIA 1RDXA 4OVSA 5EQ8A 4MMPA 2VPNA 1Z7NE 3K01A 4PF6A 3G3KA 1QUJA 1SQYA 3M3KA 3GBBA 4P8BA 4F19A 2HEUA 3EN3A 2B4LA 4OMBA 4TQUQ 1VDWA 2XXIA 4XKRA 5TP9B 2OJTA 5TPAB 1BTJA 3E79A 4F1UA 4XKPA 1VFDA 4OETA 3RPLA 4EQ7A 3IOUA 4BDQA 3USDA 4GWZA 4GWXA 4H67A 5A5LA 1URSA 1XVYA 2F5XA 5M2VA 3LC8A 4IGRA 3FIRA 2OK2A 3DM0A 2UXAA 1IMCA 3O29A 4YB5A 4R9FA 1MPDA 4PAIA 1JNFA 4N91A 5AA4B 2Y7RA 2XXXA 2OX3A 3FUZA 1NV6A 3LSFB 1MH3A 2P2AA 1FPLA 4PGNA 2Q88A 4UA8A 4LONB 5CMBA 4I8CA 4R74A 5HPQA 1IQ7A 1MQHA 1JEVA 4OEVA 1JVXA 3TYHA 5IGAA 5ESYA 1YYZA 1LBWA 4BDRA 2F78A 1QULA 2Y84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GH9 A;  2XXQ A;  1SYI A;  2D5W A;  3HST A;  4OES A;  3R6U A;  5HBC A;  1XC1 A;  4NAP A;  1SW2 A;  3L6G A;  4YKK A;  4OTE A;  1B4Z A;  3C31 A;  2ZNT A;  5LOM A;  4NF5 B;  1A55 A;  1B58 A;  1O64 A;  3O6I A;  3U1O A;  2PMS A;  4O94 A;  4XTC Q;  3IO4 A;  1ZKB A;  4N07 A;  2P1S A;  4N15 A;  4OVR A;  1IUD A;  3EF7 A;  1EZO A;  4NG7 A;  3IX1 A;  1PEB A;  3FVN A;  1JET A;  2V93 A;  4IO7 A;  2G93 A;  2PYY A;  2XWI A;  3UIF A;  5BWJ A;  2V3T A;  3T9U A;  4GXA A;  4PBQ A;  4R72 A;  5DVF A;  4RXL A;  3K02 A;  2QMW A;  4N17 A;  3RUM A;  3S2V A;  3MBP A;  2DS9 A;  3IK6 B;  4H5F A;  4HW8 A;  2XXK A;  3MPL A;  1J1N A;  4FJP A;  3C9H A;  1MM7 A;  1PB7 A;  5L9M A;  4PC9 A;  1LCT A;  3SES A;  5H8N B;  4PE5 B;  2Q8J A;  1OIB A;  3KOS A;  3IR1 A;  4C1U A;  4DXB A;  4YMB A;  5I2N A;  4WEP A;  1FQF A;  4PFB A;  2ZNU A;  3U8Q A;  2W7Y A;  4N8G A;  2HCA A;  2F6P A;  1DTG A;  4P47 A;  3VXC A;  3VLW A;  1KWH A;  4YIC A;  2XHD A;  2ZYM A;  5TU0 A;  4E0X A;  4MH5 A;  4ELO A;  1XS5 A;  3RNN A;  4EQB A;  4JWO A;  2DXY A;  1MXW A;  3LBS A;  4OHN A;  3PUZ E;  3TPA A;  3OO7 A;  4RNS A;  4NF0 A;  5LTC A;  4GXS B;  2XXP A;  4UAC A;  1Y4C A;  4F1V A;  3K6W A;  1Z7M E;  4GRK A;  4R6K A;  4F31 B;  2Z22 A;  4H65 A;  3MAM A;  4NGU A;  4OQO A;  1S9T A;  3QXM A;  5DYH A;  1NH7 A;  3PUX E;  3TZA A;  2OZZ A;  3FXR A;  3RTW B;  1VSO A;  1B5I A;  5L9S A;  3FXB A;  4HCY A;  1M5D A;  3UGW A;  3KJT A;  3KEI A;  3SEV A;  1YCJ A;  3PPP A;  2O7I A;  2VHA A;  3JYR A;  3D4G A;  5DVJ A;  4ZED A;  1Y3N A;  4MCO A;  4NF8 B;  1B3E A;  4LUB A;  2I0B A;  3CFZ A;  1SW1 A;  4POX A;  1OQH A;  1SI1 A;  4EDP A;  1M5E A;  3FV1 A;  4WXJ A;  1NNP A;  3IOV A;  5TPA A;  5TP9 A;  1OLC A;  3IOR A;  4R9G A;  1LB8 A;  4GVO A;  4QFO A;  1CE2 A;  2I6E A;  1N0T A;  3K6U A;  3CRB A;  3U92 A;  3IOW A;  5BUU A;  1GVC A;  4NHB A;  3OO6 A;  3KOT A;  4P11 A;  1R6Z A;  1DMB A;  2DWH A;  1LFI A;  4JWX A;  4DIG A;  4OVJ A;  4MHF A;  2M8C A;  3KSX A;  4N4U A;  1MY2 A;  2V3Q A;  4KHZ E;  4G8N A;  4P9K A;  3OOA A;  4X1D A;  4ONY A;  4MF3 A;  4YKP A;  1MQD A;  4O8M A;  2V25 A;  4TOZ A;  5CBS A;  4NE4 A;  1GR2 A;  3MVX A;  1H43 A;  1FQC A;  1MDQ A;  4IO2 A;  4NQ8 A;  4X9T A;  4F39 A;  3TCH A;  4BDL A;  1FQB A;  5EYF A;  2O69 A;  3H6V A;  3D4C A;  4LQ2 A;  4QSD A;  4AB6 A;  2F8D A;  4KYS A;  1B51 A;  2QPQ A;  4MNP A;  3C33 A;  1ZTY A;  2Y7W A;  3DP4 A;  4IO5 A;  3ECR A;  4NF5 A;  2QJE A;  4U23 A;  1MY1 A;  4F3B A;  2AYS A;  4OFL A;  1JEU A;  1B40 A;  3CFX A;  3R26 A;  4IO6 A;  3OSR A;  2Z8E A;  4DCX A;  1JQF A;  5ICT A;  2YPN A;  2O6A A;  4ELP A;  3PMV A;  2QMX A;  2OWS A;  3GXA A;  3GBA A;  4XEQ A;  4ZS9 A;  3VLV A;  3IOT A;  4M4G A;  4GL8 A;  3RT8 A;  1B52 A;  3Q27 A;  3V83 A;  4Z7E A;  4QF9 A;  1O7T A;  4OVT A;  1UTB B;  5ITP A;  1N7X A;  2Y7I A;  2HZK A;  4QFN A;  3HHF A;  3SDF A;  3MP1 A;  2F35 A;  3ILT B;  1B3L A;  2XXH A;  3V89 B;  2WKY A;  5I2K A;  5I58 A;  4PFI A;  3RY3 A;  3SKP A;  2O1L A;  4YKI A;  1NNF A;  3Q26 A;  2VOZ A;  2DYX A;  3QUF A;  1BP5 A;  4O3A A;  3Q28 A;  2I4C A;  4P0I A;  1OMP A;  4I9D A;  3FAT A;  3I5O A;  4F29 A;  3IJO B;  2UVJ A;  3RGY A;  4PFT A;  3MVW A;  4NF6 B;  3OO8 A;  3UN6 A;  5B7D A;  1VR5 A;  5CMC A;  3A3C A;  1FTJ A;  1S7Y A;  3B6W A;  2XD2 A;  4F2O A;  1QKA A;  4GWO A;  1XT8 A;  4RK9 A;  1II5 A;  3O66 A;  4GOT A;  5I2K B;  4YMA A;  3VLU A;  2DSF A;  5KDT A;  4PAF A;  3U65 A;  3FZV A;  1A8F A;  3Q25 A;  1TT1 A;  3FJ7 A;  1NKX A;  3DLN A;  1URD A;  2Y7P A;  4G77 A;  1AOV A;  2XXW A;  4XKQ A;  1D4N A;  3MW0 A;  1B5J A;  4P1L A;  4KPT A;  2R71 A;  3W9V A;  4FOR A;  1A7L A;  4U2R A;  2ZZV A;  4N6P A;  3T93 B;  4LVQ A;  3FAS A;  5FHO A;  1ZIU A;  4U4X A;  1ANF A;  1A40 A;  4ELQ A;  2H99 A;  4AB5 A;  1P1W A;  2QS4 A;  3TCG A;  1Y3Q A;  4NX1 A;  3KSJ A;  3A3U A;  4RY1 A;  3E3K A;  3BBR A;  4H8J A;  4P3L A;  1I6B A;  3TFL A;  1IXI A;  2ZNS A;  4FIM A;  3TAJ A;  5FTH A;  4X04 A;  3ZS6 A;  1IXH A;  2D3I A;  1M5C A;  4PP0 A;  4NED A;  4DI3 D;  1TWY A;  4MNI A;  4C0R A;  2X7Q A;  2XXT A;  5H8H A;  4DI4 B;  1L5T A;  4OXV A;  1B0H A;  2D21 A;  3PMX A;  4IO3 A;  1H45 A;  1LAG E;  5AA1 A;  2REJ A;  5DEX A;  2QSX A;  3MJN A;  1B7U A;  3GLB A;  3FVK A;  3CFL A;  5CC2 A;  1SW4 A;  4MIJ A;  1VFE A;  2GRV A;  1N04 A;  5KZT A;  1MQI A;  1I6A A;  1SYH A;  3Q29 A;  3CIJ A;  2H25 A;  2PVU A;  2RC7 A;  4LAT A;  3C32 A;  2NXO A;  4JXI A;  3RT6 B;  5I56 B;  3ODB A;  1FCK A;  1DOT A;  3GZG A;  3VV5 A;  1HSJ A;  2OWT A;  3T22 A;  1MRP A;  1D9V A;  2I49 A;  2RC9 A;  4OWD A;  1AIV A;  4R2B A;  1MXY A;  1RYX A;  4I62 A;  2E0S A;  1ZU0 A;  1HSE A;  1A99 A;  1MY4 A;  3M3F A;  3RN8 A;  1TXF A;  5FHN A;  4G8M A;  2F97 A;  4FEC A;  1MH4 A;  3HO7 A;  3K1P A;  2NUV A;  3P7I A;  1NH8 A;  3G3G A;  3IAZ A;  3QUJ A;  2PT1 A;  3PPN A;  4BDM A;  3C34 A;  2DWI A;  1YPN A;  1ZBM A;  2ONS A;  2ZYK A;  3OMB A;  4Z0I A;  1WDN A;  1B0L A;  2DQV A;  2LAO A;  3V5A A;  1MQJ A;  2Z8F A;  4ESW A;  4P56 A;  1M5F A;  4OEU A;  1T0K A;  4G4P A;  1I6Q A;  4RPO A;  2GFE A;  2XA5 A;  3BFU A;  4XXU A;  2H4I A;  3FJG A;  1QW0 A;  1Y9U A;  3IB1 A;  5IZZ A;  1RKM A;  3KGC A;  1ATG A;  2XWO A;  1FQD A;  4YKJ A;  1D3K A;  4P0G A;  3PPQ A;  4QFL A;  1BKA A;  1LB9 A;  2F34 A;  4EXK A;  4G68 A;  1IZ1 A;  2XX9 A;  4RYA A;  3AXF A;  3FVG A;  5JTY B;  3R7X A;  2Z8D A;  1ZMG A;  4LZ5 A;  1B6H A;  4JSD A;  3I3V A;  3G3J A;  2CEY A;  2Q2A A;  4PGP A;  5I7I A;  4MAG A;  2ZZX A;  1LBB A;  2G29 A;  3DP6 A;  2ZMB A;  4IGT A;  2UVG A;  1MXU A;  1P1Q A;  3MPK A;  1N84 A;  3TTL A;  1M5B A;  2VGQ A;  3TTM A;  3THI A;  1MPC A;  2Q89 A;  3CSG A;  3RLF E;  2DWJ A;  4IO4 A;  1USY H;  1S50 A;  4DDD A;  3B50 A;  1WOD A;  2UYF A;  1QUI A;  2PT2 A;  2V4C A;  2F6G A;  4F3P A;  4PFU A;  5JEI A;  5IAI A;  3N94 A;  4R73 A;  3H3G A;  4TLL B;  3LSW A;  1NNK A;  4MEV A;  1D9Y A;  5K2X A;  3CSB A;  3KBR A;  2ESN A;  1FTO A;  1FW0 A;  5L8D A;  4PFY A;  1Q1K A;  3MZ9 A;  2ZYO A;  1Y1M A;  3T9V A;  4F3S A;  3MZB A;  5L9O A;  4GF8 A;  4ZE8 A;  2DWA A;  2NWJ A;  1B5H A;  4N8Y A;  5AA4 A;  3O6H A;  1F9B A;  3KFM A;  3SEY A;  5DT6 A;  2V3U A;  4H6D A;  4TLM B;  1R9Q A;  4KQP A;  1HSL A;  1MQG A;  5I84 A;  2ANJ A;  3VVD A;  2I48 A;  1A54 A;  4E0W A;  1UIU A;  3C36 A;  2V84 A;  3BKI B;  3TKD A;  1UQW A;  4NMY A;  4EUO A;  4F1Y A;  3ZSF A;  1SI0 A;  2WYK A;  5F7V A;  2H5Y A;  2WX9 A;  3TTN A;  1IXC A;  4EQ9 A;  3T9H B;  4QFP A;  3OD7 A;  1PB9 A;  3H06 B;  3G3H A;  3TTR A;  3TQL A;  3KN8 A;  3M8U A;  2DOJ A;  3N6U A;  2HFB A;  4Q0C A;  1N7W A;  1JW1 A;  2PFY A;  4H0W A;  4JB7 A;  5EHS A;  3O6G A;  2GHA A;  3HHG A;  1EH3 A;  1DSN A;  5AA2 A;  4GFR A;  2HQ0 A;  4YB6 A;  2B65 A;  4R6Y A;  3T96 B;  3W15 C;  5H8N A;  2VD3 A;  1B46 A;  3UA8 A;  4NWD A;  1MDP 1;  5I56 A;  3L6H A;  3KZG A;  3IO6 A;  1Y20 A;  3RPW A;  5FHM A;  1ELJ A;  1LGB C;  5KDT B;  2XXR A;  5A5X A;  1P1N A;  4IB2 A;  5ITO A;  4XIG Q;  2VD2 A;  2A5T A;  3K1M A;  4MLV A;  1FTM A;  1Q35 A;  1AH5 A;  4PCD A;  4NWC A;  3CG1 A;  2A5T B;  1LFG A;  5H8Q B;  3JZJ A;  3BFT A;  2IEE A;  4KCD A;  4LZ8 A;  1OQG A;  3B6Q A;  4NTL A;  4ISU A;  2HAU A;  2OCU A;  4Q8R A;  3E13 X;  3B7D A;  3TOD A;  3U93 A;  1IXG A;  3KG2 A;  4QSE A;  3K6V A;  2NVU B;  3IB2 A;  2CEX A;  3DP8 A;  3EQ1 A;  1BLF A;  4F3G A;  2I3V A;  2IA4 A;  4K3F A;  1IIW A;  1UTH B;  2ONR A;  3M3L A;  1DPP A;  3N26 A;  1SW5 A;  2REG A;  1NL5 A;  1N76 A;  4ZEK A;  1I69 A;  1TFA A;  3OO9 A;  3KN3 A;  3HPI A;  4NF4 B;  3MVY A;  4RPN A;  4O3B A;  4YZZ A;  1B3G A;  3S9L C;  3PUW E;  4U1Z A;  4OYV A;  3PUV E;  4WKM A;  4N6D A;  4WED A;  1B05 A;  1POT A;  2O84 X;  1R1N A;  4DXC A;  3VVE A;  3S4U A;  1B7H A;  4L17 A;  4PDD A;  4ZEI A;  1YAE A;  1XOC A;  1Y1Z A;  1EZ9 A;  2ZZW A;  4PE3 A;  3FXQ A;  4THI A;  2F36 A;  2PX1 A;  3VE1 B;  1LAF E;  4NN3 A;  5DEX B;  2ONK E;  5CMK A;  2F7C A;  4RA1 A;  4MX6 A;  3VFJ A;  4G2Z A;  5DTB A;  1B2H A;  2RCB A;  4R2F A;  3E9X A;  1H44 A;  3N5L A;  4ZDM A;  3IJX B;  4KD5 A;  2CMO A;  2ABH A;  4OFO A;  5JTY A;  2HXW A;  1PDA A;  2NOO A;  1B7Z A;  4BDO A;  3RTF B;  1MXZ A;  3A09 A;  2PFZ A;  4H1X A;  1US5 A;  4IY6 A;  4U1O A;  3PD8 A;  3TQW A;  5I57 A;  3SEU A;  3T66 A;  2O51 A;  3EHU A;  1P99 A;  2XX7 A;  3EHT A;  3MP6 A;  3FD3 A;  4GLI A;  4X1B A;  4R75 A;  4JSO A;  4MBP A;  2F7B A;  4OVQ A;  4KI0 E;  1LBC A;  2Z23 A;  3EHS A;  1LAX A;  2I4B A;  3UOR A;  3G3F A;  4GL0 A;  1EZP A;  2XXY A;  3MUQ A;  4AQ4 A;  1LLS A;  4XF5 A;  1SD3 A;  4ELR A;  1POY 1;  3PD9 A;  5CI5 A;  4RJZ A;  4NF4 A;  4H5G A;  3OEM A;  2RCA A;  3SER A;  3C4M A;  4QRZ A;  1QVS A;  2YLN A;  5I57 B;  1US4 A;  3KN7 A;  1VE4 A;  3O9P A;  3SEW A;  1Y4T A;  2XWK A;  4JDF A;  2RC8 A;  5AA2 B;  4DXU A;  1B1X A;  3QK6 A;  4G68 C;  4BDN A;  4MNC A;  1NNT A;  2OBG A;  1FTL A;  2XXU A;  4F2Q A;  4KFQ A;  2KLF A;  2DP8 A;  2AIX A;  4IY5 A;  5I59 A;  2QRY A;  3I6V A;  2QS1 A;  2Y7K A;  2UVI A;  4PAK A;  4OEN A;  2DVC A;  3H03 A;  4LQ5 A;  2QS2 A;  2R6G E;  5EHM A;  4EF1 A;  1OLA A;  1OVT A;  5KCJ B;  2DE2 A;  3B6T A;  1OVB A;  4XFE A;  2O68 A;  3S9E A;  4G68 B;  2B3B A;  1Y3P A;  3S9N C;  1O63 A;  1TFD A;  4F18 A;  4GQO A;  4OER A;  2H9B A;  5F1Q A;  2DE4 A;  3UK4 A;  1YTV A;  4KCC A;  4LN5 A;  1FQA A;  3K4U A;  3UP9 A;  1XVX A;  3IB0 A;  5ISU A;  2QS3 A;  5DVI A;  2BJJ X;  3PMW A;  4JWY A;  5K2Y A;  1AMF A;  4HS7 A;  3H6U A;  2O7U A;  1MY0 A;  1LFH A;  3OEN A;  4ECF A;  4POW A;  1IIT A;  1DPE A;  4OAN A;  4U21 A;  2HPG A;  3CG3 A;  5H8S A;  4KR5 A;  4ZEF A;  4N13 A;  2ALU A;  1NMU A;  4ESX A;  4NF6 A;  1PB8 A;  5H8H B;  1URG A;  3CVG A;  4BLA A;  5H8F A;  3TEL A;  2OLB A;  4DE8 A;  2DVZ A;  4QSC A;  4LP2 B;  4DZ1 A;  4XKN A;  3PPR A;  4GIZ A;  1R9L A;  1LAH E;  3O28 A;  1PC3 A;  5CBR A;  4P1E A;  1CB6 A;  1PBQ A;  3K2D A;  1B3F A;  3OXN A;  1XHY A;  4PF8 A;  1JVY A;  1QJM A;  1MPB A;  3OSQ A;  4PET A;  1MXV A;  5CRY A;  4OZ9 A;  1B32 A;  1P1O A;  4YU0 A;  3PU5 A;  1B9J A;  1LCF A;  1A8E A;  3HN0 A;  1JW4 A;  3K00 A;  1PBP A;  1UIV A;  5I2N B;  3LUY A;  4PBH A;  4FE8 A;  5FTI A;  5A5X B;  2ZYN A;  4QFK A;  4OA4 A;  4FAT A;  2FA7 A;  2P0S A;  1B3H A;  2FNC A;  3FGS A;  4Q5T A;  2AL4 A;  3JV9 A;  2UVH A;  3H6W A;  4OFJ A;  1QUK A;  4KYD A;  4ZEC A;  4O7M A;  3TDJ A;  1SDX A;  4M1V A;  4H8I A;  4FED A;  3VXB A;  2ZXT A;  3C35 A;  2THI A;  2VP1 A;  2PBW A;  4R6H A;  2GHB A;  3V8X B;  1UTB A;  4O3C A;  4X8R A;  3LSL A;  3PPO A;  3ILU B;  2I0C A;  4JBZ A;  2E1S A;  3U94 A;  1GTK A;  4LZ7 A;  5ELV A;  5I59 B;  4UAB A;  3ONM A;  1UTH A;  4DCY A;  4G8H A;  3KJ7 A;  3O97 A;  2R9J A;  4U4S A;  5CMM A;  1N3X A;  5I5P A;  3E4R A;  3HV1 A;  4ZE9 A;  3S9M C;  3MWB A;  2X26 A;  2H98 A;  1LST A;  1DTZ A;  4I1D A;  3K6X A;  5IKB A;  2Q9T A;  4NF8 A;  3H6T A;  4X48 A;  1AL3 A;  3PGF A;  1MM6 A;  3EPE A;  5JK4 A;  2X7P A;  3VDF A;  1N3W A;  3CR9 A;  2VPO A;  3MP8 A;  2CZL A;  4DLD A;  4OVP A;  3LSX A;  4FAJ A;  3N6T A;  2UYE A;  5AA3 A;  5AE4 A;  4N6K A;  4PQJ A;  4MLQ A;  4RK2 A;  2XXV A;  4ZEB A;  3K1N A;  4YB7 A;  4LA9 A;  2A5S A;  2XD3 A;  2RIN A;  3GYY A;  4PFR A;  3RQT A;  2I3W A;  3QAX A;  1ZJL A;  1MXX A;  3SET A;  4FEB A;  1EU8 A;  4GD5 A;  4Q30 B;  2F7A A;  2XWV A;  3VVF A;  5ICQ A;  1SBP A;  3FJM A;  3FXU A;  1GGG A;  4F22 A;  2I58 A;  3ZKL A;  4C1T A;  1ZLQ A;  4PFW A;  3MC2 A;  1NFT A;  1RYO A;  3K0V A;  1H76 A;  4ND9 A;  5B70 A;  3U72 A;  1USY E;  3OEK A;  1GV8 A;  3MZ1 A;  1BIY A;  1MS7 A;  2RKM A;  3TEP A;  4EXL A;  3MQ9 A;  5KCJ A;  3QYT A;  3G7W A;  4HCW A;  2WYP A;  1H3D A;  4YAH X;  3FVO A;  1P1U A;  4HTG A;  3SEX A;  2YJP A;  3LR1 A;  5IM2 A;  4EF2 A;  2DE3 A;  2B3F A;  1IEJ A;  3PV0 E;  5HM4 B;  3ZKK A;  5H8F B;  3TCF A;  3IL1 B;  5CM6 A;  1WVJ A;  2XX8 A;  1QKB A;  1JW5 A;  3TMG A;  1B4H A;  4MFI A;  3FV2 A;  3CI8 A;  1FQE A;  2HZL A;  5AA2 D;  3WAE A;  1MG1 A;  1B1H A;  3PUY E;  2Q2C A;  3WAF A;  5J1D A;  3H7M A;  4KYE A;  3TTK A;  2QL3 A;  3QIM A;  3OEL A;  3H4Z A;  4U22 A;  4ZZE A;  3DEL B;  1SVX B;  3TUS A;  3HCQ A;  5I58 B;  4PDH A;  3T9X B;  2AL5 A;  3QSL A;  3W9W A;  3G3I A;  2O1M A;  4QHQ A;  4ZZA A;  2HAV A;  3MVZ A;  1MY3 A;  3O2A A;  2DXR A;  3F11 A;  2RF1 A;  5H8Q A;  1FTK A;  2FYI A;  4OVS A;  4MMP A;  2VPN A;  1Z7N E;  3K01 A;  4PF6 A;  3G3K A;  1QUJ A;  1SQY A;  3M3K A;  3GBB A;  4P8B A;  4F19 A;  2HEU A;  3EN3 A;  4OMB A;  4TQU Q;  2XXI A;  4XKR A;  5TP9 B;  2OJT A;  5TPA B;  1BTJ A;  4F1U A;  4XKP A;  1VFD A;  4OET A;  4EQ7 A;  3IOU A;  4BDQ A;  3USD A;  4H67 A;  1URS A;  1XVY A;  2F5X A;  5M2V A;  3LC8 A;  4IGR A;  3FIR A;  2OK2 A;  3DM0 A;  2UXA A;  3O29 A;  4YB5 A;  4R9F A;  1MPD A;  4PAI A;  1JNF A;  4N91 A;  5AA4 B;  2Y7R A;  2XXX A;  3FUZ A;  3LSF B;  1MH3 A;  2P2A A;  4PGN A;  2Q88 A;  4UA8 A;  4LON B;  5CMB A;  4I8C A;  4R74 A;  5HPQ A;  1IQ7 A;  1MQH A;  1JEV A;  4OEV A;  1JVX A;  3TYH A;  5IGA A;  4BDR A;  2F78 A;  1QUL A;  2Y84 A; 
#chains in the Genus database with same CATH topology
 2GH9 A;  2XXQ A;  1SYI A;  2D5W A;  3HST A;  1EYI A;  4OES A;  3R6U A;  2WBB A;  3T0J A;  2L5V A;  1XC1 A;  5HBC A;  4NAP A;  1SW2 A;  3L6G A;  4YKK A;  4OTE A;  1B4Z A;  3C31 A;  2ZNT A;  5LOM A;  4NF5 B;  1A55 A;  1B58 A;  1O64 A;  3O6I A;  3U1O A;  2PMS A;  4O94 A;  4XTC Q;  3IO4 A;  1ZKB A;  4N07 A;  2P1S A;  4N15 A;  4OVR A;  1IUD A;  3EF7 A;  3EKI A;  1EZO A;  2P3N A;  4NG7 A;  3IX1 A;  1PEB A;  3FVN A;  1JET A;  2V93 A;  4IO7 A;  2G93 A;  2PYY A;  2XWI A;  3UIF A;  5BWJ A;  2V3T A;  3T9U A;  4GXA A;  4PBQ A;  4R72 A;  5DVF A;  4RXL A;  3K02 A;  2QMW A;  4N17 A;  3RUM A;  3S2V A;  3MBP A;  2DS9 A;  3QMF A;  2XXK A;  3IK6 B;  4H5F A;  4HW8 A;  3MPL A;  1J1N A;  4FJP A;  3C9H A;  1MM7 A;  1INP A;  1PB7 A;  5L9M A;  4PC9 A;  1LCT A;  3SES A;  5H8N B;  4PE5 B;  2Q8J A;  1OIB A;  3KOS A;  3IR1 A;  4C1U A;  4DXB A;  4YMB A;  5I2N A;  4WEP A;  1FQF A;  4PFB A;  2ZNU A;  3U8Q A;  2W7Y A;  4N8G A;  2HCA A;  2F6P A;  1DTG A;  4P47 A;  3VXC A;  3VLW A;  2QFL A;  1KWH A;  4YIC A;  2XHD A;  2ZYM A;  5TU0 A;  4E0X A;  4MH5 A;  4ELO A;  1XS5 A;  3RNN A;  4EQB A;  4JWO A;  2DXY A;  1MXW A;  3LBS A;  4OHN A;  3PUZ E;  3TPA A;  3OO7 A;  4RNS A;  5LDZ A;  4NF0 A;  5LTC A;  4GXS B;  2XXP A;  4UAC A;  1Y4C A;  4F1V A;  5IZ3 A;  3K6W A;  1Z7M E;  4GRK A;  4R6K A;  4F31 B;  2Z22 A;  4H65 A;  3MAM A;  4GX3 A;  4NGU A;  4OQO A;  1S9T A;  3QXM A;  5DYH A;  1NH7 A;  3PUX E;  3TZA A;  3MST A;  2OZZ A;  3FXR A;  1FRP A;  3RTW B;  1NUW A;  1VSO A;  1B5I A;  5L9S A;  1AWB A;  3FXB A;  4HCY A;  1Q9D A;  1M5D A;  4QBA A;  3UGW A;  3KJT A;  3KEI A;  3SEV A;  1YCJ A;  3PPP A;  2O7I A;  2VHA A;  3JYR A;  3D4G A;  5DVJ A;  1FPE A;  4ZED A;  1Y3N A;  4MCO A;  4NF8 B;  1B3E A;  4LUB A;  4HE0 A;  2I0B A;  3CFZ A;  1SW1 A;  4POX A;  1NV3 A;  1OQH A;  1SI1 A;  4EDP A;  1M5E A;  3FV1 A;  2DDK A;  4WXJ A;  1NNP A;  1YZ0 A;  3IOV A;  4GX6 A;  5TPA A;  5TP9 A;  1OLC A;  3IOR A;  4R9G A;  1LB8 A;  4GVO A;  4QFO A;  1CE2 A;  2I6E A;  3SZP A;  1N0T A;  3K6U A;  3CRB A;  4HXV A;  3U92 A;  3IOW A;  5BUU A;  4NHB A;  1GVC A;  2R8T A;  3OO6 A;  3KOT A;  4P11 A;  1R6Z A;  1DMB A;  1RDY A;  2DWH A;  1LFI A;  1XI6 A;  4JWX A;  4DIG A;  4OVJ A;  4MHF A;  2M8C A;  3KSX A;  4N4U A;  1MY2 A;  1FPB A;  2V3Q A;  4KHZ E;  4G8N A;  4P9K A;  3OOA A;  4X1D A;  4ONY A;  4MF3 A;  4YKP A;  1MQD A;  4O8M A;  2V25 A;  4TOZ A;  5CBS A;  4NE4 A;  1GR2 A;  3MVX A;  1H43 A;  4MJO A;  1FQC A;  1MDQ A;  4IO2 A;  4NQ8 A;  4X9T A;  4F39 A;  3TCH A;  4BDL A;  1FQB A;  5EYF A;  2O69 A;  3H6V A;  3D4C A;  4HE1 A;  4LQ2 A;  4QSD A;  4AB6 A;  2F8D A;  4KYS A;  1B51 A;  2QPQ A;  4MNP A;  3C33 A;  1ZTY A;  3KBZ A;  2Y7W A;  1CNQ A;  3DP4 A;  4IO5 A;  3ECR A;  4NF5 A;  2QJE A;  4U23 A;  1MY1 A;  4F3B A;  2AYS A;  4OFL A;  1JEU A;  1FBH A;  1B40 A;  3CFX A;  3R26 A;  4IO6 A;  3OSR A;  2Z8E A;  4DCX A;  1JQF A;  5ICT A;  1EYK A;  1NV2 A;  2YPN A;  2O6A A;  4ELP A;  3PMV A;  4G61 A;  2QMX A;  2OWS A;  3GXA A;  3GBA A;  4XEQ A;  4ZS9 A;  1LBX A;  3VLV A;  3IOT A;  4M4G A;  1SPI A;  4GL8 A;  3RT8 A;  1B52 A;  3Q27 A;  3V83 A;  4QF9 A;  4Z7E A;  1O7T A;  1K9Z A;  4OVT A;  1UTB B;  5ITP A;  1N7X A;  2Y7I A;  2HZK A;  4QFN A;  3HHF A;  3SDF A;  3MP1 A;  2F35 A;  3ILT B;  1B3L A;  2XXH A;  2JJK A;  3V89 B;  2WKY A;  5I2K A;  4PFI A;  5I58 A;  3RY3 A;  3SKP A;  2O1L A;  2B4M A;  4YKI A;  1FPI A;  1NNF A;  3Q26 A;  2VOZ A;  2DYX A;  3QUF A;  1BP5 A;  4O3A A;  3Q28 A;  2I4C A;  4P0I A;  1OMP A;  4I9D A;  3FAT A;  3I5O A;  4F29 A;  3IJO B;  3RGY A;  2UVJ A;  2CZH A;  4PFT A;  3MVW A;  4NF6 B;  3OO8 A;  3UN6 A;  5B7D A;  1VR5 A;  1IMF A;  5CMC A;  3A3C A;  1FTJ A;  1S7Y A;  3B6W A;  1FPF A;  2XD2 A;  4F2O A;  1QKA A;  4GWO A;  1XT8 A;  4RK9 A;  1II5 A;  3O66 A;  4GOT A;  5I2K B;  4YMA A;  3VLU A;  2DSF A;  2GQ1 A;  5KDT A;  1NI9 A;  4PAF A;  3U65 A;  3FZV A;  1A8F A;  1FPG A;  3Q25 A;  1TT1 A;  3FJ7 A;  1NKX A;  3DLN A;  1URD A;  3HFU A;  2Y7P A;  4GWY A;  4G77 A;  1AOV A;  2XXW A;  4XKQ A;  1D4N A;  3MW0 A;  1B5J A;  2KQZ A;  4P1L A;  4KPT A;  2R71 A;  3W9V A;  4FOR A;  1A7L A;  4U2R A;  3T1B A;  2ZZV A;  4N6P A;  3T93 B;  4LVQ A;  3FAS A;  5FHO A;  1ZIU A;  1KA0 A;  4U4X A;  1ANF A;  1A40 A;  4ELQ A;  2H99 A;  4AB5 A;  1P1W A;  2QS4 A;  3TCG A;  1Y3Q A;  4NX1 A;  3KSJ A;  3A3U A;  4RY1 A;  3E3K A;  3BBR A;  4H8J A;  4P3L A;  1I6B A;  3TFL A;  2WEF A;  1IXI A;  2ZNS A;  4FIM A;  3TAJ A;  4X04 A;  5FTH A;  3ZS6 A;  1IXH A;  2D3I A;  1M5C A;  4PP0 A;  4NED A;  2F3B A;  4DI3 D;  1TWY A;  2VT5 A;  3B8B A;  4MNI A;  4C0R A;  2X7Q A;  2XXT A;  5H8H A;  4DI4 B;  5EQ9 A;  1L5T A;  4OXV A;  1B0H A;  2D21 A;  3PMX A;  4IO3 A;  1H45 A;  1LAG E;  5AA1 A;  2REJ A;  5DEX A;  2QSX A;  3MJN A;  1B7U A;  3GLB A;  3FVK A;  3CFL A;  4MIJ A;  1SW4 A;  5CC2 A;  1VFE A;  2GRV A;  1N04 A;  5KZT A;  1MQI A;  3A29 A;  1I6A A;  1SYH A;  3Q29 A;  3CIJ A;  2H25 A;  2PVU A;  2FBP A;  3MYU A;  2RC7 A;  4LAT A;  3C32 A;  2NXO A;  4JXI A;  3RT6 B;  5I56 B;  3ODB A;  1FCK A;  1DOT A;  3GZG A;  3VV5 A;  4JVD A;  2WBD A;  1HSJ A;  2OWT A;  3T22 A;  1MRP A;  1D9V A;  2I49 A;  1NUY A;  2RC9 A;  4OWD A;  1AIV A;  3LUZ A;  5J16 A;  4R2B A;  1MXY A;  1RYX A;  4I62 A;  2E0S A;  1ZU0 A;  1HSE A;  1A99 A;  1MY4 A;  1IMD A;  3M3F A;  3RN8 A;  1TXF A;  5FHN A;  4G8M A;  2F97 A;  4FEC A;  1MH4 A;  3HO7 A;  3K1P A;  2NUV A;  1FBC A;  3P7I A;  1NH8 A;  3G3G A;  3IAZ A;  3QUJ A;  2PT1 A;  3PPN A;  1FBP A;  4BDM A;  3C34 A;  2DWI A;  1YPN A;  1ZBM A;  2ONS A;  2ZYK A;  3OMB A;  5ET6 A;  4Z0I A;  1WDN A;  1B0L A;  4IR8 A;  2DQV A;  2LAO A;  3V5A A;  1MQJ A;  2Z8F A;  4ESW A;  4P56 A;  1M5F A;  4OEU A;  1T0K A;  3D1R A;  2Y5K A;  4G4P A;  1I6Q A;  1FPK A;  4RPO A;  1QGX A;  2Q74 A;  2GFE A;  2XA5 A;  3BFU A;  2P3V A;  4XXU A;  2H4I A;  3FJG A;  1QW0 A;  1Y9U A;  3IB1 A;  5IZZ A;  1RKM A;  3KGC A;  1ATG A;  2XWO A;  1FQD A;  1JP4 A;  4YKJ A;  1D3K A;  4P0G A;  3PPQ A;  4I40 A;  4QFL A;  1BKA A;  1LB9 A;  2F34 A;  4EXK A;  4G68 A;  2FVZ A;  1IZ1 A;  2XX9 A;  4RYA A;  3AXF A;  3FVG A;  5JTY B;  3R7X A;  2Z8D A;  1ZMG A;  2FIE A;  4LZ5 A;  1B6H A;  4JSD A;  3I3V A;  5DW8 A;  4GBW A;  3G3J A;  2CEY A;  2Q2A A;  4PGP A;  4GBV A;  5I7I A;  4MAG A;  2ZZX A;  1LBB A;  2G29 A;  3DP6 A;  2ZMB A;  3RYD A;  4IGT A;  2UVG A;  1MXU A;  1P1Q A;  3MPK A;  1N84 A;  3TTL A;  1M5B A;  2VGQ A;  3TTM A;  3THI A;  1MPC A;  2Q89 A;  3CSG A;  3RLF E;  2DWJ A;  4IO4 A;  1USY H;  1FBD A;  1S50 A;  4DDD A;  3B50 A;  1WOD A;  2UYF A;  1QUI A;  2PT2 A;  2V4C A;  2F6G A;  4F3P A;  4PFU A;  5JEI A;  5IAI A;  3N94 A;  4R73 A;  1FPJ A;  3H3G A;  4TLL B;  3LSW A;  1NNK A;  1LBZ A;  4MEV A;  1D9Y A;  5K2X A;  3CSB A;  3KBR A;  2ESN A;  1FTO A;  1FW0 A;  5L8D A;  4PFY A;  1Q1K A;  3MZ9 A;  4GX4 A;  2ZYO A;  1Y1M A;  2PCR A;  3T9V A;  4F3S A;  3MZB A;  5L9O A;  4GF8 A;  4ZE8 A;  2DWA A;  2NWJ A;  1B5H A;  4N8Y A;  5AA4 A;  3O6H A;  1F9B A;  3KFM A;  5DT6 A;  4TLM B;  2V3U A;  4H6D A;  3SEY A;  1R9Q A;  4KQP A;  1HSL A;  1MQG A;  5I84 A;  2ANJ A;  3VVD A;  2I48 A;  1A54 A;  4E0W A;  1UIU A;  3C36 A;  5T3J A;  2V84 A;  3BKI B;  3TKD A;  1UQW A;  4NMY A;  4EUO A;  4F1Y A;  3ZSF A;  1SI0 A;  2WYK A;  5F7V A;  2H5Y A;  2WX9 A;  3TTN A;  1IXC A;  4EQ9 A;  3T9H B;  5IZ1 A;  4QFP A;  3OD7 A;  1PB9 A;  3H06 B;  3G3H A;  3TTR A;  3TQL A;  3KN8 A;  3M8U A;  2DOJ A;  3N6U A;  2HFB A;  4Q0C A;  1N7W A;  1JW1 A;  2PFY A;  4H0W A;  4JB7 A;  5EHS A;  3O6G A;  3ROJ A;  4H46 A;  2GHA A;  3HHG A;  1EH3 A;  1DSN A;  5AA2 A;  4GFR A;  2HQ0 A;  4YB6 A;  2B65 A;  2Y5L A;  4R6Y A;  3T96 B;  3W15 C;  5H8N A;  2VD3 A;  1B46 A;  3UA8 A;  4NWD A;  1MDP 1;  5I56 A;  3L6H A;  3KZG A;  3IO6 A;  1Y20 A;  3RPW A;  5FHM A;  5I3S A;  1ELJ A;  1LGB C;  2QVR A;  5KDT B;  2XXR A;  5A5X A;  1P1N A;  4IB2 A;  5ITO A;  1NV1 A;  3KC1 A;  4XIG Q;  2VD2 A;  2A5T A;  3K1M A;  4MLV A;  1FTM A;  1Q35 A;  1AH5 A;  4PCD A;  4NWC A;  1NV0 A;  3CG1 A;  2OWZ A;  2A5T B;  1LFG A;  5H8Q B;  3IFA A;  3JZJ A;  3BFT A;  2IEE A;  4KCD A;  4LZ8 A;  3IFC A;  1OQG A;  3B6Q A;  4NTL A;  2FHY A;  4ISU A;  2HAU A;  2OCU A;  4Q8R A;  3E13 X;  3B7D A;  3TOD A;  3U93 A;  1IXG A;  2KR0 A;  3KG2 A;  4QSE A;  3K6V A;  2NVU B;  3IB2 A;  2CEX A;  3DP8 A;  3EQ1 A;  1BLF A;  4F3G A;  2I3V A;  2IA4 A;  4K3F A;  1IIW A;  1UTH B;  2ONR A;  3M3L A;  1DPP A;  3N26 A;  1SW5 A;  2REG A;  1NL5 A;  1N76 A;  4ZEK A;  1I69 A;  1TFA A;  3OO9 A;  3KN3 A;  4H45 A;  3HPI A;  4JVI A;  4NF4 B;  1NUX A;  3MVY A;  4RPN A;  4O3B A;  4YZZ A;  1B3G A;  3S9L C;  3PUW E;  4U1Z A;  4OYV A;  3PUV E;  4WKM A;  4N6D A;  5ET7 A;  4WED A;  1B05 A;  1POT A;  2CZK A;  2O84 X;  1R1N A;  4DXC A;  3VVE A;  3S4U A;  1B7H A;  4L17 A;  4O7I A;  4PDD A;  4ZEI A;  1YAE A;  1XOC A;  1Y1Z A;  1FJ9 A;  1EZ9 A;  2ZZW A;  4PE3 A;  3FXQ A;  4THI A;  2F36 A;  3NOH A;  2PX1 A;  5EYG A;  3VE1 B;  1LAF E;  4NN3 A;  5DEX B;  1FPD A;  2ONK E;  5CMK A;  2F7C A;  4RA1 A;  4MX6 A;  3VFJ A;  1FJ6 A;  4G2Z A;  5DTB A;  4FBP A;  1B2H A;  2RCB A;  4R2F A;  3E9X A;  1H44 A;  3N5L A;  4I3Y A;  4ZDM A;  3IJX B;  4KD5 A;  2CMO A;  1IME A;  2ABH A;  4OFO A;  5JTY A;  2HXW A;  1PDA A;  2NOO A;  1FTA A;  1B7Z A;  4BDO A;  3RTF B;  1MXZ A;  3KC0 A;  3A09 A;  2PFZ A;  2FIX A;  4H1X A;  1US5 A;  4IY6 A;  4U1O A;  3PD8 A;  3TQW A;  5I57 A;  3SEU A;  3T66 A;  2O51 A;  1DK4 A;  3EHU A;  1P99 A;  2XX7 A;  3EHT A;  3MP6 A;  3FD3 A;  4GLI A;  4X1B A;  4R75 A;  4JSO A;  4MBP A;  2F7B A;  4OVQ A;  4KI0 E;  1LBC A;  3LV0 A;  2Z23 A;  1NV7 A;  3EHS A;  1LAX A;  2CZI A;  2I4B A;  3UOR A;  3G3F A;  4GL0 A;  1EZP A;  2XXY A;  3MUQ A;  4AQ4 A;  1LLS A;  5EYH A;  4XF5 A;  1SD3 A;  4ELR A;  1POY 1;  5EQA A;  3PD9 A;  5CI5 A;  4RJZ A;  4NF4 A;  4H5G A;  3OEM A;  2RCA A;  3SER A;  3C4M A;  4QRZ A;  1LEV A;  1QVS A;  2YLN A;  5I57 B;  1US4 A;  3KN7 A;  1VE4 A;  3O9P A;  3SEW A;  5IZ3 B;  1DBZ A;  1Y4T A;  2XWK A;  4JDF A;  4PTK A;  2RC8 A;  5AA2 B;  4DXU A;  1B1X A;  3QK6 A;  4G68 C;  4BDN A;  4MNC A;  1NNT A;  2OBG A;  4GWW A;  1FTL A;  3RPL B;  2XXU A;  4F2Q A;  4KFQ A;  2KLF A;  2DP8 A;  2AIX A;  4IY5 A;  5I59 A;  2QRY A;  3I6V A;  2HHM A;  2QS1 A;  2Y7K A;  2UVI A;  4PAK A;  4OEN A;  2DVC A;  3H03 A;  4JVC A;  4LQ5 A;  2QS2 A;  3CHG A;  1G0I A;  4GWS A;  2R6G E;  5EHM A;  4EF1 A;  1OLA A;  1OVT A;  5KCJ B;  2DE2 A;  3B6T A;  1OVB A;  4XFE A;  3PTY A;  2O68 A;  3S9E A;  1NV5 A;  4G68 B;  2B3B A;  1Y3P A;  3S9N C;  1O63 A;  1KA1 A;  1TFD A;  4F18 A;  4GQO A;  4OER A;  2H9B A;  5F1Q A;  2DE4 A;  3UK4 A;  1YTV A;  4KCC A;  4LN5 A;  1FQA A;  3K4U A;  3UP9 A;  1XVX A;  3IB0 A;  5ISU A;  2QS3 A;  5DVI A;  2BJJ X;  3PMW A;  4JWY A;  5K2Y A;  1AMF A;  4HS7 A;  3H6U A;  2O7U A;  4GWU A;  1G0H A;  1MY0 A;  1LFH A;  3OEN A;  4ECF A;  4POW A;  1IIT A;  1DPE A;  4OAN A;  4U21 A;  2HPG A;  3CG3 A;  5H8S A;  4KR5 A;  4ZEF A;  2QVU A;  4N13 A;  2ALU A;  5F24 A;  1NMU A;  4ESX A;  4NF6 A;  1PB8 A;  1NV4 A;  5H8H B;  1URG A;  3CVG A;  4BLA A;  1DCU A;  5H8F A;  3TEL A;  2OLB A;  4DE8 A;  2DVZ A;  4QSC A;  4LP2 B;  4DZ1 A;  4XKN A;  3PPR A;  4GIZ A;  1R9L A;  1LAH E;  3O28 A;  1PC3 A;  4KXP A;  5CBR A;  4P1E A;  1CB6 A;  1IMA A;  1PBQ A;  3K2D A;  1B3F A;  2F3D A;  3OXN A;  1K9Y A;  1XHY A;  4PF8 A;  2QVV A;  1JVY A;  1QJM A;  1MPB A;  3OSQ A;  4PET A;  1MXV A;  4HE2 A;  5CRY A;  4OZ9 A;  1B32 A;  1P1O A;  4YU0 A;  3PU5 A;  1B9J A;  1LCF A;  1A8E A;  3HN0 A;  1JW4 A;  3K00 A;  1IMB A;  1PBP A;  1UIV A;  5I2N B;  3LUY A;  4N81 A;  4PBH A;  4FE8 A;  2Q8M A;  5FTI A;  5A5X B;  2ZYN A;  4QFK A;  4OA4 A;  4FAT A;  2FA7 A;  2P0S A;  1B3H A;  2FNC A;  3FGS A;  4Q5T A;  2AL4 A;  3JV9 A;  2MKZ A;  2UVH A;  3H6W A;  4OFJ A;  1QUK A;  4KYD A;  4ZEC A;  1LBV A;  4O7M A;  3TDJ A;  1SDX A;  4M1V A;  4H8I A;  4FED A;  3VXB A;  2ZXT A;  3C35 A;  2THI A;  2VP1 A;  2PBW A;  4R6H A;  2GHB A;  3BIG A;  3V8X B;  1UTB A;  4O3C A;  4I3E A;  4X8R A;  3LSL A;  3PPO A;  3ILU B;  2I0C A;  4JBZ A;  2E1S A;  5ET8 A;  3U94 A;  1GTK A;  2HXR A;  4LZ7 A;  5ET5 A;  5ELV A;  1D9Q A;  5I59 B;  4UAB A;  3ONM A;  1UTH A;  4DCY A;  3E78 A;  4G8H A;  3KJ7 A;  3O97 A;  2R9J A;  4U4S A;  5CMM A;  1N3X A;  5I5P A;  3E4R A;  3HV1 A;  4ZE9 A;  3S9M C;  3MWB A;  2X26 A;  2H98 A;  1LST A;  1DTZ A;  4I1D A;  3K6X A;  5IKB A;  2Q9T A;  4AS5 A;  4NF8 A;  3H6T A;  4X48 A;  1AL3 A;  3PGF A;  1MM6 A;  3EPE A;  5JK4 A;  2X7P A;  3VDF A;  1N3W A;  1RDZ A;  3CR9 A;  2VPO A;  3MP8 A;  2CZL A;  4DLD A;  4OVP A;  3LSX A;  1NUZ A;  4FAJ A;  3N6T A;  2UYE A;  5AA3 A;  5AE4 A;  4N6K A;  4PQJ A;  4MLQ A;  4RK2 A;  2XXV A;  4ZEB A;  1EYJ A;  3K1N A;  4YB7 A;  4LA9 A;  2A5S A;  1FBF A;  2XD3 A;  2RIN A;  3GYY A;  4PFR A;  3RQT A;  2I3W A;  3QAX A;  1ZJL A;  1MXX A;  4QXD A;  3SET A;  1BK4 A;  4FEB A;  1EU8 A;  4GD5 A;  4Q30 B;  1FBE A;  2F7A A;  2XWV A;  3VVF A;  5ICQ A;  1SBP A;  3FJM A;  3FXU A;  3ISP A;  1GGG A;  4F22 A;  1FSA A;  2I58 A;  3ZKL A;  4C1T A;  1ZLQ A;  4PFW A;  3MC2 A;  1NFT A;  1RYO A;  3K0V A;  1H76 A;  4ND9 A;  5B70 A;  3U72 A;  1USY E;  4AS4 A;  3OEK A;  1GV8 A;  3MZ1 A;  1LBY A;  1BIY A;  2BJI A;  1MS7 A;  2RKM A;  3TEP A;  4EXL A;  3MQ9 A;  5KCJ A;  3QYT A;  3G7W A;  4HCW A;  2WYP A;  1H3D A;  4YAH X;  3FVO A;  1P1U A;  4HTG A;  3SEX A;  2YJP A;  3LR1 A;  5IM2 A;  4EF2 A;  2DE3 A;  2B3F A;  1IEJ A;  1KZ8 A;  3PV0 E;  3FBP A;  5HM4 B;  3ZKK A;  5H8F B;  3TCF A;  3IL1 B;  5CM6 A;  1WVJ A;  2XX8 A;  1QKB A;  1JW5 A;  3TMG A;  3BIH A;  1B4H A;  4MFI A;  3FV2 A;  3CI8 A;  1FQE A;  1FBG A;  2HZL A;  5AA2 D;  5EQ7 A;  5FBP A;  3WAE A;  1MG1 A;  1B1H A;  3PUY E;  2Q2C A;  3WAF A;  5J1D A;  3H7M A;  4KYE A;  3TTK A;  2QL3 A;  3QIM A;  3OEL A;  3H4Z A;  4U22 A;  4ZZE A;  3DEL B;  1SVX B;  3TUS A;  3HCQ A;  5I58 B;  4PDH A;  3T9X B;  2AL5 A;  3QSL A;  3W9W A;  3G3I A;  2O1M A;  4QHQ A;  4ZZA A;  2HAV A;  3MVZ A;  1YXI A;  1MY3 A;  3O2A A;  2DXR A;  3F11 A;  2RF1 A;  5H8Q A;  1FTK A;  2FYI A;  1RDX A;  4OVS A;  5EQ8 A;  4MMP A;  2VPN A;  1Z7N E;  3K01 A;  4PF6 A;  3G3K A;  1QUJ A;  1SQY A;  3M3K A;  3GBB A;  4P8B A;  4F19 A;  2HEU A;  3EN3 A;  2B4L A;  4OMB A;  4TQU Q;  1VDW A;  2XXI A;  4XKR A;  5TP9 B;  2OJT A;  5TPA B;  1BTJ A;  3E79 A;  4F1U A;  4XKP A;  1VFD A;  4OET A;  3RPL A;  4EQ7 A;  3IOU A;  4BDQ A;  3USD A;  4GWZ A;  4GWX A;  4H67 A;  5A5L A;  1URS A;  1XVY A;  2F5X A;  5M2V A;  3LC8 A;  4IGR A;  3FIR A;  2OK2 A;  3DM0 A;  2UXA A;  1IMC A;  3O29 A;  4YB5 A;  4R9F A;  1MPD A;  4PAI A;  1JNF A;  4N91 A;  5AA4 B;  2Y7R A;  2XXX A;  2OX3 A;  3FUZ A;  1NV6 A;  3LSF B;  1MH3 A;  2P2A A;  1FPL A;  4PGN A;  2Q88 A;  4UA8 A;  4LON B;  5CMB A;  4I8C A;  4R74 A;  5HPQ A;  1IQ7 A;  1MQH A;  1JEV A;  4OEV A;  1JVX A;  3TYH A;  5IGA A;  5ESY A;  1YYZ A;  1LBW A;  4BDR A;  2F78 A;  1QUL A;  2Y84 A; 
#chains in the Genus database with same CATH homology
 2GH9 A;  2XXQ A;  1SYI A;  2D5W A;  3HST A;  1EYI A;  4OES A;  3R6U A;  2WBB A;  3T0J A;  5HBC A;  1XC1 A;  2L5V A;  4NAP A;  1SW2 A;  3L6G A;  4YKK A;  4OTE A;  1B4Z A;  3C31 A;  2ZNT A;  5LOM A;  4NF5 B;  1A55 A;  1B58 A;  1O64 A;  3O6I A;  3U1O A;  2PMS A;  4O94 A;  4XTC Q;  3IO4 A;  1ZKB A;  4N07 A;  2P1S A;  4N15 A;  4OVR A;  1IUD A;  3EF7 A;  3EKI A;  1EZO A;  2P3N A;  4NG7 A;  3IX1 A;  1PEB A;  3FVN A;  1JET A;  2V93 A;  4IO7 A;  2G93 A;  2PYY A;  2XWI A;  3UIF A;  5BWJ A;  2V3T A;  3T9U A;  4GXA A;  4PBQ A;  4R72 A;  5DVF A;  4RXL A;  3K02 A;  2QMW A;  4N17 A;  3RUM A;  3S2V A;  3MBP A;  2DS9 A;  3QMF A;  3IK6 B;  4H5F A;  4HW8 A;  2XXK A;  3MPL A;  1J1N A;  4FJP A;  3C9H A;  1MM7 A;  1PB7 A;  5L9M A;  1INP A;  4PC9 A;  1LCT A;  3SES A;  5H8N B;  4PE5 B;  2Q8J A;  1OIB A;  3KOS A;  3IR1 A;  4C1U A;  4DXB A;  4YMB A;  5I2N A;  4WEP A;  1FQF A;  4PFB A;  2ZNU A;  3U8Q A;  2W7Y A;  4N8G A;  2HCA A;  2F6P A;  1DTG A;  4P47 A;  3VXC A;  3VLW A;  2QFL A;  1KWH A;  4YIC A;  2XHD A;  2ZYM A;  5TU0 A;  4E0X A;  4MH5 A;  4ELO A;  1XS5 A;  3RNN A;  4EQB A;  4JWO A;  2DXY A;  1MXW A;  3LBS A;  4OHN A;  3PUZ E;  3TPA A;  3OO7 A;  4RNS A;  5LDZ A;  4NF0 A;  5LTC A;  4GXS B;  2XXP A;  4UAC A;  1Y4C A;  4F1V A;  5IZ3 A;  3K6W A;  1Z7M E;  4GRK A;  4R6K A;  4F31 B;  2Z22 A;  4H65 A;  3MAM A;  4GX3 A;  4NGU A;  4OQO A;  1S9T A;  3QXM A;  5DYH A;  1NH7 A;  3PUX E;  3TZA A;  3MST A;  2OZZ A;  3FXR A;  1FRP A;  3RTW B;  1NUW A;  1VSO A;  1B5I A;  5L9S A;  1AWB A;  3FXB A;  4HCY A;  1Q9D A;  1M5D A;  4QBA A;  3UGW A;  3KJT A;  3KEI A;  3SEV A;  1YCJ A;  3PPP A;  2O7I A;  2VHA A;  3JYR A;  3D4G A;  5DVJ A;  1FPE A;  4ZED A;  1Y3N A;  4MCO A;  4NF8 B;  1B3E A;  4LUB A;  4HE0 A;  2I0B A;  3CFZ A;  1SW1 A;  4POX A;  1NV3 A;  1OQH A;  1SI1 A;  4EDP A;  1M5E A;  3FV1 A;  4WXJ A;  2DDK A;  1NNP A;  1YZ0 A;  3IOV A;  5TPA A;  5TP9 A;  4GX6 A;  1OLC A;  3IOR A;  4R9G A;  1LB8 A;  4GVO A;  4QFO A;  1CE2 A;  2I6E A;  3SZP A;  1N0T A;  3K6U A;  3CRB A;  4HXV A;  3U92 A;  3IOW A;  5BUU A;  1GVC A;  4NHB A;  2R8T A;  3OO6 A;  3KOT A;  4P11 A;  1R6Z A;  1DMB A;  2DWH A;  1RDY A;  1LFI A;  1XI6 A;  4JWX A;  4DIG A;  4OVJ A;  4MHF A;  2M8C A;  3KSX A;  4N4U A;  1MY2 A;  1FPB A;  2V3Q A;  4KHZ E;  4G8N A;  4P9K A;  3OOA A;  4X1D A;  4ONY A;  4MF3 A;  4YKP A;  1MQD A;  4O8M A;  2V25 A;  4TOZ A;  5CBS A;  4NE4 A;  1GR2 A;  3MVX A;  1H43 A;  4MJO A;  1FQC A;  1MDQ A;  4IO2 A;  4NQ8 A;  4X9T A;  4F39 A;  3TCH A;  4BDL A;  1FQB A;  5EYF A;  2O69 A;  3H6V A;  3D4C A;  4LQ2 A;  4HE1 A;  4QSD A;  4AB6 A;  2F8D A;  4KYS A;  1B51 A;  2QPQ A;  4MNP A;  3C33 A;  1ZTY A;  3KBZ A;  2Y7W A;  1CNQ A;  3DP4 A;  4IO5 A;  3ECR A;  4NF5 A;  2QJE A;  4U23 A;  1MY1 A;  4F3B A;  2AYS A;  4OFL A;  1JEU A;  1B40 A;  1FBH A;  3CFX A;  3R26 A;  4IO6 A;  3OSR A;  2Z8E A;  4DCX A;  1JQF A;  5ICT A;  1EYK A;  2YPN A;  1NV2 A;  2O6A A;  4ELP A;  3PMV A;  4G61 A;  2QMX A;  2OWS A;  3GXA A;  3GBA A;  4XEQ A;  4ZS9 A;  1LBX A;  3VLV A;  3IOT A;  4M4G A;  1SPI A;  4GL8 A;  3RT8 A;  1B52 A;  3Q27 A;  3V83 A;  4Z7E A;  4QF9 A;  1O7T A;  1K9Z A;  4OVT A;  1UTB B;  5ITP A;  1N7X A;  2Y7I A;  2HZK A;  4QFN A;  3HHF A;  3SDF A;  3MP1 A;  2F35 A;  3ILT B;  1B3L A;  2XXH A;  2JJK A;  3V89 B;  2WKY A;  5I2K A;  5I58 A;  4PFI A;  3RY3 A;  3SKP A;  2O1L A;  2B4M A;  4YKI A;  1FPI A;  1NNF A;  3Q26 A;  2VOZ A;  2DYX A;  3QUF A;  1BP5 A;  4O3A A;  3Q28 A;  2I4C A;  4P0I A;  1OMP A;  4I9D A;  3FAT A;  3I5O A;  4F29 A;  3IJO B;  2UVJ A;  2CZH A;  3RGY A;  4PFT A;  3MVW A;  4NF6 B;  3OO8 A;  3UN6 A;  5B7D A;  1VR5 A;  1IMF A;  5CMC A;  3A3C A;  1FTJ A;  1S7Y A;  3B6W A;  1FPF A;  2XD2 A;  4F2O A;  1QKA A;  4GWO A;  1XT8 A;  4RK9 A;  1II5 A;  3O66 A;  4GOT A;  5I2K B;  4YMA A;  3VLU A;  2DSF A;  2GQ1 A;  5KDT A;  1NI9 A;  4PAF A;  3U65 A;  3FZV A;  1A8F A;  3Q25 A;  1FPG A;  1TT1 A;  3FJ7 A;  1NKX A;  3DLN A;  1URD A;  3HFU A;  2Y7P A;  4GWY A;  4G77 A;  1AOV A;  2XXW A;  4XKQ A;  1D4N A;  3MW0 A;  1B5J A;  2KQZ A;  4P1L A;  4KPT A;  2R71 A;  3W9V A;  4FOR A;  1A7L A;  4U2R A;  3T1B A;  2ZZV A;  4N6P A;  3T93 B;  4LVQ A;  3FAS A;  5FHO A;  1ZIU A;  1KA0 A;  4U4X A;  1ANF A;  1A40 A;  4ELQ A;  2H99 A;  4AB5 A;  1P1W A;  2QS4 A;  3TCG A;  1Y3Q A;  4NX1 A;  3KSJ A;  3A3U A;  4RY1 A;  3E3K A;  3BBR A;  4H8J A;  4P3L A;  1I6B A;  3TFL A;  2WEF A;  1IXI A;  2ZNS A;  4FIM A;  3TAJ A;  5FTH A;  4X04 A;  3ZS6 A;  1IXH A;  2D3I A;  1M5C A;  4PP0 A;  4NED A;  2F3B A;  4DI3 D;  1TWY A;  2VT5 A;  3B8B A;  4MNI A;  4C0R A;  2X7Q A;  2XXT A;  5H8H A;  4DI4 B;  5EQ9 A;  1L5T A;  4OXV A;  1B0H A;  2D21 A;  3PMX A;  4IO3 A;  1H45 A;  1LAG E;  5AA1 A;  2REJ A;  5DEX A;  2QSX A;  3MJN A;  1B7U A;  3GLB A;  3FVK A;  3CFL A;  5CC2 A;  1SW4 A;  4MIJ A;  1VFE A;  2GRV A;  1N04 A;  5KZT A;  1MQI A;  3A29 A;  1I6A A;  1SYH A;  3Q29 A;  3CIJ A;  2H25 A;  2PVU A;  2FBP A;  3MYU A;  2RC7 A;  4LAT A;  3C32 A;  2NXO A;  4JXI A;  3RT6 B;  5I56 B;  3ODB A;  1FCK A;  1DOT A;  3GZG A;  3VV5 A;  4JVD A;  2WBD A;  1HSJ A;  2OWT A;  3T22 A;  1MRP A;  1D9V A;  2I49 A;  2RC9 A;  4OWD A;  1NUY A;  1AIV A;  3LUZ A;  5J16 A;  4R2B A;  1MXY A;  1RYX A;  4I62 A;  2E0S A;  1ZU0 A;  1HSE A;  1A99 A;  1MY4 A;  1IMD A;  3M3F A;  3RN8 A;  1TXF A;  5FHN A;  4G8M A;  2F97 A;  4FEC A;  1MH4 A;  3HO7 A;  3K1P A;  2NUV A;  1FBC A;  3P7I A;  1NH8 A;  3G3G A;  3IAZ A;  3QUJ A;  2PT1 A;  3PPN A;  1FBP A;  4BDM A;  3C34 A;  2DWI A;  1YPN A;  1ZBM A;  2ONS A;  2ZYK A;  3OMB A;  5ET6 A;  4Z0I A;  1WDN A;  1B0L A;  4IR8 A;  2DQV A;  2LAO A;  3V5A A;  1MQJ A;  2Z8F A;  4ESW A;  4P56 A;  1M5F A;  4OEU A;  1T0K A;  3D1R A;  2Y5K A;  4G4P A;  1I6Q A;  1FPK A;  4RPO A;  1QGX A;  2Q74 A;  2GFE A;  2XA5 A;  3BFU A;  2P3V A;  4XXU A;  2H4I A;  3FJG A;  1QW0 A;  1Y9U A;  3IB1 A;  5IZZ A;  1RKM A;  3KGC A;  1ATG A;  2XWO A;  1FQD A;  1JP4 A;  4YKJ A;  1D3K A;  4P0G A;  3PPQ A;  4I40 A;  4QFL A;  1BKA A;  1LB9 A;  2F34 A;  4EXK A;  4G68 A;  2FVZ A;  1IZ1 A;  2XX9 A;  4RYA A;  3AXF A;  3FVG A;  5JTY B;  3R7X A;  2Z8D A;  1ZMG A;  4LZ5 A;  2FIE A;  1B6H A;  4JSD A;  3I3V A;  5DW8 A;  4GBW A;  3G3J A;  2CEY A;  2Q2A A;  4PGP A;  4GBV A;  5I7I A;  4MAG A;  2ZZX A;  1LBB A;  2G29 A;  3DP6 A;  2ZMB A;  3RYD A;  4IGT A;  2UVG A;  1MXU A;  1P1Q A;  3MPK A;  1N84 A;  3TTL A;  1M5B A;  2VGQ A;  3TTM A;  3THI A;  1MPC A;  2Q89 A;  3CSG A;  3RLF E;  2DWJ A;  4IO4 A;  1USY H;  1FBD A;  1S50 A;  4DDD A;  3B50 A;  1WOD A;  2UYF A;  1QUI A;  2PT2 A;  2V4C A;  2F6G A;  4F3P A;  4PFU A;  5JEI A;  5IAI A;  3N94 A;  4R73 A;  3H3G A;  1FPJ A;  4TLL B;  3LSW A;  1NNK A;  1LBZ A;  4MEV A;  1D9Y A;  5K2X A;  3CSB A;  3KBR A;  2ESN A;  1FTO A;  1FW0 A;  5L8D A;  4PFY A;  1Q1K A;  3MZ9 A;  4GX4 A;  2ZYO A;  1Y1M A;  2PCR A;  3T9V A;  4F3S A;  3MZB A;  5L9O A;  4GF8 A;  4ZE8 A;  2DWA A;  2NWJ A;  1B5H A;  4N8Y A;  5AA4 A;  3O6H A;  1F9B A;  3KFM A;  3SEY A;  5DT6 A;  2V3U A;  4H6D A;  4TLM B;  1R9Q A;  4KQP A;  1HSL A;  1MQG A;  5I84 A;  2ANJ A;  3VVD A;  2I48 A;  1A54 A;  4E0W A;  1UIU A;  3C36 A;  5T3J A;  2V84 A;  3BKI B;  3TKD A;  1UQW A;  4NMY A;  4EUO A;  4F1Y A;  3ZSF A;  1SI0 A;  2WYK A;  5F7V A;  2H5Y A;  2WX9 A;  3TTN A;  1IXC A;  4EQ9 A;  3T9H B;  5IZ1 A;  4QFP A;  3OD7 A;  1PB9 A;  3H06 B;  3G3H A;  3TTR A;  3TQL A;  3KN8 A;  3M8U A;  2DOJ A;  3N6U A;  2HFB A;  4Q0C A;  1N7W A;  1JW1 A;  2PFY A;  4H0W A;  4JB7 A;  5EHS A;  3O6G A;  3ROJ A;  4H46 A;  2GHA A;  3HHG A;  1EH3 A;  1DSN A;  5AA2 A;  4GFR A;  2HQ0 A;  4YB6 A;  2B65 A;  2Y5L A;  4R6Y A;  3T96 B;  3W15 C;  5H8N A;  2VD3 A;  1B46 A;  3UA8 A;  4NWD A;  1MDP 1;  5I56 A;  3L6H A;  3KZG A;  3IO6 A;  1Y20 A;  3RPW A;  5FHM A;  5I3S A;  1ELJ A;  1LGB C;  5KDT B;  2QVR A;  2XXR A;  5A5X A;  1P1N A;  4IB2 A;  5ITO A;  1NV1 A;  3KC1 A;  4XIG Q;  2VD2 A;  2A5T A;  3K1M A;  4MLV A;  1FTM A;  1Q35 A;  1AH5 A;  4PCD A;  4NWC A;  1NV0 A;  3CG1 A;  2OWZ A;  2A5T B;  1LFG A;  5H8Q B;  3IFA A;  3JZJ A;  3BFT A;  2IEE A;  4KCD A;  4LZ8 A;  3IFC A;  1OQG A;  3B6Q A;  4NTL A;  2FHY A;  4ISU A;  2HAU A;  2OCU A;  4Q8R A;  3E13 X;  3B7D A;  3TOD A;  3U93 A;  1IXG A;  3KG2 A;  4QSE A;  2KR0 A;  3K6V A;  2NVU B;  3IB2 A;  2CEX A;  3DP8 A;  3EQ1 A;  1BLF A;  4F3G A;  2I3V A;  2IA4 A;  4K3F A;  1IIW A;  1UTH B;  2ONR A;  3M3L A;  1DPP A;  3N26 A;  1SW5 A;  2REG A;  1NL5 A;  1N76 A;  4ZEK A;  1I69 A;  1TFA A;  3OO9 A;  3KN3 A;  4H45 A;  3HPI A;  4JVI A;  4NF4 B;  3MVY A;  1NUX A;  4RPN A;  4O3B A;  4YZZ A;  1B3G A;  3S9L C;  3PUW E;  4U1Z A;  4OYV A;  3PUV E;  4WKM A;  4N6D A;  5ET7 A;  4WED A;  1B05 A;  1POT A;  2CZK A;  2O84 X;  1R1N A;  4DXC A;  3VVE A;  3S4U A;  1B7H A;  4L17 A;  4O7I A;  4PDD A;  4ZEI A;  1YAE A;  1XOC A;  1Y1Z A;  1FJ9 A;  1EZ9 A;  2ZZW A;  4PE3 A;  3FXQ A;  4THI A;  2F36 A;  3NOH A;  2PX1 A;  5EYG A;  3VE1 B;  1LAF E;  4NN3 A;  5DEX B;  1FPD A;  2ONK E;  5CMK A;  2F7C A;  4RA1 A;  4MX6 A;  3VFJ A;  1FJ6 A;  4G2Z A;  5DTB A;  4FBP A;  1B2H A;  2RCB A;  4R2F A;  3E9X A;  1H44 A;  3N5L A;  4I3Y A;  4ZDM A;  3IJX B;  4KD5 A;  2CMO A;  1IME A;  2ABH A;  4OFO A;  5JTY A;  2HXW A;  1PDA A;  2NOO A;  1FTA A;  1B7Z A;  4BDO A;  3RTF B;  1MXZ A;  3KC0 A;  3A09 A;  2PFZ A;  2FIX A;  4H1X A;  1US5 A;  4IY6 A;  4U1O A;  3PD8 A;  3TQW A;  5I57 A;  3SEU A;  3T66 A;  2O51 A;  1DK4 A;  3EHU A;  1P99 A;  2XX7 A;  3EHT A;  3MP6 A;  3FD3 A;  4GLI A;  4X1B A;  4R75 A;  4JSO A;  4MBP A;  2F7B A;  4OVQ A;  4KI0 E;  1LBC A;  3LV0 A;  2Z23 A;  1NV7 A;  3EHS A;  1LAX A;  2CZI A;  2I4B A;  3UOR A;  3G3F A;  4GL0 A;  1EZP A;  2XXY A;  3MUQ A;  4AQ4 A;  1LLS A;  5EYH A;  4XF5 A;  1SD3 A;  4ELR A;  1POY 1;  5EQA A;  3PD9 A;  5CI5 A;  4RJZ A;  4NF4 A;  4H5G A;  3OEM A;  2RCA A;  3SER A;  3C4M A;  4QRZ A;  1LEV A;  1QVS A;  2YLN A;  5I57 B;  1US4 A;  3KN7 A;  1VE4 A;  3O9P A;  3SEW A;  5IZ3 B;  1DBZ A;  1Y4T A;  2XWK A;  4JDF A;  4PTK A;  2RC8 A;  5AA2 B;  4DXU A;  1B1X A;  3QK6 A;  4G68 C;  4BDN A;  4MNC A;  1NNT A;  2OBG A;  4GWW A;  1FTL A;  3RPL B;  2XXU A;  4F2Q A;  4KFQ A;  2KLF A;  2DP8 A;  2AIX A;  4IY5 A;  5I59 A;  2QRY A;  3I6V A;  2HHM A;  2QS1 A;  2Y7K A;  2UVI A;  4PAK A;  4OEN A;  2DVC A;  3H03 A;  4JVC A;  4LQ5 A;  2QS2 A;  3CHG A;  1G0I A;  4GWS A;  2R6G E;  5EHM A;  4EF1 A;  1OLA A;  1OVT A;  5KCJ B;  2DE2 A;  3B6T A;  1OVB A;  4XFE A;  3PTY A;  2O68 A;  3S9E A;  1NV5 A;  4G68 B;  2B3B A;  1Y3P A;  3S9N C;  1O63 A;  1TFD A;  4F18 A;  1KA1 A;  4GQO A;  4OER A;  2H9B A;  5F1Q A;  2DE4 A;  3UK4 A;  1YTV A;  4KCC A;  4LN5 A;  1FQA A;  3K4U A;  3UP9 A;  1XVX A;  3IB0 A;  5ISU A;  2QS3 A;  5DVI A;  2BJJ X;  3PMW A;  4JWY A;  5K2Y A;  1AMF A;  4HS7 A;  3H6U A;  2O7U A;  4GWU A;  1MY0 A;  1G0H A;  1LFH A;  3OEN A;  4ECF A;  4POW A;  1IIT A;  1DPE A;  4OAN A;  4U21 A;  2HPG A;  3CG3 A;  5H8S A;  4KR5 A;  4ZEF A;  2QVU A;  4N13 A;  2ALU A;  5F24 A;  1NMU A;  4ESX A;  4NF6 A;  1PB8 A;  1NV4 A;  5H8H B;  1URG A;  3CVG A;  4BLA A;  1DCU A;  5H8F A;  3TEL A;  2OLB A;  4DE8 A;  2DVZ A;  4QSC A;  4LP2 B;  4DZ1 A;  4XKN A;  3PPR A;  4GIZ A;  1R9L A;  1LAH E;  3O28 A;  1PC3 A;  4KXP A;  5CBR A;  1CB6 A;  4P1E A;  1IMA A;  1PBQ A;  3K2D A;  1B3F A;  2F3D A;  3OXN A;  1K9Y A;  1XHY A;  4PF8 A;  2QVV A;  1JVY A;  1QJM A;  1MPB A;  3OSQ A;  4PET A;  1MXV A;  4HE2 A;  5CRY A;  4OZ9 A;  1B32 A;  1P1O A;  4YU0 A;  3PU5 A;  1B9J A;  1LCF A;  1A8E A;  3HN0 A;  1JW4 A;  3K00 A;  1IMB A;  1PBP A;  1UIV A;  5I2N B;  3LUY A;  4N81 A;  4PBH A;  4FE8 A;  2Q8M A;  5FTI A;  5A5X B;  2ZYN A;  4QFK A;  4OA4 A;  4FAT A;  2FA7 A;  2P0S A;  1B3H A;  2FNC A;  3FGS A;  4Q5T A;  2AL4 A;  3JV9 A;  2MKZ A;  2UVH A;  3H6W A;  4OFJ A;  1QUK A;  4KYD A;  4ZEC A;  1LBV A;  4O7M A;  3TDJ A;  1SDX A;  4M1V A;  4H8I A;  4FED A;  3VXB A;  2ZXT A;  3C35 A;  2THI A;  2VP1 A;  2PBW A;  4R6H A;  2GHB A;  3BIG A;  3V8X B;  1UTB A;  4O3C A;  4I3E A;  4X8R A;  3LSL A;  3PPO A;  3ILU B;  2I0C A;  4JBZ A;  2E1S A;  3U94 A;  5ET8 A;  1GTK A;  4LZ7 A;  2HXR A;  5ET5 A;  5ELV A;  1D9Q A;  5I59 B;  4UAB A;  3ONM A;  1UTH A;  4DCY A;  3E78 A;  4G8H A;  3KJ7 A;  3O97 A;  2R9J A;  4U4S A;  5CMM A;  1N3X A;  5I5P A;  3E4R A;  3HV1 A;  4ZE9 A;  3S9M C;  3MWB A;  2X26 A;  2H98 A;  1LST A;  1DTZ A;  4I1D A;  3K6X A;  5IKB A;  2Q9T A;  4AS5 A;  4NF8 A;  3H6T A;  4X48 A;  1AL3 A;  3PGF A;  1MM6 A;  3EPE A;  5JK4 A;  2X7P A;  3VDF A;  1N3W A;  1RDZ A;  3CR9 A;  2VPO A;  3MP8 A;  2CZL A;  4DLD A;  4OVP A;  3LSX A;  1NUZ A;  4FAJ A;  3N6T A;  2UYE A;  5AA3 A;  5AE4 A;  4N6K A;  4PQJ A;  4MLQ A;  4RK2 A;  2XXV A;  4ZEB A;  1EYJ A;  3K1N A;  4YB7 A;  4LA9 A;  2A5S A;  1FBF A;  2XD3 A;  2RIN A;  3GYY A;  4PFR A;  3RQT A;  2I3W A;  3QAX A;  1ZJL A;  1MXX A;  4QXD A;  3SET A;  4FEB A;  1BK4 A;  1EU8 A;  4GD5 A;  4Q30 B;  1FBE A;  2F7A A;  2XWV A;  3VVF A;  5ICQ A;  1SBP A;  3FJM A;  3FXU A;  3ISP A;  1GGG A;  4F22 A;  1FSA A;  2I58 A;  3ZKL A;  4C1T A;  1ZLQ A;  4PFW A;  3MC2 A;  1NFT A;  1RYO A;  3K0V A;  1H76 A;  4ND9 A;  5B70 A;  3U72 A;  1USY E;  4AS4 A;  3OEK A;  1GV8 A;  3MZ1 A;  1LBY A;  1BIY A;  2BJI A;  1MS7 A;  2RKM A;  3TEP A;  4EXL A;  3MQ9 A;  5KCJ A;  3QYT A;  3G7W A;  4HCW A;  2WYP A;  1H3D A;  4YAH X;  3FVO A;  1P1U A;  4HTG A;  3SEX A;  2YJP A;  3LR1 A;  5IM2 A;  4EF2 A;  2DE3 A;  2B3F A;  1IEJ A;  3PV0 E;  5HM4 B;  1KZ8 A;  3FBP A;  3ZKK A;  5H8F B;  3TCF A;  3IL1 B;  5CM6 A;  1WVJ A;  2XX8 A;  1QKB A;  1JW5 A;  3TMG A;  3BIH A;  1B4H A;  4MFI A;  3FV2 A;  3CI8 A;  1FQE A;  1FBG A;  2HZL A;  5AA2 D;  5EQ7 A;  5FBP A;  3WAE A;  1MG1 A;  1B1H A;  3PUY E;  2Q2C A;  3WAF A;  5J1D A;  3H7M A;  4KYE A;  3TTK A;  2QL3 A;  3QIM A;  3OEL A;  3H4Z A;  4U22 A;  4ZZE A;  3DEL B;  1SVX B;  3TUS A;  3HCQ A;  5I58 B;  4PDH A;  3T9X B;  2AL5 A;  3QSL A;  3W9W A;  3G3I A;  2O1M A;  4QHQ A;  4ZZA A;  2HAV A;  3MVZ A;  1YXI A;  1MY3 A;  3O2A A;  2DXR A;  3F11 A;  2RF1 A;  5H8Q A;  1FTK A;  2FYI A;  1RDX A;  4OVS A;  5EQ8 A;  4MMP A;  2VPN A;  1Z7N E;  3K01 A;  4PF6 A;  3G3K A;  1QUJ A;  1SQY A;  3M3K A;  3GBB A;  4P8B A;  4F19 A;  2HEU A;  3EN3 A;  2B4L A;  4OMB A;  4TQU Q;  1VDW A;  2XXI A;  4XKR A;  5TP9 B;  2OJT A;  5TPA B;  1BTJ A;  3E79 A;  4F1U A;  4XKP A;  1VFD A;  4OET A;  3RPL A;  4EQ7 A;  3IOU A;  4BDQ A;  3USD A;  4GWZ A;  4GWX A;  4H67 A;  5A5L A;  1URS A;  1XVY A;  2F5X A;  5M2V A;  3LC8 A;  4IGR A;  3FIR A;  2OK2 A;  3DM0 A;  2UXA A;  1IMC A;  3O29 A;  4YB5 A;  4R9F A;  1MPD A;  4PAI A;  1JNF A;  4N91 A;  5AA4 B;  2Y7R A;  2XXX A;  2OX3 A;  3FUZ A;  1NV6 A;  3LSF B;  1MH3 A;  2P2A A;  1FPL A;  4PGN A;  2Q88 A;  4UA8 A;  4LON B;  5CMB A;  4I8C A;  4R74 A;  5HPQ A;  1IQ7 A;  1MQH A;  1JEV A;  4OEV A;  1JVX A;  3TYH A;  5IGA A;  5ESY A;  1YYZ A;  1LBW A;  4BDR A;  2F78 A;  1QUL A;  2Y84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...