4NMYA

Crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
299
structure length
299
Chain Sequence
SKKVTMVLDWTPNTNHTGLFVALDKGYYKEEGLDVEIVQPPESGAETLVATGKADFGISYQEQVTYAKTSEDPLPIKAVATVIQHNTSGFASPKEKNITTAKDFEGKTYGGWGSPSEEAVFKAVMKKNRADFNKLKIVNTGQDDFFAAMKTVDFAWIFEGWDAVKADLIGYDLNFIPVKDLDERLDYYTPLIISNETVLKDNPELAKKFLKATTKGYEYAIKNPEESAKILVKHAPEVDEKLALKSQEYLASKYKDDAPRWGEMKDSVWNNYTSFLKEYKLIDKDMKASDAYTNEFLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC-type transport system, extracellular solute-binding prot
publication title Crystal Structure of the Thiamin-bound form of Substrate-binding Protein of ABC Transporter from Clostridium difficile
rcsb
source organism Clostridium difficile
total genus 103
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nmyA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nmyA01
3S9LC 4ECFA 1ZJLA 3CFXA 5H8QB 5HM4B 4PFYA 1H3DA 1LAHE 1N7WA 3RY3A 1B6HA 2QRYA 3H7MA 1DTGA 1S50A 5B7DA 4H5GA 4KD5A 3RN8A 3U1OA 4Z0IA 3AXFA 1QW0A 3G3JA 3QUFA 3K00A 4R73A 3OO8A 3G3FA 3PUXE 1CB6A 4F31B 2QS1A 1MXWA 2G29A 1ZIUA 1URDA 1A8EA 4U21A 1MM7A 3DELB 4PFTA 5KCJA 3MP1A 3K6VA 5J1DA 3O6HA 1MH4A 3PMVA 1EZ9A 3D4CA 1Y20A 4GF8A 4PE5B 4H8JA 3MZ1A 3VLWA 4BLAA 3C35A 3JZJA 4IO7A 4JWXA 4PETA 3CG1A 1R9QA 3T9XB 3THIA 3K6XA 3KN8A 4LUBA 3U92A 3K02A 4EQ7A 4NWCA 1B1XA 5AA3A 1P1NA 3PUZE 2HQ0A 5FHNA 1MY0A 1B7HA 3H03A 1NH7A 3IL1B 2I0BA 1N3WA 3TDJA 3H06B 5KDTB 4XKRA 1SI0A 4H6DA 1ELJA 2E1SA 4GWOA 1GR2A 2ABHA 3G3GA 1B32A 5A5XB 4BDLA 2F5XA 4ZEDA 4G68C 5JTYB 3FD3A 2X7PA 5L9SA 2OWSA 1CE2A 4G68B 4R6HA 2VOZA 4WEPA 3MQ9A 2A5SA 4DXUA 1MY1A 3RLFE 3VDFA 4JDFA 4RXLA 3FJGA 3MVYA 3TTRA 1B46A 5EHSA 3UGWA 2QS4A 1UIUA 2I4CA 3MVXA 2F6PA 1M5CA 1SYIA 3JYRA 1LCTA 3PPOA 4E0WA 4F1YA 1Y1MA 3B7DA 4ELQA 5IKBA 2Y7PA 4IGTA 1KWHA 4Q8RA 1US5A 3ZKLA 1N3XA 4OEVA 3IJXB 1QKBA 2DWJA 2Y7RA 4NF5B 1POY1 4G8MA 3K0VA 2F78A 1JETA 1M5BA 4IO4A 2PT2A 4YB7A 2ZNSA 5F1QA 4OWDA 2VGQA 1NH8A 3TFLA 3ZKKA 3H3GA 3OO6A 2Q89A 4QSCA 4GFRA 2F97A 3Q25A 1MXVA 2OLBA 2XD2A 5JTYA 4HS7A 3MJNA 5DT6A 5FTHA 2Y7WA 4G68A 4X9TA 1AIVA 4XTCQ 3FZVA 5I2KA 2GH9A 4R9GA 1MPBA 3Q27A 1OIBA 4X48A 4Z7EA 2PT1A 2Q2CA 4H8IA 1XHYA 3K1NA 4KYSA 1JW5A 1TXFA 3T9HB 4O3BA 1B4HA 4EXKA 1FTKA 3HHFA 4TLLB 3VVEA 4IO6A 3KN3A 5M2VA 4F19A 1P1UA 1TT1A 4ZE9A 5AA4A 4BDOA 1S9TA 3E9XA 3V5AA 1AL3A 1PEBA 4F3GA 5JEIA 4RPOA 5TPAB 4WKMA 5H8NA 3K6UA 1LFIA 4DDDA 3HHGA 2I3VA 2XXYA 2UVJA 3D4GA 1URGA 5H8SA 1PBQA 3OEKA 3O28A 1AMFA 2DXRA 2ZYMA 1Y4CA 4BDMA 1NNFA 3N94A 4U1ZA 3H6TA 4POXA 3TAJA 2B3BA 3CVGA 5KZTA 3SDFA 1JW1A 2RC8A 2AL5A 2UVHA 1PB7A 4GL0A 3V83A 4ZEBA 3OOAA 4Q0CA 3FVGA 2O51A 4GXAA 4ZEFA 1Y3QA 2H9BA 2B3FA 1Y1ZA 1LFGA 4EF2A 4O3AA 3RT6B 1P1OA 1WVJA 3FJMA 4X1DA 2DS9A 2D5WA 4PFUA 2H5YA 3C4MA 1MRPA 5H8HB 2GHAA 1BP5A 2D21A 4LZ7A 1DSNA 1BTJA 4KCCA 2O69A 1BLFA 2P2AA 3ZS6A 1JEVA 2R71A 3KG2A 1SW5A 4I62A 2QPQA 5TP9A 5BWJA 3QSLA 1N84A 5CC2A 3O66A 4NF8B 2ZMBA 3DP4A 4F2QA 5K2XA 1A55A 3S9MC 2HCAA 1MQJA 2PYYA 3KJ7A 4UA8A 3TMGA 4JBZA 3S9EA 2HZLA 2F7AA 3M8UA 1GVCA 4F39A 2AIXA 5CMMA 5H8FB 3QK6A 2Q2AA 1QUKA 1B40A 3C9HA 1IXIA 2DE2A 3PU5A 1A40A 4XIGQ 1B5JA 4ZEIA 1A8FA 4LP2B 4GVOA 3QUJA 2Y84A 2QMWA 4YKKA 4AB5A 3LSLA 4E0XA 1MXYA 1O63A 4YKPA 3GLBA 3VLVA 5I84A 4RA1A 2RKMA 3DP6A 4F3BA 5I59B 3KOSA 2XXVA 3CFZA 4DLDA 3TCGA 3OO9A 3JV9A 2V3UA 3RNNA 4NF8A 4OXVA 3KSXA 2XX7A 4MH5A 3B6QA 3R6UA 1B4ZA 3EN3A 3R26A 4C1UA 4ZZAA 3I5OA 3L6HA 1XT8A 4DE8A 2DP8A 1BIYA 5CBRA 2IEEA 3M3FA 3FASA 3OXNA 4P0GA 1LBBA 4GIZA 2HZKA 3SEVA 3T96B 4X1BA 3KSJA 3TYHA 4ZDMA 1A54A 4H67A 3C32A 3OSRA 3LR1A 4QFPA 2HXWA 3UIFA 2E0SA 2H4IA 1JEUA 2UYEA 4YMAA 4FAJA 4AQ4A 5ITOA 3FV2A 2UVIA 4NE4A 1MY3A 2F35A 4XKNA 4YMBA 4EQ9A 3PUWE 1PBPA 5I59A 2ZNTA 4YU0A 3BBRA 3K01A 4F22A 4R6KA 4YICA 1UTHA 4OESA 4HCWA 3KOTA 1EZPA 3FIRA 1MY4A 2XXHA 4BDNA 4YAHX 4FECA 4MLQA 4ELOA 4LQ2A 2DWHA 2V84A 1S7YA 1DOTA 4IY6A 4THIA 3T9VA 3O2AA 4KCDA 1MQIA 1M5EA 2M8CA 3PGFA 2UYFA 4JSOA 1LGBC 4KPTA 1OLAA 3MZ9A 3USDA 3N26A 1ZTYA 2NUVA 3TTNA 4FORA 3N5LA 2V25A 1M5DA 1ZLQA 3HCQA 3E3KA 1IIWA 1JVYA 1MG1A 3M3LA 1POTA 4PP0A 2UXAA 2HFBA 3KJTA 3Q28A 1Y3NA 1FTMA 3KBRA 3DM0A 3K1MA 2HAUA 1H76A 4G8NA 2VD3A 3OMBA 1O7TA 4U4SA 4ZEKA 3TKDA 5H8QA 4I8CA 5EYFA 3H6VA 2THIA 1B58A 3IORA 3RTFB 4U1OA 1YAEA 4U4XA 3BKIB 1I6QA 4HTGA 4YKJA 3EHUA 3HO7A 3KGCA 3OENA 1A99A 5K2YA 4K3FA 1B7UA 3O6GA 3ILUB 1PC3A 3PV0E 4G4PA 3WAEA 2VD2A 5DVIA 2LAOA 5ITPA 2OZZA 2FA7A 2A5TB 4ZS9A 3PD8A 3V8XB 5LOMA 1MS7A 3K4UA 2H25A 2OWTA 1QJMA 2V3TA 3RPWA 1LFHA 5BUUA 3C33A 3LSXA 4OERA 4ESXA 4FE8A 3OO7A 1DPEA 3K1PA 4C1TA 5DVJA 1PB9A 3IO6A 1Y4TA 1B2HA 1FQFA 2F6GA 1D9VA 3KFMA 3PMWA 2XXPA 3E4RA 3MVZA 1QKAA 5KDTA 5I57B 3VV5A 2OBGA 1B52A 3SEUA 5TU0A 5A5XA 2NVUB 1OQHA 3FUZA 3U72A 3DP8A 3A09A 3H6UA 4YKIA 3CI8A 3HV1A 1B3GA 3C31A 1RYOA 4RPNA 1SYHA 5AA2B 1MXZA 1SVXB 3CG3A 2A5TA 3DLNA 1IZ1A 2HEUA 3IR1A 3O9PA 3FATA 1MXXA 1SW4A 5IAIA 2Z22A 4JWYA 4KR5A 4Q30B 4FJPA 4IY5A 4N13A 1H43A 4R9FA 4R2FA 1YCJA 3C36A 1VSOA 4NF5A 3FXRA 4OEUA 3S4UA 3MPLA 1IXHA 3G3IA 1MQHA 3FVNA 1NMUA 2ALUA 3OD7A 3IOVA 1MPCA 5DTBA 2NXOA 2ZYKA 2Y7IA 2XXRA 2PMSA 2XX9A 4LZ8A 3G3HA 3GBAA 4I1DA 3B6TA 5CMBA 1NKXA 4G8HA 5L9MA 1ZU0A 2P0SA 2R6GE 3CFLA 3IAZA 4FATA 2DOJA 2ZNUA 3OEMA 3G3KA 1WODA 4KYDA 3O29A 3VE1B 1NNKA 1UIVA 5L8DA 3A3UA 5EHMA 4GL8A 1SBPA 2ONSA 1XVXA 2I4BA 3FXUA 3MPKA 2ZYNA 5TPAA 1I69A 4P11A 4QSEA 5ISUA 4OZ9A 5I58B 3Q29A 4BDRA 4C0RA 4MBPA 2REJA 1SD3A 4U22A 3CSBA 4IB2A 4U23A 1MH3A 3S2VA 3L6GA 4U2RA 4KFQA 2DE4A 3T22A 3FV1A 2XHDA 5FHMA 1NL5A 2YLNA 4GXSB 2F7CA 2DYXA 2O7IA 3VFJA 4GOTA 1BKAA 1B05A 3LC8A 2QSXA 2I58A 2Z23A 3EF7A 1MDQA 4H65A 4ELRA 5H8HA 1USYH 2XXXA 5L9OA 1VFDA 3ECRA 2BJJX 1FTOA 1NFTA 1LCFA 4LONB 4AB6A 1OMPA 2H98A 2CMOA 1UQWA 3TCHA 2Z8FA 3EHTA 1FTLA 1JW4A 4EF1A 1IEJA 4FEDA 5DYHA 3M3KA 4H1XA 3MC2A 2ONKE 4MLVA 5HBCA 1FQAA 2REGA 1XVYA 3HSTA 3TQWA 4ZECA 3TTKA 4DCXA 5H8FA 3IOTA 2QS2A 3O6IA 4NMYA 1EU8A 2I49A 3TZAA 2XXQA 1PB8A 4TQUQ 1J1NA 4RJZA 4F3PA 4QFNA 2XXWA 3VVDA 4GLIA 2Q8JA 1USYE 2O84X 4OFLA 4YB6A 4DZ1A 2V93A 2F34A 2ANJA 4R74A 4P0IA 2I48A 1F9BA 5CM6A 5KCJB 1B1HA 3UK4A 1RKMA 3VXBA 3VXCA 4DCYA 1P1QA 1SDXA 4KI0E 3FJ7A 1II5A 4EQBA 4LVQA 3PPNA 3KEIA 1TFDA 4LQ5A 1EZOA 2NOOA 3H6WA 1NNTA 1Z7NE 4XKQA 1IUDA 1TWYA 4WXJA 3P7IA 3RQTA 3SETA 2GHBA 3TTMA 2F8DA 1QULA 2DVCA 3SEWA 3IO4A 1WDNA 2NWJA 3MZBA 5HPQA 3OSQA 1B51A 2QS3A 4RNSA 4F29A 4YZZA 4I9DA 2DVZA 4F1UA 4MFIA 2O1MA 3O97A 3RUMA 3UA8A 3PPPA 1I6AA 3TTLA 3PUVE 4XKPA 1IQ7A 1N04A 4DXBA 5I56B 3PMXA 4R2BA 4RK9A 2ONRA 3VVFA 4ND9A 3EHSA 4LATA 2OCUA 3R7XA 4TLMB 4HCYA 1ANFA 3HN0A 2RC9A 4L17A 4OYVA 1FQBA 4PFWA 4OETA 3IK6B 1Y9UA 1US4A 1IITA 2AL4A 3T93B 2DSFA 3QXMA 1GTKA 2FYIA 2DWAA 3MVWA 4NWDA 4LZ5A 3B6WA 4QHQA 4NEDA 4OFOA 4BDQA 3GBBA 3UN6A 4YB5A 2XXIA 1R1NA 3A3CA 1DPPA 1JQFA 2VHAA 4R75A 1HSJA 2Y7KA 1LLSA 3ILTB 3N6TA 1NNPA 3MUQA 3QAXA 1LB8A 1FCKA 1P99A 4NF6B 3MP8A 2RCAA 4PQJA 4EUOA 3IOWA 5B70A 2GFEA 1Q1KA 3CIJA 5I56A 5I2KB 1HSLA 1LSTA 3MAMA 3PPQA 4KHZE 5FTIA 1MDP1 2O68A 4MF3A 2B65A 1N0TA 3GXAA 1MM6A 1FW0A 5CBSA 1LAXA 5DEXB 2DQVA 5AA2D 1OVTA 2I6EA 2P1SA 1Y3PA 2O1LA 2XD3A 1OVBA 4R72A 3U93A 4QFOA 5AA4B 4ZZEA 2AYSA 3IJOB 1SW1A 2DE3A 2X7QA 3SESA 3W15C 3KZGA 1OQGA 3CR9A 4LA9A 5H8NB 1AOVA 1PDAA 2ESNA 2X26A 4NF4B 2Z8EA 4QFLA 1XC1A 2DWIA 1FQDA 4ONYA 2QL3A 3ZSFA 2I0CA 2RC7A 3ODBA 3TPAA 4N07A 4OTEA 1MQGA 1SQYA 4OHNA 5DVFA 1B0HA 3K6WA 3T66A 4NF6A 1IXCA 3KN7A 3MP6A 1B7ZA 3LSWA 3TCFA 3EPEA 3PPRA 4RYAA 2HAVA 4G2ZA 1QVSA 3FVOA 3G7WA 4ELPA 1Q35A 3PD9A 3LSFB 5CMKA 5ICTA 3ONMA 4DXCA 3H4ZA 2YJPA 1FTJA 2PBWA 1B0LA 5DEXA 4OENA 1XOCA 2O7UA 3QYTA 4H5FA 1HSEA 4OFJA 5CI5A 1B3HA 4Q5TA 2Z8DA 4QF9A 2PVUA 4ISUA 2D3IA 3V89B 1YTVA 2Q88A 5I57A 3WAFA 5AA1A 4M1VA 3I3VA 5TP9B 1I6BA 1VE4A 1YPNA 4NF4A 4RY1A 3K2DA 3QIMA 3SEXA 1JVXA 1OLCA 1ZKBA 2I3WA 1R6ZA 3RT8A 1ATGA 3SERA 1MXUA 2XXUA 2F7BA 4QSDA 4F3SA 5AA2A 3TUSA 2G93A 3FXQA 1N76A 3T9UA 3BFUA 3CSGA 2XXTA 4FEBA 3MW0A 2GRVA 3TEPA 1B3FA 3OELA 1P1WA 1IXGA 4N6PA 4QRZA 1B5HA 5I2NB 2OK2A 3F11A 1ZBMA 5FHOA 3LUYA 5AE4A 3UORA 5ELVA 3C34A 5CMCA 1O64A 1URSA 2QJEA 1L5TA 1B9JA 3UP9A 4IGRA 4M4GA 4H0WA 4POWA 3RTWB 1SI1A 2V3QA 3VLUA 1FQEA 2Q9TA 1RYXA 1MY2A 1EH3A 1H44A 3I6VA 1LAGE 4OQOA 1LBCA 4JB7A 3U8QA 4ESWA 4NTLA 3N6UA 2YPNA 2VP1A 2RF1A 1MPDA 1R9LA 2WKYA 3BFTA 4OVJA 1UTBB 2ZXTA 4ZE8A 2QMXA 3TQLA 3LBSA 4KYEA 3IB2A 2W7YA 4GQOA 1MQDA 1FQCA 5F7VA 2FNCA 4G77A 4F2OA 2XX8A 2CZLA 5I2NA 3IOUA 2UVGA 1JNFA 4EDPA 1D3KA 3EQ1A 1H45A 1SW2A 4GD5A 4O3CA 1LAFE 3SEYA 3Q26A 3IX1A 4JWOA 1AH5A 3CRBA 4F18A 3PUYE 1DTZA 1N7XA 4JXIA 5I58A 3IB0A 3TELA 3MWBA 4IO5A 3GZGA 1QUIA 2DXYA 3W9WA 1UTHB 1D9YA 4TOZA 3E13X 2F36A 1M5FA 4UACA 1D4NA 3FVKA 1UTBA 1GV8A 1TFAA 2IA4A 2O6AA 1VR5A 3W9VA 4QFKA 5CRYA 2RCBA 3FGSA 4F1VA 1B3LA 2ZYOA 3U94A 4IO3A 2PX1A 4EXLA 3RGYA 4IO2A 4WEDA 2R9JA 3SKPA 1VFEA 1A7LA 4OMBA 2H99A 3MBPA 4RK2A 4FIMA 5ICQA 3IB1A 3S9NC 4R6YA 4GRKA 1XS5A 2OJTA 2KLFA 4JSDA 4HW8A 1DMBA 1ZMGA 4DIGA 1Z7ME 4XXUA 1GGGA 1T0KA 3HPIA 1QUJA 1LB9A 1B5IA 3TODA 2RINA 5JK4A 1B3EA 4KQPA
chains in the Genus database with same CATH superfamily
1NV1A 3S9LC 4ECFA 1ZJLA 3CFXA 5H8QB 5HM4B 4PFYA 1H3DA 1LAHE 1N7WA 3RY3A 1B6HA 1EYIA 2QRYA 3H7MA 1DTGA 1S50A 5B7DA 1FRPA 4H5GA 4KD5A 3RN8A 3U1OA 4Z0IA 3AXFA 1QW0A 3G3JA 3QUFA 3K00A 4R73A 3OO8A 1FBDA 3G3FA 5I5PA 2ZZVA 3PUXE 1CB6A 5EYGA 2JJKA 4GWSA 4F31B 4NGUA 1LBVA 2QS1A 1MXWA 2G29A 1ZIUA 1URDA 2FBPA 5IZ1A 1A8EA 4U21A 1MM7A 3DELB 4PFTA 5KCJA 2FIXA 3MP1A 3K6VA 5J1DA 3O6HA 3LUZA 1MH4A 3PMVA 1EZ9A 4MJOA 3D4CA 2CEXA 1Y20A 4GF8A 1AWBA 4H8JA 4PE5B 3MZ1A 3VLWA 4BLAA 3C35A 3JZJA 4IO7A 4JWXA 4PETA 3CG1A 3SZPA 1R9QA 3T9XB 3THIA 3K6XA 3KN8A 1VDWA 4LUBA 3U92A 3K02A 4EQ7A 4NWCA 1B1XA 5AA3A 1P1NA 3BIGA 3PUZE 2HQ0A 5IZ3A 4GWWA 5FHNA 1MY0A 3KC1A 3H03A 1B7HA 1NH7A 1FBCA 3IL1B 2I0BA 1N3WA 3TDJA 3H06B 5KDTB 4XKRA 1SI0A 4H6DA 1ELJA 2E1SA 5IZZA 5I7IA 4GWOA 1FBEA 1GR2A 2ABHA 3G3GA 1B32A 5A5XB 4BDLA 2F5XA 4ZEDA 4G68C 5JTYB 3FD3A 2X7PA 5L9SA 2OWSA 1CE2A 4G68B 4R6HA 3GYYA 2VOZA 4WEPA 3MQ9A 2A5SA 4DXUA 1MY1A 3E78A 3RLFE 3VDFA 4JDFA 4RXLA 1FPBA 3FJGA 3MVYA 3TTRA 2BJIA 1B46A 5EHSA 3UGWA 2QS4A 2Y5KA 1UIUA 2I4CA 3MVXA 2F6PA 1M5CA 1SYIA 3JYRA 1FPFA 1LCTA 3PPOA 4NHBA 4E0WA 4F1YA 1Y1MA 1FPJA 3B7DA 2Y5LA 4MMPA 4ELQA 4JVDA 5IKBA 2Y7PA 4IGTA 1KWHA 4Q8RA 1US5A 3ZKLA 1N3XA 4OEVA 3IJXB 2VPOA 1QKBA 2DWJA 2Y7RA 4PDDA 4NF5B 1POY1 2PFYA 4G8MA 3K0VA 2F78A 1JETA 1M5BA 2B4LA 4IO4A 2PT2A 4YB7A 2ZNSA 5F1QA 4OWDA 2VGQA 1NH8A 3TFLA 3ZKKA 3H3GA 1YYZA 3OO6A 2Q89A 4QSCA 4GFRA 2F97A 3Q25A 1MXVA 2OLBA 2XD2A 5JTYA 4HS7A 4QBAA 4XEQA 3MJNA 5DT6A 5FTHA 2Y7WA 4G68A 4X9TA 1AIVA 4XTCQ 1FSAA 1G0HA 3FZVA 5I2KA 2GH9A 4R9GA 1MPBA 1IMEA 2Q8MA 3Q27A 1OIBA 4X48A 4Z7EA 2PT1A 2Q2CA 4H8IA 1XHYA 3K1NA 4KYSA 3PTYA 1JW5A 1TXFA 3T9HB 4O3BA 1B4HA 4EXKA 1FTKA 3HHFA 2XWIA 4TLLB 3VVEA 4IO6A 3KN3A 1FJ9A 5M2VA 4F19A 1P1UA 1TT1A 4ZE9A 5AA4A 4BDOA 1LBWA 1S9TA 3E9XA 4PBQA 3V5AA 1AL3A 2P3NA 4PFRA 1PEBA 4F3GA 5JEIA 4RPOA 5TPAB 4OVRA 4WKMA 5H8NA 3K6UA 1LFIA 1LBYA 4DDDA 3HHGA 2I3VA 2XXYA 2UVJA 3D4GA 1URGA 5H8SA 1PBQA 3OEKA 3O28A 1AMFA 2DXRA 2ZYMA 1Y4CA 4BDMA 1FBPA 1NNFA 3N94A 4U1ZA 3MYUA 3H6TA 4N8YA 4POXA 3TAJA 2FVZA 2B3BA 3CVGA 1NUWA 5KZTA 3SDFA 1JW1A 3IFAA 2RC8A 2AL5A 2UVHA 1PB7A 4GL0A 3IFCA 3V83A 4ZEBA 3OOAA 4Q0CA 3FVGA 2O51A 4GXAA 4ZEFA 1Y3QA 2H9BA 2B3FA 1Y1ZA 1LFGA 4EF2A 4XFEA 4O3AA 3RT6B 1P1OA 1WVJA 3FJMA 4X1DA 2DS9A 2D5WA 4PFUA 2H5YA 3C4MA 1MRPA 4X8RA 5H8HB 2GHAA 1BP5A 2D21A 4LZ7A 1DSNA 1BTJA 4KCCA 2O69A 1BLFA 2P2AA 3ZS6A 1JEVA 2R71A 3KG2A 1SW5A 1IMBA 5EQ7A 4I62A 2QPQA 5TP9A 2HHMA 3QSLA 5BWJA 1N84A 5CC2A 2KR0A 3O66A 4NF8B 2ZMBA 3DP4A 4F2QA 2QVUA 5K2XA 1A55A 3S9MC 2HCAA 4AS5A 1DCUA 1MQJA 2WYKA 2PYYA 3KJ7A 4UA8A 3TMGA 4JBZA 3S9EA 2HZLA 4H46A 2F7AA 3M8UA 1GVCA 1KZ8A 4F39A 2AIXA 5CMMA 5H8FB 3QK6A 2Q2AA 4GWUA 1QUKA 1B40A 4PFBA 3C9HA 1IXIA 2DE2A 3PU5A 1A40A 4XIGQ 1B5JA 2CZKA 4ZEIA 1A8FA 4LP2B 4GVOA 1IMFA 3QUJA 4OVTA 2Y84A 2QMWA 3ISPA 4YKKA 4N17A 4AB5A 3LSLA 4E0XA 3B50A 1MXYA 2OX3A 4KXPA 1O63A 4YKPA 3GLBA 2CEYA 3VLVA 5I84A 4RA1A 2RKMA 3DP6A 4F3BA 5I59B 3KOSA 2XXVA 3CFZA 4DLDA 3TCGA 1RDXA 1KA0A 3OO9A 3JV9A 2V3UA 3RNNA 4NF8A 4OXVA 3KSXA 2XX7A 4MH5A 3B6QA 2WX9A 3R6UA 3RPLA 1B4ZA 3EN3A 3R26A 4C1UA 4N91A 4ZZAA 3I5OA 3L6HA 1XT8A 4DE8A 2DP8A 1BIYA 5CBRA 2IEEA 3M3FA 1YZ0A 3FASA 3OXNA 4P0GA 1LBBA 4GIZA 2HZKA 3SEVA 3T96B 2ZZXA 4X1BA 3KSJA 3TYHA 4ZDMA 1A54A 1NUZA 4H67A 4O94A 2B4MA 3KBZA 3EKIA 3C32A 3OSRA 3LR1A 4QFPA 2HXWA 4P1LA 3UIFA 2E0SA 4GWXA 4OVPA 2H4IA 1JEUA 2UYEA 4YMAA 4FAJA 4AQ4A 5ITOA 3FV2A 2UVIA 4NE4A 1MY3A 2F35A 4XKNA 2QVRA 4PAIA 4YMBA 4EQ9A 5EQ9A 3PUWE 1PBPA 5I59A 4HE2A 2ZNTA 4YU0A 3BBRA 1K9ZA 4NG7A 3K01A 4F22A 4R6KA 4YICA 1UTHA 2KQZA 4OESA 4HCWA 3KOTA 2CZIA 1EZPA 3FIRA 4PF6A 1MY4A 2XXHA 4BDNA 4YAHX 4FECA 4MLQA 2L5VA 4ELOA 4LQ2A 2DWHA 2V84A 1S7YA 1DOTA 4IY6A 4THIA 3T9VA 3O2AA 2P3VA 4KCDA 4GX3A 1MQIA 1M5EA 2M8CA 3PGFA 2UYFA 4JSOA 1LGBC 4KPTA 1OLAA 3MZ9A 4PAKA 3USDA 2WEFA 3N26A 1ZTYA 2NUVA 3TTNA 4FORA 3N5LA 2V25A 1M5DA 1ZLQA 3HCQA 3E3KA 2F3BA 1IIWA 1JVYA 1MG1A 3M3LA 1POTA 1FBFA 5I3SA 4PP0A 2UXAA 2HFBA 3KJTA 3Q28A 1Y3NA 2QVVA 1DBZA 1FTMA 3KBRA 3DM0A 3K1MA 2HAUA 1H76A 4G8NA 2VD3A 3OMBA 1O7TA 4U4SA 4ZEKA 1DK4A 3TKDA 5H8QA 4I8CA 5EYFA 1LEVA 3H6VA 2THIA 1B58A 3IORA 3RTFB 4U1OA 1YAEA 2XWOA 4U4XA 3BKIB 1I6QA 4HTGA 4OANA 4YKJA 3EHUA 3HO7A 3KGCA 5EQAA 3OENA 1A99A 5K2YA 4K3FA 1B7UA 3O6GA 3ILUB 2GQ1A 1PC3A 5IM2A 2FHYA 5EYHA 3PV0E 4I40A 4G4PA 3WAEA 2VD2A 3B8BA 2LAOA 5DVIA 5ITPA 2OZZA 2FA7A 2A5TB 4ZS9A 3PD8A 1NUYA 3V8XB 5LOMA 4N81A 1MS7A 3K4UA 2ZZWA 4MAGA 2H25A 2OWTA 1QJMA 2V3TA 3RPWA 1LFHA 4OERA 3C33A 3LSXA 5BUUA 1LBZA 4ESXA 5J16A 2R8TA 4FE8A 3OO7A 1DPEA 3K1PA 4C1TA 1PB9A 3IO6A 1Y4TA 4NX1A 5DVJA 1B2HA 1FQFA 2F6GA 1D9VA 3KFMA 3PMWA 2XXPA 1FJ6A 3E4RA 3MVZA 1QKAA 5KDTA 5I57B 3VV5A 2OBGA 1B52A 3SEUA 5TU0A 4MEVA 4N8GA 5A5XA 2NVUB 3T1BA 1OQHA 3FUZA 3U72A 4JVIA 4NAPA 3DP8A 3A09A 3H6UA 4YKIA 3CI8A 3HV1A 1B3GA 2VPNA 3C31A 1RYOA 2V4CA 4RPNA 1SYHA 5AA2B 1MXZA 1SVXB 3CG3A 2A5TA 3DLNA 1IZ1A 2HEUA 3IR1A 3O9PA 3FATA 1MXXA 1SW4A 4GWYA 5IAIA 4PTKA 2Z22A 4N15A 4JWYA 4KR5A 4P9KA 4Q30B 4FJPA 4MHFA 4IY5A 2WBBA 4OA4A 4NF0A 4N13A 1H43A 4PFIA 4R9FA 4R2FA 1YCJA 3C36A 1VSOA 4NF5A 2HXRA 3FXRA 1FPGA 4OEUA 3S4UA 4P47A 3MPLA 1IXHA 3FXBA 3G3IA 1FPLA 1MQHA 3FVNA 1NMUA 2ALUA 3OD7A 3IOVA 1MPCA 5DTBA 4GWZA 2NXOA 2CZHA 2ZYKA 2Y7IA 2XXRA 2PMSA 4NN3A 2XX9A 1JP4A 4LZ8A 3G3HA 3GBAA 4I1DA 3B6TA 5CMBA 1NKXA 4G8HA 5L9MA 4MNPA 1ZU0A 1NV0A 2P0SA 2R6GE 3CFLA 3IAZA 4FATA 2DOJA 2ZNUA 3OEMA 3G3KA 1WODA 4KYDA 3O29A 4IR8A 4GBWA 3VE1B 1NNKA 1UIVA 5L8DA 3A3UA 5EHMA 4GL8A 1SBPA 2ONSA 1XVXA 2I4BA 3FXUA 3MPKA 4O7IA 2ZYNA 5TPAA 1I69A 4P11A 4QSEA 4P56A 5ISUA 4PDHA 4AS4A 1Q9DA 4OZ9A 5I58B 4QXDA 3Q29A 4X04A 4BDRA 4C0RA 3T0JA 4MBPA 1NV3A 2REJA 1SD3A 4U22A 3CSBA 4IB2A 4U23A 1MH3A 3S2VA 3L6GA 4U2RA 4KFQA 2DE4A 2FIEA 3T22A 3FV1A 5ET7A 1YXIA 2XHDA 5FHMA 1NL5A 4NQ8A 2YLNA 5EQ8A 4GXSB 2F7CA 3MSTA 2DYXA 2O7IA 4PE3A 3VFJA 4O7MA 4GOTA 1BKAA 1B05A 1INPA 3LC8A 1BK4A 2QSXA 2I58A 4N6DA 2Z23A 3EF7A 1MDQA 4H65A 4ELRA 5H8HA 1USYH 2XXXA 5L9OA 1VFDA 3ECRA 2BJJX 1FTOA 1NFTA 5IGAA 1LCFA 4LONB 4AB6A 1OMPA 2H98A 2CMOA 4I3YA 4P8BA 1UQWA 3TCHA 5F24A 2Z8FA 3EHTA 5ESYA 1FTLA 1JW4A 4EF1A 1IEJA 4FEDA 5DYHA 3M3KA 1D9QA 4H1XA 4PGPA 2XXKA 1FPDA 3MC2A 2ONKE 4MLVA 5HBCA 1FQAA 2REGA 1XVYA 3HSTA 4HE0A 4DI4B 3TQWA 4ZECA 3TTKA 4DCXA 5H8FA 1SPIA 3IOTA 2QS2A 3O6IA 4NMYA 1EU8A 2I49A 2F3DA 2XWVA 3TZAA 2XXQA 2WBDA 1PB8A 4TQUQ 1J1NA 4RJZA 5ET6A 4F3PA 4QFNA 2XXWA 3VVDA 4GLIA 2Q8JA 1USYE 2O84X 4OFLA 4YB6A 4DZ1A 1EYKA 2V93A 2F34A 4PF8A 2ANJA 4R74A 4P0IA 2I48A 1F9BA 5CM6A 5KCJB 1B1HA 5DW8A 3UK4A 1RKMA 3VXBA 3VXCA 4DCYA 3CHGA 1P1QA 1SDXA 1CNQA 4KI0E 3FJ7A 1II5A 4EQBA 4LVQA 3PPNA 3KEIA 1TFDA 4LQ5A 1EZOA 3U65A 2NOOA 3H6WA 1NNTA 1Z7NE 4XKQA 1IUDA 1TWYA 4WXJA 3BIHA 3P7IA 3RQTA 3SETA 3NOHA 4PBHA 2GHBA 3TTMA 2F8DA 5IZ3B 1QULA 2DVCA 3SEWA 3IO4A 1WDNA 2NWJA 3MZBA 5HPQA 3OSQA 1B51A 2QS3A 4RNSA 4F29A 4YZZA 4I9DA 2DVZA 4F1UA 4MFIA 2PFZA 1FBGA 2O1MA 3O97A 3RUMA 3UA8A 3PPPA 1I6AA 4P3LA 3TTLA 3PUVE 1K9YA 4XKPA 1IQ7A 1N04A 4DXBA 5I56B 3PMXA 4R2BA 4RK9A 2ONRA 3VVFA 1RDZA 4ND9A 3EHSA 4LATA 2OCUA 3R7XA 4TLMB 4HCYA 1ANFA 1G0IA 3HN0A 4N4UA 2RC9A 4L17A 5A5LA 4OYVA 1FQBA 4PFWA 4OETA 3IK6B 1Y9UA 1US4A 1IITA 2AL4A 3T93B 2DSFA 3QXMA 3D1RA 1GTKA 2FYIA 2DWAA 3MVWA 4NWDA 4LZ5A 3B6WA 4QHQA 4HE1A 4NEDA 4OFOA 4BDQA 3GBBA 3UN6A 4YB5A 2XXIA 1R1NA 3A3CA 1DPPA 1JQFA 2VHAA 4R75A 3FBPA 1HSJA 2Y7KA 1LLSA 3ILTB 3N6TA 1NNPA 3MUQA 3QAXA 1LB8A 3A29A 1FCKA 1P99A 4NF6B 3MP8A 2RCAA 4PQJA 4XF5A 1NV4A 4EUOA 3IOWA 5B70A 2GFEA 1Q1KA 3CIJA 5I56A 4OVQA 5I2KB 1HSLA 1LSTA 4LN5A 3MAMA 3PPQA 4KHZE 1NV5A 5FTIA 1MDP1 1QGXA 2O68A 4MF3A 2B65A 1N0TA 3GXAA 1MM6A 1FW0A 5CBSA 1LAXA 5DEXB 2DQVA 5AA2D 1OVTA 2I6EA 2P1SA 1Y3PA 2O1LA 2XD3A 1OVBA 4R72A 3U93A 4QFOA 2QFLA 5AA4B 4ZZEA 2AYSA 3IJOB 1SW1A 5LTCA 2DE3A 2X7QA 3SESA 3W15C 3KZGA 1RDYA 1OQGA 3CR9A 4LA9A 5H8NB 1AOVA 1PDAA 2ESNA 2X26A 4NF4B 2Z8EA 4QFLA 4PGNA 1XC1A 2DWIA 1FQDA 4ONYA 2QL3A 3ZSFA 1IMCA 2I0CA 2RC7A 3ODBA 3TPAA 4PAFA 4N07A 4OTEA 1MQGA 1KA1A 1SQYA 4OHNA 5DVFA 1B0HA 3K6WA 3T66A 4NF6A 1IXCA 3KN7A 3MP6A 1B7ZA 3LSWA 3TCFA 3EPEA 3PPRA 4RYAA 2HAVA 4G2ZA 1QVSA 3FVOA 3G7WA 4ELPA 1FPIA 1FTAA 1Q35A 2XWKA 3PD9A 3LSFB 5CMKA 5ICTA 3ONMA 4DXCA 1NUXA 3H4ZA 2XA5A 2Q74A 2YJPA 1FTJA 2PBWA 1B0LA 3KC0A 5DEXA 4OENA 1XOCA 2O7UA 3QYTA 4H5FA 1HSEA 4OFJA 5CI5A 1B3HA 4Q5TA 2Z8DA 4QF9A 2PVUA 1LBXA 4ISUA 2D3IA 4MIJA 3V89B 1YTVA 2Q88A 5I57A 3WAFA 5AA1A 1FPKA 4MNCA 4M1VA 3I3VA 5TP9B 1I6BA 1VE4A 1YPNA 4NF4A 4RY1A 4GBVA 4GX4A 3K2DA 3QIMA 3SEXA 1JVXA 4PC9A 1OLCA 1ZKBA 2I3WA 5T3JA 1R6ZA 3RT8A 1ATGA 3SERA 1MXUA 2XXUA 2F7BA 4QSDA 4F3SA 5AA2A 3TUSA 2G93A 3FXQA 1N76A 3T9UA 3BFUA 3CSGA 2XXTA 4FEBA 2VT5A 3MW0A 2GRVA 4N6KA 3TEPA 1NV6A 1B3FA 3OELA 1P1WA 1IXGA 4N6PA 4QRZA 1B5HA 5I2NB 1FPEA 2OK2A 3F11A 1ZBMA 5FHOA 4G61A 4MCOA 3LUYA 4OVSA 5AE4A 3UORA 5ELVA 3C34A 5CMCA 1O64A 1URSA 2QJEA 1L5TA 1B9JA 3UP9A 4GX6A 4IGRA 4M4GA 4H0WA 4P1EA 4POWA 3RTWB 1SI1A 2V3QA 3VLUA 1FQEA 2Q9TA 1RYXA 1MY2A 1EH3A 1H44A 3I6VA 1LAGE 4OQOA 4H45A 3HFUA 1LBCA 4JB7A 3U8QA 4ESWA 4NTLA 3RPLB 3N6UA 2YPNA 2VP1A 4UABA 2RF1A 1MPDA 1R9LA 1FBHA 2WKYA 3BFTA 4OVJA 1UTBB 2ZXTA 5ET8A 4ZE8A 2QMXA 3TQLA 3LBSA 4FBPA 4KYEA 3IB2A 2W7YA 4GQOA 3RYDA 1MQDA 1FQCA 4MNIA 5F7VA 2FNCA 3QMFA 4G77A 4F2OA 2XX8A 1NI9A 2CZLA 5I2NA 3IOUA 2UVGA 4PCDA 1JNFA 4EDPA 1D3KA 3EQ1A 4O8MA 4MX6A 1H45A 1SW2A 4GD5A 1IMAA 4O3CA 1LAFE 3SEYA 3Q26A 3IX1A 4JWOA 1AH5A 3CRBA 4F18A 4DI3D 3PUYE 1DTZA 1N7XA 2DDKA 4JXIA 5I58A 3IB0A 3TELA 3MWBA 4IO5A 5LDZA 2PCRA 2OWZA 3GZGA 1QUIA 1XI6A 2DXYA 5FBPA 2HPGA 3W9WA 1UTHB 1D9YA 4TOZA 2MKZA 1IMDA 3ROJA 3E13X 2F36A 1NV2A 1M5FA 4UACA 4I3EA 4JVCA 1D4NA 3FVKA 1UTBA 1GV8A 1TFAA 2WYPA 2IA4A 2O6AA 3E79A 1VR5A 1NV7A 3W9VA 4QFKA 5CRYA 1EYJA 2RCBA 3FGSA 4F1VA 1B3LA 2ZYOA 3U94A 4IO3A 2PX1A 4EXLA 5ET5A 3RGYA 4IO2A 4WEDA 2R9JA 4HXVA 3SKPA 1VFEA 1A7LA 4OMBA 2H99A 3MBPA 4RK2A 4FIMA 5ICQA 3IB1A 3S9NC 4R6YA 4GRKA 1XS5A 2OJTA 2KLFA 4JSDA 4HW8A 1DMBA 1ZMGA 3LV0A 4DIGA 1Z7ME 4XXUA 1GGGA 1T0KA 3HPIA 1QUJA 1LB9A 1B5IA 3TODA 2RINA 5JK4A 1B3EA 4KQPA
chains in the Genus database with same CATH topology
3S9LC 4ECFA 1ZJLA 3CFXA 5H8QB 5HM4B 4PFYA 1H3DA 1LAHE 1N7WA 3RY3A 1B6HA 2QRYA 3H7MA 1DTGA 1S50A 5B7DA 4H5GA 4KD5A 3RN8A 3U1OA 4Z0IA 3AXFA 1QW0A 3G3JA 3QUFA 3K00A 4R73A 3OO8A 3G3FA 3PUXE 1CB6A 4F31B 2QS1A 1MXWA 2G29A 1ZIUA 1URDA 1A8EA 4U21A 1MM7A 3DELB 4PFTA 5KCJA 3MP1A 3K6VA 5J1DA 3O6HA 1MH4A 3PMVA 1EZ9A 3D4CA 1Y20A 4GF8A 4PE5B 4H8JA 3MZ1A 3VLWA 4BLAA 3C35A 3JZJA 4IO7A 4JWXA 4PETA 3CG1A 1R9QA 3T9XB 3THIA 3K6XA 3KN8A 4LUBA 3U92A 3K02A 4EQ7A 4NWCA 1B1XA 5AA3A 1P1NA 3PUZE 2HQ0A 5FHNA 1MY0A 1B7HA 3H03A 1NH7A 3IL1B 2I0BA 1N3WA 3TDJA 3H06B 5KDTB 4XKRA 1SI0A 4H6DA 1ELJA 2E1SA 4GWOA 1GR2A 2ABHA 3G3GA 1B32A 5A5XB 4BDLA 2F5XA 4ZEDA 4G68C 5JTYB 3FD3A 2X7PA 5L9SA 2OWSA 1CE2A 4G68B 4R6HA 2VOZA 4WEPA 3MQ9A 2A5SA 4DXUA 1MY1A 3RLFE 3VDFA 4JDFA 4RXLA 3FJGA 3MVYA 3TTRA 1B46A 5EHSA 3UGWA 2QS4A 1UIUA 2I4CA 3MVXA 2F6PA 1M5CA 1SYIA 3JYRA 1LCTA 3PPOA 4E0WA 4F1YA 1Y1MA 3B7DA 4ELQA 5IKBA 2Y7PA 4IGTA 1KWHA 4Q8RA 1US5A 3ZKLA 1N3XA 4OEVA 3IJXB 1QKBA 2DWJA 2Y7RA 4NF5B 1POY1 4G8MA 3K0VA 2F78A 1JETA 1M5BA 4IO4A 2PT2A 4YB7A 2ZNSA 5F1QA 4OWDA 2VGQA 1NH8A 3TFLA 3ZKKA 3H3GA 3OO6A 2Q89A 4QSCA 4GFRA 2F97A 3Q25A 1MXVA 2OLBA 2XD2A 5JTYA 4HS7A 3MJNA 5DT6A 5FTHA 2Y7WA 4G68A 4X9TA 1AIVA 4XTCQ 3FZVA 5I2KA 2GH9A 4R9GA 1MPBA 3Q27A 1OIBA 4X48A 4Z7EA 2PT1A 2Q2CA 4H8IA 1XHYA 3K1NA 4KYSA 1JW5A 1TXFA 3T9HB 4O3BA 1B4HA 4EXKA 1FTKA 3HHFA 4TLLB 3VVEA 4IO6A 3KN3A 5M2VA 4F19A 1P1UA 1TT1A 4ZE9A 5AA4A 4BDOA 1S9TA 3E9XA 3V5AA 1AL3A 1PEBA 4F3GA 5JEIA 4RPOA 5TPAB 4WKMA 5H8NA 3K6UA 1LFIA 4DDDA 3HHGA 2I3VA 2XXYA 2UVJA 3D4GA 1URGA 5H8SA 1PBQA 3OEKA 3O28A 1AMFA 2DXRA 2ZYMA 1Y4CA 4BDMA 1NNFA 3N94A 4U1ZA 3H6TA 4POXA 3TAJA 2B3BA 3CVGA 5KZTA 3SDFA 1JW1A 2RC8A 2AL5A 2UVHA 1PB7A 4GL0A 3V83A 4ZEBA 3OOAA 4Q0CA 3FVGA 2O51A 4GXAA 4ZEFA 1Y3QA 2H9BA 2B3FA 1Y1ZA 1LFGA 4EF2A 4O3AA 3RT6B 1P1OA 1WVJA 3FJMA 4X1DA 2DS9A 2D5WA 4PFUA 2H5YA 3C4MA 1MRPA 5H8HB 2GHAA 1BP5A 2D21A 4LZ7A 1DSNA 1BTJA 4KCCA 2O69A 1BLFA 2P2AA 3ZS6A 1JEVA 2R71A 3KG2A 1SW5A 4I62A 2QPQA 5TP9A 5BWJA 3QSLA 1N84A 5CC2A 3O66A 4NF8B 2ZMBA 3DP4A 4F2QA 5K2XA 1A55A 3S9MC 2HCAA 1MQJA 2PYYA 3KJ7A 4UA8A 3TMGA 4JBZA 3S9EA 2HZLA 2F7AA 3M8UA 1GVCA 4F39A 2AIXA 5CMMA 5H8FB 3QK6A 2Q2AA 1QUKA 1B40A 3C9HA 1IXIA 2DE2A 3PU5A 1A40A 4XIGQ 1B5JA 4ZEIA 1A8FA 4LP2B 4GVOA 3QUJA 2Y84A 2QMWA 4YKKA 4AB5A 3LSLA 4E0XA 1MXYA 1O63A 4YKPA 3GLBA 3VLVA 5I84A 4RA1A 2RKMA 3DP6A 4F3BA 5I59B 3KOSA 2XXVA 3CFZA 4DLDA 3TCGA 3OO9A 3JV9A 2V3UA 3RNNA 4NF8A 4OXVA 3KSXA 2XX7A 4MH5A 3B6QA 3R6UA 1B4ZA 3EN3A 3R26A 4C1UA 4ZZAA 3I5OA 3L6HA 1XT8A 4DE8A 2DP8A 1BIYA 5CBRA 2IEEA 3M3FA 3FASA 3OXNA 4P0GA 1LBBA 4GIZA 2HZKA 3SEVA 3T96B 4X1BA 3KSJA 3TYHA 4ZDMA 1A54A 4H67A 3C32A 3OSRA 3LR1A 4QFPA 2HXWA 3UIFA 2E0SA 2H4IA 1JEUA 2UYEA 4YMAA 4FAJA 4AQ4A 5ITOA 3FV2A 2UVIA 4NE4A 1MY3A 2F35A 4XKNA 4YMBA 4EQ9A 3PUWE 1PBPA 5I59A 2ZNTA 4YU0A 3BBRA 3K01A 4F22A 4R6KA 4YICA 1UTHA 4OESA 4HCWA 3KOTA 1EZPA 3FIRA 1MY4A 2XXHA 4BDNA 4YAHX 4FECA 4MLQA 4ELOA 4LQ2A 2DWHA 2V84A 1S7YA 1DOTA 4IY6A 4THIA 3T9VA 3O2AA 4KCDA 1MQIA 1M5EA 2M8CA 3PGFA 2UYFA 4JSOA 1LGBC 4KPTA 1OLAA 3MZ9A 3USDA 3N26A 1ZTYA 2NUVA 3TTNA 4FORA 3N5LA 2V25A 1M5DA 1ZLQA 3HCQA 3E3KA 1IIWA 1JVYA 1MG1A 3M3LA 1POTA 4PP0A 2UXAA 2HFBA 3KJTA 3Q28A 1Y3NA 1FTMA 3KBRA 3DM0A 3K1MA 2HAUA 1H76A 4G8NA 2VD3A 3OMBA 1O7TA 4U4SA 4ZEKA 3TKDA 5H8QA 4I8CA 5EYFA 3H6VA 2THIA 1B58A 3IORA 3RTFB 4U1OA 1YAEA 4U4XA 3BKIB 1I6QA 4HTGA 4YKJA 3EHUA 3HO7A 3KGCA 3OENA 1A99A 5K2YA 4K3FA 1B7UA 3O6GA 3ILUB 1PC3A 3PV0E 4G4PA 3WAEA 2VD2A 5DVIA 2LAOA 5ITPA 2OZZA 2FA7A 2A5TB 4ZS9A 3PD8A 3V8XB 5LOMA 1MS7A 3K4UA 2H25A 2OWTA 1QJMA 2V3TA 3RPWA 1LFHA 5BUUA 3C33A 3LSXA 4OERA 4ESXA 4FE8A 3OO7A 1DPEA 3K1PA 4C1TA 5DVJA 1PB9A 3IO6A 1Y4TA 1B2HA 1FQFA 2F6GA 1D9VA 3KFMA 3PMWA 2XXPA 3E4RA 3MVZA 1QKAA 5KDTA 5I57B 3VV5A 2OBGA 1B52A 3SEUA 5TU0A 5A5XA 2NVUB 1OQHA 3FUZA 3U72A 3DP8A 3A09A 3H6UA 4YKIA 3CI8A 3HV1A 1B3GA 3C31A 1RYOA 4RPNA 1SYHA 5AA2B 1MXZA 1SVXB 3CG3A 2A5TA 3DLNA 1IZ1A 2HEUA 3IR1A 3O9PA 3FATA 1MXXA 1SW4A 5IAIA 2Z22A 4JWYA 4KR5A 4Q30B 4FJPA 4IY5A 4N13A 1H43A 4R9FA 4R2FA 1YCJA 3C36A 1VSOA 4NF5A 3FXRA 4OEUA 3S4UA 3MPLA 1IXHA 3G3IA 1MQHA 3FVNA 1NMUA 2ALUA 3OD7A 3IOVA 1MPCA 5DTBA 2NXOA 2ZYKA 2Y7IA 2XXRA 2PMSA 2XX9A 4LZ8A 3G3HA 3GBAA 4I1DA 3B6TA 5CMBA 1NKXA 4G8HA 5L9MA 1ZU0A 2P0SA 2R6GE 3CFLA 3IAZA 4FATA 2DOJA 2ZNUA 3OEMA 3G3KA 1WODA 4KYDA 3O29A 3VE1B 1NNKA 1UIVA 5L8DA 3A3UA 5EHMA 4GL8A 1SBPA 2ONSA 1XVXA 2I4BA 3FXUA 3MPKA 2ZYNA 5TPAA 1I69A 4P11A 4QSEA 5ISUA 4OZ9A 5I58B 3Q29A 4BDRA 4C0RA 4MBPA 2REJA 1SD3A 4U22A 3CSBA 4IB2A 4U23A 1MH3A 3S2VA 3L6GA 4U2RA 4KFQA 2DE4A 3T22A 3FV1A 2XHDA 5FHMA 1NL5A 2YLNA 4GXSB 2F7CA 2DYXA 2O7IA 3VFJA 4GOTA 1BKAA 1B05A 3LC8A 2QSXA 2I58A 2Z23A 3EF7A 1MDQA 4H65A 4ELRA 5H8HA 1USYH 2XXXA 5L9OA 1VFDA 3ECRA 2BJJX 1FTOA 1NFTA 1LCFA 4LONB 4AB6A 1OMPA 2H98A 2CMOA 1UQWA 3TCHA 2Z8FA 3EHTA 1FTLA 1JW4A 4EF1A 1IEJA 4FEDA 5DYHA 3M3KA 4H1XA 3MC2A 2ONKE 4MLVA 5HBCA 1FQAA 2REGA 1XVYA 3HSTA 3TQWA 4ZECA 3TTKA 4DCXA 5H8FA 3IOTA 2QS2A 3O6IA 4NMYA 1EU8A 2I49A 3TZAA 2XXQA 1PB8A 4TQUQ 1J1NA 4RJZA 4F3PA 4QFNA 2XXWA 3VVDA 4GLIA 2Q8JA 1USYE 2O84X 4OFLA 4YB6A 4DZ1A 2V93A 2F34A 2ANJA 4R74A 4P0IA 2I48A 1F9BA 5CM6A 5KCJB 1B1HA 3UK4A 1RKMA 3VXBA 3VXCA 4DCYA 1P1QA 1SDXA 4KI0E 3FJ7A 1II5A 4EQBA 4LVQA 3PPNA 3KEIA 1TFDA 4LQ5A 1EZOA 2NOOA 3H6WA 1NNTA 1Z7NE 4XKQA 1IUDA 1TWYA 4WXJA 3P7IA 3RQTA 3SETA 2GHBA 3TTMA 2F8DA 1QULA 2DVCA 3SEWA 3IO4A 1WDNA 2NWJA 3MZBA 5HPQA 3OSQA 1B51A 2QS3A 4RNSA 4F29A 4YZZA 4I9DA 2DVZA 4F1UA 4MFIA 2O1MA 3O97A 3RUMA 3UA8A 3PPPA 1I6AA 3TTLA 3PUVE 4XKPA 1IQ7A 1N04A 4DXBA 5I56B 3PMXA 4R2BA 4RK9A 2ONRA 3VVFA 4ND9A 3EHSA 4LATA 2OCUA 3R7XA 4TLMB 4HCYA 1ANFA 3HN0A 2RC9A 4L17A 4OYVA 1FQBA 4PFWA 4OETA 3IK6B 1Y9UA 1US4A 1IITA 2AL4A 3T93B 2DSFA 3QXMA 1GTKA 2FYIA 2DWAA 3MVWA 4NWDA 4LZ5A 3B6WA 4QHQA 4NEDA 4OFOA 4BDQA 3GBBA 3UN6A 4YB5A 2XXIA 1R1NA 3A3CA 1DPPA 1JQFA 2VHAA 4R75A 1HSJA 2Y7KA 1LLSA 3ILTB 3N6TA 1NNPA 3MUQA 3QAXA 1LB8A 1FCKA 1P99A 4NF6B 3MP8A 2RCAA 4PQJA 4EUOA 3IOWA 5B70A 2GFEA 1Q1KA 3CIJA 5I56A 5I2KB 1HSLA 1LSTA 3MAMA 3PPQA 4KHZE 5FTIA 1MDP1 2O68A 4MF3A 2B65A 1N0TA 3GXAA 1MM6A 1FW0A 5CBSA 1LAXA 5DEXB 2DQVA 5AA2D 1OVTA 2I6EA 2P1SA 1Y3PA 2O1LA 2XD3A 1OVBA 4R72A 3U93A 4QFOA 5AA4B 4ZZEA 2AYSA 3IJOB 1SW1A 2DE3A 2X7QA 3SESA 3W15C 3KZGA 1OQGA 3CR9A 4LA9A 5H8NB 1AOVA 1PDAA 2ESNA 2X26A 4NF4B 2Z8EA 4QFLA 1XC1A 2DWIA 1FQDA 4ONYA 2QL3A 3ZSFA 2I0CA 2RC7A 3ODBA 3TPAA 4N07A 4OTEA 1MQGA 1SQYA 4OHNA 5DVFA 1B0HA 3K6WA 3T66A 4NF6A 1IXCA 3KN7A 3MP6A 1B7ZA 3LSWA 3TCFA 3EPEA 3PPRA 4RYAA 2HAVA 4G2ZA 1QVSA 3FVOA 3G7WA 4ELPA 1Q35A 3PD9A 3LSFB 5CMKA 5ICTA 3ONMA 4DXCA 3H4ZA 2YJPA 1FTJA 2PBWA 1B0LA 5DEXA 4OENA 1XOCA 2O7UA 3QYTA 4H5FA 1HSEA 4OFJA 5CI5A 1B3HA 4Q5TA 2Z8DA 4QF9A 2PVUA 4ISUA 2D3IA 3V89B 1YTVA 2Q88A 5I57A 3WAFA 5AA1A 4M1VA 3I3VA 5TP9B 1I6BA 1VE4A 1YPNA 4NF4A 4RY1A 3K2DA 3QIMA 3SEXA 1JVXA 1OLCA 1ZKBA 2I3WA 1R6ZA 3RT8A 1ATGA 3SERA 1MXUA 2XXUA 2F7BA 4QSDA 4F3SA 5AA2A 3TUSA 2G93A 3FXQA 1N76A 3T9UA 3BFUA 3CSGA 2XXTA 4FEBA 3MW0A 2GRVA 3TEPA 1B3FA 3OELA 1P1WA 1IXGA 4N6PA 4QRZA 1B5HA 5I2NB 2OK2A 3F11A 1ZBMA 5FHOA 3LUYA 5AE4A 3UORA 5ELVA 3C34A 5CMCA 1O64A 1URSA 2QJEA 1L5TA 1B9JA 3UP9A 4IGRA 4M4GA 4H0WA 4POWA 3RTWB 1SI1A 2V3QA 3VLUA 1FQEA 2Q9TA 1RYXA 1MY2A 1EH3A 1H44A 3I6VA 1LAGE 4OQOA 1LBCA 4JB7A 3U8QA 4ESWA 4NTLA 3N6UA 2YPNA 2VP1A 2RF1A 1MPDA 1R9LA 2WKYA 3BFTA 4OVJA 1UTBB 2ZXTA 4ZE8A 2QMXA 3TQLA 3LBSA 4KYEA 3IB2A 2W7YA 4GQOA 1MQDA 1FQCA 5F7VA 2FNCA 4G77A 4F2OA 2XX8A 2CZLA 5I2NA 3IOUA 2UVGA 1JNFA 4EDPA 1D3KA 3EQ1A 1H45A 1SW2A 4GD5A 4O3CA 1LAFE 3SEYA 3Q26A 3IX1A 4JWOA 1AH5A 3CRBA 4F18A 3PUYE 1DTZA 1N7XA 4JXIA 5I58A 3IB0A 3TELA 3MWBA 4IO5A 3GZGA 1QUIA 2DXYA 3W9WA 1UTHB 1D9YA 4TOZA 3E13X 2F36A 1M5FA 4UACA 1D4NA 3FVKA 1UTBA 1GV8A 1TFAA 2IA4A 2O6AA 1VR5A 3W9VA 4QFKA 5CRYA 2RCBA 3FGSA 4F1VA 1B3LA 2ZYOA 3U94A 4IO3A 2PX1A 4EXLA 3RGYA 4IO2A 4WEDA 2R9JA 3SKPA 1VFEA 1A7LA 4OMBA 2H99A 3MBPA 4RK2A 4FIMA 5ICQA 3IB1A 3S9NC 4R6YA 4GRKA 1XS5A 2OJTA 2KLFA 4JSDA 4HW8A 1DMBA 1ZMGA 4DIGA 1Z7ME 4XXUA 1GGGA 1T0KA 3HPIA 1QUJA 1LB9A 1B5IA 3TODA 2RINA 5JK4A 1B3EA 4KQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9L C;  4ECF A;  1ZJL A;  3CFX A;  5H8Q B;  5HM4 B;  4PFY A;  1H3D A;  1LAH E;  1N7W A;  3RY3 A;  1B6H A;  2QRY A;  3H7M A;  1DTG A;  1S50 A;  5B7D A;  4H5G A;  4KD5 A;  3RN8 A;  3U1O A;  4Z0I A;  3AXF A;  1QW0 A;  3G3J A;  3QUF A;  3K00 A;  4R73 A;  3OO8 A;  3G3F A;  3PUX E;  1CB6 A;  4F31 B;  2QS1 A;  1MXW A;  2G29 A;  1ZIU A;  1URD A;  1A8E A;  4U21 A;  1MM7 A;  3DEL B;  4PFT A;  5KCJ A;  3MP1 A;  3K6V A;  5J1D A;  3O6H A;  1MH4 A;  3PMV A;  1EZ9 A;  3D4C A;  1Y20 A;  4GF8 A;  4PE5 B;  4H8J A;  3MZ1 A;  3VLW A;  4BLA A;  3C35 A;  3JZJ A;  4IO7 A;  4JWX A;  4PET A;  3CG1 A;  1R9Q A;  3T9X B;  3THI A;  3K6X A;  3KN8 A;  4LUB A;  3U92 A;  3K02 A;  4EQ7 A;  4NWC A;  1B1X A;  5AA3 A;  1P1N A;  3PUZ E;  2HQ0 A;  5FHN A;  1MY0 A;  1B7H A;  3H03 A;  1NH7 A;  3IL1 B;  2I0B A;  1N3W A;  3TDJ A;  3H06 B;  5KDT B;  4XKR A;  1SI0 A;  4H6D A;  1ELJ A;  2E1S A;  4GWO A;  1GR2 A;  2ABH A;  3G3G A;  1B32 A;  5A5X B;  4BDL A;  2F5X A;  4ZED A;  4G68 C;  5JTY B;  3FD3 A;  2X7P A;  5L9S A;  2OWS A;  1CE2 A;  4G68 B;  4R6H A;  2VOZ A;  4WEP A;  3MQ9 A;  2A5S A;  4DXU A;  1MY1 A;  3RLF E;  3VDF A;  4JDF A;  4RXL A;  3FJG A;  3MVY A;  3TTR A;  1B46 A;  5EHS A;  3UGW A;  2QS4 A;  1UIU A;  2I4C A;  3MVX A;  2F6P A;  1M5C A;  1SYI A;  3JYR A;  1LCT A;  3PPO A;  4E0W A;  4F1Y A;  1Y1M A;  3B7D A;  4ELQ A;  5IKB A;  2Y7P A;  4IGT A;  1KWH A;  4Q8R A;  1US5 A;  3ZKL A;  1N3X A;  4OEV A;  3IJX B;  1QKB A;  2DWJ A;  2Y7R A;  4NF5 B;  1POY 1;  4G8M A;  3K0V A;  2F78 A;  1JET A;  1M5B A;  4IO4 A;  2PT2 A;  4YB7 A;  2ZNS A;  5F1Q A;  4OWD A;  2VGQ A;  1NH8 A;  3TFL A;  3ZKK A;  3H3G A;  3OO6 A;  2Q89 A;  4QSC A;  4GFR A;  2F97 A;  3Q25 A;  1MXV A;  2OLB A;  2XD2 A;  5JTY A;  4HS7 A;  3MJN A;  5DT6 A;  5FTH A;  2Y7W A;  4G68 A;  4X9T A;  1AIV A;  4XTC Q;  3FZV A;  5I2K A;  2GH9 A;  4R9G A;  1MPB A;  3Q27 A;  1OIB A;  4X48 A;  4Z7E A;  2PT1 A;  2Q2C A;  4H8I A;  1XHY A;  3K1N A;  4KYS A;  1JW5 A;  1TXF A;  3T9H B;  4O3B A;  1B4H A;  4EXK A;  1FTK A;  3HHF A;  4TLL B;  3VVE A;  4IO6 A;  3KN3 A;  5M2V A;  4F19 A;  1P1U A;  1TT1 A;  4ZE9 A;  5AA4 A;  4BDO A;  1S9T A;  3E9X A;  3V5A A;  1AL3 A;  1PEB A;  4F3G A;  5JEI A;  4RPO A;  5TPA B;  4WKM A;  5H8N A;  3K6U A;  1LFI A;  4DDD A;  3HHG A;  2I3V A;  2XXY A;  2UVJ A;  3D4G A;  1URG A;  5H8S A;  1PBQ A;  3OEK A;  3O28 A;  1AMF A;  2DXR A;  2ZYM A;  1Y4C A;  4BDM A;  1NNF A;  3N94 A;  4U1Z A;  3H6T A;  4POX A;  3TAJ A;  2B3B A;  3CVG A;  5KZT A;  3SDF A;  1JW1 A;  2RC8 A;  2AL5 A;  2UVH A;  1PB7 A;  4GL0 A;  3V83 A;  4ZEB A;  3OOA A;  4Q0C A;  3FVG A;  2O51 A;  4GXA A;  4ZEF A;  1Y3Q A;  2H9B A;  2B3F A;  1Y1Z A;  1LFG A;  4EF2 A;  4O3A A;  3RT6 B;  1P1O A;  1WVJ A;  3FJM A;  4X1D A;  2DS9 A;  2D5W A;  4PFU A;  2H5Y A;  3C4M A;  1MRP A;  5H8H B;  2GHA A;  1BP5 A;  2D21 A;  4LZ7 A;  1DSN A;  1BTJ A;  4KCC A;  2O69 A;  1BLF A;  2P2A A;  3ZS6 A;  1JEV A;  2R71 A;  3KG2 A;  1SW5 A;  4I62 A;  2QPQ A;  5TP9 A;  5BWJ A;  3QSL A;  1N84 A;  5CC2 A;  3O66 A;  4NF8 B;  2ZMB A;  3DP4 A;  4F2Q A;  5K2X A;  1A55 A;  3S9M C;  2HCA A;  1MQJ A;  2PYY A;  3KJ7 A;  4UA8 A;  3TMG A;  4JBZ A;  3S9E A;  2HZL A;  2F7A A;  3M8U A;  1GVC A;  4F39 A;  2AIX A;  5CMM A;  5H8F B;  3QK6 A;  2Q2A A;  1QUK A;  1B40 A;  3C9H A;  1IXI A;  2DE2 A;  3PU5 A;  1A40 A;  4XIG Q;  1B5J A;  4ZEI A;  1A8F A;  4LP2 B;  4GVO A;  3QUJ A;  2Y84 A;  2QMW A;  4YKK A;  4AB5 A;  3LSL A;  4E0X A;  1MXY A;  1O63 A;  4YKP A;  3GLB A;  3VLV A;  5I84 A;  4RA1 A;  2RKM A;  3DP6 A;  4F3B A;  5I59 B;  3KOS A;  2XXV A;  3CFZ A;  4DLD A;  3TCG A;  3OO9 A;  3JV9 A;  2V3U A;  3RNN A;  4NF8 A;  4OXV A;  3KSX A;  2XX7 A;  4MH5 A;  3B6Q A;  3R6U A;  1B4Z A;  3EN3 A;  3R26 A;  4C1U A;  4ZZA A;  3I5O A;  3L6H A;  1XT8 A;  4DE8 A;  2DP8 A;  1BIY A;  5CBR A;  2IEE A;  3M3F A;  3FAS A;  3OXN A;  4P0G A;  1LBB A;  4GIZ A;  2HZK A;  3SEV A;  3T96 B;  4X1B A;  3KSJ A;  3TYH A;  4ZDM A;  1A54 A;  4H67 A;  3C32 A;  3OSR A;  3LR1 A;  4QFP A;  2HXW A;  3UIF A;  2E0S A;  2H4I A;  1JEU A;  2UYE A;  4YMA A;  4FAJ A;  4AQ4 A;  5ITO A;  3FV2 A;  2UVI A;  4NE4 A;  1MY3 A;  2F35 A;  4XKN A;  4YMB A;  4EQ9 A;  3PUW E;  1PBP A;  5I59 A;  2ZNT A;  4YU0 A;  3BBR A;  3K01 A;  4F22 A;  4R6K A;  4YIC A;  1UTH A;  4OES A;  4HCW A;  3KOT A;  1EZP A;  3FIR A;  1MY4 A;  2XXH A;  4BDN A;  4YAH X;  4FEC A;  4MLQ A;  4ELO A;  4LQ2 A;  2DWH A;  2V84 A;  1S7Y A;  1DOT A;  4IY6 A;  4THI A;  3T9V A;  3O2A A;  4KCD A;  1MQI A;  1M5E A;  2M8C A;  3PGF A;  2UYF A;  4JSO A;  1LGB C;  4KPT A;  1OLA A;  3MZ9 A;  3USD A;  3N26 A;  1ZTY A;  2NUV A;  3TTN A;  4FOR A;  3N5L A;  2V25 A;  1M5D A;  1ZLQ A;  3HCQ A;  3E3K A;  1IIW A;  1JVY A;  1MG1 A;  3M3L A;  1POT A;  4PP0 A;  2UXA A;  2HFB A;  3KJT A;  3Q28 A;  1Y3N A;  1FTM A;  3KBR A;  3DM0 A;  3K1M A;  2HAU A;  1H76 A;  4G8N A;  2VD3 A;  3OMB A;  1O7T A;  4U4S A;  4ZEK A;  3TKD A;  5H8Q A;  4I8C A;  5EYF A;  3H6V A;  2THI A;  1B58 A;  3IOR A;  3RTF B;  4U1O A;  1YAE A;  4U4X A;  3BKI B;  1I6Q A;  4HTG A;  4YKJ A;  3EHU A;  3HO7 A;  3KGC A;  3OEN A;  1A99 A;  5K2Y A;  4K3F A;  1B7U A;  3O6G A;  3ILU B;  1PC3 A;  3PV0 E;  4G4P A;  3WAE A;  2VD2 A;  5DVI A;  2LAO A;  5ITP A;  2OZZ A;  2FA7 A;  2A5T B;  4ZS9 A;  3PD8 A;  3V8X B;  5LOM A;  1MS7 A;  3K4U A;  2H25 A;  2OWT A;  1QJM A;  2V3T A;  3RPW A;  1LFH A;  5BUU A;  3C33 A;  3LSX A;  4OER A;  4ESX A;  4FE8 A;  3OO7 A;  1DPE A;  3K1P A;  4C1T A;  5DVJ A;  1PB9 A;  3IO6 A;  1Y4T A;  1B2H A;  1FQF A;  2F6G A;  1D9V A;  3KFM A;  3PMW A;  2XXP A;  3E4R A;  3MVZ A;  1QKA A;  5KDT A;  5I57 B;  3VV5 A;  2OBG A;  1B52 A;  3SEU A;  5TU0 A;  5A5X A;  2NVU B;  1OQH A;  3FUZ A;  3U72 A;  3DP8 A;  3A09 A;  3H6U A;  4YKI A;  3CI8 A;  3HV1 A;  1B3G A;  3C31 A;  1RYO A;  4RPN A;  1SYH A;  5AA2 B;  1MXZ A;  1SVX B;  3CG3 A;  2A5T A;  3DLN A;  1IZ1 A;  2HEU A;  3IR1 A;  3O9P A;  3FAT A;  1MXX A;  1SW4 A;  5IAI A;  2Z22 A;  4JWY A;  4KR5 A;  4Q30 B;  4FJP A;  4IY5 A;  4N13 A;  1H43 A;  4R9F A;  4R2F A;  1YCJ A;  3C36 A;  1VSO A;  4NF5 A;  3FXR A;  4OEU A;  3S4U A;  3MPL A;  1IXH A;  3G3I A;  1MQH A;  3FVN A;  1NMU A;  2ALU A;  3OD7 A;  3IOV A;  1MPC A;  5DTB A;  2NXO A;  2ZYK A;  2Y7I A;  2XXR A;  2PMS A;  2XX9 A;  4LZ8 A;  3G3H A;  3GBA A;  4I1D A;  3B6T A;  5CMB A;  1NKX A;  4G8H A;  5L9M A;  1ZU0 A;  2P0S A;  2R6G E;  3CFL A;  3IAZ A;  4FAT A;  2DOJ A;  2ZNU A;  3OEM A;  3G3K A;  1WOD A;  4KYD A;  3O29 A;  3VE1 B;  1NNK A;  1UIV A;  5L8D A;  3A3U A;  5EHM A;  4GL8 A;  1SBP A;  2ONS A;  1XVX A;  2I4B A;  3FXU A;  3MPK A;  2ZYN A;  5TPA A;  1I69 A;  4P11 A;  4QSE A;  5ISU A;  4OZ9 A;  5I58 B;  3Q29 A;  4BDR A;  4C0R A;  4MBP A;  2REJ A;  1SD3 A;  4U22 A;  3CSB A;  4IB2 A;  4U23 A;  1MH3 A;  3S2V A;  3L6G A;  4U2R A;  4KFQ A;  2DE4 A;  3T22 A;  3FV1 A;  2XHD A;  5FHM A;  1NL5 A;  2YLN A;  4GXS B;  2F7C A;  2DYX A;  2O7I A;  3VFJ A;  4GOT A;  1BKA A;  1B05 A;  3LC8 A;  2QSX A;  2I58 A;  2Z23 A;  3EF7 A;  1MDQ A;  4H65 A;  4ELR A;  5H8H A;  1USY H;  2XXX A;  5L9O A;  1VFD A;  3ECR A;  2BJJ X;  1FTO A;  1NFT A;  1LCF A;  4LON B;  4AB6 A;  1OMP A;  2H98 A;  2CMO A;  1UQW A;  3TCH A;  2Z8F A;  3EHT A;  1FTL A;  1JW4 A;  4EF1 A;  1IEJ A;  4FED A;  5DYH A;  3M3K A;  4H1X A;  3MC2 A;  2ONK E;  4MLV A;  5HBC A;  1FQA A;  2REG A;  1XVY A;  3HST A;  3TQW A;  4ZEC A;  3TTK A;  4DCX A;  5H8F A;  3IOT A;  2QS2 A;  3O6I A;  4NMY A;  1EU8 A;  2I49 A;  3TZA A;  2XXQ A;  1PB8 A;  4TQU Q;  1J1N A;  4RJZ A;  4F3P A;  4QFN A;  2XXW A;  3VVD A;  4GLI A;  2Q8J A;  1USY E;  2O84 X;  4OFL A;  4YB6 A;  4DZ1 A;  2V93 A;  2F34 A;  2ANJ A;  4R74 A;  4P0I A;  2I48 A;  1F9B A;  5CM6 A;  5KCJ B;  1B1H A;  3UK4 A;  1RKM A;  3VXB A;  3VXC A;  4DCY A;  1P1Q A;  1SDX A;  4KI0 E;  3FJ7 A;  1II5 A;  4EQB A;  4LVQ A;  3PPN A;  3KEI A;  1TFD A;  4LQ5 A;  1EZO A;  2NOO A;  3H6W A;  1NNT A;  1Z7N E;  4XKQ A;  1IUD A;  1TWY A;  4WXJ A;  3P7I A;  3RQT A;  3SET A;  2GHB A;  3TTM A;  2F8D A;  1QUL A;  2DVC A;  3SEW A;  3IO4 A;  1WDN A;  2NWJ A;  3MZB A;  5HPQ A;  3OSQ A;  1B51 A;  2QS3 A;  4RNS A;  4F29 A;  4YZZ A;  4I9D A;  2DVZ A;  4F1U A;  4MFI A;  2O1M A;  3O97 A;  3RUM A;  3UA8 A;  3PPP A;  1I6A A;  3TTL A;  3PUV E;  4XKP A;  1IQ7 A;  1N04 A;  4DXB A;  5I56 B;  3PMX A;  4R2B A;  4RK9 A;  2ONR A;  3VVF A;  4ND9 A;  3EHS A;  4LAT A;  2OCU A;  3R7X A;  4TLM B;  4HCY A;  1ANF A;  3HN0 A;  2RC9 A;  4L17 A;  4OYV A;  1FQB A;  4PFW A;  4OET A;  3IK6 B;  1Y9U A;  1US4 A;  1IIT A;  2AL4 A;  3T93 B;  2DSF A;  3QXM A;  1GTK A;  2FYI A;  2DWA A;  3MVW A;  4NWD A;  4LZ5 A;  3B6W A;  4QHQ A;  4NED A;  4OFO A;  4BDQ A;  3GBB A;  3UN6 A;  4YB5 A;  2XXI A;  1R1N A;  3A3C A;  1DPP A;  1JQF A;  2VHA A;  4R75 A;  1HSJ A;  2Y7K A;  1LLS A;  3ILT B;  3N6T A;  1NNP A;  3MUQ A;  3QAX A;  1LB8 A;  1FCK A;  1P99 A;  4NF6 B;  3MP8 A;  2RCA A;  4PQJ A;  4EUO A;  3IOW A;  5B70 A;  2GFE A;  1Q1K A;  3CIJ A;  5I56 A;  5I2K B;  1HSL A;  1LST A;  3MAM A;  3PPQ A;  4KHZ E;  5FTI A;  1MDP 1;  2O68 A;  4MF3 A;  2B65 A;  1N0T A;  3GXA A;  1MM6 A;  1FW0 A;  5CBS A;  1LAX A;  5DEX B;  2DQV A;  5AA2 D;  1OVT A;  2I6E A;  2P1S A;  1Y3P A;  2O1L A;  2XD3 A;  1OVB A;  4R72 A;  3U93 A;  4QFO A;  5AA4 B;  4ZZE A;  2AYS A;  3IJO B;  1SW1 A;  2DE3 A;  2X7Q A;  3SES A;  3W15 C;  3KZG A;  1OQG A;  3CR9 A;  4LA9 A;  5H8N B;  1AOV A;  1PDA A;  2ESN A;  2X26 A;  4NF4 B;  2Z8E A;  4QFL A;  1XC1 A;  2DWI A;  1FQD A;  4ONY A;  2QL3 A;  3ZSF A;  2I0C A;  2RC7 A;  3ODB A;  3TPA A;  4N07 A;  4OTE A;  1MQG A;  1SQY A;  4OHN A;  5DVF A;  1B0H A;  3K6W A;  3T66 A;  4NF6 A;  1IXC A;  3KN7 A;  3MP6 A;  1B7Z A;  3LSW A;  3TCF A;  3EPE A;  3PPR A;  4RYA A;  2HAV A;  4G2Z A;  1QVS A;  3FVO A;  3G7W A;  4ELP A;  1Q35 A;  3PD9 A;  3LSF B;  5CMK A;  5ICT A;  3ONM A;  4DXC A;  3H4Z A;  2YJP A;  1FTJ A;  2PBW A;  1B0L A;  5DEX A;  4OEN A;  1XOC A;  2O7U A;  3QYT A;  4H5F A;  1HSE A;  4OFJ A;  5CI5 A;  1B3H A;  4Q5T A;  2Z8D A;  4QF9 A;  2PVU A;  4ISU A;  2D3I A;  3V89 B;  1YTV A;  2Q88 A;  5I57 A;  3WAF A;  5AA1 A;  4M1V A;  3I3V A;  5TP9 B;  1I6B A;  1VE4 A;  1YPN A;  4NF4 A;  4RY1 A;  3K2D A;  3QIM A;  3SEX A;  1JVX A;  1OLC A;  1ZKB A;  2I3W A;  1R6Z A;  3RT8 A;  1ATG A;  3SER A;  1MXU A;  2XXU A;  2F7B A;  4QSD A;  4F3S A;  5AA2 A;  3TUS A;  2G93 A;  3FXQ A;  1N76 A;  3T9U A;  3BFU A;  3CSG A;  2XXT A;  4FEB A;  3MW0 A;  2GRV A;  3TEP A;  1B3F A;  3OEL A;  1P1W A;  1IXG A;  4N6P A;  4QRZ A;  1B5H A;  5I2N B;  2OK2 A;  3F11 A;  1ZBM A;  5FHO A;  3LUY A;  5AE4 A;  3UOR A;  5ELV A;  3C34 A;  5CMC A;  1O64 A;  1URS A;  2QJE A;  1L5T A;  1B9J A;  3UP9 A;  4IGR A;  4M4G A;  4H0W A;  4POW A;  3RTW B;  1SI1 A;  2V3Q A;  3VLU A;  1FQE A;  2Q9T A;  1RYX A;  1MY2 A;  1EH3 A;  1H44 A;  3I6V A;  1LAG E;  4OQO A;  1LBC A;  4JB7 A;  3U8Q A;  4ESW A;  4NTL A;  3N6U A;  2YPN A;  2VP1 A;  2RF1 A;  1MPD A;  1R9L A;  2WKY A;  3BFT A;  4OVJ A;  1UTB B;  2ZXT A;  4ZE8 A;  2QMX A;  3TQL A;  3LBS A;  4KYE A;  3IB2 A;  2W7Y A;  4GQO A;  1MQD A;  1FQC A;  5F7V A;  2FNC A;  4G77 A;  4F2O A;  2XX8 A;  2CZL A;  5I2N A;  3IOU A;  2UVG A;  1JNF A;  4EDP A;  1D3K A;  3EQ1 A;  1H45 A;  1SW2 A;  4GD5 A;  4O3C A;  1LAF E;  3SEY A;  3Q26 A;  3IX1 A;  4JWO A;  1AH5 A;  3CRB A;  4F18 A;  3PUY E;  1DTZ A;  1N7X A;  4JXI A;  5I58 A;  3IB0 A;  3TEL A;  3MWB A;  4IO5 A;  3GZG A;  1QUI A;  2DXY A;  3W9W A;  1UTH B;  1D9Y A;  4TOZ A;  3E13 X;  2F36 A;  1M5F A;  4UAC A;  1D4N A;  3FVK A;  1UTB A;  1GV8 A;  1TFA A;  2IA4 A;  2O6A A;  1VR5 A;  3W9V A;  4QFK A;  5CRY A;  2RCB A;  3FGS A;  4F1V A;  1B3L A;  2ZYO A;  3U94 A;  4IO3 A;  2PX1 A;  4EXL A;  3RGY A;  4IO2 A;  4WED A;  2R9J A;  3SKP A;  1VFE A;  1A7L A;  4OMB A;  2H99 A;  3MBP A;  4RK2 A;  4FIM A;  5ICQ A;  3IB1 A;  3S9N C;  4R6Y A;  4GRK A;  1XS5 A;  2OJT A;  2KLF A;  4JSD A;  4HW8 A;  1DMB A;  1ZMG A;  4DIG A;  1Z7M E;  4XXU A;  1GGG A;  1T0K A;  3HPI A;  1QUJ A;  1LB9 A;  1B5I A;  3TOD A;  2RIN A;  5JK4 A;  1B3E A;  4KQP A; 
#chains in the Genus database with same CATH topology
 1NV1 A;  3S9L C;  4ECF A;  1ZJL A;  3CFX A;  5H8Q B;  5HM4 B;  4PFY A;  1H3D A;  1LAH E;  1N7W A;  3RY3 A;  1B6H A;  1EYI A;  2QRY A;  3H7M A;  1DTG A;  1S50 A;  5B7D A;  1FRP A;  4H5G A;  4KD5 A;  3RN8 A;  3U1O A;  4Z0I A;  3AXF A;  1QW0 A;  3G3J A;  3QUF A;  3K00 A;  4R73 A;  3OO8 A;  1FBD A;  3G3F A;  5I5P A;  2ZZV A;  3PUX E;  1CB6 A;  5EYG A;  2JJK A;  4GWS A;  4F31 B;  4NGU A;  1LBV A;  2QS1 A;  1MXW A;  2G29 A;  1ZIU A;  1URD A;  2FBP A;  5IZ1 A;  1A8E A;  4U21 A;  1MM7 A;  3DEL B;  4PFT A;  5KCJ A;  2FIX A;  3MP1 A;  3K6V A;  5J1D A;  3O6H A;  3LUZ A;  1MH4 A;  3PMV A;  1EZ9 A;  4MJO A;  3D4C A;  2CEX A;  1Y20 A;  4GF8 A;  1AWB A;  4H8J A;  4PE5 B;  3MZ1 A;  3VLW A;  4BLA A;  3C35 A;  3JZJ A;  4IO7 A;  4JWX A;  4PET A;  3CG1 A;  3SZP A;  1R9Q A;  3T9X B;  3THI A;  3K6X A;  3KN8 A;  1VDW A;  4LUB A;  3U92 A;  3K02 A;  4EQ7 A;  4NWC A;  1B1X A;  5AA3 A;  1P1N A;  3BIG A;  3PUZ E;  2HQ0 A;  5IZ3 A;  4GWW A;  5FHN A;  1MY0 A;  3KC1 A;  3H03 A;  1B7H A;  1NH7 A;  1FBC A;  3IL1 B;  2I0B A;  1N3W A;  3TDJ A;  3H06 B;  5KDT B;  4XKR A;  1SI0 A;  4H6D A;  1ELJ A;  2E1S A;  5IZZ A;  5I7I A;  4GWO A;  1FBE A;  1GR2 A;  2ABH A;  3G3G A;  1B32 A;  5A5X B;  4BDL A;  2F5X A;  4ZED A;  4G68 C;  5JTY B;  3FD3 A;  2X7P A;  5L9S A;  2OWS A;  1CE2 A;  4G68 B;  4R6H A;  3GYY A;  2VOZ A;  4WEP A;  3MQ9 A;  2A5S A;  4DXU A;  1MY1 A;  3E78 A;  3RLF E;  3VDF A;  4JDF A;  4RXL A;  1FPB A;  3FJG A;  3MVY A;  3TTR A;  2BJI A;  1B46 A;  5EHS A;  3UGW A;  2QS4 A;  2Y5K A;  1UIU A;  2I4C A;  3MVX A;  2F6P A;  1M5C A;  1SYI A;  3JYR A;  1FPF A;  1LCT A;  3PPO A;  4NHB A;  4E0W A;  4F1Y A;  1Y1M A;  1FPJ A;  3B7D A;  2Y5L A;  4MMP A;  4ELQ A;  4JVD A;  5IKB A;  2Y7P A;  4IGT A;  1KWH A;  4Q8R A;  1US5 A;  3ZKL A;  1N3X A;  4OEV A;  3IJX B;  2VPO A;  1QKB A;  2DWJ A;  2Y7R A;  4PDD A;  4NF5 B;  1POY 1;  2PFY A;  4G8M A;  3K0V A;  2F78 A;  1JET A;  1M5B A;  2B4L A;  4IO4 A;  2PT2 A;  4YB7 A;  2ZNS A;  5F1Q A;  4OWD A;  2VGQ A;  1NH8 A;  3TFL A;  3ZKK A;  3H3G A;  1YYZ A;  3OO6 A;  2Q89 A;  4QSC A;  4GFR A;  2F97 A;  3Q25 A;  1MXV A;  2OLB A;  2XD2 A;  5JTY A;  4HS7 A;  4QBA A;  4XEQ A;  3MJN A;  5DT6 A;  5FTH A;  2Y7W A;  4G68 A;  4X9T A;  1AIV A;  4XTC Q;  1FSA A;  1G0H A;  3FZV A;  5I2K A;  2GH9 A;  4R9G A;  1MPB A;  1IME A;  2Q8M A;  3Q27 A;  1OIB A;  4X48 A;  4Z7E A;  2PT1 A;  2Q2C A;  4H8I A;  1XHY A;  3K1N A;  4KYS A;  3PTY A;  1JW5 A;  1TXF A;  3T9H B;  4O3B A;  1B4H A;  4EXK A;  1FTK A;  3HHF A;  2XWI A;  4TLL B;  3VVE A;  4IO6 A;  3KN3 A;  1FJ9 A;  5M2V A;  4F19 A;  1P1U A;  1TT1 A;  4ZE9 A;  5AA4 A;  4BDO A;  1LBW A;  1S9T A;  3E9X A;  4PBQ A;  3V5A A;  1AL3 A;  2P3N A;  4PFR A;  1PEB A;  4F3G A;  5JEI A;  4RPO A;  5TPA B;  4OVR A;  4WKM A;  5H8N A;  3K6U A;  1LFI A;  1LBY A;  4DDD A;  3HHG A;  2I3V A;  2XXY A;  2UVJ A;  3D4G A;  1URG A;  5H8S A;  1PBQ A;  3OEK A;  3O28 A;  1AMF A;  2DXR A;  2ZYM A;  1Y4C A;  4BDM A;  1FBP A;  1NNF A;  3N94 A;  4U1Z A;  3MYU A;  3H6T A;  4N8Y A;  4POX A;  3TAJ A;  2FVZ A;  2B3B A;  3CVG A;  1NUW A;  5KZT A;  3SDF A;  1JW1 A;  3IFA A;  2RC8 A;  2AL5 A;  2UVH A;  1PB7 A;  4GL0 A;  3IFC A;  3V83 A;  4ZEB A;  3OOA A;  4Q0C A;  3FVG A;  2O51 A;  4GXA A;  4ZEF A;  1Y3Q A;  2H9B A;  2B3F A;  1Y1Z A;  1LFG A;  4EF2 A;  4XFE A;  4O3A A;  3RT6 B;  1P1O A;  1WVJ A;  3FJM A;  4X1D A;  2DS9 A;  2D5W A;  4PFU A;  2H5Y A;  3C4M A;  1MRP A;  4X8R A;  5H8H B;  2GHA A;  1BP5 A;  2D21 A;  4LZ7 A;  1DSN A;  1BTJ A;  4KCC A;  2O69 A;  1BLF A;  2P2A A;  3ZS6 A;  1JEV A;  2R71 A;  3KG2 A;  1SW5 A;  1IMB A;  5EQ7 A;  4I62 A;  2QPQ A;  5TP9 A;  2HHM A;  3QSL A;  5BWJ A;  1N84 A;  5CC2 A;  2KR0 A;  3O66 A;  4NF8 B;  2ZMB A;  3DP4 A;  4F2Q A;  2QVU A;  5K2X A;  1A55 A;  3S9M C;  2HCA A;  4AS5 A;  1DCU A;  1MQJ A;  2WYK A;  2PYY A;  3KJ7 A;  4UA8 A;  3TMG A;  4JBZ A;  3S9E A;  2HZL A;  4H46 A;  2F7A A;  3M8U A;  1GVC A;  1KZ8 A;  4F39 A;  2AIX A;  5CMM A;  5H8F B;  3QK6 A;  2Q2A A;  4GWU A;  1QUK A;  1B40 A;  4PFB A;  3C9H A;  1IXI A;  2DE2 A;  3PU5 A;  1A40 A;  4XIG Q;  1B5J A;  2CZK A;  4ZEI A;  1A8F A;  4LP2 B;  4GVO A;  1IMF A;  3QUJ A;  4OVT A;  2Y84 A;  2QMW A;  3ISP A;  4YKK A;  4N17 A;  4AB5 A;  3LSL A;  4E0X A;  3B50 A;  1MXY A;  2OX3 A;  4KXP A;  1O63 A;  4YKP A;  3GLB A;  2CEY A;  3VLV A;  5I84 A;  4RA1 A;  2RKM A;  3DP6 A;  4F3B A;  5I59 B;  3KOS A;  2XXV A;  3CFZ A;  4DLD A;  3TCG A;  1RDX A;  1KA0 A;  3OO9 A;  3JV9 A;  2V3U A;  3RNN A;  4NF8 A;  4OXV A;  3KSX A;  2XX7 A;  4MH5 A;  3B6Q A;  2WX9 A;  3R6U A;  3RPL A;  1B4Z A;  3EN3 A;  3R26 A;  4C1U A;  4N91 A;  4ZZA A;  3I5O A;  3L6H A;  1XT8 A;  4DE8 A;  2DP8 A;  1BIY A;  5CBR A;  2IEE A;  3M3F A;  1YZ0 A;  3FAS A;  3OXN A;  4P0G A;  1LBB A;  4GIZ A;  2HZK A;  3SEV A;  3T96 B;  2ZZX A;  4X1B A;  3KSJ A;  3TYH A;  4ZDM A;  1A54 A;  1NUZ A;  4H67 A;  4O94 A;  2B4M A;  3KBZ A;  3EKI A;  3C32 A;  3OSR A;  3LR1 A;  4QFP A;  2HXW A;  4P1L A;  3UIF A;  2E0S A;  4GWX A;  4OVP A;  2H4I A;  1JEU A;  2UYE A;  4YMA A;  4FAJ A;  4AQ4 A;  5ITO A;  3FV2 A;  2UVI A;  4NE4 A;  1MY3 A;  2F35 A;  4XKN A;  2QVR A;  4PAI A;  4YMB A;  4EQ9 A;  5EQ9 A;  3PUW E;  1PBP A;  5I59 A;  4HE2 A;  2ZNT A;  4YU0 A;  3BBR A;  1K9Z A;  4NG7 A;  3K01 A;  4F22 A;  4R6K A;  4YIC A;  1UTH A;  2KQZ A;  4OES A;  4HCW A;  3KOT A;  2CZI A;  1EZP A;  3FIR A;  4PF6 A;  1MY4 A;  2XXH A;  4BDN A;  4YAH X;  4FEC A;  4MLQ A;  2L5V A;  4ELO A;  4LQ2 A;  2DWH A;  2V84 A;  1S7Y A;  1DOT A;  4IY6 A;  4THI A;  3T9V A;  3O2A A;  2P3V A;  4KCD A;  4GX3 A;  1MQI A;  1M5E A;  2M8C A;  3PGF A;  2UYF A;  4JSO A;  1LGB C;  4KPT A;  1OLA A;  3MZ9 A;  4PAK A;  3USD A;  2WEF A;  3N26 A;  1ZTY A;  2NUV A;  3TTN A;  4FOR A;  3N5L A;  2V25 A;  1M5D A;  1ZLQ A;  3HCQ A;  3E3K A;  2F3B A;  1IIW A;  1JVY A;  1MG1 A;  3M3L A;  1POT A;  1FBF A;  5I3S A;  4PP0 A;  2UXA A;  2HFB A;  3KJT A;  3Q28 A;  1Y3N A;  2QVV A;  1DBZ A;  1FTM A;  3KBR A;  3DM0 A;  3K1M A;  2HAU A;  1H76 A;  4G8N A;  2VD3 A;  3OMB A;  1O7T A;  4U4S A;  4ZEK A;  1DK4 A;  3TKD A;  5H8Q A;  4I8C A;  5EYF A;  1LEV A;  3H6V A;  2THI A;  1B58 A;  3IOR A;  3RTF B;  4U1O A;  1YAE A;  2XWO A;  4U4X A;  3BKI B;  1I6Q A;  4HTG A;  4OAN A;  4YKJ A;  3EHU A;  3HO7 A;  3KGC A;  5EQA A;  3OEN A;  1A99 A;  5K2Y A;  4K3F A;  1B7U A;  3O6G A;  3ILU B;  2GQ1 A;  1PC3 A;  5IM2 A;  2FHY A;  5EYH A;  3PV0 E;  4I40 A;  4G4P A;  3WAE A;  2VD2 A;  3B8B A;  2LAO A;  5DVI A;  5ITP A;  2OZZ A;  2FA7 A;  2A5T B;  4ZS9 A;  3PD8 A;  1NUY A;  3V8X B;  5LOM A;  4N81 A;  1MS7 A;  3K4U A;  2ZZW A;  4MAG A;  2H25 A;  2OWT A;  1QJM A;  2V3T A;  3RPW A;  1LFH A;  4OER A;  3C33 A;  3LSX A;  5BUU A;  1LBZ A;  4ESX A;  5J16 A;  2R8T A;  4FE8 A;  3OO7 A;  1DPE A;  3K1P A;  4C1T A;  1PB9 A;  3IO6 A;  1Y4T A;  4NX1 A;  5DVJ A;  1B2H A;  1FQF A;  2F6G A;  1D9V A;  3KFM A;  3PMW A;  2XXP A;  1FJ6 A;  3E4R A;  3MVZ A;  1QKA A;  5KDT A;  5I57 B;  3VV5 A;  2OBG A;  1B52 A;  3SEU A;  5TU0 A;  4MEV A;  4N8G A;  5A5X A;  2NVU B;  3T1B A;  1OQH A;  3FUZ A;  3U72 A;  4JVI A;  4NAP A;  3DP8 A;  3A09 A;  3H6U A;  4YKI A;  3CI8 A;  3HV1 A;  1B3G A;  2VPN A;  3C31 A;  1RYO A;  2V4C A;  4RPN A;  1SYH A;  5AA2 B;  1MXZ A;  1SVX B;  3CG3 A;  2A5T A;  3DLN A;  1IZ1 A;  2HEU A;  3IR1 A;  3O9P A;  3FAT A;  1MXX A;  1SW4 A;  4GWY A;  5IAI A;  4PTK A;  2Z22 A;  4N15 A;  4JWY A;  4KR5 A;  4P9K A;  4Q30 B;  4FJP A;  4MHF A;  4IY5 A;  2WBB A;  4OA4 A;  4NF0 A;  4N13 A;  1H43 A;  4PFI A;  4R9F A;  4R2F A;  1YCJ A;  3C36 A;  1VSO A;  4NF5 A;  2HXR A;  3FXR A;  1FPG A;  4OEU A;  3S4U A;  4P47 A;  3MPL A;  1IXH A;  3FXB A;  3G3I A;  1FPL A;  1MQH A;  3FVN A;  1NMU A;  2ALU A;  3OD7 A;  3IOV A;  1MPC A;  5DTB A;  4GWZ A;  2NXO A;  2CZH A;  2ZYK A;  2Y7I A;  2XXR A;  2PMS A;  4NN3 A;  2XX9 A;  1JP4 A;  4LZ8 A;  3G3H A;  3GBA A;  4I1D A;  3B6T A;  5CMB A;  1NKX A;  4G8H A;  5L9M A;  4MNP A;  1ZU0 A;  1NV0 A;  2P0S A;  2R6G E;  3CFL A;  3IAZ A;  4FAT A;  2DOJ A;  2ZNU A;  3OEM A;  3G3K A;  1WOD A;  4KYD A;  3O29 A;  4IR8 A;  4GBW A;  3VE1 B;  1NNK A;  1UIV A;  5L8D A;  3A3U A;  5EHM A;  4GL8 A;  1SBP A;  2ONS A;  1XVX A;  2I4B A;  3FXU A;  3MPK A;  4O7I A;  2ZYN A;  5TPA A;  1I69 A;  4P11 A;  4QSE A;  4P56 A;  5ISU A;  4PDH A;  4AS4 A;  1Q9D A;  4OZ9 A;  5I58 B;  4QXD A;  3Q29 A;  4X04 A;  4BDR A;  4C0R A;  3T0J A;  4MBP A;  1NV3 A;  2REJ A;  1SD3 A;  4U22 A;  3CSB A;  4IB2 A;  4U23 A;  1MH3 A;  3S2V A;  3L6G A;  4U2R A;  4KFQ A;  2DE4 A;  2FIE A;  3T22 A;  3FV1 A;  5ET7 A;  1YXI A;  2XHD A;  5FHM A;  1NL5 A;  4NQ8 A;  2YLN A;  5EQ8 A;  4GXS B;  2F7C A;  3MST A;  2DYX A;  2O7I A;  4PE3 A;  3VFJ A;  4O7M A;  4GOT A;  1BKA A;  1B05 A;  1INP A;  3LC8 A;  1BK4 A;  2QSX A;  2I58 A;  4N6D A;  2Z23 A;  3EF7 A;  1MDQ A;  4H65 A;  4ELR A;  5H8H A;  1USY H;  2XXX A;  5L9O A;  1VFD A;  3ECR A;  2BJJ X;  1FTO A;  1NFT A;  5IGA A;  1LCF A;  4LON B;  4AB6 A;  1OMP A;  2H98 A;  2CMO A;  4I3Y A;  4P8B A;  1UQW A;  3TCH A;  5F24 A;  2Z8F A;  3EHT A;  5ESY A;  1FTL A;  1JW4 A;  4EF1 A;  1IEJ A;  4FED A;  5DYH A;  3M3K A;  1D9Q A;  4H1X A;  4PGP A;  2XXK A;  1FPD A;  3MC2 A;  2ONK E;  4MLV A;  5HBC A;  1FQA A;  2REG A;  1XVY A;  3HST A;  4HE0 A;  4DI4 B;  3TQW A;  4ZEC A;  3TTK A;  4DCX A;  5H8F A;  1SPI A;  3IOT A;  2QS2 A;  3O6I A;  4NMY A;  1EU8 A;  2I49 A;  2F3D A;  2XWV A;  3TZA A;  2XXQ A;  2WBD A;  1PB8 A;  4TQU Q;  1J1N A;  4RJZ A;  5ET6 A;  4F3P A;  4QFN A;  2XXW A;  3VVD A;  4GLI A;  2Q8J A;  1USY E;  2O84 X;  4OFL A;  4YB6 A;  4DZ1 A;  1EYK A;  2V93 A;  2F34 A;  4PF8 A;  2ANJ A;  4R74 A;  4P0I A;  2I48 A;  1F9B A;  5CM6 A;  5KCJ B;  1B1H A;  5DW8 A;  3UK4 A;  1RKM A;  3VXB A;  3VXC A;  4DCY A;  3CHG A;  1P1Q A;  1SDX A;  1CNQ A;  4KI0 E;  3FJ7 A;  1II5 A;  4EQB A;  4LVQ A;  3PPN A;  3KEI A;  1TFD A;  4LQ5 A;  1EZO A;  3U65 A;  2NOO A;  3H6W A;  1NNT A;  1Z7N E;  4XKQ A;  1IUD A;  1TWY A;  4WXJ A;  3BIH A;  3P7I A;  3RQT A;  3SET A;  3NOH A;  4PBH A;  2GHB A;  3TTM A;  2F8D A;  5IZ3 B;  1QUL A;  2DVC A;  3SEW A;  3IO4 A;  1WDN A;  2NWJ A;  3MZB A;  5HPQ A;  3OSQ A;  1B51 A;  2QS3 A;  4RNS A;  4F29 A;  4YZZ A;  4I9D A;  2DVZ A;  4F1U A;  4MFI A;  2PFZ A;  1FBG A;  2O1M A;  3O97 A;  3RUM A;  3UA8 A;  3PPP A;  1I6A A;  4P3L A;  3TTL A;  3PUV E;  1K9Y A;  4XKP A;  1IQ7 A;  1N04 A;  4DXB A;  5I56 B;  3PMX A;  4R2B A;  4RK9 A;  2ONR A;  3VVF A;  1RDZ A;  4ND9 A;  3EHS A;  4LAT A;  2OCU A;  3R7X A;  4TLM B;  4HCY A;  1ANF A;  1G0I A;  3HN0 A;  4N4U A;  2RC9 A;  4L17 A;  5A5L A;  4OYV A;  1FQB A;  4PFW A;  4OET A;  3IK6 B;  1Y9U A;  1US4 A;  1IIT A;  2AL4 A;  3T93 B;  2DSF A;  3QXM A;  3D1R A;  1GTK A;  2FYI A;  2DWA A;  3MVW A;  4NWD A;  4LZ5 A;  3B6W A;  4QHQ A;  4HE1 A;  4NED A;  4OFO A;  4BDQ A;  3GBB A;  3UN6 A;  4YB5 A;  2XXI A;  1R1N A;  3A3C A;  1DPP A;  1JQF A;  2VHA A;  4R75 A;  3FBP A;  1HSJ A;  2Y7K A;  1LLS A;  3ILT B;  3N6T A;  1NNP A;  3MUQ A;  3QAX A;  1LB8 A;  3A29 A;  1FCK A;  1P99 A;  4NF6 B;  3MP8 A;  2RCA A;  4PQJ A;  4XF5 A;  1NV4 A;  4EUO A;  3IOW A;  5B70 A;  2GFE A;  1Q1K A;  3CIJ A;  5I56 A;  4OVQ A;  5I2K B;  1HSL A;  1LST A;  4LN5 A;  3MAM A;  3PPQ A;  4KHZ E;  1NV5 A;  5FTI A;  1MDP 1;  1QGX A;  2O68 A;  4MF3 A;  2B65 A;  1N0T A;  3GXA A;  1MM6 A;  1FW0 A;  5CBS A;  1LAX A;  5DEX B;  2DQV A;  5AA2 D;  1OVT A;  2I6E A;  2P1S A;  1Y3P A;  2O1L A;  2XD3 A;  1OVB A;  4R72 A;  3U93 A;  4QFO A;  2QFL A;  5AA4 B;  4ZZE A;  2AYS A;  3IJO B;  1SW1 A;  5LTC A;  2DE3 A;  2X7Q A;  3SES A;  3W15 C;  3KZG A;  1RDY A;  1OQG A;  3CR9 A;  4LA9 A;  5H8N B;  1AOV A;  1PDA A;  2ESN A;  2X26 A;  4NF4 B;  2Z8E A;  4QFL A;  4PGN A;  1XC1 A;  2DWI A;  1FQD A;  4ONY A;  2QL3 A;  3ZSF A;  1IMC A;  2I0C A;  2RC7 A;  3ODB A;  3TPA A;  4PAF A;  4N07 A;  4OTE A;  1MQG A;  1KA1 A;  1SQY A;  4OHN A;  5DVF A;  1B0H A;  3K6W A;  3T66 A;  4NF6 A;  1IXC A;  3KN7 A;  3MP6 A;  1B7Z A;  3LSW A;  3TCF A;  3EPE A;  3PPR A;  4RYA A;  2HAV A;  4G2Z A;  1QVS A;  3FVO A;  3G7W A;  4ELP A;  1FPI A;  1FTA A;  1Q35 A;  2XWK A;  3PD9 A;  3LSF B;  5CMK A;  5ICT A;  3ONM A;  4DXC A;  1NUX A;  3H4Z A;  2XA5 A;  2Q74 A;  2YJP A;  1FTJ A;  2PBW A;  1B0L A;  3KC0 A;  5DEX A;  4OEN A;  1XOC A;  2O7U A;  3QYT A;  4H5F A;  1HSE A;  4OFJ A;  5CI5 A;  1B3H A;  4Q5T A;  2Z8D A;  4QF9 A;  2PVU A;  1LBX A;  4ISU A;  2D3I A;  4MIJ A;  3V89 B;  1YTV A;  2Q88 A;  5I57 A;  3WAF A;  5AA1 A;  1FPK A;  4MNC A;  4M1V A;  3I3V A;  5TP9 B;  1I6B A;  1VE4 A;  1YPN A;  4NF4 A;  4RY1 A;  4GBV A;  4GX4 A;  3K2D A;  3QIM A;  3SEX A;  1JVX A;  4PC9 A;  1OLC A;  1ZKB A;  2I3W A;  5T3J A;  1R6Z A;  3RT8 A;  1ATG A;  3SER A;  1MXU A;  2XXU A;  2F7B A;  4QSD A;  4F3S A;  5AA2 A;  3TUS A;  2G93 A;  3FXQ A;  1N76 A;  3T9U A;  3BFU A;  3CSG A;  2XXT A;  4FEB A;  2VT5 A;  3MW0 A;  2GRV A;  4N6K A;  3TEP A;  1NV6 A;  1B3F A;  3OEL A;  1P1W A;  1IXG A;  4N6P A;  4QRZ A;  1B5H A;  5I2N B;  1FPE A;  2OK2 A;  3F11 A;  1ZBM A;  5FHO A;  4G61 A;  4MCO A;  3LUY A;  4OVS A;  5AE4 A;  3UOR A;  5ELV A;  3C34 A;  5CMC A;  1O64 A;  1URS A;  2QJE A;  1L5T A;  1B9J A;  3UP9 A;  4GX6 A;  4IGR A;  4M4G A;  4H0W A;  4P1E A;  4POW A;  3RTW B;  1SI1 A;  2V3Q A;  3VLU A;  1FQE A;  2Q9T A;  1RYX A;  1MY2 A;  1EH3 A;  1H44 A;  3I6V A;  1LAG E;  4OQO A;  4H45 A;  3HFU A;  1LBC A;  4JB7 A;  3U8Q A;  4ESW A;  4NTL A;  3RPL B;  3N6U A;  2YPN A;  2VP1 A;  4UAB A;  2RF1 A;  1MPD A;  1R9L A;  1FBH A;  2WKY A;  3BFT A;  4OVJ A;  1UTB B;  2ZXT A;  5ET8 A;  4ZE8 A;  2QMX A;  3TQL A;  3LBS A;  4FBP A;  4KYE A;  3IB2 A;  2W7Y A;  4GQO A;  3RYD A;  1MQD A;  1FQC A;  4MNI A;  5F7V A;  2FNC A;  3QMF A;  4G77 A;  4F2O A;  2XX8 A;  1NI9 A;  2CZL A;  5I2N A;  3IOU A;  2UVG A;  4PCD A;  1JNF A;  4EDP A;  1D3K A;  3EQ1 A;  4O8M A;  4MX6 A;  1H45 A;  1SW2 A;  4GD5 A;  1IMA A;  4O3C A;  1LAF E;  3SEY A;  3Q26 A;  3IX1 A;  4JWO A;  1AH5 A;  3CRB A;  4F18 A;  4DI3 D;  3PUY E;  1DTZ A;  1N7X A;  2DDK A;  4JXI A;  5I58 A;  3IB0 A;  3TEL A;  3MWB A;  4IO5 A;  5LDZ A;  2PCR A;  2OWZ A;  3GZG A;  1QUI A;  1XI6 A;  2DXY A;  5FBP A;  2HPG A;  3W9W A;  1UTH B;  1D9Y A;  4TOZ A;  2MKZ A;  1IMD A;  3ROJ A;  3E13 X;  2F36 A;  1NV2 A;  1M5F A;  4UAC A;  4I3E A;  4JVC A;  1D4N A;  3FVK A;  1UTB A;  1GV8 A;  1TFA A;  2WYP A;  2IA4 A;  2O6A A;  3E79 A;  1VR5 A;  1NV7 A;  3W9V A;  4QFK A;  5CRY A;  1EYJ A;  2RCB A;  3FGS A;  4F1V A;  1B3L A;  2ZYO A;  3U94 A;  4IO3 A;  2PX1 A;  4EXL A;  5ET5 A;  3RGY A;  4IO2 A;  4WED A;  2R9J A;  4HXV A;  3SKP A;  1VFE A;  1A7L A;  4OMB A;  2H99 A;  3MBP A;  4RK2 A;  4FIM A;  5ICQ A;  3IB1 A;  3S9N C;  4R6Y A;  4GRK A;  1XS5 A;  2OJT A;  2KLF A;  4JSD A;  4HW8 A;  1DMB A;  1ZMG A;  3LV0 A;  4DIG A;  1Z7M E;  4XXU A;  1GGG A;  1T0K A;  3HPI A;  1QUJ A;  1LB9 A;  1B5I A;  3TOD A;  2RIN A;  5JK4 A;  1B3E A;  4KQP A; 
#chains in the Genus database with same CATH homology
 3S9L C;  4ECF A;  1ZJL A;  3CFX A;  5H8Q B;  5HM4 B;  4PFY A;  1H3D A;  1LAH E;  1N7W A;  3RY3 A;  1B6H A;  2QRY A;  3H7M A;  1DTG A;  1S50 A;  5B7D A;  4H5G A;  4KD5 A;  3RN8 A;  3U1O A;  4Z0I A;  3AXF A;  1QW0 A;  3G3J A;  3QUF A;  3K00 A;  4R73 A;  3OO8 A;  3G3F A;  3PUX E;  1CB6 A;  4F31 B;  2QS1 A;  1MXW A;  2G29 A;  1ZIU A;  1URD A;  1A8E A;  4U21 A;  1MM7 A;  3DEL B;  4PFT A;  5KCJ A;  3MP1 A;  3K6V A;  5J1D A;  3O6H A;  1MH4 A;  3PMV A;  1EZ9 A;  3D4C A;  1Y20 A;  4GF8 A;  4PE5 B;  4H8J A;  3MZ1 A;  3VLW A;  4BLA A;  3C35 A;  3JZJ A;  4IO7 A;  4JWX A;  4PET A;  3CG1 A;  1R9Q A;  3T9X B;  3THI A;  3K6X A;  3KN8 A;  4LUB A;  3U92 A;  3K02 A;  4EQ7 A;  4NWC A;  1B1X A;  5AA3 A;  1P1N A;  3PUZ E;  2HQ0 A;  5FHN A;  1MY0 A;  1B7H A;  3H03 A;  1NH7 A;  3IL1 B;  2I0B A;  1N3W A;  3TDJ A;  3H06 B;  5KDT B;  4XKR A;  1SI0 A;  4H6D A;  1ELJ A;  2E1S A;  4GWO A;  1GR2 A;  2ABH A;  3G3G A;  1B32 A;  5A5X B;  4BDL A;  2F5X A;  4ZED A;  4G68 C;  5JTY B;  3FD3 A;  2X7P A;  5L9S A;  2OWS A;  1CE2 A;  4G68 B;  4R6H A;  2VOZ A;  4WEP A;  3MQ9 A;  2A5S A;  4DXU A;  1MY1 A;  3RLF E;  3VDF A;  4JDF A;  4RXL A;  3FJG A;  3MVY A;  3TTR A;  1B46 A;  5EHS A;  3UGW A;  2QS4 A;  1UIU A;  2I4C A;  3MVX A;  2F6P A;  1M5C A;  1SYI A;  3JYR A;  1LCT A;  3PPO A;  4E0W A;  4F1Y A;  1Y1M A;  3B7D A;  4ELQ A;  5IKB A;  2Y7P A;  4IGT A;  1KWH A;  4Q8R A;  1US5 A;  3ZKL A;  1N3X A;  4OEV A;  3IJX B;  1QKB A;  2DWJ A;  2Y7R A;  4NF5 B;  1POY 1;  4G8M A;  3K0V A;  2F78 A;  1JET A;  1M5B A;  4IO4 A;  2PT2 A;  4YB7 A;  2ZNS A;  5F1Q A;  4OWD A;  2VGQ A;  1NH8 A;  3TFL A;  3ZKK A;  3H3G A;  3OO6 A;  2Q89 A;  4QSC A;  4GFR A;  2F97 A;  3Q25 A;  1MXV A;  2OLB A;  2XD2 A;  5JTY A;  4HS7 A;  3MJN A;  5DT6 A;  5FTH A;  2Y7W A;  4G68 A;  4X9T A;  1AIV A;  4XTC Q;  3FZV A;  5I2K A;  2GH9 A;  4R9G A;  1MPB A;  3Q27 A;  1OIB A;  4X48 A;  4Z7E A;  2PT1 A;  2Q2C A;  4H8I A;  1XHY A;  3K1N A;  4KYS A;  1JW5 A;  1TXF A;  3T9H B;  4O3B A;  1B4H A;  4EXK A;  1FTK A;  3HHF A;  4TLL B;  3VVE A;  4IO6 A;  3KN3 A;  5M2V A;  4F19 A;  1P1U A;  1TT1 A;  4ZE9 A;  5AA4 A;  4BDO A;  1S9T A;  3E9X A;  3V5A A;  1AL3 A;  1PEB A;  4F3G A;  5JEI A;  4RPO A;  5TPA B;  4WKM A;  5H8N A;  3K6U A;  1LFI A;  4DDD A;  3HHG A;  2I3V A;  2XXY A;  2UVJ A;  3D4G A;  1URG A;  5H8S A;  1PBQ A;  3OEK A;  3O28 A;  1AMF A;  2DXR A;  2ZYM A;  1Y4C A;  4BDM A;  1NNF A;  3N94 A;  4U1Z A;  3H6T A;  4POX A;  3TAJ A;  2B3B A;  3CVG A;  5KZT A;  3SDF A;  1JW1 A;  2RC8 A;  2AL5 A;  2UVH A;  1PB7 A;  4GL0 A;  3V83 A;  4ZEB A;  3OOA A;  4Q0C A;  3FVG A;  2O51 A;  4GXA A;  4ZEF A;  1Y3Q A;  2H9B A;  2B3F A;  1Y1Z A;  1LFG A;  4EF2 A;  4O3A A;  3RT6 B;  1P1O A;  1WVJ A;  3FJM A;  4X1D A;  2DS9 A;  2D5W A;  4PFU A;  2H5Y A;  3C4M A;  1MRP A;  5H8H B;  2GHA A;  1BP5 A;  2D21 A;  4LZ7 A;  1DSN A;  1BTJ A;  4KCC A;  2O69 A;  1BLF A;  2P2A A;  3ZS6 A;  1JEV A;  2R71 A;  3KG2 A;  1SW5 A;  4I62 A;  2QPQ A;  5TP9 A;  5BWJ A;  3QSL A;  1N84 A;  5CC2 A;  3O66 A;  4NF8 B;  2ZMB A;  3DP4 A;  4F2Q A;  5K2X A;  1A55 A;  3S9M C;  2HCA A;  1MQJ A;  2PYY A;  3KJ7 A;  4UA8 A;  3TMG A;  4JBZ A;  3S9E A;  2HZL A;  2F7A A;  3M8U A;  1GVC A;  4F39 A;  2AIX A;  5CMM A;  5H8F B;  3QK6 A;  2Q2A A;  1QUK A;  1B40 A;  3C9H A;  1IXI A;  2DE2 A;  3PU5 A;  1A40 A;  4XIG Q;  1B5J A;  4ZEI A;  1A8F A;  4LP2 B;  4GVO A;  3QUJ A;  2Y84 A;  2QMW A;  4YKK A;  4AB5 A;  3LSL A;  4E0X A;  1MXY A;  1O63 A;  4YKP A;  3GLB A;  3VLV A;  5I84 A;  4RA1 A;  2RKM A;  3DP6 A;  4F3B A;  5I59 B;  3KOS A;  2XXV A;  3CFZ A;  4DLD A;  3TCG A;  3OO9 A;  3JV9 A;  2V3U A;  3RNN A;  4NF8 A;  4OXV A;  3KSX A;  2XX7 A;  4MH5 A;  3B6Q A;  3R6U A;  1B4Z A;  3EN3 A;  3R26 A;  4C1U A;  4ZZA A;  3I5O A;  3L6H A;  1XT8 A;  4DE8 A;  2DP8 A;  1BIY A;  5CBR A;  2IEE A;  3M3F A;  3FAS A;  3OXN A;  4P0G A;  1LBB A;  4GIZ A;  2HZK A;  3SEV A;  3T96 B;  4X1B A;  3KSJ A;  3TYH A;  4ZDM A;  1A54 A;  4H67 A;  3C32 A;  3OSR A;  3LR1 A;  4QFP A;  2HXW A;  3UIF A;  2E0S A;  2H4I A;  1JEU A;  2UYE A;  4YMA A;  4FAJ A;  4AQ4 A;  5ITO A;  3FV2 A;  2UVI A;  4NE4 A;  1MY3 A;  2F35 A;  4XKN A;  4YMB A;  4EQ9 A;  3PUW E;  1PBP A;  5I59 A;  2ZNT A;  4YU0 A;  3BBR A;  3K01 A;  4F22 A;  4R6K A;  4YIC A;  1UTH A;  4OES A;  4HCW A;  3KOT A;  1EZP A;  3FIR A;  1MY4 A;  2XXH A;  4BDN A;  4YAH X;  4FEC A;  4MLQ A;  4ELO A;  4LQ2 A;  2DWH A;  2V84 A;  1S7Y A;  1DOT A;  4IY6 A;  4THI A;  3T9V A;  3O2A A;  4KCD A;  1MQI A;  1M5E A;  2M8C A;  3PGF A;  2UYF A;  4JSO A;  1LGB C;  4KPT A;  1OLA A;  3MZ9 A;  3USD A;  3N26 A;  1ZTY A;  2NUV A;  3TTN A;  4FOR A;  3N5L A;  2V25 A;  1M5D A;  1ZLQ A;  3HCQ A;  3E3K A;  1IIW A;  1JVY A;  1MG1 A;  3M3L A;  1POT A;  4PP0 A;  2UXA A;  2HFB A;  3KJT A;  3Q28 A;  1Y3N A;  1FTM A;  3KBR A;  3DM0 A;  3K1M A;  2HAU A;  1H76 A;  4G8N A;  2VD3 A;  3OMB A;  1O7T A;  4U4S A;  4ZEK A;  3TKD A;  5H8Q A;  4I8C A;  5EYF A;  3H6V A;  2THI A;  1B58 A;  3IOR A;  3RTF B;  4U1O A;  1YAE A;  4U4X A;  3BKI B;  1I6Q A;  4HTG A;  4YKJ A;  3EHU A;  3HO7 A;  3KGC A;  3OEN A;  1A99 A;  5K2Y A;  4K3F A;  1B7U A;  3O6G A;  3ILU B;  1PC3 A;  3PV0 E;  4G4P A;  3WAE A;  2VD2 A;  5DVI A;  2LAO A;  5ITP A;  2OZZ A;  2FA7 A;  2A5T B;  4ZS9 A;  3PD8 A;  3V8X B;  5LOM A;  1MS7 A;  3K4U A;  2H25 A;  2OWT A;  1QJM A;  2V3T A;  3RPW A;  1LFH A;  5BUU A;  3C33 A;  3LSX A;  4OER A;  4ESX A;  4FE8 A;  3OO7 A;  1DPE A;  3K1P A;  4C1T A;  5DVJ A;  1PB9 A;  3IO6 A;  1Y4T A;  1B2H A;  1FQF A;  2F6G A;  1D9V A;  3KFM A;  3PMW A;  2XXP A;  3E4R A;  3MVZ A;  1QKA A;  5KDT A;  5I57 B;  3VV5 A;  2OBG A;  1B52 A;  3SEU A;  5TU0 A;  5A5X A;  2NVU B;  1OQH A;  3FUZ A;  3U72 A;  3DP8 A;  3A09 A;  3H6U A;  4YKI A;  3CI8 A;  3HV1 A;  1B3G A;  3C31 A;  1RYO A;  4RPN A;  1SYH A;  5AA2 B;  1MXZ A;  1SVX B;  3CG3 A;  2A5T A;  3DLN A;  1IZ1 A;  2HEU A;  3IR1 A;  3O9P A;  3FAT A;  1MXX A;  1SW4 A;  5IAI A;  2Z22 A;  4JWY A;  4KR5 A;  4Q30 B;  4FJP A;  4IY5 A;  4N13 A;  1H43 A;  4R9F A;  4R2F A;  1YCJ A;  3C36 A;  1VSO A;  4NF5 A;  3FXR A;  4OEU A;  3S4U A;  3MPL A;  1IXH A;  3G3I A;  1MQH A;  3FVN A;  1NMU A;  2ALU A;  3OD7 A;  3IOV A;  1MPC A;  5DTB A;  2NXO A;  2ZYK A;  2Y7I A;  2XXR A;  2PMS A;  2XX9 A;  4LZ8 A;  3G3H A;  3GBA A;  4I1D A;  3B6T A;  5CMB A;  1NKX A;  4G8H A;  5L9M A;  1ZU0 A;  2P0S A;  2R6G E;  3CFL A;  3IAZ A;  4FAT A;  2DOJ A;  2ZNU A;  3OEM A;  3G3K A;  1WOD A;  4KYD A;  3O29 A;  3VE1 B;  1NNK A;  1UIV A;  5L8D A;  3A3U A;  5EHM A;  4GL8 A;  1SBP A;  2ONS A;  1XVX A;  2I4B A;  3FXU A;  3MPK A;  2ZYN A;  5TPA A;  1I69 A;  4P11 A;  4QSE A;  5ISU A;  4OZ9 A;  5I58 B;  3Q29 A;  4BDR A;  4C0R A;  4MBP A;  2REJ A;  1SD3 A;  4U22 A;  3CSB A;  4IB2 A;  4U23 A;  1MH3 A;  3S2V A;  3L6G A;  4U2R A;  4KFQ A;  2DE4 A;  3T22 A;  3FV1 A;  2XHD A;  5FHM A;  1NL5 A;  2YLN A;  4GXS B;  2F7C A;  2DYX A;  2O7I A;  3VFJ A;  4GOT A;  1BKA A;  1B05 A;  3LC8 A;  2QSX A;  2I58 A;  2Z23 A;  3EF7 A;  1MDQ A;  4H65 A;  4ELR A;  5H8H A;  1USY H;  2XXX A;  5L9O A;  1VFD A;  3ECR A;  2BJJ X;  1FTO A;  1NFT A;  1LCF A;  4LON B;  4AB6 A;  1OMP A;  2H98 A;  2CMO A;  1UQW A;  3TCH A;  2Z8F A;  3EHT A;  1FTL A;  1JW4 A;  4EF1 A;  1IEJ A;  4FED A;  5DYH A;  3M3K A;  4H1X A;  3MC2 A;  2ONK E;  4MLV A;  5HBC A;  1FQA A;  2REG A;  1XVY A;  3HST A;  3TQW A;  4ZEC A;  3TTK A;  4DCX A;  5H8F A;  3IOT A;  2QS2 A;  3O6I A;  4NMY A;  1EU8 A;  2I49 A;  3TZA A;  2XXQ A;  1PB8 A;  4TQU Q;  1J1N A;  4RJZ A;  4F3P A;  4QFN A;  2XXW A;  3VVD A;  4GLI A;  2Q8J A;  1USY E;  2O84 X;  4OFL A;  4YB6 A;  4DZ1 A;  2V93 A;  2F34 A;  2ANJ A;  4R74 A;  4P0I A;  2I48 A;  1F9B A;  5CM6 A;  5KCJ B;  1B1H A;  3UK4 A;  1RKM A;  3VXB A;  3VXC A;  4DCY A;  1P1Q A;  1SDX A;  4KI0 E;  3FJ7 A;  1II5 A;  4EQB A;  4LVQ A;  3PPN A;  3KEI A;  1TFD A;  4LQ5 A;  1EZO A;  2NOO A;  3H6W A;  1NNT A;  1Z7N E;  4XKQ A;  1IUD A;  1TWY A;  4WXJ A;  3P7I A;  3RQT A;  3SET A;  2GHB A;  3TTM A;  2F8D A;  1QUL A;  2DVC A;  3SEW A;  3IO4 A;  1WDN A;  2NWJ A;  3MZB A;  5HPQ A;  3OSQ A;  1B51 A;  2QS3 A;  4RNS A;  4F29 A;  4YZZ A;  4I9D A;  2DVZ A;  4F1U A;  4MFI A;  2O1M A;  3O97 A;  3RUM A;  3UA8 A;  3PPP A;  1I6A A;  3TTL A;  3PUV E;  4XKP A;  1IQ7 A;  1N04 A;  4DXB A;  5I56 B;  3PMX A;  4R2B A;  4RK9 A;  2ONR A;  3VVF A;  4ND9 A;  3EHS A;  4LAT A;  2OCU A;  3R7X A;  4TLM B;  4HCY A;  1ANF A;  3HN0 A;  2RC9 A;  4L17 A;  4OYV A;  1FQB A;  4PFW A;  4OET A;  3IK6 B;  1Y9U A;  1US4 A;  1IIT A;  2AL4 A;  3T93 B;  2DSF A;  3QXM A;  1GTK A;  2FYI A;  2DWA A;  3MVW A;  4NWD A;  4LZ5 A;  3B6W A;  4QHQ A;  4NED A;  4OFO A;  4BDQ A;  3GBB A;  3UN6 A;  4YB5 A;  2XXI A;  1R1N A;  3A3C A;  1DPP A;  1JQF A;  2VHA A;  4R75 A;  1HSJ A;  2Y7K A;  1LLS A;  3ILT B;  3N6T A;  1NNP A;  3MUQ A;  3QAX A;  1LB8 A;  1FCK A;  1P99 A;  4NF6 B;  3MP8 A;  2RCA A;  4PQJ A;  4EUO A;  3IOW A;  5B70 A;  2GFE A;  1Q1K A;  3CIJ A;  5I56 A;  5I2K B;  1HSL A;  1LST A;  3MAM A;  3PPQ A;  4KHZ E;  5FTI A;  1MDP 1;  2O68 A;  4MF3 A;  2B65 A;  1N0T A;  3GXA A;  1MM6 A;  1FW0 A;  5CBS A;  1LAX A;  5DEX B;  2DQV A;  5AA2 D;  1OVT A;  2I6E A;  2P1S A;  1Y3P A;  2O1L A;  2XD3 A;  1OVB A;  4R72 A;  3U93 A;  4QFO A;  5AA4 B;  4ZZE A;  2AYS A;  3IJO B;  1SW1 A;  2DE3 A;  2X7Q A;  3SES A;  3W15 C;  3KZG A;  1OQG A;  3CR9 A;  4LA9 A;  5H8N B;  1AOV A;  1PDA A;  2ESN A;  2X26 A;  4NF4 B;  2Z8E A;  4QFL A;  1XC1 A;  2DWI A;  1FQD A;  4ONY A;  2QL3 A;  3ZSF A;  2I0C A;  2RC7 A;  3ODB A;  3TPA A;  4N07 A;  4OTE A;  1MQG A;  1SQY A;  4OHN A;  5DVF A;  1B0H A;  3K6W A;  3T66 A;  4NF6 A;  1IXC A;  3KN7 A;  3MP6 A;  1B7Z A;  3LSW A;  3TCF A;  3EPE A;  3PPR A;  4RYA A;  2HAV A;  4G2Z A;  1QVS A;  3FVO A;  3G7W A;  4ELP A;  1Q35 A;  3PD9 A;  3LSF B;  5CMK A;  5ICT A;  3ONM A;  4DXC A;  3H4Z A;  2YJP A;  1FTJ A;  2PBW A;  1B0L A;  5DEX A;  4OEN A;  1XOC A;  2O7U A;  3QYT A;  4H5F A;  1HSE A;  4OFJ A;  5CI5 A;  1B3H A;  4Q5T A;  2Z8D A;  4QF9 A;  2PVU A;  4ISU A;  2D3I A;  3V89 B;  1YTV A;  2Q88 A;  5I57 A;  3WAF A;  5AA1 A;  4M1V A;  3I3V A;  5TP9 B;  1I6B A;  1VE4 A;  1YPN A;  4NF4 A;  4RY1 A;  3K2D A;  3QIM A;  3SEX A;  1JVX A;  1OLC A;  1ZKB A;  2I3W A;  1R6Z A;  3RT8 A;  1ATG A;  3SER A;  1MXU A;  2XXU A;  2F7B A;  4QSD A;  4F3S A;  5AA2 A;  3TUS A;  2G93 A;  3FXQ A;  1N76 A;  3T9U A;  3BFU A;  3CSG A;  2XXT A;  4FEB A;  3MW0 A;  2GRV A;  3TEP A;  1B3F A;  3OEL A;  1P1W A;  1IXG A;  4N6P A;  4QRZ A;  1B5H A;  5I2N B;  2OK2 A;  3F11 A;  1ZBM A;  5FHO A;  3LUY A;  5AE4 A;  3UOR A;  5ELV A;  3C34 A;  5CMC A;  1O64 A;  1URS A;  2QJE A;  1L5T A;  1B9J A;  3UP9 A;  4IGR A;  4M4G A;  4H0W A;  4POW A;  3RTW B;  1SI1 A;  2V3Q A;  3VLU A;  1FQE A;  2Q9T A;  1RYX A;  1MY2 A;  1EH3 A;  1H44 A;  3I6V A;  1LAG E;  4OQO A;  1LBC A;  4JB7 A;  3U8Q A;  4ESW A;  4NTL A;  3N6U A;  2YPN A;  2VP1 A;  2RF1 A;  1MPD A;  1R9L A;  2WKY A;  3BFT A;  4OVJ A;  1UTB B;  2ZXT A;  4ZE8 A;  2QMX A;  3TQL A;  3LBS A;  4KYE A;  3IB2 A;  2W7Y A;  4GQO A;  1MQD A;  1FQC A;  5F7V A;  2FNC A;  4G77 A;  4F2O A;  2XX8 A;  2CZL A;  5I2N A;  3IOU A;  2UVG A;  1JNF A;  4EDP A;  1D3K A;  3EQ1 A;  1H45 A;  1SW2 A;  4GD5 A;  4O3C A;  1LAF E;  3SEY A;  3Q26 A;  3IX1 A;  4JWO A;  1AH5 A;  3CRB A;  4F18 A;  3PUY E;  1DTZ A;  1N7X A;  4JXI A;  5I58 A;  3IB0 A;  3TEL A;  3MWB A;  4IO5 A;  3GZG A;  1QUI A;  2DXY A;  3W9W A;  1UTH B;  1D9Y A;  4TOZ A;  3E13 X;  2F36 A;  1M5F A;  4UAC A;  1D4N A;  3FVK A;  1UTB A;  1GV8 A;  1TFA A;  2IA4 A;  2O6A A;  1VR5 A;  3W9V A;  4QFK A;  5CRY A;  2RCB A;  3FGS A;  4F1V A;  1B3L A;  2ZYO A;  3U94 A;  4IO3 A;  2PX1 A;  4EXL A;  3RGY A;  4IO2 A;  4WED A;  2R9J A;  3SKP A;  1VFE A;  1A7L A;  4OMB A;  2H99 A;  3MBP A;  4RK2 A;  4FIM A;  5ICQ A;  3IB1 A;  3S9N C;  4R6Y A;  4GRK A;  1XS5 A;  2OJT A;  2KLF A;  4JSD A;  4HW8 A;  1DMB A;  1ZMG A;  4DIG A;  1Z7M E;  4XXU A;  1GGG A;  1T0K A;  3HPI A;  1QUJ A;  1LB9 A;  1B5I A;  3TOD A;  2RIN A;  5JK4 A;  1B3E A;  4KQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...