4NMYA

Crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
299
structure length
299
Chain Sequence
SKKVTMVLDWTPNTNHTGLFVALDKGYYKEEGLDVEIVQPPESGAETLVATGKADFGISYQEQVTYAKTSEDPLPIKAVATVIQHNTSGFASPKEKNITTAKDFEGKTYGGWGSPSEEAVFKAVMKKNRADFNKLKIVNTGQDDFFAAMKTVDFAWIFEGWDAVKADLIGYDLNFIPVKDLDERLDYYTPLIISNETVLKDNPELAKKFLKATTKGYEYAIKNPEESAKILVKHAPEVDEKLALKSQEYLASKYKDDAPRWGEMKDSVWNNYTSFLKEYKLIDKDMKASDAYTNEFLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Thiamin-bound form of Substrate-binding Protein of ABC Transporter from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Transport protein
molecule keywords ABC-type transport system, extracellular solute-binding prot
total genus 103
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nmyA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nmyA01
1MXWA 2XHDA 4YICA 5I2KB 2V84A 3UK4A 4IO7A 2V3TA 3TEPA 3PUZE 4KFQA 5ISUA 5LOMA 3TMGA 1GTKA 3VE1B 2ABHA 4LATA 4LZ7A 3R7XA 4R9GA 3QSLA 2F34A 3N6UA 2F35A 4NWCA 3T93B 2GHAA 4DCXA 5CM6A 2F7CA 3VLUA 3OO8A 2PBWA 2R71A 5CMKA 3TAJA 4ELRA 4GQOA 1JW5A 3D4GA 3IAZA 2XD2A 1GGGA 1QUJA 3RN8A 2OWTA 3LR1A 3N26A 5FTHA 1BLFA 1XHYA 3TTRA 3RPWA 2D5WA 1TFAA 3H4ZA 3RT6B 4R6KA 3QUFA 2QS1A 3HSTA 4IO6A 1DTGA 1LBBA 3Q26A 1MPCA 4IO3A 3UN6A 2AIXA 4U23A 1NNPA 4BDMA 3H06B 2HZKA 1PB8A 4C1TA 3K1NA 2Q2CA 3FJ7A 4WKMA 3SDFA 4OHNA 3PUWE 5M2VA 3K01A 3OEMA 2Y7IA 3TTNA 2Y84A 2F6GA 3EHSA 2F36A 4OZ9A 4R2BA 4ZZEA 4F3SA 3K1PA 2XXQA 4RA1A 1Y9UA 2WKYA 1DPPA 1TFDA 4QSDA 4RXLA 3WAFA 4BDNA 1JQFA 3MZ9A 3UORA 3L6HA 4U2RA 1M5CA 1B6HA 1OIBA 4X1DA 4NF5B 3RQTA 4NF5A 1PB7A 1ZBMA 4RJZA 3TTKA 4QFNA 3A3UA 3V89B 1QKBA 1ZU0A 2GRVA 3CSBA 1B7UA 1FQAA 3H6UA 3HCQA 3MC2A 3MVWA 4I9DA 3IOTA 2REJA 3TKDA 1POTA 1FTJA 2DSFA 1MH3A 3K6UA 4JSOA 4ZEIA 3MJNA 3K4UA 1SW5A 3E9XA 1US4A 3OSRA 4RK2A 4XIGQ 5AA4B 1VE4A 3TTMA 4YMBA 4XTCQ 2XXRA 3O97A 1L5TA 1VSOA 4ESWA 1F9BA 1YCJA 2QS4A 2RCBA 4F22A 4OFOA 3CFXA 3VXBA 5A5XB 4GFRA 2YJPA 2OK2A 1NNFA 3FV1A 1NFTA 1IXCA 4GXSB 5TPAA 3SEVA 2PYYA 5H8FB 4KPTA 1UTBA 2QS2A 3TFLA 2UYFA 4F2QA 1OLCA 2DWJA 2FA7A 4RK9A 2QMXA 5I59A 1B9JA 1B51A 3LSFB 3O6IA 4OEVA 4WXJA 4X1BA 4QSCA 5L9MA 2QPQA 4AB6A 3M8UA 3MP6A 5I57A 3M3FA 1MY4A 4F3GA 2NOOA 3KJ7A 4EUOA 4IO5A 4DXCA 2O7UA 3T9XB 3FXUA 1A8EA 1M5FA 1LCFA 2PT1A 3TQLA 3VVEA 2A5TB 3RTFB 4F29A 5I56A 1QJMA 2H5YA 1FQFA 3G3HA 3MW0A 3LBSA 3W15C 3QIMA 5ITPA 1B3EA 1KWHA 4HCWA 5CMBA 2QJEA 3SEYA 4PQJA 2Q88A 1B40A 3MP1A 3OXNA 3DP8A 3KSJA 4ZS9A 2XXVA 2XXXA 3KJTA 3ODBA 4MF3A 3PD9A 4YKIA 4R72A 5K2XA 1FTKA 2YLNA 2Q8JA 3U72A 4BDLA 2HAUA 4C1UA 1D9YA 3Q29A 4EQBA 3OOAA 4KYSA 1N04A 1Y3PA 3B6WA 4RYAA 4F3PA 5KCJB 1WVJA 2DYXA 3KGCA 3C4MA 3I6VA 2Z22A 3HV1A 2QRYA 2E0SA 1SD3A 2OJTA 4G8NA 4UA8A 4DIGA 5JK4A 2RKMA 4H8JA 3MP8A 1P1UA 4IO4A 4RPOA 2V93A 4YB5A 1Z7NE 1AIVA 2G93A 1JW4A 3G3FA 4QFPA 2RF1A 4R74A 3DLNA 4FIMA 3QUJA 1MXZA 3A3CA 3IO6A 3CI8A 3FVOA 3SEWA 3TZAA 3FVGA 4XKRA 3MAMA 3U93A 5FHNA 4EDPA 2H25A 2X7QA 3OO6A 1IXGA 3FXQA 4I1DA 4TQUQ 1Z7ME 4IB2A 3OENA 4P0IA 4U22A 3CG3A 5CMCA 5DEXB 1OQGA 1LB8A 1XVXA 1JW1A 2OZZA 5DT6A 5AA3A 5I58B 5I84A 4Q8RA 5KDTA 2PT2A 5I2NB 2I49A 4F31B 4THIA 5I2KA 1HSLA 1B32A 4FECA 3TYHA 3EF7A 3TODA 3MVZA 3RTWB 3UP9A 5DYHA 3R6UA 4U1OA 3FXRA 4XKQA 1FQBA 3DP4A 3MPKA 1ELJA 3ZKLA 4ZE9A 2HCAA 4QFOA 3LSLA 1BTJA 3G3IA 1MXYA 1YPNA 4NF6B 2HFBA 5JEIA 1FQDA 2KLFA 3FGSA 3G3KA 1A55A 1I6BA 4OWDA 4ESXA 1P99A 2AL5A 1CE2A 3OELA 1B3LA 1DTZA 1URDA 1JVXA 2ALUA 1LAXA 2OLBA 3E13X 4I8CA 4M4GA 2A5TA 4MFIA 4NF8A 1B46A 4NF4B 4WEPA 4AB5A 1VFEA 3E3KA 4KYDA 1PEBA 2XXPA 2DWHA 5DVFA 3T9UA 3VFJA 1AOVA 1MQDA 1D4NA 4NE4A 1I69A 1QUIA 3CIJA 3O28A 5J1DA 4QFLA 1MQHA 3I5OA 4RPNA 5AE4A 5JTYA 1MS7A 1MY0A 2F6PA 2UVHA 4NWDA 1N0TA 2ONSA 2V25A 1MY2A 5IAIA 2XXIA 4KI0E 3GXAA 2UVIA 1UTBB 4MBPA 4O3BA 3K0VA 3MUQA 1LCTA 3CFZA 4HS7A 1EZPA 3Q27A 4G68A 4XKPA 3GLBA 2RINA 1N7XA 4QHQA 5DEXA 3OO7A 4NEDA 2XX7A 4JSDA 3EQ1A 1EU8A 4ZEBA 3UA8A 1AH5A 5TP9A 4DLDA 4EQ9A 1RYOA 4YB7A 3W9WA 1MXVA 1H76A 2H99A 1Y3NA 3CR9A 5H8HB 2O1LA 1IITA 3G3JA 5AA2B 5AA4A 1D3KA 3T96B 5BUUA 4BDOA 1SQYA 4BDQA 3I3VA 4JBZA 4XXUA 2DS9A 2RC7A 3PU5A 3QYTA 1NMUA 1LFIA 1H43A 2B3BA 3C35A 3FJMA 4AQ4A 3RT8A 1S9TA 2DOJA 1T0KA 2HAVA 1UIUA 3O66A 4DXUA 1ZLQA 2ZYOA 5K2YA 1US5A 4YB6A 1B7HA 3THIA 2ONRA 3ILTB 2ZMBA 1UTHB 2HXWA 4YKPA 2I48A 4OVJA 5EYFA 5DTBA 1PC3A 2DXRA 3KBRA 1R1NA 1O63A 2X7PA 4IGTA 4ZDMA 1DMBA 1H44A 4POWA 5L8DA 3SESA 2ZNSA 4YKJA 3EPEA 3VLVA 5CBSA 1YTVA 4DE8A 5KZTA 2RC8A 1QW0A 2UVJA 2BJJX 3Q28A 2P2AA 2HZLA 3C9HA 3O2AA 4N6PA 3TUSA 2UVGA 1NH8A 1N76A 1USYH 4FEDA 2QL3A 4GVOA 5FTIA 1FTLA 1Y3QA 2PVUA 3T22A 4LP2B 3O6GA 4G68C 2DE2A 1NL5A 5AA1A 5DVJA 1B05A 1OQHA 4FEBA 4EF2A 1Q1KA 1LAGE 2UYEA 4ELOA 1UQWA 3IO4A 1IXIA 1TT1A 4DDDA 3KN8A 3G7WA 1DOTA 1JNFA 2FNCA 1SBPA 2Q9TA 2B3FA 3BKIB 3U94A 1MPBA 3V83A 2ZYNA 2DXYA 2CMOA 2VGQA 2ZNTA 4BDRA 1SW4A 3IB0A 1QUKA 3GBBA 5H8NA 3USDA 4ZE8A 2GFEA 3LC8A 2I4BA 4HTGA 3RLFE 1IXHA 2XXHA 5AA2D 5FHMA 4EXLA 4NF4A 3KN7A 1OMPA 3MVYA 1FQEA 3PD8A 1EZOA 2I58A 3TTLA 2I0BA 3BFTA 2I4CA 3H6VA 3OD7A 4JWXA 2Y7PA 5DVIA 4F1UA 4U4SA 3UIFA 1B5JA 2Z8FA 1ZJLA 1LFGA 1BKAA 1AMFA 3IK6B 2ZNUA 2B65A 1SW1A 2P1SA 3IJOB 4U4XA 2NVUB 1NKXA 1MY3A 3PUXE 4GL8A 1N3XA 1N7WA 1B5HA 1IZ1A 3CVGA 3EHTA 1B7ZA 4H5GA 2QMWA 1ZKBA 4MLQA 2QSXA 2Z8EA 1DPEA 2AL4A 4IGRA 3VVDA 4R2FA 1NH7A 3FASA 5F7VA 1XT8A 2VD2A 4KCCA 5TU0A 3U92A 4X9TA 5CRYA 3VXCA 1MXXA 1D9VA 1R9QA 3BBRA 1MQGA 3DP6A 1Y1MA 2HQ0A 3KN3A 3S9EA 1YAEA 5CBRA 3ZSFA 2I0CA 2P0SA 4E0XA 1P1NA 4F2OA 2O6AA 1ANFA 1BIYA 2VOZA 3IOVA 4U21A 1PDAA 4XKNA 2I3WA 2Q89A 1P1WA 3OEKA 4LZ8A 2F8DA 3C33A 2ONKE 4GOTA 4GWOA 4PP0A 2Y7RA 5HBCA 4OENA 4TOZA 3SEUA 1IIWA 1OLAA 1B5IA 3ONMA 4ZZAA 3LSWA 3N6TA 2H98A 3IL1B 4X48A 1TWYA 3CG1A 2XXTA 3ILUB 3A09A 3M3KA 3T9HB 2O7IA 2VD3A 4ELQA 4FAJA 3K1MA 3IB1A 2F5XA 3OSQA 3KFMA 5FHOA 1EZ9A 1R6ZA 5EHMA 4N07A 2XD3A 3TCGA 1S50A 4H5FA 2OCUA 3H6TA 1MH4A 3IOWA 4G68B 4TLLB 3PGFA 2UXAA 1M5BA 4OFLA 3FZVA 1HSEA 4LZ5A 1B2HA 3KZGA 3RNNA 1O7TA 3S4UA 4GL0A 4R73A 5H8NB 4H6DA 3K6XA 4QRZA 3KSXA 3K02A 2DWAA 2F97A 3LUYA 3MVXA 3PMWA 4JDFA 2H9BA 4OETA 4QSEA 5I57B 1A8FA 1SYHA 4LQ2A 5ITOA 1MY1A 2D3IA 2H4IA 5H8QB 4DCYA 4HW8A 5I59B 3RY3A 4LONB 1URSA 3PPRA 1ZTYA 3IJXB 4NF8B 4Q30B 3TCHA 4Z7EA 4Q5TA 3B6TA 4I62A 1FTOA 1USYE 2GHBA 1B1XA 3KEIA 4OYVA 1A40A 1SYIA 3P7IA 4POXA 5TPAB 1QVSA 4IY5A 3WAEA 2Z8DA 2O51A 1GVCA 1GV8A 1LGBC 4OXVA 3TPAA 2O68A 1B4HA 4R6HA 3FATA 4YMAA 2A5SA 1VFDA 4NTLA 4E0WA 2Y7WA 1XS5A 3C36A 4EQ7A 1TXFA 1ATGA 2DVCA 1IUDA 3Q25A 1MXUA 3H7MA 1BP5A 1MDP1 3CFLA 4FORA 4H0WA 4OQOA 2V3UA 4R9FA 1NNKA 3VDFA 4F1YA 3QXMA 4LA9A 1B4ZA 3MZ1A 3MZBA 3AXFA 4OTEA 3M3LA 4PFUA 4WEDA 5I2NA 3FVNA 3FJGA 2RC9A 1MQJA 2RCAA 3JV9A 4G2ZA 5L9SA 3V5AA 2DVZA 2E1SA 2GH9A 5JTYB 3CRBA 4Q0CA 3FIRA 3OMBA 2G29A 4IO2A 5ICQA 1MQIA 2W7YA 3VV5A 3U8QA 2V3QA 4KR5A 3RGYA 4KD5A 1JEUA 4H65A 1B3GA 2VP1A 1WDNA 3HN0A 3SERA 3TQWA 4ELPA 1H45A 1GR2A 1Y4TA 1II5A 4MH5A 4IY6A 1B1HA 3EHUA 1SVXB 1URGA 2F78A 4L17A 4FATA 3E4RA 4O3CA 1P1OA 4R75A 3SKPA 5H8HA 2F7AA 3S9NC 4QFKA 3O6HA 4LVQA 1MPDA 5TP9B 3PV0E 2HEUA 4JB7A 1SI1A 4KYEA 4G4PA 2ZYMA 1FQCA 3HO7A 1MM6A 3K2DA 1RYXA 3L6GA 4FE8A 4OMBA 3D4CA 3W9VA 1LLSA 2OBGA 1UIVA 2AYSA 1LSTA 1WODA 4JWYA 1MG1A 4U1ZA 5B70A 1ZIUA 3PPQA 5KDTB 2QS3A 3B7DA 3OO9A 1B3HA 1SW2A 3UGWA 3VVFA 2ZYKA 1XC1A 3IORA 5BWJA 4OESA 1EH3A 1JVYA 3N5LA 1OVTA 5I56B 4ECFA 4KCDA 1B0HA 3C34A 1O64A 3S2VA 3JZJA 5CMMA 4F19A 1UTHA 2OWSA 1B58A 3K00A 2FYIA 1I6QA 1ZMGA 2O1MA 2O69A 3O29A 3IR1A 3PUVE 4OERA 5ELVA 4ND9A 3FD3A 4Z0IA 3TELA 1FTMA 1CB6A 3F11A 4YKKA 1LFHA 3G3GA 2PMSA 3K6WA 2ANJA 3MBPA 5EHSA 3PMVA 2DE3A 3HHFA 1M5DA 1MRPA 1VR5A 2CZLA 3PPNA 1Y4CA 2IA4A 4KQPA 4UACA 4H1XA 4ZECA 5H8FA 3S9LC 1IEJA 3PMXA 3ZS6A 4G8HA 3PPOA 4PFYA 4F3BA 3HHGA 3O9PA 3QK6A 4P0GA 1P1QA 4PETA 1LB9A 4PE5B 2Z23A 4YZZA 2ZXTA 1DSNA 4K3FA 1B52A 1XVYA 3MPLA 4YU0A 3S9MC 3T66A 5B7DA 4GXAA 1SI0A 4ONYA 4EXKA 3C31A 1J1NA 1LAHE 4RY1A 2XX8A 3V8XB 1R9LA 3N94A 4YAHX 5H8QA 2DE4A 1OVBA 3QAXA 3KOTA 1LBCA 4GRKA 2THIA 2XXUA 3B6QA 2M8CA 2Q2AA 2NUVA 3EN3A 3GZGA 1PBQA 1I6AA 2Y7KA 3HPIA 4H67A 1RKMA 2DP8A 4ZEFA 4ZEKA 1JEVA 1QULA 5HPQA 4JXIA 2DQVA 3MQ9A 5CC2A 3VLWA 1XOCA 5ICTA 3TCFA 1JETA 1MDQA 3IB2A 3TDJA 4G8MA 4PFWA 1B3FA 2D21A 2XXYA 1Y1ZA 3CSGA 3FUZA 3GBAA 3K6VA 4GLIA 4KHZE 2R6GE 4RNSA 4F18A 4DXBA 4ZEDA 1H3DA 2XXWA 4N13A 5A5XA 2LAOA 2O84X 5KCJA 3JYRA 4H8IA 3H3GA 1Q35A 3ECRA 4LUBA 2I3VA 4PFTA 4BLAA 3SETA 1Y20A 2PX1A 2DWIA 3R26A 3BFUA 4FJPA 1PBPA 1POY1 4P11A 4MLVA 5IKBA 4NMYA 1NNTA 5I58A 1M5EA 2IEEA 5H8SA 4GIZA 3SEXA 1FCKA 1HSJA 2NXOA 2YPNA 3IX1A 3PPPA 3DM0A 3FVKA 3U1OA 2VHAA 3C32A 3IOUA 3LSXA 1IQ7A 2X26A 4F1VA 3DELB 4O3AA 1PB9A 1FW0A 4OEUA 3H03A 4GF8A 2R9JA 1LAFE 4C0RA 4G77A 2ESNA 4OFJA 1A99A 1S7YA 1B0LA 3MWBA 3KG2A 5CI5A 2NWJA 5HM4B 1A54A 3FV2A 1AL3A 4EF1A 2REGA 3T9VA 3PUYE 1N84A 4HCYA 4ISUA 4GD5A 1SDXA 1MM7A 5AA2A 4NF6A 4LQ5A 3KOSA 5L9OA 4TLMB 4R6YA 3H6WA 4M1VA 2XX9A 4DZ1A 4JWOA 2I6EA 4QF9A 1N3WA 3ZKKA 1QKAA 2F7BA 4F39A 1A7LA 3RUMA 5F1QA
chains in the Genus database with same CATH superfamily
4YICA 5I2KB 2V84A 2QVUA 5LOMA 1GTKA 2ABHA 4R9GA 3QSLA 2F34A 2F7CA 5EQ8A 2XD2A 3N26A 5FTHA 3RPWA 4IO6A 3UN6A 2HZKA 4WKMA 2MKZA 3K01A 2Y7IA 2F6GA 2F36A 4F3SA 3KBZA 3WAFA 1Y9UA 4BDNA 1B6HA 5ET6A 1PB7A 1ZBMA 4MHFA 3TTKA 4QFNA 3V89B 3CSBA 1B7UA 3MC2A 3TKDA 2REJA 1FTJA 2DSFA 1US4A 4XTCQ 4ESWA 1VSOA 1YCJA 2QS4A 1FBPA 1AWBA 1NNFA 1OLCA 2DWJA 1B51A 1NV2A 5L9MA 2QPQA 3RYDA 2WBBA 1A8EA 2PT1A 3LV0A 3W15C 3SEYA 4PQJA 4QBAA 2XXVA 3KJTA 4MF3A 3T22A 2YLNA 3B6WA 1EYKA 4I40A 1SD3A 4QFPA 3G3FA 2RF1A 3DLNA 3A3CA 3SEWA 3FVGA 5FHNA 3FXQA 4TQUQ 3OENA 2OZZA 1XVXA 4Q8RA 5I2NB 1YZ0A 1HSLA 3TYHA 3EF7A 3RTWB 4U1OA 3MPKA 4NX1A 3FGSA 2AL5A 1B3LA 4MFIA 4M4GA 4I8CA 4EXKA 4NF8A 4NF4B 1B46A 4WEPA 4KYDA 4XF5A 4NE4A 4PFBA 5J1DA 1MQHA 2CZHA 2CEYA 1MY2A 1NI9A 4KI0E 4MBPA 3Q27A 4QHQA 3OO7A 4NEDA 4JSDA 4ZEBA 3UA8A 5TP9A 4DLDA 2H99A 1IITA 5AA4A 3T96B 4BDQA 4XXUA 1T0KA 2DOJA 2HAVA 1G0HA 4DXUA 1FPFA 1ZLQA 2ZYOA 3THIA 1UTHB 2KQZA 2I48A 2DXRA 1O63A 5L8DA 3VLVA 1QW0A 2P2AA 2QL3A 1FTLA 1Y3QA 3O6GA 2DE2A 1Q1KA 3IO4A 2Q9TA 2CMOA 2OX3A 5H8NA 2GFEA 1IXHA 4P3LA 5FHMA 4EXLA 2I58A 3BFTA 4JWXA 3OD7A 5DVIA 2Y7PA 3K6UA 4R72A 4FIMA 4YB7A 1LFGA 1AMFA 2B65A 2P1SA 3IJOB 2NVUB 1NKXA 5A5LA 1MY3A 3PUXE 1N3XA 3EHTA 1ZKBA 1DPEA 2CZIA 4X9TA 3VXCA 4PGPA 1R9QA 3DP6A 1Y1MA 5EQ9A 1YAEA 5LDZA 5I3SA 3ZSFA 2P0SA 4E0XA 1BIYA 2Q89A 3OEKA 1P1WA 4LZ8A 3C33A 4GWOA 2Y7RA 5HBCA 2XXKA 3IL1B 3T9HB 2VD3A 3IB1A 4H5FA 1MH4A 3BIGA 3RNNA 3KZGA 3S4UA 4GL0A 3KSXA 3LUYA 2FBPA 4OETA 1SYHA 4DCYA 2D3IA 4LONB 4XEQA 3TCHA 4P1EA 2WX9A 4RYAA 2GHBA 1NV7A 3KEIA 5TPAB 4P9KA 4IY5A 4OXVA 1TXFA 3Q25A 4H0WA 4MEVA 4LA9A 1B4ZA 4WEDA 2RC9A 3JV9A 2DVZA 5JTYB 2G29A 5ICQA 4GX3A 2W7YA 3U8QA 2V3QA 3RGYA 4H65A 1WDNA 1H45A 4FATA 3SKPA 2F7AA 4QFKA 2XA5A 2ZYMA 1FQCA 4FE8A 2OBGA 1WODA 1MG1A 1ZIUA 2QS3A 1B3HA 3UGWA 2ZYKA 4OESA 1OVTA 3C34A 3B8BA 3QYTA 4AQ4A 3PUVE 1I6QA 1NUWA 2O69A 3EKIA 3FD3A 4HE1A 1CB6A 4GBVA 4YKKA 2PMSA 3HHFA 1VR5A 2CZLA 5H8FA 3S9LC 5ET5A 1IEJA 4PFYA 4P0GA 1NUYA 1P1QA 4PE5B 2Z23A 2ZXTA 1DSNA 1B52A 1XVYA 3MPLA 4YU0A 5B7DA 4PAIA 4N6DA 3N94A 1OVBA 1FRPA 2Q2AA 1FBGA 1I6AA 2Y7KA 3HPIA 2DQVA 5CC2A 1JETA 3IB2A 2R6GE 5A5XA 2LAOA 3JYRA 5EYGA 4BLAA 1NV1A 1POY1 4MLVA 5IKBA 2ZZVA 4GIZA 5IZ3B 1HSJA 2YPNA 3IX1A 2VHAA 4GWXA 3LSXA 2X26A 1PB9A 4UABA 1LAFE 1A99A 3MWBA 5HM4B 4NHBA 2REGA 3PUYE 1N84A 4NF6A 3ISPA 1A7LA 3RUMA 2XHDA 3FXBA 4IO7A 2V3TA 3PUZE 4KFQA 4LZ7A 1KA0A 2F35A 2GHAA 1NV0A 5CMKA 3IAZA 1FPIA 4OVRA 4AS5A 1BLFA 4N81A 3HSTA 1DTGA 4IO3A 2FVZA 4U23A 1PB8A 2Q2CA 3SDFA 1FBDA 2XXQA 4RA1A 1DPPA 1JQFA 3L6HA 1OIBA 4NF5A 4RJZA 3A3UA 1QKBA 1ZU0A 2GRVA 3MVWA 4OFJA 3BIHA 4JSOA 4ZEIA 4GX4A 4RK2A 4HE0A 3VXBA 4GFRA 2YJPA 1NFTA 1IXCA 5TPAA 2PYYA 1LBVA 1UTBA 4KPTA 2UYFA 2QMXA 1B9JA 3O6IA 3LSFB 4AB6A 3KJ7A 1K9ZA 3T9XB 1NV6A 4F29A 5I56A 2H5YA 3MW0A 2Q74A 1B3EA 1KWHA 5CMBA 2QJEA 3MP1A 3DP8A 4PTKA 4EQBA 1Y3PA 2DYXA 3HV1A 4DIGA 4UA8A 2OJTA 5JK4A 2RKMA 4RPOA 3B50A 1Z7NE 2WBDA 1FPDA 4R74A 1MXZA 3MSTA 4N4UA 3TZAA 3U93A 1YXIA 4EDPA 5ET7A 1Z7ME 4IB2A 3FBPA 4H45A 5DT6A 1OQGA 5KDTA 2PT2A 2HXRA 4THIA 5I2KA 3MVZA 5DYHA 3R6UA 1FQBA 3DP4A 4ZE9A 1BTJA 3G3IA 1YPNA 4NF6B 1FQDA 4OWDA 3G3KA 4ESXA 4ELQA 5FHOA 2OLBA 5DVFA 3E3KA 1PEBA 2PCRA 2DWHA 3VFJA 1MQDA 1QUIA 3CIJA 2F6PA 4NWDA 5IAIA 2XXIA 1UTBB 5DW8A 4O3BA 3MUQA 1EZPA 4XKPA 2QVRA 4DI4B 3EQ1A 3ROJA 1MXVA 1H76A 3G3JA 1D3KA 4BDOA 1SQYA 3I3VA 4MCOA 2RC7A 3PU5A 2B3BA 3C35A 2FIEA 5K2YA 1US5A 4P8BA 2ONRA 3ILTB 4OVJA 5EYFA 3RPLB 3KBRA 2X7PA 1H44A 4POWA 5IZ3A 2ZNSA 5I7IA 5CBSA 1YTVA 4DE8A 2RC8A 2BJJX 2XWKA 2HZLA 4N6PA 4GWYA 1USYH 4G68C 5AA1A 1B05A 1OQHA 4FEBA 1LAGE 1TT1A 1DOTA 1JNFA 2FNCA 1SBPA 3U94A 3V83A 2ZYNA 2VGQA 1SW4A 1FBHA 3USDA 3LC8A 2I4BA 3KN7A 1OMPA 3GYYA 3UIFA 1NV3A 2ZNUA 4U4XA 4GL8A 2QSXA 1NH7A 2VD2A 3U92A 5CRYA 1D9VA 2HQ0A 3KN3A 1P1NA 2O6AA 1ANFA 3IOVA 2F8DA 4TOZA 3ONMA 1OLAA 3LSWA 4LN5A 1KZ8A 1TWYA 2VPNA 3CG1A 2XXTA 2XWIA 4N07A 2XD3A 1S50A 4I3YA 1HSEA 1O7TA 4H46A 3PMWA 4QSEA 1A8FA 2H4IA 1URSA 4Q30B 3UK4A 2HPGA 1SYIA 3P7IA 2WEFA 4NG7A 2Z8DA 4R6HA 1VFDA 4NTLA 4E0WA 2Y7WA 1XS5A 1ATGA 2DVCA 1MXUA 1MDP1 2JJKA 3CFLA 4FORA 4R9FA 4F1YA 4Z0IA 3M3LA 3V5AA 2GH9A 3FIRA 1MQIA 4JVCA 1K9YA 4KD5A 1JEUA 1B3GA 2VP1A 3HN0A 4ELPA 3TQWA 2F78A 2CEXA 4R75A 1P1OA 3O6HA 4LVQA 5DEXB 5I84A 2OWZA 3HO7A 1RYXA 1UIVA 4GX6A 4JWYA 3PPQA 3OO9A 3VVFA 1XC1A 5I56B 5BWJA 4ECFA 1B0HA 4F19A 3K00A 5ELVA 2FYIA 1ZMGA 4ND9A 3F11A 1LFHA 3G3GA 3MBPA 4O8MA 2IA4A 3PMXA 4G8HA 3QK6A 4YZZA 4K3FA 1FSAA 4PAKA 1SI0A 4PDHA 4P47A 1J1NA 4MNIA 3KOTA 2M8CA 2NUVA 3GZGA 4MAGA 4ZEFA 4ZEKA 4MMPA 4JXIA 5ICTA 3CSGA 4GLIA 4KHZE 1INPA 4I3EA 4RNSA 4F18A 4DXBA 4ZEDA 2O84X 5KCJA 4H8IA 4LUBA 3ECRA 2PX1A 2DWIA 3R26A 3BFUA 4FJPA 4DI3D 5I58A 1M5EA 3SEXA 1LEVA 3PPPA 4PC9A 3FVKA 4PCDA 5LTCA 3DELB 1FW0A 4NQ8A 4G77A 2ESNA 5CI5A 1B0LA 3KG2A 1A54A 1AL3A 3T9VA 1MM7A 3H6WA 4DZ1A 4QF9A 1N3WA 1QKAA 4OVPA 3VE1B 4LATA 3R7XA 5CM6A 4NWCA 3N6UA 3T93B 1EYJA 3VLUA 3TAJA 4ELRA 4OVQA 3RN8A 4N15A 1TFAA 4GWUA 2QS1A 1MPCA 1FPGA 2AIXA 4BDMA 3H06B 5IM2A 4C1TA 4OHNA 5M2VA 2Y84A 3EHSA 4QSDA 1FBEA 4N8GA 4MNCA 1M5CA 4X1DA 3RQTA 3S9MC 3H6UA 4I9DA 1XI6A 3IOTA 1POTA 1SW5A 4XIGQ 1IMBA 1VE4A 3TTMA 4YMBA 1F9BA 4F22A 4OFOA 2B4LA 3FV1A 3SEVA 3TFLA 1VDWA 4WXJA 4QSCA 3M8UA 3MP6A 5I57A 3M3FA 1MY4A 2NOOA 4DXCA 3FXUA 1M5FA 1LCFA 3TQLA 3QIMA 1CNQA 2Y5LA 1B40A 3OXNA 2XXXA 4YKIA 5K2XA 3U72A 4PF8A 4C1UA 2HAUA 4KYSA 1N04A 4F3PA 3C4MA 3I6VA 2QRYA 4G8NA 3T1BA 5EQ7A 4P56A 1AIVA 3QUJA 3FVOA 4XKRA 3MAMA 5EQAA 3OO6A 1IXGA 4P0IA 4U22A 3CG3A 5CMCA 5AA3A 1LB8A 1JW1A 4OVTA 5I58B 2WYPA 2L5VA 2VPOA 4XKQA 3ZKLA 1ELJA 3IFCA 4QFOA 2QFLA 3LSLA 5JEIA 1MXYA 2HFBA 2R8TA 1I6BA 1P99A 1CE2A 4OMBA 1DTZA 1LAXA 2ALUA 3E13X 1VFEA 1AOVA 3T9UA 5I5PA 1I69A 3I5OA 4PDDA 4N8YA 5JTYA 4XFEA 1N0TA 2ONSA 5IZZA 4HS7A 3IFAA 2RINA 1EU8A 3W9WA 3NOHA 5H8HB 1Y3NA 3LUZA 2O1LA 5AA2B 5BUUA 5IGAA 4JBZA 1DCUA 1LFIA 1H43A 3RT8A 1S9TA 1UIUA 5EYHA 3O66A 1B7HA 4NAPA 5DTBA 1PC3A 1R1NA 4IGTA 4GWWA 3SESA 5KZTA 3Q28A 3O2AA 1NH8A 1N76A 4FEDA 4GVOA 5FTIA 1IMFA 4LP2B 1NL5A 5DVJA 4EF2A 1IXIA 1BK4A 2PFZA 2B3FA 3BKIB 1RDZA 1QUKA 3RLFE 1RDXA 2XXHA 4NF4A 3HFUA 1EZOA 3TTLA 2I0BA 3H6VA 4U4SA 4OVSA 1ZJLA 1BKAA 1SW1A 1N7WA 1B5HA 1B7ZA 2QMWA 3E78A 1RDYA 4IGRA 1XT8A 4KCCA 5TU0A 3BBRA 1MQGA 2I0CA 4F2OA 3E79A 1PDAA 4XKNA 2ONKE 5IZ1A 4P1LA 3SEUA 1B5IA 4ZZAA 2H98A 4X48A 1LBWA 3ILUB 3A09A 3M3KA 2O7IA 3OSQA 4NF0A 1D9QA 1EZ9A 1R6ZA 3TPAA 3H6TA 3IOWA 4TLLB 1FPJA 4NGUA 2UXAA 1FBCA 4N17A 4H6DA 3K6XA 2B4MA 2F97A 4JDFA 5ITOA 2KR0A 4HW8A 3RY3A 3IJXB 4NF8B 4Q5TA 4I62A 3B6TA 4OYVA 1FTOA 1USYE 1B1XA 4F2QA 3WAEA 1QVSA 1GV8A 1LGBC 1B4HA 3FATA 2XWVA 3RT6B 1IUDA 4OQOA 1BP5A 3VDFA 2V3UA 3QXMA 5I2NA 4PFUA 3AXFA 3FVNA 1MQJA 5L9SA 2E1SA 3SERA 1Y4TA 1GR2A 1II5A 1B1HA 3EHUA 1URGA 1NV5A 4L17A 5H8HA 2CZKA 3PV0E 4GBWA 2HEUA 4JB7A 4KYEA 4G4PA 3L6GA 1MM6A 3W9VA 4U1ZA 1LLSA 5KDTB 5B70A 3B7DA 1EH3A 4KCDA 5CMMA 2OWSA 1B58A 4ZS9A 2O1MA 3O29A 4OERA 4MJOA 3K6WA 5EHSA 2DE3A 4KQPA 1M5DA 4X04A 1MRPA 3PPNA 4O7MA 1Y4CA 4UACA 4H1XA 4PE3A 3MYUA 3PPOA 4F3BA 3HHGA 4PETA 1LB9A 3T66A 4GXAA 3C31A 4RY1A 2XX8A 3V8XB 1R9LA 4HXVA 5H8QA 2DE4A 1Q9DA 3QAXA 2XWOA 1LBCA 4GRKA 2THIA 2XXUA 3B6QA 5HPQA 1JEVA 3VLWA 1XOCA 3TCFA 1MDQA 4G8MA 4PFWA 2XXYA 1Y1ZA 3KC1A 3GBAA 3FUZA 3K6VA 3H3GA 2I3VA 3SETA 1Y20A 4P11A 1PBPA 1NNTA 1FCKA 2FHYA 2F3BA 3U1OA 4F1VA 1SPIA 3H03A 4PBQA 2P3VA 4C0RA 1S7YA 4EF1A 4AS4A 4TLMB 4FBPA 4JWOA 3PTYA 2UYEA 3TUSA 5F1QA 1MXWA 1IMEA 2P3NA 5ISUA 3TMGA 4DCXA 3OO8A 2PBWA 2R71A 4GQOA 1JW5A 3D4GA 1GGGA 1QUJA 2OWTA 3LR1A 3TTRA 1XHYA 2D5WA 3H4ZA 4R6KA 3QUFA 1NV4A 1LBBA 3Q26A 1NNPA 5ESYA 3K1NA 3FJ7A 3PUWE 3OEMA 3TTNA 4ZZEA 4OZ9A 4R2BA 3K1PA 4OA4A 2WKYA 1TFDA 4RXLA 3MZ9A 3UORA 4U2RA 4NF5B 1FBFA 1LBYA 3HCQA 1FQAA 4O7IA 1FJ6A 1MH3A 4PGNA 3MJNA 3K4UA 3E9XA 3OSRA 5AA4B 2XXRA 3O97A 1L5TA 2RCBA 3CFXA 5A5XB 3U65A 2OK2A 4PBHA 4GXSB 2HHMA 2ZZWA 5H8FB 2QS2A 2FA7A 4RK9A 5I59A 4X1BA 4OEVA 4F3GA 4EUOA 4IO5A 2O7UA 3VVEA 2A5TB 3RTFB 1QJMA 1FQFA 3G3HA 3LBSA 4HCWA 2Q88A 3KSJA 3ODBA 3PD9A 2Q8JA 1FTKA 4BDLA 1D9YA 3Q29A 4HE2A 3OOAA 5KCJB 1WVJA 3KGCA 2Z22A 2E0SA 2F3DA 4H8JA 3MP8A 1P1UA 4IO4A 4YB5A 2V93A 2G93A 1JW4A 3IO6A 3CI8A 3KC0A 2H25A 2X7QA 4I1DA 3QMFA 2I49A 4F31B 1B32A 4FECA 3TODA 3UP9A 5T3JA 3FXRA 2Q8MA 1IMDA 2HCAA 3TEPA 2KLFA 1DBZA 1A55A 5ET8A 3OELA 1URDA 1JVXA 2A5TA 4AB5A 2XXPA 1D4NA 3O28A 4QFLA 4RPNA 5AE4A 1FTAA 1MS7A 1MY0A 2QVVA 2UVHA 2V25A 3GXAA 2UVIA 3K0VA 1LCTA 3CFZA 4G68A 3GLBA 1FPEA 1N7XA 5DEXA 2XX7A 1EYIA 4EQ9A 1AH5A 1RYOA 3CR9A 5J16A 2DS9A 1NMUA 3FJMA 4YB6A 2ZMBA 2HXWA 2PFYA 4YKPA 4OANA 5F24A 4X8RA 1FPBA 4ZDMA 1DMBA 1FPLA 4YKJA 3EPEA 4JVDA 3SZPA 2UVJA 1QGXA 3C9HA 2UVGA 2PVUA 1JP4A 4ELOA 1UQWA 2GQ1A 2VT5A 4DDDA 3KN8A 3G7WA 4QXDA 1FPKA 1MPBA 2DXYA 2ZNTA 4BDRA 4MNPA 3IB0A 3GBBA 4ZE8A 4HTGA 5AA2D 3MVYA 1FQEA 3PD8A 4PFIA 2I4CA 4F1UA 1B5JA 2Z8FA 3IK6B 1IZ1A 3CVGA 4O94A 4H5GA 4MLQA 2Z8EA 2AL4A 3VVDA 4R2FA 3FASA 1NUXA 4G61A 5F7VA 1MXXA 1DK4A 4MX6A 3S9EA 5CBRA 4GWZA 1IMAA 2VOZA 4U21A 2I3WA 4PP0A 4GOTA 3T0JA 4KXPA 4OENA 1IIWA 3N6TA 1KA1A 4IR8A 3K1MA 2F5XA 3KFMA 5EHMA 5ITPA 3TCGA 2OCUA 3CHGA 4G68B 3PGFA 3D1RA 1M5BA 4OFLA 3FZVA 4LZ5A 4PF6A 1B2HA 4R73A 5H8NB 4QRZA 3K02A 2DWAA 3MVXA 5I57B 2H9BA 4LQ2A 1MY1A 5H8QB 5I59B 3PPRA 1ZTYA 4Z7EA 1YYZA 4NN3A 1A40A 4POXA 2BJIA 1GVCA 2O51A 2O68A 4YMAA 2A5SA 3C36A 4EQ7A 2Y5KA 3H7MA 1NNKA 3MZ1A 3MZBA 4OTEA 3FJGA 2RCAA 4G2ZA 4GWSA 5FBPA 3CRBA 4Q0CA 3OMBA 4IO2A 3VV5A 4KR5A 4MH5A 4IY6A 1SVXB 3E4RA 4O3CA 1G0IA 3S9NC 2WYKA 1IMCA 1MPDA 5TP9B 1SI1A 3K2DA 3D4CA 2V4CA 4FAJA 2AYSA 1LSTA 4PAFA 1SW2A 3IORA 1JVYA 3N5LA 3RPLA 1LBZA 1O64A 3S2VA 3JZJA 1UTHA 3IR1A 3TELA 1FTMA 2ANJA 3PMVA 2ZZXA 4ZECA 3ZS6A 3O9PA 4ONYA 1LAHE 1FJ9A 4YAHX 4PFRA 3EN3A 1PBQA 4H67A 1RKMA 2DP8A 1QULA 3MQ9A 3TDJA 1B3FA 2D21A 1LBXA 1H3DA 2FIXA 2XXWA 4N13A 2DDKA 1Q35A 4PFTA 1NUZA 4NMYA 2IEEA 5H8SA 4JVIA 3A29A 2NXOA 3DM0A 3C32A 3IOUA 1IQ7A 4O3AA 4N91A 4OEUA 4GF8A 2R9JA 2NWJA 3FV2A 4MIJA 4HCYA 4ISUA 4GD5A 1SDXA 5AA2A 5L9OA 4LQ5A 3KOSA 4N6KA 4R6YA 4M1VA 2XX9A 2I6EA 3ZKKA 2F7BA 4F39A
chains in the Genus database with same CATH topology
1MXWA 2XHDA 4YICA 5I2KB 2V84A 3UK4A 4IO7A 2V3TA 3TEPA 3PUZE 4KFQA 5ISUA 5LOMA 3TMGA 1GTKA 3VE1B 2ABHA 4LATA 4LZ7A 3R7XA 4R9GA 3QSLA 2F34A 3N6UA 2F35A 4NWCA 3T93B 2GHAA 4DCXA 5CM6A 2F7CA 3VLUA 3OO8A 2PBWA 2R71A 5CMKA 3TAJA 4ELRA 4GQOA 1JW5A 3D4GA 3IAZA 2XD2A 1GGGA 1QUJA 3RN8A 2OWTA 3LR1A 3N26A 5FTHA 1BLFA 1XHYA 3TTRA 3RPWA 2D5WA 1TFAA 3H4ZA 3RT6B 4R6KA 3QUFA 2QS1A 3HSTA 4IO6A 1DTGA 1LBBA 3Q26A 1MPCA 4IO3A 3UN6A 2AIXA 4U23A 1NNPA 4BDMA 3H06B 2HZKA 1PB8A 4C1TA 3K1NA 2Q2CA 3FJ7A 4WKMA 3SDFA 4OHNA 3PUWE 5M2VA 3K01A 3OEMA 2Y7IA 3TTNA 2Y84A 2F6GA 3EHSA 2F36A 4OZ9A 4R2BA 4ZZEA 4F3SA 3K1PA 2XXQA 4RA1A 1Y9UA 2WKYA 1DPPA 1TFDA 4QSDA 4RXLA 3WAFA 4BDNA 1JQFA 3MZ9A 3UORA 3L6HA 4U2RA 1M5CA 1B6HA 1OIBA 4X1DA 4NF5B 3RQTA 4NF5A 1PB7A 1ZBMA 4RJZA 3TTKA 4QFNA 3A3UA 3V89B 1QKBA 1ZU0A 2GRVA 3CSBA 1B7UA 1FQAA 3H6UA 3HCQA 3MC2A 3MVWA 4I9DA 3IOTA 2REJA 3TKDA 1POTA 1FTJA 2DSFA 1MH3A 3K6UA 4JSOA 4ZEIA 3MJNA 3K4UA 1SW5A 3E9XA 1US4A 3OSRA 4RK2A 4XIGQ 5AA4B 1VE4A 3TTMA 4YMBA 4XTCQ 2XXRA 3O97A 1L5TA 1VSOA 4ESWA 1F9BA 1YCJA 2QS4A 2RCBA 4F22A 4OFOA 3CFXA 3VXBA 5A5XB 4GFRA 2YJPA 2OK2A 1NNFA 3FV1A 1NFTA 1IXCA 4GXSB 5TPAA 3SEVA 2PYYA 5H8FB 4KPTA 1UTBA 2QS2A 3TFLA 2UYFA 4F2QA 1OLCA 2DWJA 2FA7A 4RK9A 2QMXA 5I59A 1B9JA 1B51A 3LSFB 3O6IA 4OEVA 4WXJA 4X1BA 4QSCA 5L9MA 2QPQA 4AB6A 3M8UA 3MP6A 5I57A 3M3FA 1MY4A 4F3GA 2NOOA 3KJ7A 4EUOA 4IO5A 4DXCA 2O7UA 3T9XB 3FXUA 1A8EA 1M5FA 1LCFA 2PT1A 3TQLA 3VVEA 2A5TB 3RTFB 4F29A 5I56A 1QJMA 2H5YA 1FQFA 3G3HA 3MW0A 3LBSA 3W15C 3QIMA 5ITPA 1B3EA 1KWHA 4HCWA 5CMBA 2QJEA 3SEYA 4PQJA 2Q88A 1B40A 3MP1A 3OXNA 3DP8A 3KSJA 4ZS9A 2XXVA 2XXXA 3KJTA 3ODBA 4MF3A 3PD9A 4YKIA 4R72A 5K2XA 1FTKA 2YLNA 2Q8JA 3U72A 4BDLA 2HAUA 4C1UA 1D9YA 3Q29A 4EQBA 3OOAA 4KYSA 1N04A 1Y3PA 3B6WA 4RYAA 4F3PA 5KCJB 1WVJA 2DYXA 3KGCA 3C4MA 3I6VA 2Z22A 3HV1A 2QRYA 2E0SA 1SD3A 2OJTA 4G8NA 4UA8A 4DIGA 5JK4A 2RKMA 4H8JA 3MP8A 1P1UA 4IO4A 4RPOA 2V93A 4YB5A 1Z7NE 1AIVA 2G93A 1JW4A 3G3FA 4QFPA 2RF1A 4R74A 3DLNA 4FIMA 3QUJA 1MXZA 3A3CA 3IO6A 3CI8A 3FVOA 3SEWA 3TZAA 3FVGA 4XKRA 3MAMA 3U93A 5FHNA 4EDPA 2H25A 2X7QA 3OO6A 1IXGA 3FXQA 4I1DA 4TQUQ 1Z7ME 4IB2A 3OENA 4P0IA 4U22A 3CG3A 5CMCA 5DEXB 1OQGA 1LB8A 1XVXA 1JW1A 2OZZA 5DT6A 5AA3A 5I58B 5I84A 4Q8RA 5KDTA 2PT2A 5I2NB 2I49A 4F31B 4THIA 5I2KA 1HSLA 1B32A 4FECA 3TYHA 3EF7A 3TODA 3MVZA 3RTWB 3UP9A 5DYHA 3R6UA 4U1OA 3FXRA 4XKQA 1FQBA 3DP4A 3MPKA 1ELJA 3ZKLA 4ZE9A 2HCAA 4QFOA 3LSLA 1BTJA 3G3IA 1MXYA 1YPNA 4NF6B 2HFBA 5JEIA 1FQDA 2KLFA 3FGSA 3G3KA 1A55A 1I6BA 4OWDA 4ESXA 1P99A 2AL5A 1CE2A 3OELA 1B3LA 1DTZA 1URDA 1JVXA 2ALUA 1LAXA 2OLBA 3E13X 4I8CA 4M4GA 2A5TA 4MFIA 4NF8A 1B46A 4NF4B 4WEPA 4AB5A 1VFEA 3E3KA 4KYDA 1PEBA 2XXPA 2DWHA 5DVFA 3T9UA 3VFJA 1AOVA 1MQDA 1D4NA 4NE4A 1I69A 1QUIA 3CIJA 3O28A 5J1DA 4QFLA 1MQHA 3I5OA 4RPNA 5AE4A 5JTYA 1MS7A 1MY0A 2F6PA 2UVHA 4NWDA 1N0TA 2ONSA 2V25A 1MY2A 5IAIA 2XXIA 4KI0E 3GXAA 2UVIA 1UTBB 4MBPA 4O3BA 3K0VA 3MUQA 1LCTA 3CFZA 4HS7A 1EZPA 3Q27A 4G68A 4XKPA 3GLBA 2RINA 1N7XA 4QHQA 5DEXA 3OO7A 4NEDA 2XX7A 4JSDA 3EQ1A 1EU8A 4ZEBA 3UA8A 1AH5A 5TP9A 4DLDA 4EQ9A 1RYOA 4YB7A 3W9WA 1MXVA 1H76A 2H99A 1Y3NA 3CR9A 5H8HB 2O1LA 1IITA 3G3JA 5AA2B 5AA4A 1D3KA 3T96B 5BUUA 4BDOA 1SQYA 4BDQA 3I3VA 4JBZA 4XXUA 2DS9A 2RC7A 3PU5A 3QYTA 1NMUA 1LFIA 1H43A 2B3BA 3C35A 3FJMA 4AQ4A 3RT8A 1S9TA 2DOJA 1T0KA 2HAVA 1UIUA 3O66A 4DXUA 1ZLQA 2ZYOA 5K2YA 1US5A 4YB6A 1B7HA 3THIA 2ONRA 3ILTB 2ZMBA 1UTHB 2HXWA 4YKPA 2I48A 4OVJA 5EYFA 5DTBA 1PC3A 2DXRA 3KBRA 1R1NA 1O63A 2X7PA 4IGTA 4ZDMA 1DMBA 1H44A 4POWA 5L8DA 3SESA 2ZNSA 4YKJA 3EPEA 3VLVA 5CBSA 1YTVA 4DE8A 5KZTA 2RC8A 1QW0A 2UVJA 2BJJX 3Q28A 2P2AA 2HZLA 3C9HA 3O2AA 4N6PA 3TUSA 2UVGA 1NH8A 1N76A 1USYH 4FEDA 2QL3A 4GVOA 5FTIA 1FTLA 1Y3QA 2PVUA 3T22A 4LP2B 3O6GA 4G68C 2DE2A 1NL5A 5AA1A 5DVJA 1B05A 1OQHA 4FEBA 4EF2A 1Q1KA 1LAGE 2UYEA 4ELOA 1UQWA 3IO4A 1IXIA 1TT1A 4DDDA 3KN8A 3G7WA 1DOTA 1JNFA 2FNCA 1SBPA 2Q9TA 2B3FA 3BKIB 3U94A 1MPBA 3V83A 2ZYNA 2DXYA 2CMOA 2VGQA 2ZNTA 4BDRA 1SW4A 3IB0A 1QUKA 3GBBA 5H8NA 3USDA 4ZE8A 2GFEA 3LC8A 2I4BA 4HTGA 3RLFE 1IXHA 2XXHA 5AA2D 5FHMA 4EXLA 4NF4A 3KN7A 1OMPA 3MVYA 1FQEA 3PD8A 1EZOA 2I58A 3TTLA 2I0BA 3BFTA 2I4CA 3H6VA 3OD7A 4JWXA 2Y7PA 5DVIA 4F1UA 4U4SA 3UIFA 1B5JA 2Z8FA 1ZJLA 1LFGA 1BKAA 1AMFA 3IK6B 2ZNUA 2B65A 1SW1A 2P1SA 3IJOB 4U4XA 2NVUB 1NKXA 1MY3A 3PUXE 4GL8A 1N3XA 1N7WA 1B5HA 1IZ1A 3CVGA 3EHTA 1B7ZA 4H5GA 2QMWA 1ZKBA 4MLQA 2QSXA 2Z8EA 1DPEA 2AL4A 4IGRA 3VVDA 4R2FA 1NH7A 3FASA 5F7VA 1XT8A 2VD2A 4KCCA 5TU0A 3U92A 4X9TA 5CRYA 3VXCA 1MXXA 1D9VA 1R9QA 3BBRA 1MQGA 3DP6A 1Y1MA 2HQ0A 3KN3A 3S9EA 1YAEA 5CBRA 3ZSFA 2I0CA 2P0SA 4E0XA 1P1NA 4F2OA 2O6AA 1ANFA 1BIYA 2VOZA 3IOVA 4U21A 1PDAA 4XKNA 2I3WA 2Q89A 1P1WA 3OEKA 4LZ8A 2F8DA 3C33A 2ONKE 4GOTA 4GWOA 4PP0A 2Y7RA 5HBCA 4OENA 4TOZA 3SEUA 1IIWA 1OLAA 1B5IA 3ONMA 4ZZAA 3LSWA 3N6TA 2H98A 3IL1B 4X48A 1TWYA 3CG1A 2XXTA 3ILUB 3A09A 3M3KA 3T9HB 2O7IA 2VD3A 4ELQA 4FAJA 3K1MA 3IB1A 2F5XA 3OSQA 3KFMA 5FHOA 1EZ9A 1R6ZA 5EHMA 4N07A 2XD3A 3TCGA 1S50A 4H5FA 2OCUA 3H6TA 1MH4A 3IOWA 4G68B 4TLLB 3PGFA 2UXAA 1M5BA 4OFLA 3FZVA 1HSEA 4LZ5A 1B2HA 3KZGA 3RNNA 1O7TA 3S4UA 4GL0A 4R73A 5H8NB 4H6DA 3K6XA 4QRZA 3KSXA 3K02A 2DWAA 2F97A 3LUYA 3MVXA 3PMWA 4JDFA 2H9BA 4OETA 4QSEA 5I57B 1A8FA 1SYHA 4LQ2A 5ITOA 1MY1A 2D3IA 2H4IA 5H8QB 4DCYA 4HW8A 5I59B 3RY3A 4LONB 1URSA 3PPRA 1ZTYA 3IJXB 4NF8B 4Q30B 3TCHA 4Z7EA 4Q5TA 3B6TA 4I62A 1FTOA 1USYE 2GHBA 1B1XA 3KEIA 4OYVA 1A40A 1SYIA 3P7IA 4POXA 5TPAB 1QVSA 4IY5A 3WAEA 2Z8DA 2O51A 1GVCA 1GV8A 1LGBC 4OXVA 3TPAA 2O68A 1B4HA 4R6HA 3FATA 4YMAA 2A5SA 1VFDA 4NTLA 4E0WA 2Y7WA 1XS5A 3C36A 4EQ7A 1TXFA 1ATGA 2DVCA 1IUDA 3Q25A 1MXUA 3H7MA 1BP5A 1MDP1 3CFLA 4FORA 4H0WA 4OQOA 2V3UA 4R9FA 1NNKA 3VDFA 4F1YA 3QXMA 4LA9A 1B4ZA 3MZ1A 3MZBA 3AXFA 4OTEA 3M3LA 4PFUA 4WEDA 5I2NA 3FVNA 3FJGA 2RC9A 1MQJA 2RCAA 3JV9A 4G2ZA 5L9SA 3V5AA 2DVZA 2E1SA 2GH9A 5JTYB 3CRBA 4Q0CA 3FIRA 3OMBA 2G29A 4IO2A 5ICQA 1MQIA 2W7YA 3VV5A 3U8QA 2V3QA 4KR5A 3RGYA 4KD5A 1JEUA 4H65A 1B3GA 2VP1A 1WDNA 3HN0A 3SERA 3TQWA 4ELPA 1H45A 1GR2A 1Y4TA 1II5A 4MH5A 4IY6A 1B1HA 3EHUA 1SVXB 1URGA 2F78A 4L17A 4FATA 3E4RA 4O3CA 1P1OA 4R75A 3SKPA 5H8HA 2F7AA 3S9NC 4QFKA 3O6HA 4LVQA 1MPDA 5TP9B 3PV0E 2HEUA 4JB7A 1SI1A 4KYEA 4G4PA 2ZYMA 1FQCA 3HO7A 1MM6A 3K2DA 1RYXA 3L6GA 4FE8A 4OMBA 3D4CA 3W9VA 1LLSA 2OBGA 1UIVA 2AYSA 1LSTA 1WODA 4JWYA 1MG1A 4U1ZA 5B70A 1ZIUA 3PPQA 5KDTB 2QS3A 3B7DA 3OO9A 1B3HA 1SW2A 3UGWA 3VVFA 2ZYKA 1XC1A 3IORA 5BWJA 4OESA 1EH3A 1JVYA 3N5LA 1OVTA 5I56B 4ECFA 4KCDA 1B0HA 3C34A 1O64A 3S2VA 3JZJA 5CMMA 4F19A 1UTHA 2OWSA 1B58A 3K00A 2FYIA 1I6QA 1ZMGA 2O1MA 2O69A 3O29A 3IR1A 3PUVE 4OERA 5ELVA 4ND9A 3FD3A 4Z0IA 3TELA 1FTMA 1CB6A 3F11A 4YKKA 1LFHA 3G3GA 2PMSA 3K6WA 2ANJA 3MBPA 5EHSA 3PMVA 2DE3A 3HHFA 1M5DA 1MRPA 1VR5A 2CZLA 3PPNA 1Y4CA 2IA4A 4KQPA 4UACA 4H1XA 4ZECA 5H8FA 3S9LC 1IEJA 3PMXA 3ZS6A 4G8HA 3PPOA 4PFYA 4F3BA 3HHGA 3O9PA 3QK6A 4P0GA 1P1QA 4PETA 1LB9A 4PE5B 2Z23A 4YZZA 2ZXTA 1DSNA 4K3FA 1B52A 1XVYA 3MPLA 4YU0A 3S9MC 3T66A 5B7DA 4GXAA 1SI0A 4ONYA 4EXKA 3C31A 1J1NA 1LAHE 4RY1A 2XX8A 3V8XB 1R9LA 3N94A 4YAHX 5H8QA 2DE4A 1OVBA 3QAXA 3KOTA 1LBCA 4GRKA 2THIA 2XXUA 3B6QA 2M8CA 2Q2AA 2NUVA 3EN3A 3GZGA 1PBQA 1I6AA 2Y7KA 3HPIA 4H67A 1RKMA 2DP8A 4ZEFA 4ZEKA 1JEVA 1QULA 5HPQA 4JXIA 2DQVA 3MQ9A 5CC2A 3VLWA 1XOCA 5ICTA 3TCFA 1JETA 1MDQA 3IB2A 3TDJA 4G8MA 4PFWA 1B3FA 2D21A 2XXYA 1Y1ZA 3CSGA 3FUZA 3GBAA 3K6VA 4GLIA 4KHZE 2R6GE 4RNSA 4F18A 4DXBA 4ZEDA 1H3DA 2XXWA 4N13A 5A5XA 2LAOA 2O84X 5KCJA 3JYRA 4H8IA 3H3GA 1Q35A 3ECRA 4LUBA 2I3VA 4PFTA 4BLAA 3SETA 1Y20A 2PX1A 2DWIA 3R26A 3BFUA 4FJPA 1PBPA 1POY1 4P11A 4MLVA 5IKBA 4NMYA 1NNTA 5I58A 1M5EA 2IEEA 5H8SA 4GIZA 3SEXA 1FCKA 1HSJA 2NXOA 2YPNA 3IX1A 3PPPA 3DM0A 3FVKA 3U1OA 2VHAA 3C32A 3IOUA 3LSXA 1IQ7A 2X26A 4F1VA 3DELB 4O3AA 1PB9A 1FW0A 4OEUA 3H03A 4GF8A 2R9JA 1LAFE 4C0RA 4G77A 2ESNA 4OFJA 1A99A 1S7YA 1B0LA 3MWBA 3KG2A 5CI5A 2NWJA 5HM4B 1A54A 3FV2A 1AL3A 4EF1A 2REGA 3T9VA 3PUYE 1N84A 4HCYA 4ISUA 4GD5A 1SDXA 1MM7A 5AA2A 4NF6A 4LQ5A 3KOSA 5L9OA 4TLMB 4R6YA 3H6WA 4M1VA 2XX9A 4DZ1A 4JWOA 2I6EA 4QF9A 1N3WA 3ZKKA 1QKAA 2F7BA 4F39A 1A7LA 3RUMA 5F1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXW A;  2XHD A;  4YIC A;  5I2K B;  2V84 A;  3UK4 A;  4IO7 A;  2V3T A;  3TEP A;  3PUZ E;  4KFQ A;  5ISU A;  5LOM A;  3TMG A;  1GTK A;  3VE1 B;  2ABH A;  4LAT A;  4LZ7 A;  3R7X A;  4R9G A;  3QSL A;  2F34 A;  3N6U A;  2F35 A;  4NWC A;  3T93 B;  2GHA A;  4DCX A;  5CM6 A;  2F7C A;  3VLU A;  3OO8 A;  2PBW A;  2R71 A;  5CMK A;  3TAJ A;  4ELR A;  4GQO A;  1JW5 A;  3D4G A;  3IAZ A;  2XD2 A;  1GGG A;  1QUJ A;  3RN8 A;  2OWT A;  3LR1 A;  3N26 A;  5FTH A;  1BLF A;  1XHY A;  3TTR A;  3RPW A;  2D5W A;  1TFA A;  3H4Z A;  3RT6 B;  4R6K A;  3QUF A;  2QS1 A;  3HST A;  4IO6 A;  1DTG A;  1LBB A;  3Q26 A;  1MPC A;  4IO3 A;  3UN6 A;  2AIX A;  4U23 A;  1NNP A;  4BDM A;  3H06 B;  2HZK A;  1PB8 A;  4C1T A;  3K1N A;  2Q2C A;  3FJ7 A;  4WKM A;  3SDF A;  4OHN A;  3PUW E;  5M2V A;  3K01 A;  3OEM A;  2Y7I A;  3TTN A;  2Y84 A;  2F6G A;  3EHS A;  2F36 A;  4OZ9 A;  4R2B A;  4ZZE A;  4F3S A;  3K1P A;  2XXQ A;  4RA1 A;  1Y9U A;  2WKY A;  1DPP A;  1TFD A;  4QSD A;  4RXL A;  3WAF A;  4BDN A;  1JQF A;  3MZ9 A;  3UOR A;  3L6H A;  4U2R A;  1M5C A;  1B6H A;  1OIB A;  4X1D A;  4NF5 B;  3RQT A;  4NF5 A;  1PB7 A;  1ZBM A;  4RJZ A;  3TTK A;  4QFN A;  3A3U A;  3V89 B;  1QKB A;  1ZU0 A;  2GRV A;  3CSB A;  1B7U A;  1FQA A;  3H6U A;  3HCQ A;  3MC2 A;  3MVW A;  4I9D A;  3IOT A;  2REJ A;  3TKD A;  1POT A;  1FTJ A;  2DSF A;  1MH3 A;  3K6U A;  4JSO A;  4ZEI A;  3MJN A;  3K4U A;  1SW5 A;  3E9X A;  1US4 A;  3OSR A;  4RK2 A;  4XIG Q;  5AA4 B;  1VE4 A;  3TTM A;  4YMB A;  4XTC Q;  2XXR A;  3O97 A;  1L5T A;  1VSO A;  4ESW A;  1F9B A;  1YCJ A;  2QS4 A;  2RCB A;  4F22 A;  4OFO A;  3CFX A;  3VXB A;  5A5X B;  4GFR A;  2YJP A;  2OK2 A;  1NNF A;  3FV1 A;  1NFT A;  1IXC A;  4GXS B;  5TPA A;  3SEV A;  2PYY A;  5H8F B;  4KPT A;  1UTB A;  2QS2 A;  3TFL A;  2UYF A;  4F2Q A;  1OLC A;  2DWJ A;  2FA7 A;  4RK9 A;  2QMX A;  5I59 A;  1B9J A;  1B51 A;  3LSF B;  3O6I A;  4OEV A;  4WXJ A;  4X1B A;  4QSC A;  5L9M A;  2QPQ A;  4AB6 A;  3M8U A;  3MP6 A;  5I57 A;  3M3F A;  1MY4 A;  4F3G A;  2NOO A;  3KJ7 A;  4EUO A;  4IO5 A;  4DXC A;  2O7U A;  3T9X B;  3FXU A;  1A8E A;  1M5F A;  1LCF A;  2PT1 A;  3TQL A;  3VVE A;  2A5T B;  3RTF B;  4F29 A;  5I56 A;  1QJM A;  2H5Y A;  1FQF A;  3G3H A;  3MW0 A;  3LBS A;  3W15 C;  3QIM A;  5ITP A;  1B3E A;  1KWH A;  4HCW A;  5CMB A;  2QJE A;  3SEY A;  4PQJ A;  2Q88 A;  1B40 A;  3MP1 A;  3OXN A;  3DP8 A;  3KSJ A;  4ZS9 A;  2XXV A;  2XXX A;  3KJT A;  3ODB A;  4MF3 A;  3PD9 A;  4YKI A;  4R72 A;  5K2X A;  1FTK A;  2YLN A;  2Q8J A;  3U72 A;  4BDL A;  2HAU A;  4C1U A;  1D9Y A;  3Q29 A;  4EQB A;  3OOA A;  4KYS A;  1N04 A;  1Y3P A;  3B6W A;  4RYA A;  4F3P A;  5KCJ B;  1WVJ A;  2DYX A;  3KGC A;  3C4M A;  3I6V A;  2Z22 A;  3HV1 A;  2QRY A;  2E0S A;  1SD3 A;  2OJT A;  4G8N A;  4UA8 A;  4DIG A;  5JK4 A;  2RKM A;  4H8J A;  3MP8 A;  1P1U A;  4IO4 A;  4RPO A;  2V93 A;  4YB5 A;  1Z7N E;  1AIV A;  2G93 A;  1JW4 A;  3G3F A;  4QFP A;  2RF1 A;  4R74 A;  3DLN A;  4FIM A;  3QUJ A;  1MXZ A;  3A3C A;  3IO6 A;  3CI8 A;  3FVO A;  3SEW A;  3TZA A;  3FVG A;  4XKR A;  3MAM A;  3U93 A;  5FHN A;  4EDP A;  2H25 A;  2X7Q A;  3OO6 A;  1IXG A;  3FXQ A;  4I1D A;  4TQU Q;  1Z7M E;  4IB2 A;  3OEN A;  4P0I A;  4U22 A;  3CG3 A;  5CMC A;  5DEX B;  1OQG A;  1LB8 A;  1XVX A;  1JW1 A;  2OZZ A;  5DT6 A;  5AA3 A;  5I58 B;  5I84 A;  4Q8R A;  5KDT A;  2PT2 A;  5I2N B;  2I49 A;  4F31 B;  4THI A;  5I2K A;  1HSL A;  1B32 A;  4FEC A;  3TYH A;  3EF7 A;  3TOD A;  3MVZ A;  3RTW B;  3UP9 A;  5DYH A;  3R6U A;  4U1O A;  3FXR A;  4XKQ A;  1FQB A;  3DP4 A;  3MPK A;  1ELJ A;  3ZKL A;  4ZE9 A;  2HCA A;  4QFO A;  3LSL A;  1BTJ A;  3G3I A;  1MXY A;  1YPN A;  4NF6 B;  2HFB A;  5JEI A;  1FQD A;  2KLF A;  3FGS A;  3G3K A;  1A55 A;  1I6B A;  4OWD A;  4ESX A;  1P99 A;  2AL5 A;  1CE2 A;  3OEL A;  1B3L A;  1DTZ A;  1URD A;  1JVX A;  2ALU A;  1LAX A;  2OLB A;  3E13 X;  4I8C A;  4M4G A;  2A5T A;  4MFI A;  4NF8 A;  1B46 A;  4NF4 B;  4WEP A;  4AB5 A;  1VFE A;  3E3K A;  4KYD A;  1PEB A;  2XXP A;  2DWH A;  5DVF A;  3T9U A;  3VFJ A;  1AOV A;  1MQD A;  1D4N A;  4NE4 A;  1I69 A;  1QUI A;  3CIJ A;  3O28 A;  5J1D A;  4QFL A;  1MQH A;  3I5O A;  4RPN A;  5AE4 A;  5JTY A;  1MS7 A;  1MY0 A;  2F6P A;  2UVH A;  4NWD A;  1N0T A;  2ONS A;  2V25 A;  1MY2 A;  5IAI A;  2XXI A;  4KI0 E;  3GXA A;  2UVI A;  1UTB B;  4MBP A;  4O3B A;  3K0V A;  3MUQ A;  1LCT A;  3CFZ A;  4HS7 A;  1EZP A;  3Q27 A;  4G68 A;  4XKP A;  3GLB A;  2RIN A;  1N7X A;  4QHQ A;  5DEX A;  3OO7 A;  4NED A;  2XX7 A;  4JSD A;  3EQ1 A;  1EU8 A;  4ZEB A;  3UA8 A;  1AH5 A;  5TP9 A;  4DLD A;  4EQ9 A;  1RYO A;  4YB7 A;  3W9W A;  1MXV A;  1H76 A;  2H99 A;  1Y3N A;  3CR9 A;  5H8H B;  2O1L A;  1IIT A;  3G3J A;  5AA2 B;  5AA4 A;  1D3K A;  3T96 B;  5BUU A;  4BDO A;  1SQY A;  4BDQ A;  3I3V A;  4JBZ A;  4XXU A;  2DS9 A;  2RC7 A;  3PU5 A;  3QYT A;  1NMU A;  1LFI A;  1H43 A;  2B3B A;  3C35 A;  3FJM A;  4AQ4 A;  3RT8 A;  1S9T A;  2DOJ A;  1T0K A;  2HAV A;  1UIU A;  3O66 A;  4DXU A;  1ZLQ A;  2ZYO A;  5K2Y A;  1US5 A;  4YB6 A;  1B7H A;  3THI A;  2ONR A;  3ILT B;  2ZMB A;  1UTH B;  2HXW A;  4YKP A;  2I48 A;  4OVJ A;  5EYF A;  5DTB A;  1PC3 A;  2DXR A;  3KBR A;  1R1N A;  1O63 A;  2X7P A;  4IGT A;  4ZDM A;  1DMB A;  1H44 A;  4POW A;  5L8D A;  3SES A;  2ZNS A;  4YKJ A;  3EPE A;  3VLV A;  5CBS A;  1YTV A;  4DE8 A;  5KZT A;  2RC8 A;  1QW0 A;  2UVJ A;  2BJJ X;  3Q28 A;  2P2A A;  2HZL A;  3C9H A;  3O2A A;  4N6P A;  3TUS A;  2UVG A;  1NH8 A;  1N76 A;  1USY H;  4FED A;  2QL3 A;  4GVO A;  5FTI A;  1FTL A;  1Y3Q A;  2PVU A;  3T22 A;  4LP2 B;  3O6G A;  4G68 C;  2DE2 A;  1NL5 A;  5AA1 A;  5DVJ A;  1B05 A;  1OQH A;  4FEB A;  4EF2 A;  1Q1K A;  1LAG E;  2UYE A;  4ELO A;  1UQW A;  3IO4 A;  1IXI A;  1TT1 A;  4DDD A;  3KN8 A;  3G7W A;  1DOT A;  1JNF A;  2FNC A;  1SBP A;  2Q9T A;  2B3F A;  3BKI B;  3U94 A;  1MPB A;  3V83 A;  2ZYN A;  2DXY A;  2CMO A;  2VGQ A;  2ZNT A;  4BDR A;  1SW4 A;  3IB0 A;  1QUK A;  3GBB A;  5H8N A;  3USD A;  4ZE8 A;  2GFE A;  3LC8 A;  2I4B A;  4HTG A;  3RLF E;  1IXH A;  2XXH A;  5AA2 D;  5FHM A;  4EXL A;  4NF4 A;  3KN7 A;  1OMP A;  3MVY A;  1FQE A;  3PD8 A;  1EZO A;  2I58 A;  3TTL A;  2I0B A;  3BFT A;  2I4C A;  3H6V A;  3OD7 A;  4JWX A;  2Y7P A;  5DVI A;  4F1U A;  4U4S A;  3UIF A;  1B5J A;  2Z8F A;  1ZJL A;  1LFG A;  1BKA A;  1AMF A;  3IK6 B;  2ZNU A;  2B65 A;  1SW1 A;  2P1S A;  3IJO B;  4U4X A;  2NVU B;  1NKX A;  1MY3 A;  3PUX E;  4GL8 A;  1N3X A;  1N7W A;  1B5H A;  1IZ1 A;  3CVG A;  3EHT A;  1B7Z A;  4H5G A;  2QMW A;  1ZKB A;  4MLQ A;  2QSX A;  2Z8E A;  1DPE A;  2AL4 A;  4IGR A;  3VVD A;  4R2F A;  1NH7 A;  3FAS A;  5F7V A;  1XT8 A;  2VD2 A;  4KCC A;  5TU0 A;  3U92 A;  4X9T A;  5CRY A;  3VXC A;  1MXX A;  1D9V A;  1R9Q A;  3BBR A;  1MQG A;  3DP6 A;  1Y1M A;  2HQ0 A;  3KN3 A;  3S9E A;  1YAE A;  5CBR A;  3ZSF A;  2I0C A;  2P0S A;  4E0X A;  1P1N A;  4F2O A;  2O6A A;  1ANF A;  1BIY A;  2VOZ A;  3IOV A;  4U21 A;  1PDA A;  4XKN A;  2I3W A;  2Q89 A;  1P1W A;  3OEK A;  4LZ8 A;  2F8D A;  3C33 A;  2ONK E;  4GOT A;  4GWO A;  4PP0 A;  2Y7R A;  5HBC A;  4OEN A;  4TOZ A;  3SEU A;  1IIW A;  1OLA A;  1B5I A;  3ONM A;  4ZZA A;  3LSW A;  3N6T A;  2H98 A;  3IL1 B;  4X48 A;  1TWY A;  3CG1 A;  2XXT A;  3ILU B;  3A09 A;  3M3K A;  3T9H B;  2O7I A;  2VD3 A;  4ELQ A;  4FAJ A;  3K1M A;  3IB1 A;  2F5X A;  3OSQ A;  3KFM A;  5FHO A;  1EZ9 A;  1R6Z A;  5EHM A;  4N07 A;  2XD3 A;  3TCG A;  1S50 A;  4H5F A;  2OCU A;  3H6T A;  1MH4 A;  3IOW A;  4G68 B;  4TLL B;  3PGF A;  2UXA A;  1M5B A;  4OFL A;  3FZV A;  1HSE A;  4LZ5 A;  1B2H A;  3KZG A;  3RNN A;  1O7T A;  3S4U A;  4GL0 A;  4R73 A;  5H8N B;  4H6D A;  3K6X A;  4QRZ A;  3KSX A;  3K02 A;  2DWA A;  2F97 A;  3LUY A;  3MVX A;  3PMW A;  4JDF A;  2H9B A;  4OET A;  4QSE A;  5I57 B;  1A8F A;  1SYH A;  4LQ2 A;  5ITO A;  1MY1 A;  2D3I A;  2H4I A;  5H8Q B;  4DCY A;  4HW8 A;  5I59 B;  3RY3 A;  4LON B;  1URS A;  3PPR A;  1ZTY A;  3IJX B;  4NF8 B;  4Q30 B;  3TCH A;  4Z7E A;  4Q5T A;  3B6T A;  4I62 A;  1FTO A;  1USY E;  2GHB A;  1B1X A;  3KEI A;  4OYV A;  1A40 A;  1SYI A;  3P7I A;  4POX A;  5TPA B;  1QVS A;  4IY5 A;  3WAE A;  2Z8D A;  2O51 A;  1GVC A;  1GV8 A;  1LGB C;  4OXV A;  3TPA A;  2O68 A;  1B4H A;  4R6H A;  3FAT A;  4YMA A;  2A5S A;  1VFD A;  4NTL A;  4E0W A;  2Y7W A;  1XS5 A;  3C36 A;  4EQ7 A;  1TXF A;  1ATG A;  2DVC A;  1IUD A;  3Q25 A;  1MXU A;  3H7M A;  1BP5 A;  1MDP 1;  3CFL A;  4FOR A;  4H0W A;  4OQO A;  2V3U A;  4R9F A;  1NNK A;  3VDF A;  4F1Y A;  3QXM A;  4LA9 A;  1B4Z A;  3MZ1 A;  3MZB A;  3AXF A;  4OTE A;  3M3L A;  4PFU A;  4WED A;  5I2N A;  3FVN A;  3FJG A;  2RC9 A;  1MQJ A;  2RCA A;  3JV9 A;  4G2Z A;  5L9S A;  3V5A A;  2DVZ A;  2E1S A;  2GH9 A;  5JTY B;  3CRB A;  4Q0C A;  3FIR A;  3OMB A;  2G29 A;  4IO2 A;  5ICQ A;  1MQI A;  2W7Y A;  3VV5 A;  3U8Q A;  2V3Q A;  4KR5 A;  3RGY A;  4KD5 A;  1JEU A;  4H65 A;  1B3G A;  2VP1 A;  1WDN A;  3HN0 A;  3SER A;  3TQW A;  4ELP A;  1H45 A;  1GR2 A;  1Y4T A;  1II5 A;  4MH5 A;  4IY6 A;  1B1H A;  3EHU A;  1SVX B;  1URG A;  2F78 A;  4L17 A;  4FAT A;  3E4R A;  4O3C A;  1P1O A;  4R75 A;  3SKP A;  5H8H A;  2F7A A;  3S9N C;  4QFK A;  3O6H A;  4LVQ A;  1MPD A;  5TP9 B;  3PV0 E;  2HEU A;  4JB7 A;  1SI1 A;  4KYE A;  4G4P A;  2ZYM A;  1FQC A;  3HO7 A;  1MM6 A;  3K2D A;  1RYX A;  3L6G A;  4FE8 A;  4OMB A;  3D4C A;  3W9V A;  1LLS A;  2OBG A;  1UIV A;  2AYS A;  1LST A;  1WOD A;  4JWY A;  1MG1 A;  4U1Z A;  5B70 A;  1ZIU A;  3PPQ A;  5KDT B;  2QS3 A;  3B7D A;  3OO9 A;  1B3H A;  1SW2 A;  3UGW A;  3VVF A;  2ZYK A;  1XC1 A;  3IOR A;  5BWJ A;  4OES A;  1EH3 A;  1JVY A;  3N5L A;  1OVT A;  5I56 B;  4ECF A;  4KCD A;  1B0H A;  3C34 A;  1O64 A;  3S2V A;  3JZJ A;  5CMM A;  4F19 A;  1UTH A;  2OWS A;  1B58 A;  3K00 A;  2FYI A;  1I6Q A;  1ZMG A;  2O1M A;  2O69 A;  3O29 A;  3IR1 A;  3PUV E;  4OER A;  5ELV A;  4ND9 A;  3FD3 A;  4Z0I A;  3TEL A;  1FTM A;  1CB6 A;  3F11 A;  4YKK A;  1LFH A;  3G3G A;  2PMS A;  3K6W A;  2ANJ A;  3MBP A;  5EHS A;  3PMV A;  2DE3 A;  3HHF A;  1M5D A;  1MRP A;  1VR5 A;  2CZL A;  3PPN A;  1Y4C A;  2IA4 A;  4KQP A;  4UAC A;  4H1X A;  4ZEC A;  5H8F A;  3S9L C;  1IEJ A;  3PMX A;  3ZS6 A;  4G8H A;  3PPO A;  4PFY A;  4F3B A;  3HHG A;  3O9P A;  3QK6 A;  4P0G A;  1P1Q A;  4PET A;  1LB9 A;  4PE5 B;  2Z23 A;  4YZZ A;  2ZXT A;  1DSN A;  4K3F A;  1B52 A;  1XVY A;  3MPL A;  4YU0 A;  3S9M C;  3T66 A;  5B7D A;  4GXA A;  1SI0 A;  4ONY A;  4EXK A;  3C31 A;  1J1N A;  1LAH E;  4RY1 A;  2XX8 A;  3V8X B;  1R9L A;  3N94 A;  4YAH X;  5H8Q A;  2DE4 A;  1OVB A;  3QAX A;  3KOT A;  1LBC A;  4GRK A;  2THI A;  2XXU A;  3B6Q A;  2M8C A;  2Q2A A;  2NUV A;  3EN3 A;  3GZG A;  1PBQ A;  1I6A A;  2Y7K A;  3HPI A;  4H67 A;  1RKM A;  2DP8 A;  4ZEF A;  4ZEK A;  1JEV A;  1QUL A;  5HPQ A;  4JXI A;  2DQV A;  3MQ9 A;  5CC2 A;  3VLW A;  1XOC A;  5ICT A;  3TCF A;  1JET A;  1MDQ A;  3IB2 A;  3TDJ A;  4G8M A;  4PFW A;  1B3F A;  2D21 A;  2XXY A;  1Y1Z A;  3CSG A;  3FUZ A;  3GBA A;  3K6V A;  4GLI A;  4KHZ E;  2R6G E;  4RNS A;  4F18 A;  4DXB A;  4ZED A;  1H3D A;  2XXW A;  4N13 A;  5A5X A;  2LAO A;  2O84 X;  5KCJ A;  3JYR A;  4H8I A;  3H3G A;  1Q35 A;  3ECR A;  4LUB A;  2I3V A;  4PFT A;  4BLA A;  3SET A;  1Y20 A;  2PX1 A;  2DWI A;  3R26 A;  3BFU A;  4FJP A;  1PBP A;  1POY 1;  4P11 A;  4MLV A;  5IKB A;  4NMY A;  1NNT A;  5I58 A;  1M5E A;  2IEE A;  5H8S A;  4GIZ A;  3SEX A;  1FCK A;  1HSJ A;  2NXO A;  2YPN A;  3IX1 A;  3PPP A;  3DM0 A;  3FVK A;  3U1O A;  2VHA A;  3C32 A;  3IOU A;  3LSX A;  1IQ7 A;  2X26 A;  4F1V A;  3DEL B;  4O3A A;  1PB9 A;  1FW0 A;  4OEU A;  3H03 A;  4GF8 A;  2R9J A;  1LAF E;  4C0R A;  4G77 A;  2ESN A;  4OFJ A;  1A99 A;  1S7Y A;  1B0L A;  3MWB A;  3KG2 A;  5CI5 A;  2NWJ A;  5HM4 B;  1A54 A;  3FV2 A;  1AL3 A;  4EF1 A;  2REG A;  3T9V A;  3PUY E;  1N84 A;  4HCY A;  4ISU A;  4GD5 A;  1SDX A;  1MM7 A;  5AA2 A;  4NF6 A;  4LQ5 A;  3KOS A;  5L9O A;  4TLM B;  4R6Y A;  3H6W A;  4M1V A;  2XX9 A;  4DZ1 A;  4JWO A;  2I6E A;  4QF9 A;  1N3W A;  3ZKK A;  1QKA A;  2F7B A;  4F39 A;  1A7L A;  3RUM A;  5F1Q A; 
#chains in the Genus database with same CATH topology
 4YIC A;  5I2K B;  2V84 A;  2QVU A;  5LOM A;  1GTK A;  2ABH A;  4R9G A;  3QSL A;  2F34 A;  2F7C A;  5EQ8 A;  2XD2 A;  3N26 A;  5FTH A;  3RPW A;  4IO6 A;  3UN6 A;  2HZK A;  4WKM A;  2MKZ A;  3K01 A;  2Y7I A;  2F6G A;  2F36 A;  4F3S A;  3KBZ A;  3WAF A;  1Y9U A;  4BDN A;  1B6H A;  5ET6 A;  1PB7 A;  1ZBM A;  4MHF A;  3TTK A;  4QFN A;  3V89 B;  3CSB A;  1B7U A;  3MC2 A;  3TKD A;  2REJ A;  1FTJ A;  2DSF A;  1US4 A;  4XTC Q;  4ESW A;  1VSO A;  1YCJ A;  2QS4 A;  1FBP A;  1AWB A;  1NNF A;  1OLC A;  2DWJ A;  1B51 A;  1NV2 A;  5L9M A;  2QPQ A;  3RYD A;  2WBB A;  1A8E A;  2PT1 A;  3LV0 A;  3W15 C;  3SEY A;  4PQJ A;  4QBA A;  2XXV A;  3KJT A;  4MF3 A;  3T22 A;  2YLN A;  3B6W A;  1EYK A;  4I40 A;  1SD3 A;  4QFP A;  3G3F A;  2RF1 A;  3DLN A;  3A3C A;  3SEW A;  3FVG A;  5FHN A;  3FXQ A;  4TQU Q;  3OEN A;  2OZZ A;  1XVX A;  4Q8R A;  5I2N B;  1YZ0 A;  1HSL A;  3TYH A;  3EF7 A;  3RTW B;  4U1O A;  3MPK A;  4NX1 A;  3FGS A;  2AL5 A;  1B3L A;  4MFI A;  4M4G A;  4I8C A;  4EXK A;  4NF8 A;  4NF4 B;  1B46 A;  4WEP A;  4KYD A;  4XF5 A;  4NE4 A;  4PFB A;  5J1D A;  1MQH A;  2CZH A;  2CEY A;  1MY2 A;  1NI9 A;  4KI0 E;  4MBP A;  3Q27 A;  4QHQ A;  3OO7 A;  4NED A;  4JSD A;  4ZEB A;  3UA8 A;  5TP9 A;  4DLD A;  2H99 A;  1IIT A;  5AA4 A;  3T96 B;  4BDQ A;  4XXU A;  1T0K A;  2DOJ A;  2HAV A;  1G0H A;  4DXU A;  1FPF A;  1ZLQ A;  2ZYO A;  3THI A;  1UTH B;  2KQZ A;  2I48 A;  2DXR A;  1O63 A;  5L8D A;  3VLV A;  1QW0 A;  2P2A A;  2QL3 A;  1FTL A;  1Y3Q A;  3O6G A;  2DE2 A;  1Q1K A;  3IO4 A;  2Q9T A;  2CMO A;  2OX3 A;  5H8N A;  2GFE A;  1IXH A;  4P3L A;  5FHM A;  4EXL A;  2I58 A;  3BFT A;  4JWX A;  3OD7 A;  5DVI A;  2Y7P A;  3K6U A;  4R72 A;  4FIM A;  4YB7 A;  1LFG A;  1AMF A;  2B65 A;  2P1S A;  3IJO B;  2NVU B;  1NKX A;  5A5L A;  1MY3 A;  3PUX E;  1N3X A;  3EHT A;  1ZKB A;  1DPE A;  2CZI A;  4X9T A;  3VXC A;  4PGP A;  1R9Q A;  3DP6 A;  1Y1M A;  5EQ9 A;  1YAE A;  5LDZ A;  5I3S A;  3ZSF A;  2P0S A;  4E0X A;  1BIY A;  2Q89 A;  3OEK A;  1P1W A;  4LZ8 A;  3C33 A;  4GWO A;  2Y7R A;  5HBC A;  2XXK A;  3IL1 B;  3T9H B;  2VD3 A;  3IB1 A;  4H5F A;  1MH4 A;  3BIG A;  3RNN A;  3KZG A;  3S4U A;  4GL0 A;  3KSX A;  3LUY A;  2FBP A;  4OET A;  1SYH A;  4DCY A;  2D3I A;  4LON B;  4XEQ A;  3TCH A;  4P1E A;  2WX9 A;  4RYA A;  2GHB A;  1NV7 A;  3KEI A;  5TPA B;  4P9K A;  4IY5 A;  4OXV A;  1TXF A;  3Q25 A;  4H0W A;  4MEV A;  4LA9 A;  1B4Z A;  4WED A;  2RC9 A;  3JV9 A;  2DVZ A;  5JTY B;  2G29 A;  5ICQ A;  4GX3 A;  2W7Y A;  3U8Q A;  2V3Q A;  3RGY A;  4H65 A;  1WDN A;  1H45 A;  4FAT A;  3SKP A;  2F7A A;  4QFK A;  2XA5 A;  2ZYM A;  1FQC A;  4FE8 A;  2OBG A;  1WOD A;  1MG1 A;  1ZIU A;  2QS3 A;  1B3H A;  3UGW A;  2ZYK A;  4OES A;  1OVT A;  3C34 A;  3B8B A;  3QYT A;  4AQ4 A;  3PUV E;  1I6Q A;  1NUW A;  2O69 A;  3EKI A;  3FD3 A;  4HE1 A;  1CB6 A;  4GBV A;  4YKK A;  2PMS A;  3HHF A;  1VR5 A;  2CZL A;  5H8F A;  3S9L C;  5ET5 A;  1IEJ A;  4PFY A;  4P0G A;  1NUY A;  1P1Q A;  4PE5 B;  2Z23 A;  2ZXT A;  1DSN A;  1B52 A;  1XVY A;  3MPL A;  4YU0 A;  5B7D A;  4PAI A;  4N6D A;  3N94 A;  1OVB A;  1FRP A;  2Q2A A;  1FBG A;  1I6A A;  2Y7K A;  3HPI A;  2DQV A;  5CC2 A;  1JET A;  3IB2 A;  2R6G E;  5A5X A;  2LAO A;  3JYR A;  5EYG A;  4BLA A;  1NV1 A;  1POY 1;  4MLV A;  5IKB A;  2ZZV A;  4GIZ A;  5IZ3 B;  1HSJ A;  2YPN A;  3IX1 A;  2VHA A;  4GWX A;  3LSX A;  2X26 A;  1PB9 A;  4UAB A;  1LAF E;  1A99 A;  3MWB A;  5HM4 B;  4NHB A;  2REG A;  3PUY E;  1N84 A;  4NF6 A;  3ISP A;  1A7L A;  3RUM A;  2XHD A;  3FXB A;  4IO7 A;  2V3T A;  3PUZ E;  4KFQ A;  4LZ7 A;  1KA0 A;  2F35 A;  2GHA A;  1NV0 A;  5CMK A;  3IAZ A;  1FPI A;  4OVR A;  4AS5 A;  1BLF A;  4N81 A;  3HST A;  1DTG A;  4IO3 A;  2FVZ A;  4U23 A;  1PB8 A;  2Q2C A;  3SDF A;  1FBD A;  2XXQ A;  4RA1 A;  1DPP A;  1JQF A;  3L6H A;  1OIB A;  4NF5 A;  4RJZ A;  3A3U A;  1QKB A;  1ZU0 A;  2GRV A;  3MVW A;  4OFJ A;  3BIH A;  4JSO A;  4ZEI A;  4GX4 A;  4RK2 A;  4HE0 A;  3VXB A;  4GFR A;  2YJP A;  1NFT A;  1IXC A;  5TPA A;  2PYY A;  1LBV A;  1UTB A;  4KPT A;  2UYF A;  2QMX A;  1B9J A;  3O6I A;  3LSF B;  4AB6 A;  3KJ7 A;  1K9Z A;  3T9X B;  1NV6 A;  4F29 A;  5I56 A;  2H5Y A;  3MW0 A;  2Q74 A;  1B3E A;  1KWH A;  5CMB A;  2QJE A;  3MP1 A;  3DP8 A;  4PTK A;  4EQB A;  1Y3P A;  2DYX A;  3HV1 A;  4DIG A;  4UA8 A;  2OJT A;  5JK4 A;  2RKM A;  4RPO A;  3B50 A;  1Z7N E;  2WBD A;  1FPD A;  4R74 A;  1MXZ A;  3MST A;  4N4U A;  3TZA A;  3U93 A;  1YXI A;  4EDP A;  5ET7 A;  1Z7M E;  4IB2 A;  3FBP A;  4H45 A;  5DT6 A;  1OQG A;  5KDT A;  2PT2 A;  2HXR A;  4THI A;  5I2K A;  3MVZ A;  5DYH A;  3R6U A;  1FQB A;  3DP4 A;  4ZE9 A;  1BTJ A;  3G3I A;  1YPN A;  4NF6 B;  1FQD A;  4OWD A;  3G3K A;  4ESX A;  4ELQ A;  5FHO A;  2OLB A;  5DVF A;  3E3K A;  1PEB A;  2PCR A;  2DWH A;  3VFJ A;  1MQD A;  1QUI A;  3CIJ A;  2F6P A;  4NWD A;  5IAI A;  2XXI A;  1UTB B;  5DW8 A;  4O3B A;  3MUQ A;  1EZP A;  4XKP A;  2QVR A;  4DI4 B;  3EQ1 A;  3ROJ A;  1MXV A;  1H76 A;  3G3J A;  1D3K A;  4BDO A;  1SQY A;  3I3V A;  4MCO A;  2RC7 A;  3PU5 A;  2B3B A;  3C35 A;  2FIE A;  5K2Y A;  1US5 A;  4P8B A;  2ONR A;  3ILT B;  4OVJ A;  5EYF A;  3RPL B;  3KBR A;  2X7P A;  1H44 A;  4POW A;  5IZ3 A;  2ZNS A;  5I7I A;  5CBS A;  1YTV A;  4DE8 A;  2RC8 A;  2BJJ X;  2XWK A;  2HZL A;  4N6P A;  4GWY A;  1USY H;  4G68 C;  5AA1 A;  1B05 A;  1OQH A;  4FEB A;  1LAG E;  1TT1 A;  1DOT A;  1JNF A;  2FNC A;  1SBP A;  3U94 A;  3V83 A;  2ZYN A;  2VGQ A;  1SW4 A;  1FBH A;  3USD A;  3LC8 A;  2I4B A;  3KN7 A;  1OMP A;  3GYY A;  3UIF A;  1NV3 A;  2ZNU A;  4U4X A;  4GL8 A;  2QSX A;  1NH7 A;  2VD2 A;  3U92 A;  5CRY A;  1D9V A;  2HQ0 A;  3KN3 A;  1P1N A;  2O6A A;  1ANF A;  3IOV A;  2F8D A;  4TOZ A;  3ONM A;  1OLA A;  3LSW A;  4LN5 A;  1KZ8 A;  1TWY A;  2VPN A;  3CG1 A;  2XXT A;  2XWI A;  4N07 A;  2XD3 A;  1S50 A;  4I3Y A;  1HSE A;  1O7T A;  4H46 A;  3PMW A;  4QSE A;  1A8F A;  2H4I A;  1URS A;  4Q30 B;  3UK4 A;  2HPG A;  1SYI A;  3P7I A;  2WEF A;  4NG7 A;  2Z8D A;  4R6H A;  1VFD A;  4NTL A;  4E0W A;  2Y7W A;  1XS5 A;  1ATG A;  2DVC A;  1MXU A;  1MDP 1;  2JJK A;  3CFL A;  4FOR A;  4R9F A;  4F1Y A;  4Z0I A;  3M3L A;  3V5A A;  2GH9 A;  3FIR A;  1MQI A;  4JVC A;  1K9Y A;  4KD5 A;  1JEU A;  1B3G A;  2VP1 A;  3HN0 A;  4ELP A;  3TQW A;  2F78 A;  2CEX A;  4R75 A;  1P1O A;  3O6H A;  4LVQ A;  5DEX B;  5I84 A;  2OWZ A;  3HO7 A;  1RYX A;  1UIV A;  4GX6 A;  4JWY A;  3PPQ A;  3OO9 A;  3VVF A;  1XC1 A;  5I56 B;  5BWJ A;  4ECF A;  1B0H A;  4F19 A;  3K00 A;  5ELV A;  2FYI A;  1ZMG A;  4ND9 A;  3F11 A;  1LFH A;  3G3G A;  3MBP A;  4O8M A;  2IA4 A;  3PMX A;  4G8H A;  3QK6 A;  4YZZ A;  4K3F A;  1FSA A;  4PAK A;  1SI0 A;  4PDH A;  4P47 A;  1J1N A;  4MNI A;  3KOT A;  2M8C A;  2NUV A;  3GZG A;  4MAG A;  4ZEF A;  4ZEK A;  4MMP A;  4JXI A;  5ICT A;  3CSG A;  4GLI A;  4KHZ E;  1INP A;  4I3E A;  4RNS A;  4F18 A;  4DXB A;  4ZED A;  2O84 X;  5KCJ A;  4H8I A;  4LUB A;  3ECR A;  2PX1 A;  2DWI A;  3R26 A;  3BFU A;  4FJP A;  4DI3 D;  5I58 A;  1M5E A;  3SEX A;  1LEV A;  3PPP A;  4PC9 A;  3FVK A;  4PCD A;  5LTC A;  3DEL B;  1FW0 A;  4NQ8 A;  4G77 A;  2ESN A;  5CI5 A;  1B0L A;  3KG2 A;  1A54 A;  1AL3 A;  3T9V A;  1MM7 A;  3H6W A;  4DZ1 A;  4QF9 A;  1N3W A;  1QKA A;  4OVP A;  3VE1 B;  4LAT A;  3R7X A;  5CM6 A;  4NWC A;  3N6U A;  3T93 B;  1EYJ A;  3VLU A;  3TAJ A;  4ELR A;  4OVQ A;  3RN8 A;  4N15 A;  1TFA A;  4GWU A;  2QS1 A;  1MPC A;  1FPG A;  2AIX A;  4BDM A;  3H06 B;  5IM2 A;  4C1T A;  4OHN A;  5M2V A;  2Y84 A;  3EHS A;  4QSD A;  1FBE A;  4N8G A;  4MNC A;  1M5C A;  4X1D A;  3RQT A;  3S9M C;  3H6U A;  4I9D A;  1XI6 A;  3IOT A;  1POT A;  1SW5 A;  4XIG Q;  1IMB A;  1VE4 A;  3TTM A;  4YMB A;  1F9B A;  4F22 A;  4OFO A;  2B4L A;  3FV1 A;  3SEV A;  3TFL A;  1VDW A;  4WXJ A;  4QSC A;  3M8U A;  3MP6 A;  5I57 A;  3M3F A;  1MY4 A;  2NOO A;  4DXC A;  3FXU A;  1M5F A;  1LCF A;  3TQL A;  3QIM A;  1CNQ A;  2Y5L A;  1B40 A;  3OXN A;  2XXX A;  4YKI A;  5K2X A;  3U72 A;  4PF8 A;  4C1U A;  2HAU A;  4KYS A;  1N04 A;  4F3P A;  3C4M A;  3I6V A;  2QRY A;  4G8N A;  3T1B A;  5EQ7 A;  4P56 A;  1AIV A;  3QUJ A;  3FVO A;  4XKR A;  3MAM A;  5EQA A;  3OO6 A;  1IXG A;  4P0I A;  4U22 A;  3CG3 A;  5CMC A;  5AA3 A;  1LB8 A;  1JW1 A;  4OVT A;  5I58 B;  2WYP A;  2L5V A;  2VPO A;  4XKQ A;  3ZKL A;  1ELJ A;  3IFC A;  4QFO A;  2QFL A;  3LSL A;  5JEI A;  1MXY A;  2HFB A;  2R8T A;  1I6B A;  1P99 A;  1CE2 A;  4OMB A;  1DTZ A;  1LAX A;  2ALU A;  3E13 X;  1VFE A;  1AOV A;  3T9U A;  5I5P A;  1I69 A;  3I5O A;  4PDD A;  4N8Y A;  5JTY A;  4XFE A;  1N0T A;  2ONS A;  5IZZ A;  4HS7 A;  3IFA A;  2RIN A;  1EU8 A;  3W9W A;  3NOH A;  5H8H B;  1Y3N A;  3LUZ A;  2O1L A;  5AA2 B;  5BUU A;  5IGA A;  4JBZ A;  1DCU A;  1LFI A;  1H43 A;  3RT8 A;  1S9T A;  1UIU A;  5EYH A;  3O66 A;  1B7H A;  4NAP A;  5DTB A;  1PC3 A;  1R1N A;  4IGT A;  4GWW A;  3SES A;  5KZT A;  3Q28 A;  3O2A A;  1NH8 A;  1N76 A;  4FED A;  4GVO A;  5FTI A;  1IMF A;  4LP2 B;  1NL5 A;  5DVJ A;  4EF2 A;  1IXI A;  1BK4 A;  2PFZ A;  2B3F A;  3BKI B;  1RDZ A;  1QUK A;  3RLF E;  1RDX A;  2XXH A;  4NF4 A;  3HFU A;  1EZO A;  3TTL A;  2I0B A;  3H6V A;  4U4S A;  4OVS A;  1ZJL A;  1BKA A;  1SW1 A;  1N7W A;  1B5H A;  1B7Z A;  2QMW A;  3E78 A;  1RDY A;  4IGR A;  1XT8 A;  4KCC A;  5TU0 A;  3BBR A;  1MQG A;  2I0C A;  4F2O A;  3E79 A;  1PDA A;  4XKN A;  2ONK E;  5IZ1 A;  4P1L A;  3SEU A;  1B5I A;  4ZZA A;  2H98 A;  4X48 A;  1LBW A;  3ILU B;  3A09 A;  3M3K A;  2O7I A;  3OSQ A;  4NF0 A;  1D9Q A;  1EZ9 A;  1R6Z A;  3TPA A;  3H6T A;  3IOW A;  4TLL B;  1FPJ A;  4NGU A;  2UXA A;  1FBC A;  4N17 A;  4H6D A;  3K6X A;  2B4M A;  2F97 A;  4JDF A;  5ITO A;  2KR0 A;  4HW8 A;  3RY3 A;  3IJX B;  4NF8 B;  4Q5T A;  4I62 A;  3B6T A;  4OYV A;  1FTO A;  1USY E;  1B1X A;  4F2Q A;  3WAE A;  1QVS A;  1GV8 A;  1LGB C;  1B4H A;  3FAT A;  2XWV A;  3RT6 B;  1IUD A;  4OQO A;  1BP5 A;  3VDF A;  2V3U A;  3QXM A;  5I2N A;  4PFU A;  3AXF A;  3FVN A;  1MQJ A;  5L9S A;  2E1S A;  3SER A;  1Y4T A;  1GR2 A;  1II5 A;  1B1H A;  3EHU A;  1URG A;  1NV5 A;  4L17 A;  5H8H A;  2CZK A;  3PV0 E;  4GBW A;  2HEU A;  4JB7 A;  4KYE A;  4G4P A;  3L6G A;  1MM6 A;  3W9V A;  4U1Z A;  1LLS A;  5KDT B;  5B70 A;  3B7D A;  1EH3 A;  4KCD A;  5CMM A;  2OWS A;  1B58 A;  4ZS9 A;  2O1M A;  3O29 A;  4OER A;  4MJO A;  3K6W A;  5EHS A;  2DE3 A;  4KQP A;  1M5D A;  4X04 A;  1MRP A;  3PPN A;  4O7M A;  1Y4C A;  4UAC A;  4H1X A;  4PE3 A;  3MYU A;  3PPO A;  4F3B A;  3HHG A;  4PET A;  1LB9 A;  3T66 A;  4GXA A;  3C31 A;  4RY1 A;  2XX8 A;  3V8X B;  1R9L A;  4HXV A;  5H8Q A;  2DE4 A;  1Q9D A;  3QAX A;  2XWO A;  1LBC A;  4GRK A;  2THI A;  2XXU A;  3B6Q A;  5HPQ A;  1JEV A;  3VLW A;  1XOC A;  3TCF A;  1MDQ A;  4G8M A;  4PFW A;  2XXY A;  1Y1Z A;  3KC1 A;  3GBA A;  3FUZ A;  3K6V A;  3H3G A;  2I3V A;  3SET A;  1Y20 A;  4P11 A;  1PBP A;  1NNT A;  1FCK A;  2FHY A;  2F3B A;  3U1O A;  4F1V A;  1SPI A;  3H03 A;  4PBQ A;  2P3V A;  4C0R A;  1S7Y A;  4EF1 A;  4AS4 A;  4TLM B;  4FBP A;  4JWO A;  3PTY A;  2UYE A;  3TUS A;  5F1Q A;  1MXW A;  1IME A;  2P3N A;  5ISU A;  3TMG A;  4DCX A;  3OO8 A;  2PBW A;  2R71 A;  4GQO A;  1JW5 A;  3D4G A;  1GGG A;  1QUJ A;  2OWT A;  3LR1 A;  3TTR A;  1XHY A;  2D5W A;  3H4Z A;  4R6K A;  3QUF A;  1NV4 A;  1LBB A;  3Q26 A;  1NNP A;  5ESY A;  3K1N A;  3FJ7 A;  3PUW E;  3OEM A;  3TTN A;  4ZZE A;  4OZ9 A;  4R2B A;  3K1P A;  4OA4 A;  2WKY A;  1TFD A;  4RXL A;  3MZ9 A;  3UOR A;  4U2R A;  4NF5 B;  1FBF A;  1LBY A;  3HCQ A;  1FQA A;  4O7I A;  1FJ6 A;  1MH3 A;  4PGN A;  3MJN A;  3K4U A;  3E9X A;  3OSR A;  5AA4 B;  2XXR A;  3O97 A;  1L5T A;  2RCB A;  3CFX A;  5A5X B;  3U65 A;  2OK2 A;  4PBH A;  4GXS B;  2HHM A;  2ZZW A;  5H8F B;  2QS2 A;  2FA7 A;  4RK9 A;  5I59 A;  4X1B A;  4OEV A;  4F3G A;  4EUO A;  4IO5 A;  2O7U A;  3VVE A;  2A5T B;  3RTF B;  1QJM A;  1FQF A;  3G3H A;  3LBS A;  4HCW A;  2Q88 A;  3KSJ A;  3ODB A;  3PD9 A;  2Q8J A;  1FTK A;  4BDL A;  1D9Y A;  3Q29 A;  4HE2 A;  3OOA A;  5KCJ B;  1WVJ A;  3KGC A;  2Z22 A;  2E0S A;  2F3D A;  4H8J A;  3MP8 A;  1P1U A;  4IO4 A;  4YB5 A;  2V93 A;  2G93 A;  1JW4 A;  3IO6 A;  3CI8 A;  3KC0 A;  2H25 A;  2X7Q A;  4I1D A;  3QMF A;  2I49 A;  4F31 B;  1B32 A;  4FEC A;  3TOD A;  3UP9 A;  5T3J A;  3FXR A;  2Q8M A;  1IMD A;  2HCA A;  3TEP A;  2KLF A;  1DBZ A;  1A55 A;  5ET8 A;  3OEL A;  1URD A;  1JVX A;  2A5T A;  4AB5 A;  2XXP A;  1D4N A;  3O28 A;  4QFL A;  4RPN A;  5AE4 A;  1FTA A;  1MS7 A;  1MY0 A;  2QVV A;  2UVH A;  2V25 A;  3GXA A;  2UVI A;  3K0V A;  1LCT A;  3CFZ A;  4G68 A;  3GLB A;  1FPE A;  1N7X A;  5DEX A;  2XX7 A;  1EYI A;  4EQ9 A;  1AH5 A;  1RYO A;  3CR9 A;  5J16 A;  2DS9 A;  1NMU A;  3FJM A;  4YB6 A;  2ZMB A;  2HXW A;  2PFY A;  4YKP A;  4OAN A;  5F24 A;  4X8R A;  1FPB A;  4ZDM A;  1DMB A;  1FPL A;  4YKJ A;  3EPE A;  4JVD A;  3SZP A;  2UVJ A;  1QGX A;  3C9H A;  2UVG A;  2PVU A;  1JP4 A;  4ELO A;  1UQW A;  2GQ1 A;  2VT5 A;  4DDD A;  3KN8 A;  3G7W A;  4QXD A;  1FPK A;  1MPB A;  2DXY A;  2ZNT A;  4BDR A;  4MNP A;  3IB0 A;  3GBB A;  4ZE8 A;  4HTG A;  5AA2 D;  3MVY A;  1FQE A;  3PD8 A;  4PFI A;  2I4C A;  4F1U A;  1B5J A;  2Z8F A;  3IK6 B;  1IZ1 A;  3CVG A;  4O94 A;  4H5G A;  4MLQ A;  2Z8E A;  2AL4 A;  3VVD A;  4R2F A;  3FAS A;  1NUX A;  4G61 A;  5F7V A;  1MXX A;  1DK4 A;  4MX6 A;  3S9E A;  5CBR A;  4GWZ A;  1IMA A;  2VOZ A;  4U21 A;  2I3W A;  4PP0 A;  4GOT A;  3T0J A;  4KXP A;  4OEN A;  1IIW A;  3N6T A;  1KA1 A;  4IR8 A;  3K1M A;  2F5X A;  3KFM A;  5EHM A;  5ITP A;  3TCG A;  2OCU A;  3CHG A;  4G68 B;  3PGF A;  3D1R A;  1M5B A;  4OFL A;  3FZV A;  4LZ5 A;  4PF6 A;  1B2H A;  4R73 A;  5H8N B;  4QRZ A;  3K02 A;  2DWA A;  3MVX A;  5I57 B;  2H9B A;  4LQ2 A;  1MY1 A;  5H8Q B;  5I59 B;  3PPR A;  1ZTY A;  4Z7E A;  1YYZ A;  4NN3 A;  1A40 A;  4POX A;  2BJI A;  1GVC A;  2O51 A;  2O68 A;  4YMA A;  2A5S A;  3C36 A;  4EQ7 A;  2Y5K A;  3H7M A;  1NNK A;  3MZ1 A;  3MZB A;  4OTE A;  3FJG A;  2RCA A;  4G2Z A;  4GWS A;  5FBP A;  3CRB A;  4Q0C A;  3OMB A;  4IO2 A;  3VV5 A;  4KR5 A;  4MH5 A;  4IY6 A;  1SVX B;  3E4R A;  4O3C A;  1G0I A;  3S9N C;  2WYK A;  1IMC A;  1MPD A;  5TP9 B;  1SI1 A;  3K2D A;  3D4C A;  2V4C A;  4FAJ A;  2AYS A;  1LST A;  4PAF A;  1SW2 A;  3IOR A;  1JVY A;  3N5L A;  3RPL A;  1LBZ A;  1O64 A;  3S2V A;  3JZJ A;  1UTH A;  3IR1 A;  3TEL A;  1FTM A;  2ANJ A;  3PMV A;  2ZZX A;  4ZEC A;  3ZS6 A;  3O9P A;  4ONY A;  1LAH E;  1FJ9 A;  4YAH X;  4PFR A;  3EN3 A;  1PBQ A;  4H67 A;  1RKM A;  2DP8 A;  1QUL A;  3MQ9 A;  3TDJ A;  1B3F A;  2D21 A;  1LBX A;  1H3D A;  2FIX A;  2XXW A;  4N13 A;  2DDK A;  1Q35 A;  4PFT A;  1NUZ A;  4NMY A;  2IEE A;  5H8S A;  4JVI A;  3A29 A;  2NXO A;  3DM0 A;  3C32 A;  3IOU A;  1IQ7 A;  4O3A A;  4N91 A;  4OEU A;  4GF8 A;  2R9J A;  2NWJ A;  3FV2 A;  4MIJ A;  4HCY A;  4ISU A;  4GD5 A;  1SDX A;  5AA2 A;  5L9O A;  4LQ5 A;  3KOS A;  4N6K A;  4R6Y A;  4M1V A;  2XX9 A;  2I6E A;  3ZKK A;  2F7B A;  4F39 A; 
#chains in the Genus database with same CATH homology
 1MXW A;  2XHD A;  4YIC A;  5I2K B;  2V84 A;  3UK4 A;  4IO7 A;  2V3T A;  3TEP A;  3PUZ E;  4KFQ A;  5ISU A;  5LOM A;  3TMG A;  1GTK A;  3VE1 B;  2ABH A;  4LAT A;  4LZ7 A;  3R7X A;  4R9G A;  3QSL A;  2F34 A;  3N6U A;  2F35 A;  4NWC A;  3T93 B;  2GHA A;  4DCX A;  5CM6 A;  2F7C A;  3VLU A;  3OO8 A;  2PBW A;  2R71 A;  5CMK A;  3TAJ A;  4ELR A;  4GQO A;  1JW5 A;  3D4G A;  3IAZ A;  2XD2 A;  1GGG A;  1QUJ A;  3RN8 A;  2OWT A;  3LR1 A;  3N26 A;  5FTH A;  1BLF A;  1XHY A;  3TTR A;  3RPW A;  2D5W A;  1TFA A;  3H4Z A;  3RT6 B;  4R6K A;  3QUF A;  2QS1 A;  3HST A;  4IO6 A;  1DTG A;  1LBB A;  3Q26 A;  1MPC A;  4IO3 A;  3UN6 A;  2AIX A;  4U23 A;  1NNP A;  4BDM A;  3H06 B;  2HZK A;  1PB8 A;  4C1T A;  3K1N A;  2Q2C A;  3FJ7 A;  4WKM A;  3SDF A;  4OHN A;  3PUW E;  5M2V A;  3K01 A;  3OEM A;  2Y7I A;  3TTN A;  2Y84 A;  2F6G A;  3EHS A;  2F36 A;  4OZ9 A;  4R2B A;  4ZZE A;  4F3S A;  3K1P A;  2XXQ A;  4RA1 A;  1Y9U A;  2WKY A;  1DPP A;  1TFD A;  4QSD A;  4RXL A;  3WAF A;  4BDN A;  1JQF A;  3MZ9 A;  3UOR A;  3L6H A;  4U2R A;  1M5C A;  1B6H A;  1OIB A;  4X1D A;  4NF5 B;  3RQT A;  4NF5 A;  1PB7 A;  1ZBM A;  4RJZ A;  3TTK A;  4QFN A;  3A3U A;  3V89 B;  1QKB A;  1ZU0 A;  2GRV A;  3CSB A;  1B7U A;  1FQA A;  3H6U A;  3HCQ A;  3MC2 A;  3MVW A;  4I9D A;  3IOT A;  2REJ A;  3TKD A;  1POT A;  1FTJ A;  2DSF A;  1MH3 A;  3K6U A;  4JSO A;  4ZEI A;  3MJN A;  3K4U A;  1SW5 A;  3E9X A;  1US4 A;  3OSR A;  4RK2 A;  4XIG Q;  5AA4 B;  1VE4 A;  3TTM A;  4YMB A;  4XTC Q;  2XXR A;  3O97 A;  1L5T A;  1VSO A;  4ESW A;  1F9B A;  1YCJ A;  2QS4 A;  2RCB A;  4F22 A;  4OFO A;  3CFX A;  3VXB A;  5A5X B;  4GFR A;  2YJP A;  2OK2 A;  1NNF A;  3FV1 A;  1NFT A;  1IXC A;  4GXS B;  5TPA A;  3SEV A;  2PYY A;  5H8F B;  4KPT A;  1UTB A;  2QS2 A;  3TFL A;  2UYF A;  4F2Q A;  1OLC A;  2DWJ A;  2FA7 A;  4RK9 A;  2QMX A;  5I59 A;  1B9J A;  1B51 A;  3LSF B;  3O6I A;  4OEV A;  4WXJ A;  4X1B A;  4QSC A;  5L9M A;  2QPQ A;  4AB6 A;  3M8U A;  3MP6 A;  5I57 A;  3M3F A;  1MY4 A;  4F3G A;  2NOO A;  3KJ7 A;  4EUO A;  4IO5 A;  4DXC A;  2O7U A;  3T9X B;  3FXU A;  1A8E A;  1M5F A;  1LCF A;  2PT1 A;  3TQL A;  3VVE A;  2A5T B;  3RTF B;  4F29 A;  5I56 A;  1QJM A;  2H5Y A;  1FQF A;  3G3H A;  3MW0 A;  3LBS A;  3W15 C;  3QIM A;  5ITP A;  1B3E A;  1KWH A;  4HCW A;  5CMB A;  2QJE A;  3SEY A;  4PQJ A;  2Q88 A;  1B40 A;  3MP1 A;  3OXN A;  3DP8 A;  3KSJ A;  4ZS9 A;  2XXV A;  2XXX A;  3KJT A;  3ODB A;  4MF3 A;  3PD9 A;  4YKI A;  4R72 A;  5K2X A;  1FTK A;  2YLN A;  2Q8J A;  3U72 A;  4BDL A;  2HAU A;  4C1U A;  1D9Y A;  3Q29 A;  4EQB A;  3OOA A;  4KYS A;  1N04 A;  1Y3P A;  3B6W A;  4RYA A;  4F3P A;  5KCJ B;  1WVJ A;  2DYX A;  3KGC A;  3C4M A;  3I6V A;  2Z22 A;  3HV1 A;  2QRY A;  2E0S A;  1SD3 A;  2OJT A;  4G8N A;  4UA8 A;  4DIG A;  5JK4 A;  2RKM A;  4H8J A;  3MP8 A;  1P1U A;  4IO4 A;  4RPO A;  2V93 A;  4YB5 A;  1Z7N E;  1AIV A;  2G93 A;  1JW4 A;  3G3F A;  4QFP A;  2RF1 A;  4R74 A;  3DLN A;  4FIM A;  3QUJ A;  1MXZ A;  3A3C A;  3IO6 A;  3CI8 A;  3FVO A;  3SEW A;  3TZA A;  3FVG A;  4XKR A;  3MAM A;  3U93 A;  5FHN A;  4EDP A;  2H25 A;  2X7Q A;  3OO6 A;  1IXG A;  3FXQ A;  4I1D A;  4TQU Q;  1Z7M E;  4IB2 A;  3OEN A;  4P0I A;  4U22 A;  3CG3 A;  5CMC A;  5DEX B;  1OQG A;  1LB8 A;  1XVX A;  1JW1 A;  2OZZ A;  5DT6 A;  5AA3 A;  5I58 B;  5I84 A;  4Q8R A;  5KDT A;  2PT2 A;  5I2N B;  2I49 A;  4F31 B;  4THI A;  5I2K A;  1HSL A;  1B32 A;  4FEC A;  3TYH A;  3EF7 A;  3TOD A;  3MVZ A;  3RTW B;  3UP9 A;  5DYH A;  3R6U A;  4U1O A;  3FXR A;  4XKQ A;  1FQB A;  3DP4 A;  3MPK A;  1ELJ A;  3ZKL A;  4ZE9 A;  2HCA A;  4QFO A;  3LSL A;  1BTJ A;  3G3I A;  1MXY A;  1YPN A;  4NF6 B;  2HFB A;  5JEI A;  1FQD A;  2KLF A;  3FGS A;  3G3K A;  1A55 A;  1I6B A;  4OWD A;  4ESX A;  1P99 A;  2AL5 A;  1CE2 A;  3OEL A;  1B3L A;  1DTZ A;  1URD A;  1JVX A;  2ALU A;  1LAX A;  2OLB A;  3E13 X;  4I8C A;  4M4G A;  2A5T A;  4MFI A;  4NF8 A;  1B46 A;  4NF4 B;  4WEP A;  4AB5 A;  1VFE A;  3E3K A;  4KYD A;  1PEB A;  2XXP A;  2DWH A;  5DVF A;  3T9U A;  3VFJ A;  1AOV A;  1MQD A;  1D4N A;  4NE4 A;  1I69 A;  1QUI A;  3CIJ A;  3O28 A;  5J1D A;  4QFL A;  1MQH A;  3I5O A;  4RPN A;  5AE4 A;  5JTY A;  1MS7 A;  1MY0 A;  2F6P A;  2UVH A;  4NWD A;  1N0T A;  2ONS A;  2V25 A;  1MY2 A;  5IAI A;  2XXI A;  4KI0 E;  3GXA A;  2UVI A;  1UTB B;  4MBP A;  4O3B A;  3K0V A;  3MUQ A;  1LCT A;  3CFZ A;  4HS7 A;  1EZP A;  3Q27 A;  4G68 A;  4XKP A;  3GLB A;  2RIN A;  1N7X A;  4QHQ A;  5DEX A;  3OO7 A;  4NED A;  2XX7 A;  4JSD A;  3EQ1 A;  1EU8 A;  4ZEB A;  3UA8 A;  1AH5 A;  5TP9 A;  4DLD A;  4EQ9 A;  1RYO A;  4YB7 A;  3W9W A;  1MXV A;  1H76 A;  2H99 A;  1Y3N A;  3CR9 A;  5H8H B;  2O1L A;  1IIT A;  3G3J A;  5AA2 B;  5AA4 A;  1D3K A;  3T96 B;  5BUU A;  4BDO A;  1SQY A;  4BDQ A;  3I3V A;  4JBZ A;  4XXU A;  2DS9 A;  2RC7 A;  3PU5 A;  3QYT A;  1NMU A;  1LFI A;  1H43 A;  2B3B A;  3C35 A;  3FJM A;  4AQ4 A;  3RT8 A;  1S9T A;  2DOJ A;  1T0K A;  2HAV A;  1UIU A;  3O66 A;  4DXU A;  1ZLQ A;  2ZYO A;  5K2Y A;  1US5 A;  4YB6 A;  1B7H A;  3THI A;  2ONR A;  3ILT B;  2ZMB A;  1UTH B;  2HXW A;  4YKP A;  2I48 A;  4OVJ A;  5EYF A;  5DTB A;  1PC3 A;  2DXR A;  3KBR A;  1R1N A;  1O63 A;  2X7P A;  4IGT A;  4ZDM A;  1DMB A;  1H44 A;  4POW A;  5L8D A;  3SES A;  2ZNS A;  4YKJ A;  3EPE A;  3VLV A;  5CBS A;  1YTV A;  4DE8 A;  5KZT A;  2RC8 A;  1QW0 A;  2UVJ A;  2BJJ X;  3Q28 A;  2P2A A;  2HZL A;  3C9H A;  3O2A A;  4N6P A;  3TUS A;  2UVG A;  1NH8 A;  1N76 A;  1USY H;  4FED A;  2QL3 A;  4GVO A;  5FTI A;  1FTL A;  1Y3Q A;  2PVU A;  3T22 A;  4LP2 B;  3O6G A;  4G68 C;  2DE2 A;  1NL5 A;  5AA1 A;  5DVJ A;  1B05 A;  1OQH A;  4FEB A;  4EF2 A;  1Q1K A;  1LAG E;  2UYE A;  4ELO A;  1UQW A;  3IO4 A;  1IXI A;  1TT1 A;  4DDD A;  3KN8 A;  3G7W A;  1DOT A;  1JNF A;  2FNC A;  1SBP A;  2Q9T A;  2B3F A;  3BKI B;  3U94 A;  1MPB A;  3V83 A;  2ZYN A;  2DXY A;  2CMO A;  2VGQ A;  2ZNT A;  4BDR A;  1SW4 A;  3IB0 A;  1QUK A;  3GBB A;  5H8N A;  3USD A;  4ZE8 A;  2GFE A;  3LC8 A;  2I4B A;  4HTG A;  3RLF E;  1IXH A;  2XXH A;  5AA2 D;  5FHM A;  4EXL A;  4NF4 A;  3KN7 A;  1OMP A;  3MVY A;  1FQE A;  3PD8 A;  1EZO A;  2I58 A;  3TTL A;  2I0B A;  3BFT A;  2I4C A;  3H6V A;  3OD7 A;  4JWX A;  2Y7P A;  5DVI A;  4F1U A;  4U4S A;  3UIF A;  1B5J A;  2Z8F A;  1ZJL A;  1LFG A;  1BKA A;  1AMF A;  3IK6 B;  2ZNU A;  2B65 A;  1SW1 A;  2P1S A;  3IJO B;  4U4X A;  2NVU B;  1NKX A;  1MY3 A;  3PUX E;  4GL8 A;  1N3X A;  1N7W A;  1B5H A;  1IZ1 A;  3CVG A;  3EHT A;  1B7Z A;  4H5G A;  2QMW A;  1ZKB A;  4MLQ A;  2QSX A;  2Z8E A;  1DPE A;  2AL4 A;  4IGR A;  3VVD A;  4R2F A;  1NH7 A;  3FAS A;  5F7V A;  1XT8 A;  2VD2 A;  4KCC A;  5TU0 A;  3U92 A;  4X9T A;  5CRY A;  3VXC A;  1MXX A;  1D9V A;  1R9Q A;  3BBR A;  1MQG A;  3DP6 A;  1Y1M A;  2HQ0 A;  3KN3 A;  3S9E A;  1YAE A;  5CBR A;  3ZSF A;  2I0C A;  2P0S A;  4E0X A;  1P1N A;  4F2O A;  2O6A A;  1ANF A;  1BIY A;  2VOZ A;  3IOV A;  4U21 A;  1PDA A;  4XKN A;  2I3W A;  2Q89 A;  1P1W A;  3OEK A;  4LZ8 A;  2F8D A;  3C33 A;  2ONK E;  4GOT A;  4GWO A;  4PP0 A;  2Y7R A;  5HBC A;  4OEN A;  4TOZ A;  3SEU A;  1IIW A;  1OLA A;  1B5I A;  3ONM A;  4ZZA A;  3LSW A;  3N6T A;  2H98 A;  3IL1 B;  4X48 A;  1TWY A;  3CG1 A;  2XXT A;  3ILU B;  3A09 A;  3M3K A;  3T9H B;  2O7I A;  2VD3 A;  4ELQ A;  4FAJ A;  3K1M A;  3IB1 A;  2F5X A;  3OSQ A;  3KFM A;  5FHO A;  1EZ9 A;  1R6Z A;  5EHM A;  4N07 A;  2XD3 A;  3TCG A;  1S50 A;  4H5F A;  2OCU A;  3H6T A;  1MH4 A;  3IOW A;  4G68 B;  4TLL B;  3PGF A;  2UXA A;  1M5B A;  4OFL A;  3FZV A;  1HSE A;  4LZ5 A;  1B2H A;  3KZG A;  3RNN A;  1O7T A;  3S4U A;  4GL0 A;  4R73 A;  5H8N B;  4H6D A;  3K6X A;  4QRZ A;  3KSX A;  3K02 A;  2DWA A;  2F97 A;  3LUY A;  3MVX A;  3PMW A;  4JDF A;  2H9B A;  4OET A;  4QSE A;  5I57 B;  1A8F A;  1SYH A;  4LQ2 A;  5ITO A;  1MY1 A;  2D3I A;  2H4I A;  5H8Q B;  4DCY A;  4HW8 A;  5I59 B;  3RY3 A;  4LON B;  1URS A;  3PPR A;  1ZTY A;  3IJX B;  4NF8 B;  4Q30 B;  3TCH A;  4Z7E A;  4Q5T A;  3B6T A;  4I62 A;  1FTO A;  1USY E;  2GHB A;  1B1X A;  3KEI A;  4OYV A;  1A40 A;  1SYI A;  3P7I A;  4POX A;  5TPA B;  1QVS A;  4IY5 A;  3WAE A;  2Z8D A;  2O51 A;  1GVC A;  1GV8 A;  1LGB C;  4OXV A;  3TPA A;  2O68 A;  1B4H A;  4R6H A;  3FAT A;  4YMA A;  2A5S A;  1VFD A;  4NTL A;  4E0W A;  2Y7W A;  1XS5 A;  3C36 A;  4EQ7 A;  1TXF A;  1ATG A;  2DVC A;  1IUD A;  3Q25 A;  1MXU A;  3H7M A;  1BP5 A;  1MDP 1;  3CFL A;  4FOR A;  4H0W A;  4OQO A;  2V3U A;  4R9F A;  1NNK A;  3VDF A;  4F1Y A;  3QXM A;  4LA9 A;  1B4Z A;  3MZ1 A;  3MZB A;  3AXF A;  4OTE A;  3M3L A;  4PFU A;  4WED A;  5I2N A;  3FVN A;  3FJG A;  2RC9 A;  1MQJ A;  2RCA A;  3JV9 A;  4G2Z A;  5L9S A;  3V5A A;  2DVZ A;  2E1S A;  2GH9 A;  5JTY B;  3CRB A;  4Q0C A;  3FIR A;  3OMB A;  2G29 A;  4IO2 A;  5ICQ A;  1MQI A;  2W7Y A;  3VV5 A;  3U8Q A;  2V3Q A;  4KR5 A;  3RGY A;  4KD5 A;  1JEU A;  4H65 A;  1B3G A;  2VP1 A;  1WDN A;  3HN0 A;  3SER A;  3TQW A;  4ELP A;  1H45 A;  1GR2 A;  1Y4T A;  1II5 A;  4MH5 A;  4IY6 A;  1B1H A;  3EHU A;  1SVX B;  1URG A;  2F78 A;  4L17 A;  4FAT A;  3E4R A;  4O3C A;  1P1O A;  4R75 A;  3SKP A;  5H8H A;  2F7A A;  3S9N C;  4QFK A;  3O6H A;  4LVQ A;  1MPD A;  5TP9 B;  3PV0 E;  2HEU A;  4JB7 A;  1SI1 A;  4KYE A;  4G4P A;  2ZYM A;  1FQC A;  3HO7 A;  1MM6 A;  3K2D A;  1RYX A;  3L6G A;  4FE8 A;  4OMB A;  3D4C A;  3W9V A;  1LLS A;  2OBG A;  1UIV A;  2AYS A;  1LST A;  1WOD A;  4JWY A;  1MG1 A;  4U1Z A;  5B70 A;  1ZIU A;  3PPQ A;  5KDT B;  2QS3 A;  3B7D A;  3OO9 A;  1B3H A;  1SW2 A;  3UGW A;  3VVF A;  2ZYK A;  1XC1 A;  3IOR A;  5BWJ A;  4OES A;  1EH3 A;  1JVY A;  3N5L A;  1OVT A;  5I56 B;  4ECF A;  4KCD A;  1B0H A;  3C34 A;  1O64 A;  3S2V A;  3JZJ A;  5CMM A;  4F19 A;  1UTH A;  2OWS A;  1B58 A;  3K00 A;  2FYI A;  1I6Q A;  1ZMG A;  2O1M A;  2O69 A;  3O29 A;  3IR1 A;  3PUV E;  4OER A;  5ELV A;  4ND9 A;  3FD3 A;  4Z0I A;  3TEL A;  1FTM A;  1CB6 A;  3F11 A;  4YKK A;  1LFH A;  3G3G A;  2PMS A;  3K6W A;  2ANJ A;  3MBP A;  5EHS A;  3PMV A;  2DE3 A;  3HHF A;  1M5D A;  1MRP A;  1VR5 A;  2CZL A;  3PPN A;  1Y4C A;  2IA4 A;  4KQP A;  4UAC A;  4H1X A;  4ZEC A;  5H8F A;  3S9L C;  1IEJ A;  3PMX A;  3ZS6 A;  4G8H A;  3PPO A;  4PFY A;  4F3B A;  3HHG A;  3O9P A;  3QK6 A;  4P0G A;  1P1Q A;  4PET A;  1LB9 A;  4PE5 B;  2Z23 A;  4YZZ A;  2ZXT A;  1DSN A;  4K3F A;  1B52 A;  1XVY A;  3MPL A;  4YU0 A;  3S9M C;  3T66 A;  5B7D A;  4GXA A;  1SI0 A;  4ONY A;  4EXK A;  3C31 A;  1J1N A;  1LAH E;  4RY1 A;  2XX8 A;  3V8X B;  1R9L A;  3N94 A;  4YAH X;  5H8Q A;  2DE4 A;  1OVB A;  3QAX A;  3KOT A;  1LBC A;  4GRK A;  2THI A;  2XXU A;  3B6Q A;  2M8C A;  2Q2A A;  2NUV A;  3EN3 A;  3GZG A;  1PBQ A;  1I6A A;  2Y7K A;  3HPI A;  4H67 A;  1RKM A;  2DP8 A;  4ZEF A;  4ZEK A;  1JEV A;  1QUL A;  5HPQ A;  4JXI A;  2DQV A;  3MQ9 A;  5CC2 A;  3VLW A;  1XOC A;  5ICT A;  3TCF A;  1JET A;  1MDQ A;  3IB2 A;  3TDJ A;  4G8M A;  4PFW A;  1B3F A;  2D21 A;  2XXY A;  1Y1Z A;  3CSG A;  3FUZ A;  3GBA A;  3K6V A;  4GLI A;  4KHZ E;  2R6G E;  4RNS A;  4F18 A;  4DXB A;  4ZED A;  1H3D A;  2XXW A;  4N13 A;  5A5X A;  2LAO A;  2O84 X;  5KCJ A;  3JYR A;  4H8I A;  3H3G A;  1Q35 A;  3ECR A;  4LUB A;  2I3V A;  4PFT A;  4BLA A;  3SET A;  1Y20 A;  2PX1 A;  2DWI A;  3R26 A;  3BFU A;  4FJP A;  1PBP A;  1POY 1;  4P11 A;  4MLV A;  5IKB A;  4NMY A;  1NNT A;  5I58 A;  1M5E A;  2IEE A;  5H8S A;  4GIZ A;  3SEX A;  1FCK A;  1HSJ A;  2NXO A;  2YPN A;  3IX1 A;  3PPP A;  3DM0 A;  3FVK A;  3U1O A;  2VHA A;  3C32 A;  3IOU A;  3LSX A;  1IQ7 A;  2X26 A;  4F1V A;  3DEL B;  4O3A A;  1PB9 A;  1FW0 A;  4OEU A;  3H03 A;  4GF8 A;  2R9J A;  1LAF E;  4C0R A;  4G77 A;  2ESN A;  4OFJ A;  1A99 A;  1S7Y A;  1B0L A;  3MWB A;  3KG2 A;  5CI5 A;  2NWJ A;  5HM4 B;  1A54 A;  3FV2 A;  1AL3 A;  4EF1 A;  2REG A;  3T9V A;  3PUY E;  1N84 A;  4HCY A;  4ISU A;  4GD5 A;  1SDX A;  1MM7 A;  5AA2 A;  4NF6 A;  4LQ5 A;  3KOS A;  5L9O A;  4TLM B;  4R6Y A;  3H6W A;  4M1V A;  2XX9 A;  4DZ1 A;  4JWO A;  2I6E A;  4QF9 A;  1N3W A;  3ZKK A;  1QKA A;  2F7B A;  4F39 A;  1A7L A;  3RUM A;  5F1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...