4O94A

Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_3329), target efi-510223, with bound succinate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
309
structure length
309
Chain Sequence
QPIVVKFSHVVADNTPKGQAAIKFKELAEKYTNGKVKVEVYPNSQLFGDAKEMEAVALGDVQFIAPSLSKFDKFTKQIQVFDLPFLFNDIAAVDRFQAGKQGQALLRSMESKNFLGLAYWHNGMKQISANRPLLKPEDAKGLKFRIQASDILAAQFQGLNATPQKLAFSEVYQALQVGTVDGQENTWSNIFSQKFYEVQKDITESDHGVIDYMVVVNAKWWNGLSKDLQDAMKKAMDEATKVNNDVAGKLNDEAKQKIASSGASKIHQLTPEQRKQWVEAMKPVWAKFESAIGKDLIDAAVASNDTKTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transport protein
total genus 103
structure length 309
sequence length 309
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o94A00
2XWVA 4XFEA 4MHFA 4P56A 5IGAA 4MNCA 4N15A 4NGUA 4O94A 4PGPA 2ZZXA 2XWOA 4PF6A 4MNIA 4DI3D 4PAKA 4PF8A 2CEXA 4OVRA 4PAIA 4PCDA 4NN3A 4MEVA 3GYYA 2XA5A 2XXKA 4XF5A 4PETA 4PDDA 4N91A 4X8RA 2WYPA 4X04A 4MAGA 4DI4B 2HPGA 2XWKA 4O7MA 2HZLA 4N4UA 4XEQA 2WYKA 4P3LA 4N6KA 4OVPA 4NQ8A 4YICA 2PFYA 5IZZA 4N6DA 2V4CA 4NF0A 4P8BA 4NG7A 4PAFA 2VPNA 4PFRA 2VPOA 4N17A 4LN5A 4P1EA 4MCOA 4UABA 2XWIA 3B50A 4P47A 4P9KA 4MIJA 4NX1A 5CM6A 2CEYA 4N8YA 4O8MA 4PDHA 4OANA 4PBQA 4PFIA 5IM2A 4N8GA 2WX9A 3U65A 4PBHA 2ZZWA 5LTCA 4PFBA 2ZZVA 2HZKA 3FXBA 5I7IA 4OVQA 4PC9A 4MNPA 4NAPA 4OVSA 4NHBA 4MMPA 5I5PA 4OVTA 4OA4A 4P1LA 4PE3A 4YZZA 2PFZA 4PGNA 4MX6A
chains in the Genus database with same CATH superfamily
3PUYE 5A5XB 1UQWA 4ZZAA 5IGAA 5ICQA 2VD2A 3N26A 5L9MA 2D3IA 5I3SA 5L9SA 5BWJA 4PGPA 3JV9A 4RY1A 3HV1A 5I56B 1M5CA 4N6PA 1FBFA 4F39A 1TT1A 3SEUA 4PAIA 3C9HA 1FTOA 5T3JA 5I57A 3ILTB 3KJ7A 1B1HA 5KDTA 3ODBA 1POTA 1D4NA 1S9TA 2HAVA 3ILUB 1A7LA 5I59A 2XXUA 4BDLA 2NXOA 3USDA 4FORA 1SBPA 1I6BA 4HE1A 3Q29A 4I3YA 3T9XB 4TOZA 4POWA 3IOVA 5I58A 4P11A 2H5YA 1MY2A 4R75A 3TTLA 3U72A 1KA0A 2YLNA 1NI9A 3DP8A 5I2KA 3RY3A 4ZEKA 2XD3A 1TFAA 3OD7A 3PUXE 4PBHA 2PBWA 1HSEA 5A5XA 3IORA 3FXBA 4NTLA 2PT1A 2GH9A 1LB9A 4QXDA 1NL5A 5I56A 4YKIA 2XXPA 3PU5A 2PT2A 2F34A 2QS2A 3O2AA 2ZNSA 1SYIA 1JW4A 3S9EA 1XOCA 3L6GA 2QRYA 4RPOA 3K0VA 4NN3A 1RYOA 3KN8A 1Y3NA 3O29A 1IIWA 1ATGA 4PETA 1SPIA 3D4GA 1NMUA 1SW5A 5TPAB 5B7DA 4X8RA 1PC3A 4JWOA 1LBXA 4EQ7A 3IX1A 5HPQA 5EQ7A 3QIMA 3SETA 4OZ9A 3UGWA 1Y1MA 4H8JA 1A54A 2ZNUA 3ECRA 2Q8JA 4N6KA 1EU8A 2PFYA 2W7YA 5IZZA 2QPQA 1MQDA 3FZVA 2Q8MA 5JEIA 3FVGA 2QMXA 2H9BA 4NG7A 3PUVE 1MRPA 3MBPA 1JEVA 2M8CA 3IO6A 1B51A 1MPDA 1EZPA 3B7DA 4QSEA 2F7CA 1US4A 3QK6A 2XXHA 1H44A 1LSTA 1LBBA 1MH3A 4ELQA 4N8YA 2GHAA 4WXJA 1SDXA 2F97A 1JVXA 3GLBA 3BFUA 4OESA 1R6ZA 1G0HA 3TZAA 1NUWA 2P3VA 4IGTA 4OVQA 1ELJA 3MP6A 5CBSA 4RA1A 4P1LA 4OWDA 4PE3A 2NUVA 1SYHA 3CRBA 2DS9A 2XWVA 2O6AA 2PMSA 3FUZA 1IQ7A 1JVYA 3F11A 2RC8A 1FTJA 3E3KA 1USYE 5TPAA 4F2QA 4RK9A 2X7QA 3LSLA 3EKIA 4OVRA 3E78A 4QBAA 1PB9A 1LBZA 1HSJA 1F9BA 4E0WA 4ELOA 1B7HA 5LOMA 1N0TA 3H03A 1LB8A 4OYVA 2BJJX 3BIHA 2FHYA 2F78A 1OLCA 1FSAA 3TKDA 1FPDA 3IOTA 3OO6A 1MXUA 2XXQA 4QFNA 4ZEIA 4JB7A 1VFEA 4IO4A 1LFGA 5K2XA 3FBPA 4NF8A 3VXBA 5ITOA 1EYIA 3FJ7A 4P1EA 4MCOA 4O3BA 1M5FA 3KOSA 1FPFA 3QAXA 1QGXA 3MZ9A 4LUBA 4RNSA 4XKNA 3SERA 1AL3A 1IUDA 2DDKA 2DE4A 4DCYA 4F3SA 1DBZA 4N8GA 1FPIA 3PMWA 4R6YA 5DVFA 2F8DA 1SI1A 2HZKA 1D3KA 3H6WA 4BDRA 4GBWA 3H6UA 1JP4A 3KBRA 3EHSA 1URDA 5JK4A 2H98A 1TWYA 5FBPA 3KC1A 4QFOA 2H99A 4QSDA 3OSRA 4H5FA 1FPLA 1SW4A 3QSLA 4U22A 4JBZA 2OWSA 3K6UA 3O97A 5FHMA 4KQPA 5ITPA 3RPWA 3CIJA 4R6KA 2DYXA 3CFZA 3IO4A 4GD5A 2A5TB 4JSOA 3PUWE 5CMCA 3PPOA 3TTRA 3T66A 2DE3A 3QUFA 5L8DA 4RPNA 2ZYMA 3GZGA 4Z7EA 4XKPA 1JW1A 1YCJA 1RDYA 4FE8A 1LFIA 5IKBA 3DLNA 1RKMA 3AXFA 1B46A 3U93A 3PD8A 1LAFE 3KOTA 4X1BA 3PPQA 1FJ6A 1P1WA 2O1LA 2DWAA 2QSXA 4F3BA 1ZTYA 3OSQA 1N04A 4YU0A 3E13X 3S2VA 3A09A 1FPBA 4O3AA 2XWIA 3U94A 2Q2AA 1ZLQA 4F31B 1M5DA 4UA8A 4YB7A 3PD9A 2FIEA 4RXLA 2R8TA 4F1YA 1J1NA 4I1DA 1CB6A 4LQ5A 3UN6A 4LA9A 2Z22A 2REGA 2WEFA 5I5PA 4NF5A 3KFMA 1N76A 1YZ0A 1B5JA 3N6TA 3IJOB 4LZ5A 3V83A 2PCRA 4IO6A 2O68A 4N15A 1T0KA 3ONMA 2ZMBA 4NF4B 5LDZA 2ONSA 4OTEA 2D21A 5AA1A 1A40A 1S7YA 1Q9DA 1P1UA 4WEDA 4F1VA 1POY1 5CMMA 2XXKA 3G3JA 1GTKA 3DELB 2I6EA 4QF9A 4NEDA 2Z8DA 3R26A 4FJPA 3V5AA 1OQGA 4MAGA 2HPGA 1P1QA 2VOZA 3GBBA 3IB2A 3FATA 1MM7A 2WBBA 2QJEA 1TXFA 3O9PA 2GRVA 1NUZA 2F3DA 1NNTA 3VXCA 2F36A 4XIGQ 3Q27A 2BJIA 3O6IA 2XXRA 1IZ1A 1YAEA 2QFLA 1DTGA 4QFLA 1NUXA 5AE4A 4PDHA 1FPGA 1URGA 2GQ1A 3ISPA 1AH5A 5IM2A 2ABHA 3N6UA 2KQZA 1B32A 2WX9A 2A5SA 3IFAA 3TFLA 1H3DA 3PMXA 3PTYA 1G0IA 3OEMA 3MVZA 3CHGA 2G29A 4NF4A 1MY1A 1FBEA 1IMEA 5EQ9A 1B3LA 5H8FA 2I58A 1BKAA 4P56A 1IXGA 1LLSA 4F2OA 5JTYA 4POXA 3RUMA 2UVHA 3U92A 4U1OA 3UORA 4DI3D 5ESYA 4GXAA 4HS7A 2DSFA 2O1MA 4Z0IA 3Q28A 3TQWA 2DXRA 3FV1A 1KWHA 1N7XA 4ZEFA 5EHMA 2CZKA 3K1PA 3MPLA 2Q88A 3CG1A 1ZKBA 4HXVA 1Q35A 3FXRA 2GFEA 5HM4B 1IXIA 3EN3A 5ISUA 4F3PA 4LP2B 2I3WA 1NV4A 3LSXA 1EH3A 4NQ8A 4YICA 4N6DA 3RPLA 2P0SA 4M1VA 4P8BA 3RNNA 1FTAA 3FASA 3MC2A 3V89B 1OLAA 2QS4A 3FJMA 2RINA 3LR1A 5CM6A 1MS7A 3HHGA 1SI0A 1JETA 3TCFA 2B3BA 1MY0A 4IO5A 2ANJA 3OO9A 1B05A 5BUUA 2DWHA 2L5VA 1NV6A 3H6VA 4K3FA 4JDFA 1Q1KA 2ONRA 3LUZA 3PPNA 5HBCA 4RK2A 3EHUA 5KZTA 4OEVA 1A8EA 4BDQA 2OK2A 3PPPA 2HEUA 2I4CA 5KCJA 3CSBA 3QYTA 4H6DA 5EQAA 4FEBA 2FYIA 1MXVA 1RDXA 1FQBA 4ZZEA 4BLAA 2ZYOA 1B40A 3OOAA 5DVJA 1YXIA 4ESXA 1MDP1 1QUKA 1Y3QA 1GGGA 1NV5A 4H67A 1EZ9A 1FQAA 3HCQA 4MLVA 5IAIA 1FBDA 2XA5A 1AIVA 3TODA 3D1RA 3KEIA 1INPA 3TTKA 3LSWA 4IR8A 4EXKA 2I3VA 2XX9A 4N4UA 4U21A 3A3UA 3TUSA 1MH4A 4GVOA 3VLUA 2THIA 4EF1A 4I40A 4BDMA 3VVDA 2Z23A 4GL8A 4PAFA 3K1MA 4G4PA 2VP1A 4HCYA 4Q30B 2HQ0A 4P47A 4P9KA 4MIJA 2DE2A 3B6WA 2PYYA 1A8FA 2QS1A 3RYDA 2FBPA 1UTHB 4OANA 1DOTA 5CI5A 1NUYA 3FVNA 1AMFA 2B3FA 3HSTA 1B1XA 4GRKA 1LAGE 1FQCA 5CC2A 4TLMB 3K6WA 1FW0A 1PB7A 1XVXA 1Y4TA 5LTCA 2VHAA 4NAPA 4OVSA 4MH5A 1PEBA 4O7IA 4OA4A 1QUIA 4GWOA 4YZZA 1B52A 1BTJA 4X9TA 3CG3A 5CBRA 4RYAA 1UIVA 4MHFA 1OVTA 1ZJLA 4G8MA 1QKAA 4MNCA 1B6HA 4DZ1A 1OVBA 4YAHX 1B3HA 3MYUA 4O94A 4XXUA 4PFWA 3RGYA 2IA4A 3KSXA 3IJXB 1FPJA 4NMYA 1QVSA 1OIBA 3TMGA 2RKMA 1R9QA 3S9LC 3MZBA 2QVRA 2Y7PA 3FIRA 4KYEA 5CMKA 3T96B 1XT8A 4MFIA 3PGFA 4AS5A 1R1NA 4R6HA 1LBVA 2Q9TA 4QSCA 3RQTA 4GWUA 1NH7A 1LAHE 3MAMA 4I9DA 2H25A 2WYKA 2F7BA 2ZYNA 3ZSFA 2REJA 4YMBA 5EYHA 4NF0A 1M5EA 1UTHA 1I6AA 4GWSA 5EYFA 4EQ9A 5EHSA 2G93A 3O28A 3B6QA 4N17A 4UABA 3KN7A 3D4CA 4H46A 2QS3A 2V93A 3P7IA 2F3BA 4H45A 1NKXA 4OENA 3ROJA 4YKPA 3O6GA 1DSNA 1MG1A 2UYFA 2D5WA 2DOJA 1Y4CA 3U65A 3KG2A 1Z7NE 2ZZVA 1URSA 4MF3A 2Q89A 2X26A 1B7ZA 2Y7KA 1MQIA 1P99A 1IXHA 4OETA 4KXPA 1VE4A 1VR5A 3BBRA 2RCBA 3G3FA 5ET8A 2ZZXA 4PF6A 1BK4A 5H8NB 3MWBA 4LQ2A 4GQOA 1B3EA 3MVXA 3LSFB 4KD5A 4QHQA 3SZPA 5H8QB 1LGBC 5FTIA 5DT6A 1B5HA 4X04A 3W9VA 5ET5A 1LCTA 4KCCA 1M5BA 4JWYA 4OVPA 3BKIB 4ELRA 3I3VA 4R73A 3NOHA 4P0IA 3LV0A 3SEVA 1NFTA 5ET6A 3RTFB 4NWDA 3WAFA 4NE4A 4FAJA 4GOTA 3B50A 5AA2B 5A5LA 3M8UA 4YB5A 2KR0A 3TEPA 2YPNA 5CRYA 3OMBA 2FVZA 4M4GA 1Z7ME 3FGSA 1SW2A 4R72A 3S9MC 2F6GA 4OXVA 1JW5A 4ZS9A 2E1SA 2ZYKA 1B9JA 4OFJA 1EZOA 2Y84A 4GF8A 5H8NA 2R9JA 3MP8A 3SDFA 1JNFA 4PGNA 4GIZA 1H43A 1DMBA 1GR2A 2QVUA 4FEDA 5H8QA 2ONKE 3JYRA 4G68B 1FQDA 4MNIA 3T0JA 4DXUA 4PF8A 4PE5B 4IB2A 4KPTA 1A99A 2A5TA 4PCDA 1LBYA 2UVJA 3KJTA 1NV1A 2XX7A 4QRZA 4R9FA 4IO2A 4DI4B 3R6UA 4X48A 1IMFA 4U4XA 3T9UA 1WVJA 1HSLA 1FRPA 4QFPA 1R9LA 3V8XB 4XKRA 5AA2A 3S4UA 3KC0A 1IEJA 2RC9A 5DYHA 4MBPA 4I62A 2XXTA 4NX1A 2WBDA 1MY4A 4ZE9A 4ZEDA 3U8QA 4I8CA 3IB0A 4UACA 2KLFA 4G2ZA 4NF6B 4U4SA 1D9VA 4PFBA 1Y1ZA 3I5OA 4PC9A 4MNPA 4F22A 3O6HA 5L9OA 3H3GA 3OXNA 1UTBB 1US5A 4OVJA 2UVIA 4G68A 3DP4A 4JVCA 2VD3A 4YMAA 4X1DA 3HPIA 2DWIA 4LZ7A 4ESWA 3H06B 3JZJA 3K2DA 3W9WA 1AWBA 1QJMA 2XWOA 4AB5A 1AOVA 4R74A 1I69A 3IAZA 3UP9A 2QMWA 3HO7A 3QUJA 5KDTB 1A55A 4L17A 2AL4A 3M3FA 4H0WA 3KSJA 1NV0A 4N91A 3ZKKA 3VE1B 2Y5LA 5F1QA 3KBZA 2HXRA 1IMBA 1SQYA 1LFHA 3TCHA 3W15C 4XEQA 1H45A 2O7IA 4G8NA 3A29A 5I58B 1YTVA 4R9GA 4OHNA 1BLFA 2OZZA 4OERA 5I2KB 4F29A 1FBHA 4G77A 3C36A 3A3CA 2CEYA 4TLLB 1NV3A 3T1BA 3K02A 2PX1A 2F6PA 2ZNTA 1H76A 1VDWA 3TQLA 4KYSA 3EHTA 3OO8A 2XXWA 1ANFA 1N7WA 3IL1B 3IOUA 3DM0A 4OFOA 4LONB 1SW1A 2UYEA 3FJGA 4DLDA 4C1UA 4HCWA 2PFZA 4JWXA 4N13A 2Z8FA 1ZMGA 1N3XA 3IR1A 3FVOA 4XFEA 3U1OA 2AIXA 3OEKA 3M3LA 3MPKA 1OMPA 5IZ3B 5ICTA 4GX3A 1B5IA 4ND9A 2XX8A 1MXYA 1D9YA 4PFTA 3HHFA 3C35A 3E4RA 4GWZA 3TDJA 4XF5A 3BFTA 1FPEA 1NH8A 3PV0E 4FATA 1IMDA 1DK4A 5H8HB 3R7XA 1B2HA 1FPKA 2XD2A 2XXIA 4EQBA 4ZEBA 2XXXA 3CFXA 1XI6A 3FD3A 3T9VA 1MDQA 1D9QA 4O7MA 1MY3A 3TTNA 3I6VA 1MXZA 2XXVA 3K1NA 2NVUB 5ET7A 1K9ZA 3IB1A 2VPNA 1EYJA 1B0HA 3T9HB 4OQOA 5J1DA 2UXAA 3K4UA 2O84X 1JQFA 2JJKA 2VT5A 2WKYA 3G3IA 4LZ8A 1K9YA 4PFIA 1MXXA 3MVYA 4FIMA 3E9XA 4DXCA 4WEPA 3VVFA 4OFLA 4JVDA 5I7IA 3M3KA 2I0BA 2O7UA 4MMPA 4OVTA 4MJOA 5IZ3A 5ELVA 3CI8A 3FXQA 2HHMA 4KR5A 4U1ZA 1LEVA 2R6GE 4AS4A 4MX6A 1QULA 4G8HA 2V84A 3TPAA 4KCDA 5DVIA 2P2AA 4IY5A 3RLFE 5I2NB 2Q2CA 4H1XA 2RF1A 4DE8A 5H8HA 1B0LA 3QXMA 4ZE8A 4IY6A 5H8SA 2XXYA 4ELPA 3N5LA 3MVWA 4JXIA 5DW8A 4PAKA 1IMAA 3MZ1A 4H8IA 3RT8A 4IGRA 1ZBMA 2RCAA 3Q26A 1P1OA 4THIA 4U23A 2E0SA 1JEUA 2FA7A 3C4MA 3EF7A 3K00A 1PBPA 4HTGA 3SKPA 3FXUA 2HFBA 2PVUA 1YYZA 1LBWA 2V3UA 1DCUA 4PFYA 2XWKA 3HFUA 4NF8B 3LBSA 1ZIUA 2X7PA 1MXWA 4GWWA 1DPEA 2OLBA 2GHBA 1B3GA 1NNFA 2B65A 2H4IA 2VPOA 3MSTA 3IOWA 3PMVA 2ALUA 1ZU0A 3FV2A 1IITA 3HN0A 4PBQA 3E79A 4KFQA 3QMFA 4F1UA 4KI0E 3O66A 5I2NA 4PFUA 4EXLA 4GWXA 1YPNA 4EF2A 1KZ8A 2YJPA 3TELA 1VFDA 2I0CA 3VVEA 2QVVA 4EUOA 2DP8A 1Y3PA 3H4ZA 1XVYA 4NGUA 3UIFA 4KYDA 4O3CA 1OQHA 2OWTA 3VFJA 2V3TA 3GYYA 1SD3A 1XS5A 2B4LA 1FBGA 2HXWA 2F5XA 4C1TA 3MQ9A 3RT6B 1B7UA 3MP1A 1RYXA 2CZHA 5CMBA 1XHYA 4IO7A 2NWJA 1IXCA 4AB6A 2NOOA 4P3LA 1DTZA 3TYHA 2OBGA 3VDFA 1QW0A 4GL0A 3IFCA 5AA4B 4MLQA 1FTMA 3MW0A 3S9NC 3IK6B 4DDDA 4IO3A 4G68C 3PPRA 3RTWB 3THIA 2B4MA 2OJTA 1P1NA 2OCUA 3KGCA 2Y5KA 2HAUA 5AA2D 4O8MA 1NV2A 4LATA 5I84A 3C31A 1EYKA 2UVGA 4TQUQ 3KZGA 5F7VA 2VGQA 4EDPA 2Y7WA 5M2VA 1O7TA 4NF5B 4N07A 4YKJA 2OWZA 1WODA 3ZS6A 4F3GA 4NHBA 5DEXB 1LCFA 1B4ZA 3CVGA 1S50A 3VLWA 2ESNA 4ZECA 5EQ8A 3RN8A 1QUJA 1BIYA 2F7AA 3N94A 4HE2A 3EPEA 2HCAA 1PDAA 4I3EA 1FQFA 4F18A 2I49A 3GXAA 5IZ1A 4P0GA 5F24A 4U2RA 2AYSA 2F35A 1FBCA 2MKZA 3C32A 2DQVA 1FQEA 1RDZA 2CEXA 5FTHA 3Q25A 2V3QA 1BP5A 3VLVA 1O63A 4H5GA 1FCKA 4HE0A 2I48A 1DPPA 2LAOA 3OENA 3H6TA 4PDDA 1XC1A 3L6HA 1MPBA 2WYPA 2R71A 5AA4A 4F19A 4FECA 4FBPA 4GX6A 3G3HA 1MQHA 2HZLA 5B70A 1VSOA 1FTKA 1II5A 1MPCA 4YB6A 2V4CA 4DIGA 3G3GA 4ECFA 2QL3A 3CR9A 1LBCA 4DCXA 1B3FA 4N81A 4GBVA 4KHZE 4YKKA 4LN5A 1UIUA 1WDNA 1GV8A 1Y9UA 1I6QA 2Q74A 1FBPA 1FTLA 4H65A 1SVXB 2CZIA 3GBAA 3K6VA 1O64A 1PB8A 5DEXA 3TTMA 3T22A 4OMBA 4PQJA 4R2BA 5EYGA 3LC8A 1PBQA 2OX3A 1USYH 1N84A 2Y7IA 2DVZA 4OEUA 4BDNA 2CMOA 5H8FB 4C0RA 5TP9B 3WAEA 5JTYB 4GXSB 4PP0A 3CFLA 1LAXA 5DTBA 1L5TA 1B4HA 4Q0CA 1TFDA 1GVCA 3B8BA 2DWJA 1CNQA 3TAJA 2FNCA 5FHNA 3PUZE 3EQ1A 3ZKLA 1NNPA 4MEVA 4ZDMA 3B6TA 5TU0A 4BDOA 1CE2A 4JSDA 1KA1A 4RJZA 3G7WA 2RC7A 1QKBA 1B58A 3BIGA 2V25A 4WKMA 3MJNA 4QFKA 1MM6A 3SEXA 3RPLB 2Z8EA 3VV5A 3G3KA 4GX4A 2Y7RA 5I57B 1MQJA 4XTCQ 4AQ4A 4Q8RA 5AA3A 3SEWA 3LUYA 4JVIA 3C34A 3DP6A 3UA8A 3SEYA 4NWCA 5FHOA 1Y20A 4PFRA 4PTKA 3SESA 5J16A 2DVCA 3CSGA 3KN3A 1NNKA 4GWYA 4LVQA 4DXBA 2DXYA 5I59B 2P1SA 2I4BA 2ZXTA 3H7MA 2XHDA 3K01A 3OELA 4E0XA 3UK4A 3TCGA 1NV7A 2O69A 2P3NA 5TP9A 1N3WA 1IMCA 1MQGA 4G61A 2ZZWA 5KCJB 4NF6A 4HW8A 3K6XA 4XKQA 4ISUA 2IEEA 2CZLA 4ONYA 4Q5TA 3FVKA 3OO7A 3C33A 4GLIA 4R2FA 3MUQA 2FIXA 5K2YA 4GFRA 2AL5A 1UTBA 3T93B 1FJ9A 2O51A
chains in the Genus database with same CATH topology
5IGAA 4N15A 5I3SA 5ET8A 4PGPA 2ZZXA 5LDZA 4PF6A 1BK4A 5DW8A 4PAKA 1FBFA 1Q9DA 4PAIA 1IMAA 4F1VA 2XXKA 5T3JA 3SZPA 4X04A 1YYZA 3W9VA 4MAGA 1LBWA 5ET5A 2HPGA 1DCUA 2XWKA 2WBBA 3HFUA 4OVPA 1FJ9A 1NUZA 2F3DA 3NOHA 3LV0A 4GWWA 4HE1A 5ET6A 4I3YA 2BJIA 2VPOA 3MSTA 3B50A 2QFLA 1KA0A 5A5LA 1NI9A 1NUXA 2KR0A 4PDHA 1FPGA 2GQ1A 4PBQA 3ISPA 3E79A 5IM2A 3QMFA 2FVZA 2KQZA 2WX9A 3IFAA 4PBHA 4F1UA 3FXBA 3PTYA 1G0IA 3CHGA 4QXDA 4GWXA 1KZ8A 1IMEA 5EQ9A 1FBEA 4PGNA 4P56A 2QVVA 2QVUA 4NGUA 4MNIA 4DI3D 5ESYA 3T0JA 4PF8A 4PCDA 1LBYA 4NN3A 3GYYA 4PETA 2B4LA 1FBGA 1SPIA 2F5XA 1NV1A 2CZKA 4X8RA 1LBXA 2CZHA 5EQ7A 4DI4B 4HXVA 1IMFA 1FRPA 1NV4A 4P3LA 4N6KA 4NQ8A 4YICA 2PFYA 5IZZA 3IFCA 3KC0A 4N6DA 3RPLA 2QPQA 2Q8MA 4M1VA 4P8BA 4NG7A 1FTAA 4NX1A 5CM6A 2B4MA 2WBDA 2Y5KA 4N8YA 4O8MA 1NV2A 1EYKA 2L5VA 1NV6A 1G0HA 1NUWA 2P3VA 4PFBA 2OWZA 3LUZA 4OVQA 4PC9A 4MNPA 4NHBA 4P1LA 4PE3A 5EQAA 5EQ8A 4JVCA 1RDXA 2XWVA 4HE2A 1YXIA 4I3EA 4F18A 5IZ1A 3W9WA 1AWBA 2PCRA 5F24A 1NV5A 2XWOA 1FBCA 2MKZA 1RDZA 2CEXA 3EKIA 4OVRA 3E78A 4QBAA 2V3QA 1FBDA 1LBZA 4HE0A 2XA5A 3D1RA 1NV0A 4PDDA 1INPA 3BIHA 2FHYA 4N91A 4IR8A 2WYPA 2Y5LA 3KBZA 2HXRA 1FSAA 4F19A 1FPDA 1IMBA 4FBPA 4GX6A 2HZLA 4N4UA 4XEQA 4I40A 3FBPA 2V4CA 3A29A 1EYIA 4PAFA 4N81A 4GBVA 4HCYA 4LN5A 4P1EA 4MCOA 1FBHA 4P47A 4P9KA 4MIJA 1FPFA 2Q74A 2DE2A 1FBPA 1QGXA 3RYDA 2CEYA 2FBPA 2CZIA 2DDKA 2DE4A 4OANA 1NV3A 3T1BA 1NUYA 1DBZA 4N8GA 1FPIA 1VDWA 5EYGA 2OX3A 5LTCA 2HZKA 4GBWA 4NAPA 4OVSA 1JP4A 2DVZA 4O7IA 4OA4A 5JK4A 5FBPA 3KC1A 4HCWA 4YZZA 2PFZA 1FPLA 4X9TA 4XFEA 4MHFA 4MNCA 3MYUA 4O94A 5IZ3B 3B8BA 4GX3A 1CNQA 2DE3A 1FPJA 4GWZA 4MEVA 2QVRA 4XF5A 1FPEA 1RDYA 1IMDA 1KA1A 1DK4A 4AS5A 1FPKA 1LBVA 2Q9TA 3BIGA 1XI6A 4GWUA 3RPLB 1D9QA 4O7MA 2WYKA 4GX4A 1FJ6A 5ET7A 4JVIA 5EYHA 4NF0A 1K9ZA 4GWSA 2VPNA 1EYJA 4PFRA 4PTKA 5J16A 1FPBA 5J1DA 4N17A 4UABA 2XWIA 4H46A 4GWYA 2F3BA 4H45A 3ROJA 2JJKA 2VT5A 2FIEA 1K9YA 4PFIA 1NV7A 2P3NA 1IMCA 2R8TA 4G61A 3U65A 2ZZWA 2ZZVA 4JVDA 5I7IA 4MMPA 2WEFA 4OVTA 5I5PA 4MJOA 5IZ3A 1YZ0A 2HHMA 1LEVA 4AS4A 2FIXA 4KXPA 4MX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWV A;  4XFE A;  4MHF A;  4P56 A;  5IGA A;  4MNC A;  4N15 A;  4NGU A;  4O94 A;  4PGP A;  2ZZX A;  2XWO A;  4PF6 A;  4MNI A;  4DI3 D;  4PAK A;  4PF8 A;  2CEX A;  4OVR A;  4PAI A;  4PCD A;  4NN3 A;  4MEV A;  3GYY A;  2XA5 A;  2XXK A;  4XF5 A;  4PET A;  4PDD A;  4N91 A;  4X8R A;  2WYP A;  4X04 A;  4MAG A;  4DI4 B;  2HPG A;  2XWK A;  4O7M A;  2HZL A;  4N4U A;  4XEQ A;  2WYK A;  4P3L A;  4N6K A;  4OVP A;  4NQ8 A;  4YIC A;  2PFY A;  5IZZ A;  4N6D A;  2V4C A;  4NF0 A;  4P8B A;  4NG7 A;  4PAF A;  2VPN A;  4PFR A;  2VPO A;  4N17 A;  4LN5 A;  4P1E A;  4MCO A;  4UAB A;  2XWI A;  3B50 A;  4P47 A;  4P9K A;  4MIJ A;  4NX1 A;  5CM6 A;  2CEY A;  4N8Y A;  4O8M A;  4PDH A;  4OAN A;  4PBQ A;  4PFI A;  5IM2 A;  4N8G A;  2WX9 A;  3U65 A;  4PBH A;  2ZZW A;  5LTC A;  4PFB A;  2ZZV A;  2HZK A;  3FXB A;  5I7I A;  4OVQ A;  4PC9 A;  4MNP A;  4NAP A;  4OVS A;  4NHB A;  4MMP A;  5I5P A;  4OVT A;  4OA4 A;  4P1L A;  4PE3 A;  4YZZ A;  2PFZ A;  4PGN A;  4MX6 A; 
#chains in the Genus database with same CATH topology
 3PUY E;  5A5X B;  1UQW A;  4ZZA A;  5IGA A;  5ICQ A;  2VD2 A;  3N26 A;  5L9M A;  2D3I A;  5I3S A;  5L9S A;  5BWJ A;  4PGP A;  3JV9 A;  4RY1 A;  3HV1 A;  5I56 B;  1M5C A;  4N6P A;  1FBF A;  4F39 A;  1TT1 A;  3SEU A;  4PAI A;  3C9H A;  1FTO A;  5T3J A;  5I57 A;  3ILT B;  3KJ7 A;  1B1H A;  5KDT A;  3ODB A;  1POT A;  1D4N A;  1S9T A;  2HAV A;  3ILU B;  1A7L A;  5I59 A;  2XXU A;  4BDL A;  2NXO A;  3USD A;  4FOR A;  1SBP A;  1I6B A;  4HE1 A;  3Q29 A;  4I3Y A;  3T9X B;  4TOZ A;  4POW A;  3IOV A;  5I58 A;  4P11 A;  2H5Y A;  1MY2 A;  4R75 A;  3TTL A;  3U72 A;  1KA0 A;  2YLN A;  1NI9 A;  3DP8 A;  5I2K A;  3RY3 A;  4ZEK A;  2XD3 A;  1TFA A;  3OD7 A;  3PUX E;  4PBH A;  2PBW A;  1HSE A;  5A5X A;  3IOR A;  3FXB A;  4NTL A;  2PT1 A;  2GH9 A;  1LB9 A;  4QXD A;  1NL5 A;  5I56 A;  4YKI A;  2XXP A;  3PU5 A;  2PT2 A;  2F34 A;  2QS2 A;  3O2A A;  2ZNS A;  1SYI A;  1JW4 A;  3S9E A;  1XOC A;  3L6G A;  2QRY A;  4RPO A;  3K0V A;  4NN3 A;  1RYO A;  3KN8 A;  1Y3N A;  3O29 A;  1IIW A;  1ATG A;  4PET A;  1SPI A;  3D4G A;  1NMU A;  1SW5 A;  5TPA B;  5B7D A;  4X8R A;  1PC3 A;  4JWO A;  1LBX A;  4EQ7 A;  3IX1 A;  5HPQ A;  5EQ7 A;  3QIM A;  3SET A;  4OZ9 A;  3UGW A;  1Y1M A;  4H8J A;  1A54 A;  2ZNU A;  3ECR A;  2Q8J A;  4N6K A;  1EU8 A;  2PFY A;  2W7Y A;  5IZZ A;  2QPQ A;  1MQD A;  3FZV A;  2Q8M A;  5JEI A;  3FVG A;  2QMX A;  2H9B A;  4NG7 A;  3PUV E;  1MRP A;  3MBP A;  1JEV A;  2M8C A;  3IO6 A;  1B51 A;  1MPD A;  1EZP A;  3B7D A;  4QSE A;  2F7C A;  1US4 A;  3QK6 A;  2XXH A;  1H44 A;  1LST A;  1LBB A;  1MH3 A;  4ELQ A;  4N8Y A;  2GHA A;  4WXJ A;  1SDX A;  2F97 A;  1JVX A;  3GLB A;  3BFU A;  4OES A;  1R6Z A;  1G0H A;  3TZA A;  1NUW A;  2P3V A;  4IGT A;  4OVQ A;  1ELJ A;  3MP6 A;  5CBS A;  4RA1 A;  4P1L A;  4OWD A;  4PE3 A;  2NUV A;  1SYH A;  3CRB A;  2DS9 A;  2XWV A;  2O6A A;  2PMS A;  3FUZ A;  1IQ7 A;  1JVY A;  3F11 A;  2RC8 A;  1FTJ A;  3E3K A;  1USY E;  5TPA A;  4F2Q A;  4RK9 A;  2X7Q A;  3LSL A;  3EKI A;  4OVR A;  3E78 A;  4QBA A;  1PB9 A;  1LBZ A;  1HSJ A;  1F9B A;  4E0W A;  4ELO A;  1B7H A;  5LOM A;  1N0T A;  3H03 A;  1LB8 A;  4OYV A;  2BJJ X;  3BIH A;  2FHY A;  2F78 A;  1OLC A;  1FSA A;  3TKD A;  1FPD A;  3IOT A;  3OO6 A;  1MXU A;  2XXQ A;  4QFN A;  4ZEI A;  4JB7 A;  1VFE A;  4IO4 A;  1LFG A;  5K2X A;  3FBP A;  4NF8 A;  3VXB A;  5ITO A;  1EYI A;  3FJ7 A;  4P1E A;  4MCO A;  4O3B A;  1M5F A;  3KOS A;  1FPF A;  3QAX A;  1QGX A;  3MZ9 A;  4LUB A;  4RNS A;  4XKN A;  3SER A;  1AL3 A;  1IUD A;  2DDK A;  2DE4 A;  4DCY A;  4F3S A;  1DBZ A;  4N8G A;  1FPI A;  3PMW A;  4R6Y A;  5DVF A;  2F8D A;  1SI1 A;  2HZK A;  1D3K A;  3H6W A;  4BDR A;  4GBW A;  3H6U A;  1JP4 A;  3KBR A;  3EHS A;  1URD A;  5JK4 A;  2H98 A;  1TWY A;  5FBP A;  3KC1 A;  4QFO A;  2H99 A;  4QSD A;  3OSR A;  4H5F A;  1FPL A;  1SW4 A;  3QSL A;  4U22 A;  4JBZ A;  2OWS A;  3K6U A;  3O97 A;  5FHM A;  4KQP A;  5ITP A;  3RPW A;  3CIJ A;  4R6K A;  2DYX A;  3CFZ A;  3IO4 A;  4GD5 A;  2A5T B;  4JSO A;  3PUW E;  5CMC A;  3PPO A;  3TTR A;  3T66 A;  2DE3 A;  3QUF A;  5L8D A;  4RPN A;  2ZYM A;  3GZG A;  4Z7E A;  4XKP A;  1JW1 A;  1YCJ A;  1RDY A;  4FE8 A;  1LFI A;  5IKB A;  3DLN A;  1RKM A;  3AXF A;  1B46 A;  3U93 A;  3PD8 A;  1LAF E;  3KOT A;  4X1B A;  3PPQ A;  1FJ6 A;  1P1W A;  2O1L A;  2DWA A;  2QSX A;  4F3B A;  1ZTY A;  3OSQ A;  1N04 A;  4YU0 A;  3E13 X;  3S2V A;  3A09 A;  1FPB A;  4O3A A;  2XWI A;  3U94 A;  2Q2A A;  1ZLQ A;  4F31 B;  1M5D A;  4UA8 A;  4YB7 A;  3PD9 A;  2FIE A;  4RXL A;  2R8T A;  4F1Y A;  1J1N A;  4I1D A;  1CB6 A;  4LQ5 A;  3UN6 A;  4LA9 A;  2Z22 A;  2REG A;  2WEF A;  5I5P A;  4NF5 A;  3KFM A;  1N76 A;  1YZ0 A;  1B5J A;  3N6T A;  3IJO B;  4LZ5 A;  3V83 A;  2PCR A;  4IO6 A;  2O68 A;  4N15 A;  1T0K A;  3ONM A;  2ZMB A;  4NF4 B;  5LDZ A;  2ONS A;  4OTE A;  2D21 A;  5AA1 A;  1A40 A;  1S7Y A;  1Q9D A;  1P1U A;  4WED A;  4F1V A;  1POY 1;  5CMM A;  2XXK A;  3G3J A;  1GTK A;  3DEL B;  2I6E A;  4QF9 A;  4NED A;  2Z8D A;  3R26 A;  4FJP A;  3V5A A;  1OQG A;  4MAG A;  2HPG A;  1P1Q A;  2VOZ A;  3GBB A;  3IB2 A;  3FAT A;  1MM7 A;  2WBB A;  2QJE A;  1TXF A;  3O9P A;  2GRV A;  1NUZ A;  2F3D A;  1NNT A;  3VXC A;  2F36 A;  4XIG Q;  3Q27 A;  2BJI A;  3O6I A;  2XXR A;  1IZ1 A;  1YAE A;  2QFL A;  1DTG A;  4QFL A;  1NUX A;  5AE4 A;  4PDH A;  1FPG A;  1URG A;  2GQ1 A;  3ISP A;  1AH5 A;  5IM2 A;  2ABH A;  3N6U A;  2KQZ A;  1B32 A;  2WX9 A;  2A5S A;  3IFA A;  3TFL A;  1H3D A;  3PMX A;  3PTY A;  1G0I A;  3OEM A;  3MVZ A;  3CHG A;  2G29 A;  4NF4 A;  1MY1 A;  1FBE A;  1IME A;  5EQ9 A;  1B3L A;  5H8F A;  2I58 A;  1BKA A;  4P56 A;  1IXG A;  1LLS A;  4F2O A;  5JTY A;  4POX A;  3RUM A;  2UVH A;  3U92 A;  4U1O A;  3UOR A;  4DI3 D;  5ESY A;  4GXA A;  4HS7 A;  2DSF A;  2O1M A;  4Z0I A;  3Q28 A;  3TQW A;  2DXR A;  3FV1 A;  1KWH A;  1N7X A;  4ZEF A;  5EHM A;  2CZK A;  3K1P A;  3MPL A;  2Q88 A;  3CG1 A;  1ZKB A;  4HXV A;  1Q35 A;  3FXR A;  2GFE A;  5HM4 B;  1IXI A;  3EN3 A;  5ISU A;  4F3P A;  4LP2 B;  2I3W A;  1NV4 A;  3LSX A;  1EH3 A;  4NQ8 A;  4YIC A;  4N6D A;  3RPL A;  2P0S A;  4M1V A;  4P8B A;  3RNN A;  1FTA A;  3FAS A;  3MC2 A;  3V89 B;  1OLA A;  2QS4 A;  3FJM A;  2RIN A;  3LR1 A;  5CM6 A;  1MS7 A;  3HHG A;  1SI0 A;  1JET A;  3TCF A;  2B3B A;  1MY0 A;  4IO5 A;  2ANJ A;  3OO9 A;  1B05 A;  5BUU A;  2DWH A;  2L5V A;  1NV6 A;  3H6V A;  4K3F A;  4JDF A;  1Q1K A;  2ONR A;  3LUZ A;  3PPN A;  5HBC A;  4RK2 A;  3EHU A;  5KZT A;  4OEV A;  1A8E A;  4BDQ A;  2OK2 A;  3PPP A;  2HEU A;  2I4C A;  5KCJ A;  3CSB A;  3QYT A;  4H6D A;  5EQA A;  4FEB A;  2FYI A;  1MXV A;  1RDX A;  1FQB A;  4ZZE A;  4BLA A;  2ZYO A;  1B40 A;  3OOA A;  5DVJ A;  1YXI A;  4ESX A;  1MDP 1;  1QUK A;  1Y3Q A;  1GGG A;  1NV5 A;  4H67 A;  1EZ9 A;  1FQA A;  3HCQ A;  4MLV A;  5IAI A;  1FBD A;  2XA5 A;  1AIV A;  3TOD A;  3D1R A;  3KEI A;  1INP A;  3TTK A;  3LSW A;  4IR8 A;  4EXK A;  2I3V A;  2XX9 A;  4N4U A;  4U21 A;  3A3U A;  3TUS A;  1MH4 A;  4GVO A;  3VLU A;  2THI A;  4EF1 A;  4I40 A;  4BDM A;  3VVD A;  2Z23 A;  4GL8 A;  4PAF A;  3K1M A;  4G4P A;  2VP1 A;  4HCY A;  4Q30 B;  2HQ0 A;  4P47 A;  4P9K A;  4MIJ A;  2DE2 A;  3B6W A;  2PYY A;  1A8F A;  2QS1 A;  3RYD A;  2FBP A;  1UTH B;  4OAN A;  1DOT A;  5CI5 A;  1NUY A;  3FVN A;  1AMF A;  2B3F A;  3HST A;  1B1X A;  4GRK A;  1LAG E;  1FQC A;  5CC2 A;  4TLM B;  3K6W A;  1FW0 A;  1PB7 A;  1XVX A;  1Y4T A;  5LTC A;  2VHA A;  4NAP A;  4OVS A;  4MH5 A;  1PEB A;  4O7I A;  4OA4 A;  1QUI A;  4GWO A;  4YZZ A;  1B52 A;  1BTJ A;  4X9T A;  3CG3 A;  5CBR A;  4RYA A;  1UIV A;  4MHF A;  1OVT A;  1ZJL A;  4G8M A;  1QKA A;  4MNC A;  1B6H A;  4DZ1 A;  1OVB A;  4YAH X;  1B3H A;  3MYU A;  4O94 A;  4XXU A;  4PFW A;  3RGY A;  2IA4 A;  3KSX A;  3IJX B;  1FPJ A;  4NMY A;  1QVS A;  1OIB A;  3TMG A;  2RKM A;  1R9Q A;  3S9L C;  3MZB A;  2QVR A;  2Y7P A;  3FIR A;  4KYE A;  5CMK A;  3T96 B;  1XT8 A;  4MFI A;  3PGF A;  4AS5 A;  1R1N A;  4R6H A;  1LBV A;  2Q9T A;  4QSC A;  3RQT A;  4GWU A;  1NH7 A;  1LAH E;  3MAM A;  4I9D A;  2H25 A;  2WYK A;  2F7B A;  2ZYN A;  3ZSF A;  2REJ A;  4YMB A;  5EYH A;  4NF0 A;  1M5E A;  1UTH A;  1I6A A;  4GWS A;  5EYF A;  4EQ9 A;  5EHS A;  2G93 A;  3O28 A;  3B6Q A;  4N17 A;  4UAB A;  3KN7 A;  3D4C A;  4H46 A;  2QS3 A;  2V93 A;  3P7I A;  2F3B A;  4H45 A;  1NKX A;  4OEN A;  3ROJ A;  4YKP A;  3O6G A;  1DSN A;  1MG1 A;  2UYF A;  2D5W A;  2DOJ A;  1Y4C A;  3U65 A;  3KG2 A;  1Z7N E;  2ZZV A;  1URS A;  4MF3 A;  2Q89 A;  2X26 A;  1B7Z A;  2Y7K A;  1MQI A;  1P99 A;  1IXH A;  4OET A;  4KXP A;  1VE4 A;  1VR5 A;  3BBR A;  2RCB A;  3G3F A;  5ET8 A;  2ZZX A;  4PF6 A;  1BK4 A;  5H8N B;  3MWB A;  4LQ2 A;  4GQO A;  1B3E A;  3MVX A;  3LSF B;  4KD5 A;  4QHQ A;  3SZP A;  5H8Q B;  1LGB C;  5FTI A;  5DT6 A;  1B5H A;  4X04 A;  3W9V A;  5ET5 A;  1LCT A;  4KCC A;  1M5B A;  4JWY A;  4OVP A;  3BKI B;  4ELR A;  3I3V A;  4R73 A;  3NOH A;  4P0I A;  3LV0 A;  3SEV A;  1NFT A;  5ET6 A;  3RTF B;  4NWD A;  3WAF A;  4NE4 A;  4FAJ A;  4GOT A;  3B50 A;  5AA2 B;  5A5L A;  3M8U A;  4YB5 A;  2KR0 A;  3TEP A;  2YPN A;  5CRY A;  3OMB A;  2FVZ A;  4M4G A;  1Z7M E;  3FGS A;  1SW2 A;  4R72 A;  3S9M C;  2F6G A;  4OXV A;  1JW5 A;  4ZS9 A;  2E1S A;  2ZYK A;  1B9J A;  4OFJ A;  1EZO A;  2Y84 A;  4GF8 A;  5H8N A;  2R9J A;  3MP8 A;  3SDF A;  1JNF A;  4PGN A;  4GIZ A;  1H43 A;  1DMB A;  1GR2 A;  2QVU A;  4FED A;  5H8Q A;  2ONK E;  3JYR A;  4G68 B;  1FQD A;  4MNI A;  3T0J A;  4DXU A;  4PF8 A;  4PE5 B;  4IB2 A;  4KPT A;  1A99 A;  2A5T A;  4PCD A;  1LBY A;  2UVJ A;  3KJT A;  1NV1 A;  2XX7 A;  4QRZ A;  4R9F A;  4IO2 A;  4DI4 B;  3R6U A;  4X48 A;  1IMF A;  4U4X A;  3T9U A;  1WVJ A;  1HSL A;  1FRP A;  4QFP A;  1R9L A;  3V8X B;  4XKR A;  5AA2 A;  3S4U A;  3KC0 A;  1IEJ A;  2RC9 A;  5DYH A;  4MBP A;  4I62 A;  2XXT A;  4NX1 A;  2WBD A;  1MY4 A;  4ZE9 A;  4ZED A;  3U8Q A;  4I8C A;  3IB0 A;  4UAC A;  2KLF A;  4G2Z A;  4NF6 B;  4U4S A;  1D9V A;  4PFB A;  1Y1Z A;  3I5O A;  4PC9 A;  4MNP A;  4F22 A;  3O6H A;  5L9O A;  3H3G A;  3OXN A;  1UTB B;  1US5 A;  4OVJ A;  2UVI A;  4G68 A;  3DP4 A;  4JVC A;  2VD3 A;  4YMA A;  4X1D A;  3HPI A;  2DWI A;  4LZ7 A;  4ESW A;  3H06 B;  3JZJ A;  3K2D A;  3W9W A;  1AWB A;  1QJM A;  2XWO A;  4AB5 A;  1AOV A;  4R74 A;  1I69 A;  3IAZ A;  3UP9 A;  2QMW A;  3HO7 A;  3QUJ A;  5KDT B;  1A55 A;  4L17 A;  2AL4 A;  3M3F A;  4H0W A;  3KSJ A;  1NV0 A;  4N91 A;  3ZKK A;  3VE1 B;  2Y5L A;  5F1Q A;  3KBZ A;  2HXR A;  1IMB A;  1SQY A;  1LFH A;  3TCH A;  3W15 C;  4XEQ A;  1H45 A;  2O7I A;  4G8N A;  3A29 A;  5I58 B;  1YTV A;  4R9G A;  4OHN A;  1BLF A;  2OZZ A;  4OER A;  5I2K B;  4F29 A;  1FBH A;  4G77 A;  3C36 A;  3A3C A;  2CEY A;  4TLL B;  1NV3 A;  3T1B A;  3K02 A;  2PX1 A;  2F6P A;  2ZNT A;  1H76 A;  1VDW A;  3TQL A;  4KYS A;  3EHT A;  3OO8 A;  2XXW A;  1ANF A;  1N7W A;  3IL1 B;  3IOU A;  3DM0 A;  4OFO A;  4LON B;  1SW1 A;  2UYE A;  3FJG A;  4DLD A;  4C1U A;  4HCW A;  2PFZ A;  4JWX A;  4N13 A;  2Z8F A;  1ZMG A;  1N3X A;  3IR1 A;  3FVO A;  4XFE A;  3U1O A;  2AIX A;  3OEK A;  3M3L A;  3MPK A;  1OMP A;  5IZ3 B;  5ICT A;  4GX3 A;  1B5I A;  4ND9 A;  2XX8 A;  1MXY A;  1D9Y A;  4PFT A;  3HHF A;  3C35 A;  3E4R A;  4GWZ A;  3TDJ A;  4XF5 A;  3BFT A;  1FPE A;  1NH8 A;  3PV0 E;  4FAT A;  1IMD A;  1DK4 A;  5H8H B;  3R7X A;  1B2H A;  1FPK A;  2XD2 A;  2XXI A;  4EQB A;  4ZEB A;  2XXX A;  3CFX A;  1XI6 A;  3FD3 A;  3T9V A;  1MDQ A;  1D9Q A;  4O7M A;  1MY3 A;  3TTN A;  3I6V A;  1MXZ A;  2XXV A;  3K1N A;  2NVU B;  5ET7 A;  1K9Z A;  3IB1 A;  2VPN A;  1EYJ A;  1B0H A;  3T9H B;  4OQO A;  5J1D A;  2UXA A;  3K4U A;  2O84 X;  1JQF A;  2JJK A;  2VT5 A;  2WKY A;  3G3I A;  4LZ8 A;  1K9Y A;  4PFI A;  1MXX A;  3MVY A;  4FIM A;  3E9X A;  4DXC A;  4WEP A;  3VVF A;  4OFL A;  4JVD A;  5I7I A;  3M3K A;  2I0B A;  2O7U A;  4MMP A;  4OVT A;  4MJO A;  5IZ3 A;  5ELV A;  3CI8 A;  3FXQ A;  2HHM A;  4KR5 A;  4U1Z A;  1LEV A;  2R6G E;  4AS4 A;  4MX6 A;  1QUL A;  4G8H A;  2V84 A;  3TPA A;  4KCD A;  5DVI A;  2P2A A;  4IY5 A;  3RLF E;  5I2N B;  2Q2C A;  4H1X A;  2RF1 A;  4DE8 A;  5H8H A;  1B0L A;  3QXM A;  4ZE8 A;  4IY6 A;  5H8S A;  2XXY A;  4ELP A;  3N5L A;  3MVW A;  4JXI A;  5DW8 A;  4PAK A;  1IMA A;  3MZ1 A;  4H8I A;  3RT8 A;  4IGR A;  1ZBM A;  2RCA A;  3Q26 A;  1P1O A;  4THI A;  4U23 A;  2E0S A;  1JEU A;  2FA7 A;  3C4M A;  3EF7 A;  3K00 A;  1PBP A;  4HTG A;  3SKP A;  3FXU A;  2HFB A;  2PVU A;  1YYZ A;  1LBW A;  2V3U A;  1DCU A;  4PFY A;  2XWK A;  3HFU A;  4NF8 B;  3LBS A;  1ZIU A;  2X7P A;  1MXW A;  4GWW A;  1DPE A;  2OLB A;  2GHB A;  1B3G A;  1NNF A;  2B65 A;  2H4I A;  2VPO A;  3MST A;  3IOW A;  3PMV A;  2ALU A;  1ZU0 A;  3FV2 A;  1IIT A;  3HN0 A;  4PBQ A;  3E79 A;  4KFQ A;  3QMF A;  4F1U A;  4KI0 E;  3O66 A;  5I2N A;  4PFU A;  4EXL A;  4GWX A;  1YPN A;  4EF2 A;  1KZ8 A;  2YJP A;  3TEL A;  1VFD A;  2I0C A;  3VVE A;  2QVV A;  4EUO A;  2DP8 A;  1Y3P A;  3H4Z A;  1XVY A;  4NGU A;  3UIF A;  4KYD A;  4O3C A;  1OQH A;  2OWT A;  3VFJ A;  2V3T A;  3GYY A;  1SD3 A;  1XS5 A;  2B4L A;  1FBG A;  2HXW A;  2F5X A;  4C1T A;  3MQ9 A;  3RT6 B;  1B7U A;  3MP1 A;  1RYX A;  2CZH A;  5CMB A;  1XHY A;  4IO7 A;  2NWJ A;  1IXC A;  4AB6 A;  2NOO A;  4P3L A;  1DTZ A;  3TYH A;  2OBG A;  3VDF A;  1QW0 A;  4GL0 A;  3IFC A;  5AA4 B;  4MLQ A;  1FTM A;  3MW0 A;  3S9N C;  3IK6 B;  4DDD A;  4IO3 A;  4G68 C;  3PPR A;  3RTW B;  3THI A;  2B4M A;  2OJT A;  1P1N A;  2OCU A;  3KGC A;  2Y5K A;  2HAU A;  5AA2 D;  4O8M A;  1NV2 A;  4LAT A;  5I84 A;  3C31 A;  1EYK A;  2UVG A;  4TQU Q;  3KZG A;  5F7V A;  2VGQ A;  4EDP A;  2Y7W A;  5M2V A;  1O7T A;  4NF5 B;  4N07 A;  4YKJ A;  2OWZ A;  1WOD A;  3ZS6 A;  4F3G A;  4NHB A;  5DEX B;  1LCF A;  1B4Z A;  3CVG A;  1S50 A;  3VLW A;  2ESN A;  4ZEC A;  5EQ8 A;  3RN8 A;  1QUJ A;  1BIY A;  2F7A A;  3N94 A;  4HE2 A;  3EPE A;  2HCA A;  1PDA A;  4I3E A;  1FQF A;  4F18 A;  2I49 A;  3GXA A;  5IZ1 A;  4P0G A;  5F24 A;  4U2R A;  2AYS A;  2F35 A;  1FBC A;  2MKZ A;  3C32 A;  2DQV A;  1FQE A;  1RDZ A;  2CEX A;  5FTH A;  3Q25 A;  2V3Q A;  1BP5 A;  3VLV A;  1O63 A;  4H5G A;  1FCK A;  4HE0 A;  2I48 A;  1DPP A;  2LAO A;  3OEN A;  3H6T A;  4PDD A;  1XC1 A;  3L6H A;  1MPB A;  2WYP A;  2R71 A;  5AA4 A;  4F19 A;  4FEC A;  4FBP A;  4GX6 A;  3G3H A;  1MQH A;  2HZL A;  5B70 A;  1VSO A;  1FTK A;  1II5 A;  1MPC A;  4YB6 A;  2V4C A;  4DIG A;  3G3G A;  4ECF A;  2QL3 A;  3CR9 A;  1LBC A;  4DCX A;  1B3F A;  4N81 A;  4GBV A;  4KHZ E;  4YKK A;  4LN5 A;  1UIU A;  1WDN A;  1GV8 A;  1Y9U A;  1I6Q A;  2Q74 A;  1FBP A;  1FTL A;  4H65 A;  1SVX B;  2CZI A;  3GBA A;  3K6V A;  1O64 A;  1PB8 A;  5DEX A;  3TTM A;  3T22 A;  4OMB A;  4PQJ A;  4R2B A;  5EYG A;  3LC8 A;  1PBQ A;  2OX3 A;  1USY H;  1N84 A;  2Y7I A;  2DVZ A;  4OEU A;  4BDN A;  2CMO A;  5H8F B;  4C0R A;  5TP9 B;  3WAE A;  5JTY B;  4GXS B;  4PP0 A;  3CFL A;  1LAX A;  5DTB A;  1L5T A;  1B4H A;  4Q0C A;  1TFD A;  1GVC A;  3B8B A;  2DWJ A;  1CNQ A;  3TAJ A;  2FNC A;  5FHN A;  3PUZ E;  3EQ1 A;  3ZKL A;  1NNP A;  4MEV A;  4ZDM A;  3B6T A;  5TU0 A;  4BDO A;  1CE2 A;  4JSD A;  1KA1 A;  4RJZ A;  3G7W A;  2RC7 A;  1QKB A;  1B58 A;  3BIG A;  2V25 A;  4WKM A;  3MJN A;  4QFK A;  1MM6 A;  3SEX A;  3RPL B;  2Z8E A;  3VV5 A;  3G3K A;  4GX4 A;  2Y7R A;  5I57 B;  1MQJ A;  4XTC Q;  4AQ4 A;  4Q8R A;  5AA3 A;  3SEW A;  3LUY A;  4JVI A;  3C34 A;  3DP6 A;  3UA8 A;  3SEY A;  4NWC A;  5FHO A;  1Y20 A;  4PFR A;  4PTK A;  3SES A;  5J16 A;  2DVC A;  3CSG A;  3KN3 A;  1NNK A;  4GWY A;  4LVQ A;  4DXB A;  2DXY A;  5I59 B;  2P1S A;  2I4B A;  2ZXT A;  3H7M A;  2XHD A;  3K01 A;  3OEL A;  4E0X A;  3UK4 A;  3TCG A;  1NV7 A;  2O69 A;  2P3N A;  5TP9 A;  1N3W A;  1IMC A;  1MQG A;  4G61 A;  2ZZW A;  5KCJ B;  4NF6 A;  4HW8 A;  3K6X A;  4XKQ A;  4ISU A;  2IEE A;  2CZL A;  4ONY A;  4Q5T A;  3FVK A;  3OO7 A;  3C33 A;  4GLI A;  4R2F A;  3MUQ A;  2FIX A;  5K2Y A;  4GFR A;  2AL5 A;  1UTB A;  3T93 B;  1FJ9 A;  2O51 A; 
#chains in the Genus database with same CATH homology
 5IGA A;  4N15 A;  5I3S A;  5ET8 A;  4PGP A;  2ZZX A;  5LDZ A;  4PF6 A;  1BK4 A;  5DW8 A;  4PAK A;  1FBF A;  1Q9D A;  4PAI A;  1IMA A;  4F1V A;  2XXK A;  5T3J A;  3SZP A;  4X04 A;  1YYZ A;  3W9V A;  4MAG A;  1LBW A;  5ET5 A;  2HPG A;  1DCU A;  2XWK A;  2WBB A;  3HFU A;  4OVP A;  1FJ9 A;  1NUZ A;  2F3D A;  3NOH A;  3LV0 A;  4GWW A;  4HE1 A;  5ET6 A;  4I3Y A;  2BJI A;  2VPO A;  3MST A;  3B50 A;  2QFL A;  1KA0 A;  5A5L A;  1NI9 A;  1NUX A;  2KR0 A;  4PDH A;  1FPG A;  2GQ1 A;  4PBQ A;  3ISP A;  3E79 A;  5IM2 A;  3QMF A;  2FVZ A;  2KQZ A;  2WX9 A;  3IFA A;  4PBH A;  4F1U A;  3FXB A;  3PTY A;  1G0I A;  3CHG A;  4QXD A;  4GWX A;  1KZ8 A;  1IME A;  5EQ9 A;  1FBE A;  4PGN A;  4P56 A;  2QVV A;  2QVU A;  4NGU A;  4MNI A;  4DI3 D;  5ESY A;  3T0J A;  4PF8 A;  4PCD A;  1LBY A;  4NN3 A;  3GYY A;  4PET A;  2B4L A;  1FBG A;  1SPI A;  2F5X A;  1NV1 A;  2CZK A;  4X8R A;  1LBX A;  2CZH A;  5EQ7 A;  4DI4 B;  4HXV A;  1IMF A;  1FRP A;  1NV4 A;  4P3L A;  4N6K A;  4NQ8 A;  4YIC A;  2PFY A;  5IZZ A;  3IFC A;  3KC0 A;  4N6D A;  3RPL A;  2QPQ A;  2Q8M A;  4M1V A;  4P8B A;  4NG7 A;  1FTA A;  4NX1 A;  5CM6 A;  2B4M A;  2WBD A;  2Y5K A;  4N8Y A;  4O8M A;  1NV2 A;  1EYK A;  2L5V A;  1NV6 A;  1G0H A;  1NUW A;  2P3V A;  4PFB A;  2OWZ A;  3LUZ A;  4OVQ A;  4PC9 A;  4MNP A;  4NHB A;  4P1L A;  4PE3 A;  5EQA A;  5EQ8 A;  4JVC A;  1RDX A;  2XWV A;  4HE2 A;  1YXI A;  4I3E A;  4F18 A;  5IZ1 A;  3W9W A;  1AWB A;  2PCR A;  5F24 A;  1NV5 A;  2XWO A;  1FBC A;  2MKZ A;  1RDZ A;  2CEX A;  3EKI A;  4OVR A;  3E78 A;  4QBA A;  2V3Q A;  1FBD A;  1LBZ A;  4HE0 A;  2XA5 A;  3D1R A;  1NV0 A;  4PDD A;  1INP A;  3BIH A;  2FHY A;  4N91 A;  4IR8 A;  2WYP A;  2Y5L A;  3KBZ A;  2HXR A;  1FSA A;  4F19 A;  1FPD A;  1IMB A;  4FBP A;  4GX6 A;  2HZL A;  4N4U A;  4XEQ A;  4I40 A;  3FBP A;  2V4C A;  3A29 A;  1EYI A;  4PAF A;  4N81 A;  4GBV A;  4HCY A;  4LN5 A;  4P1E A;  4MCO A;  1FBH A;  4P47 A;  4P9K A;  4MIJ A;  1FPF A;  2Q74 A;  2DE2 A;  1FBP A;  1QGX A;  3RYD A;  2CEY A;  2FBP A;  2CZI A;  2DDK A;  2DE4 A;  4OAN A;  1NV3 A;  3T1B A;  1NUY A;  1DBZ A;  4N8G A;  1FPI A;  1VDW A;  5EYG A;  2OX3 A;  5LTC A;  2HZK A;  4GBW A;  4NAP A;  4OVS A;  1JP4 A;  2DVZ A;  4O7I A;  4OA4 A;  5JK4 A;  5FBP A;  3KC1 A;  4HCW A;  4YZZ A;  2PFZ A;  1FPL A;  4X9T A;  4XFE A;  4MHF A;  4MNC A;  3MYU A;  4O94 A;  5IZ3 B;  3B8B A;  4GX3 A;  1CNQ A;  2DE3 A;  1FPJ A;  4GWZ A;  4MEV A;  2QVR A;  4XF5 A;  1FPE A;  1RDY A;  1IMD A;  1KA1 A;  1DK4 A;  4AS5 A;  1FPK A;  1LBV A;  2Q9T A;  3BIG A;  1XI6 A;  4GWU A;  3RPL B;  1D9Q A;  4O7M A;  2WYK A;  4GX4 A;  1FJ6 A;  5ET7 A;  4JVI A;  5EYH A;  4NF0 A;  1K9Z A;  4GWS A;  2VPN A;  1EYJ A;  4PFR A;  4PTK A;  5J16 A;  1FPB A;  5J1D A;  4N17 A;  4UAB A;  2XWI A;  4H46 A;  4GWY A;  2F3B A;  4H45 A;  3ROJ A;  2JJK A;  2VT5 A;  2FIE A;  1K9Y A;  4PFI A;  1NV7 A;  2P3N A;  1IMC A;  2R8T A;  4G61 A;  3U65 A;  2ZZW A;  2ZZV A;  4JVD A;  5I7I A;  4MMP A;  2WEF A;  4OVT A;  5I5P A;  4MJO A;  5IZ3 A;  1YZ0 A;  2HHM A;  1LEV A;  4AS4 A;  2FIX A;  4KXP A;  4MX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...