4O94A

Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_3329), target efi-510223, with bound succinate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
309
structure length
309
Chain Sequence
QPIVVKFSHVVADNTPKGQAAIKFKELAEKYTNGKVKVEVYPNSQLFGDAKEMEAVALGDVQFIAPSLSKFDKFTKQIQVFDLPFLFNDIAAVDRFQAGKQGQALLRSMESKNFLGLAYWHNGMKQISANRPLLKPEDAKGLKFRIQASDILAAQFQGLNATPQKLAFSEVYQALQVGTVDGQENTWSNIFSQKFYEVQKDITESDHGVIDYMVVVNAKWWNGLSKDLQDAMKKAMDEATKVNNDVAGKLNDEAKQKIASSGASKIHQLTPEQRKQWVEAMKPVWAKFESAIGKDLIDAAVASNDTKTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 103
structure length 309
sequence length 309
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o94A00
4PCDA 4P8BA 4PAIA 4N15A 3FXBA 4NGUA 4NAPA 4PF8A 5CM6A 4P47A 5IGAA 4N6KA 4P56A 4N8GA 4XF5A 5IZZA 4MX6A 4NQ8A 2CEYA 4PGNA 4P1EA 4O7MA 2ZZVA 2XWIA 2PFYA 2WX9A 2ZZXA 2WYKA 4XFEA 4UABA 4OA4A 4MAGA 4PFBA 2WYPA 4DI3D 4XEQA 4MCOA 4MEVA 4OVQA 4OVTA 2HZKA 4YZZA 4OANA 4DI4B 4NX1A 4P3LA 4YICA 4PF6A 4PC9A 4NF0A 4PBHA 4X04A 4X8RA 4PDDA 4MHFA 4PDHA 4PFIA 4N4UA 4MNPA 2XA5A 2ZZWA 4NG7A 4P9KA 4PBQA 3U65A 4NHBA 4PFRA 4N17A 2CEXA 2XXKA 4PAKA 2VPOA 4MNCA 3GYYA 4MIJA 4PGPA 5I5PA 4OVPA 5IM2A 2PFZA 4NN3A 3B50A 2XWVA 2VPNA 4LN5A 4OVSA 2V4CA 5LTCA 4MNIA 2XWOA 4O8MA 2HZLA 4N91A 4P1LA 4O94A 2HPGA 4PE3A 5I7IA 4PAFA 4N6DA 4PETA 4MMPA 2XWKA 4N8YA 4OVRA
chains in the Genus database with same CATH superfamily
2DXRA 2DOJA 1JVYA 4PF8A 3TCGA 5K2YA 3TFLA 3IOWA 3WAFA 4X9TA 1GTKA 1NH8A 3TODA 3RYDA 4KQPA 3RTFB 4XKPA 3TTRA 4NQ8A 4ND9A 4IB2A 2FYIA 5CBSA 3H4ZA 1LBBA 1JVXA 3MJNA 4MAGA 2ONKE 2UXAA 5L9MA 4NF6B 1FBEA 4HW8A 2QRYA 3HV1A 4QRZA 4YZZA 5AA2A 3SESA 2Y5LA 3HN0A 1XI6A 4F18A 5DW8A 1MY2A 2R6GE 2ZYKA 3N6TA 1ELJA 1POY1 3VFJA 1IXIA 4BLAA 3GBAA 3PPPA 3VVEA 2XXQA 4PBQA 1BK4A 1LEVA 3EHUA 4F19A 4PAKA 3MQ9A 1YAEA 3KBRA 4YMBA 2ONSA 1P1WA 4G2ZA 1SQYA 1BKAA 3FBPA 4I3YA 3RUMA 4GWOA 1US4A 2F97A 3L6HA 4ESWA 4I62A 3PTYA 3S2VA 4U4XA 1MRPA 3PPQA 1UIVA 2AIXA 3A3CA 1SW4A 4PFUA 3CSBA 3UP9A 3IX1A 4PQJA 4R2BA 4YAHX 1IZ1A 1GVCA 1MM7A 5LDZA 1SVXB 4H1XA 2XXIA 4OFOA 3K1NA 1S9TA 4H6DA 5FHOA 3KN7A 2DWIA 2GHBA 3K1MA 3RTWB 1MQHA 3GLBA 1AL3A 1FBCA 4P1EA 4GXAA 4O7MA 4O3CA 3KJTA 1MH4A 2XHDA 3SDFA 3FD3A 5AA1A 3KC0A 3FV1A 1LAXA 3KZGA 4ZE9A 4F3GA 2F8DA 3M3KA 4AB5A 1MY0A 4OANA 4U1OA 2F34A 4EUOA 1YZ0A 2H98A 4G8HA 4U4SA 4HE2A 4X04A 3OXNA 2F36A 5L8DA 1YCJA 1ZU0A 1B1XA 3OO6A 2UVHA 1KA1A 4FORA 4NHBA 5ITOA 4PFRA 3B8BA 1FQCA 4PGPA 5CBRA 4LZ7A 1AOVA 3KN3A 2I4CA 2XWVA 4DXBA 4GX4A 2A5TB 3MVYA 4PFWA 3DP8A 1UTHB 3Q25A 4RPNA 4OZ9A 3IB2A 3IFAA 3VLWA 1NV0A 2V3TA 4R75A 4R9GA 3FXUA 3O9PA 1A8FA 1MS7A 2UYEA 4JDFA 3V8XB 2DVZA 4FE8A 3UA8A 2XXPA 3TAJA 1EU8A 3KN8A 4K3FA 3IL1B 4AB6A 2H4IA 2I0BA 4PE5B 1FW0A 5IZ3A 1NV3A 3VE1B 3USDA 1MDP1 3LC8A 1FPFA 1WODA 2VGQA 2FHYA 4PFBA 4YKPA 1QVSA 4OVQA 4DI4B 5I57A 1B3FA 5CMMA 1MY1A 1JEVA 2KR0A 4ZEIA 4RNSA 5EHSA 4FJPA 4PF6A 4IO6A 4PBHA 4BDOA 1QUJA 2W7YA 4UACA 1IXCA 4R6KA 4THIA 1TFAA 2ZZWA 3B6TA 4LATA 1MXVA 4ZDMA 1MQGA 5DVFA 5I2NA 3B7DA 1SI1A 2Z8EA 4U2RA 4YB6A 3B50A 5DEXA 3VVDA 2VPNA 1K9ZA 3O6HA 3G7WA 4H67A 1NUWA 1G0HA 3SEVA 2REGA 2QS1A 1JQFA 2X7PA 3PGFA 1PB7A 3H3GA 1FPLA 2XXHA 3VVFA 3MP1A 2YJPA 4RK9A 4F3PA 1RYOA 3CI8A 3G3JA 2THIA 4N8GA 2UVIA 3RPLA 1SW2A 3ONMA 1TXFA 3JV9A 3HHFA 4F3SA 1MQDA 3DP6A 4PGNA 1VDWA 2WBBA 1QUKA 2NUVA 1B0LA 2GFEA 5TP9A 4NWCA 3T9HB 2A5SA 2QMXA 2FIXA 3K00A 5CC2A 2OCUA 1R1NA 3T96B 4JVCA 2BJJX 4JVIA 1N7XA 2HZKA 2V3QA 1CNQA 1SYHA 1H44A 3S9EA 3LSFB 3TTLA 5AA2D 3RT8A 2XXVA 2F6PA 1IXGA 1I6BA 3T1BA 4F1UA 5F24A 4HE0A 3D1RA 1ATGA 3CRBA 4P9KA 3BFUA 3PPRA 3CG3A 4GF8A 3T0JA 5IM2A 2WBDA 2ZYNA 3LV0A 1Y20A 2RC9A 1NL5A 3IJXB 5T3JA 1A40A 5KDTA 2PCRA 5H8NA 3KSXA 5I7IA 3O2AA 2Q8JA 4JSDA 5AA4A 4ZEDA 1DMBA 4MMPA 3QUFA 1GGGA 2HFBA 1FQDA 1KZ8A 1NNKA 5H8FB 1B7ZA 2DWAA 5EYHA 4E0WA 3CG1A 1US5A 4H8IA 1TFDA 2Y7PA 2DS9A 2V84A 4Z0IA 2GQ1A 1VFEA 3KFMA 4G8NA 3EQ1A 3MUQA 3K02A 2ZZXA 5JEIA 4XTCQ 2Q9TA 3SKPA 2DSFA 3U93A 4H65A 1MDQA 1FTKA 2F7CA 2Z23A 4QFPA 2Q2AA 3OSRA 2ESNA 4G68B 1LBVA 1N76A 1SD3A 4NX1A 5IZ3B 1PB9A 4IO2A 4KCDA 3QSLA 2MKZA 3D4GA 1LCTA 3SEWA 5DT6A 3RLFE 4HS7A 3TTNA 3LSLA 3K6VA 2WEFA 4QSCA 1ZMGA 4ZEBA 4WEPA 3M3LA 4GBVA 2Y7KA 5I56A 5EQAA 4NMYA 1JW5A 2O68A 4MF3A 2F7BA 3C34A 1M5CA 2XXRA 1LSTA 1YYZA 3BKIB 4LP2B 3C36A 2B4LA 2H25A 2P2AA 2Y7RA 4MNIA 3E79A 2RCAA 4GIZA 1FCKA 4O8MA 4P1LA 5H8HA 1MXXA 1PB8A 5HBCA 1NV6A 4DXUA 3G3GA 4PAFA 3W15C 4U23A 1LBZA 3U94A 3MP8A 3IAZA 2DXYA 5H8SA 5I2NB 3TCHA 1IMEA 2HHMA 4OVRA 4P11A 4IY5A 5DEXB 3SEXA 1A55A 5CRYA 5TPAA 1EZPA 3FXBA 1OIBA 4OYVA 4IO5A 1TT1A 3N94A 1LLSA 4NE4A 2LAOA 5KZTA 1BP5A 1PC3A 4JXIA 1YPNA 1MXYA 2Q89A 4ZECA 5JK4A 3LSXA 4BDQA 3U72A 2PVUA 1P1OA 1Y3QA 1II5A 2V3UA 4BDMA 2XWIA 3TEPA 1CE2A 5I2KA 4OEVA 4MJOA 2O6AA 1PDAA 5AA3A 4N81A 2Z22A 1NUYA 2OK2A 1HSEA 1NMUA 4ZEKA 3VXBA 1P1QA 5EQ9A 5FBPA 2HAVA 3TQWA 2I0CA 3IOVA 5TP9B 3U92A 4OETA 5A5XB 1H76A 4XKRA 1D4NA 2DWHA 2DVCA 3TKDA 3PMVA 3S9LC 3EPEA 1K9YA 5EQ7A 2PFZA 3TDJA 1D9VA 4X48A 3IFCA 4H46A 2XXWA 2DYXA 5ITPA 5ET8A 2QS3A 1RDXA 4O94A 5FHMA 2QS2A 1NH7A 3OD7A 4EDPA 3NOHA 1M5FA 1LFGA 4R9FA 3S4UA 3FUZA 2XXYA 5IKBA 3FXQA 2O1LA 4NAPA 1FQBA 3OELA 3MVZA 1LGBC 1SPIA 5KDTB 1WVJA 5H8NB 5B70A 1XOCA 1XVXA 1Y1ZA 4F2OA 2B65A 3VDFA 5AA4B 4X1DA 5J1DA 1QULA 2PMSA 4NF8A 1MH3A 3MZ9A 2CEYA 2O7IA 1FTOA 3KSJA 4FECA 5M2VA 3H03A 4G77A 5ISUA 3K2DA 4C1UA 4XEQA 2QFLA 4M4GA 3G3FA 4OVTA 3EHSA 3GBBA 1NV2A 1NNFA 4ZZAA 1JW4A 3DELB 1B5HA 4PDHA 5FTIA 3ZKLA 4RPOA 3IO4A 5EHMA 3IB1A 3RY3A 3FVOA 1B4ZA 2CMOA 4R6YA 3TPAA 5FTHA 3K4UA 2XXKA 2R8TA 4QXDA 1FRPA 2OWSA 3L6GA 3IOUA 2XXTA 2VD3A 3N26A 4OVPA 5AE4A 4TOZA 3MW0A 4LN5A 1B32A 2V4CA 3PUXE 3TZAA 4OMBA 3RNNA 3OO7A 1Y3NA 4N91A 5FHNA 4JWOA 3PMXA 5HPQA 4PFYA 4MFIA 2GH9A 4N6DA 3SETA 1LFIA 1O7TA 4R2FA 1P1UA 4L17A 4QBAA 4BDRA 1FPBA 1KA0A 4TQUQ 4KD5A 3KOSA 2CZIA 2E0SA 1FTAA 1B1HA 3FJGA 3PV0E 4N6KA 4QFNA 5H8HB 1I69A 2DE2A 2PX1A 3LUYA 5F1QA 4GRKA 2QVUA 2F3DA 3LBSA 3CFZA 3ZKKA 3FJMA 1S50A 1CB6A 4LA9A 4ZS9A 5TPAB 2WYKA 4XFEA 1Y1MA 3KG2A 3UORA 4NF4B 5ET7A 1IMAA 3PD9A 4GX3A 2R9JA 5HM4B 4R73A 3IORA 5A5LA 3EHTA 4OERA 4OFLA 1D9QA 2BJIA 4X8RA 5I59A 3IJOB 4OENA 2XD3A 3EN3A 4P0GA 4MNPA 4NG7A 4MLVA 5I2KB 4G68C 1A8EA 3QAXA 2VPOA 5H8QA 1NKXA 1DPPA 3TCFA 1FBPA 3TUSA 4HTGA 4QHQA 1IMCA 2QMWA 4IGTA 2F78A 4OVSA 4ZZEA 3E13X 1ZJLA 2DE3A 5LTCA 1URGA 1FBDA 4AQ4A 3E78A 1IMDA 2VD2A 1IUDA 5AA2B 4GQOA 1VSOA 3MZ1A 1R9QA 2V25A 4EQ9A 5CMKA 1PBPA 2Y5KA 4KCCA 3A3UA 2XXUA 4F29A 4QSEA 3QXMA 3ILTB 4FATA 4N15A 3SEUA 2P0SA 1IXHA 4DIGA 2ZNSA 4KYDA 3R6UA 5IGAA 3C33A 1DK4A 2FIEA 4QFLA 1Y4TA 4F31B 3TTKA 3MVXA 3F11A 2YLNA 3K1PA 2PT1A 5BUUA 1ZIUA 2HXRA 1R9LA 5I84A 5TU0A 2RC8A 3C35A 1N3XA 4DXCA 2OWTA 1MXZA 4LQ2A 2Q2CA 2PYYA 2WYPA 1EZ9A 1H43A 4MCOA 3QUJA 1D3KA 4EF2A 4FEDA 2I58A 1NV4A 2Q88A 3QMFA 1OLCA 4NF0A 1FJ9A 3A09A 3TTMA 1XVYA 4KFQA 4DCXA 4MHFA 3RT6B 3IB0A 4GWSA 4PFIA 2OZZA 3T9UA 1PBQA 4G8MA 2ZXTA 1AMFA 2O7UA 2HQ0A 2FA7A 1URDA 4O7IA 4GVOA 4MNCA 5F7VA 3PUZE 1FTLA 4ELRA 3HPIA 3H7MA 1DPEA 5IZ1A 1F9BA 4ELPA 4I9DA 4KYEA 4NF6A 3R7XA 3T9VA 4NTLA 3K0VA 4WKMA 1M5BA 1SBPA 1UTBA 4E0XA 4X1BA 1AH5A 1M5DA 5ET5A 3CHGA 3OENA 3MZBA 4O3AA 2CZHA 2R71A 4KPTA 4LVQA 2DDKA 1B6HA 3ECRA 4NGUA 1RKMA 1MY3A 4LZ8A 1OMPA 4MLQA 2RC7A 3LUZA 3RN8A 4KI0E 4NEDA 1LBCA 4WXJA 3FATA 5EYGA 1FTJA 1FPKA 3MC2A 4MX6A 4DLDA 3C32A 3W9WA 3PPOA 1FPGA 3I5OA 4GFRA 1OVTA 2ZNTA 2ZZVA 2P3NA 2WX9A 4UABA 3O6IA 1JW1A 5CMCA 4FAJA 3PUYE 4C0RA 1D9YA 3C31A 2CZKA 3K6XA 1NV1A 4OHNA 1FSAA 3EKIA 4YICA 1MXUA 5JTYA 3KOTA 4Q30B 4EXKA 4KXPA 2E1SA 3P7IA 3Q29A 3PUVE 4H45A 1EYKA 4IO7A 1B2HA 1IMBA 3K01A 2KQZA 5ESYA 1N7WA 5I5PA 1AIVA 4JB7A 4N13A 1LBXA 1T0KA 5I59B 2F5XA 3W9VA 1FPJA 3O6GA 2QS4A 3H6TA 2HZLA 2O69A 3PD8A 2RINA 2KLFA 2ZYOA 1QJMA 1IITA 1ANFA 4JWYA 1XC1A 5H8QB 3PUWE 5I57B 4N8YA 1I6AA 3H6VA 1H45A 1B52A 4OXVA 1ZLQA 3FV2A 2GRVA 2UVJA 3K6UA 1NNTA 4P56A 3UN6A 1LAGE 2DWJA 1Q35A 3CFXA 3O97A 4RK2A 2HEUA 1HSJA 4YB5A 1UQWA 1HSLA 4Z7EA 1A7LA 4ZE8A 4HE1A 4OA4A 3I3VA 3FVKA 1UTHA 4YB7A 3M8UA 3MAMA 1MQIA 2OX3A 3KEIA 4I1DA 1BIYA 3QYTA 1GR2A 1ZBMA 3ILUB 3O29A 3N6UA 4GBWA 4RJZA 1SW1A 2I49A 1B5JA 4ONYA 4OWDA 3OSQA 2V93A 4IO3A 2XA5A 3RPWA 5K2XA 3KJ7A 4DE8A 2PT2A 1Q1KA 3RPLB 3GYYA 3FXRA 2NWJA 1Y4CA 2H9BA 1N3WA 4N07A 4IGRA 1LCFA 3BIGA 1QGXA 3ODBA 1POTA 4OESA 3K6WA 2QVVA 4H0WA 2YPNA 1AWBA 4Q0CA 5ET6A 1DCUA 3VLVA 1VFDA 2O51A 3HSTA 2I3WA 2NVUB 4FEBA 3A29A 2ZNUA 1BLFA 2P3VA 4LQ5A 4M1VA 1FJ6A 4BDLA 1UIUA 3THIA 1UTBB 1NI9A 2D3IA 3EF7A 2UYFA 5IAIA 4PP0A 2B3BA 3D4CA 3IO6A 4H8JA 4RY1A 5B7DA 5L9OA 5LOMA 3ZSFA 1FBGA 4O3BA 3T9XB 4QFKA 1FQEA 1BTJA 1NV5A 2I48A 2D21A 1XHYA 3KGCA 4YKIA 3T93B 2GHAA 3WAEA 4OFJA 1LAHE 3C9HA 2G29A 4NF5A 3M3FA 2REJA 3TQLA 4TLMB 3VLUA 5ICQA 2XXXA 2IA4A 4EQBA 3U1OA 2NOOA 2ONRA 4EF1A 2OJTA 1B3LA 4AS5A 1ZTYA 3HCQA 3FJ7A 2HAUA 3RGYA 4MIJA 1EYIA 3OEKA 3MPKA 1G0IA 2Y84A 4GD5A 5JTYB 1B3EA 4R72A 2XWOA 4FIMA 3MPLA 2HPGA 1B0HA 1MY4A 3OO8A 4OVJA 4YU0A 4QSDA 1OQGA 2DE4A 3PMWA 2QPQA 2DP8A 2VHAA 5EQ8A 1Y9UA 4Q8RA 4RXLA 2OWZA 4ELQA 3FZVA 4GWXA 5CM6A 2VOZA 1P1NA 2XX9A 3H6UA 4ECFA 4EQ7A 4I40A 2ABHA 5I56B 1N0TA 3TYHA 3UK4A 1OVBA 3KBZA 2ZMBA 1XS5A 2I4BA 3ISPA 3VV5A 3OOAA 3O28A 3LR1A 1SDXA 2FNCA 1R6ZA 4F2QA 5H8FA 5KCJA 3IR1A 1B7UA 1EYJA 2ZYMA 1DTZA 4ELOA 1TWYA 1VR5A 3B6QA 4C1TA 4IY6A 1MM6A 2RKMA 1MPDA 2Z8FA 4JWXA 4GOTA 2OLBA 2L5VA 2Z8DA 3MWBA 3G3HA 3O66A 2JJKA 4GLIA 4HCWA 1A99A 3V89B 3E9XA 1INPA 1VE4A 1N04A 3BIHA 3GXAA 1MPCA 5L9SA 4G4PA 4PE3A 3JYRA 3FVNA 2M8CA 4GX6A 2XX8A 4G68A 1QKAA 1FBFA 5EYFA 2FBPA 3VXCA 4GL0A 1RDYA 1LB9A 4F3BA 3FVGA 2NXOA 1LBYA 3MVWA 5DVJA 3FIRA 3U8QA 4PCDA 2RF1A 5I58A 1B9JA 2H5YA 2XD2A 4KR5A 2HCAA 3S9NC 4ISUA 3Q26A 4OQOA 3MBPA 5I3SA 4F39A 1B05A 4LZ5A 4YKKA 1Y3PA 5IZZA 4Q5TA 4U21A 2VT5A 1MXWA 2PFYA 4LUBA 1IEJA 2AL4A 3BFTA 3Q28A 1L5TA 1H3DA 4U1ZA 3PU5A 4ZEFA 2I3VA 2QVRA 2I6EA 1A54A 2QL3A 3DLNA 4R6HA 1DOTA 3V5AA 1NFTA 4P3LA 3BBRA 3PPNA 3ROJA 1XT8A 4XXUA 4PDDA 4YKJA 1DBZA 3DM0A 4N4UA 3V83A 4RA1A 3SEYA 4KHZE 1OQHA 3ZS6A 3SZPA 2Q8MA 1NUZA 4N17A 3IK6B 1IQ7A 1EZOA 1B3GA 1JETA 1USYH 2CZLA 1DTGA 2P1SA 4MBPA 1OLAA 4NF8B 4NF5B 1MPBA 1FQAA 1LFHA 3GZGA 1GV8A 3TELA 2F35A 2H99A 1IIWA 1B5IA 4POXA 3UIFA 3S9MC 3E4RA 4F1VA 5BWJA 4DZ1A 4N6PA 4PETA 4GWUA 3IOTA 3KC1A 3JZJA 4PAIA 5A5XA 1YXIA 1NV7A 2QJEA 5DVIA 1P99A 2B4MA 4P47A 3OEMA 3FGSA 4G61A 1B3HA 1FPDA 4OTEA 4GWZA 2QSXA 3LSWA 4XF5A 1QW0A 4AS4A 4F1YA 4IR8A 3HHGA 4QFOA 3T22A 3H06B 2UVGA 4JVDA 4XIGQ 4DDDA 4MEVA 1FPIA 5ELVA 4NWDA 2AYSA 4LONB 1IMFA 1YTVA 4PC9A 3CFLA 2OBGA 2Y7IA 3CIJA 4JSOA 5J16A 5CMBA 2Q74A 3N5LA 3UGWA 4I8CA 2XX7A 1Z7ME 1O64A 3U65A 4OEUA 3AXFA 2AL5A 2F6GA 4I3EA 2HXWA 1FQFA 4POWA 2ANJA 3H6WA 5KCJB 4NN3A 2F3BA 2VP1A 1B40A 4JBZA 1B7HA 4TLLB 1B58A 4XKQA 5DTBA 1JNFA 4PFTA 1URSA 4YMAA 3CSGA 1MG1A 4GXSB 1SYIA 3HFUA 2WKYA 4HCYA 1FBHA 3FASA 1Q9DA 2B3FA 4F22A 3CVGA 3SERA 4P8BA 3QK6A 1LB8A 4GWYA 1EH3A 2X26A 3MP6A 4XKNA 3T66A 1DSNA 3TMGA 2ALUA 1Z7NE 1I6QA 1ZKBA 4MH5A 1MQJA 3MSTA 2DQVA 1QKBA 1NNPA 4EXLA 1M5EA 3G3KA 3CR9A 4PTKA 5DYHA 4IO4A 1PEBA 4R74A 5ICTA 5I58B 4DCYA 1B51A 4KYSA 2O84X 4DI3D 1J1NA 3I6VA 4H5GA 4BDNA 1JP4A 1N84A 1B46A 3B6WA 1RYXA 4ESXA 1NUXA 1O63A 2FVZA 2D5WA 5CI5A 1WDNA 4H5FA 3E3KA 3OO9A 3HO7A 3OMBA 2A5TA 3MYUA 1FTMA 4QF9A 2F7AA 4WEDA 2IEEA 3Q27A 4FBPA 4P0IA 1FPEA 2X7QA 1SW5A 4GWWA 2CEXA 1LAFE 2G93A 3G3IA 1LBWA 4RYAA 1USYE 4HXVA 3QIMA 2PBWA 3RQTA 2O1MA 4U22A 4NF4A 1S7YA 1SI0A 3DP4A 3R26A 1RDZA 1QUIA 2Y7WA 4GL8A 1JEUA 4UA8A 2XWKA 1KWHA 3C4MA 1B4HA 2RCBA
chains in the Genus database with same CATH topology
5EYHA 2OWZA 4N15A 4GWXA 4PF8A 5CM6A 5IGAA 1DK4A 2FIEA 2GQ1A 4I40A 4X9TA 3RYDA 2HXRA 4NQ8A 3KBZA 2ZZXA 4MAGA 2Q9TA 2WYPA 3ISPA 4MCOA 1FBEA 4YZZA 4NX1A 1LBVA 2Y5LA 5IZ3B 1NV4A 2MKZA 3QMFA 1XI6A 4NF0A 1FJ9A 1EYJA 4F18A 4MHFA 5DW8A 4GWSA 4PFIA 2WEFA 4PBQA 2L5VA 1BK4A 1LEVA 4GBVA 4F19A 4O7IA 4PAKA 2JJKA 5EQAA 4MNCA 4HCWA 4I3YA 1YYZA 1INPA 3FBPA 5IZ1A 3BIHA 2B4LA 4MNIA 3E79A 3PTYA 4O8MA 4P1LA 4PE3A 1NV6A 4GX6A 4PAFA 1LBZA 5ET5A 3CHGA 1FBFA 2FBPA 1RDYA 1IMEA 1LBYA 2HHMA 4OVRA 2CZHA 4PCDA 2DDKA 3FXBA 4NGUA 5LDZA 3LUZA 5I3SA 5JK4A 5EYGA 1FPKA 5IZZA 4MX6A 3W9WA 4P1EA 1FBCA 4O7MA 1FPGA 2ZZVA 2P3NA 2XWIA 2VT5A 2PFYA 2WX9A 4UABA 2QVRA 3KC0A 4MJOA 4N81A 4OANA 1NUYA 2CZKA 1NV1A 1FSAA 4P3LA 3EKIA 5EQ9A 1YZ0A 4YICA 3ROJA 5FBPA 4HE2A 4X04A 4PDDA 1DBZA 4KXPA 4N4UA 3SZPA 4H45A 1EYKA 2Q8MA 1KA1A 4NHBA 1NUZA 1IMBA 4PFRA 3B8BA 4N17A 2KQZA 4PGPA 5ESYA 5I5PA 1K9YA 1LBXA 5EQ7A 2PFZA 2XWVA 3IFCA 4H46A 4GX4A 2F5XA 3W9VA 1FPJA 5ET8A 2HZLA 1RDXA 4O94A 4F1VA 4PETA 3IFAA 3NOHA 4N8YA 1NV0A 4GWUA 3KC1A 4PAIA 1YXIA 1NV7A 4NAPA 2B4MA 4P47A 1SPIA 2DVZA 4P56A 4G61A 1FPDA 4GWZA 5IZ3A 5J1DA 4XF5A 1NV3A 4AS4A 2CEYA 4IR8A 1FPFA 4HE1A 4OA4A 4PFBA 2FHYA 4JVDA 4XEQA 2QFLA 4MEVA 1FPIA 4OVQA 2OX3A 4OVTA 1IMFA 4DI4B 1NV2A 2KR0A 4PF6A 4PC9A 4PBHA 4GBWA 4PDHA 5J16A 2Q74A 2XA5A 2ZZWA 3U65A 4I3EA 2XXKA 3RPLB 2R8TA 1FRPA 4QXDA 3GYYA 4OVPA 4NN3A 2F3BA 3B50A 2VPNA 4LN5A 2V4CA 1K9ZA 3BIGA 1QGXA 1NUWA 4N91A 1G0HA 2QVVA 1AWBA 4N6DA 5ET6A 3HFUA 1FPLA 1DCUA 4QBAA 4HCYA 1FBHA 1FPBA 1Q9DA 1KA0A 4P8BA 4GWYA 2CZIA 3A29A 2P3VA 1FTAA 4M1VA 4N6KA 4N8GA 1FJ6A 3RPLA 1NI9A 3MSTA 2DE2A 2QVUA 2F3DA 4PTKA 1VDWA 4PGNA 1FBGA 2WBBA 1NV5A 2WYKA 4XFEA 5ET7A 2FIXA 1IMAA 4DI3D 4GX3A 4JVCA 4JVIA 2HZKA 2V3QA 1JP4A 1CNQA 5A5LA 1NUXA 2FVZA 1D9QA 2BJIA 4X8RA 3MYUA 3T1BA 4F1UA 5F24A 4HE0A 4MNPA 3D1RA 4NG7A 4P9KA 4FBPA 4AS5A 1FPEA 4GWWA 2CEXA 2VPOA 1FBPA 4MIJA 1EYIA 1LBWA 3T0JA 5IM2A 2WBDA 1G0IA 4HXVA 1IMCA 3LV0A 4OVSA 2DE3A 5LTCA 5T3JA 2XWOA 1FBDA 2PCRA 2HPGA 1RDZA 5I7IA 3E78A 1IMDA 2DE4A 2QPQA 4MMPA 2XWKA 2Y5KA 1KZ8A 5EQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PCD A;  4P8B A;  4PAI A;  4N15 A;  3FXB A;  4NGU A;  4NAP A;  4PF8 A;  5CM6 A;  4P47 A;  5IGA A;  4N6K A;  4P56 A;  4N8G A;  4XF5 A;  5IZZ A;  4MX6 A;  4NQ8 A;  2CEY A;  4PGN A;  4P1E A;  4O7M A;  2ZZV A;  2XWI A;  2PFY A;  2WX9 A;  2ZZX A;  2WYK A;  4XFE A;  4UAB A;  4OA4 A;  4MAG A;  4PFB A;  2WYP A;  4DI3 D;  4XEQ A;  4MCO A;  4MEV A;  4OVQ A;  4OVT A;  2HZK A;  4YZZ A;  4OAN A;  4DI4 B;  4NX1 A;  4P3L A;  4YIC A;  4PF6 A;  4PC9 A;  4NF0 A;  4PBH A;  4X04 A;  4X8R A;  4PDD A;  4MHF A;  4PDH A;  4PFI A;  4N4U A;  4MNP A;  2XA5 A;  2ZZW A;  4NG7 A;  4P9K A;  4PBQ A;  3U65 A;  4NHB A;  4PFR A;  4N17 A;  2CEX A;  2XXK A;  4PAK A;  2VPO A;  4MNC A;  3GYY A;  4MIJ A;  4PGP A;  5I5P A;  4OVP A;  5IM2 A;  2PFZ A;  4NN3 A;  3B50 A;  2XWV A;  2VPN A;  4LN5 A;  4OVS A;  2V4C A;  5LTC A;  4MNI A;  2XWO A;  4O8M A;  2HZL A;  4N91 A;  4P1L A;  4O94 A;  2HPG A;  4PE3 A;  5I7I A;  4PAF A;  4N6D A;  4PET A;  4MMP A;  2XWK A;  4N8Y A;  4OVR A; 
#chains in the Genus database with same CATH topology
 2DXR A;  2DOJ A;  1JVY A;  4PF8 A;  3TCG A;  5K2Y A;  3TFL A;  3IOW A;  3WAF A;  4X9T A;  1GTK A;  1NH8 A;  3TOD A;  3RYD A;  4KQP A;  3RTF B;  4XKP A;  3TTR A;  4NQ8 A;  4ND9 A;  4IB2 A;  2FYI A;  5CBS A;  3H4Z A;  1LBB A;  1JVX A;  3MJN A;  4MAG A;  2ONK E;  2UXA A;  5L9M A;  4NF6 B;  1FBE A;  4HW8 A;  2QRY A;  3HV1 A;  4QRZ A;  4YZZ A;  5AA2 A;  3SES A;  2Y5L A;  3HN0 A;  1XI6 A;  4F18 A;  5DW8 A;  1MY2 A;  2R6G E;  2ZYK A;  3N6T A;  1ELJ A;  1POY 1;  3VFJ A;  1IXI A;  4BLA A;  3GBA A;  3PPP A;  3VVE A;  2XXQ A;  4PBQ A;  1BK4 A;  1LEV A;  3EHU A;  4F19 A;  4PAK A;  3MQ9 A;  1YAE A;  3KBR A;  4YMB A;  2ONS A;  1P1W A;  4G2Z A;  1SQY A;  1BKA A;  3FBP A;  4I3Y A;  3RUM A;  4GWO A;  1US4 A;  2F97 A;  3L6H A;  4ESW A;  4I62 A;  3PTY A;  3S2V A;  4U4X A;  1MRP A;  3PPQ A;  1UIV A;  2AIX A;  3A3C A;  1SW4 A;  4PFU A;  3CSB A;  3UP9 A;  3IX1 A;  4PQJ A;  4R2B A;  4YAH X;  1IZ1 A;  1GVC A;  1MM7 A;  5LDZ A;  1SVX B;  4H1X A;  2XXI A;  4OFO A;  3K1N A;  1S9T A;  4H6D A;  5FHO A;  3KN7 A;  2DWI A;  2GHB A;  3K1M A;  3RTW B;  1MQH A;  3GLB A;  1AL3 A;  1FBC A;  4P1E A;  4GXA A;  4O7M A;  4O3C A;  3KJT A;  1MH4 A;  2XHD A;  3SDF A;  3FD3 A;  5AA1 A;  3KC0 A;  3FV1 A;  1LAX A;  3KZG A;  4ZE9 A;  4F3G A;  2F8D A;  3M3K A;  4AB5 A;  1MY0 A;  4OAN A;  4U1O A;  2F34 A;  4EUO A;  1YZ0 A;  2H98 A;  4G8H A;  4U4S A;  4HE2 A;  4X04 A;  3OXN A;  2F36 A;  5L8D A;  1YCJ A;  1ZU0 A;  1B1X A;  3OO6 A;  2UVH A;  1KA1 A;  4FOR A;  4NHB A;  5ITO A;  4PFR A;  3B8B A;  1FQC A;  4PGP A;  5CBR A;  4LZ7 A;  1AOV A;  3KN3 A;  2I4C A;  2XWV A;  4DXB A;  4GX4 A;  2A5T B;  3MVY A;  4PFW A;  3DP8 A;  1UTH B;  3Q25 A;  4RPN A;  4OZ9 A;  3IB2 A;  3IFA A;  3VLW A;  1NV0 A;  2V3T A;  4R75 A;  4R9G A;  3FXU A;  3O9P A;  1A8F A;  1MS7 A;  2UYE A;  4JDF A;  3V8X B;  2DVZ A;  4FE8 A;  3UA8 A;  2XXP A;  3TAJ A;  1EU8 A;  3KN8 A;  4K3F A;  3IL1 B;  4AB6 A;  2H4I A;  2I0B A;  4PE5 B;  1FW0 A;  5IZ3 A;  1NV3 A;  3VE1 B;  3USD A;  1MDP 1;  3LC8 A;  1FPF A;  1WOD A;  2VGQ A;  2FHY A;  4PFB A;  4YKP A;  1QVS A;  4OVQ A;  4DI4 B;  5I57 A;  1B3F A;  5CMM A;  1MY1 A;  1JEV A;  2KR0 A;  4ZEI A;  4RNS A;  5EHS A;  4FJP A;  4PF6 A;  4IO6 A;  4PBH A;  4BDO A;  1QUJ A;  2W7Y A;  4UAC A;  1IXC A;  4R6K A;  4THI A;  1TFA A;  2ZZW A;  3B6T A;  4LAT A;  1MXV A;  4ZDM A;  1MQG A;  5DVF A;  5I2N A;  3B7D A;  1SI1 A;  2Z8E A;  4U2R A;  4YB6 A;  3B50 A;  5DEX A;  3VVD A;  2VPN A;  1K9Z A;  3O6H A;  3G7W A;  4H67 A;  1NUW A;  1G0H A;  3SEV A;  2REG A;  2QS1 A;  1JQF A;  2X7P A;  3PGF A;  1PB7 A;  3H3G A;  1FPL A;  2XXH A;  3VVF A;  3MP1 A;  2YJP A;  4RK9 A;  4F3P A;  1RYO A;  3CI8 A;  3G3J A;  2THI A;  4N8G A;  2UVI A;  3RPL A;  1SW2 A;  3ONM A;  1TXF A;  3JV9 A;  3HHF A;  4F3S A;  1MQD A;  3DP6 A;  4PGN A;  1VDW A;  2WBB A;  1QUK A;  2NUV A;  1B0L A;  2GFE A;  5TP9 A;  4NWC A;  3T9H B;  2A5S A;  2QMX A;  2FIX A;  3K00 A;  5CC2 A;  2OCU A;  1R1N A;  3T96 B;  4JVC A;  2BJJ X;  4JVI A;  1N7X A;  2HZK A;  2V3Q A;  1CNQ A;  1SYH A;  1H44 A;  3S9E A;  3LSF B;  3TTL A;  5AA2 D;  3RT8 A;  2XXV A;  2F6P A;  1IXG A;  1I6B A;  3T1B A;  4F1U A;  5F24 A;  4HE0 A;  3D1R A;  1ATG A;  3CRB A;  4P9K A;  3BFU A;  3PPR A;  3CG3 A;  4GF8 A;  3T0J A;  5IM2 A;  2WBD A;  2ZYN A;  3LV0 A;  1Y20 A;  2RC9 A;  1NL5 A;  3IJX B;  5T3J A;  1A40 A;  5KDT A;  2PCR A;  5H8N A;  3KSX A;  5I7I A;  3O2A A;  2Q8J A;  4JSD A;  5AA4 A;  4ZED A;  1DMB A;  4MMP A;  3QUF A;  1GGG A;  2HFB A;  1FQD A;  1KZ8 A;  1NNK A;  5H8F B;  1B7Z A;  2DWA A;  5EYH A;  4E0W A;  3CG1 A;  1US5 A;  4H8I A;  1TFD A;  2Y7P A;  2DS9 A;  2V84 A;  4Z0I A;  2GQ1 A;  1VFE A;  3KFM A;  4G8N A;  3EQ1 A;  3MUQ A;  3K02 A;  2ZZX A;  5JEI A;  4XTC Q;  2Q9T A;  3SKP A;  2DSF A;  3U93 A;  4H65 A;  1MDQ A;  1FTK A;  2F7C A;  2Z23 A;  4QFP A;  2Q2A A;  3OSR A;  2ESN A;  4G68 B;  1LBV A;  1N76 A;  1SD3 A;  4NX1 A;  5IZ3 B;  1PB9 A;  4IO2 A;  4KCD A;  3QSL A;  2MKZ A;  3D4G A;  1LCT A;  3SEW A;  5DT6 A;  3RLF E;  4HS7 A;  3TTN A;  3LSL A;  3K6V A;  2WEF A;  4QSC A;  1ZMG A;  4ZEB A;  4WEP A;  3M3L A;  4GBV A;  2Y7K A;  5I56 A;  5EQA A;  4NMY A;  1JW5 A;  2O68 A;  4MF3 A;  2F7B A;  3C34 A;  1M5C A;  2XXR A;  1LST A;  1YYZ A;  3BKI B;  4LP2 B;  3C36 A;  2B4L A;  2H25 A;  2P2A A;  2Y7R A;  4MNI A;  3E79 A;  2RCA A;  4GIZ A;  1FCK A;  4O8M A;  4P1L A;  5H8H A;  1MXX A;  1PB8 A;  5HBC A;  1NV6 A;  4DXU A;  3G3G A;  4PAF A;  3W15 C;  4U23 A;  1LBZ A;  3U94 A;  3MP8 A;  3IAZ A;  2DXY A;  5H8S A;  5I2N B;  3TCH A;  1IME A;  2HHM A;  4OVR A;  4P11 A;  4IY5 A;  5DEX B;  3SEX A;  1A55 A;  5CRY A;  5TPA A;  1EZP A;  3FXB A;  1OIB A;  4OYV A;  4IO5 A;  1TT1 A;  3N94 A;  1LLS A;  4NE4 A;  2LAO A;  5KZT A;  1BP5 A;  1PC3 A;  4JXI A;  1YPN A;  1MXY A;  2Q89 A;  4ZEC A;  5JK4 A;  3LSX A;  4BDQ A;  3U72 A;  2PVU A;  1P1O A;  1Y3Q A;  1II5 A;  2V3U A;  4BDM A;  2XWI A;  3TEP A;  1CE2 A;  5I2K A;  4OEV A;  4MJO A;  2O6A A;  1PDA A;  5AA3 A;  4N81 A;  2Z22 A;  1NUY A;  2OK2 A;  1HSE A;  1NMU A;  4ZEK A;  3VXB A;  1P1Q A;  5EQ9 A;  5FBP A;  2HAV A;  3TQW A;  2I0C A;  3IOV A;  5TP9 B;  3U92 A;  4OET A;  5A5X B;  1H76 A;  4XKR A;  1D4N A;  2DWH A;  2DVC A;  3TKD A;  3PMV A;  3S9L C;  3EPE A;  1K9Y A;  5EQ7 A;  2PFZ A;  3TDJ A;  1D9V A;  4X48 A;  3IFC A;  4H46 A;  2XXW A;  2DYX A;  5ITP A;  5ET8 A;  2QS3 A;  1RDX A;  4O94 A;  5FHM A;  2QS2 A;  1NH7 A;  3OD7 A;  4EDP A;  3NOH A;  1M5F A;  1LFG A;  4R9F A;  3S4U A;  3FUZ A;  2XXY A;  5IKB A;  3FXQ A;  2O1L A;  4NAP A;  1FQB A;  3OEL A;  3MVZ A;  1LGB C;  1SPI A;  5KDT B;  1WVJ A;  5H8N B;  5B70 A;  1XOC A;  1XVX A;  1Y1Z A;  4F2O A;  2B65 A;  3VDF A;  5AA4 B;  4X1D A;  5J1D A;  1QUL A;  2PMS A;  4NF8 A;  1MH3 A;  3MZ9 A;  2CEY A;  2O7I A;  1FTO A;  3KSJ A;  4FEC A;  5M2V A;  3H03 A;  4G77 A;  5ISU A;  3K2D A;  4C1U A;  4XEQ A;  2QFL A;  4M4G A;  3G3F A;  4OVT A;  3EHS A;  3GBB A;  1NV2 A;  1NNF A;  4ZZA A;  1JW4 A;  3DEL B;  1B5H A;  4PDH A;  5FTI A;  3ZKL A;  4RPO A;  3IO4 A;  5EHM A;  3IB1 A;  3RY3 A;  3FVO A;  1B4Z A;  2CMO A;  4R6Y A;  3TPA A;  5FTH A;  3K4U A;  2XXK A;  2R8T A;  4QXD A;  1FRP A;  2OWS A;  3L6G A;  3IOU A;  2XXT A;  2VD3 A;  3N26 A;  4OVP A;  5AE4 A;  4TOZ A;  3MW0 A;  4LN5 A;  1B32 A;  2V4C A;  3PUX E;  3TZA A;  4OMB A;  3RNN A;  3OO7 A;  1Y3N A;  4N91 A;  5FHN A;  4JWO A;  3PMX A;  5HPQ A;  4PFY A;  4MFI A;  2GH9 A;  4N6D A;  3SET A;  1LFI A;  1O7T A;  4R2F A;  1P1U A;  4L17 A;  4QBA A;  4BDR A;  1FPB A;  1KA0 A;  4TQU Q;  4KD5 A;  3KOS A;  2CZI A;  2E0S A;  1FTA A;  1B1H A;  3FJG A;  3PV0 E;  4N6K A;  4QFN A;  5H8H B;  1I69 A;  2DE2 A;  2PX1 A;  3LUY A;  5F1Q A;  4GRK A;  2QVU A;  2F3D A;  3LBS A;  3CFZ A;  3ZKK A;  3FJM A;  1S50 A;  1CB6 A;  4LA9 A;  4ZS9 A;  5TPA B;  2WYK A;  4XFE A;  1Y1M A;  3KG2 A;  3UOR A;  4NF4 B;  5ET7 A;  1IMA A;  3PD9 A;  4GX3 A;  2R9J A;  5HM4 B;  4R73 A;  3IOR A;  5A5L A;  3EHT A;  4OER A;  4OFL A;  1D9Q A;  2BJI A;  4X8R A;  5I59 A;  3IJO B;  4OEN A;  2XD3 A;  3EN3 A;  4P0G A;  4MNP A;  4NG7 A;  4MLV A;  5I2K B;  4G68 C;  1A8E A;  3QAX A;  2VPO A;  5H8Q A;  1NKX A;  1DPP A;  3TCF A;  1FBP A;  3TUS A;  4HTG A;  4QHQ A;  1IMC A;  2QMW A;  4IGT A;  2F78 A;  4OVS A;  4ZZE A;  3E13 X;  1ZJL A;  2DE3 A;  5LTC A;  1URG A;  1FBD A;  4AQ4 A;  3E78 A;  1IMD A;  2VD2 A;  1IUD A;  5AA2 B;  4GQO A;  1VSO A;  3MZ1 A;  1R9Q A;  2V25 A;  4EQ9 A;  5CMK A;  1PBP A;  2Y5K A;  4KCC A;  3A3U A;  2XXU A;  4F29 A;  4QSE A;  3QXM A;  3ILT B;  4FAT A;  4N15 A;  3SEU A;  2P0S A;  1IXH A;  4DIG A;  2ZNS A;  4KYD A;  3R6U A;  5IGA A;  3C33 A;  1DK4 A;  2FIE A;  4QFL A;  1Y4T A;  4F31 B;  3TTK A;  3MVX A;  3F11 A;  2YLN A;  3K1P A;  2PT1 A;  5BUU A;  1ZIU A;  2HXR A;  1R9L A;  5I84 A;  5TU0 A;  2RC8 A;  3C35 A;  1N3X A;  4DXC A;  2OWT A;  1MXZ A;  4LQ2 A;  2Q2C A;  2PYY A;  2WYP A;  1EZ9 A;  1H43 A;  4MCO A;  3QUJ A;  1D3K A;  4EF2 A;  4FED A;  2I58 A;  1NV4 A;  2Q88 A;  3QMF A;  1OLC A;  4NF0 A;  1FJ9 A;  3A09 A;  3TTM A;  1XVY A;  4KFQ A;  4DCX A;  4MHF A;  3RT6 B;  3IB0 A;  4GWS A;  4PFI A;  2OZZ A;  3T9U A;  1PBQ A;  4G8M A;  2ZXT A;  1AMF A;  2O7U A;  2HQ0 A;  2FA7 A;  1URD A;  4O7I A;  4GVO A;  4MNC A;  5F7V A;  3PUZ E;  1FTL A;  4ELR A;  3HPI A;  3H7M A;  1DPE A;  5IZ1 A;  1F9B A;  4ELP A;  4I9D A;  4KYE A;  4NF6 A;  3R7X A;  3T9V A;  4NTL A;  3K0V A;  4WKM A;  1M5B A;  1SBP A;  1UTB A;  4E0X A;  4X1B A;  1AH5 A;  1M5D A;  5ET5 A;  3CHG A;  3OEN A;  3MZB A;  4O3A A;  2CZH A;  2R71 A;  4KPT A;  4LVQ A;  2DDK A;  1B6H A;  3ECR A;  4NGU A;  1RKM A;  1MY3 A;  4LZ8 A;  1OMP A;  4MLQ A;  2RC7 A;  3LUZ A;  3RN8 A;  4KI0 E;  4NED A;  1LBC A;  4WXJ A;  3FAT A;  5EYG A;  1FTJ A;  1FPK A;  3MC2 A;  4MX6 A;  4DLD A;  3C32 A;  3W9W A;  3PPO A;  1FPG A;  3I5O A;  4GFR A;  1OVT A;  2ZNT A;  2ZZV A;  2P3N A;  2WX9 A;  4UAB A;  3O6I A;  1JW1 A;  5CMC A;  4FAJ A;  3PUY E;  4C0R A;  1D9Y A;  3C31 A;  2CZK A;  3K6X A;  1NV1 A;  4OHN A;  1FSA A;  3EKI A;  4YIC A;  1MXU A;  5JTY A;  3KOT A;  4Q30 B;  4EXK A;  4KXP A;  2E1S A;  3P7I A;  3Q29 A;  3PUV E;  4H45 A;  1EYK A;  4IO7 A;  1B2H A;  1IMB A;  3K01 A;  2KQZ A;  5ESY A;  1N7W A;  5I5P A;  1AIV A;  4JB7 A;  4N13 A;  1LBX A;  1T0K A;  5I59 B;  2F5X A;  3W9V A;  1FPJ A;  3O6G A;  2QS4 A;  3H6T A;  2HZL A;  2O69 A;  3PD8 A;  2RIN A;  2KLF A;  2ZYO A;  1QJM A;  1IIT A;  1ANF A;  4JWY A;  1XC1 A;  5H8Q B;  3PUW E;  5I57 B;  4N8Y A;  1I6A A;  3H6V A;  1H45 A;  1B52 A;  4OXV A;  1ZLQ A;  3FV2 A;  2GRV A;  2UVJ A;  3K6U A;  1NNT A;  4P56 A;  3UN6 A;  1LAG E;  2DWJ A;  1Q35 A;  3CFX A;  3O97 A;  4RK2 A;  2HEU A;  1HSJ A;  4YB5 A;  1UQW A;  1HSL A;  4Z7E A;  1A7L A;  4ZE8 A;  4HE1 A;  4OA4 A;  3I3V A;  3FVK A;  1UTH A;  4YB7 A;  3M8U A;  3MAM A;  1MQI A;  2OX3 A;  3KEI A;  4I1D A;  1BIY A;  3QYT A;  1GR2 A;  1ZBM A;  3ILU B;  3O29 A;  3N6U A;  4GBW A;  4RJZ A;  1SW1 A;  2I49 A;  1B5J A;  4ONY A;  4OWD A;  3OSQ A;  2V93 A;  4IO3 A;  2XA5 A;  3RPW A;  5K2X A;  3KJ7 A;  4DE8 A;  2PT2 A;  1Q1K A;  3RPL B;  3GYY A;  3FXR A;  2NWJ A;  1Y4C A;  2H9B A;  1N3W A;  4N07 A;  4IGR A;  1LCF A;  3BIG A;  1QGX A;  3ODB A;  1POT A;  4OES A;  3K6W A;  2QVV A;  4H0W A;  2YPN A;  1AWB A;  4Q0C A;  5ET6 A;  1DCU A;  3VLV A;  1VFD A;  2O51 A;  3HST A;  2I3W A;  2NVU B;  4FEB A;  3A29 A;  2ZNU A;  1BLF A;  2P3V A;  4LQ5 A;  4M1V A;  1FJ6 A;  4BDL A;  1UIU A;  3THI A;  1UTB B;  1NI9 A;  2D3I A;  3EF7 A;  2UYF A;  5IAI A;  4PP0 A;  2B3B A;  3D4C A;  3IO6 A;  4H8J A;  4RY1 A;  5B7D A;  5L9O A;  5LOM A;  3ZSF A;  1FBG A;  4O3B A;  3T9X B;  4QFK A;  1FQE A;  1BTJ A;  1NV5 A;  2I48 A;  2D21 A;  1XHY A;  3KGC A;  4YKI A;  3T93 B;  2GHA A;  3WAE A;  4OFJ A;  1LAH E;  3C9H A;  2G29 A;  4NF5 A;  3M3F A;  2REJ A;  3TQL A;  4TLM B;  3VLU A;  5ICQ A;  2XXX A;  2IA4 A;  4EQB A;  3U1O A;  2NOO A;  2ONR A;  4EF1 A;  2OJT A;  1B3L A;  4AS5 A;  1ZTY A;  3HCQ A;  3FJ7 A;  2HAU A;  3RGY A;  4MIJ A;  1EYI A;  3OEK A;  3MPK A;  1G0I A;  2Y84 A;  4GD5 A;  5JTY B;  1B3E A;  4R72 A;  2XWO A;  4FIM A;  3MPL A;  2HPG A;  1B0H A;  1MY4 A;  3OO8 A;  4OVJ A;  4YU0 A;  4QSD A;  1OQG A;  2DE4 A;  3PMW A;  2QPQ A;  2DP8 A;  2VHA A;  5EQ8 A;  1Y9U A;  4Q8R A;  4RXL A;  2OWZ A;  4ELQ A;  3FZV A;  4GWX A;  5CM6 A;  2VOZ A;  1P1N A;  2XX9 A;  3H6U A;  4ECF A;  4EQ7 A;  4I40 A;  2ABH A;  5I56 B;  1N0T A;  3TYH A;  3UK4 A;  1OVB A;  3KBZ A;  2ZMB A;  1XS5 A;  2I4B A;  3ISP A;  3VV5 A;  3OOA A;  3O28 A;  3LR1 A;  1SDX A;  2FNC A;  1R6Z A;  4F2Q A;  5H8F A;  5KCJ A;  3IR1 A;  1B7U A;  1EYJ A;  2ZYM A;  1DTZ A;  4ELO A;  1TWY A;  1VR5 A;  3B6Q A;  4C1T A;  4IY6 A;  1MM6 A;  2RKM A;  1MPD A;  2Z8F A;  4JWX A;  4GOT A;  2OLB A;  2L5V A;  2Z8D A;  3MWB A;  3G3H A;  3O66 A;  2JJK A;  4GLI A;  4HCW A;  1A99 A;  3V89 B;  3E9X A;  1INP A;  1VE4 A;  1N04 A;  3BIH A;  3GXA A;  1MPC A;  5L9S A;  4G4P A;  4PE3 A;  3JYR A;  3FVN A;  2M8C A;  4GX6 A;  2XX8 A;  4G68 A;  1QKA A;  1FBF A;  5EYF A;  2FBP A;  3VXC A;  4GL0 A;  1RDY A;  1LB9 A;  4F3B A;  3FVG A;  2NXO A;  1LBY A;  3MVW A;  5DVJ A;  3FIR A;  3U8Q A;  4PCD A;  2RF1 A;  5I58 A;  1B9J A;  2H5Y A;  2XD2 A;  4KR5 A;  2HCA A;  3S9N C;  4ISU A;  3Q26 A;  4OQO A;  3MBP A;  5I3S A;  4F39 A;  1B05 A;  4LZ5 A;  4YKK A;  1Y3P A;  5IZZ A;  4Q5T A;  4U21 A;  2VT5 A;  1MXW A;  2PFY A;  4LUB A;  1IEJ A;  2AL4 A;  3BFT A;  3Q28 A;  1L5T A;  1H3D A;  4U1Z A;  3PU5 A;  4ZEF A;  2I3V A;  2QVR A;  2I6E A;  1A54 A;  2QL3 A;  3DLN A;  4R6H A;  1DOT A;  3V5A A;  1NFT A;  4P3L A;  3BBR A;  3PPN A;  3ROJ A;  1XT8 A;  4XXU A;  4PDD A;  4YKJ A;  1DBZ A;  3DM0 A;  4N4U A;  3V83 A;  4RA1 A;  3SEY A;  4KHZ E;  1OQH A;  3ZS6 A;  3SZP A;  2Q8M A;  1NUZ A;  4N17 A;  3IK6 B;  1IQ7 A;  1EZO A;  1B3G A;  1JET A;  1USY H;  2CZL A;  1DTG A;  2P1S A;  4MBP A;  1OLA A;  4NF8 B;  4NF5 B;  1MPB A;  1FQA A;  1LFH A;  3GZG A;  1GV8 A;  3TEL A;  2F35 A;  2H99 A;  1IIW A;  1B5I A;  4POX A;  3UIF A;  3S9M C;  3E4R A;  4F1V A;  5BWJ A;  4DZ1 A;  4N6P A;  4PET A;  4GWU A;  3IOT A;  3KC1 A;  3JZJ A;  4PAI A;  5A5X A;  1YXI A;  1NV7 A;  2QJE A;  5DVI A;  1P99 A;  2B4M A;  4P47 A;  3OEM A;  3FGS A;  4G61 A;  1B3H A;  1FPD A;  4OTE A;  4GWZ A;  2QSX A;  3LSW A;  4XF5 A;  1QW0 A;  4AS4 A;  4F1Y A;  4IR8 A;  3HHG A;  4QFO A;  3T22 A;  3H06 B;  2UVG A;  4JVD A;  4XIG Q;  4DDD A;  4MEV A;  1FPI A;  5ELV A;  4NWD A;  2AYS A;  4LON B;  1IMF A;  1YTV A;  4PC9 A;  3CFL A;  2OBG A;  2Y7I A;  3CIJ A;  4JSO A;  5J16 A;  5CMB A;  2Q74 A;  3N5L A;  3UGW A;  4I8C A;  2XX7 A;  1Z7M E;  1O64 A;  3U65 A;  4OEU A;  3AXF A;  2AL5 A;  2F6G A;  4I3E A;  2HXW A;  1FQF A;  4POW A;  2ANJ A;  3H6W A;  5KCJ B;  4NN3 A;  2F3B A;  2VP1 A;  1B40 A;  4JBZ A;  1B7H A;  4TLL B;  1B58 A;  4XKQ A;  5DTB A;  1JNF A;  4PFT A;  1URS A;  4YMA A;  3CSG A;  1MG1 A;  4GXS B;  1SYI A;  3HFU A;  2WKY A;  4HCY A;  1FBH A;  3FAS A;  1Q9D A;  2B3F A;  4F22 A;  3CVG A;  3SER A;  4P8B A;  3QK6 A;  1LB8 A;  4GWY A;  1EH3 A;  2X26 A;  3MP6 A;  4XKN A;  3T66 A;  1DSN A;  3TMG A;  2ALU A;  1Z7N E;  1I6Q A;  1ZKB A;  4MH5 A;  1MQJ A;  3MST A;  2DQV A;  1QKB A;  1NNP A;  4EXL A;  1M5E A;  3G3K A;  3CR9 A;  4PTK A;  5DYH A;  4IO4 A;  1PEB A;  4R74 A;  5ICT A;  5I58 B;  4DCY A;  1B51 A;  4KYS A;  2O84 X;  4DI3 D;  1J1N A;  3I6V A;  4H5G A;  4BDN A;  1JP4 A;  1N84 A;  1B46 A;  3B6W A;  1RYX A;  4ESX A;  1NUX A;  1O63 A;  2FVZ A;  2D5W A;  5CI5 A;  1WDN A;  4H5F A;  3E3K A;  3OO9 A;  3HO7 A;  3OMB A;  2A5T A;  3MYU A;  1FTM A;  4QF9 A;  2F7A A;  4WED A;  2IEE A;  3Q27 A;  4FBP A;  4P0I A;  1FPE A;  2X7Q A;  1SW5 A;  4GWW A;  2CEX A;  1LAF E;  2G93 A;  3G3I A;  1LBW A;  4RYA A;  1USY E;  4HXV A;  3QIM A;  2PBW A;  3RQT A;  2O1M A;  4U22 A;  4NF4 A;  1S7Y A;  1SI0 A;  3DP4 A;  3R26 A;  1RDZ A;  1QUI A;  2Y7W A;  4GL8 A;  1JEU A;  4UA8 A;  2XWK A;  1KWH A;  3C4M A;  1B4H A;  2RCB A; 
#chains in the Genus database with same CATH homology
 5EYH A;  2OWZ A;  4N15 A;  4GWX A;  4PF8 A;  5CM6 A;  5IGA A;  1DK4 A;  2FIE A;  2GQ1 A;  4I40 A;  4X9T A;  3RYD A;  2HXR A;  4NQ8 A;  3KBZ A;  2ZZX A;  4MAG A;  2Q9T A;  2WYP A;  3ISP A;  4MCO A;  1FBE A;  4YZZ A;  4NX1 A;  1LBV A;  2Y5L A;  5IZ3 B;  1NV4 A;  2MKZ A;  3QMF A;  1XI6 A;  4NF0 A;  1FJ9 A;  1EYJ A;  4F18 A;  4MHF A;  5DW8 A;  4GWS A;  4PFI A;  2WEF A;  4PBQ A;  2L5V A;  1BK4 A;  1LEV A;  4GBV A;  4F19 A;  4O7I A;  4PAK A;  2JJK A;  5EQA A;  4MNC A;  4HCW A;  4I3Y A;  1YYZ A;  1INP A;  3FBP A;  5IZ1 A;  3BIH A;  2B4L A;  4MNI A;  3E79 A;  3PTY A;  4O8M A;  4P1L A;  4PE3 A;  1NV6 A;  4GX6 A;  4PAF A;  1LBZ A;  5ET5 A;  3CHG A;  1FBF A;  2FBP A;  1RDY A;  1IME A;  1LBY A;  2HHM A;  4OVR A;  2CZH A;  4PCD A;  2DDK A;  3FXB A;  4NGU A;  5LDZ A;  3LUZ A;  5I3S A;  5JK4 A;  5EYG A;  1FPK A;  5IZZ A;  4MX6 A;  3W9W A;  4P1E A;  1FBC A;  4O7M A;  1FPG A;  2ZZV A;  2P3N A;  2XWI A;  2VT5 A;  2PFY A;  2WX9 A;  4UAB A;  2QVR A;  3KC0 A;  4MJO A;  4N81 A;  4OAN A;  1NUY A;  2CZK A;  1NV1 A;  1FSA A;  4P3L A;  3EKI A;  5EQ9 A;  1YZ0 A;  4YIC A;  3ROJ A;  5FBP A;  4HE2 A;  4X04 A;  4PDD A;  1DBZ A;  4KXP A;  4N4U A;  3SZP A;  4H45 A;  1EYK A;  2Q8M A;  1KA1 A;  4NHB A;  1NUZ A;  1IMB A;  4PFR A;  3B8B A;  4N17 A;  2KQZ A;  4PGP A;  5ESY A;  5I5P A;  1K9Y A;  1LBX A;  5EQ7 A;  2PFZ A;  2XWV A;  3IFC A;  4H46 A;  4GX4 A;  2F5X A;  3W9V A;  1FPJ A;  5ET8 A;  2HZL A;  1RDX A;  4O94 A;  4F1V A;  4PET A;  3IFA A;  3NOH A;  4N8Y A;  1NV0 A;  4GWU A;  3KC1 A;  4PAI A;  1YXI A;  1NV7 A;  4NAP A;  2B4M A;  4P47 A;  1SPI A;  2DVZ A;  4P56 A;  4G61 A;  1FPD A;  4GWZ A;  5IZ3 A;  5J1D A;  4XF5 A;  1NV3 A;  4AS4 A;  2CEY A;  4IR8 A;  1FPF A;  4HE1 A;  4OA4 A;  4PFB A;  2FHY A;  4JVD A;  4XEQ A;  2QFL A;  4MEV A;  1FPI A;  4OVQ A;  2OX3 A;  4OVT A;  1IMF A;  4DI4 B;  1NV2 A;  2KR0 A;  4PF6 A;  4PC9 A;  4PBH A;  4GBW A;  4PDH A;  5J16 A;  2Q74 A;  2XA5 A;  2ZZW A;  3U65 A;  4I3E A;  2XXK A;  3RPL B;  2R8T A;  1FRP A;  4QXD A;  3GYY A;  4OVP A;  4NN3 A;  2F3B A;  3B50 A;  2VPN A;  4LN5 A;  2V4C A;  1K9Z A;  3BIG A;  1QGX A;  1NUW A;  4N91 A;  1G0H A;  2QVV A;  1AWB A;  4N6D A;  5ET6 A;  3HFU A;  1FPL A;  1DCU A;  4QBA A;  4HCY A;  1FBH A;  1FPB A;  1Q9D A;  1KA0 A;  4P8B A;  4GWY A;  2CZI A;  3A29 A;  2P3V A;  1FTA A;  4M1V A;  4N6K A;  4N8G A;  1FJ6 A;  3RPL A;  1NI9 A;  3MST A;  2DE2 A;  2QVU A;  2F3D A;  4PTK A;  1VDW A;  4PGN A;  1FBG A;  2WBB A;  1NV5 A;  2WYK A;  4XFE A;  5ET7 A;  2FIX A;  1IMA A;  4DI3 D;  4GX3 A;  4JVC A;  4JVI A;  2HZK A;  2V3Q A;  1JP4 A;  1CNQ A;  5A5L A;  1NUX A;  2FVZ A;  1D9Q A;  2BJI A;  4X8R A;  3MYU A;  3T1B A;  4F1U A;  5F24 A;  4HE0 A;  4MNP A;  3D1R A;  4NG7 A;  4P9K A;  4FBP A;  4AS5 A;  1FPE A;  4GWW A;  2CEX A;  2VPO A;  1FBP A;  4MIJ A;  1EYI A;  1LBW A;  3T0J A;  5IM2 A;  2WBD A;  1G0I A;  4HXV A;  1IMC A;  3LV0 A;  4OVS A;  2DE3 A;  5LTC A;  5T3J A;  2XWO A;  1FBD A;  2PCR A;  2HPG A;  1RDZ A;  5I7I A;  3E78 A;  1IMD A;  2DE4 A;  2QPQ A;  4MMP A;  2XWK A;  2Y5K A;  1KZ8 A;  5EQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...