5AA3A

Crystal structure of mltf from pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
417
structure length
417
Chain Sequence
GVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 138
structure length 417
sequence length 417
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa3A02
4OFOA 4Q5TA 3FVNA 5H8HB 1URSA 1LGBC 3MQ9A 5I56B 3C33A 4G8MA 3FVOA 4BLAA 2RC8A 5A5XB 1MM7A 3MP1A 1B3EA 4M4GA 3ZSFA 3EF7A 2Y7WA 1TFAA 4O3AA 4XXUA 2GHAA 4F18A 1QJMA 2B3FA 1XOCA 5L9MA 3DELB 2XXTA 1B1HA 3PD9A 2GHBA 1H43A 3IJXB 5I58B 1P99A 4E0WA 5ISUA 3N5LA 3RT8A 1MH4A 4DCXA 1URDA 5BUUA 3C9HA 2XX8A 1B0HA 3ECRA 3H6WA 2DP8A 2H5YA 4HCYA 1B52A 5TU0A 2RCBA 3FJGA 2OBGA 1PEBA 4OWDA 2RINA 5I57A 2VD3A 3IX1A 2RKMA 2O68A 3OOAA 5CMKA 3TCHA 1B7UA 4NMYA 3TTMA 3C31A 4C0RA 1B7ZA 4H6DA 1LCTA 3OSQA 3PV0E 4NWCA 3LUYA 4XKQA 1AH5A 1GGGA 2HAVA 3TAJA 4G8HA 3KJ7A 4IB2A 2V3UA 3EQ1A 3T22A 2YPNA 2DXYA 3G3KA 4ELQA 4GL8A 1JW1A 3KOSA 4I1DA 5I2NB 5IAIA 1HSJA 3IO4A 2QS1A 4EF2A 1UTHA 1M5EA 2Z8DA 3MAMA 5L8DA 2A5TB 3P7IA 3PMVA 1KWHA 4ELOA 3KSXA 5B7DA 1MDP1 1MXUA 4WKMA 2ZYOA 3PUVE 1MH3A 1VFEA 3PPNA 5TP9A 5ICQA 4QF9A 4U1ZA 3PUXE 1MQGA 1DPPA 4P0IA 4X1DA 3RUMA 1YCJA 3FD3A 4YB5A 2E0SA 1MRPA 3TODA 2DWJA 3PMWA 1OLCA 3K4UA 1LBBA 2Z8FA 4NF5A 5AA3A 3C35A 4OXVA 1PC3A 3MVZA 3KOTA 3O97A 2I0BA 2ONKE 4YKJA 5CRYA 2NXOA 1JQFA 2ZNTA 4ISUA 4NWDA 3K1PA 1SI1A 4KR5A 4RK2A 4ZEBA 1FCKA 2NWJA 2XXQA 3KSJA 1MDQA 4IY5A 1B46A 1Y3PA 1WVJA 5JK4A 4NF6B 2Z22A 2OLBA 4O3BA 3OO9A 1UIVA 4U2RA 5H8FA 3IK6B 4NTLA 2DWIA 1FTOA 3LC8A 4GWOA 5AA1A 5HPQA 1B40A 4FATA 4MLVA 1QVSA 3SDFA 3L6GA 4LUBA 3K01A 3FUZA 3E4RA 2THIA 1DSNA 3MZ9A 3E3KA 4DE8A 4OFLA 3EPEA 3K2DA 2FA7A 3VFJA 1QULA 4U22A 2Y84A 3E13X 5CMCA 4LA9A 1OVTA 3KN3A 1MQJA 2X7QA 3CSBA 1NNTA 2FYIA 4HW8A 2H25A 2F6GA 4QSCA 1PB8A 1XHYA 3LR1A 3N26A 4ZE8A 5K2YA 2F78A 2QL3A 3EN3A 4H8IA 3MJNA 4POXA 4HTGA 4OZ9A 4ZEIA 2QS2A 5AA4B 4ESWA 3TCFA 1GVCA 5CBRA 3IOVA 3MC2A 1DOTA 1FTKA 3W15C 1M5BA 4PFTA 1Z7NE 4F3BA 3CVGA 1CB6A 1VE4A 3GBBA 4PP0A 5DTBA 3QYTA 5KDTA 4F19A 4ZEKA 3EHTA 4F3GA 2XX9A 3RTWB 2HEUA 2DOJA 1MY0A 3B6QA 1B9JA 3DLNA 3QIMA 4ND9A 1JW5A 3R6UA 4XKRA 4G8NA 3IL1B 5H8QA 2GFEA 3MVYA 3H6UA 3QK6A 1PB7A 4KI0E 4TLLB 3HN0A 3G7WA 3HSTA 5DEXA 1NL5A 3BFTA 1SQYA 5J1DA 1EZOA 4IO6A 1POTA 5H8NB 1D9YA 3FJ7A 1SVXB 1B32A 2R6GE 2QMWA 3MWBA 4YU0A 4LONB 1I6AA 2B65A 1QUIA 4F29A 1JEUA 4K3FA 3SEVA 2I3WA 3SKPA 3V8XB 3UA8A 2O6AA 2F36A 1H3DA 1XC1A 1IEJA 3PPQA 3RQTA 4Q30B 1YTVA 3IORA 1Y4TA 4YMAA 4GRKA 2AYSA 1AMFA 2YLNA 1OQGA 2WKYA 1MXWA 4OFJA 3LSLA 1R6ZA 1NNKA 5H8HA 5FHOA 1FTJA 3I3VA 1XT8A 2UVHA 1NH7A 2D3IA 1ATGA 4GF8A 3OELA 5A5XA 4H1XA 2Q2AA 3K6WA 3ONMA 4EXLA 5BWJA 1MXXA 1B6HA 3TTKA 3FVGA 1QUKA 3RTFB 2UYEA 1IITA 4PQJA 4PFUA 3Q29A 1OIBA 2DE3A 3BFUA 1ZIUA 4PFWA 1POY1 3D4GA 1URGA 1FQDA 3TMGA 3H3GA 2VP1A 1B5IA 1MXVA 4DIGA 5ITOA 1MY4A 3H4ZA 4PE5B 5LOMA 3OXNA 4QFLA 3JZJA 3O6GA 5KCJB 3TTLA 3FASA 4F1YA 4NF8B 3GZGA 1ANFA 3VDFA 2Q9TA 1UTBB 2V93A 2F6PA 4RXLA 4YMBA 1O64A 3KEIA 3PMXA 4R75A 2B3BA 1DTZA 1UIUA 5HBCA 1A7LA 2HCAA 3S9NC 3KJTA 4P11A 5I2KB 3HV1A 1B3FA 3FIRA 2CZLA 3TELA 1II5A 5EHSA 4EF1A 3IOTA 3UK4A 2DWHA 4ONYA 3B6TA 3O28A 4R6YA 4RPNA 3TTRA 3TDJA 1N7WA 1IXGA 1MQIA 4JWXA 1B2HA 4RY1A 1ZU0A 1Y3NA 4JBZA 1DMBA 1B3HA 1N84A 2F97A 2O1MA 2DS9A 4ZS9A 2A5TA 5CMMA 3MZBA 2PVUA 2RC7A 1OLAA 3MW0A 3SEYA 4R72A 1B0LA 1A40A 1SDXA 5CI5A 2X26A 4GLIA 3ZKLA 5AA2B 3VLUA 3IB2A 1USYE 3OO8A 2XXIA 4Z7EA 1YPNA 4UACA 3W9VA 3SESA 4DXCA 3ILUB 1Y1MA 4G4PA 3VVDA 4P0GA 1QW0A 1S9TA 3A3UA 2NUVA 1N3XA 2DWAA 1IXCA 4YKKA 4XKNA 3CRBA 1QKBA 3B7DA 4IO7A 3FXRA 4BDLA 4PETA 3S4UA 3T66A 1M5FA 1RYXA 5I59B 4RJZA 4IGRA 2I58A 3MZ1A 1FQFA 1QUJA 5DVFA 3VLWA 4ZEFA 4OENA 1D4NA 2I48A 1P1QA 3N6UA 5HM4B 1R1NA 4H65A 4GL0A 2FNCA 5I57B 1N04A 2ESNA 2V3QA 2ZYNA 1B4HA 3H06B 2PYYA 2F5XA 3T9HB 5FTHA 4NF6A 4ESXA 3IB0A 3VLVA 3JYRA 2HXWA 5JTYB 5F7VA 4ECFA 2NVUB 3U92A 1VSOA 2V25A 1LAFE 4IO4A 3H7MA 4LVQA 2AIXA 3K6VA 5FHMA 2Y7PA 3WAFA 1JNFA 1HSLA 1LSTA 2VGQA 4GXSB 1FQAA 2Z23A 3H6VA 2XX7A 2UXAA 3IOWA 2UVJA 4C1UA 2QJEA 1LFGA 4IO5A 4G68A 4MFIA 3S2VA 4F31B 1QKAA 5JEIA 1Y20A 2O7IA 3G3GA 1P1NA 3VXCA 1AOVA 2F7CA 1DPEA 4R74A 1XVXA 1AIVA 2XD3A 4OEVA 5TP9B 4POWA 1SYIA 1SBPA 4ZDMA 3FV1A 5AA4A 3VE1B 2RC9A 2ZNUA 4TLMB 5ITPA 2HFBA 3K00A 3U94A 5L9OA 3K1NA 2X7PA 4ELRA 1B3GA 4N13A 1TWYA 4AB5A 4YB6A 3C32A 2I0CA 4GD5A 4F3PA 1R9QA 4X48A 1B1XA 3PU5A 4H8JA 3KG2A 2NOOA 3ZS6A 1XS5A 4RK9A 2IA4A 3KN7A 4R2BA 1LFHA 3S9EA 4BDRA 2QS4A 4F2QA 5CM6A 3UGWA 2O7UA 3MUQA 4KFQA 1MY1A 4NF4B 3PPPA 2P2AA 1B3LA 1WDNA 2ABHA 4Q0CA 2H98A 5CMBA 4IY6A 4Z0IA 1SW5A 3PGFA 3U93A 3CFLA 1Y9UA 1P1UA 4KYDA 2ZYMA 3KGCA 2O69A 2GRVA 3O9PA 1I69A 3K1MA 4R73A 2DQVA 3OMBA 2Q88A 1ZMGA 1NMUA 4WEDA 4LQ5A 2I4CA 3OENA 4DDDA 4E0XA 1N7XA 4KHZE 3TQWA 3G3JA 4XIGQ 4YZZA 3SEXA 4G68C 3GLBA 2XXUA 3RLFE 2PMSA 3TFLA 1NNFA 3BBRA 1EH3A 1JVXA 1ELJA 3V83A 3LSFB 1MPCA 2HAUA 4EDPA 4U23A 1BIYA 3VXBA 3M3FA 1B5HA 3LSXA 1A8EA 4BDOA 2O84X 4HCWA 3OO6A 2ZNSA 3V89B 4RYAA 2HQ0A 3G3HA 5TPAB 3O66A 1JEVA 1EZ9A 4M1VA 3SETA 1MY3A 3PUZE 1A99A 2Z8EA 3Q27A 2DE2A 2QMXA 3T9XB 1ZLQA 1IXIA 4N6PA 3WAEA 4X9TA 1RKMA 1B7HA 1EZPA 3OD7A 4QHQA 3ZKKA 5KCJA 4JSDA 2REGA 3R26A 3A09A 1D3KA 3I5OA 4U1OA 4BDQA 3DP8A 3EHSA 5EYFA 3IJOB 4GXAA 5I56A 2ONSA 3TKDA 4KYSA 2YJPA 3T96B 2XD2A 1LAXA 4FEBA 4LZ7A 1LAHE 1BKAA 4X1BA 4R2FA 4YB7A 4YKIA 1N3WA 2UVGA 4F1VA 1SW1A 3QUFA 5DEXB 1M5CA 2VHAA 1CE2A 5I2KA 1FQCA 2O1LA 1NNPA 3BKIB 3ILTB 4GFRA 3A3CA 5I58A 3B6WA 2O51A 4JSOA 4THIA 1A55A 4YKPA 4KCDA 3N94A 4H5FA 1PBQA 3CSGA 1MM6A 1TXFA 4DZ1A 1TFDA 1VFDA 1EU8A 1IIWA 3S9LC 1LAGE 3TEPA 3Q28A 3RNNA 3C4MA 1GR2A 3RN8A 3HO7A 4OEUA 3U8QA 5CC2A 4KCCA 3FVKA 4FECA 2I6EA 3R7XA 5AA2A 2XXYA 5AE4A 1LLSA 1N0TA 4GVOA 4YICA 2D21A 4U21A 4QSEA 3H03A 3F11A 4DXBA 3MVWA 3I6VA 3IB1A 2PBWA 3RT6B 2E1SA 2XXXA 4H5GA 5I2NA 1BTJA 2GH9A 1Q35A 5I59A 2OCUA 2UVIA 3PPRA 5CBSA 3N6TA 4EQBA 4JXIA 4LATA 3FV2A 4OHNA 4F22A 1HSEA 3T9UA 1S7YA 1WODA 1JVYA 2XXPA 4I9DA 1H45A 1LBCA 1I6QA 3HHGA 4BDNA 2ZMBA 1AL3A 2H99A 3W9WA 3OEKA 4BDMA 5FTIA 1IQ7A 2A5SA 1Y1ZA 2Q2CA 2QSXA 2G29A 5JTYA 2I3VA 3ODBA 4G2ZA 1DTGA 1PDAA 3K6UA 3E9XA 1A8FA 4H0WA 1FQBA 1T0KA 4QFOA 1P1OA 2F34A 4ELPA 3HCQA 1GTKA 2R9JA 3QAXA 1SD3A 4LP2B 2RF1A 5ELVA 1OVBA 3DP4A 3QSLA 1YAEA 3TYHA 3FZVA 3QUJA 5DVIA 1O7TA 4TQUQ 2XXRA 4XKPA 1B05A 1F9BA 2F35A 4UA8A 4EXKA 3IO6A 3O29A 2F8DA 4NE4A 4U4XA 4R6KA 3IR1A 3O2AA 4KD5A 1D9VA 2P0SA 5DYHA 4IO3A 1VR5A 4G77A 4U4SA 2ZXTA 3CFZA 3OO7A 4MF3A 2BJJX 2XXHA 4KQPA 1M5DA 3TUSA 3PUWE 4IGTA 2DE4A 4GQOA 3OSRA 2AL4A 3THIA 3K6XA 3KBRA 2DVCA 1ZJLA 3UORA 2ANJA 2PX1A 2RCAA 3EHUA 2H9BA 5B70A 3SEWA 4QFKA 4FIMA 2DXRA 2G93A 2I4BA 3FATA 2OK2A 2I49A 3AXFA 4H67A 1UTHB 1B5JA 2F7BA 4OESA 2VD2A 2OWSA 3SEUA 3VV5A 1JW4A 3K0VA 4DCYA 4RNSA 3RY3A 3C34A 2W7YA 3C36A 1PBPA 2XXVA 3PPOA 3MPKA 1PB9A 1I6BA 1SI0A 2Q8JA 4IO2A 3MBPA 1MQDA 1Z7ME 4O3CA 1SYHA 2AL5A 4JWOA 4ZZEA 3V5AA 3L6HA 4NEDA 1R9LA 4WEPA 1XVYA 4NF4A 5DVJA 4OMBA 1SW4A 5FHNA 1FTMA 5IKBA 1US4A 2HZLA 2VOZA 1ZBMA 4EQ9A 1O63A 2PT1A 4FE8A 3KZGA 4MLQA 4WXJA 4OYVA 4NF5B 1BP5A 1UQWA 3GXAA 4EUOA 1L5TA 2XHDA 3O6IA 1MPBA 1IZ1A 3Q26A 4MBPA 3CG1A 1OMPA 1MXZA 2KLFA 1NH8A 5KZTA 4OQOA 4G68B 1MPDA 2ZYKA 3TTNA 4OETA 4F1UA 4R9FA 2QS3A 2UYFA 3LSWA 3K02A 4F3SA 4ZEDA 3HHFA 2Y7KA 1OQHA 3G3IA 5H8FB 1SW2A 4LZ5A 4F39A 3DP6A 3HPIA 4KPTA 4QSDA 4C1TA 5F1QA 3MP8A 1JETA 5H8NA 1B51A 2V84A 1MG1A 1USYH 2PT2A 5TPAA 3FGSA 4JDFA 1Y4CA 4FEDA 3USDA 1ZKBA 2OJTA 2ALUA 1LB8A 3M3KA 3CI8A 2DSFA 3T93B 3T9VA 4AB6A 4ZZAA 3Q25A 4DLDA 4QRZA 1P1WA 1FQEA 3PUYE 4LQ2A 1US5A 1ZTYA 4ZE9A 3PD8A 1BLFA 3CIJA 1H44A 4EQ7A 4RA1A 3CFXA 3UIFA 1N76A 4QFNA 4TOZA 3U1OA 3RGYA 1LB9A 2Y7IA 4R9GA 3MP6A 3M8UA 2QPQA 2XXWA 3QXMA 1MQHA 1B58A 4HS7A 1MY2A 2H4IA 4DXUA 2P1SA 5M2VA 4GOTA 3TCGA 2OWTA 4R6HA 2LAOA 1MS7A 4I62A 4JWYA 3U72A 3UN6A 1LCFA 1A54A 4RPOA 2F7AA 4OERA 1S50A 1Q1KA 4YAHX 4QFPA 5KDTB 1FW0A 5AA2D 4XTCQ 1TT1A 3TPAA 1NFTA 3GBAA 4OVJA 4GIZA 3TZAA 3UP9A 2ONRA 2Y7RA 2DVZA 4JB7A 4NF8A 3RPWA 3FXUA 1UTBA 3DM0A 5H8QB 1IUDA 4PFYA 2DYXA 2R71A 5K2XA 2D5WA 3G3FA 4LZ8A 1RYOA 3KN8A 1Y3QA 4I8CA 3CG3A 3SERA 4ZECA 4KYEA 3VVEA 3CR9A 2M8CA 1LFIA 4L17A 2QRYA 2HZKA 4FORA 5H8SA 3JV9A 1NKXA 4MH5A 1GV8A 3O6HA 3TQLA 3FJMA 3LBSA 3IOUA 4OTEA 4N07A 4AQ4A 3IAZA 5L9SA 3FXQA 2IEEA 1IXHA 3MVXA 3MPLA 3M3LA 4FJPA 2CMOA 1FTLA 3KFMA 5EHMA 2REJA 3D4CA 2OZZA 2V3TA 5ICTA 3S9MC 3OEMA 2Q89A 5I84A 4F2OA 1B4ZA 1J1NA 5DT6A 4FAJA 1H76A 4Q8RA 3H6TA 3VVFA 1MXYA
chains in the Genus database with same CATH superfamily
4OFOA 4Q5TA 3FVNA 5H8HB 2CEXA 1URSA 4PDHA 1LGBC 3MQ9A 5I56B 3C33A 4G8MA 1NV4A 3FVOA 4BLAA 2RC8A 5A5XB 4MIJA 1DK4A 2HPGA 1MM7A 3MP1A 1B3EA 4M4GA 3ZSFA 3EF7A 2Y7WA 1FPDA 1NV5A 1TFAA 4O3AA 3T0JA 4XXUA 1RDYA 2GHAA 4F18A 1QJMA 4PDDA 5EYGA 2B3FA 1XOCA 5L9MA 3DELB 2XXTA 1B1HA 3PD9A 2GHBA 1H43A 3IJXB 5I58B 1P99A 4E0WA 5ISUA 1K9ZA 3N5LA 3RT8A 1MH4A 4DCXA 1URDA 5BUUA 3C9HA 2XX8A 1B0HA 2Q8MA 3ECRA 3E79A 3H6WA 2DP8A 2H5YA 1FPIA 4HCYA 4PE3A 1B52A 4N6KA 5TU0A 2RCBA 3FJGA 2OBGA 1PEBA 4OWDA 2RINA 5I7IA 5I57A 1FPJA 4IR8A 2VD3A 3IX1A 2RKMA 2O68A 3OOAA 5CMKA 3TCHA 1B7UA 4OVRA 4G61A 4NMYA 3TTMA 1IMDA 3C31A 4C0RA 1B7ZA 5EQ9A 4H6DA 1LCTA 3D1RA 3OSQA 3PV0E 4NWCA 3LUYA 4XKQA 1IMFA 4PBQA 1AH5A 1GGGA 2HAVA 3TAJA 4G8HA 3KJ7A 4IB2A 3ROJA 2V3UA 3EQ1A 3T22A 2YPNA 2DXYA 3G3KA 4ELQA 4GL8A 1JW1A 4UABA 3KOSA 4I1DA 5I2NB 5IAIA 4PFRA 1HSJA 3IO4A 2QS1A 4EF2A 1UTHA 1M5EA 2Z8DA 3MAMA 5L8DA 2A5TB 3P7IA 2ZZWA 3PMVA 2CEYA 4LN5A 2PFZA 2WX9A 2WYKA 1KWHA 5A5LA 4ELOA 3KSXA 5B7DA 1MDP1 1MXUA 4WKMA 2ZYOA 3PUVE 1MH3A 2ZZVA 1VFEA 3PPNA 5TP9A 5ICQA 4QF9A 3E78A 4U1ZA 3PUXE 4PFBA 1MQGA 1DPPA 4P0IA 4X1DA 3RUMA 1YCJA 4OVPA 3FD3A 4YB5A 2E0SA 1MRPA 3TODA 2DWJA 3PMWA 4HE0A 4N4UA 1OLCA 3K4UA 1LBBA 2Z8FA 4NF5A 1NV1A 5AA3A 3C35A 4OXVA 1PC3A 3IFAA 4GBWA 3MVZA 3KOTA 3O97A 2I0BA 2ONKE 4YKJA 5CRYA 2NXOA 1JQFA 2ZNTA 4ISUA 4NWDA 3K1PA 1SI1A 4KR5A 4RK2A 4ZEBA 1FCKA 2NWJA 5IZ3B 2XXQA 1FBFA 3KSJA 1MDQA 4IY5A 1B46A 1Y3PA 1WVJA 5JK4A 4NF6B 2Z22A 2OLBA 4O3BA 3T1BA 3OO9A 1UIVA 4U2RA 5H8FA 3IK6B 4NTLA 4KXPA 2DWIA 1FTOA 3LC8A 4GWOA 5AA1A 3GYYA 5HPQA 1B40A 4FATA 2ZZXA 4MLVA 1QVSA 3SDFA 3L6GA 4LUBA 3K01A 1NUYA 2XA5A 3FUZA 3E4RA 2THIA 1DSNA 3MZ9A 3E3KA 4DE8A 4OFLA 1LBXA 3EPEA 3K2DA 4OVQA 2FA7A 3VFJA 1QULA 4U22A 1FPLA 2Y84A 3E13X 5CMCA 4LA9A 1OVTA 2QVVA 3KN3A 1MQJA 2X7QA 4NGUA 2Q74A 3CSBA 1NNTA 2FYIA 4HW8A 2H25A 2F6GA 4QSCA 1PB8A 1XHYA 3LR1A 3N26A 4ZE8A 5K2YA 2F78A 3RYDA 2QL3A 3EN3A 4H8IA 3MJNA 4POXA 3QMFA 4HTGA 4OZ9A 1INPA 4ZEIA 2QS2A 5AA4B 2BJIA 4ESWA 3TCFA 1GVCA 5CBRA 3IOVA 3HFUA 3MC2A 1DOTA 1FTKA 3W15C 1SPIA 1FBGA 1M5BA 4PFTA 1Z7NE 4QXDA 4F3BA 3CVGA 1CB6A 1VE4A 3GBBA 4PP0A 5DTBA 3QYTA 5KDTA 4F19A 4ZEKA 2P3NA 3EHTA 4F3GA 4I40A 2XX9A 3RTWB 4GWWA 2HEUA 2DOJA 1MY0A 1IMEA 3B6QA 1B9JA 3DLNA 2CZKA 3QIMA 5IZ1A 4ND9A 1JW5A 3R6UA 4XKRA 1FPGA 4G8NA 3IL1B 5H8QA 2GFEA 3MVYA 3H6UA 4PFIA 3QK6A 1PB7A 4KI0E 4TLLB 4PC9A 3HN0A 3G7WA 2HXRA 2VT5A 3HSTA 5DEXA 4JVDA 1NL5A 3BFTA 4PGPA 1SQYA 5J1DA 1EZOA 4IO6A 1XI6A 1POTA 5H8NB 1D9YA 3FJ7A 2XWKA 1SVXB 1B32A 2R6GE 2QMWA 1FBEA 3MWBA 4YU0A 4LONB 1I6AA 1NUWA 2B65A 1QUIA 4F29A 1JEUA 4K3FA 3SEVA 2I3WA 4JVCA 3SKPA 3V8XB 3UA8A 2O6AA 2F36A 3RPLA 1H3DA 1XC1A 1IEJA 5ET6A 3PPQA 3RQTA 4Q30B 1YTVA 3IORA 1Y4TA 4YMAA 1RDXA 4GRKA 2AYSA 1AMFA 2YLNA 1OQGA 2WKYA 1MXWA 4OFJA 3LSLA 1R6ZA 1NNKA 5H8HA 5FHOA 1FTJA 3I3VA 1XT8A 2UVHA 4P9KA 1NH7A 2D3IA 1ATGA 4GF8A 3OELA 5A5XA 4H1XA 2Q2AA 3K6WA 3ONMA 4EXLA 5BWJA 1MXXA 1B6HA 4GWZA 3TTKA 3FVGA 1QUKA 3RTFB 2UYEA 1IITA 4PFUA 4PQJA 3Q29A 1OIBA 2DE3A 3BFUA 1ZIUA 4PFWA 1POY1 3D4GA 1URGA 1FQDA 3TMGA 3H3GA 2VP1A 1LBWA 1B5IA 1MXVA 4DIGA 5ITOA 1MY4A 1LBVA 3H4ZA 4PE5B 5EQAA 5I3SA 5LOMA 3OXNA 4QFLA 1NV7A 4XEQA 3JZJA 3O6GA 5KCJB 3TTLA 3FASA 4P1EA 4F1YA 4NF8B 1YZ0A 3GZGA 1ANFA 3VDFA 2Q9TA 1UTBB 2V93A 5IZZA 1BK4A 2F6PA 4MCOA 4RXLA 1IMAA 5DW8A 4YMBA 4P8BA 1O64A 4PCDA 3KEIA 3PMXA 4R75A 2B3BA 1DTZA 1KZ8A 3FBPA 4NAPA 1FPEA 1UIUA 5HBCA 1A7LA 2HCAA 3S9NC 3KJTA 4NF0A 4P11A 5I2KB 3HV1A 1B3FA 3FIRA 2CZLA 3TELA 2XWIA 1II5A 4O94A 5EHSA 4EF1A 3IOTA 3UK4A 2DWHA 4ONYA 3B6TA 3O28A 4R6YA 4RPNA 3TTRA 3TDJA 1N7WA 1IXGA 1MQIA 2B4MA 4JWXA 1B2HA 4RY1A 1ZU0A 1Y3NA 4JBZA 1DMBA 1B3HA 1N84A 2F97A 2O1MA 2DS9A 4ZS9A 2A5TA 5CMMA 4MMPA 1DCUA 3MZBA 2PVUA 2RC7A 1OLAA 3LV0A 3MW0A 3SEYA 3B50A 4R72A 2CZHA 1B0LA 1A40A 1SDXA 5CI5A 2X26A 4GLIA 3ZKLA 5AA2B 3VLUA 3IB2A 1USYE 3OO8A 2XXIA 4Z7EA 1YPNA 4UACA 3W9VA 2DDKA 3SESA 4DXCA 3ILUB 1Y1MA 4G4PA 3VVDA 4P0GA 1QW0A 2JJKA 1S9TA 4GWYA 4P47A 3A3UA 2NUVA 1N3XA 2DWAA 1IXCA 4YKKA 4XKNA 3CRBA 1QKBA 2QVUA 1D9QA 3B7DA 4IO7A 3FXRA 4BDLA 2KR0A 3CHGA 4PETA 3S4UA 3T66A 4H46A 1M5FA 1RYXA 5I59B 4RJZA 4MHFA 4IGRA 2I58A 3KC0A 3MZ1A 1FQFA 1QUJA 5DVFA 3VLWA 4ZEFA 4OENA 1D4NA 2I48A 1P1QA 3N6UA 5HM4B 1R1NA 4H65A 4GL0A 2FNCA 1YXIA 5I57B 1N04A 2ESNA 2V3QA 2ZYNA 1B4HA 3H06B 4DI4B 1KA1A 2PYYA 4P3LA 5IZ3A 2CZIA 2OWZA 1AWBA 2F5XA 3T9HB 5FTHA 4NF6A 4ESXA 3IB0A 3VLVA 3JYRA 2HXWA 5JTYB 5F7VA 4ECFA 2NVUB 1CNQA 3U92A 1VSOA 2V25A 1LAFE 4IO4A 3H7MA 4LVQA 2AIXA 4H45A 3K6VA 5FHMA 2Y7PA 3WAFA 1FBDA 1JNFA 1HSLA 4MNIA 1LSTA 2VGQA 4GXSB 1FQAA 2Z23A 3H6VA 1K9YA 2XX7A 2UXAA 3IOWA 2UVJA 4C1UA 2QJEA 2F3BA 5IGAA 1LFGA 4IO5A 4G68A 4MFIA 3S2VA 4F31B 1QKAA 5JEIA 1Y20A 2O7IA 3G3GA 1P1NA 3VXCA 1AOVA 2F7CA 4GWXA 1DPEA 4R74A 1XVXA 1AIVA 2XD3A 4OEVA 5TP9B 4POWA 1SYIA 1SBPA 4ZDMA 3FV1A 5AA4A 3VE1B 2PFYA 2RC9A 2ZNUA 5IM2A 4TLMB 5ITPA 2HFBA 3K00A 5LDZA 5ET7A 3U94A 5L9OA 3K1NA 2X7PA 4ELRA 1B3GA 4N13A 2KQZA 1G0HA 1TWYA 3ISPA 4AB5A 4YB6A 3C32A 2I0CA 4GD5A 3MSTA 4F3PA 1R9QA 4X48A 4N81A 1B1XA 3PU5A 4H8JA 3KG2A 2NOOA 3ZS6A 1XS5A 4RK9A 2IA4A 3KN7A 4R2BA 1LFHA 3S9EA 4BDRA 4MJOA 2QS4A 4F2QA 5CM6A 4X8RA 3UGWA 2O7UA 3MUQA 4O7IA 1FPBA 4KFQA 1MY1A 4NF4B 3PPPA 2P2AA 4NQ8A 1B3LA 1WDNA 2ABHA 4Q0CA 2H98A 5CMBA 4IY6A 4Z0IA 1SW5A 3PGFA 3U93A 3CFLA 1Y9UA 1VDWA 1P1UA 4KYDA 2ZYMA 3KGCA 2O69A 2GRVA 3O9PA 1I69A 4XFEA 3K1MA 2GQ1A 4R73A 4DI3D 2DQVA 3BIGA 3OMBA 2Q88A 4N17A 1ZMGA 1NMUA 2WBDA 4WEDA 4LQ5A 2I4CA 3OENA 1FRPA 4GWUA 4DDDA 4E0XA 1N7XA 4KHZE 3TQWA 4MNCA 3G3JA 4XIGQ 4YZZA 1NV0A 3SEXA 4G68C 3GLBA 2XXUA 3RLFE 2PMSA 3TFLA 1NNFA 3BBRA 1EH3A 1JVXA 1ELJA 3V83A 3LSFB 1MPCA 2HAUA 4EDPA 4U23A 1BIYA 3VXBA 3M3FA 2XXKA 1B5HA 3LSXA 1A8EA 4BDOA 4N8GA 2O84X 4HCWA 3OO6A 2ZNSA 4OA4A 3V89B 4RYAA 2HQ0A 3G3HA 5TPAB 3O66A 1JEVA 1EZ9A 4M1VA 3SETA 4FBPA 1MY3A 2Y5LA 3PUZE 1A99A 3SZPA 2Z8EA 3Q27A 4PF8A 2DE2A 2QMXA 1QGXA 3T9XB 1ZLQA 1IXIA 4N6PA 3WAEA 4X9TA 1RKMA 1B7HA 1EZPA 3OD7A 4QHQA 3ZKKA 5KCJA 4JSDA 2REGA 3KBZA 1FSAA 1FJ9A 3R26A 3A09A 1D3KA 3I5OA 4U1OA 4BDQA 3DP8A 3EHSA 5EYFA 3IJOB 4GXAA 5I56A 2ONSA 3TKDA 4KYSA 2L5VA 2YJPA 3T96B 2XD2A 1LAXA 2V4CA 4FEBA 4LZ7A 1LAHE 1BKAA 4X1BA 5ET8A 4R2FA 4YB7A 4YKIA 1N3WA 2UVGA 2P3VA 4F1VA 1SW1A 3QUFA 5DEXB 1M5CA 2VHAA 1CE2A 1EYJA 5I2KA 1FQCA 2O1LA 1NNPA 2QVRA 1LBZA 3BKIB 3ILTB 4GFRA 2R8TA 3A3CA 5I58A 4PAKA 3B6WA 2O51A 3KC1A 4JSOA 4THIA 1A55A 4YKPA 4KCDA 3N94A 4H5FA 1PBQA 3CSGA 1MM6A 1TXFA 4DZ1A 2WEFA 1TFDA 1VFDA 1EU8A 1IIWA 3S9LC 1LAGE 3TEPA 3Q28A 3RNNA 3C4MA 1GR2A 2Y5KA 3RN8A 3HO7A 4OEUA 4N8YA 3U8QA 5CC2A 4KCCA 3U65A 3FVKA 4FECA 2I6EA 4QBAA 3R7XA 5AA2A 2XXYA 5AE4A 1LLSA 1N0TA 4GVOA 4YICA 4NN3A 4XF5A 2D21A 4U21A 4QSEA 3H03A 3F11A 4DXBA 3MVWA 1IMCA 3I6VA 3IB1A 2PBWA 1FBHA 3RT6B 2E1SA 2XXXA 4H5GA 4GX4A 5I2NA 1BTJA 2GH9A 1FBCA 1Q35A 5I59A 2OCUA 2UVIA 3PPRA 5CBSA 3N6TA 4EQBA 4JXIA 4LATA 4HXVA 3FV2A 4OHNA 4F22A 1HSEA 3T9UA 1S7YA 4PF6A 1WODA 2B4LA 1JVYA 2XXPA 4I9DA 4I3YA 1H45A 1LBCA 1I6QA 3HHGA 1EYIA 4BDNA 2ZMBA 1NV3A 1AL3A 1NV6A 2H99A 3W9WA 3OEKA 4BDMA 5FTIA 1IQ7A 2A5SA 4X04A 1Y1ZA 2Q2CA 2QSXA 2G29A 5JTYA 2MKZA 3IFCA 2I3VA 3ODBA 1Q9DA 4G2ZA 1DTGA 1PDAA 3K6UA 3E9XA 1A8FA 4H0WA 4NX1A 1FQBA 1T0KA 4QFOA 3LUZA 4P56A 1P1OA 2F34A 1FPFA 4ELPA 3HCQA 5LTCA 1GTKA 2R9JA 1YYZA 3QAXA 1SD3A 4HE1A 4LP2B 2RF1A 5ELVA 1OVBA 3DP4A 4NG7A 3QSLA 1YAEA 3PTYA 3TYHA 3FZVA 3QUJA 5DVIA 1O7TA 4TQUQ 4MX6A 2XXRA 4XKPA 1B05A 1F9BA 4MNPA 1EYKA 2F35A 5I5PA 4UA8A 4EXKA 3IO6A 3O29A 2F8DA 4NE4A 4PAIA 4JVIA 4U4XA 4R6KA 3IR1A 5T3JA 3O2AA 4KD5A 1D9VA 2P0SA 5DYHA 4IO3A 1VR5A 4G77A 4U4SA 2ZXTA 2F3DA 3CFZA 3OO7A 4MF3A 2BJJX 2XXHA 4KQPA 1M5DA 3TUSA 2FHYA 3PUWE 4IGTA 2DE4A 4GQOA 3OSRA 2AL4A 3THIA 3K6XA 3KBRA 2DVCA 1NUXA 1ZJLA 3UORA 2ANJA 2PX1A 2RCAA 3EHUA 2H9BA 1IMBA 2HHMA 4P1LA 5B70A 3SEWA 4QFKA 4FIMA 2DXRA 2G93A 2I4BA 3FATA 2OK2A 2I49A 3AXFA 1G0IA 4H67A 1UTHB 1NV2A 1B5JA 2F7BA 4OESA 2VD2A 2OWSA 1DBZA 3SEUA 3VV5A 1JW4A 3K0VA 4DCYA 4RNSA 3RY3A 3C34A 2W7YA 3C36A 1PBPA 2XXVA 3PPOA 3MPKA 1PB9A 4GBVA 1I6BA 1SI0A 2Q8JA 2PCRA 4IO2A 3MBPA 1FBPA 1MQDA 1Z7ME 4O3CA 1SYHA 2AL5A 4JWOA 4OANA 4ZZEA 3V5AA 4OVSA 3L6HA 4NEDA 1R9LA 4WEPA 1XVYA 4NF4A 5DVJA 4OMBA 1SW4A 3B8BA 3NOHA 5FHNA 1FTMA 5IKBA 1US4A 2HZLA 2VOZA 1NUZA 1FPKA 1ZBMA 4EQ9A 1O63A 4O8MA 4PGNA 2PT1A 4FE8A 3KZGA 4MLQA 4WXJA 4OYVA 4NF5B 1BP5A 1UQWA 3GXAA 4EUOA 1LEVA 1L5TA 2XHDA 3O6IA 1MPBA 1IZ1A 3Q26A 2OX3A 4MBPA 3CG1A 2QFLA 1OMPA 1MXZA 2KLFA 1NH8A 5KZTA 4OQOA 4G68B 1MPDA 2ZYKA 4N15A 3TTNA 2FBPA 4GWSA 4OETA 4F1UA 4R9FA 2QS3A 2UYFA 3LSWA 3K02A 1RDZA 3FXBA 4F3SA 4ZEDA 2FIEA 2XWOA 3HHFA 2Y7KA 1OQHA 3G3IA 5H8FB 1SW2A 4LZ5A 2VPNA 4F39A 3DP6A 3EKIA 3HPIA 4PTKA 2WBBA 4KPTA 4O7MA 4QSDA 4C1TA 3MP8A 1JETA 5F1QA 5H8NA 1B51A 2V84A 1MG1A 1USYH 2PT2A 2FVZA 5TPAA 5EQ7A 3FGSA 4JDFA 1Y4CA 4FEDA 3USDA 1ZKBA 1LBYA 2OJTA 2ALUA 1LB8A 2XWVA 3M3KA 3CI8A 2DSFA 3T93B 3T9VA 4AB6A 4ZZAA 3Q25A 4DLDA 4QRZA 1P1WA 1FQEA 3PUYE 3MYUA 4LQ2A 1US5A 4GX3A 1ZTYA 4ZE9A 3PD8A 4N91A 1BLFA 3CIJA 1H44A 4EQ7A 4RA1A 3CFXA 3UIFA 1N76A 4QFNA 4TOZA 3U1OA 5J16A 3RGYA 1LB9A 4I3EA 3BIHA 2Y7IA 4R9GA 3MP6A 3M8UA 2QPQA 2XXWA 3QXMA 1MQHA 1B58A 4HS7A 1MY2A 2H4IA 4DXUA 2P1SA 5M2VA 4GOTA 3TCGA 2OWTA 4R6HA 2LAOA 1MS7A 4I62A 4JWYA 3U72A 3UN6A 1LCFA 4NHBA 1A54A 4RPOA 2F7AA 4OERA 1S50A 1Q1KA 4YAHX 4QFPA 5KDTB 4PAFA 1FW0A 5AA2D 4XTCQ 1TT1A 3TPAA 4MAGA 1NFTA 3GBAA 4PBHA 5ET5A 4OVJA 4GIZA 3A29A 3TZAA 3UP9A 2ONRA 2Y7RA 4N6DA 4OVTA 2DVZA 1JP4A 4JB7A 2VPOA 4NF8A 3RPWA 3FXUA 1UTBA 3DM0A 5H8QB 1IUDA 4PFYA 2DYXA 2R71A 5K2XA 2D5WA 3G3FA 4LZ8A 1RYOA 3KN8A 1Y3QA 4I8CA 3CG3A 1NI9A 3SERA 4ZECA 4KYEA 3VVEA 3CR9A 1FTAA 1LFIA 2M8CA 4L17A 2QRYA 2HZKA 4FORA 5H8SA 3JV9A 1NKXA 4AS4A 1FJ6A 1KA0A 4MH5A 1GV8A 5ESYA 3O6HA 3TQLA 3FJMA 4AS5A 3LBSA 4OTEA 3IOUA 4N07A 5F24A 4AQ4A 3IAZA 5L9SA 3FXQA 2IEEA 5EQ8A 1IXHA 3MVXA 3MPLA 3M3LA 4FJPA 2CMOA 1FTLA 3KFMA 5EHMA 2REJA 3D4CA 2OZZA 2V3TA 5ICTA 2WYPA 3S9MC 3OEMA 2Q89A 4GX6A 5I84A 4F2OA 3RPLB 1B4ZA 1J1NA 2FIXA 5DT6A 4HE2A 4FAJA 5FBPA 1H76A 4Q8RA 3H6TA 4MEVA 3VVFA 5EYHA 1MXYA
chains in the Genus database with same CATH topology
4OFOA 4Q5TA 3FVNA 5H8HB 1URSA 1LGBC 3MQ9A 5I56B 3C33A 4G8MA 3FVOA 4BLAA 2RC8A 5A5XB 1MM7A 3MP1A 1B3EA 4M4GA 3ZSFA 3EF7A 2Y7WA 1TFAA 4O3AA 4XXUA 2GHAA 4F18A 1QJMA 2B3FA 1XOCA 5L9MA 3DELB 2XXTA 1B1HA 3PD9A 2GHBA 1H43A 3IJXB 5I58B 1P99A 4E0WA 5ISUA 3N5LA 3RT8A 1MH4A 4DCXA 1URDA 5BUUA 3C9HA 2XX8A 1B0HA 3ECRA 3H6WA 2DP8A 2H5YA 4HCYA 1B52A 5TU0A 2RCBA 3FJGA 2OBGA 1PEBA 4OWDA 2RINA 5I57A 2VD3A 3IX1A 2RKMA 2O68A 3OOAA 5CMKA 3TCHA 1B7UA 4NMYA 3TTMA 3C31A 4C0RA 1B7ZA 4H6DA 1LCTA 3OSQA 3PV0E 4NWCA 3LUYA 4XKQA 1AH5A 1GGGA 2HAVA 3TAJA 4G8HA 3KJ7A 4IB2A 2V3UA 3EQ1A 3T22A 2YPNA 2DXYA 3G3KA 4ELQA 4GL8A 1JW1A 3KOSA 4I1DA 5I2NB 5IAIA 1HSJA 3IO4A 2QS1A 4EF2A 1UTHA 1M5EA 2Z8DA 3MAMA 5L8DA 2A5TB 3P7IA 3PMVA 1KWHA 4ELOA 3KSXA 5B7DA 1MDP1 1MXUA 4WKMA 2ZYOA 3PUVE 1MH3A 1VFEA 3PPNA 5TP9A 5ICQA 4QF9A 4U1ZA 3PUXE 1MQGA 1DPPA 4P0IA 4X1DA 3RUMA 1YCJA 3FD3A 4YB5A 2E0SA 1MRPA 3TODA 2DWJA 3PMWA 1OLCA 3K4UA 1LBBA 2Z8FA 4NF5A 5AA3A 3C35A 4OXVA 1PC3A 3MVZA 3KOTA 3O97A 2I0BA 2ONKE 4YKJA 5CRYA 2NXOA 1JQFA 2ZNTA 4ISUA 4NWDA 3K1PA 1SI1A 4KR5A 4RK2A 4ZEBA 1FCKA 2NWJA 2XXQA 3KSJA 1MDQA 4IY5A 1B46A 1Y3PA 1WVJA 5JK4A 4NF6B 2Z22A 2OLBA 4O3BA 3OO9A 1UIVA 4U2RA 5H8FA 3IK6B 4NTLA 2DWIA 1FTOA 3LC8A 4GWOA 5AA1A 5HPQA 1B40A 4FATA 4MLVA 1QVSA 3SDFA 3L6GA 4LUBA 3K01A 3FUZA 3E4RA 2THIA 1DSNA 3MZ9A 3E3KA 4DE8A 4OFLA 3EPEA 3K2DA 2FA7A 3VFJA 1QULA 4U22A 2Y84A 3E13X 5CMCA 4LA9A 1OVTA 3KN3A 1MQJA 2X7QA 3CSBA 1NNTA 2FYIA 4HW8A 2H25A 2F6GA 4QSCA 1PB8A 1XHYA 3LR1A 3N26A 4ZE8A 5K2YA 2F78A 2QL3A 3EN3A 4H8IA 3MJNA 4POXA 4HTGA 4OZ9A 4ZEIA 2QS2A 5AA4B 4ESWA 3TCFA 1GVCA 5CBRA 3IOVA 3MC2A 1DOTA 1FTKA 3W15C 1M5BA 4PFTA 1Z7NE 4F3BA 3CVGA 1CB6A 1VE4A 3GBBA 4PP0A 5DTBA 3QYTA 5KDTA 4F19A 4ZEKA 3EHTA 4F3GA 2XX9A 3RTWB 2HEUA 2DOJA 1MY0A 3B6QA 1B9JA 3DLNA 3QIMA 4ND9A 1JW5A 3R6UA 4XKRA 4G8NA 3IL1B 5H8QA 2GFEA 3MVYA 3H6UA 3QK6A 1PB7A 4KI0E 4TLLB 3HN0A 3G7WA 3HSTA 5DEXA 1NL5A 3BFTA 1SQYA 5J1DA 1EZOA 4IO6A 1POTA 5H8NB 1D9YA 3FJ7A 1SVXB 1B32A 2R6GE 2QMWA 3MWBA 4YU0A 4LONB 1I6AA 2B65A 1QUIA 4F29A 1JEUA 4K3FA 3SEVA 2I3WA 3SKPA 3V8XB 3UA8A 2O6AA 2F36A 1H3DA 1XC1A 1IEJA 3PPQA 3RQTA 4Q30B 1YTVA 3IORA 1Y4TA 4YMAA 4GRKA 2AYSA 1AMFA 2YLNA 1OQGA 2WKYA 1MXWA 4OFJA 3LSLA 1R6ZA 1NNKA 5H8HA 5FHOA 1FTJA 3I3VA 1XT8A 2UVHA 1NH7A 2D3IA 1ATGA 4GF8A 3OELA 5A5XA 4H1XA 2Q2AA 3K6WA 3ONMA 4EXLA 5BWJA 1MXXA 1B6HA 3TTKA 3FVGA 1QUKA 3RTFB 2UYEA 1IITA 4PQJA 4PFUA 3Q29A 1OIBA 2DE3A 3BFUA 1ZIUA 4PFWA 1POY1 3D4GA 1URGA 1FQDA 3TMGA 3H3GA 2VP1A 1B5IA 1MXVA 4DIGA 5ITOA 1MY4A 3H4ZA 4PE5B 5LOMA 3OXNA 4QFLA 3JZJA 3O6GA 5KCJB 3TTLA 3FASA 4F1YA 4NF8B 3GZGA 1ANFA 3VDFA 2Q9TA 1UTBB 2V93A 2F6PA 4RXLA 4YMBA 1O64A 3KEIA 3PMXA 4R75A 2B3BA 1DTZA 1UIUA 5HBCA 1A7LA 2HCAA 3S9NC 3KJTA 4P11A 5I2KB 3HV1A 1B3FA 3FIRA 2CZLA 3TELA 1II5A 5EHSA 4EF1A 3IOTA 3UK4A 2DWHA 4ONYA 3B6TA 3O28A 4R6YA 4RPNA 3TTRA 3TDJA 1N7WA 1IXGA 1MQIA 4JWXA 1B2HA 4RY1A 1ZU0A 1Y3NA 4JBZA 1DMBA 1B3HA 1N84A 2F97A 2O1MA 2DS9A 4ZS9A 2A5TA 5CMMA 3MZBA 2PVUA 2RC7A 1OLAA 3MW0A 3SEYA 4R72A 1B0LA 1A40A 1SDXA 5CI5A 2X26A 4GLIA 3ZKLA 5AA2B 3VLUA 3IB2A 1USYE 3OO8A 2XXIA 4Z7EA 1YPNA 4UACA 3W9VA 3SESA 4DXCA 3ILUB 1Y1MA 4G4PA 3VVDA 4P0GA 1QW0A 1S9TA 3A3UA 2NUVA 1N3XA 2DWAA 1IXCA 4YKKA 4XKNA 3CRBA 1QKBA 3B7DA 4IO7A 3FXRA 4BDLA 4PETA 3S4UA 3T66A 1M5FA 1RYXA 5I59B 4RJZA 4IGRA 2I58A 3MZ1A 1FQFA 1QUJA 5DVFA 3VLWA 4ZEFA 4OENA 1D4NA 2I48A 1P1QA 3N6UA 5HM4B 1R1NA 4H65A 4GL0A 2FNCA 5I57B 1N04A 2ESNA 2V3QA 2ZYNA 1B4HA 3H06B 2PYYA 2F5XA 3T9HB 5FTHA 4NF6A 4ESXA 3IB0A 3VLVA 3JYRA 2HXWA 5JTYB 5F7VA 4ECFA 2NVUB 3U92A 1VSOA 2V25A 1LAFE 4IO4A 3H7MA 4LVQA 2AIXA 3K6VA 5FHMA 2Y7PA 3WAFA 1JNFA 1HSLA 1LSTA 2VGQA 4GXSB 1FQAA 2Z23A 3H6VA 2XX7A 2UXAA 3IOWA 2UVJA 4C1UA 2QJEA 1LFGA 4IO5A 4G68A 4MFIA 3S2VA 4F31B 1QKAA 5JEIA 1Y20A 2O7IA 3G3GA 1P1NA 3VXCA 1AOVA 2F7CA 1DPEA 4R74A 1XVXA 1AIVA 2XD3A 4OEVA 5TP9B 4POWA 1SYIA 1SBPA 4ZDMA 3FV1A 5AA4A 3VE1B 2RC9A 2ZNUA 4TLMB 5ITPA 2HFBA 3K00A 3U94A 5L9OA 3K1NA 2X7PA 4ELRA 1B3GA 4N13A 1TWYA 4AB5A 4YB6A 3C32A 2I0CA 4GD5A 4F3PA 1R9QA 4X48A 1B1XA 3PU5A 4H8JA 3KG2A 2NOOA 3ZS6A 1XS5A 4RK9A 2IA4A 3KN7A 4R2BA 1LFHA 3S9EA 4BDRA 2QS4A 4F2QA 5CM6A 3UGWA 2O7UA 3MUQA 4KFQA 1MY1A 4NF4B 3PPPA 2P2AA 1B3LA 1WDNA 2ABHA 4Q0CA 2H98A 5CMBA 4IY6A 4Z0IA 1SW5A 3PGFA 3U93A 3CFLA 1Y9UA 1P1UA 4KYDA 2ZYMA 3KGCA 2O69A 2GRVA 3O9PA 1I69A 3K1MA 4R73A 2DQVA 3OMBA 2Q88A 1ZMGA 1NMUA 4WEDA 4LQ5A 2I4CA 3OENA 4DDDA 4E0XA 1N7XA 4KHZE 3TQWA 3G3JA 4XIGQ 4YZZA 3SEXA 4G68C 3GLBA 2XXUA 3RLFE 2PMSA 3TFLA 1NNFA 3BBRA 1EH3A 1JVXA 1ELJA 3V83A 3LSFB 1MPCA 2HAUA 4EDPA 4U23A 1BIYA 3VXBA 3M3FA 1B5HA 3LSXA 1A8EA 4BDOA 2O84X 4HCWA 3OO6A 2ZNSA 3V89B 4RYAA 2HQ0A 3G3HA 5TPAB 3O66A 1JEVA 1EZ9A 4M1VA 3SETA 1MY3A 3PUZE 1A99A 2Z8EA 3Q27A 2DE2A 2QMXA 3T9XB 1ZLQA 1IXIA 4N6PA 3WAEA 4X9TA 1RKMA 1B7HA 1EZPA 3OD7A 4QHQA 3ZKKA 5KCJA 4JSDA 2REGA 3R26A 3A09A 1D3KA 3I5OA 4U1OA 4BDQA 3DP8A 3EHSA 5EYFA 3IJOB 4GXAA 5I56A 2ONSA 3TKDA 4KYSA 2YJPA 3T96B 2XD2A 1LAXA 4FEBA 4LZ7A 1LAHE 1BKAA 4X1BA 4R2FA 4YB7A 4YKIA 1N3WA 2UVGA 4F1VA 1SW1A 3QUFA 5DEXB 1M5CA 2VHAA 1CE2A 5I2KA 1FQCA 2O1LA 1NNPA 3BKIB 3ILTB 4GFRA 3A3CA 5I58A 3B6WA 2O51A 4JSOA 4THIA 1A55A 4YKPA 4KCDA 3N94A 4H5FA 1PBQA 3CSGA 1MM6A 1TXFA 4DZ1A 1TFDA 1VFDA 1EU8A 1IIWA 3S9LC 1LAGE 3TEPA 3Q28A 3RNNA 3C4MA 1GR2A 3RN8A 3HO7A 4OEUA 3U8QA 5CC2A 4KCCA 3FVKA 4FECA 2I6EA 3R7XA 5AA2A 2XXYA 5AE4A 1LLSA 1N0TA 4GVOA 4YICA 2D21A 4U21A 4QSEA 3H03A 3F11A 4DXBA 3MVWA 3I6VA 3IB1A 2PBWA 3RT6B 2E1SA 2XXXA 4H5GA 5I2NA 1BTJA 2GH9A 1Q35A 5I59A 2OCUA 2UVIA 3PPRA 5CBSA 3N6TA 4EQBA 4JXIA 4LATA 3FV2A 4OHNA 4F22A 1HSEA 3T9UA 1S7YA 1WODA 1JVYA 2XXPA 4I9DA 1H45A 1LBCA 1I6QA 3HHGA 4BDNA 2ZMBA 1AL3A 2H99A 3W9WA 3OEKA 4BDMA 5FTIA 1IQ7A 2A5SA 1Y1ZA 2Q2CA 2QSXA 2G29A 5JTYA 2I3VA 3ODBA 4G2ZA 1DTGA 1PDAA 3K6UA 3E9XA 1A8FA 4H0WA 1FQBA 1T0KA 4QFOA 1P1OA 2F34A 4ELPA 3HCQA 1GTKA 2R9JA 3QAXA 1SD3A 4LP2B 2RF1A 5ELVA 1OVBA 3DP4A 3QSLA 1YAEA 3TYHA 3FZVA 3QUJA 5DVIA 1O7TA 4TQUQ 2XXRA 4XKPA 1B05A 1F9BA 2F35A 4UA8A 4EXKA 3IO6A 3O29A 2F8DA 4NE4A 4U4XA 4R6KA 3IR1A 3O2AA 4KD5A 1D9VA 2P0SA 5DYHA 4IO3A 1VR5A 4G77A 4U4SA 2ZXTA 3CFZA 3OO7A 4MF3A 2BJJX 2XXHA 4KQPA 1M5DA 3TUSA 3PUWE 4IGTA 2DE4A 4GQOA 3OSRA 2AL4A 3THIA 3K6XA 3KBRA 2DVCA 1ZJLA 3UORA 2ANJA 2PX1A 2RCAA 3EHUA 2H9BA 5B70A 3SEWA 4QFKA 4FIMA 2DXRA 2G93A 2I4BA 3FATA 2OK2A 2I49A 3AXFA 4H67A 1UTHB 1B5JA 2F7BA 4OESA 2VD2A 2OWSA 3SEUA 3VV5A 1JW4A 3K0VA 4DCYA 4RNSA 3RY3A 3C34A 2W7YA 3C36A 1PBPA 2XXVA 3PPOA 3MPKA 1PB9A 1I6BA 1SI0A 2Q8JA 4IO2A 3MBPA 1MQDA 1Z7ME 4O3CA 1SYHA 2AL5A 4JWOA 4ZZEA 3V5AA 3L6HA 4NEDA 1R9LA 4WEPA 1XVYA 4NF4A 5DVJA 4OMBA 1SW4A 5FHNA 1FTMA 5IKBA 1US4A 2HZLA 2VOZA 1ZBMA 4EQ9A 1O63A 2PT1A 4FE8A 3KZGA 4MLQA 4WXJA 4OYVA 4NF5B 1BP5A 1UQWA 3GXAA 4EUOA 1L5TA 2XHDA 3O6IA 1MPBA 1IZ1A 3Q26A 4MBPA 3CG1A 1OMPA 1MXZA 2KLFA 1NH8A 5KZTA 4OQOA 4G68B 1MPDA 2ZYKA 3TTNA 4OETA 4F1UA 4R9FA 2QS3A 2UYFA 3LSWA 3K02A 4F3SA 4ZEDA 3HHFA 2Y7KA 1OQHA 3G3IA 5H8FB 1SW2A 4LZ5A 4F39A 3DP6A 3HPIA 4KPTA 4QSDA 4C1TA 5F1QA 3MP8A 1JETA 5H8NA 1B51A 2V84A 1MG1A 1USYH 2PT2A 5TPAA 3FGSA 4JDFA 1Y4CA 4FEDA 3USDA 1ZKBA 2OJTA 2ALUA 1LB8A 3M3KA 3CI8A 2DSFA 3T93B 3T9VA 4AB6A 4ZZAA 3Q25A 4DLDA 4QRZA 1P1WA 1FQEA 3PUYE 4LQ2A 1US5A 1ZTYA 4ZE9A 3PD8A 1BLFA 3CIJA 1H44A 4EQ7A 4RA1A 3CFXA 3UIFA 1N76A 4QFNA 4TOZA 3U1OA 3RGYA 1LB9A 2Y7IA 4R9GA 3MP6A 3M8UA 2QPQA 2XXWA 3QXMA 1MQHA 1B58A 4HS7A 1MY2A 2H4IA 4DXUA 2P1SA 5M2VA 4GOTA 3TCGA 2OWTA 4R6HA 2LAOA 1MS7A 4I62A 4JWYA 3U72A 3UN6A 1LCFA 1A54A 4RPOA 2F7AA 4OERA 1S50A 1Q1KA 4YAHX 4QFPA 5KDTB 1FW0A 5AA2D 4XTCQ 1TT1A 3TPAA 1NFTA 3GBAA 4OVJA 4GIZA 3TZAA 3UP9A 2ONRA 2Y7RA 2DVZA 4JB7A 4NF8A 3RPWA 3FXUA 1UTBA 3DM0A 5H8QB 1IUDA 4PFYA 2DYXA 2R71A 5K2XA 2D5WA 3G3FA 4LZ8A 1RYOA 3KN8A 1Y3QA 4I8CA 3CG3A 3SERA 4ZECA 4KYEA 3VVEA 3CR9A 2M8CA 1LFIA 4L17A 2QRYA 2HZKA 4FORA 5H8SA 3JV9A 1NKXA 4MH5A 1GV8A 3O6HA 3TQLA 3FJMA 3LBSA 3IOUA 4OTEA 4N07A 4AQ4A 3IAZA 5L9SA 3FXQA 2IEEA 1IXHA 3MVXA 3MPLA 3M3LA 4FJPA 2CMOA 1FTLA 3KFMA 5EHMA 2REJA 3D4CA 2OZZA 2V3TA 5ICTA 3S9MC 3OEMA 2Q89A 5I84A 4F2OA 1B4ZA 1J1NA 5DT6A 4FAJA 1H76A 4Q8RA 3H6TA 3VVFA 1MXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OFO A;  4Q5T A;  3FVN A;  5H8H B;  1URS A;  1LGB C;  3MQ9 A;  5I56 B;  3C33 A;  4G8M A;  3FVO A;  4BLA A;  2RC8 A;  5A5X B;  1MM7 A;  3MP1 A;  1B3E A;  4M4G A;  3ZSF A;  3EF7 A;  2Y7W A;  1TFA A;  4O3A A;  4XXU A;  2GHA A;  4F18 A;  1QJM A;  2B3F A;  1XOC A;  5L9M A;  3DEL B;  2XXT A;  1B1H A;  3PD9 A;  2GHB A;  1H43 A;  3IJX B;  5I58 B;  1P99 A;  4E0W A;  5ISU A;  3N5L A;  3RT8 A;  1MH4 A;  4DCX A;  1URD A;  5BUU A;  3C9H A;  2XX8 A;  1B0H A;  3ECR A;  3H6W A;  2DP8 A;  2H5Y A;  4HCY A;  1B52 A;  5TU0 A;  2RCB A;  3FJG A;  2OBG A;  1PEB A;  4OWD A;  2RIN A;  5I57 A;  2VD3 A;  3IX1 A;  2RKM A;  2O68 A;  3OOA A;  5CMK A;  3TCH A;  1B7U A;  4NMY A;  3TTM A;  3C31 A;  4C0R A;  1B7Z A;  4H6D A;  1LCT A;  3OSQ A;  3PV0 E;  4NWC A;  3LUY A;  4XKQ A;  1AH5 A;  1GGG A;  2HAV A;  3TAJ A;  4G8H A;  3KJ7 A;  4IB2 A;  2V3U A;  3EQ1 A;  3T22 A;  2YPN A;  2DXY A;  3G3K A;  4ELQ A;  4GL8 A;  1JW1 A;  3KOS A;  4I1D A;  5I2N B;  5IAI A;  1HSJ A;  3IO4 A;  2QS1 A;  4EF2 A;  1UTH A;  1M5E A;  2Z8D A;  3MAM A;  5L8D A;  2A5T B;  3P7I A;  3PMV A;  1KWH A;  4ELO A;  3KSX A;  5B7D A;  1MDP 1;  1MXU A;  4WKM A;  2ZYO A;  3PUV E;  1MH3 A;  1VFE A;  3PPN A;  5TP9 A;  5ICQ A;  4QF9 A;  4U1Z A;  3PUX E;  1MQG A;  1DPP A;  4P0I A;  4X1D A;  3RUM A;  1YCJ A;  3FD3 A;  4YB5 A;  2E0S A;  1MRP A;  3TOD A;  2DWJ A;  3PMW A;  1OLC A;  3K4U A;  1LBB A;  2Z8F A;  4NF5 A;  5AA3 A;  3C35 A;  4OXV A;  1PC3 A;  3MVZ A;  3KOT A;  3O97 A;  2I0B A;  2ONK E;  4YKJ A;  5CRY A;  2NXO A;  1JQF A;  2ZNT A;  4ISU A;  4NWD A;  3K1P A;  1SI1 A;  4KR5 A;  4RK2 A;  4ZEB A;  1FCK A;  2NWJ A;  2XXQ A;  3KSJ A;  1MDQ A;  4IY5 A;  1B46 A;  1Y3P A;  1WVJ A;  5JK4 A;  4NF6 B;  2Z22 A;  2OLB A;  4O3B A;  3OO9 A;  1UIV A;  4U2R A;  5H8F A;  3IK6 B;  4NTL A;  2DWI A;  1FTO A;  3LC8 A;  4GWO A;  5AA1 A;  5HPQ A;  1B40 A;  4FAT A;  4MLV A;  1QVS A;  3SDF A;  3L6G A;  4LUB A;  3K01 A;  3FUZ A;  3E4R A;  2THI A;  1DSN A;  3MZ9 A;  3E3K A;  4DE8 A;  4OFL A;  3EPE A;  3K2D A;  2FA7 A;  3VFJ A;  1QUL A;  4U22 A;  2Y84 A;  3E13 X;  5CMC A;  4LA9 A;  1OVT A;  3KN3 A;  1MQJ A;  2X7Q A;  3CSB A;  1NNT A;  2FYI A;  4HW8 A;  2H25 A;  2F6G A;  4QSC A;  1PB8 A;  1XHY A;  3LR1 A;  3N26 A;  4ZE8 A;  5K2Y A;  2F78 A;  2QL3 A;  3EN3 A;  4H8I A;  3MJN A;  4POX A;  4HTG A;  4OZ9 A;  4ZEI A;  2QS2 A;  5AA4 B;  4ESW A;  3TCF A;  1GVC A;  5CBR A;  3IOV A;  3MC2 A;  1DOT A;  1FTK A;  3W15 C;  1M5B A;  4PFT A;  1Z7N E;  4F3B A;  3CVG A;  1CB6 A;  1VE4 A;  3GBB A;  4PP0 A;  5DTB A;  3QYT A;  5KDT A;  4F19 A;  4ZEK A;  3EHT A;  4F3G A;  2XX9 A;  3RTW B;  2HEU A;  2DOJ A;  1MY0 A;  3B6Q A;  1B9J A;  3DLN A;  3QIM A;  4ND9 A;  1JW5 A;  3R6U A;  4XKR A;  4G8N A;  3IL1 B;  5H8Q A;  2GFE A;  3MVY A;  3H6U A;  3QK6 A;  1PB7 A;  4KI0 E;  4TLL B;  3HN0 A;  3G7W A;  3HST A;  5DEX A;  1NL5 A;  3BFT A;  1SQY A;  5J1D A;  1EZO A;  4IO6 A;  1POT A;  5H8N B;  1D9Y A;  3FJ7 A;  1SVX B;  1B32 A;  2R6G E;  2QMW A;  3MWB A;  4YU0 A;  4LON B;  1I6A A;  2B65 A;  1QUI A;  4F29 A;  1JEU A;  4K3F A;  3SEV A;  2I3W A;  3SKP A;  3V8X B;  3UA8 A;  2O6A A;  2F36 A;  1H3D A;  1XC1 A;  1IEJ A;  3PPQ A;  3RQT A;  4Q30 B;  1YTV A;  3IOR A;  1Y4T A;  4YMA A;  4GRK A;  2AYS A;  1AMF A;  2YLN A;  1OQG A;  2WKY A;  1MXW A;  4OFJ A;  3LSL A;  1R6Z A;  1NNK A;  5H8H A;  5FHO A;  1FTJ A;  3I3V A;  1XT8 A;  2UVH A;  1NH7 A;  2D3I A;  1ATG A;  4GF8 A;  3OEL A;  5A5X A;  4H1X A;  2Q2A A;  3K6W A;  3ONM A;  4EXL A;  5BWJ A;  1MXX A;  1B6H A;  3TTK A;  3FVG A;  1QUK A;  3RTF B;  2UYE A;  1IIT A;  4PQJ A;  4PFU A;  3Q29 A;  1OIB A;  2DE3 A;  3BFU A;  1ZIU A;  4PFW A;  1POY 1;  3D4G A;  1URG A;  1FQD A;  3TMG A;  3H3G A;  2VP1 A;  1B5I A;  1MXV A;  4DIG A;  5ITO A;  1MY4 A;  3H4Z A;  4PE5 B;  5LOM A;  3OXN A;  4QFL A;  3JZJ A;  3O6G A;  5KCJ B;  3TTL A;  3FAS A;  4F1Y A;  4NF8 B;  3GZG A;  1ANF A;  3VDF A;  2Q9T A;  1UTB B;  2V93 A;  2F6P A;  4RXL A;  4YMB A;  1O64 A;  3KEI A;  3PMX A;  4R75 A;  2B3B A;  1DTZ A;  1UIU A;  5HBC A;  1A7L A;  2HCA A;  3S9N C;  3KJT A;  4P11 A;  5I2K B;  3HV1 A;  1B3F A;  3FIR A;  2CZL A;  3TEL A;  1II5 A;  5EHS A;  4EF1 A;  3IOT A;  3UK4 A;  2DWH A;  4ONY A;  3B6T A;  3O28 A;  4R6Y A;  4RPN A;  3TTR A;  3TDJ A;  1N7W A;  1IXG A;  1MQI A;  4JWX A;  1B2H A;  4RY1 A;  1ZU0 A;  1Y3N A;  4JBZ A;  1DMB A;  1B3H A;  1N84 A;  2F97 A;  2O1M A;  2DS9 A;  4ZS9 A;  2A5T A;  5CMM A;  3MZB A;  2PVU A;  2RC7 A;  1OLA A;  3MW0 A;  3SEY A;  4R72 A;  1B0L A;  1A40 A;  1SDX A;  5CI5 A;  2X26 A;  4GLI A;  3ZKL A;  5AA2 B;  3VLU A;  3IB2 A;  1USY E;  3OO8 A;  2XXI A;  4Z7E A;  1YPN A;  4UAC A;  3W9V A;  3SES A;  4DXC A;  3ILU B;  1Y1M A;  4G4P A;  3VVD A;  4P0G A;  1QW0 A;  1S9T A;  3A3U A;  2NUV A;  1N3X A;  2DWA A;  1IXC A;  4YKK A;  4XKN A;  3CRB A;  1QKB A;  3B7D A;  4IO7 A;  3FXR A;  4BDL A;  4PET A;  3S4U A;  3T66 A;  1M5F A;  1RYX A;  5I59 B;  4RJZ A;  4IGR A;  2I58 A;  3MZ1 A;  1FQF A;  1QUJ A;  5DVF A;  3VLW A;  4ZEF A;  4OEN A;  1D4N A;  2I48 A;  1P1Q A;  3N6U A;  5HM4 B;  1R1N A;  4H65 A;  4GL0 A;  2FNC A;  5I57 B;  1N04 A;  2ESN A;  2V3Q A;  2ZYN A;  1B4H A;  3H06 B;  2PYY A;  2F5X A;  3T9H B;  5FTH A;  4NF6 A;  4ESX A;  3IB0 A;  3VLV A;  3JYR A;  2HXW A;  5JTY B;  5F7V A;  4ECF A;  2NVU B;  3U92 A;  1VSO A;  2V25 A;  1LAF E;  4IO4 A;  3H7M A;  4LVQ A;  2AIX A;  3K6V A;  5FHM A;  2Y7P A;  3WAF A;  1JNF A;  1HSL A;  1LST A;  2VGQ A;  4GXS B;  1FQA A;  2Z23 A;  3H6V A;  2XX7 A;  2UXA A;  3IOW A;  2UVJ A;  4C1U A;  2QJE A;  1LFG A;  4IO5 A;  4G68 A;  4MFI A;  3S2V A;  4F31 B;  1QKA A;  5JEI A;  1Y20 A;  2O7I A;  3G3G A;  1P1N A;  3VXC A;  1AOV A;  2F7C A;  1DPE A;  4R74 A;  1XVX A;  1AIV A;  2XD3 A;  4OEV A;  5TP9 B;  4POW A;  1SYI A;  1SBP A;  4ZDM A;  3FV1 A;  5AA4 A;  3VE1 B;  2RC9 A;  2ZNU A;  4TLM B;  5ITP A;  2HFB A;  3K00 A;  3U94 A;  5L9O A;  3K1N A;  2X7P A;  4ELR A;  1B3G A;  4N13 A;  1TWY A;  4AB5 A;  4YB6 A;  3C32 A;  2I0C A;  4GD5 A;  4F3P A;  1R9Q A;  4X48 A;  1B1X A;  3PU5 A;  4H8J A;  3KG2 A;  2NOO A;  3ZS6 A;  1XS5 A;  4RK9 A;  2IA4 A;  3KN7 A;  4R2B A;  1LFH A;  3S9E A;  4BDR A;  2QS4 A;  4F2Q A;  5CM6 A;  3UGW A;  2O7U A;  3MUQ A;  4KFQ A;  1MY1 A;  4NF4 B;  3PPP A;  2P2A A;  1B3L A;  1WDN A;  2ABH A;  4Q0C A;  2H98 A;  5CMB A;  4IY6 A;  4Z0I A;  1SW5 A;  3PGF A;  3U93 A;  3CFL A;  1Y9U A;  1P1U A;  4KYD A;  2ZYM A;  3KGC A;  2O69 A;  2GRV A;  3O9P A;  1I69 A;  3K1M A;  4R73 A;  2DQV A;  3OMB A;  2Q88 A;  1ZMG A;  1NMU A;  4WED A;  4LQ5 A;  2I4C A;  3OEN A;  4DDD A;  4E0X A;  1N7X A;  4KHZ E;  3TQW A;  3G3J A;  4XIG Q;  4YZZ A;  3SEX A;  4G68 C;  3GLB A;  2XXU A;  3RLF E;  2PMS A;  3TFL A;  1NNF A;  3BBR A;  1EH3 A;  1JVX A;  1ELJ A;  3V83 A;  3LSF B;  1MPC A;  2HAU A;  4EDP A;  4U23 A;  1BIY A;  3VXB A;  3M3F A;  1B5H A;  3LSX A;  1A8E A;  4BDO A;  2O84 X;  4HCW A;  3OO6 A;  2ZNS A;  3V89 B;  4RYA A;  2HQ0 A;  3G3H A;  5TPA B;  3O66 A;  1JEV A;  1EZ9 A;  4M1V A;  3SET A;  1MY3 A;  3PUZ E;  1A99 A;  2Z8E A;  3Q27 A;  2DE2 A;  2QMX A;  3T9X B;  1ZLQ A;  1IXI A;  4N6P A;  3WAE A;  4X9T A;  1RKM A;  1B7H A;  1EZP A;  3OD7 A;  4QHQ A;  3ZKK A;  5KCJ A;  4JSD A;  2REG A;  3R26 A;  3A09 A;  1D3K A;  3I5O A;  4U1O A;  4BDQ A;  3DP8 A;  3EHS A;  5EYF A;  3IJO B;  4GXA A;  5I56 A;  2ONS A;  3TKD A;  4KYS A;  2YJP A;  3T96 B;  2XD2 A;  1LAX A;  4FEB A;  4LZ7 A;  1LAH E;  1BKA A;  4X1B A;  4R2F A;  4YB7 A;  4YKI A;  1N3W A;  2UVG A;  4F1V A;  1SW1 A;  3QUF A;  5DEX B;  1M5C A;  2VHA A;  1CE2 A;  5I2K A;  1FQC A;  2O1L A;  1NNP A;  3BKI B;  3ILT B;  4GFR A;  3A3C A;  5I58 A;  3B6W A;  2O51 A;  4JSO A;  4THI A;  1A55 A;  4YKP A;  4KCD A;  3N94 A;  4H5F A;  1PBQ A;  3CSG A;  1MM6 A;  1TXF A;  4DZ1 A;  1TFD A;  1VFD A;  1EU8 A;  1IIW A;  3S9L C;  1LAG E;  3TEP A;  3Q28 A;  3RNN A;  3C4M A;  1GR2 A;  3RN8 A;  3HO7 A;  4OEU A;  3U8Q A;  5CC2 A;  4KCC A;  3FVK A;  4FEC A;  2I6E A;  3R7X A;  5AA2 A;  2XXY A;  5AE4 A;  1LLS A;  1N0T A;  4GVO A;  4YIC A;  2D21 A;  4U21 A;  4QSE A;  3H03 A;  3F11 A;  4DXB A;  3MVW A;  3I6V A;  3IB1 A;  2PBW A;  3RT6 B;  2E1S A;  2XXX A;  4H5G A;  5I2N A;  1BTJ A;  2GH9 A;  1Q35 A;  5I59 A;  2OCU A;  2UVI A;  3PPR A;  5CBS A;  3N6T A;  4EQB A;  4JXI A;  4LAT A;  3FV2 A;  4OHN A;  4F22 A;  1HSE A;  3T9U A;  1S7Y A;  1WOD A;  1JVY A;  2XXP A;  4I9D A;  1H45 A;  1LBC A;  1I6Q A;  3HHG A;  4BDN A;  2ZMB A;  1AL3 A;  2H99 A;  3W9W A;  3OEK A;  4BDM A;  5FTI A;  1IQ7 A;  2A5S A;  1Y1Z A;  2Q2C A;  2QSX A;  2G29 A;  5JTY A;  2I3V A;  3ODB A;  4G2Z A;  1DTG A;  1PDA A;  3K6U A;  3E9X A;  1A8F A;  4H0W A;  1FQB A;  1T0K A;  4QFO A;  1P1O A;  2F34 A;  4ELP A;  3HCQ A;  1GTK A;  2R9J A;  3QAX A;  1SD3 A;  4LP2 B;  2RF1 A;  5ELV A;  1OVB A;  3DP4 A;  3QSL A;  1YAE A;  3TYH A;  3FZV A;  3QUJ A;  5DVI A;  1O7T A;  4TQU Q;  2XXR A;  4XKP A;  1B05 A;  1F9B A;  2F35 A;  4UA8 A;  4EXK A;  3IO6 A;  3O29 A;  2F8D A;  4NE4 A;  4U4X A;  4R6K A;  3IR1 A;  3O2A A;  4KD5 A;  1D9V A;  2P0S A;  5DYH A;  4IO3 A;  1VR5 A;  4G77 A;  4U4S A;  2ZXT A;  3CFZ A;  3OO7 A;  4MF3 A;  2BJJ X;  2XXH A;  4KQP A;  1M5D A;  3TUS A;  3PUW E;  4IGT A;  2DE4 A;  4GQO A;  3OSR A;  2AL4 A;  3THI A;  3K6X A;  3KBR A;  2DVC A;  1ZJL A;  3UOR A;  2ANJ A;  2PX1 A;  2RCA A;  3EHU A;  2H9B A;  5B70 A;  3SEW A;  4QFK A;  4FIM A;  2DXR A;  2G93 A;  2I4B A;  3FAT A;  2OK2 A;  2I49 A;  3AXF A;  4H67 A;  1UTH B;  1B5J A;  2F7B A;  4OES A;  2VD2 A;  2OWS A;  3SEU A;  3VV5 A;  1JW4 A;  3K0V A;  4DCY A;  4RNS A;  3RY3 A;  3C34 A;  2W7Y A;  3C36 A;  1PBP A;  2XXV A;  3PPO A;  3MPK A;  1PB9 A;  1I6B A;  1SI0 A;  2Q8J A;  4IO2 A;  3MBP A;  1MQD A;  1Z7M E;  4O3C A;  1SYH A;  2AL5 A;  4JWO A;  4ZZE A;  3V5A A;  3L6H A;  4NED A;  1R9L A;  4WEP A;  1XVY A;  4NF4 A;  5DVJ A;  4OMB A;  1SW4 A;  5FHN A;  1FTM A;  5IKB A;  1US4 A;  2HZL A;  2VOZ A;  1ZBM A;  4EQ9 A;  1O63 A;  2PT1 A;  4FE8 A;  3KZG A;  4MLQ A;  4WXJ A;  4OYV A;  4NF5 B;  1BP5 A;  1UQW A;  3GXA A;  4EUO A;  1L5T A;  2XHD A;  3O6I A;  1MPB A;  1IZ1 A;  3Q26 A;  4MBP A;  3CG1 A;  1OMP A;  1MXZ A;  2KLF A;  1NH8 A;  5KZT A;  4OQO A;  4G68 B;  1MPD A;  2ZYK A;  3TTN A;  4OET A;  4F1U A;  4R9F A;  2QS3 A;  2UYF A;  3LSW A;  3K02 A;  4F3S A;  4ZED A;  3HHF A;  2Y7K A;  1OQH A;  3G3I A;  5H8F B;  1SW2 A;  4LZ5 A;  4F39 A;  3DP6 A;  3HPI A;  4KPT A;  4QSD A;  4C1T A;  5F1Q A;  3MP8 A;  1JET A;  5H8N A;  1B51 A;  2V84 A;  1MG1 A;  1USY H;  2PT2 A;  5TPA A;  3FGS A;  4JDF A;  1Y4C A;  4FED A;  3USD A;  1ZKB A;  2OJT A;  2ALU A;  1LB8 A;  3M3K A;  3CI8 A;  2DSF A;  3T93 B;  3T9V A;  4AB6 A;  4ZZA A;  3Q25 A;  4DLD A;  4QRZ A;  1P1W A;  1FQE A;  3PUY E;  4LQ2 A;  1US5 A;  1ZTY A;  4ZE9 A;  3PD8 A;  1BLF A;  3CIJ A;  1H44 A;  4EQ7 A;  4RA1 A;  3CFX A;  3UIF A;  1N76 A;  4QFN A;  4TOZ A;  3U1O A;  3RGY A;  1LB9 A;  2Y7I A;  4R9G A;  3MP6 A;  3M8U A;  2QPQ A;  2XXW A;  3QXM A;  1MQH A;  1B58 A;  4HS7 A;  1MY2 A;  2H4I A;  4DXU A;  2P1S A;  5M2V A;  4GOT A;  3TCG A;  2OWT A;  4R6H A;  2LAO A;  1MS7 A;  4I62 A;  4JWY A;  3U72 A;  3UN6 A;  1LCF A;  1A54 A;  4RPO A;  2F7A A;  4OER A;  1S50 A;  1Q1K A;  4YAH X;  4QFP A;  5KDT B;  1FW0 A;  5AA2 D;  4XTC Q;  1TT1 A;  3TPA A;  1NFT A;  3GBA A;  4OVJ A;  4GIZ A;  3TZA A;  3UP9 A;  2ONR A;  2Y7R A;  2DVZ A;  4JB7 A;  4NF8 A;  3RPW A;  3FXU A;  1UTB A;  3DM0 A;  5H8Q B;  1IUD A;  4PFY A;  2DYX A;  2R71 A;  5K2X A;  2D5W A;  3G3F A;  4LZ8 A;  1RYO A;  3KN8 A;  1Y3Q A;  4I8C A;  3CG3 A;  3SER A;  4ZEC A;  4KYE A;  3VVE A;  3CR9 A;  2M8C A;  1LFI A;  4L17 A;  2QRY A;  2HZK A;  4FOR A;  5H8S A;  3JV9 A;  1NKX A;  4MH5 A;  1GV8 A;  3O6H A;  3TQL A;  3FJM A;  3LBS A;  3IOU A;  4OTE A;  4N07 A;  4AQ4 A;  3IAZ A;  5L9S A;  3FXQ A;  2IEE A;  1IXH A;  3MVX A;  3MPL A;  3M3L A;  4FJP A;  2CMO A;  1FTL A;  3KFM A;  5EHM A;  2REJ A;  3D4C A;  2OZZ A;  2V3T A;  5ICT A;  3S9M C;  3OEM A;  2Q89 A;  5I84 A;  4F2O A;  1B4Z A;  1J1N A;  5DT6 A;  4FAJ A;  1H76 A;  4Q8R A;  3H6T A;  3VVF A;  1MXY A; 
#chains in the Genus database with same CATH topology
 4OFO A;  4Q5T A;  3FVN A;  5H8H B;  2CEX A;  1URS A;  4PDH A;  1LGB C;  3MQ9 A;  5I56 B;  3C33 A;  4G8M A;  1NV4 A;  3FVO A;  4BLA A;  2RC8 A;  5A5X B;  4MIJ A;  1DK4 A;  2HPG A;  1MM7 A;  3MP1 A;  1B3E A;  4M4G A;  3ZSF A;  3EF7 A;  2Y7W A;  1FPD A;  1NV5 A;  1TFA A;  4O3A A;  3T0J A;  4XXU A;  1RDY A;  2GHA A;  4F18 A;  1QJM A;  4PDD A;  5EYG A;  2B3F A;  1XOC A;  5L9M A;  3DEL B;  2XXT A;  1B1H A;  3PD9 A;  2GHB A;  1H43 A;  3IJX B;  5I58 B;  1P99 A;  4E0W A;  5ISU A;  1K9Z A;  3N5L A;  3RT8 A;  1MH4 A;  4DCX A;  1URD A;  5BUU A;  3C9H A;  2XX8 A;  1B0H A;  2Q8M A;  3ECR A;  3E79 A;  3H6W A;  2DP8 A;  2H5Y A;  1FPI A;  4HCY A;  4PE3 A;  1B52 A;  4N6K A;  5TU0 A;  2RCB A;  3FJG A;  2OBG A;  1PEB A;  4OWD A;  2RIN A;  5I7I A;  5I57 A;  1FPJ A;  4IR8 A;  2VD3 A;  3IX1 A;  2RKM A;  2O68 A;  3OOA A;  5CMK A;  3TCH A;  1B7U A;  4OVR A;  4G61 A;  4NMY A;  3TTM A;  1IMD A;  3C31 A;  4C0R A;  1B7Z A;  5EQ9 A;  4H6D A;  1LCT A;  3D1R A;  3OSQ A;  3PV0 E;  4NWC A;  3LUY A;  4XKQ A;  1IMF A;  4PBQ A;  1AH5 A;  1GGG A;  2HAV A;  3TAJ A;  4G8H A;  3KJ7 A;  4IB2 A;  3ROJ A;  2V3U A;  3EQ1 A;  3T22 A;  2YPN A;  2DXY A;  3G3K A;  4ELQ A;  4GL8 A;  1JW1 A;  4UAB A;  3KOS A;  4I1D A;  5I2N B;  5IAI A;  4PFR A;  1HSJ A;  3IO4 A;  2QS1 A;  4EF2 A;  1UTH A;  1M5E A;  2Z8D A;  3MAM A;  5L8D A;  2A5T B;  3P7I A;  2ZZW A;  3PMV A;  2CEY A;  4LN5 A;  2PFZ A;  2WX9 A;  2WYK A;  1KWH A;  5A5L A;  4ELO A;  3KSX A;  5B7D A;  1MDP 1;  1MXU A;  4WKM A;  2ZYO A;  3PUV E;  1MH3 A;  2ZZV A;  1VFE A;  3PPN A;  5TP9 A;  5ICQ A;  4QF9 A;  3E78 A;  4U1Z A;  3PUX E;  4PFB A;  1MQG A;  1DPP A;  4P0I A;  4X1D A;  3RUM A;  1YCJ A;  4OVP A;  3FD3 A;  4YB5 A;  2E0S A;  1MRP A;  3TOD A;  2DWJ A;  3PMW A;  4HE0 A;  4N4U A;  1OLC A;  3K4U A;  1LBB A;  2Z8F A;  4NF5 A;  1NV1 A;  5AA3 A;  3C35 A;  4OXV A;  1PC3 A;  3IFA A;  4GBW A;  3MVZ A;  3KOT A;  3O97 A;  2I0B A;  2ONK E;  4YKJ A;  5CRY A;  2NXO A;  1JQF A;  2ZNT A;  4ISU A;  4NWD A;  3K1P A;  1SI1 A;  4KR5 A;  4RK2 A;  4ZEB A;  1FCK A;  2NWJ A;  5IZ3 B;  2XXQ A;  1FBF A;  3KSJ A;  1MDQ A;  4IY5 A;  1B46 A;  1Y3P A;  1WVJ A;  5JK4 A;  4NF6 B;  2Z22 A;  2OLB A;  4O3B A;  3T1B A;  3OO9 A;  1UIV A;  4U2R A;  5H8F A;  3IK6 B;  4NTL A;  4KXP A;  2DWI A;  1FTO A;  3LC8 A;  4GWO A;  5AA1 A;  3GYY A;  5HPQ A;  1B40 A;  4FAT A;  2ZZX A;  4MLV A;  1QVS A;  3SDF A;  3L6G A;  4LUB A;  3K01 A;  1NUY A;  2XA5 A;  3FUZ A;  3E4R A;  2THI A;  1DSN A;  3MZ9 A;  3E3K A;  4DE8 A;  4OFL A;  1LBX A;  3EPE A;  3K2D A;  4OVQ A;  2FA7 A;  3VFJ A;  1QUL A;  4U22 A;  1FPL A;  2Y84 A;  3E13 X;  5CMC A;  4LA9 A;  1OVT A;  2QVV A;  3KN3 A;  1MQJ A;  2X7Q A;  4NGU A;  2Q74 A;  3CSB A;  1NNT A;  2FYI A;  4HW8 A;  2H25 A;  2F6G A;  4QSC A;  1PB8 A;  1XHY A;  3LR1 A;  3N26 A;  4ZE8 A;  5K2Y A;  2F78 A;  3RYD A;  2QL3 A;  3EN3 A;  4H8I A;  3MJN A;  4POX A;  3QMF A;  4HTG A;  4OZ9 A;  1INP A;  4ZEI A;  2QS2 A;  5AA4 B;  2BJI A;  4ESW A;  3TCF A;  1GVC A;  5CBR A;  3IOV A;  3HFU A;  3MC2 A;  1DOT A;  1FTK A;  3W15 C;  1SPI A;  1FBG A;  1M5B A;  4PFT A;  1Z7N E;  4QXD A;  4F3B A;  3CVG A;  1CB6 A;  1VE4 A;  3GBB A;  4PP0 A;  5DTB A;  3QYT A;  5KDT A;  4F19 A;  4ZEK A;  2P3N A;  3EHT A;  4F3G A;  4I40 A;  2XX9 A;  3RTW B;  4GWW A;  2HEU A;  2DOJ A;  1MY0 A;  1IME A;  3B6Q A;  1B9J A;  3DLN A;  2CZK A;  3QIM A;  5IZ1 A;  4ND9 A;  1JW5 A;  3R6U A;  4XKR A;  1FPG A;  4G8N A;  3IL1 B;  5H8Q A;  2GFE A;  3MVY A;  3H6U A;  4PFI A;  3QK6 A;  1PB7 A;  4KI0 E;  4TLL B;  4PC9 A;  3HN0 A;  3G7W A;  2HXR A;  2VT5 A;  3HST A;  5DEX A;  4JVD A;  1NL5 A;  3BFT A;  4PGP A;  1SQY A;  5J1D A;  1EZO A;  4IO6 A;  1XI6 A;  1POT A;  5H8N B;  1D9Y A;  3FJ7 A;  2XWK A;  1SVX B;  1B32 A;  2R6G E;  2QMW A;  1FBE A;  3MWB A;  4YU0 A;  4LON B;  1I6A A;  1NUW A;  2B65 A;  1QUI A;  4F29 A;  1JEU A;  4K3F A;  3SEV A;  2I3W A;  4JVC A;  3SKP A;  3V8X B;  3UA8 A;  2O6A A;  2F36 A;  3RPL A;  1H3D A;  1XC1 A;  1IEJ A;  5ET6 A;  3PPQ A;  3RQT A;  4Q30 B;  1YTV A;  3IOR A;  1Y4T A;  4YMA A;  1RDX A;  4GRK A;  2AYS A;  1AMF A;  2YLN A;  1OQG A;  2WKY A;  1MXW A;  4OFJ A;  3LSL A;  1R6Z A;  1NNK A;  5H8H A;  5FHO A;  1FTJ A;  3I3V A;  1XT8 A;  2UVH A;  4P9K A;  1NH7 A;  2D3I A;  1ATG A;  4GF8 A;  3OEL A;  5A5X A;  4H1X A;  2Q2A A;  3K6W A;  3ONM A;  4EXL A;  5BWJ A;  1MXX A;  1B6H A;  4GWZ A;  3TTK A;  3FVG A;  1QUK A;  3RTF B;  2UYE A;  1IIT A;  4PFU A;  4PQJ A;  3Q29 A;  1OIB A;  2DE3 A;  3BFU A;  1ZIU A;  4PFW A;  1POY 1;  3D4G A;  1URG A;  1FQD A;  3TMG A;  3H3G A;  2VP1 A;  1LBW A;  1B5I A;  1MXV A;  4DIG A;  5ITO A;  1MY4 A;  1LBV A;  3H4Z A;  4PE5 B;  5EQA A;  5I3S A;  5LOM A;  3OXN A;  4QFL A;  1NV7 A;  4XEQ A;  3JZJ A;  3O6G A;  5KCJ B;  3TTL A;  3FAS A;  4P1E A;  4F1Y A;  4NF8 B;  1YZ0 A;  3GZG A;  1ANF A;  3VDF A;  2Q9T A;  1UTB B;  2V93 A;  5IZZ A;  1BK4 A;  2F6P A;  4MCO A;  4RXL A;  1IMA A;  5DW8 A;  4YMB A;  4P8B A;  1O64 A;  4PCD A;  3KEI A;  3PMX A;  4R75 A;  2B3B A;  1DTZ A;  1KZ8 A;  3FBP A;  4NAP A;  1FPE A;  1UIU A;  5HBC A;  1A7L A;  2HCA A;  3S9N C;  3KJT A;  4NF0 A;  4P11 A;  5I2K B;  3HV1 A;  1B3F A;  3FIR A;  2CZL A;  3TEL A;  2XWI A;  1II5 A;  4O94 A;  5EHS A;  4EF1 A;  3IOT A;  3UK4 A;  2DWH A;  4ONY A;  3B6T A;  3O28 A;  4R6Y A;  4RPN A;  3TTR A;  3TDJ A;  1N7W A;  1IXG A;  1MQI A;  2B4M A;  4JWX A;  1B2H A;  4RY1 A;  1ZU0 A;  1Y3N A;  4JBZ A;  1DMB A;  1B3H A;  1N84 A;  2F97 A;  2O1M A;  2DS9 A;  4ZS9 A;  2A5T A;  5CMM A;  4MMP A;  1DCU A;  3MZB A;  2PVU A;  2RC7 A;  1OLA A;  3LV0 A;  3MW0 A;  3SEY A;  3B50 A;  4R72 A;  2CZH A;  1B0L A;  1A40 A;  1SDX A;  5CI5 A;  2X26 A;  4GLI A;  3ZKL A;  5AA2 B;  3VLU A;  3IB2 A;  1USY E;  3OO8 A;  2XXI A;  4Z7E A;  1YPN A;  4UAC A;  3W9V A;  2DDK A;  3SES A;  4DXC A;  3ILU B;  1Y1M A;  4G4P A;  3VVD A;  4P0G A;  1QW0 A;  2JJK A;  1S9T A;  4GWY A;  4P47 A;  3A3U A;  2NUV A;  1N3X A;  2DWA A;  1IXC A;  4YKK A;  4XKN A;  3CRB A;  1QKB A;  2QVU A;  1D9Q A;  3B7D A;  4IO7 A;  3FXR A;  4BDL A;  2KR0 A;  3CHG A;  4PET A;  3S4U A;  3T66 A;  4H46 A;  1M5F A;  1RYX A;  5I59 B;  4RJZ A;  4MHF A;  4IGR A;  2I58 A;  3KC0 A;  3MZ1 A;  1FQF A;  1QUJ A;  5DVF A;  3VLW A;  4ZEF A;  4OEN A;  1D4N A;  2I48 A;  1P1Q A;  3N6U A;  5HM4 B;  1R1N A;  4H65 A;  4GL0 A;  2FNC A;  1YXI A;  5I57 B;  1N04 A;  2ESN A;  2V3Q A;  2ZYN A;  1B4H A;  3H06 B;  4DI4 B;  1KA1 A;  2PYY A;  4P3L A;  5IZ3 A;  2CZI A;  2OWZ A;  1AWB A;  2F5X A;  3T9H B;  5FTH A;  4NF6 A;  4ESX A;  3IB0 A;  3VLV A;  3JYR A;  2HXW A;  5JTY B;  5F7V A;  4ECF A;  2NVU B;  1CNQ A;  3U92 A;  1VSO A;  2V25 A;  1LAF E;  4IO4 A;  3H7M A;  4LVQ A;  2AIX A;  4H45 A;  3K6V A;  5FHM A;  2Y7P A;  3WAF A;  1FBD A;  1JNF A;  1HSL A;  4MNI A;  1LST A;  2VGQ A;  4GXS B;  1FQA A;  2Z23 A;  3H6V A;  1K9Y A;  2XX7 A;  2UXA A;  3IOW A;  2UVJ A;  4C1U A;  2QJE A;  2F3B A;  5IGA A;  1LFG A;  4IO5 A;  4G68 A;  4MFI A;  3S2V A;  4F31 B;  1QKA A;  5JEI A;  1Y20 A;  2O7I A;  3G3G A;  1P1N A;  3VXC A;  1AOV A;  2F7C A;  4GWX A;  1DPE A;  4R74 A;  1XVX A;  1AIV A;  2XD3 A;  4OEV A;  5TP9 B;  4POW A;  1SYI A;  1SBP A;  4ZDM A;  3FV1 A;  5AA4 A;  3VE1 B;  2PFY A;  2RC9 A;  2ZNU A;  5IM2 A;  4TLM B;  5ITP A;  2HFB A;  3K00 A;  5LDZ A;  5ET7 A;  3U94 A;  5L9O A;  3K1N A;  2X7P A;  4ELR A;  1B3G A;  4N13 A;  2KQZ A;  1G0H A;  1TWY A;  3ISP A;  4AB5 A;  4YB6 A;  3C32 A;  2I0C A;  4GD5 A;  3MST A;  4F3P A;  1R9Q A;  4X48 A;  4N81 A;  1B1X A;  3PU5 A;  4H8J A;  3KG2 A;  2NOO A;  3ZS6 A;  1XS5 A;  4RK9 A;  2IA4 A;  3KN7 A;  4R2B A;  1LFH A;  3S9E A;  4BDR A;  4MJO A;  2QS4 A;  4F2Q A;  5CM6 A;  4X8R A;  3UGW A;  2O7U A;  3MUQ A;  4O7I A;  1FPB A;  4KFQ A;  1MY1 A;  4NF4 B;  3PPP A;  2P2A A;  4NQ8 A;  1B3L A;  1WDN A;  2ABH A;  4Q0C A;  2H98 A;  5CMB A;  4IY6 A;  4Z0I A;  1SW5 A;  3PGF A;  3U93 A;  3CFL A;  1Y9U A;  1VDW A;  1P1U A;  4KYD A;  2ZYM A;  3KGC A;  2O69 A;  2GRV A;  3O9P A;  1I69 A;  4XFE A;  3K1M A;  2GQ1 A;  4R73 A;  4DI3 D;  2DQV A;  3BIG A;  3OMB A;  2Q88 A;  4N17 A;  1ZMG A;  1NMU A;  2WBD A;  4WED A;  4LQ5 A;  2I4C A;  3OEN A;  1FRP A;  4GWU A;  4DDD A;  4E0X A;  1N7X A;  4KHZ E;  3TQW A;  4MNC A;  3G3J A;  4XIG Q;  4YZZ A;  1NV0 A;  3SEX A;  4G68 C;  3GLB A;  2XXU A;  3RLF E;  2PMS A;  3TFL A;  1NNF A;  3BBR A;  1EH3 A;  1JVX A;  1ELJ A;  3V83 A;  3LSF B;  1MPC A;  2HAU A;  4EDP A;  4U23 A;  1BIY A;  3VXB A;  3M3F A;  2XXK A;  1B5H A;  3LSX A;  1A8E A;  4BDO A;  4N8G A;  2O84 X;  4HCW A;  3OO6 A;  2ZNS A;  4OA4 A;  3V89 B;  4RYA A;  2HQ0 A;  3G3H A;  5TPA B;  3O66 A;  1JEV A;  1EZ9 A;  4M1V A;  3SET A;  4FBP A;  1MY3 A;  2Y5L A;  3PUZ E;  1A99 A;  3SZP A;  2Z8E A;  3Q27 A;  4PF8 A;  2DE2 A;  2QMX A;  1QGX A;  3T9X B;  1ZLQ A;  1IXI A;  4N6P A;  3WAE A;  4X9T A;  1RKM A;  1B7H A;  1EZP A;  3OD7 A;  4QHQ A;  3ZKK A;  5KCJ A;  4JSD A;  2REG A;  3KBZ A;  1FSA A;  1FJ9 A;  3R26 A;  3A09 A;  1D3K A;  3I5O A;  4U1O A;  4BDQ A;  3DP8 A;  3EHS A;  5EYF A;  3IJO B;  4GXA A;  5I56 A;  2ONS A;  3TKD A;  4KYS A;  2L5V A;  2YJP A;  3T96 B;  2XD2 A;  1LAX A;  2V4C A;  4FEB A;  4LZ7 A;  1LAH E;  1BKA A;  4X1B A;  5ET8 A;  4R2F A;  4YB7 A;  4YKI A;  1N3W A;  2UVG A;  2P3V A;  4F1V A;  1SW1 A;  3QUF A;  5DEX B;  1M5C A;  2VHA A;  1CE2 A;  1EYJ A;  5I2K A;  1FQC A;  2O1L A;  1NNP A;  2QVR A;  1LBZ A;  3BKI B;  3ILT B;  4GFR A;  2R8T A;  3A3C A;  5I58 A;  4PAK A;  3B6W A;  2O51 A;  3KC1 A;  4JSO A;  4THI A;  1A55 A;  4YKP A;  4KCD A;  3N94 A;  4H5F A;  1PBQ A;  3CSG A;  1MM6 A;  1TXF A;  4DZ1 A;  2WEF A;  1TFD A;  1VFD A;  1EU8 A;  1IIW A;  3S9L C;  1LAG E;  3TEP A;  3Q28 A;  3RNN A;  3C4M A;  1GR2 A;  2Y5K A;  3RN8 A;  3HO7 A;  4OEU A;  4N8Y A;  3U8Q A;  5CC2 A;  4KCC A;  3U65 A;  3FVK A;  4FEC A;  2I6E A;  4QBA A;  3R7X A;  5AA2 A;  2XXY A;  5AE4 A;  1LLS A;  1N0T A;  4GVO A;  4YIC A;  4NN3 A;  4XF5 A;  2D21 A;  4U21 A;  4QSE A;  3H03 A;  3F11 A;  4DXB A;  3MVW A;  1IMC A;  3I6V A;  3IB1 A;  2PBW A;  1FBH A;  3RT6 B;  2E1S A;  2XXX A;  4H5G A;  4GX4 A;  5I2N A;  1BTJ A;  2GH9 A;  1FBC A;  1Q35 A;  5I59 A;  2OCU A;  2UVI A;  3PPR A;  5CBS A;  3N6T A;  4EQB A;  4JXI A;  4LAT A;  4HXV A;  3FV2 A;  4OHN A;  4F22 A;  1HSE A;  3T9U A;  1S7Y A;  4PF6 A;  1WOD A;  2B4L A;  1JVY A;  2XXP A;  4I9D A;  4I3Y A;  1H45 A;  1LBC A;  1I6Q A;  3HHG A;  1EYI A;  4BDN A;  2ZMB A;  1NV3 A;  1AL3 A;  1NV6 A;  2H99 A;  3W9W A;  3OEK A;  4BDM A;  5FTI A;  1IQ7 A;  2A5S A;  4X04 A;  1Y1Z A;  2Q2C A;  2QSX A;  2G29 A;  5JTY A;  2MKZ A;  3IFC A;  2I3V A;  3ODB A;  1Q9D A;  4G2Z A;  1DTG A;  1PDA A;  3K6U A;  3E9X A;  1A8F A;  4H0W A;  4NX1 A;  1FQB A;  1T0K A;  4QFO A;  3LUZ A;  4P56 A;  1P1O A;  2F34 A;  1FPF A;  4ELP A;  3HCQ A;  5LTC A;  1GTK A;  2R9J A;  1YYZ A;  3QAX A;  1SD3 A;  4HE1 A;  4LP2 B;  2RF1 A;  5ELV A;  1OVB A;  3DP4 A;  4NG7 A;  3QSL A;  1YAE A;  3PTY A;  3TYH A;  3FZV A;  3QUJ A;  5DVI A;  1O7T A;  4TQU Q;  4MX6 A;  2XXR A;  4XKP A;  1B05 A;  1F9B A;  4MNP A;  1EYK A;  2F35 A;  5I5P A;  4UA8 A;  4EXK A;  3IO6 A;  3O29 A;  2F8D A;  4NE4 A;  4PAI A;  4JVI A;  4U4X A;  4R6K A;  3IR1 A;  5T3J A;  3O2A A;  4KD5 A;  1D9V A;  2P0S A;  5DYH A;  4IO3 A;  1VR5 A;  4G77 A;  4U4S A;  2ZXT A;  2F3D A;  3CFZ A;  3OO7 A;  4MF3 A;  2BJJ X;  2XXH A;  4KQP A;  1M5D A;  3TUS A;  2FHY A;  3PUW E;  4IGT A;  2DE4 A;  4GQO A;  3OSR A;  2AL4 A;  3THI A;  3K6X A;  3KBR A;  2DVC A;  1NUX A;  1ZJL A;  3UOR A;  2ANJ A;  2PX1 A;  2RCA A;  3EHU A;  2H9B A;  1IMB A;  2HHM A;  4P1L A;  5B70 A;  3SEW A;  4QFK A;  4FIM A;  2DXR A;  2G93 A;  2I4B A;  3FAT A;  2OK2 A;  2I49 A;  3AXF A;  1G0I A;  4H67 A;  1UTH B;  1NV2 A;  1B5J A;  2F7B A;  4OES A;  2VD2 A;  2OWS A;  1DBZ A;  3SEU A;  3VV5 A;  1JW4 A;  3K0V A;  4DCY A;  4RNS A;  3RY3 A;  3C34 A;  2W7Y A;  3C36 A;  1PBP A;  2XXV A;  3PPO A;  3MPK A;  1PB9 A;  4GBV A;  1I6B A;  1SI0 A;  2Q8J A;  2PCR A;  4IO2 A;  3MBP A;  1FBP A;  1MQD A;  1Z7M E;  4O3C A;  1SYH A;  2AL5 A;  4JWO A;  4OAN A;  4ZZE A;  3V5A A;  4OVS A;  3L6H A;  4NED A;  1R9L A;  4WEP A;  1XVY A;  4NF4 A;  5DVJ A;  4OMB A;  1SW4 A;  3B8B A;  3NOH A;  5FHN A;  1FTM A;  5IKB A;  1US4 A;  2HZL A;  2VOZ A;  1NUZ A;  1FPK A;  1ZBM A;  4EQ9 A;  1O63 A;  4O8M A;  4PGN A;  2PT1 A;  4FE8 A;  3KZG A;  4MLQ A;  4WXJ A;  4OYV A;  4NF5 B;  1BP5 A;  1UQW A;  3GXA A;  4EUO A;  1LEV A;  1L5T A;  2XHD A;  3O6I A;  1MPB A;  1IZ1 A;  3Q26 A;  2OX3 A;  4MBP A;  3CG1 A;  2QFL A;  1OMP A;  1MXZ A;  2KLF A;  1NH8 A;  5KZT A;  4OQO A;  4G68 B;  1MPD A;  2ZYK A;  4N15 A;  3TTN A;  2FBP A;  4GWS A;  4OET A;  4F1U A;  4R9F A;  2QS3 A;  2UYF A;  3LSW A;  3K02 A;  1RDZ A;  3FXB A;  4F3S A;  4ZED A;  2FIE A;  2XWO A;  3HHF A;  2Y7K A;  1OQH A;  3G3I A;  5H8F B;  1SW2 A;  4LZ5 A;  2VPN A;  4F39 A;  3DP6 A;  3EKI A;  3HPI A;  4PTK A;  2WBB A;  4KPT A;  4O7M A;  4QSD A;  4C1T A;  3MP8 A;  1JET A;  5F1Q A;  5H8N A;  1B51 A;  2V84 A;  1MG1 A;  1USY H;  2PT2 A;  2FVZ A;  5TPA A;  5EQ7 A;  3FGS A;  4JDF A;  1Y4C A;  4FED A;  3USD A;  1ZKB A;  1LBY A;  2OJT A;  2ALU A;  1LB8 A;  2XWV A;  3M3K A;  3CI8 A;  2DSF A;  3T93 B;  3T9V A;  4AB6 A;  4ZZA A;  3Q25 A;  4DLD A;  4QRZ A;  1P1W A;  1FQE A;  3PUY E;  3MYU A;  4LQ2 A;  1US5 A;  4GX3 A;  1ZTY A;  4ZE9 A;  3PD8 A;  4N91 A;  1BLF A;  3CIJ A;  1H44 A;  4EQ7 A;  4RA1 A;  3CFX A;  3UIF A;  1N76 A;  4QFN A;  4TOZ A;  3U1O A;  5J16 A;  3RGY A;  1LB9 A;  4I3E A;  3BIH A;  2Y7I A;  4R9G A;  3MP6 A;  3M8U A;  2QPQ A;  2XXW A;  3QXM A;  1MQH A;  1B58 A;  4HS7 A;  1MY2 A;  2H4I A;  4DXU A;  2P1S A;  5M2V A;  4GOT A;  3TCG A;  2OWT A;  4R6H A;  2LAO A;  1MS7 A;  4I62 A;  4JWY A;  3U72 A;  3UN6 A;  1LCF A;  4NHB A;  1A54 A;  4RPO A;  2F7A A;  4OER A;  1S50 A;  1Q1K A;  4YAH X;  4QFP A;  5KDT B;  4PAF A;  1FW0 A;  5AA2 D;  4XTC Q;  1TT1 A;  3TPA A;  4MAG A;  1NFT A;  3GBA A;  4PBH A;  5ET5 A;  4OVJ A;  4GIZ A;  3A29 A;  3TZA A;  3UP9 A;  2ONR A;  2Y7R A;  4N6D A;  4OVT A;  2DVZ A;  1JP4 A;  4JB7 A;  2VPO A;  4NF8 A;  3RPW A;  3FXU A;  1UTB A;  3DM0 A;  5H8Q B;  1IUD A;  4PFY A;  2DYX A;  2R71 A;  5K2X A;  2D5W A;  3G3F A;  4LZ8 A;  1RYO A;  3KN8 A;  1Y3Q A;  4I8C A;  3CG3 A;  1NI9 A;  3SER A;  4ZEC A;  4KYE A;  3VVE A;  3CR9 A;  1FTA A;  1LFI A;  2M8C A;  4L17 A;  2QRY A;  2HZK A;  4FOR A;  5H8S A;  3JV9 A;  1NKX A;  4AS4 A;  1FJ6 A;  1KA0 A;  4MH5 A;  1GV8 A;  5ESY A;  3O6H A;  3TQL A;  3FJM A;  4AS5 A;  3LBS A;  4OTE A;  3IOU A;  4N07 A;  5F24 A;  4AQ4 A;  3IAZ A;  5L9S A;  3FXQ A;  2IEE A;  5EQ8 A;  1IXH A;  3MVX A;  3MPL A;  3M3L A;  4FJP A;  2CMO A;  1FTL A;  3KFM A;  5EHM A;  2REJ A;  3D4C A;  2OZZ A;  2V3T A;  5ICT A;  2WYP A;  3S9M C;  3OEM A;  2Q89 A;  4GX6 A;  5I84 A;  4F2O A;  3RPL B;  1B4Z A;  1J1N A;  2FIX A;  5DT6 A;  4HE2 A;  4FAJ A;  5FBP A;  1H76 A;  4Q8R A;  3H6T A;  4MEV A;  3VVF A;  5EYH A;  1MXY A; 
#chains in the Genus database with same CATH homology
 4OFO A;  4Q5T A;  3FVN A;  5H8H B;  1URS A;  1LGB C;  3MQ9 A;  5I56 B;  3C33 A;  4G8M A;  3FVO A;  4BLA A;  2RC8 A;  5A5X B;  1MM7 A;  3MP1 A;  1B3E A;  4M4G A;  3ZSF A;  3EF7 A;  2Y7W A;  1TFA A;  4O3A A;  4XXU A;  2GHA A;  4F18 A;  1QJM A;  2B3F A;  1XOC A;  5L9M A;  3DEL B;  2XXT A;  1B1H A;  3PD9 A;  2GHB A;  1H43 A;  3IJX B;  5I58 B;  1P99 A;  4E0W A;  5ISU A;  3N5L A;  3RT8 A;  1MH4 A;  4DCX A;  1URD A;  5BUU A;  3C9H A;  2XX8 A;  1B0H A;  3ECR A;  3H6W A;  2DP8 A;  2H5Y A;  4HCY A;  1B52 A;  5TU0 A;  2RCB A;  3FJG A;  2OBG A;  1PEB A;  4OWD A;  2RIN A;  5I57 A;  2VD3 A;  3IX1 A;  2RKM A;  2O68 A;  3OOA A;  5CMK A;  3TCH A;  1B7U A;  4NMY A;  3TTM A;  3C31 A;  4C0R A;  1B7Z A;  4H6D A;  1LCT A;  3OSQ A;  3PV0 E;  4NWC A;  3LUY A;  4XKQ A;  1AH5 A;  1GGG A;  2HAV A;  3TAJ A;  4G8H A;  3KJ7 A;  4IB2 A;  2V3U A;  3EQ1 A;  3T22 A;  2YPN A;  2DXY A;  3G3K A;  4ELQ A;  4GL8 A;  1JW1 A;  3KOS A;  4I1D A;  5I2N B;  5IAI A;  1HSJ A;  3IO4 A;  2QS1 A;  4EF2 A;  1UTH A;  1M5E A;  2Z8D A;  3MAM A;  5L8D A;  2A5T B;  3P7I A;  3PMV A;  1KWH A;  4ELO A;  3KSX A;  5B7D A;  1MDP 1;  1MXU A;  4WKM A;  2ZYO A;  3PUV E;  1MH3 A;  1VFE A;  3PPN A;  5TP9 A;  5ICQ A;  4QF9 A;  4U1Z A;  3PUX E;  1MQG A;  1DPP A;  4P0I A;  4X1D A;  3RUM A;  1YCJ A;  3FD3 A;  4YB5 A;  2E0S A;  1MRP A;  3TOD A;  2DWJ A;  3PMW A;  1OLC A;  3K4U A;  1LBB A;  2Z8F A;  4NF5 A;  5AA3 A;  3C35 A;  4OXV A;  1PC3 A;  3MVZ A;  3KOT A;  3O97 A;  2I0B A;  2ONK E;  4YKJ A;  5CRY A;  2NXO A;  1JQF A;  2ZNT A;  4ISU A;  4NWD A;  3K1P A;  1SI1 A;  4KR5 A;  4RK2 A;  4ZEB A;  1FCK A;  2NWJ A;  2XXQ A;  3KSJ A;  1MDQ A;  4IY5 A;  1B46 A;  1Y3P A;  1WVJ A;  5JK4 A;  4NF6 B;  2Z22 A;  2OLB A;  4O3B A;  3OO9 A;  1UIV A;  4U2R A;  5H8F A;  3IK6 B;  4NTL A;  2DWI A;  1FTO A;  3LC8 A;  4GWO A;  5AA1 A;  5HPQ A;  1B40 A;  4FAT A;  4MLV A;  1QVS A;  3SDF A;  3L6G A;  4LUB A;  3K01 A;  3FUZ A;  3E4R A;  2THI A;  1DSN A;  3MZ9 A;  3E3K A;  4DE8 A;  4OFL A;  3EPE A;  3K2D A;  2FA7 A;  3VFJ A;  1QUL A;  4U22 A;  2Y84 A;  3E13 X;  5CMC A;  4LA9 A;  1OVT A;  3KN3 A;  1MQJ A;  2X7Q A;  3CSB A;  1NNT A;  2FYI A;  4HW8 A;  2H25 A;  2F6G A;  4QSC A;  1PB8 A;  1XHY A;  3LR1 A;  3N26 A;  4ZE8 A;  5K2Y A;  2F78 A;  2QL3 A;  3EN3 A;  4H8I A;  3MJN A;  4POX A;  4HTG A;  4OZ9 A;  4ZEI A;  2QS2 A;  5AA4 B;  4ESW A;  3TCF A;  1GVC A;  5CBR A;  3IOV A;  3MC2 A;  1DOT A;  1FTK A;  3W15 C;  1M5B A;  4PFT A;  1Z7N E;  4F3B A;  3CVG A;  1CB6 A;  1VE4 A;  3GBB A;  4PP0 A;  5DTB A;  3QYT A;  5KDT A;  4F19 A;  4ZEK A;  3EHT A;  4F3G A;  2XX9 A;  3RTW B;  2HEU A;  2DOJ A;  1MY0 A;  3B6Q A;  1B9J A;  3DLN A;  3QIM A;  4ND9 A;  1JW5 A;  3R6U A;  4XKR A;  4G8N A;  3IL1 B;  5H8Q A;  2GFE A;  3MVY A;  3H6U A;  3QK6 A;  1PB7 A;  4KI0 E;  4TLL B;  3HN0 A;  3G7W A;  3HST A;  5DEX A;  1NL5 A;  3BFT A;  1SQY A;  5J1D A;  1EZO A;  4IO6 A;  1POT A;  5H8N B;  1D9Y A;  3FJ7 A;  1SVX B;  1B32 A;  2R6G E;  2QMW A;  3MWB A;  4YU0 A;  4LON B;  1I6A A;  2B65 A;  1QUI A;  4F29 A;  1JEU A;  4K3F A;  3SEV A;  2I3W A;  3SKP A;  3V8X B;  3UA8 A;  2O6A A;  2F36 A;  1H3D A;  1XC1 A;  1IEJ A;  3PPQ A;  3RQT A;  4Q30 B;  1YTV A;  3IOR A;  1Y4T A;  4YMA A;  4GRK A;  2AYS A;  1AMF A;  2YLN A;  1OQG A;  2WKY A;  1MXW A;  4OFJ A;  3LSL A;  1R6Z A;  1NNK A;  5H8H A;  5FHO A;  1FTJ A;  3I3V A;  1XT8 A;  2UVH A;  1NH7 A;  2D3I A;  1ATG A;  4GF8 A;  3OEL A;  5A5X A;  4H1X A;  2Q2A A;  3K6W A;  3ONM A;  4EXL A;  5BWJ A;  1MXX A;  1B6H A;  3TTK A;  3FVG A;  1QUK A;  3RTF B;  2UYE A;  1IIT A;  4PQJ A;  4PFU A;  3Q29 A;  1OIB A;  2DE3 A;  3BFU A;  1ZIU A;  4PFW A;  1POY 1;  3D4G A;  1URG A;  1FQD A;  3TMG A;  3H3G A;  2VP1 A;  1B5I A;  1MXV A;  4DIG A;  5ITO A;  1MY4 A;  3H4Z A;  4PE5 B;  5LOM A;  3OXN A;  4QFL A;  3JZJ A;  3O6G A;  5KCJ B;  3TTL A;  3FAS A;  4F1Y A;  4NF8 B;  3GZG A;  1ANF A;  3VDF A;  2Q9T A;  1UTB B;  2V93 A;  2F6P A;  4RXL A;  4YMB A;  1O64 A;  3KEI A;  3PMX A;  4R75 A;  2B3B A;  1DTZ A;  1UIU A;  5HBC A;  1A7L A;  2HCA A;  3S9N C;  3KJT A;  4P11 A;  5I2K B;  3HV1 A;  1B3F A;  3FIR A;  2CZL A;  3TEL A;  1II5 A;  5EHS A;  4EF1 A;  3IOT A;  3UK4 A;  2DWH A;  4ONY A;  3B6T A;  3O28 A;  4R6Y A;  4RPN A;  3TTR A;  3TDJ A;  1N7W A;  1IXG A;  1MQI A;  4JWX A;  1B2H A;  4RY1 A;  1ZU0 A;  1Y3N A;  4JBZ A;  1DMB A;  1B3H A;  1N84 A;  2F97 A;  2O1M A;  2DS9 A;  4ZS9 A;  2A5T A;  5CMM A;  3MZB A;  2PVU A;  2RC7 A;  1OLA A;  3MW0 A;  3SEY A;  4R72 A;  1B0L A;  1A40 A;  1SDX A;  5CI5 A;  2X26 A;  4GLI A;  3ZKL A;  5AA2 B;  3VLU A;  3IB2 A;  1USY E;  3OO8 A;  2XXI A;  4Z7E A;  1YPN A;  4UAC A;  3W9V A;  3SES A;  4DXC A;  3ILU B;  1Y1M A;  4G4P A;  3VVD A;  4P0G A;  1QW0 A;  1S9T A;  3A3U A;  2NUV A;  1N3X A;  2DWA A;  1IXC A;  4YKK A;  4XKN A;  3CRB A;  1QKB A;  3B7D A;  4IO7 A;  3FXR A;  4BDL A;  4PET A;  3S4U A;  3T66 A;  1M5F A;  1RYX A;  5I59 B;  4RJZ A;  4IGR A;  2I58 A;  3MZ1 A;  1FQF A;  1QUJ A;  5DVF A;  3VLW A;  4ZEF A;  4OEN A;  1D4N A;  2I48 A;  1P1Q A;  3N6U A;  5HM4 B;  1R1N A;  4H65 A;  4GL0 A;  2FNC A;  5I57 B;  1N04 A;  2ESN A;  2V3Q A;  2ZYN A;  1B4H A;  3H06 B;  2PYY A;  2F5X A;  3T9H B;  5FTH A;  4NF6 A;  4ESX A;  3IB0 A;  3VLV A;  3JYR A;  2HXW A;  5JTY B;  5F7V A;  4ECF A;  2NVU B;  3U92 A;  1VSO A;  2V25 A;  1LAF E;  4IO4 A;  3H7M A;  4LVQ A;  2AIX A;  3K6V A;  5FHM A;  2Y7P A;  3WAF A;  1JNF A;  1HSL A;  1LST A;  2VGQ A;  4GXS B;  1FQA A;  2Z23 A;  3H6V A;  2XX7 A;  2UXA A;  3IOW A;  2UVJ A;  4C1U A;  2QJE A;  1LFG A;  4IO5 A;  4G68 A;  4MFI A;  3S2V A;  4F31 B;  1QKA A;  5JEI A;  1Y20 A;  2O7I A;  3G3G A;  1P1N A;  3VXC A;  1AOV A;  2F7C A;  1DPE A;  4R74 A;  1XVX A;  1AIV A;  2XD3 A;  4OEV A;  5TP9 B;  4POW A;  1SYI A;  1SBP A;  4ZDM A;  3FV1 A;  5AA4 A;  3VE1 B;  2RC9 A;  2ZNU A;  4TLM B;  5ITP A;  2HFB A;  3K00 A;  3U94 A;  5L9O A;  3K1N A;  2X7P A;  4ELR A;  1B3G A;  4N13 A;  1TWY A;  4AB5 A;  4YB6 A;  3C32 A;  2I0C A;  4GD5 A;  4F3P A;  1R9Q A;  4X48 A;  1B1X A;  3PU5 A;  4H8J A;  3KG2 A;  2NOO A;  3ZS6 A;  1XS5 A;  4RK9 A;  2IA4 A;  3KN7 A;  4R2B A;  1LFH A;  3S9E A;  4BDR A;  2QS4 A;  4F2Q A;  5CM6 A;  3UGW A;  2O7U A;  3MUQ A;  4KFQ A;  1MY1 A;  4NF4 B;  3PPP A;  2P2A A;  1B3L A;  1WDN A;  2ABH A;  4Q0C A;  2H98 A;  5CMB A;  4IY6 A;  4Z0I A;  1SW5 A;  3PGF A;  3U93 A;  3CFL A;  1Y9U A;  1P1U A;  4KYD A;  2ZYM A;  3KGC A;  2O69 A;  2GRV A;  3O9P A;  1I69 A;  3K1M A;  4R73 A;  2DQV A;  3OMB A;  2Q88 A;  1ZMG A;  1NMU A;  4WED A;  4LQ5 A;  2I4C A;  3OEN A;  4DDD A;  4E0X A;  1N7X A;  4KHZ E;  3TQW A;  3G3J A;  4XIG Q;  4YZZ A;  3SEX A;  4G68 C;  3GLB A;  2XXU A;  3RLF E;  2PMS A;  3TFL A;  1NNF A;  3BBR A;  1EH3 A;  1JVX A;  1ELJ A;  3V83 A;  3LSF B;  1MPC A;  2HAU A;  4EDP A;  4U23 A;  1BIY A;  3VXB A;  3M3F A;  1B5H A;  3LSX A;  1A8E A;  4BDO A;  2O84 X;  4HCW A;  3OO6 A;  2ZNS A;  3V89 B;  4RYA A;  2HQ0 A;  3G3H A;  5TPA B;  3O66 A;  1JEV A;  1EZ9 A;  4M1V A;  3SET A;  1MY3 A;  3PUZ E;  1A99 A;  2Z8E A;  3Q27 A;  2DE2 A;  2QMX A;  3T9X B;  1ZLQ A;  1IXI A;  4N6P A;  3WAE A;  4X9T A;  1RKM A;  1B7H A;  1EZP A;  3OD7 A;  4QHQ A;  3ZKK A;  5KCJ A;  4JSD A;  2REG A;  3R26 A;  3A09 A;  1D3K A;  3I5O A;  4U1O A;  4BDQ A;  3DP8 A;  3EHS A;  5EYF A;  3IJO B;  4GXA A;  5I56 A;  2ONS A;  3TKD A;  4KYS A;  2YJP A;  3T96 B;  2XD2 A;  1LAX A;  4FEB A;  4LZ7 A;  1LAH E;  1BKA A;  4X1B A;  4R2F A;  4YB7 A;  4YKI A;  1N3W A;  2UVG A;  4F1V A;  1SW1 A;  3QUF A;  5DEX B;  1M5C A;  2VHA A;  1CE2 A;  5I2K A;  1FQC A;  2O1L A;  1NNP A;  3BKI B;  3ILT B;  4GFR A;  3A3C A;  5I58 A;  3B6W A;  2O51 A;  4JSO A;  4THI A;  1A55 A;  4YKP A;  4KCD A;  3N94 A;  4H5F A;  1PBQ A;  3CSG A;  1MM6 A;  1TXF A;  4DZ1 A;  1TFD A;  1VFD A;  1EU8 A;  1IIW A;  3S9L C;  1LAG E;  3TEP A;  3Q28 A;  3RNN A;  3C4M A;  1GR2 A;  3RN8 A;  3HO7 A;  4OEU A;  3U8Q A;  5CC2 A;  4KCC A;  3FVK A;  4FEC A;  2I6E A;  3R7X A;  5AA2 A;  2XXY A;  5AE4 A;  1LLS A;  1N0T A;  4GVO A;  4YIC A;  2D21 A;  4U21 A;  4QSE A;  3H03 A;  3F11 A;  4DXB A;  3MVW A;  3I6V A;  3IB1 A;  2PBW A;  3RT6 B;  2E1S A;  2XXX A;  4H5G A;  5I2N A;  1BTJ A;  2GH9 A;  1Q35 A;  5I59 A;  2OCU A;  2UVI A;  3PPR A;  5CBS A;  3N6T A;  4EQB A;  4JXI A;  4LAT A;  3FV2 A;  4OHN A;  4F22 A;  1HSE A;  3T9U A;  1S7Y A;  1WOD A;  1JVY A;  2XXP A;  4I9D A;  1H45 A;  1LBC A;  1I6Q A;  3HHG A;  4BDN A;  2ZMB A;  1AL3 A;  2H99 A;  3W9W A;  3OEK A;  4BDM A;  5FTI A;  1IQ7 A;  2A5S A;  1Y1Z A;  2Q2C A;  2QSX A;  2G29 A;  5JTY A;  2I3V A;  3ODB A;  4G2Z A;  1DTG A;  1PDA A;  3K6U A;  3E9X A;  1A8F A;  4H0W A;  1FQB A;  1T0K A;  4QFO A;  1P1O A;  2F34 A;  4ELP A;  3HCQ A;  1GTK A;  2R9J A;  3QAX A;  1SD3 A;  4LP2 B;  2RF1 A;  5ELV A;  1OVB A;  3DP4 A;  3QSL A;  1YAE A;  3TYH A;  3FZV A;  3QUJ A;  5DVI A;  1O7T A;  4TQU Q;  2XXR A;  4XKP A;  1B05 A;  1F9B A;  2F35 A;  4UA8 A;  4EXK A;  3IO6 A;  3O29 A;  2F8D A;  4NE4 A;  4U4X A;  4R6K A;  3IR1 A;  3O2A A;  4KD5 A;  1D9V A;  2P0S A;  5DYH A;  4IO3 A;  1VR5 A;  4G77 A;  4U4S A;  2ZXT A;  3CFZ A;  3OO7 A;  4MF3 A;  2BJJ X;  2XXH A;  4KQP A;  1M5D A;  3TUS A;  3PUW E;  4IGT A;  2DE4 A;  4GQO A;  3OSR A;  2AL4 A;  3THI A;  3K6X A;  3KBR A;  2DVC A;  1ZJL A;  3UOR A;  2ANJ A;  2PX1 A;  2RCA A;  3EHU A;  2H9B A;  5B70 A;  3SEW A;  4QFK A;  4FIM A;  2DXR A;  2G93 A;  2I4B A;  3FAT A;  2OK2 A;  2I49 A;  3AXF A;  4H67 A;  1UTH B;  1B5J A;  2F7B A;  4OES A;  2VD2 A;  2OWS A;  3SEU A;  3VV5 A;  1JW4 A;  3K0V A;  4DCY A;  4RNS A;  3RY3 A;  3C34 A;  2W7Y A;  3C36 A;  1PBP A;  2XXV A;  3PPO A;  3MPK A;  1PB9 A;  1I6B A;  1SI0 A;  2Q8J A;  4IO2 A;  3MBP A;  1MQD A;  1Z7M E;  4O3C A;  1SYH A;  2AL5 A;  4JWO A;  4ZZE A;  3V5A A;  3L6H A;  4NED A;  1R9L A;  4WEP A;  1XVY A;  4NF4 A;  5DVJ A;  4OMB A;  1SW4 A;  5FHN A;  1FTM A;  5IKB A;  1US4 A;  2HZL A;  2VOZ A;  1ZBM A;  4EQ9 A;  1O63 A;  2PT1 A;  4FE8 A;  3KZG A;  4MLQ A;  4WXJ A;  4OYV A;  4NF5 B;  1BP5 A;  1UQW A;  3GXA A;  4EUO A;  1L5T A;  2XHD A;  3O6I A;  1MPB A;  1IZ1 A;  3Q26 A;  4MBP A;  3CG1 A;  1OMP A;  1MXZ A;  2KLF A;  1NH8 A;  5KZT A;  4OQO A;  4G68 B;  1MPD A;  2ZYK A;  3TTN A;  4OET A;  4F1U A;  4R9F A;  2QS3 A;  2UYF A;  3LSW A;  3K02 A;  4F3S A;  4ZED A;  3HHF A;  2Y7K A;  1OQH A;  3G3I A;  5H8F B;  1SW2 A;  4LZ5 A;  4F39 A;  3DP6 A;  3HPI A;  4KPT A;  4QSD A;  4C1T A;  5F1Q A;  3MP8 A;  1JET A;  5H8N A;  1B51 A;  2V84 A;  1MG1 A;  1USY H;  2PT2 A;  5TPA A;  3FGS A;  4JDF A;  1Y4C A;  4FED A;  3USD A;  1ZKB A;  2OJT A;  2ALU A;  1LB8 A;  3M3K A;  3CI8 A;  2DSF A;  3T93 B;  3T9V A;  4AB6 A;  4ZZA A;  3Q25 A;  4DLD A;  4QRZ A;  1P1W A;  1FQE A;  3PUY E;  4LQ2 A;  1US5 A;  1ZTY A;  4ZE9 A;  3PD8 A;  1BLF A;  3CIJ A;  1H44 A;  4EQ7 A;  4RA1 A;  3CFX A;  3UIF A;  1N76 A;  4QFN A;  4TOZ A;  3U1O A;  3RGY A;  1LB9 A;  2Y7I A;  4R9G A;  3MP6 A;  3M8U A;  2QPQ A;  2XXW A;  3QXM A;  1MQH A;  1B58 A;  4HS7 A;  1MY2 A;  2H4I A;  4DXU A;  2P1S A;  5M2V A;  4GOT A;  3TCG A;  2OWT A;  4R6H A;  2LAO A;  1MS7 A;  4I62 A;  4JWY A;  3U72 A;  3UN6 A;  1LCF A;  1A54 A;  4RPO A;  2F7A A;  4OER A;  1S50 A;  1Q1K A;  4YAH X;  4QFP A;  5KDT B;  1FW0 A;  5AA2 D;  4XTC Q;  1TT1 A;  3TPA A;  1NFT A;  3GBA A;  4OVJ A;  4GIZ A;  3TZA A;  3UP9 A;  2ONR A;  2Y7R A;  2DVZ A;  4JB7 A;  4NF8 A;  3RPW A;  3FXU A;  1UTB A;  3DM0 A;  5H8Q B;  1IUD A;  4PFY A;  2DYX A;  2R71 A;  5K2X A;  2D5W A;  3G3F A;  4LZ8 A;  1RYO A;  3KN8 A;  1Y3Q A;  4I8C A;  3CG3 A;  3SER A;  4ZEC A;  4KYE A;  3VVE A;  3CR9 A;  2M8C A;  1LFI A;  4L17 A;  2QRY A;  2HZK A;  4FOR A;  5H8S A;  3JV9 A;  1NKX A;  4MH5 A;  1GV8 A;  3O6H A;  3TQL A;  3FJM A;  3LBS A;  3IOU A;  4OTE A;  4N07 A;  4AQ4 A;  3IAZ A;  5L9S A;  3FXQ A;  2IEE A;  1IXH A;  3MVX A;  3MPL A;  3M3L A;  4FJP A;  2CMO A;  1FTL A;  3KFM A;  5EHM A;  2REJ A;  3D4C A;  2OZZ A;  2V3T A;  5ICT A;  3S9M C;  3OEM A;  2Q89 A;  5I84 A;  4F2O A;  1B4Z A;  1J1N A;  5DT6 A;  4FAJ A;  1H76 A;  4Q8R A;  3H6T A;  3VVF A;  1MXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...