4O8MA

Crystal structure of a trap periplasmic solute binding protein actinobacillus succinogenes 130z, target efi-510004, with bound l-galactonate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
303
structure length
303
Chain Sequence
ETEIMVAYGNQPGEPIDKAMHFWADKVKEKSNGDIVFKLFPSSQLGSETEVLEQAKFGANIITISDYGALMDIVPDLGVINAPYISQSFEKKSKLLHSDWFKDLSDKLDQHDIHIIVPDVIYGTRHLLTKKPVTKPSDLKGMKVRVQHSRLFLQTINAMGGVPTPMSLSDVYPGLSEGIIDGLENPTVVLFGGKFFEVAKNLNLTAHTKHMSPFVAGTAFWNNLTPEQQKIIVDASREMVTYGGGLIEQAENEALENLKKAGVTVNDVDLPAFEASVADVISTGFPEWSPNLYKNVQEKLSQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Actinobacillus succinogenes
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 105
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o8mA00
4OA4A 4PF8A 4XEQA 4PFIA 4PFBA 4MNIA 4MCOA 4N6DA 2WYKA 2WX9A 2HPGA 2VPNA 2XWKA 2CEYA 4PAFA 4YICA 4PFRA 4YZZA 4XF5A 4P56A 5CM6A 4P3LA 2PFYA 4PGPA 4OANA 2XA5A 4NGUA 4OVTA 4PAIA 4X04A 2CEXA 4PCDA 4NAPA 4PF6A 4MMPA 4MEVA 2XXKA 4P1LA 4MHFA 4NF0A 2VPOA 4P9KA 4XFEA 4NX1A 5IZZA 4PC9A 4N15A 4X8RA 2ZZVA 5I5PA 4PBQA 4MIJA 4N17A 4OVQA 4P47A 4OVSA 4DI3D 4NN3A 4PE3A 2PFZA 2WYPA 3FXBA 4N8YA 4N8GA 2HZLA 4P8BA 4PETA 4O7MA 4P1EA 4O8MA 4OVPA 3GYYA 4O94A 4N4UA 4MAGA 5IGAA 4MX6A 4PBHA 5LTCA 2ZZXA 5I7IA 4NG7A 3U65A 5IM2A 4PAKA 4DI4B 2HZKA 4N6KA 4NQ8A 4PDHA 2V4CA 3B50A 4PDDA 4PGNA 4LN5A 4MNCA 2XWIA 4UABA 4MNPA 4NHBA 4OVRA 2ZZWA 4N91A 2XWOA 2XWVA
chains in the Genus database with same CATH superfamily
2DWHA 4MCOA 4G8HA 1NNTA 4GWOA 3OSQA 3TTKA 3SEYA 2MKZA 5TP9A 2ESNA 1TWYA 4ZS9A 4GL0A 4LZ7A 4XXUA 1B05A 3K6VA 5ISUA 4LZ5A 2XXKA 4LONB 3T22A 3RN8A 1Z7NE 2VPOA 4H0WA 4GBWA 4RK2A 5CI5A 4KCDA 1N3WA 3FASA 3BIHA 1SW2A 4N15A 3Q28A 2I0CA 2XXXA 2F6GA 2PT2A 1VR5A 3IO4A 3FATA 3TFLA 3DP4A 2OJTA 4PTKA 3B7DA 2KR0A 1ZTYA 1UIVA 3MJNA 4N8GA 4OVPA 1NNFA 5B7DA 4KXPA 1POY1 1N7WA 3TTMA 3HO7A 4GWYA 5I7IA 4MFIA 4I3YA 3FXRA 4QFLA 1AOVA 4GX6A 2DQVA 3OENA 4XKNA 2OX3A 1ZLQA 3I5OA 5FHOA 2XD3A 1QW0A 2L5VA 3TELA 4FEDA 5HPQA 2OBGA 3S2VA 1N0TA 1TFAA 4NF5B 4PF8A 2Y7KA 2I49A 1P1QA 5KCJA 5IZ3B 3CI8A 3VXBA 4DXBA 3FUZA 2CZKA 1JQFA 1LBBA 4MH5A 3MAMA 1Q35A 1MDP1 4PAFA 4PFRA 1B2HA 4YAHX 3C34A 2Z22A 1H3DA 1FBDA 5DVIA 1MQHA 4JVCA 4YB6A 5I59B 3IB2A 3DP6A 4G4PA 1Q9DA 5EQ8A 2PCRA 1LFHA 4OVJA 2VOZA 5JTYB 1IZ1A 2O1LA 5CMKA 1MXWA 1ATGA 1LAHE 3PPOA 2Q8JA 4DXUA 4XIGQ 3TAJA 1B51A 2H9BA 4QFPA 3OELA 1QJMA 5M2VA 2Z23A 1FJ6A 2B3BA 3L6GA 3QIMA 4POWA 3MQ9A 4RPOA 4I9DA 2O6AA 3IFCA 2ZNUA 3OOAA 1OMPA 1DSNA 4GXSB 3U93A 3GBAA 3BFTA 2HAUA 3EN3A 4OEUA 3E4RA 3GYYA 2W7YA 2Q74A 4Q30B 1FQAA 5CMBA 2Q8MA 4LZ8A 1IQ7A 5IGAA 1A7LA 4FIMA 4F1VA 5TPAA 1IMAA 5F1QA 3V8XB 3THIA 3O6GA 2ZXTA 3LR1A 1LAFE 2V3TA 1H76A 4KYEA 4ISUA 4N6KA 1YZ0A 3MP1A 1FQCA 5AA2D 2PT1A 4PP0A 3H03A 4LUBA 3TYHA 2XWOA 3L6HA 3N5LA 1GV8A 4H65A 4HE2A 2ZMBA 3W9WA 3TTLA 3IJOB 1MXZA 3MZ1A 2FIEA 5KCJB 4ZEFA 4P11A 1MH4A 2ONSA 1B52A 1SW5A 3D4GA 3G3IA 3IOVA 4PGPA 1M5FA 2XA5A 4PAIA 1DOTA 4PF6A 4MMPA 2RCAA 1UTBB 2DVCA 1EZOA 4OWDA 5DVFA 3VE1B 3PUYE 4OENA 1Y3PA 3U92A 3F11A 1B3FA 5BUUA 3UN6A 3T9XB 1JEUA 2DWJA 3CFLA 3RPLB 1XVYA 4WEDA 4C1UA 1XHYA 1NUXA 3E9XA 2P0SA 3IB0A 2IEEA 2UVJA 3FV2A 3ILUB 4Z7EA 3T93B 3S9LC 1BP5A 1PBQA 4MBPA 5ET7A 1SW1A 4FAJA 4O3BA 3KSXA 4ZEDA 5F7VA 4FJPA 1UTBA 1NUWA 4X1DA 1Y9UA 1SI0A 2REGA 3OMBA 2V4CA 4FORA 2DWAA 2ONRA 3T1BA 2F35A 2O1MA 1QGXA 2ZYOA 2FIXA 1QUJA 3M3FA 4KCCA 3RQTA 2HPGA 4XKRA 3VXCA 2QVUA 2F3BA 2CEYA 1A55A 3GBBA 3IOUA 3K1MA 3S9NC 1FPDA 1BTJA 4EDPA 4P3LA 1DBZA 3WAEA 4C1TA 3MP6A 1I6AA 3Q27A 1VE4A 1DTZA 4JBZA 2XXQA 1NUZA 5ITPA 2DYXA 2THIA 4GFRA 3D4CA 4JXIA 4M4GA 1LEVA 4NX1A 4EQ7A 2BJIA 1NV0A 1MM7A 1H43A 1RYXA 1NH7A 2PMSA 4JB7A 2I4CA 3K1PA 3QAXA 5EQ9A 4L17A 4R73A 3FVGA 3RGYA 2HZLA 1UTHB 1MXUA 5KZTA 4KR5A 4M1VA 2HHMA 1GR2A 3QUJA 3K6XA 4EXLA 4RY1A 1INPA 1IMDA 1RYOA 4GX3A 2ZZXA 1IXIA 4DLDA 4G68C 1JETA 5I84A 1IMEA 4NQ8A 3OEKA 4DCYA 3QK6A 4F19A 3C35A 4LN5A 2XWIA 3EHSA 2ZZWA 2WYKA 1LCTA 3GLBA 5H8FA 3FJMA 2D5WA 2YPNA 3GZGA 4EQ9A 3OEMA 4R9GA 3IL1B 3RTFB 3KJTA 2DE2A 3LSWA 4ZEIA 3RYDA 4YZZA 3TCHA 5KDTA 1PB8A 1LFGA 1IMFA 3KSJA 4IY5A 4PFUA 4YMAA 3OO6A 4I3EA 3LUZA 5ET8A 4KYSA 4AS4A 1LBVA 1I6QA 1MS7A 3K0VA 4MEVA 3SDFA 3W9VA 1OLAA 5EYGA 3PPQA 1NFTA 4H67A 4P9KA 1Q1KA 1OQGA 4XFEA 2VD3A 3KN7A 2F7CA 4NWCA 4GWSA 5ET5A 2F78A 2I0BA 1NV6A 3SEXA 3N6UA 3CG1A 3HHGA 2ZNSA 1LAXA 4HCYA 4XKPA 2F36A 5I2NA 2UXAA 2FHYA 5TP9B 4O8MA 1OLCA 4IY6A 3UGWA 1MY4A 4ZEKA 4KD5A 2X26A 2O51A 4IO3A 3CFXA 3QYTA 5K2XA 1IITA 4NF6B 5DEXA 4HW8A 3MVYA 4YKPA 4AQ4A 3SZPA 3KZGA 3OXNA 4PDDA 3NOHA 1FPKA 4F3BA 4RA1A 4UABA 1IUDA 2OK2A 3TKDA 4FEBA 3CHGA 1WVJA 2IA4A 2Y5KA 4F1UA 4PFYA 2QPQA 1BK4A 5FBPA 2WX9A 4E0WA 2DE4A 1NV4A 2PX1A 5H8HB 1LB9A 4I1DA 3LV0A 1EZPA 3VLVA 4P0IA 3V83A 1MQGA 4OVTA 3RNNA 4G61A 3D1RA 3MUQA 2I3WA 1B5IA 3H6VA 3HN0A 5DYHA 5A5XB 1FBGA 3T96B 1Y20A 3T9VA 2QVVA 3RUMA 1EYJA 3FD3A 3TCGA 1MM6A 4I62A 4RNSA 2GRVA 4HE0A 4MLQA 3PPRA 2UVHA 4N17A 2HCAA 5ICQA 4DI3D 2PFZA 2WYPA 3TTNA 4N8YA 5HM4B 2XX7A 3HCQA 1D4NA 2RINA 3LSLA 1YYZA 2Z8DA 3IFAA 3T0JA 1FBPA 1NUYA 4XKQA 3I3VA 4GXAA 3BBRA 1EH3A 1LBZA 1Y1ZA 4QFNA 2GQ1A 4U1OA 3H6WA 3SEUA 4H6DA 3Q26A 1JW5A 2KLFA 3CFZA 3H6UA 4H8IA 4F18A 2B4LA 1NMUA 2QL3A 5AA1A 3VVFA 2AL5A 4U22A 4EF1A 1SBPA 5H8NA 1NKXA 3MW0A 4ZZAA 4IR8A 5AA4B 5T3JA 4IO4A 1RDZA 4OANA 1IEJA 1PB9A 4R6KA 3N94A 4R9FA 1B0HA 2CEXA 4H5GA 4GX4A 1YTVA 2ZYKA 3TODA 1D9QA 3E79A 4GIZA 4IGRA 2F6PA 5H8QB 4C0RA 1ANFA 2OWZA 4F3GA 3RPWA 4MIJA 3U94A 3TPAA 4OEVA 3FJGA 5H8SA 1H44A 4LVQA 4G68A 4PE3A 3KC1A 4PQJA 1A40A 4GWWA 1B32A 2OWTA 4ONYA 4WXJA 4BDOA 3K4UA 3C32A 1I6BA 2O69A 4BDLA 3K6UA 1IXHA 5IZ1A 4GWXA 3FZVA 3S4UA 3MBPA 1ZJLA 4KFQA 1IMCA 4DI4B 2PBWA 3TUSA 5ET6A 1P1WA 4IO5A 1F9BA 3RLFE 1FPBA 4DZ1A 5CBRA 4MNCA 1LFIA 1XS5A 4NHBA 1LBCA 2F97A 4EUOA 5CM6A 1FPIA 1Y4CA 3MWBA 2AL4A 4MNIA 5DVJA 3PUXE 2UVIA 3RT6B 3PD8A 3PPNA 2DE3A 2F34A 3O29A 1YCJA 1KZ8A 4NGUA 3MPKA 3UA8A 1D9YA 3PUVE 3MZ9A 4FATA 4MHFA 1XC1A 2XX9A 3PV0E 4GD5A 4JVIA 1IXCA 1FTKA 1RDYA 2I3VA 2V93A 3U1OA 1B6HA 2NXOA 2NOOA 1R9LA 1FQEA 1B40A 3DLNA 4H46A 3O66A 4F29A 3OD7A 1SVXB 3N6TA 3JZJA 2Y7WA 3IR1A 1MQJA 3PUWE 1FPJA 4RPNA 3KGCA 5CRYA 1DCUA 2D21A 1OVBA 1CNQA 2XXYA 4HTGA 1FPEA 5ICTA 5LTCA 1B58A 1MY1A 1YXIA 3KN8A 1AWBA 3EQ1A 2BJJX 5AA2B 1URDA 3O97A 4N07A 4NF5A 1G0IA 4DE8A 3O6IA 3ONMA 2QMWA 4OA4A 4XEQA 2RKMA 4HE1A 4N6DA 4F1YA 3ODBA 1DTGA 1PC3A 1JVXA 1UQWA 2XWKA 1PEBA 1CB6A 4XF5A 1RKMA 3TZAA 4E0XA 3MVZA 1XI6A 4BDRA 5FTHA 4IB2A 5TU0A 1FQFA 5I3SA 1NV3A 1R6ZA 4NF8B 4NAPA 1B3GA 3S9MC 4ELQA 5L9SA 4P1LA 4NF0A 3C36A 3KJ7A 5ITOA 4GL8A 2P3VA 5IZZA 4PC9A 1FRPA 3SERA 2ZZVA 2R8TA 1B4HA 3UP9A 4FECA 1R9QA 4I40A 4G8MA 1FCKA 3E13X 4LP2B 4RJZA 4O7IA 4R72A 1PB7A 4O7MA 4P1EA 2WEFA 4H8JA 1MG1A 1MXXA 4H1XA 4AB5A 2F8DA 3PGFA 2JJKA 3KFMA 5I57B 4UACA 4NF4A 4G77A 3T9UA 4Q8RA 2QVRA 2PVUA 2UVGA 4QRZA 5H8FB 1N3XA 4ZE9A 1A99A 4U2RA 1URGA 1XT8A 2Q2AA 3RY3A 3UIFA 3EHUA 1SDXA 1JW1A 1B0LA 1JVYA 3RT8A 2Q88A 2RC9A 2A5SA 2ZYNA 1IXGA 1FW0A 3IK6B 2V3QA 2AYSA 3PMXA 1GTKA 4U4XA 2QFLA 2GHAA 2OWSA 4X1BA 2XXHA 2Y7PA 4XTCQ 3EPEA 2QRYA 2XXUA 1WDNA 4F2QA 3LBSA 3MVXA 1LBXA 2DDKA 4YKKA 3OO9A 4YU0A 1G0HA 1UTHA 5I2KB 2B65A 4TLLB 3FVNA 4OHNA 1B1XA 1BLFA 4QFOA 3TCFA 4ESWA 2M8CA 2FVZA 1D9VA 5L9OA 3B6QA 4P47A 3R26A 4DCXA 4U21A 3CIJA 4HXVA 1FQDA 4TQUQ 1FSAA 2P3NA 1KA0A 1B4ZA 2A5TA 1Z7ME 4N4UA 4PBHA 3BIGA 3PMWA 2I58A 5ELVA 1N04A 3VFJA 4JWXA 2HFBA 1MY3A 4EXKA 2HZKA 1NNPA 1GGGA 4DDDA 4NEDA 1OQHA 3PMVA 2Z8FA 1B1HA 5L9MA 4GWZA 2OCUA 4ESXA 1ELJA 3C31A 4X9TA 1P99A 3M3KA 2REJA 1FTMA 2A5TB 3A3CA 2I48A 4QF9A 3FJ7A 4OERA 1II5A 3BKIB 1SW4A 3R7XA 3K00A 2PYYA 4ELRA 2R6GE 1IIWA 2ZYMA 4RK9A 2WBBA 4U1ZA 1N7XA 3EHTA 1B3LA 4PCDA 3TMGA 5B70A 1NV5A 2XXRA 5EYHA 2HEUA 3ILTB 4Q5TA 4QHQA 4OETA 4ELOA 2D3IA 1MPDA 1M5BA 4GWUA 2V84A 5I57A 1B3EA 3OSRA 4U4SA 2GH9A 3KN3A 3QSLA 3VVDA 1ZIUA 5IKBA 1BKAA 3CSBA 1EZ9A 2XX8A 3KC0A 2ANJA 3P7IA 5BWJA 5J1DA 4FBPA 4OVSA 3C9HA 1Y3NA 3O9PA 1VSOA 3O2AA 3FXBA 1P1NA 4IGTA 1ZBMA 4QSEA 4P8BA 4EF2A 1LGBC 1NL5A 3VDFA 2X7PA 2QS3A 2F3DA 2H5YA 4NF6A 4WKMA 2ABHA 2FYIA 2F5XA 4N6PA 4DIGA 4THIA 2G29A 3JV9A 2G93A 2NWJA 4OFJA 5EQAA 3U65A 4OFOA 1VFEA 3HSTA 4PDHA 5LDZA 1SPIA 1K9ZA 4PGNA 2GHBA 3HPIA 5I2KA 1FTAA 4OQOA 1FJ9A 1K9YA 3CG3A 1EYKA 1QUKA 4O3CA 1HSJA 1B5HA 4PFBA 5AA4A 4UA8A 2E0SA 4MJOA 1FPLA 4F3SA 2YJPA 1HSEA 1M5DA 3PTYA 1L5TA 4YMBA 4BLAA 4KYDA 4OFLA 2E1SA 1FBHA 5FHMA 3FXUA 5AA3A 4Q0CA 3SEVA 1KA1A 2WBDA 3A09A 5F24A 3B6WA 2CZHA 3FIRA 2QS1A 1QKBA 3U8QA 5I56B 2VGQA 2YLNA 2AIXA 3MP8A 5EYFA 1FPFA 3VVEA 1EYIA 4BDMA 2UYFA 4R2BA 5A5LA 2I4BA 3O28A 1DPPA 2Y5LA 4I8CA 5CMCA 1AL3A 4HS7A 3K02A 1QVSA 4PFWA 1FBFA 4TLMB 2O7IA 1MPBA 4N81A 4ZEBA 4PETA 1TFDA 4GF8A 4P0GA 2RCBA 2Y84A 4EQBA 3K01A 5ESYA 4OTEA 3TDJA 2DWIA 5J16A 2NUVA 2O68A 4PAKA 4NF8A 1MXYA 1A8EA 2Q89A 1MY2A 3TQLA 5I58A 4OVRA 3VLWA 4KPTA 4GVOA 3MZBA 3A3UA 3ZKLA 4PFIA 3HFUA 1J1NA 4X48A 1FBEA 2B4MA 3IOWA 4YICA 1T0KA 1FBCA 4OESA 1M5EA 1DMBA 2QSXA 4IO6A 4NWDA 5A5XA 1FTJA 1MY0A 1TT1A 1ZMGA 4NMYA 4FE8A 2XHDA 2QS4A 3OO7A 3DP8A 1B7UA 1MQDA 2FNCA 4BDNA 3EKIA 4JDFA 1GVCA 1A8FA 3TEPA 2HXRA 2DVZA 3M8UA 5IAIA 3IJXB 2H4IA 5AE4A 3G3HA 5FTIA 1S50A 5I5PA 3V5AA 3IB1A 2DS9A 1N76A 3OO8A 1S9TA 2XXWA 1M5CA 3FV1A 1FTOA 2H99A 4IO7A 1ZU0A 3Q25A 1RDXA 3G7WA 1B7HA 3S9EA 5DW8A 3G3GA 1JW4A 1S7YA 1MPCA 1XVXA 1QKAA 4JSDA 4MAGA 5EHSA 1EU8A 3A29A 3QXMA 2F7AA 2RC8A 3H6TA 4ZECA 2P1SA 3DELB 4H45A 5KDTB 3K2DA 1O63A 1Y1MA 4YKJA 1FPGA 3G3FA 4QXDA 4MNPA 2R71A 3MSTA 4LA9A 1NI9A 4N91A 5HBCA 4GLIA 4ELPA 1NV2A 2H25A 1NH8A 1PBPA 3ISPA 3KBZA 2ZNTA 3C33A 2VPNA 1PDAA 2QJEA 3CR9A 1QUIA 4H5FA 1MDQA 2DOJA 4P56A 2Y7RA 1LSTA 3HV1A 2PFYA 3Q29A 1O7TA 1USYE 4QBAA 1VFDA 1JNFA 1WODA 4Z0IA 3FVKA 1MRPA 2DSFA 1KWHA 2XD2A 3MVWA 5L8DA 2X7QA 5I56A 2CMOA 3IX1A 4NF4B 5JEIA 3SESA 3UK4A 5TPAB 5DT6A 1UIUA 4KQPA 2VD2A 2LAOA 5I2NB 4JSOA 2O84X 4PE5B 1B9JA 2P2AA 2CZIA 4F39A 3FBPA 4K3FA 4BDQA 3SKPA 3QMFA 3FGSA 4NN3A 2WKYA 2DXRA 3ZKKA 1DPEA 3MYUA 1BIYA 4OMBA 5H8QA 4ND9A 4N13A 1LBYA 2ALUA 1IMBA 3G3KA 5H8NB 5EQ7A 2OZZA 3W15C 1TXFA 1OIBA 1QULA 4O3AA 1Y4TA 1LLSA 1FTLA 1NV7A 1B46A 3LSXA 2B3FA 3SEWA 1XOCA 2F7BA 3R6UA 5AA2A 5JTYA 2DXYA 3SETA 3QUFA 3B50A 4QSDA 2Y7IA 3RPLA 1FQBA 4JWOA 3V89B 1N84A 4ECFA 4LQ2A 3H7MA 4QSCA 1O64A 2HXWA 1MH3A 2QMXA 3LUYA 5K2YA 3DM0A 2HAVA 3AXFA 2FBPA 5FHNA 4G68B 4ZZEA 3LSFB 1D3KA 3PU5A 1OVTA 2Q9TA 5EHMA 4AS5A 4LATA 1JP4A 3HHFA 4HCWA 4U23A 4R6HA 1P1UA 4GQOA 3E3KA 2H98A 3MPLA 1LAGE 4KI0E 4OYVA 3VLUA 3T66A 1A54A 2DP8A 3LC8A 4NTLA 1SYIA 1US4A 4JVDA 4ZDMA 3B8BA 4G8NA 1AH5A 1SI1A 2VT5A 4LQ5A 4X8RA 2CZLA 3K1NA 3KEIA 1LBWA 3PPPA 1SD3A 5IZ3A 4NE4A 1VDWA 4R6YA 3H4ZA 1US5A 1B5JA 4PBQA 3MC2A 2XXPA 4OVQA 3G3JA 2UYEA 3RTWB 2R9JA 2HQ0A 1NV1A 3EF7A 2QS2A 2V3UA 3ZSFA 1AMFA 3UORA 5CC2A 3C4MA 2XXIA 4AB6A 4O94A 3WAFA 4POXA 3O6HA 1MQIA 5CBSA 2Z8EA 1B7ZA 1H45A 2I6EA 2NVUB 3KOSA 4NG7A 3FVOA 4R75A 5IM2A 2O7UA 3GXAA 3I6VA 4KHZE 1YAEA 3T9HB 1DK4A 1HSLA 4F31B 4F22A 1SQYA 4RYAA 1ZKBA 4F2OA 3CVGA 1JEVA 3CSGA 3FXQA 3IO6A 4WEPA 4ZE8A 2KQZA 3USDA 4YB7A 1P1OA 2XXVA 5LOMA 1NNKA 3TTRA 5H8HA 4G2ZA 4YKIA 3M3LA 1URSA 4X04A 3IOTA 1R1NA 3H06B 5DTBA 4IO2A 3BFUA 4GRKA 4DXCA 3VV5A 1MXVA 1YPNA 5DEXB 3JYRA 5JK4A 4R2FA 2ONKE 4YB5A 4GBVA 5CMMA 3KG2A 3CRBA 1B3HA 2FA7A 1AIVA 2GFEA 4TOZA 3H3GA 4RXLA 3IORA 3B6TA 4QFKA 2RF1A 5I58B 3U72A 4MF3A 2RC7A 1LCFA 1LB8A 3PD9A 1POTA 4PFTA 1CE2A 2XXTA 2VP1A 4MX6A 1Y3QA 3E78A 3K6WA 5I59A 4OXVA 3PUZE 2OLBA 3ZS6A 4OZ9A 3KOTA 4MLVA 4GOTA 2V25A 2Q2CA 3KBRA 3N26A 3IAZA 2VHAA 4F3PA 4R74A 3TQWA 4JWYA 1USYH 1SYHA 1I69A 3ROJA 3ECRA 2XWVA
chains in the Genus database with same CATH topology
3T1BA 1FJ9A 1K9YA 4GWZA 1EYKA 4OA4A 4PF8A 3CHGA 1QGXA 1FPIA 4XEQA 4PFIA 2FIXA 1NV2A 4PFBA 2Y5KA 4X9TA 4F1UA 4HE1A 4MCOA 4MNIA 4N6DA 3HFUA 4MJOA 2QPQA 4HE2A 5IZ3B 1BK4A 1FPLA 2WX9A 2KQZA 3W9WA 2MKZA 3ISPA 3KBZA 5FBPA 2DE2A 2HPGA 2CZKA 4IR8A 2DE4A 2VPNA 1FBEA 1NV4A 2B4MA 2FIEA 2QVUA 2XWKA 2F3BA 5ESYA 2CEYA 4PAFA 4YICA 4PFRA 2V3QA 3PTYA 2FBPA 4YZZA 3RYDA 1RDZA 1FBCA 4XF5A 2DE3A 3LV0A 1FBDA 1FPDA 1XI6A 2QFLA 4P56A 5CM6A 4JVCA 1IMFA 4P3LA 2Q9TA 2PFYA 2WBBA 4OANA 1KZ8A 1DBZA 1Q9DA 1FBHA 4PGPA 4X04A 5EQ8A 2XA5A 1NV3A 4NGUA 4OVTA 4I3EA 1JP4A 2CEXA 4HCWA 4G61A 4PAIA 4QBAA 3LUZA 4PCDA 3D1RA 5ET8A 2PCRA 4NAPA 4PF6A 4AS4A 4MMPA 1LBVA 1KA1A 2WBDA 4GX4A 1NV5A 1LBXA 2DDKA 5EYHA 4MEVA 2XXKA 4P1LA 5F24A 1G0HA 2CZHA 4MHFA 1NUZA 4NF0A 5T3JA 3W9VA 1FBGA 5EYGA 5ET7A 3EKIA 5IGAA 2VPOA 5JK4A 4JVDA 4GWUA 1D9QA 3E79A 3B8BA 4GBWA 4JVIA 4P9KA 1LEVA 2P3VA 2QVVA 2HXRA 4XFEA 2DVZA 4NX1A 4GBVA 1EYJA 2VT5A 3BIHA 4PC9A 5IZZA 4N15A 2BJIA 4X8RA 1NV0A 1FPFA 1FRPA 1LBWA 1RDYA 1FJ6A 1EYIA 2ZZVA 5I5PA 2R8TA 5IZ3A 5A5LA 1VDWA 3KC0A 4PBQA 2FVZA 4GWSA 4HE0A 5ET5A 2CZIA 2ZZWA 1NV6A 2OWZA 4MIJA 2Y5LA 4N17A 4OVQA 3RPLB 5J1DA 4FBPA 4OVSA 4P47A 3FBPA 4DI3D 3IFCA 4I40A 1FBFA 3QMFA 4PTKA 4H46A 4NN3A 4PE3A 2KR0A 3KC1A 4HXVA 5EQ9A 4HCYA 4GWWA 4O7IA 1NUXA 1NV1A 2PFZA 2WYPA 4N81A 3FXBA 3MYUA 1FSAA 1RDXA 4N8YA 4N8GA 2HZLA 2P3NA 2FHYA 1KA0A 4O7MA 4P1EA 4P8BA 2WEFA 4PETA 5DW8A 4AS5A 4O8MA 4M1VA 2HHMA 4OVPA 1LBYA 1FPJA 1IMBA 2F3DA 3GYYA 4O94A 2Q74A 1YYZA 4N4UA 1DCUA 2F5XA 3IFAA 1CNQA 2JJKA 1INPA 4KXPA 1IMDA 4MAGA 4MX6A 4PBHA 3BIGA 5EQ7A 3E78A 3T0JA 4F1VA 1FPEA 1IMAA 3A29A 1FBPA 4GWYA 5J16A 5IZ1A 4GX3A 4GWXA 2Q8MA 1NUYA 2ZZXA 5I7IA 1NV7A 5LTCA 4NG7A 4N91A 2QVRA 5EQAA 1YXIA 4H45A 4I3YA 1NUWA 3U65A 1IMCA 4GX6A 5IM2A 4PAKA 1AWBA 1IMEA 1LBZA 4DI4B 2HZKA 5ET6A 4N6KA 2OX3A 1FPGA 2V4CA 1YZ0A 4NQ8A 4PDHA 3RPLA 3SZPA 5LDZA 3ROJA 1DK4A 1FPBA 1SPIA 2GQ1A 2L5VA 3B50A 4PDDA 1G0IA 3NOHA 4F19A 1K9ZA 1FPKA 4PGNA 4LN5A 4MNCA 2XWIA 4UABA 4QXDA 4MNPA 3MSTA 4NHBA 1NI9A 1FTAA 4OVRA 2WYKA 5I3SA 4F18A 2B4LA 2XWOA 2XWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OA4 A;  4PF8 A;  4XEQ A;  4PFI A;  4PFB A;  4MNI A;  4MCO A;  4N6D A;  2WYK A;  2WX9 A;  2HPG A;  2VPN A;  2XWK A;  2CEY A;  4PAF A;  4YIC A;  4PFR A;  4YZZ A;  4XF5 A;  4P56 A;  5CM6 A;  4P3L A;  2PFY A;  4PGP A;  4OAN A;  2XA5 A;  4NGU A;  4OVT A;  4PAI A;  4X04 A;  2CEX A;  4PCD A;  4NAP A;  4PF6 A;  4MMP A;  4MEV A;  2XXK A;  4P1L A;  4MHF A;  4NF0 A;  2VPO A;  4P9K A;  4XFE A;  4NX1 A;  5IZZ A;  4PC9 A;  4N15 A;  4X8R A;  2ZZV A;  5I5P A;  4PBQ A;  4MIJ A;  4N17 A;  4OVQ A;  4P47 A;  4OVS A;  4DI3 D;  4NN3 A;  4PE3 A;  2PFZ A;  2WYP A;  3FXB A;  4N8Y A;  4N8G A;  2HZL A;  4P8B A;  4PET A;  4O7M A;  4P1E A;  4O8M A;  4OVP A;  3GYY A;  4O94 A;  4N4U A;  4MAG A;  5IGA A;  4MX6 A;  4PBH A;  5LTC A;  2ZZX A;  5I7I A;  4NG7 A;  3U65 A;  5IM2 A;  4PAK A;  4DI4 B;  2HZK A;  4N6K A;  4NQ8 A;  4PDH A;  2V4C A;  3B50 A;  4PDD A;  4PGN A;  4LN5 A;  4MNC A;  2XWI A;  4UAB A;  4MNP A;  4NHB A;  4OVR A;  2ZZW A;  4N91 A;  2XWO A;  2XWV A; 
#chains in the Genus database with same CATH topology
 2DWH A;  4MCO A;  4G8H A;  1NNT A;  4GWO A;  3OSQ A;  3TTK A;  3SEY A;  2MKZ A;  5TP9 A;  2ESN A;  1TWY A;  4ZS9 A;  4GL0 A;  4LZ7 A;  4XXU A;  1B05 A;  3K6V A;  5ISU A;  4LZ5 A;  2XXK A;  4LON B;  3T22 A;  3RN8 A;  1Z7N E;  2VPO A;  4H0W A;  4GBW A;  4RK2 A;  5CI5 A;  4KCD A;  1N3W A;  3FAS A;  3BIH A;  1SW2 A;  4N15 A;  3Q28 A;  2I0C A;  2XXX A;  2F6G A;  2PT2 A;  1VR5 A;  3IO4 A;  3FAT A;  3TFL A;  3DP4 A;  2OJT A;  4PTK A;  3B7D A;  2KR0 A;  1ZTY A;  1UIV A;  3MJN A;  4N8G A;  4OVP A;  1NNF A;  5B7D A;  4KXP A;  1POY 1;  1N7W A;  3TTM A;  3HO7 A;  4GWY A;  5I7I A;  4MFI A;  4I3Y A;  3FXR A;  4QFL A;  1AOV A;  4GX6 A;  2DQV A;  3OEN A;  4XKN A;  2OX3 A;  1ZLQ A;  3I5O A;  5FHO A;  2XD3 A;  1QW0 A;  2L5V A;  3TEL A;  4FED A;  5HPQ A;  2OBG A;  3S2V A;  1N0T A;  1TFA A;  4NF5 B;  4PF8 A;  2Y7K A;  2I49 A;  1P1Q A;  5KCJ A;  5IZ3 B;  3CI8 A;  3VXB A;  4DXB A;  3FUZ A;  2CZK A;  1JQF A;  1LBB A;  4MH5 A;  3MAM A;  1Q35 A;  1MDP 1;  4PAF A;  4PFR A;  1B2H A;  4YAH X;  3C34 A;  2Z22 A;  1H3D A;  1FBD A;  5DVI A;  1MQH A;  4JVC A;  4YB6 A;  5I59 B;  3IB2 A;  3DP6 A;  4G4P A;  1Q9D A;  5EQ8 A;  2PCR A;  1LFH A;  4OVJ A;  2VOZ A;  5JTY B;  1IZ1 A;  2O1L A;  5CMK A;  1MXW A;  1ATG A;  1LAH E;  3PPO A;  2Q8J A;  4DXU A;  4XIG Q;  3TAJ A;  1B51 A;  2H9B A;  4QFP A;  3OEL A;  1QJM A;  5M2V A;  2Z23 A;  1FJ6 A;  2B3B A;  3L6G A;  3QIM A;  4POW A;  3MQ9 A;  4RPO A;  4I9D A;  2O6A A;  3IFC A;  2ZNU A;  3OOA A;  1OMP A;  1DSN A;  4GXS B;  3U93 A;  3GBA A;  3BFT A;  2HAU A;  3EN3 A;  4OEU A;  3E4R A;  3GYY A;  2W7Y A;  2Q74 A;  4Q30 B;  1FQA A;  5CMB A;  2Q8M A;  4LZ8 A;  1IQ7 A;  5IGA A;  1A7L A;  4FIM A;  4F1V A;  5TPA A;  1IMA A;  5F1Q A;  3V8X B;  3THI A;  3O6G A;  2ZXT A;  3LR1 A;  1LAF E;  2V3T A;  1H76 A;  4KYE A;  4ISU A;  4N6K A;  1YZ0 A;  3MP1 A;  1FQC A;  5AA2 D;  2PT1 A;  4PP0 A;  3H03 A;  4LUB A;  3TYH A;  2XWO A;  3L6H A;  3N5L A;  1GV8 A;  4H65 A;  4HE2 A;  2ZMB A;  3W9W A;  3TTL A;  3IJO B;  1MXZ A;  3MZ1 A;  2FIE A;  5KCJ B;  4ZEF A;  4P11 A;  1MH4 A;  2ONS A;  1B52 A;  1SW5 A;  3D4G A;  3G3I A;  3IOV A;  4PGP A;  1M5F A;  2XA5 A;  4PAI A;  1DOT A;  4PF6 A;  4MMP A;  2RCA A;  1UTB B;  2DVC A;  1EZO A;  4OWD A;  5DVF A;  3VE1 B;  3PUY E;  4OEN A;  1Y3P A;  3U92 A;  3F11 A;  1B3F A;  5BUU A;  3UN6 A;  3T9X B;  1JEU A;  2DWJ A;  3CFL A;  3RPL B;  1XVY A;  4WED A;  4C1U A;  1XHY A;  1NUX A;  3E9X A;  2P0S A;  3IB0 A;  2IEE A;  2UVJ A;  3FV2 A;  3ILU B;  4Z7E A;  3T93 B;  3S9L C;  1BP5 A;  1PBQ A;  4MBP A;  5ET7 A;  1SW1 A;  4FAJ A;  4O3B A;  3KSX A;  4ZED A;  5F7V A;  4FJP A;  1UTB A;  1NUW A;  4X1D A;  1Y9U A;  1SI0 A;  2REG A;  3OMB A;  2V4C A;  4FOR A;  2DWA A;  2ONR A;  3T1B A;  2F35 A;  2O1M A;  1QGX A;  2ZYO A;  2FIX A;  1QUJ A;  3M3F A;  4KCC A;  3RQT A;  2HPG A;  4XKR A;  3VXC A;  2QVU A;  2F3B A;  2CEY A;  1A55 A;  3GBB A;  3IOU A;  3K1M A;  3S9N C;  1FPD A;  1BTJ A;  4EDP A;  4P3L A;  1DBZ A;  3WAE A;  4C1T A;  3MP6 A;  1I6A A;  3Q27 A;  1VE4 A;  1DTZ A;  4JBZ A;  2XXQ A;  1NUZ A;  5ITP A;  2DYX A;  2THI A;  4GFR A;  3D4C A;  4JXI A;  4M4G A;  1LEV A;  4NX1 A;  4EQ7 A;  2BJI A;  1NV0 A;  1MM7 A;  1H43 A;  1RYX A;  1NH7 A;  2PMS A;  4JB7 A;  2I4C A;  3K1P A;  3QAX A;  5EQ9 A;  4L17 A;  4R73 A;  3FVG A;  3RGY A;  2HZL A;  1UTH B;  1MXU A;  5KZT A;  4KR5 A;  4M1V A;  2HHM A;  1GR2 A;  3QUJ A;  3K6X A;  4EXL A;  4RY1 A;  1INP A;  1IMD A;  1RYO A;  4GX3 A;  2ZZX A;  1IXI A;  4DLD A;  4G68 C;  1JET A;  5I84 A;  1IME A;  4NQ8 A;  3OEK A;  4DCY A;  3QK6 A;  4F19 A;  3C35 A;  4LN5 A;  2XWI A;  3EHS A;  2ZZW A;  2WYK A;  1LCT A;  3GLB A;  5H8F A;  3FJM A;  2D5W A;  2YPN A;  3GZG A;  4EQ9 A;  3OEM A;  4R9G A;  3IL1 B;  3RTF B;  3KJT A;  2DE2 A;  3LSW A;  4ZEI A;  3RYD A;  4YZZ A;  3TCH A;  5KDT A;  1PB8 A;  1LFG A;  1IMF A;  3KSJ A;  4IY5 A;  4PFU A;  4YMA A;  3OO6 A;  4I3E A;  3LUZ A;  5ET8 A;  4KYS A;  4AS4 A;  1LBV A;  1I6Q A;  1MS7 A;  3K0V A;  4MEV A;  3SDF A;  3W9V A;  1OLA A;  5EYG A;  3PPQ A;  1NFT A;  4H67 A;  4P9K A;  1Q1K A;  1OQG A;  4XFE A;  2VD3 A;  3KN7 A;  2F7C A;  4NWC A;  4GWS A;  5ET5 A;  2F78 A;  2I0B A;  1NV6 A;  3SEX A;  3N6U A;  3CG1 A;  3HHG A;  2ZNS A;  1LAX A;  4HCY A;  4XKP A;  2F36 A;  5I2N A;  2UXA A;  2FHY A;  5TP9 B;  4O8M A;  1OLC A;  4IY6 A;  3UGW A;  1MY4 A;  4ZEK A;  4KD5 A;  2X26 A;  2O51 A;  4IO3 A;  3CFX A;  3QYT A;  5K2X A;  1IIT A;  4NF6 B;  5DEX A;  4HW8 A;  3MVY A;  4YKP A;  4AQ4 A;  3SZP A;  3KZG A;  3OXN A;  4PDD A;  3NOH A;  1FPK A;  4F3B A;  4RA1 A;  4UAB A;  1IUD A;  2OK2 A;  3TKD A;  4FEB A;  3CHG A;  1WVJ A;  2IA4 A;  2Y5K A;  4F1U A;  4PFY A;  2QPQ A;  1BK4 A;  5FBP A;  2WX9 A;  4E0W A;  2DE4 A;  1NV4 A;  2PX1 A;  5H8H B;  1LB9 A;  4I1D A;  3LV0 A;  1EZP A;  3VLV A;  4P0I A;  3V83 A;  1MQG A;  4OVT A;  3RNN A;  4G61 A;  3D1R A;  3MUQ A;  2I3W A;  1B5I A;  3H6V A;  3HN0 A;  5DYH A;  5A5X B;  1FBG A;  3T96 B;  1Y20 A;  3T9V A;  2QVV A;  3RUM A;  1EYJ A;  3FD3 A;  3TCG A;  1MM6 A;  4I62 A;  4RNS A;  2GRV A;  4HE0 A;  4MLQ A;  3PPR A;  2UVH A;  4N17 A;  2HCA A;  5ICQ A;  4DI3 D;  2PFZ A;  2WYP A;  3TTN A;  4N8Y A;  5HM4 B;  2XX7 A;  3HCQ A;  1D4N A;  2RIN A;  3LSL A;  1YYZ A;  2Z8D A;  3IFA A;  3T0J A;  1FBP A;  1NUY A;  4XKQ A;  3I3V A;  4GXA A;  3BBR A;  1EH3 A;  1LBZ A;  1Y1Z A;  4QFN A;  2GQ1 A;  4U1O A;  3H6W A;  3SEU A;  4H6D A;  3Q26 A;  1JW5 A;  2KLF A;  3CFZ A;  3H6U A;  4H8I A;  4F18 A;  2B4L A;  1NMU A;  2QL3 A;  5AA1 A;  3VVF A;  2AL5 A;  4U22 A;  4EF1 A;  1SBP A;  5H8N A;  1NKX A;  3MW0 A;  4ZZA A;  4IR8 A;  5AA4 B;  5T3J A;  4IO4 A;  1RDZ A;  4OAN A;  1IEJ A;  1PB9 A;  4R6K A;  3N94 A;  4R9F A;  1B0H A;  2CEX A;  4H5G A;  4GX4 A;  1YTV A;  2ZYK A;  3TOD A;  1D9Q A;  3E79 A;  4GIZ A;  4IGR A;  2F6P A;  5H8Q B;  4C0R A;  1ANF A;  2OWZ A;  4F3G A;  3RPW A;  4MIJ A;  3U94 A;  3TPA A;  4OEV A;  3FJG A;  5H8S A;  1H44 A;  4LVQ A;  4G68 A;  4PE3 A;  3KC1 A;  4PQJ A;  1A40 A;  4GWW A;  1B32 A;  2OWT A;  4ONY A;  4WXJ A;  4BDO A;  3K4U A;  3C32 A;  1I6B A;  2O69 A;  4BDL A;  3K6U A;  1IXH A;  5IZ1 A;  4GWX A;  3FZV A;  3S4U A;  3MBP A;  1ZJL A;  4KFQ A;  1IMC A;  4DI4 B;  2PBW A;  3TUS A;  5ET6 A;  1P1W A;  4IO5 A;  1F9B A;  3RLF E;  1FPB A;  4DZ1 A;  5CBR A;  4MNC A;  1LFI A;  1XS5 A;  4NHB A;  1LBC A;  2F97 A;  4EUO A;  5CM6 A;  1FPI A;  1Y4C A;  3MWB A;  2AL4 A;  4MNI A;  5DVJ A;  3PUX E;  2UVI A;  3RT6 B;  3PD8 A;  3PPN A;  2DE3 A;  2F34 A;  3O29 A;  1YCJ A;  1KZ8 A;  4NGU A;  3MPK A;  3UA8 A;  1D9Y A;  3PUV E;  3MZ9 A;  4FAT A;  4MHF A;  1XC1 A;  2XX9 A;  3PV0 E;  4GD5 A;  4JVI A;  1IXC A;  1FTK A;  1RDY A;  2I3V A;  2V93 A;  3U1O A;  1B6H A;  2NXO A;  2NOO A;  1R9L A;  1FQE A;  1B40 A;  3DLN A;  4H46 A;  3O66 A;  4F29 A;  3OD7 A;  1SVX B;  3N6T A;  3JZJ A;  2Y7W A;  3IR1 A;  1MQJ A;  3PUW E;  1FPJ A;  4RPN A;  3KGC A;  5CRY A;  1DCU A;  2D21 A;  1OVB A;  1CNQ A;  2XXY A;  4HTG A;  1FPE A;  5ICT A;  5LTC A;  1B58 A;  1MY1 A;  1YXI A;  3KN8 A;  1AWB A;  3EQ1 A;  2BJJ X;  5AA2 B;  1URD A;  3O97 A;  4N07 A;  4NF5 A;  1G0I A;  4DE8 A;  3O6I A;  3ONM A;  2QMW A;  4OA4 A;  4XEQ A;  2RKM A;  4HE1 A;  4N6D A;  4F1Y A;  3ODB A;  1DTG A;  1PC3 A;  1JVX A;  1UQW A;  2XWK A;  1PEB A;  1CB6 A;  4XF5 A;  1RKM A;  3TZA A;  4E0X A;  3MVZ A;  1XI6 A;  4BDR A;  5FTH A;  4IB2 A;  5TU0 A;  1FQF A;  5I3S A;  1NV3 A;  1R6Z A;  4NF8 B;  4NAP A;  1B3G A;  3S9M C;  4ELQ A;  5L9S A;  4P1L A;  4NF0 A;  3C36 A;  3KJ7 A;  5ITO A;  4GL8 A;  2P3V A;  5IZZ A;  4PC9 A;  1FRP A;  3SER A;  2ZZV A;  2R8T A;  1B4H A;  3UP9 A;  4FEC A;  1R9Q A;  4I40 A;  4G8M A;  1FCK A;  3E13 X;  4LP2 B;  4RJZ A;  4O7I A;  4R72 A;  1PB7 A;  4O7M A;  4P1E A;  2WEF A;  4H8J A;  1MG1 A;  1MXX A;  4H1X A;  4AB5 A;  2F8D A;  3PGF A;  2JJK A;  3KFM A;  5I57 B;  4UAC A;  4NF4 A;  4G77 A;  3T9U A;  4Q8R A;  2QVR A;  2PVU A;  2UVG A;  4QRZ A;  5H8F B;  1N3X A;  4ZE9 A;  1A99 A;  4U2R A;  1URG A;  1XT8 A;  2Q2A A;  3RY3 A;  3UIF A;  3EHU A;  1SDX A;  1JW1 A;  1B0L A;  1JVY A;  3RT8 A;  2Q88 A;  2RC9 A;  2A5S A;  2ZYN A;  1IXG A;  1FW0 A;  3IK6 B;  2V3Q A;  2AYS A;  3PMX A;  1GTK A;  4U4X A;  2QFL A;  2GHA A;  2OWS A;  4X1B A;  2XXH A;  2Y7P A;  4XTC Q;  3EPE A;  2QRY A;  2XXU A;  1WDN A;  4F2Q A;  3LBS A;  3MVX A;  1LBX A;  2DDK A;  4YKK A;  3OO9 A;  4YU0 A;  1G0H A;  1UTH A;  5I2K B;  2B65 A;  4TLL B;  3FVN A;  4OHN A;  1B1X A;  1BLF A;  4QFO A;  3TCF A;  4ESW A;  2M8C A;  2FVZ A;  1D9V A;  5L9O A;  3B6Q A;  4P47 A;  3R26 A;  4DCX A;  4U21 A;  3CIJ A;  4HXV A;  1FQD A;  4TQU Q;  1FSA A;  2P3N A;  1KA0 A;  1B4Z A;  2A5T A;  1Z7M E;  4N4U A;  4PBH A;  3BIG A;  3PMW A;  2I58 A;  5ELV A;  1N04 A;  3VFJ A;  4JWX A;  2HFB A;  1MY3 A;  4EXK A;  2HZK A;  1NNP A;  1GGG A;  4DDD A;  4NED A;  1OQH A;  3PMV A;  2Z8F A;  1B1H A;  5L9M A;  4GWZ A;  2OCU A;  4ESX A;  1ELJ A;  3C31 A;  4X9T A;  1P99 A;  3M3K A;  2REJ A;  1FTM A;  2A5T B;  3A3C A;  2I48 A;  4QF9 A;  3FJ7 A;  4OER A;  1II5 A;  3BKI B;  1SW4 A;  3R7X A;  3K00 A;  2PYY A;  4ELR A;  2R6G E;  1IIW A;  2ZYM A;  4RK9 A;  2WBB A;  4U1Z A;  1N7X A;  3EHT A;  1B3L A;  4PCD A;  3TMG A;  5B70 A;  1NV5 A;  2XXR A;  5EYH A;  2HEU A;  3ILT B;  4Q5T A;  4QHQ A;  4OET A;  4ELO A;  2D3I A;  1MPD A;  1M5B A;  4GWU A;  2V84 A;  5I57 A;  1B3E A;  3OSR A;  4U4S A;  2GH9 A;  3KN3 A;  3QSL A;  3VVD A;  1ZIU A;  5IKB A;  1BKA A;  3CSB A;  1EZ9 A;  2XX8 A;  3KC0 A;  2ANJ A;  3P7I A;  5BWJ A;  5J1D A;  4FBP A;  4OVS A;  3C9H A;  1Y3N A;  3O9P A;  1VSO A;  3O2A A;  3FXB A;  1P1N A;  4IGT A;  1ZBM A;  4QSE A;  4P8B A;  4EF2 A;  1LGB C;  1NL5 A;  3VDF A;  2X7P A;  2QS3 A;  2F3D A;  2H5Y A;  4NF6 A;  4WKM A;  2ABH A;  2FYI A;  2F5X A;  4N6P A;  4DIG A;  4THI A;  2G29 A;  3JV9 A;  2G93 A;  2NWJ A;  4OFJ A;  5EQA A;  3U65 A;  4OFO A;  1VFE A;  3HST A;  4PDH A;  5LDZ A;  1SPI A;  1K9Z A;  4PGN A;  2GHB A;  3HPI A;  5I2K A;  1FTA A;  4OQO A;  1FJ9 A;  1K9Y A;  3CG3 A;  1EYK A;  1QUK A;  4O3C A;  1HSJ A;  1B5H A;  4PFB A;  5AA4 A;  4UA8 A;  2E0S A;  4MJO A;  1FPL A;  4F3S A;  2YJP A;  1HSE A;  1M5D A;  3PTY A;  1L5T A;  4YMB A;  4BLA A;  4KYD A;  4OFL A;  2E1S A;  1FBH A;  5FHM A;  3FXU A;  5AA3 A;  4Q0C A;  3SEV A;  1KA1 A;  2WBD A;  3A09 A;  5F24 A;  3B6W A;  2CZH A;  3FIR A;  2QS1 A;  1QKB A;  3U8Q A;  5I56 B;  2VGQ A;  2YLN A;  2AIX A;  3MP8 A;  5EYF A;  1FPF A;  3VVE A;  1EYI A;  4BDM A;  2UYF A;  4R2B A;  5A5L A;  2I4B A;  3O28 A;  1DPP A;  2Y5L A;  4I8C A;  5CMC A;  1AL3 A;  4HS7 A;  3K02 A;  1QVS A;  4PFW A;  1FBF A;  4TLM B;  2O7I A;  1MPB A;  4N81 A;  4ZEB A;  4PET A;  1TFD A;  4GF8 A;  4P0G A;  2RCB A;  2Y84 A;  4EQB A;  3K01 A;  5ESY A;  4OTE A;  3TDJ A;  2DWI A;  5J16 A;  2NUV A;  2O68 A;  4PAK A;  4NF8 A;  1MXY A;  1A8E A;  2Q89 A;  1MY2 A;  3TQL A;  5I58 A;  4OVR A;  3VLW A;  4KPT A;  4GVO A;  3MZB A;  3A3U A;  3ZKL A;  4PFI A;  3HFU A;  1J1N A;  4X48 A;  1FBE A;  2B4M A;  3IOW A;  4YIC A;  1T0K A;  1FBC A;  4OES A;  1M5E A;  1DMB A;  2QSX A;  4IO6 A;  4NWD A;  5A5X A;  1FTJ A;  1MY0 A;  1TT1 A;  1ZMG A;  4NMY A;  4FE8 A;  2XHD A;  2QS4 A;  3OO7 A;  3DP8 A;  1B7U A;  1MQD A;  2FNC A;  4BDN A;  3EKI A;  4JDF A;  1GVC A;  1A8F A;  3TEP A;  2HXR A;  2DVZ A;  3M8U A;  5IAI A;  3IJX B;  2H4I A;  5AE4 A;  3G3H A;  5FTI A;  1S50 A;  5I5P A;  3V5A A;  3IB1 A;  2DS9 A;  1N76 A;  3OO8 A;  1S9T A;  2XXW A;  1M5C A;  3FV1 A;  1FTO A;  2H99 A;  4IO7 A;  1ZU0 A;  3Q25 A;  1RDX A;  3G7W A;  1B7H A;  3S9E A;  5DW8 A;  3G3G A;  1JW4 A;  1S7Y A;  1MPC A;  1XVX A;  1QKA A;  4JSD A;  4MAG A;  5EHS A;  1EU8 A;  3A29 A;  3QXM A;  2F7A A;  2RC8 A;  3H6T A;  4ZEC A;  2P1S A;  3DEL B;  4H45 A;  5KDT B;  3K2D A;  1O63 A;  1Y1M A;  4YKJ A;  1FPG A;  3G3F A;  4QXD A;  4MNP A;  2R71 A;  3MST A;  4LA9 A;  1NI9 A;  4N91 A;  5HBC A;  4GLI A;  4ELP A;  1NV2 A;  2H25 A;  1NH8 A;  1PBP A;  3ISP A;  3KBZ A;  2ZNT A;  3C33 A;  2VPN A;  1PDA A;  2QJE A;  3CR9 A;  1QUI A;  4H5F A;  1MDQ A;  2DOJ A;  4P56 A;  2Y7R A;  1LST A;  3HV1 A;  2PFY A;  3Q29 A;  1O7T A;  1USY E;  4QBA A;  1VFD A;  1JNF A;  1WOD A;  4Z0I A;  3FVK A;  1MRP A;  2DSF A;  1KWH A;  2XD2 A;  3MVW A;  5L8D A;  2X7Q A;  5I56 A;  2CMO A;  3IX1 A;  4NF4 B;  5JEI A;  3SES A;  3UK4 A;  5TPA B;  5DT6 A;  1UIU A;  4KQP A;  2VD2 A;  2LAO A;  5I2N B;  4JSO A;  2O84 X;  4PE5 B;  1B9J A;  2P2A A;  2CZI A;  4F39 A;  3FBP A;  4K3F A;  4BDQ A;  3SKP A;  3QMF A;  3FGS A;  4NN3 A;  2WKY A;  2DXR A;  3ZKK A;  1DPE A;  3MYU A;  1BIY A;  4OMB A;  5H8Q A;  4ND9 A;  4N13 A;  1LBY A;  2ALU A;  1IMB A;  3G3K A;  5H8N B;  5EQ7 A;  2OZZ A;  3W15 C;  1TXF A;  1OIB A;  1QUL A;  4O3A A;  1Y4T A;  1LLS A;  1FTL A;  1NV7 A;  1B46 A;  3LSX A;  2B3F A;  3SEW A;  1XOC A;  2F7B A;  3R6U A;  5AA2 A;  5JTY A;  2DXY A;  3SET A;  3QUF A;  3B50 A;  4QSD A;  2Y7I A;  3RPL A;  1FQB A;  4JWO A;  3V89 B;  1N84 A;  4ECF A;  4LQ2 A;  3H7M A;  4QSC A;  1O64 A;  2HXW A;  1MH3 A;  2QMX A;  3LUY A;  5K2Y A;  3DM0 A;  2HAV A;  3AXF A;  2FBP A;  5FHN A;  4G68 B;  4ZZE A;  3LSF B;  1D3K A;  3PU5 A;  1OVT A;  2Q9T A;  5EHM A;  4AS5 A;  4LAT A;  1JP4 A;  3HHF A;  4HCW A;  4U23 A;  4R6H A;  1P1U A;  4GQO A;  3E3K A;  2H98 A;  3MPL A;  1LAG E;  4KI0 E;  4OYV A;  3VLU A;  3T66 A;  1A54 A;  2DP8 A;  3LC8 A;  4NTL A;  1SYI A;  1US4 A;  4JVD A;  4ZDM A;  3B8B A;  4G8N A;  1AH5 A;  1SI1 A;  2VT5 A;  4LQ5 A;  4X8R A;  2CZL A;  3K1N A;  3KEI A;  1LBW A;  3PPP A;  1SD3 A;  5IZ3 A;  4NE4 A;  1VDW A;  4R6Y A;  3H4Z A;  1US5 A;  1B5J A;  4PBQ A;  3MC2 A;  2XXP A;  4OVQ A;  3G3J A;  2UYE A;  3RTW B;  2R9J A;  2HQ0 A;  1NV1 A;  3EF7 A;  2QS2 A;  2V3U A;  3ZSF A;  1AMF A;  3UOR A;  5CC2 A;  3C4M A;  2XXI A;  4AB6 A;  4O94 A;  3WAF A;  4POX A;  3O6H A;  1MQI A;  5CBS A;  2Z8E A;  1B7Z A;  1H45 A;  2I6E A;  2NVU B;  3KOS A;  4NG7 A;  3FVO A;  4R75 A;  5IM2 A;  2O7U A;  3GXA A;  3I6V A;  4KHZ E;  1YAE A;  3T9H B;  1DK4 A;  1HSL A;  4F31 B;  4F22 A;  1SQY A;  4RYA A;  1ZKB A;  4F2O A;  3CVG A;  1JEV A;  3CSG A;  3FXQ A;  3IO6 A;  4WEP A;  4ZE8 A;  2KQZ A;  3USD A;  4YB7 A;  1P1O A;  2XXV A;  5LOM A;  1NNK A;  3TTR A;  5H8H A;  4G2Z A;  4YKI A;  3M3L A;  1URS A;  4X04 A;  3IOT A;  1R1N A;  3H06 B;  5DTB A;  4IO2 A;  3BFU A;  4GRK A;  4DXC A;  3VV5 A;  1MXV A;  1YPN A;  5DEX B;  3JYR A;  5JK4 A;  4R2F A;  2ONK E;  4YB5 A;  4GBV A;  5CMM A;  3KG2 A;  3CRB A;  1B3H A;  2FA7 A;  1AIV A;  2GFE A;  4TOZ A;  3H3G A;  4RXL A;  3IOR A;  3B6T A;  4QFK A;  2RF1 A;  5I58 B;  3U72 A;  4MF3 A;  2RC7 A;  1LCF A;  1LB8 A;  3PD9 A;  1POT A;  4PFT A;  1CE2 A;  2XXT A;  2VP1 A;  4MX6 A;  1Y3Q A;  3E78 A;  3K6W A;  5I59 A;  4OXV A;  3PUZ E;  2OLB A;  3ZS6 A;  4OZ9 A;  3KOT A;  4MLV A;  4GOT A;  2V25 A;  2Q2C A;  3KBR A;  3N26 A;  3IAZ A;  2VHA A;  4F3P A;  4R74 A;  3TQW A;  4JWY A;  1USY H;  1SYH A;  1I69 A;  3ROJ A;  3ECR A;  2XWV A; 
#chains in the Genus database with same CATH homology
 3T1B A;  1FJ9 A;  1K9Y A;  4GWZ A;  1EYK A;  4OA4 A;  4PF8 A;  3CHG A;  1QGX A;  1FPI A;  4XEQ A;  4PFI A;  2FIX A;  1NV2 A;  4PFB A;  2Y5K A;  4X9T A;  4F1U A;  4HE1 A;  4MCO A;  4MNI A;  4N6D A;  3HFU A;  4MJO A;  2QPQ A;  4HE2 A;  5IZ3 B;  1BK4 A;  1FPL A;  2WX9 A;  2KQZ A;  3W9W A;  2MKZ A;  3ISP A;  3KBZ A;  5FBP A;  2DE2 A;  2HPG A;  2CZK A;  4IR8 A;  2DE4 A;  2VPN A;  1FBE A;  1NV4 A;  2B4M A;  2FIE A;  2QVU A;  2XWK A;  2F3B A;  5ESY A;  2CEY A;  4PAF A;  4YIC A;  4PFR A;  2V3Q A;  3PTY A;  2FBP A;  4YZZ A;  3RYD A;  1RDZ A;  1FBC A;  4XF5 A;  2DE3 A;  3LV0 A;  1FBD A;  1FPD A;  1XI6 A;  2QFL A;  4P56 A;  5CM6 A;  4JVC A;  1IMF A;  4P3L A;  2Q9T A;  2PFY A;  2WBB A;  4OAN A;  1KZ8 A;  1DBZ A;  1Q9D A;  1FBH A;  4PGP A;  4X04 A;  5EQ8 A;  2XA5 A;  1NV3 A;  4NGU A;  4OVT A;  4I3E A;  1JP4 A;  2CEX A;  4HCW A;  4G61 A;  4PAI A;  4QBA A;  3LUZ A;  4PCD A;  3D1R A;  5ET8 A;  2PCR A;  4NAP A;  4PF6 A;  4AS4 A;  4MMP A;  1LBV A;  1KA1 A;  2WBD A;  4GX4 A;  1NV5 A;  1LBX A;  2DDK A;  5EYH A;  4MEV A;  2XXK A;  4P1L A;  5F24 A;  1G0H A;  2CZH A;  4MHF A;  1NUZ A;  4NF0 A;  5T3J A;  3W9V A;  1FBG A;  5EYG A;  5ET7 A;  3EKI A;  5IGA A;  2VPO A;  5JK4 A;  4JVD A;  4GWU A;  1D9Q A;  3E79 A;  3B8B A;  4GBW A;  4JVI A;  4P9K A;  1LEV A;  2P3V A;  2QVV A;  2HXR A;  4XFE A;  2DVZ A;  4NX1 A;  4GBV A;  1EYJ A;  2VT5 A;  3BIH A;  4PC9 A;  5IZZ A;  4N15 A;  2BJI A;  4X8R A;  1NV0 A;  1FPF A;  1FRP A;  1LBW A;  1RDY A;  1FJ6 A;  1EYI A;  2ZZV A;  5I5P A;  2R8T A;  5IZ3 A;  5A5L A;  1VDW A;  3KC0 A;  4PBQ A;  2FVZ A;  4GWS A;  4HE0 A;  5ET5 A;  2CZI A;  2ZZW A;  1NV6 A;  2OWZ A;  4MIJ A;  2Y5L A;  4N17 A;  4OVQ A;  3RPL B;  5J1D A;  4FBP A;  4OVS A;  4P47 A;  3FBP A;  4DI3 D;  3IFC A;  4I40 A;  1FBF A;  3QMF A;  4PTK A;  4H46 A;  4NN3 A;  4PE3 A;  2KR0 A;  3KC1 A;  4HXV A;  5EQ9 A;  4HCY A;  4GWW A;  4O7I A;  1NUX A;  1NV1 A;  2PFZ A;  2WYP A;  4N81 A;  3FXB A;  3MYU A;  1FSA A;  1RDX A;  4N8Y A;  4N8G A;  2HZL A;  2P3N A;  2FHY A;  1KA0 A;  4O7M A;  4P1E A;  4P8B A;  2WEF A;  4PET A;  5DW8 A;  4AS5 A;  4O8M A;  4M1V A;  2HHM A;  4OVP A;  1LBY A;  1FPJ A;  1IMB A;  2F3D A;  3GYY A;  4O94 A;  2Q74 A;  1YYZ A;  4N4U A;  1DCU A;  2F5X A;  3IFA A;  1CNQ A;  2JJK A;  1INP A;  4KXP A;  1IMD A;  4MAG A;  4MX6 A;  4PBH A;  3BIG A;  5EQ7 A;  3E78 A;  3T0J A;  4F1V A;  1FPE A;  1IMA A;  3A29 A;  1FBP A;  4GWY A;  5J16 A;  5IZ1 A;  4GX3 A;  4GWX A;  2Q8M A;  1NUY A;  2ZZX A;  5I7I A;  1NV7 A;  5LTC A;  4NG7 A;  4N91 A;  2QVR A;  5EQA A;  1YXI A;  4H45 A;  4I3Y A;  1NUW A;  3U65 A;  1IMC A;  4GX6 A;  5IM2 A;  4PAK A;  1AWB A;  1IME A;  1LBZ A;  4DI4 B;  2HZK A;  5ET6 A;  4N6K A;  2OX3 A;  1FPG A;  2V4C A;  1YZ0 A;  4NQ8 A;  4PDH A;  3RPL A;  3SZP A;  5LDZ A;  3ROJ A;  1DK4 A;  1FPB A;  1SPI A;  2GQ1 A;  2L5V A;  3B50 A;  4PDD A;  1G0I A;  3NOH A;  4F19 A;  1K9Z A;  1FPK A;  4PGN A;  4LN5 A;  4MNC A;  2XWI A;  4UAB A;  4QXD A;  4MNP A;  3MST A;  4NHB A;  1NI9 A;  1FTA A;  4OVR A;  2WYK A;  5I3S A;  4F18 A;  2B4L A;  2XWO A;  2XWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...