4O8MA

Crystal structure of a trap periplasmic solute binding protein actinobacillus succinogenes 130z, target efi-510004, with bound l-galactonate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
303
structure length
303
Chain Sequence
ETEIMVAYGNQPGEPIDKAMHFWADKVKEKSNGDIVFKLFPSSQLGSETEVLEQAKFGANIITISDYGALMDIVPDLGVINAPYISQSFEKKSKLLHSDWFKDLSDKLDQHDIHIIVPDVIYGTRHLLTKKPVTKPSDLKGMKVRVQHSRLFLQTINAMGGVPTPMSLSDVYPGLSEGIIDGLENPTVVLFGGKFFEVAKNLNLTAHTKHMSPFVAGTAFWNNLTPEQQKIIVDASREMVTYGGGLIEQAENEALENLKKAGVTVNDVDLPAFEASVADVISTGFPEWSPNLYKNVQEKLSQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Actinobacillus succinogenes
total genus 105
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o8mA00
4X04A 4PCDA 5IGAA 4OVPA 4YICA 4NF0A 4P56A 2HZLA 2XA5A 4MAGA 4P9KA 4PGPA 4N6DA 4OANA 4PETA 4PAIA 4NG7A 4N8GA 4PC9A 3U65A 4NGUA 4PF6A 4OVSA 4MIJA 2VPOA 4OVTA 5LTCA 2ZZXA 4PF8A 4N6KA 4XFEA 5CM6A 2CEYA 4N17A 4N15A 4NHBA 4MNIA 5I5PA 2VPNA 2XWVA 4NQ8A 4MHFA 2HZKA 4PFRA 2WYKA 4XEQA 4DI4B 4P47A 2XWKA 2ZZVA 2PFZA 2V4CA 2WX9A 2HPGA 4MEVA 2XWIA 4MNCA 4YZZA 4O94A 4MNPA 4NAPA 4N8YA 4N91A 4P8BA 4OA4A 4PFBA 4PDDA 3GYYA 4PAFA 2XXKA 5I7IA 4O7MA 4MCOA 4P1EA 4P3LA 4UABA 4OVQA 4O8MA 4PFIA 4LN5A 3FXBA 2PFYA 2ZZWA 4OVRA 4X8RA 4PE3A 4NN3A 4NX1A 3B50A 4DI3D 5IZZA 4MMPA 2XWOA 4XF5A 4PGNA 2WYPA 4P1LA 4PDHA 2CEXA 4MX6A 4PBHA 4PBQA 4PAKA 4N4UA 5IM2A
chains in the Genus database with same CATH superfamily
2OLBA 4KHZE 1FJ6A 4N6PA 2R71A 1DTZA 3O6IA 4JWYA 4H1XA 2XX8A 1NUYA 5FBPA 1LAHE 4PETA 3RPLB 4F2OA 2Y5LA 1SYHA 3Q29A 2QRYA 3RGYA 3SEXA 2CMOA 2UVJA 2HXRA 3FVGA 4XKRA 4OVTA 1B46A 4N6KA 4N15A 1IMDA 4F2QA 5EQ9A 4F19A 3MP8A 3FVKA 3T9VA 4GRKA 3VV5A 2RCBA 3OELA 1AL3A 3V8XB 2G29A 2UVHA 3U1OA 1RYOA 2Y7WA 2I3WA 3PPOA 3THIA 2O1LA 4O94A 2XD2A 2Z23A 4NF5A 3EN3A 4OEVA 3N26A 4OHNA 4G77A 5I56B 2UYFA 2XXPA 1JQFA 4GVOA 4LN5A 4JSDA 1L5TA 2QL3A 1URGA 5KCJA 4DCYA 3LSLA 4DI3D 2DS9A 4YKIA 2UXAA 1TFDA 1B3HA 4IO3A 3IAZA 5EHSA 1SD3A 4MX6A 4PBQA 3WAEA 4PAKA 4WEDA 4FEBA 3USDA 2I6EA 3K6VA 4QFNA 1B2HA 3EPEA 2VP1A 1B05A 3S9LC 4XKQA 4G8NA 5CBRA 3TMGA 5I2KA 4KFQA 3K6WA 3KFMA 4OVSA 3DP6A 3FIRA 1DOTA 3CIJA 1BTJA 1YAEA 1MQJA 3B6TA 2XXXA 1RDXA 4OETA 3MJNA 1NFTA 1IZ1A 2Q88A 3KGCA 3C35A 2O6AA 5DTBA 1IXHA 4ZZAA 3S4UA 5F7VA 1LBZA 5TP9A 1USYE 3QYTA 3HFUA 1Q9DA 3O6HA 3IJXB 3CRBA 2PBWA 1GVCA 2XXWA 4PAFA 3K0VA 3FBPA 3SEYA 1PB9A 3A09A 2HAVA 2I4CA 2O7UA 3BBRA 4ZEBA 2R8TA 3KG2A 1FPJA 3ODBA 4IB2A 1NNTA 1SW5A 3E4RA 3M3LA 2REJA 1A99A 1LGBC 3C32A 2DWIA 1H43A 3MP1A 3KN8A 4IGTA 4R72A 3VLVA 1H76A 1XVXA 3E78A 1LFGA 1FRPA 3B7DA 3LC8A 2F7BA 2UYEA 1DSNA 1IXGA 1MH4A 4HCWA 4QBAA 4BDRA 4YICA 1RDZA 4LZ7A 1TFAA 4U21A 1AWBA 5J1DA 2RKMA 4JBZA 1NV0A 1UIUA 1FPIA 1PEBA 1I6QA 4NF6B 4NG7A 2XXHA 4MLVA 1FTMA 5H8QB 3RT6B 1DCUA 3PPQA 4IY6A 3U93A 2DE2A 5KZTA 1IIWA 2NWJA 3TTMA 4X9TA 4KYSA 2OBGA 3LSWA 1ZIUA 2CZLA 2XWVA 2HEUA 3PU5A 2XXYA 2E0SA 4JWOA 2H25A 4P0GA 3Q25A 2QS4A 4KCCA 1INPA 4GIZA 3ONMA 1N84A 4BDQA 2XXKA 4O7MA 4KR5A 1GV8A 2HQ0A 1NV3A 2Y7KA 3BFTA 2XXTA 4DDDA 3V89B 1FSAA 4GWOA 1IXCA 3K1PA 3VXBA 4DLDA 4BDNA 4LQ5A 2F97A 1JNFA 1DBZA 4PBHA 2DXYA 3HPIA 2W7YA 4GXAA 4FAJA 4IR8A 5IGAA 3CI8A 3E9XA 3TTNA 1TT1A 4NF8A 4OFLA 1B0LA 1ZTYA 3FASA 1FPBA 1PB8A 1NNPA 2Y84A 3KBZA 2Y7PA 1J1NA 5K2YA 2QVRA 4JWXA 3JV9A 4PF8A 4AS5A 5I2NA 4JXIA 3G3GA 1SPIA 2P3NA 4H46A 3TAJA 4H5FA 5M2VA 1XOCA 3CSGA 3HHFA 3RTWB 2DDKA 3MBPA 4NQ8A 5I59A 4X48A 2WEFA 2V3TA 5ESYA 3KJTA 4PFRA 3TCGA 5B70A 4I9DA 2V4CA 3H7MA 5DVIA 2HPGA 4MEVA 5AA2A 2ZYOA 3VXCA 5L9SA 2V3QA 4NAPA 3BIGA 4KYEA 2KLFA 2ABHA 4YKKA 1D3KA 4ND9A 2LAOA 3GYYA 3TCFA 1SVXB 2P3VA 2PCRA 4P3LA 4FORA 3SEVA 1B1XA 1G0IA 3K1NA 4PE3A 4F31B 3T66A 2WBBA 2XD3A 3GLBA 4PTKA 3M8UA 4PDHA 2CEXA 3T0JA 4KCDA 3LR1A 1MQDA 3FXUA 4X04A 3OENA 4RXLA 5H8FB 4M4GA 5CBSA 2Y7RA 1S9TA 4NF0A 4NTLA 4TLMB 2THIA 3U8QA 3SZPA 2FYIA 5AA4B 2HCAA 3OEKA 4R73A 4L17A 4QF9A 1BP5A 1JW5A 1VDWA 4GBVA 3H6WA 2F7AA 3QMFA 5H8NB 2V3UA 3IR1A 3ILTB 4GWSA 1OIBA 5EQ8A 1Q1KA 4XKPA 3LUYA 2H9BA 4N13A 5IZ3B 5I57B 1II5A 3TZAA 3IFCA 1DK4A 3Q27A 4DI4B 3LV0A 2GH9A 3IO6A 2NXOA 2ONKE 5F24A 2CZKA 1NUZA 1JVXA 2WX9A 2GFEA 3IOUA 2XWIA 2ZNUA 4F1YA 2L5VA 1MXZA 1NV4A 1SDXA 4QSDA 4QXDA 4TLLB 1SW2A 2BJJX 4RK9A 1JETA 1MG1A 3FZVA 2RF1A 4OWDA 4AB6A 1B32A 3DELB 3QSLA 4POWA 4GWZA 2O1MA 4EF2A 4P0IA 4U22A 3JZJA 3K02A 1AMFA 2Q8JA 1B3LA 2X7QA 4LA9A 4N4UA 2O69A 2WKYA 3RT8A 1FQFA 1KA0A 4G68B 1N04A 3IOVA 5JTYA 2Z8EA 4OEUA 3RPWA 2CZHA 2YPNA 2DVCA 1NMUA 3E13X 1FQEA 4HE0A 3U65A 5I58B 1G0HA 3FV2A 1S50A 3TTLA 4ZDMA 4HTGA 3CR9A 5CMMA 3HSTA 4RK2A 1B40A 1MY4A 5I5PA 3H6VA 1B58A 3MVZA 4ISUA 3H3GA 1JVYA 2HZKA 2RC7A 3LSXA 2B3BA 2ZMBA 4GOTA 2I0BA 3TELA 2D21A 1MPCA 1MPBA 4H0WA 3TYHA 2E1SA 3QK6A 1N7XA 4JVCA 3PUWE 3PUZE 2XXQA 1F9BA 4GBWA 4HE2A 4YB6A 1DPEA 1FBEA 3QAXA 3OO6A 2HHMA 4I8CA 4X8RA 2ZXTA 2CZIA 1T0KA 3MQ9A 1Y4TA 4NX1A 4C0RA 1QW0A 4WXJA 1GTKA 4YB7A 1Y3QA 2VGQA 5B7DA 5H8QA 1B0HA 1MXWA 1QUKA 5L9MA 1LBBA 1LBXA 2ZYNA 3KSXA 3UA8A 2DXRA 2DP8A 1M5CA 2B3FA 3SKPA 3ILUB 3FGSA 3RLFE 5ITOA 1POTA 2P0SA 1UTBA 4MH5A 4PCDA 3O9PA 1IMCA 2XX9A 4U1OA 3TTKA 3SDFA 2HZLA 2Q74A 2Q9TA 4BDOA 3CG1A 5IAIA 3TCHA 5ITPA 5JEIA 2OWSA 1MY2A 1D9VA 3O97A 1PC3A 1ZU0A 3UGWA 1LLSA 3TQWA 2DVZA 5EYGA 1Y4CA 1EZOA 3PMWA 1MQIA 1Z7NE 4N17A 2RCAA 3KSJA 1FTJA 5CMBA 3QUFA 1B5JA 1SW1A 3PPNA 4IO7A 4NE4A 1POY1 3K6UA 1N7WA 1NH8A 4RYAA 4UACA 1MQHA 4KYDA 4NEDA 3KC0A 4P11A 5TU0A 4C1TA 4AQ4A 4I40A 1AOVA 1Y3PA 2Q2AA 4EDPA 2PVUA 2V25A 1LBYA 1XC1A 1FTKA 2QVUA 2I58A 3N5LA 4QFKA 2A5TA 3OO7A 3DP8A 5ICQA 2F3BA 4O8MA 1MY1A 5AE4A 1ELJA 4U4SA 1QKAA 4ONYA 3CG3A 3E79A 4LVQA 1FTAA 1OLCA 4ELOA 1BKAA 1VFDA 4BDLA 3QIMA 5DEXB 4LP2B 4XIGQ 3FVNA 3KOTA 3EHUA 2QMWA 4THIA 3PUYE 2Z22A 2PT2A 3TKDA 5CMKA 2O7IA 4FECA 3SEUA 4F3BA 2UVIA 1LEVA 2QSXA 3IB1A 3VVEA 3IK6B 3G3JA 4MJOA 1ATGA 4IGRA 4P9KA 4PGPA 5H8HA 3HCQA 3IB2A 4LATA 2ALUA 3B6WA 4N81A 3KBRA 4YB5A 2DOJA 4IO4A 4PC9A 3OMBA 3WAFA 1LAXA 3VE1B 3PPPA 4FBPA 1FBDA 5CM6A 1OQHA 4YU0A 3T1BA 1IEJA 4GWUA 1QUIA 2F36A 3HV1A 1SBPA 1OLAA 3FXRA 3KN3A 2GRVA 1ANFA 2D5WA 1M5FA 1IMBA 2AL4A 2WYKA 1IQ7A 3TODA 3C34A 2Z8FA 2I48A 1D9YA 1A40A 2OX3A 3TPAA 3PMVA 4IO2A 4GQOA 2QMXA 3SETA 3R6UA 2VOZA 3RTFB 2NUVA 4GWXA 2RC9A 3MVWA 3I6VA 3MC2A 4UABA 3ROJA 2GHAA 1P1OA 3C36A 2V84A 1NH7A 4BDMA 1FJ9A 3UP9A 2ZYKA 1IITA 3MVXA 3H6TA 2BJIA 4GWYA 5KCJB 3IOWA 1IMEA 1NUWA 2I3VA 1Y9UA 4EXLA 2QS1A 3G3KA 3FJ7A 5KDTB 4FATA 5H8NA 4GFRA 2F78A 1US5A 1UTHA 3HO7A 3T9XB 2DQVA 4DZ1A 2IA4A 2FNCA 4H5GA 1BIYA 4OVJA 2F5XA 1FBGA 3IL1B 1K9YA 1B3EA 3MSTA 3MUQA 3EQ1A 1B5IA 4WKMA 2YLNA 3RNNA 2QVVA 3MPLA 4NGUA 3VVDA 2O51A 3FUZA 4GX6A 2DWHA 5I2KB 1N3WA 1Y3NA 4H65A 1FQBA 3ZKKA 5LOMA 3KEIA 2F8DA 1Z7ME 2ONRA 3RY3A 1ZKBA 3TTRA 1FBPA 3MZ1A 5J16A 1FBFA 1XVYA 4O7IA 3FJGA 1B6HA 4U2RA 1VR5A 3RQTA 1JEVA 5CI5A 2XWKA 4DXBA 2HAUA 1M5EA 3ECRA 2OZZA 1FPFA 1FBCA 1M5BA 4ZE8A 3F11A 4XKNA 4XTCQ 4PDDA 5FTHA 3FXQA 5I7IA 2VD2A 1UQWA 1NV1A 1EU8A 3SESA 4G68A 4QHQA 4LONB 2PFYA 1QVSA 4QFPA 3T9UA 1URSA 4NF4A 4MMPA 1IMAA 2GQ1A 3CSBA 1PBPA 4GF8A 4MFIA 1EYKA 1I69A 1B4HA 5TPAB 1H45A 1UIVA 3MW0A 1R9LA 4G8MA 4LZ5A 1RDYA 4FJPA 3I3VA 4OVPA 3RPLA 4RA1A 3M3FA 4OMBA 4E0WA 4YKJA 4RNSA 1NUXA 3ZSFA 1P1NA 5ELVA 3VFJA 3B8BA 3UORA 4MNIA 4HS7A 2XXRA 2IEEA 4GWWA 3HN0A 5IKBA 4F22A 3CFXA 5A5XB 4XEQA 5CMCA 2F3DA 3DM0A 3EF7A 3FV1A 1YXIA 4DXCA 3RYDA 4I1DA 2VD3A 4E0XA 4H67A 2FIEA 3PV0E 4Q5TA 5I56A 3FJMA 1B52A 2NOOA 4OENA 3W9VA 3U94A 4F3SA 5BWJA 2HXWA 2X7PA 2FA7A 3CFLA 1QKBA 1ZBMA 3QXMA 3U72A 1MS7A 4ELQA 2ZYMA 2F6PA 4O3AA 2F35A 1D9QA 5BUUA 2XWOA 4NWCA 3N6UA 3W15C 1XT8A 2XX7A 4RPNA 2M8CA 1GR2A 1PB7A 2WBDA 4GL8A 3FATA 4YKPA 1LAGE 4FEDA 4P56A 2DE3A 4U23A 3TQLA 1BLFA 1B7UA 3C33A 4HW8A 4PAIA 1LCFA 1LFIA 1O63A 4YMBA 1B4ZA 2ZNSA 1FPLA 1EH3A 1O64A 1ZJLA 2O84X 4KQPA 4QSEA 4OERA 4F1UA 4F29A 3GZGA 5I2NB 1NV6A 3IB0A 3VLWA 1CE2A 1N0TA 1AIVA 3D1RA 5DEXA 1NNFA 1IXIA 1MQGA 4YZZA 1KA1A 2O68A 2H98A 4MNPA 4IO6A 1SI0A 5ICTA 1JW1A 3W9WA 1NI9A 3T9HB 1B7HA 4IY5A 4PP0A 5AA2B 4OA4A 4OXVA 3KZGA 3PMXA 4MLQA 1B9JA 1FPEA 1NL5A 4TQUQ 3OSQA 3R7XA 3FXBA 3V5AA 3S9EA 3FD3A 1JP4A 5HPQA 3B50A 4DE8A 5IZZA 3C31A 3RUMA 1LBCA 2HFBA 2I0CA 4UA8A 4QRZA 3VLUA 3KN7A 3S9NC 3PPRA 2Z8DA 5EYFA 3K2DA 1LSTA 1TXFA 1O7TA 4O3CA 1EZPA 1MXVA 2ANJA 4MBPA 4G8HA 4ECFA 1LBWA 2ONSA 4NF6A 5DVFA 4N6DA 1VFEA 1I6AA 3S2VA 3C4MA 4G61A 1A8EA 4R6KA 3DLNA 3IOTA 1MM6A 2QS3A 3TEPA 1XHYA 5LTCA 1MDQA 1R6ZA 2CEYA 5HBCA 3G7WA 3E3KA 1YYZA 1LCTA 3H03A 2I4BA 4NHBA 4ELPA 3IORA 1FPKA 3MZ9A 3ISPA 4I3EA 2VPNA 3PD9A 1NKXA 4AB5A 4Q8RA 5FHNA 1NNKA 5EQAA 1MXUA 3MYUA 1N76A 5ISUA 5F1QA 1HSLA 2JJKA 2Y7IA 1LFHA 4R6HA 3AXFA 3MP6A 2QPQA 1US4A 4X1DA 3OSRA 4I62A 1YCJA 5DVJA 4H8IA 4N91A 4G2ZA 3S9MC 5KDTA 1SW4A 4PFBA 4LZ8A 1HSEA 2AL5A 3PD8A 5DW8A 4MCOA 3K1MA 3TUSA 3G3HA 1FPDA 4OESA 4EQ7A 1B1HA 4PFIA 2H4IA 1FTLA 4QFLA 5AA1A 3PTYA 4EF1A 3H4ZA 4PE5B 4OTEA 3VDFA 3UIFA 4EQ9A 3ZKLA 3C9HA 2PMSA 2Y5KA 2V93A 4JVIA 3H6UA 2X26A 4JSOA 1B3GA 5IZ1A 4F3GA 4POXA 2Q89A 2NVUB 2XXUA 4PQJA 5ET8A 1NV5A 2FBPA 2OCUA 1H44A 4ZZEA 4F3PA 2KQZA 3K6XA 1FPGA 5K2XA 4PFWA 4HXVA 1A7LA 5JTYB 4N8GA 1A54A 3IJOB 2XXVA 5ET5A 4JDFA 1A8FA 4F18A 1B5HA 1PBQA 3H06B 1SI1A 2UVGA 5FHMA 4OFJA 2VT5A 5LDZA 1TWYA 2DWAA 5ET7A 3LUZA 4YMAA 4M1VA 1MM7A 3TDJA 1A55A 1QGXA 3K00A 3BFUA 4K3FA 1NV7A 3MWBA 1MRPA 4Q30B 1KWHA 2KR0A 4KXPA 1FBHA 2AYSA 4R9FA 1QUJA 2REGA 3GBBA 5TPAA 3A29A 4KD5A 5FHOA 1RYXA 2XXIA 2R6GE 3RN8A 1B51A 4GD5A 4H45A 4OVQA 3L6HA 4LQ2A 4F1VA 4U1ZA 1OVBA 1XS5A 3CHGA 3K01A 1R1NA 2PYYA 4OFOA 2F34A 1CB6A 2OK2A 5CRYA 2WYPA 4DIGA 4PFYA 5H8FA 4NF5B 4YAHX 2OWTA 3TFLA 1LAFE 1S7YA 3GBAA 3BIHA 3MVYA 5I3SA 4Z7EA 4R6YA 1ZMGA 5AA4A 1UTBB 4NMYA 2XA5A 3B6QA 3O28A 5A5XA 1QJMA 4HE1A 1OQGA 4IO5A 2I49A 4NWDA 1ZLQA 1YPNA 2VPOA 2ZZXA 3FVOA 4XFEA 4HCYA 1EZ9A 5I84A 2DE4A 1YZ0A 1LB9A 2H5YA 5IZ3A 2QS2A 5JK4A 5L9OA 5I57A 4C1UA 3PUVE 4TOZA 2AIXA 4MHFA 4GL0A 4GLIA 1P1UA 1AH5A 1MY0A 4H6DA 4ZEDA 3CFZA 5HM4B 2P1SA 3U92A 4EXKA 1H3DA 1P99A 1R9QA 4MNCA 5A5LA 4AS4A 3UK4A 4JB7A 4P8BA 2F6GA 1FQDA 3OOAA 4EQBA 4H8JA 4FIMA 2A5TB 3JYRA 2G93A 2ZZWA 4X1BA 4N07A 2FHYA 4NN3A 1MY3A 2OWZA 5EQ7A 4R2FA 4DXUA 5TP9B 3BKIB 4ZE9A 1OVTA 4P1LA 3GXAA 1Q35A 2B4LA 5T3JA 1M5DA 4R74A 4GX4A 4RY1A 5IM2A 3HHGA 4EUOA 1Y1MA 3IO4A 5L8DA 5FTIA 3O2AA 4RPOA 4MAGA 3A3UA 4ZEFA 2FVZA 1EYJA 5DYHA 5H8SA 3UN6A 5I58A 5H8HB 4GX3A 1DTGA 3VVFA 3OEMA 1IUDA 1D4NA 3I5OA 4PF6A 4MIJA 3V83A 4LUBA 4PFTA 1I6BA 2RINA 4FE8A 3G3FA 3T93B 4I3YA 2P2AA 5ET6A 3KC1A 3IFAA 4ZECA 1SYIA 4P47A 3N6TA 3QUJA 2ZZVA 2PFZA 1XI6A 2DSFA 2XHDA 1FQCA 4OYVA 4N8YA 1OMPA 4GXSB 1FQAA 1MXXA 5EHMA 3O66A 3Q26A 1PDAA 4P1EA 3OO9A 2H99A 5AA3A 1FW0A 3G3IA 3IX1A 3D4CA 4F39A 5CC2A 3OXNA 1EYIA 4OVRA 3EKIA 1NV2A 2B65A 3O29A 2VHAA 3LSFB 4ELRA 4QFOA 4XF5A 2R9JA 1WODA 4WEPA 2A5SA 4PGNA 1DMBA 1LB8A 4KI0E 4QSCA 3L6GA 1CNQA 1RKMA 1LBVA 4JVDA 1K9ZA 3SEWA 4ZEKA 3N94A 2MKZA 3A3CA 3SERA 1DPPA 1JW4A 4R2BA 3P7IA 4R75A 3T96B 4Z0IA 1P1QA 1QULA 3MZBA 4ESXA 1UTHB 4OANA 3MPKA 2PT1A 4ZS9A 4ESWA 1MH3A 3PGFA 2Q8MA 1MPDA 2Q2CA 2PX1A 3KOSA 4OQOA 3CVGA 2ZNTA 2F7CA 2DYXA 1WVJA 2GHBA 2B4MA 3OD7A 3LBSA 4MF3A 3DP4A 1FTOA 4XXUA 3Q28A 2OJTA 4NF8B 4Q0CA 1N3XA 1Y20A 3OO8A 3KJ7A 1GGGA 3NOHA 4OZ9A 1BK4A 1P1WA 3EHTA 4O3BA 5AA2D 1Y1ZA 1IMFA 4U4XA 3D4GA 4DCXA 1USYH 4R9GA 5EYHA 2QFLA 4G4PA 1MXYA 4RJZA 1YTVA 3EHSA 2DWJA 2D3IA 2RC8A 1JEUA 4BLAA 1MDP1 3R26A 1B3FA 5DT6A 1VSOA 3M3KA 4G68C 1URDA 5I59B 2QJEA 2ESNA 1FCKA 2YJPA 3MAMA 3PUXE 4NF4B 1VE4A 1SQYA 4PFUA 1KZ8A 3O6GA 1HSJA 1WDNA 3K4UA 1B7ZA 4ZEIA 2FIXA 4KPTA 3T22A 3ZS6A
chains in the Genus database with same CATH topology
4X04A 1FJ6A 5IZ1A 4NF0A 5ET8A 1NV5A 2F5XA 1FBGA 2FBPA 1NUYA 2KQZA 1K9YA 3SZPA 5FBPA 4PETA 3RPLB 1FPGA 3MSTA 2Y5LA 4HXVA 2HXRA 4N8GA 2QVVA 4NGUA 5ET5A 4GX6A 4F18A 4OVTA 4N6KA 1VDWA 4GBVA 3QMFA 2VT5A 1IMDA 4N15A 5LDZA 4GWSA 5EQ9A 1FBPA 5ET7A 4F19A 3LUZA 5J16A 5EQ8A 1FBFA 4M1VA 4O7IA 1QGXA 5IZ3B 3IFCA 1DK4A 4DI4B 1NV7A 3LV0A 2XWKA 5F24A 2CZKA 1NUZA 2WX9A 2XWIA 1FPFA 4O94A 2KR0A 2L5VA 4KXPA 1FBCA 1FBHA 1NV4A 3A29A 4QXDA 4PDDA 5I7IA 1NV1A 4H45A 4OVQA 4LN5A 4F1VA 2PFYA 3CHGA 4DI3D 4MMPA 1IMAA 2GQ1A 4GWZA 2WYPA 1EYKA 4MX6A 4PBQA 4PAKA 4N4UA 3BIHA 1RDYA 5I3SA 1KA0A 4OVPA 3RPLA 2XA5A 2CZHA 4HE1A 1NUXA 4HE0A 3U65A 4OVSA 1G0HA 2VPOA 2ZZXA 4XFEA 3B8BA 4HCYA 2DE4A 1YZ0A 1RDXA 4MNIA 5IZ3A 5JK4A 5I5PA 4GWWA 4MHFA 2HZKA 4XEQA 2F3DA 1LBZA 1YXIA 4MNCA 3RYDA 3HFUA 1Q9DA 5A5LA 4AS4A 2FIEA 4P8BA 4PAFA 3W9VA 3FBPA 4JVCA 4GBWA 4HE2A 2ZZWA 1FBEA 2R8TA 2FHYA 2HHMA 4X8RA 2CZIA 4NN3A 1FPJA 2OWZA 4NX1A 1D9QA 5EQ7A 2XWOA 1LBXA 4P1LA 5T3JA 2B4LA 3E78A 4GX4A 5IM2A 1FRPA 2WBDA 4PCDA 1IMCA 4HCWA 4QBAA 4YICA 1RDZA 4P56A 2HZLA 2DE3A 4MAGA 2Q74A 2Q9TA 1AWBA 2FVZA 1EYJA 5J1DA 1NV0A 4PAIA 1FPIA 4GX3A 4NG7A 1FPLA 1DCUA 4PF6A 4MIJA 2DVZA 5EYGA 2DE2A 4F1UA 4N17A 4X9TA 4I3YA 1NV6A 2XWVA 5ET6A 3KC1A 3IFAA 4P47A 3KC0A 3D1RA 2ZZVA 2PFZA 1XI6A 4I40A 4YZZA 1KA1A 4MNPA 1INPA 1LBYA 4N8YA 3W9WA 1NI9A 2QVUA 4OA4A 2XXKA 1FPEA 4O7MA 4P1EA 2F3BA 4O8MA 3FXBA 1NV3A 3E79A 1FTAA 1EYIA 4OVRA 3EKIA 1NV2A 1JP4A 1FSAA 3B50A 5IZZA 4XF5A 4PGNA 1CNQA 1LBVA 4JVDA 1K9ZA 1DBZA 4PBHA 2MKZA 4IR8A 1LEVA 5IGAA 1LBWA 4MJOA 4P9KA 4PGPA 1FPBA 4N6DA 4OANA 3KBZA 4G61A 4N81A 2Q8MA 4PC9A 2QVRA 4FBPA 4PF8A 1FBDA 5CM6A 5LTCA 4AS5A 2CEYA 1SPIA 2B4MA 3T1BA 2P3NA 4H46A 1YYZA 4GWUA 4NHBA 1FPKA 3ISPA 4I3EA 2VPNA 2DDKA 4NQ8A 2WEFA 1IMBA 3NOHA 1BK4A 5EQAA 5ESYA 4PFRA 3MYUA 2WYKA 1IMFA 2V4CA 2JJKA 5EYHA 2HPGA 2OX3A 4MEVA 2QFLA 2QPQA 2V3QA 4NAPA 3BIGA 4N91A 4GWXA 4PFBA 3GYYA 5DW8A 4MCOA 2P3VA 2PCRA 4P3LA 4UABA 1FPDA 3ROJA 4PFIA 1G0IA 1FJ9A 4PE3A 2BJIA 4GWYA 2WBBA 1IMEA 1NUWA 3PTYA 4PTKA 1KZ8A 4PDHA 2CEXA 3T0JA 2FIXA 2Y5KA 4JVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X04 A;  4PCD A;  5IGA A;  4OVP A;  4YIC A;  4NF0 A;  4P56 A;  2HZL A;  2XA5 A;  4MAG A;  4P9K A;  4PGP A;  4N6D A;  4OAN A;  4PET A;  4PAI A;  4NG7 A;  4N8G A;  4PC9 A;  3U65 A;  4NGU A;  4PF6 A;  4OVS A;  4MIJ A;  2VPO A;  4OVT A;  5LTC A;  2ZZX A;  4PF8 A;  4N6K A;  4XFE A;  5CM6 A;  2CEY A;  4N17 A;  4N15 A;  4NHB A;  4MNI A;  5I5P A;  2VPN A;  2XWV A;  4NQ8 A;  4MHF A;  2HZK A;  4PFR A;  2WYK A;  4XEQ A;  4DI4 B;  4P47 A;  2XWK A;  2ZZV A;  2PFZ A;  2V4C A;  2WX9 A;  2HPG A;  4MEV A;  2XWI A;  4MNC A;  4YZZ A;  4O94 A;  4MNP A;  4NAP A;  4N8Y A;  4N91 A;  4P8B A;  4OA4 A;  4PFB A;  4PDD A;  3GYY A;  4PAF A;  2XXK A;  5I7I A;  4O7M A;  4MCO A;  4P1E A;  4P3L A;  4UAB A;  4OVQ A;  4O8M A;  4PFI A;  4LN5 A;  3FXB A;  2PFY A;  2ZZW A;  4OVR A;  4X8R A;  4PE3 A;  4NN3 A;  4NX1 A;  3B50 A;  4DI3 D;  5IZZ A;  4MMP A;  2XWO A;  4XF5 A;  4PGN A;  2WYP A;  4P1L A;  4PDH A;  2CEX A;  4MX6 A;  4PBH A;  4PBQ A;  4PAK A;  4N4U A;  5IM2 A; 
#chains in the Genus database with same CATH topology
 2OLB A;  4KHZ E;  1FJ6 A;  4N6P A;  2R71 A;  1DTZ A;  3O6I A;  4JWY A;  4H1X A;  2XX8 A;  1NUY A;  5FBP A;  1LAH E;  4PET A;  3RPL B;  4F2O A;  2Y5L A;  1SYH A;  3Q29 A;  2QRY A;  3RGY A;  3SEX A;  2CMO A;  2UVJ A;  2HXR A;  3FVG A;  4XKR A;  4OVT A;  1B46 A;  4N6K A;  4N15 A;  1IMD A;  4F2Q A;  5EQ9 A;  4F19 A;  3MP8 A;  3FVK A;  3T9V A;  4GRK A;  3VV5 A;  2RCB A;  3OEL A;  1AL3 A;  3V8X B;  2G29 A;  2UVH A;  3U1O A;  1RYO A;  2Y7W A;  2I3W A;  3PPO A;  3THI A;  2O1L A;  4O94 A;  2XD2 A;  2Z23 A;  4NF5 A;  3EN3 A;  4OEV A;  3N26 A;  4OHN A;  4G77 A;  5I56 B;  2UYF A;  2XXP A;  1JQF A;  4GVO A;  4LN5 A;  4JSD A;  1L5T A;  2QL3 A;  1URG A;  5KCJ A;  4DCY A;  3LSL A;  4DI3 D;  2DS9 A;  4YKI A;  2UXA A;  1TFD A;  1B3H A;  4IO3 A;  3IAZ A;  5EHS A;  1SD3 A;  4MX6 A;  4PBQ A;  3WAE A;  4PAK A;  4WED A;  4FEB A;  3USD A;  2I6E A;  3K6V A;  4QFN A;  1B2H A;  3EPE A;  2VP1 A;  1B05 A;  3S9L C;  4XKQ A;  4G8N A;  5CBR A;  3TMG A;  5I2K A;  4KFQ A;  3K6W A;  3KFM A;  4OVS A;  3DP6 A;  3FIR A;  1DOT A;  3CIJ A;  1BTJ A;  1YAE A;  1MQJ A;  3B6T A;  2XXX A;  1RDX A;  4OET A;  3MJN A;  1NFT A;  1IZ1 A;  2Q88 A;  3KGC A;  3C35 A;  2O6A A;  5DTB A;  1IXH A;  4ZZA A;  3S4U A;  5F7V A;  1LBZ A;  5TP9 A;  1USY E;  3QYT A;  3HFU A;  1Q9D A;  3O6H A;  3IJX B;  3CRB A;  2PBW A;  1GVC A;  2XXW A;  4PAF A;  3K0V A;  3FBP A;  3SEY A;  1PB9 A;  3A09 A;  2HAV A;  2I4C A;  2O7U A;  3BBR A;  4ZEB A;  2R8T A;  3KG2 A;  1FPJ A;  3ODB A;  4IB2 A;  1NNT A;  1SW5 A;  3E4R A;  3M3L A;  2REJ A;  1A99 A;  1LGB C;  3C32 A;  2DWI A;  1H43 A;  3MP1 A;  3KN8 A;  4IGT A;  4R72 A;  3VLV A;  1H76 A;  1XVX A;  3E78 A;  1LFG A;  1FRP A;  3B7D A;  3LC8 A;  2F7B A;  2UYE A;  1DSN A;  1IXG A;  1MH4 A;  4HCW A;  4QBA A;  4BDR A;  4YIC A;  1RDZ A;  4LZ7 A;  1TFA A;  4U21 A;  1AWB A;  5J1D A;  2RKM A;  4JBZ A;  1NV0 A;  1UIU A;  1FPI A;  1PEB A;  1I6Q A;  4NF6 B;  4NG7 A;  2XXH A;  4MLV A;  1FTM A;  5H8Q B;  3RT6 B;  1DCU A;  3PPQ A;  4IY6 A;  3U93 A;  2DE2 A;  5KZT A;  1IIW A;  2NWJ A;  3TTM A;  4X9T A;  4KYS A;  2OBG A;  3LSW A;  1ZIU A;  2CZL A;  2XWV A;  2HEU A;  3PU5 A;  2XXY A;  2E0S A;  4JWO A;  2H25 A;  4P0G A;  3Q25 A;  2QS4 A;  4KCC A;  1INP A;  4GIZ A;  3ONM A;  1N84 A;  4BDQ A;  2XXK A;  4O7M A;  4KR5 A;  1GV8 A;  2HQ0 A;  1NV3 A;  2Y7K A;  3BFT A;  2XXT A;  4DDD A;  3V89 B;  1FSA A;  4GWO A;  1IXC A;  3K1P A;  3VXB A;  4DLD A;  4BDN A;  4LQ5 A;  2F97 A;  1JNF A;  1DBZ A;  4PBH A;  2DXY A;  3HPI A;  2W7Y A;  4GXA A;  4FAJ A;  4IR8 A;  5IGA A;  3CI8 A;  3E9X A;  3TTN A;  1TT1 A;  4NF8 A;  4OFL A;  1B0L A;  1ZTY A;  3FAS A;  1FPB A;  1PB8 A;  1NNP A;  2Y84 A;  3KBZ A;  2Y7P A;  1J1N A;  5K2Y A;  2QVR A;  4JWX A;  3JV9 A;  4PF8 A;  4AS5 A;  5I2N A;  4JXI A;  3G3G A;  1SPI A;  2P3N A;  4H46 A;  3TAJ A;  4H5F A;  5M2V A;  1XOC A;  3CSG A;  3HHF A;  3RTW B;  2DDK A;  3MBP A;  4NQ8 A;  5I59 A;  4X48 A;  2WEF A;  2V3T A;  5ESY A;  3KJT A;  4PFR A;  3TCG A;  5B70 A;  4I9D A;  2V4C A;  3H7M A;  5DVI A;  2HPG A;  4MEV A;  5AA2 A;  2ZYO A;  3VXC A;  5L9S A;  2V3Q A;  4NAP A;  3BIG A;  4KYE A;  2KLF A;  2ABH A;  4YKK A;  1D3K A;  4ND9 A;  2LAO A;  3GYY A;  3TCF A;  1SVX B;  2P3V A;  2PCR A;  4P3L A;  4FOR A;  3SEV A;  1B1X A;  1G0I A;  3K1N A;  4PE3 A;  4F31 B;  3T66 A;  2WBB A;  2XD3 A;  3GLB A;  4PTK A;  3M8U A;  4PDH A;  2CEX A;  3T0J A;  4KCD A;  3LR1 A;  1MQD A;  3FXU A;  4X04 A;  3OEN A;  4RXL A;  5H8F B;  4M4G A;  5CBS A;  2Y7R A;  1S9T A;  4NF0 A;  4NTL A;  4TLM B;  2THI A;  3U8Q A;  3SZP A;  2FYI A;  5AA4 B;  2HCA A;  3OEK A;  4R73 A;  4L17 A;  4QF9 A;  1BP5 A;  1JW5 A;  1VDW A;  4GBV A;  3H6W A;  2F7A A;  3QMF A;  5H8N B;  2V3U A;  3IR1 A;  3ILT B;  4GWS A;  1OIB A;  5EQ8 A;  1Q1K A;  4XKP A;  3LUY A;  2H9B A;  4N13 A;  5IZ3 B;  5I57 B;  1II5 A;  3TZA A;  3IFC A;  1DK4 A;  3Q27 A;  4DI4 B;  3LV0 A;  2GH9 A;  3IO6 A;  2NXO A;  2ONK E;  5F24 A;  2CZK A;  1NUZ A;  1JVX A;  2WX9 A;  2GFE A;  3IOU A;  2XWI A;  2ZNU A;  4F1Y A;  2L5V A;  1MXZ A;  1NV4 A;  1SDX A;  4QSD A;  4QXD A;  4TLL B;  1SW2 A;  2BJJ X;  4RK9 A;  1JET A;  1MG1 A;  3FZV A;  2RF1 A;  4OWD A;  4AB6 A;  1B32 A;  3DEL B;  3QSL A;  4POW A;  4GWZ A;  2O1M A;  4EF2 A;  4P0I A;  4U22 A;  3JZJ A;  3K02 A;  1AMF A;  2Q8J A;  1B3L A;  2X7Q A;  4LA9 A;  4N4U A;  2O69 A;  2WKY A;  3RT8 A;  1FQF A;  1KA0 A;  4G68 B;  1N04 A;  3IOV A;  5JTY A;  2Z8E A;  4OEU A;  3RPW A;  2CZH A;  2YPN A;  2DVC A;  1NMU A;  3E13 X;  1FQE A;  4HE0 A;  3U65 A;  5I58 B;  1G0H A;  3FV2 A;  1S50 A;  3TTL A;  4ZDM A;  4HTG A;  3CR9 A;  5CMM A;  3HST A;  4RK2 A;  1B40 A;  1MY4 A;  5I5P A;  3H6V A;  1B58 A;  3MVZ A;  4ISU A;  3H3G A;  1JVY A;  2HZK A;  2RC7 A;  3LSX A;  2B3B A;  2ZMB A;  4GOT A;  2I0B A;  3TEL A;  2D21 A;  1MPC A;  1MPB A;  4H0W A;  3TYH A;  2E1S A;  3QK6 A;  1N7X A;  4JVC A;  3PUW E;  3PUZ E;  2XXQ A;  1F9B A;  4GBW A;  4HE2 A;  4YB6 A;  1DPE A;  1FBE A;  3QAX A;  3OO6 A;  2HHM A;  4I8C A;  4X8R A;  2ZXT A;  2CZI A;  1T0K A;  3MQ9 A;  1Y4T A;  4NX1 A;  4C0R A;  1QW0 A;  4WXJ A;  1GTK A;  4YB7 A;  1Y3Q A;  2VGQ A;  5B7D A;  5H8Q A;  1B0H A;  1MXW A;  1QUK A;  5L9M A;  1LBB A;  1LBX A;  2ZYN A;  3KSX A;  3UA8 A;  2DXR A;  2DP8 A;  1M5C A;  2B3F A;  3SKP A;  3ILU B;  3FGS A;  3RLF E;  5ITO A;  1POT A;  2P0S A;  1UTB A;  4MH5 A;  4PCD A;  3O9P A;  1IMC A;  2XX9 A;  4U1O A;  3TTK A;  3SDF A;  2HZL A;  2Q74 A;  2Q9T A;  4BDO A;  3CG1 A;  5IAI A;  3TCH A;  5ITP A;  5JEI A;  2OWS A;  1MY2 A;  1D9V A;  3O97 A;  1PC3 A;  1ZU0 A;  3UGW A;  1LLS A;  3TQW A;  2DVZ A;  5EYG A;  1Y4C A;  1EZO A;  3PMW A;  1MQI A;  1Z7N E;  4N17 A;  2RCA A;  3KSJ A;  1FTJ A;  5CMB A;  3QUF A;  1B5J A;  1SW1 A;  3PPN A;  4IO7 A;  4NE4 A;  1POY 1;  3K6U A;  1N7W A;  1NH8 A;  4RYA A;  4UAC A;  1MQH A;  4KYD A;  4NED A;  3KC0 A;  4P11 A;  5TU0 A;  4C1T A;  4AQ4 A;  4I40 A;  1AOV A;  1Y3P A;  2Q2A A;  4EDP A;  2PVU A;  2V25 A;  1LBY A;  1XC1 A;  1FTK A;  2QVU A;  2I58 A;  3N5L A;  4QFK A;  2A5T A;  3OO7 A;  3DP8 A;  5ICQ A;  2F3B A;  4O8M A;  1MY1 A;  5AE4 A;  1ELJ A;  4U4S A;  1QKA A;  4ONY A;  3CG3 A;  3E79 A;  4LVQ A;  1FTA A;  1OLC A;  4ELO A;  1BKA A;  1VFD A;  4BDL A;  3QIM A;  5DEX B;  4LP2 B;  4XIG Q;  3FVN A;  3KOT A;  3EHU A;  2QMW A;  4THI A;  3PUY E;  2Z22 A;  2PT2 A;  3TKD A;  5CMK A;  2O7I A;  4FEC A;  3SEU A;  4F3B A;  2UVI A;  1LEV A;  2QSX A;  3IB1 A;  3VVE A;  3IK6 B;  3G3J A;  4MJO A;  1ATG A;  4IGR A;  4P9K A;  4PGP A;  5H8H A;  3HCQ A;  3IB2 A;  4LAT A;  2ALU A;  3B6W A;  4N81 A;  3KBR A;  4YB5 A;  2DOJ A;  4IO4 A;  4PC9 A;  3OMB A;  3WAF A;  1LAX A;  3VE1 B;  3PPP A;  4FBP A;  1FBD A;  5CM6 A;  1OQH A;  4YU0 A;  3T1B A;  1IEJ A;  4GWU A;  1QUI A;  2F36 A;  3HV1 A;  1SBP A;  1OLA A;  3FXR A;  3KN3 A;  2GRV A;  1ANF A;  2D5W A;  1M5F A;  1IMB A;  2AL4 A;  2WYK A;  1IQ7 A;  3TOD A;  3C34 A;  2Z8F A;  2I48 A;  1D9Y A;  1A40 A;  2OX3 A;  3TPA A;  3PMV A;  4IO2 A;  4GQO A;  2QMX A;  3SET A;  3R6U A;  2VOZ A;  3RTF B;  2NUV A;  4GWX A;  2RC9 A;  3MVW A;  3I6V A;  3MC2 A;  4UAB A;  3ROJ A;  2GHA A;  1P1O A;  3C36 A;  2V84 A;  1NH7 A;  4BDM A;  1FJ9 A;  3UP9 A;  2ZYK A;  1IIT A;  3MVX A;  3H6T A;  2BJI A;  4GWY A;  5KCJ B;  3IOW A;  1IME A;  1NUW A;  2I3V A;  1Y9U A;  4EXL A;  2QS1 A;  3G3K A;  3FJ7 A;  5KDT B;  4FAT A;  5H8N A;  4GFR A;  2F78 A;  1US5 A;  1UTH A;  3HO7 A;  3T9X B;  2DQV A;  4DZ1 A;  2IA4 A;  2FNC A;  4H5G A;  1BIY A;  4OVJ A;  2F5X A;  1FBG A;  3IL1 B;  1K9Y A;  1B3E A;  3MST A;  3MUQ A;  3EQ1 A;  1B5I A;  4WKM A;  2YLN A;  3RNN A;  2QVV A;  3MPL A;  4NGU A;  3VVD A;  2O51 A;  3FUZ A;  4GX6 A;  2DWH A;  5I2K B;  1N3W A;  1Y3N A;  4H65 A;  1FQB A;  3ZKK A;  5LOM A;  3KEI A;  2F8D A;  1Z7M E;  2ONR A;  3RY3 A;  1ZKB A;  3TTR A;  1FBP A;  3MZ1 A;  5J16 A;  1FBF A;  1XVY A;  4O7I A;  3FJG A;  1B6H A;  4U2R A;  1VR5 A;  3RQT A;  1JEV A;  5CI5 A;  2XWK A;  4DXB A;  2HAU A;  1M5E A;  3ECR A;  2OZZ A;  1FPF A;  1FBC A;  1M5B A;  4ZE8 A;  3F11 A;  4XKN A;  4XTC Q;  4PDD A;  5FTH A;  3FXQ A;  5I7I A;  2VD2 A;  1UQW A;  1NV1 A;  1EU8 A;  3SES A;  4G68 A;  4QHQ A;  4LON B;  2PFY A;  1QVS A;  4QFP A;  3T9U A;  1URS A;  4NF4 A;  4MMP A;  1IMA A;  2GQ1 A;  3CSB A;  1PBP A;  4GF8 A;  4MFI A;  1EYK A;  1I69 A;  1B4H A;  5TPA B;  1H45 A;  1UIV A;  3MW0 A;  1R9L A;  4G8M A;  4LZ5 A;  1RDY A;  4FJP A;  3I3V A;  4OVP A;  3RPL A;  4RA1 A;  3M3F A;  4OMB A;  4E0W A;  4YKJ A;  4RNS A;  1NUX A;  3ZSF A;  1P1N A;  5ELV A;  3VFJ A;  3B8B A;  3UOR A;  4MNI A;  4HS7 A;  2XXR A;  2IEE A;  4GWW A;  3HN0 A;  5IKB A;  4F22 A;  3CFX A;  5A5X B;  4XEQ A;  5CMC A;  2F3D A;  3DM0 A;  3EF7 A;  3FV1 A;  1YXI A;  4DXC A;  3RYD A;  4I1D A;  2VD3 A;  4E0X A;  4H67 A;  2FIE A;  3PV0 E;  4Q5T A;  5I56 A;  3FJM A;  1B52 A;  2NOO A;  4OEN A;  3W9V A;  3U94 A;  4F3S A;  5BWJ A;  2HXW A;  2X7P A;  2FA7 A;  3CFL A;  1QKB A;  1ZBM A;  3QXM A;  3U72 A;  1MS7 A;  4ELQ A;  2ZYM A;  2F6P A;  4O3A A;  2F35 A;  1D9Q A;  5BUU A;  2XWO A;  4NWC A;  3N6U A;  3W15 C;  1XT8 A;  2XX7 A;  4RPN A;  2M8C A;  1GR2 A;  1PB7 A;  2WBD A;  4GL8 A;  3FAT A;  4YKP A;  1LAG E;  4FED A;  4P56 A;  2DE3 A;  4U23 A;  3TQL A;  1BLF A;  1B7U A;  3C33 A;  4HW8 A;  4PAI A;  1LCF A;  1LFI A;  1O63 A;  4YMB A;  1B4Z A;  2ZNS A;  1FPL A;  1EH3 A;  1O64 A;  1ZJL A;  2O84 X;  4KQP A;  4QSE A;  4OER A;  4F1U A;  4F29 A;  3GZG A;  5I2N B;  1NV6 A;  3IB0 A;  3VLW A;  1CE2 A;  1N0T A;  1AIV A;  3D1R A;  5DEX A;  1NNF A;  1IXI A;  1MQG A;  4YZZ A;  1KA1 A;  2O68 A;  2H98 A;  4MNP A;  4IO6 A;  1SI0 A;  5ICT A;  1JW1 A;  3W9W A;  1NI9 A;  3T9H B;  1B7H A;  4IY5 A;  4PP0 A;  5AA2 B;  4OA4 A;  4OXV A;  3KZG A;  3PMX A;  4MLQ A;  1B9J A;  1FPE A;  1NL5 A;  4TQU Q;  3OSQ A;  3R7X A;  3FXB A;  3V5A A;  3S9E A;  3FD3 A;  1JP4 A;  5HPQ A;  3B50 A;  4DE8 A;  5IZZ A;  3C31 A;  3RUM A;  1LBC A;  2HFB A;  2I0C A;  4UA8 A;  4QRZ A;  3VLU A;  3KN7 A;  3S9N C;  3PPR A;  2Z8D A;  5EYF A;  3K2D A;  1LST A;  1TXF A;  1O7T A;  4O3C A;  1EZP A;  1MXV A;  2ANJ A;  4MBP A;  4G8H A;  4ECF A;  1LBW A;  2ONS A;  4NF6 A;  5DVF A;  4N6D A;  1VFE A;  1I6A A;  3S2V A;  3C4M A;  4G61 A;  1A8E A;  4R6K A;  3DLN A;  3IOT A;  1MM6 A;  2QS3 A;  3TEP A;  1XHY A;  5LTC A;  1MDQ A;  1R6Z A;  2CEY A;  5HBC A;  3G7W A;  3E3K A;  1YYZ A;  1LCT A;  3H03 A;  2I4B A;  4NHB A;  4ELP A;  3IOR A;  1FPK A;  3MZ9 A;  3ISP A;  4I3E A;  2VPN A;  3PD9 A;  1NKX A;  4AB5 A;  4Q8R A;  5FHN A;  1NNK A;  5EQA A;  1MXU A;  3MYU A;  1N76 A;  5ISU A;  5F1Q A;  1HSL A;  2JJK A;  2Y7I A;  1LFH A;  4R6H A;  3AXF A;  3MP6 A;  2QPQ A;  1US4 A;  4X1D A;  3OSR A;  4I62 A;  1YCJ A;  5DVJ A;  4H8I A;  4N91 A;  4G2Z A;  3S9M C;  5KDT A;  1SW4 A;  4PFB A;  4LZ8 A;  1HSE A;  2AL5 A;  3PD8 A;  5DW8 A;  4MCO A;  3K1M A;  3TUS A;  3G3H A;  1FPD A;  4OES A;  4EQ7 A;  1B1H A;  4PFI A;  2H4I A;  1FTL A;  4QFL A;  5AA1 A;  3PTY A;  4EF1 A;  3H4Z A;  4PE5 B;  4OTE A;  3VDF A;  3UIF A;  4EQ9 A;  3ZKL A;  3C9H A;  2PMS A;  2Y5K A;  2V93 A;  4JVI A;  3H6U A;  2X26 A;  4JSO A;  1B3G A;  5IZ1 A;  4F3G A;  4POX A;  2Q89 A;  2NVU B;  2XXU A;  4PQJ A;  5ET8 A;  1NV5 A;  2FBP A;  2OCU A;  1H44 A;  4ZZE A;  4F3P A;  2KQZ A;  3K6X A;  1FPG A;  5K2X A;  4PFW A;  4HXV A;  1A7L A;  5JTY B;  4N8G A;  1A54 A;  3IJO B;  2XXV A;  5ET5 A;  4JDF A;  1A8F A;  4F18 A;  1B5H A;  1PBQ A;  3H06 B;  1SI1 A;  2UVG A;  5FHM A;  4OFJ A;  2VT5 A;  5LDZ A;  1TWY A;  2DWA A;  5ET7 A;  3LUZ A;  4YMA A;  4M1V A;  1MM7 A;  3TDJ A;  1A55 A;  1QGX A;  3K00 A;  3BFU A;  4K3F A;  1NV7 A;  3MWB A;  1MRP A;  4Q30 B;  1KWH A;  2KR0 A;  4KXP A;  1FBH A;  2AYS A;  4R9F A;  1QUJ A;  2REG A;  3GBB A;  5TPA A;  3A29 A;  4KD5 A;  5FHO A;  1RYX A;  2XXI A;  2R6G E;  3RN8 A;  1B51 A;  4GD5 A;  4H45 A;  4OVQ A;  3L6H A;  4LQ2 A;  4F1V A;  4U1Z A;  1OVB A;  1XS5 A;  3CHG A;  3K01 A;  1R1N A;  2PYY A;  4OFO A;  2F34 A;  1CB6 A;  2OK2 A;  5CRY A;  2WYP A;  4DIG A;  4PFY A;  5H8F A;  4NF5 B;  4YAH X;  2OWT A;  3TFL A;  1LAF E;  1S7Y A;  3GBA A;  3BIH A;  3MVY A;  5I3S A;  4Z7E A;  4R6Y A;  1ZMG A;  5AA4 A;  1UTB B;  4NMY A;  2XA5 A;  3B6Q A;  3O28 A;  5A5X A;  1QJM A;  4HE1 A;  1OQG A;  4IO5 A;  2I49 A;  4NWD A;  1ZLQ A;  1YPN A;  2VPO A;  2ZZX A;  3FVO A;  4XFE A;  4HCY A;  1EZ9 A;  5I84 A;  2DE4 A;  1YZ0 A;  1LB9 A;  2H5Y A;  5IZ3 A;  2QS2 A;  5JK4 A;  5L9O A;  5I57 A;  4C1U A;  3PUV E;  4TOZ A;  2AIX A;  4MHF A;  4GL0 A;  4GLI A;  1P1U A;  1AH5 A;  1MY0 A;  4H6D A;  4ZED A;  3CFZ A;  5HM4 B;  2P1S A;  3U92 A;  4EXK A;  1H3D A;  1P99 A;  1R9Q A;  4MNC A;  5A5L A;  4AS4 A;  3UK4 A;  4JB7 A;  4P8B A;  2F6G A;  1FQD A;  3OOA A;  4EQB A;  4H8J A;  4FIM A;  2A5T B;  3JYR A;  2G93 A;  2ZZW A;  4X1B A;  4N07 A;  2FHY A;  4NN3 A;  1MY3 A;  2OWZ A;  5EQ7 A;  4R2F A;  4DXU A;  5TP9 B;  3BKI B;  4ZE9 A;  1OVT A;  4P1L A;  3GXA A;  1Q35 A;  2B4L A;  5T3J A;  1M5D A;  4R74 A;  4GX4 A;  4RY1 A;  5IM2 A;  3HHG A;  4EUO A;  1Y1M A;  3IO4 A;  5L8D A;  5FTI A;  3O2A A;  4RPO A;  4MAG A;  3A3U A;  4ZEF A;  2FVZ A;  1EYJ A;  5DYH A;  5H8S A;  3UN6 A;  5I58 A;  5H8H B;  4GX3 A;  1DTG A;  3VVF A;  3OEM A;  1IUD A;  1D4N A;  3I5O A;  4PF6 A;  4MIJ A;  3V83 A;  4LUB A;  4PFT A;  1I6B A;  2RIN A;  4FE8 A;  3G3F A;  3T93 B;  4I3Y A;  2P2A A;  5ET6 A;  3KC1 A;  3IFA A;  4ZEC A;  1SYI A;  4P47 A;  3N6T A;  3QUJ A;  2ZZV A;  2PFZ A;  1XI6 A;  2DSF A;  2XHD A;  1FQC A;  4OYV A;  4N8Y A;  1OMP A;  4GXS B;  1FQA A;  1MXX A;  5EHM A;  3O66 A;  3Q26 A;  1PDA A;  4P1E A;  3OO9 A;  2H99 A;  5AA3 A;  1FW0 A;  3G3I A;  3IX1 A;  3D4C A;  4F39 A;  5CC2 A;  3OXN A;  1EYI A;  4OVR A;  3EKI A;  1NV2 A;  2B65 A;  3O29 A;  2VHA A;  3LSF B;  4ELR A;  4QFO A;  4XF5 A;  2R9J A;  1WOD A;  4WEP A;  2A5S A;  4PGN A;  1DMB A;  1LB8 A;  4KI0 E;  4QSC A;  3L6G A;  1CNQ A;  1RKM A;  1LBV A;  4JVD A;  1K9Z A;  3SEW A;  4ZEK A;  3N94 A;  2MKZ A;  3A3C A;  3SER A;  1DPP A;  1JW4 A;  4R2B A;  3P7I A;  4R75 A;  3T96 B;  4Z0I A;  1P1Q A;  1QUL A;  3MZB A;  4ESX A;  1UTH B;  4OAN A;  3MPK A;  2PT1 A;  4ZS9 A;  4ESW A;  1MH3 A;  3PGF A;  2Q8M A;  1MPD A;  2Q2C A;  2PX1 A;  3KOS A;  4OQO A;  3CVG A;  2ZNT A;  2F7C A;  2DYX A;  1WVJ A;  2GHB A;  2B4M A;  3OD7 A;  3LBS A;  4MF3 A;  3DP4 A;  1FTO A;  4XXU A;  3Q28 A;  2OJT A;  4NF8 B;  4Q0C A;  1N3X A;  1Y20 A;  3OO8 A;  3KJ7 A;  1GGG A;  3NOH A;  4OZ9 A;  1BK4 A;  1P1W A;  3EHT A;  4O3B A;  5AA2 D;  1Y1Z A;  1IMF A;  4U4X A;  3D4G A;  4DCX A;  1USY H;  4R9G A;  5EYH A;  2QFL A;  4G4P A;  1MXY A;  4RJZ A;  1YTV A;  3EHS A;  2DWJ A;  2D3I A;  2RC8 A;  1JEU A;  4BLA A;  1MDP 1;  3R26 A;  1B3F A;  5DT6 A;  1VSO A;  3M3K A;  4G68 C;  1URD A;  5I59 B;  2QJE A;  2ESN A;  1FCK A;  2YJP A;  3MAM A;  3PUX E;  4NF4 B;  1VE4 A;  1SQY A;  4PFU A;  1KZ8 A;  3O6G A;  1HSJ A;  1WDN A;  3K4U A;  1B7Z A;  4ZEI A;  2FIX A;  4KPT A;  3T22 A;  3ZS6 A; 
#chains in the Genus database with same CATH homology
 4X04 A;  1FJ6 A;  5IZ1 A;  4NF0 A;  5ET8 A;  1NV5 A;  2F5X A;  1FBG A;  2FBP A;  1NUY A;  2KQZ A;  1K9Y A;  3SZP A;  5FBP A;  4PET A;  3RPL B;  1FPG A;  3MST A;  2Y5L A;  4HXV A;  2HXR A;  4N8G A;  2QVV A;  4NGU A;  5ET5 A;  4GX6 A;  4F18 A;  4OVT A;  4N6K A;  1VDW A;  4GBV A;  3QMF A;  2VT5 A;  1IMD A;  4N15 A;  5LDZ A;  4GWS A;  5EQ9 A;  1FBP A;  5ET7 A;  4F19 A;  3LUZ A;  5J16 A;  5EQ8 A;  1FBF A;  4M1V A;  4O7I A;  1QGX A;  5IZ3 B;  3IFC A;  1DK4 A;  4DI4 B;  1NV7 A;  3LV0 A;  2XWK A;  5F24 A;  2CZK A;  1NUZ A;  2WX9 A;  2XWI A;  1FPF A;  4O94 A;  2KR0 A;  2L5V A;  4KXP A;  1FBC A;  1FBH A;  1NV4 A;  3A29 A;  4QXD A;  4PDD A;  5I7I A;  1NV1 A;  4H45 A;  4OVQ A;  4LN5 A;  4F1V A;  2PFY A;  3CHG A;  4DI3 D;  4MMP A;  1IMA A;  2GQ1 A;  4GWZ A;  2WYP A;  1EYK A;  4MX6 A;  4PBQ A;  4PAK A;  4N4U A;  3BIH A;  1RDY A;  5I3S A;  1KA0 A;  4OVP A;  3RPL A;  2XA5 A;  2CZH A;  4HE1 A;  1NUX A;  4HE0 A;  3U65 A;  4OVS A;  1G0H A;  2VPO A;  2ZZX A;  4XFE A;  3B8B A;  4HCY A;  2DE4 A;  1YZ0 A;  1RDX A;  4MNI A;  5IZ3 A;  5JK4 A;  5I5P A;  4GWW A;  4MHF A;  2HZK A;  4XEQ A;  2F3D A;  1LBZ A;  1YXI A;  4MNC A;  3RYD A;  3HFU A;  1Q9D A;  5A5L A;  4AS4 A;  2FIE A;  4P8B A;  4PAF A;  3W9V A;  3FBP A;  4JVC A;  4GBW A;  4HE2 A;  2ZZW A;  1FBE A;  2R8T A;  2FHY A;  2HHM A;  4X8R A;  2CZI A;  4NN3 A;  1FPJ A;  2OWZ A;  4NX1 A;  1D9Q A;  5EQ7 A;  2XWO A;  1LBX A;  4P1L A;  5T3J A;  2B4L A;  3E78 A;  4GX4 A;  5IM2 A;  1FRP A;  2WBD A;  4PCD A;  1IMC A;  4HCW A;  4QBA A;  4YIC A;  1RDZ A;  4P56 A;  2HZL A;  2DE3 A;  4MAG A;  2Q74 A;  2Q9T A;  1AWB A;  2FVZ A;  1EYJ A;  5J1D A;  1NV0 A;  4PAI A;  1FPI A;  4GX3 A;  4NG7 A;  1FPL A;  1DCU A;  4PF6 A;  4MIJ A;  2DVZ A;  5EYG A;  2DE2 A;  4F1U A;  4N17 A;  4X9T A;  4I3Y A;  1NV6 A;  2XWV A;  5ET6 A;  3KC1 A;  3IFA A;  4P47 A;  3KC0 A;  3D1R A;  2ZZV A;  2PFZ A;  1XI6 A;  4I40 A;  4YZZ A;  1KA1 A;  4MNP A;  1INP A;  1LBY A;  4N8Y A;  3W9W A;  1NI9 A;  2QVU A;  4OA4 A;  2XXK A;  1FPE A;  4O7M A;  4P1E A;  2F3B A;  4O8M A;  3FXB A;  1NV3 A;  3E79 A;  1FTA A;  1EYI A;  4OVR A;  3EKI A;  1NV2 A;  1JP4 A;  1FSA A;  3B50 A;  5IZZ A;  4XF5 A;  4PGN A;  1CNQ A;  1LBV A;  4JVD A;  1K9Z A;  1DBZ A;  4PBH A;  2MKZ A;  4IR8 A;  1LEV A;  5IGA A;  1LBW A;  4MJO A;  4P9K A;  4PGP A;  1FPB A;  4N6D A;  4OAN A;  3KBZ A;  4G61 A;  4N81 A;  2Q8M A;  4PC9 A;  2QVR A;  4FBP A;  4PF8 A;  1FBD A;  5CM6 A;  5LTC A;  4AS5 A;  2CEY A;  1SPI A;  2B4M A;  3T1B A;  2P3N A;  4H46 A;  1YYZ A;  4GWU A;  4NHB A;  1FPK A;  3ISP A;  4I3E A;  2VPN A;  2DDK A;  4NQ8 A;  2WEF A;  1IMB A;  3NOH A;  1BK4 A;  5EQA A;  5ESY A;  4PFR A;  3MYU A;  2WYK A;  1IMF A;  2V4C A;  2JJK A;  5EYH A;  2HPG A;  2OX3 A;  4MEV A;  2QFL A;  2QPQ A;  2V3Q A;  4NAP A;  3BIG A;  4N91 A;  4GWX A;  4PFB A;  3GYY A;  5DW8 A;  4MCO A;  2P3V A;  2PCR A;  4P3L A;  4UAB A;  1FPD A;  3ROJ A;  4PFI A;  1G0I A;  1FJ9 A;  4PE3 A;  2BJI A;  4GWY A;  2WBB A;  1IME A;  1NUW A;  3PTY A;  4PTK A;  1KZ8 A;  4PDH A;  2CEX A;  3T0J A;  2FIX A;  2Y5K A;  4JVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...