5L9OA

Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
DNPLGLIDPTTISVGTMGDAKPYAFTTADGNFTGFDIELFLNVAGRLGFKKEQVVFTGQEFSALMPSVANGRFDVAAAAIGTTAKRKETVDFSDGYLAGFLSVLTSEAGITDAAGLKGKRLGVVQGTLQEIYAEKNFAGTDLVKFPDNNSAVSALNNGTVDAHFLDFEAAKDYSARYPALKIAVNIPSFDAPAGFVIRKGNDALRNALDKGLKEAMQDGTWKKLHEKWFPGTPMPAAYLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for High Specificity of Amadori Compound and Mannopine Opine Binding in Bacterial Pathogens.
pubmed doi rcsb
source organism Agrobacterium fabrum (strain c58 / atcc 33970)
molecule tags Transport protein
molecule keywords Deoxyfructosyl-amino Acid Transporter Periplasmic Binding Pr
total genus 73
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5l9oA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5l9oA02
3H4ZA 3MBPA 4PFWA 3WAFA 4KD5A 1SW5A 2PX1A 4DCXA 2Y7KA 3IOWA 2DE4A 5I84A 5H8FB 1JQFA 4GXSB 3OELA 2Q89A 4U22A 1AOVA 5CI5A 1MXYA 4U4SA 2ZYMA 3HPIA 1H3DA 2FYIA 2ONSA 2O51A 3KOTA 1QVSA 4GWOA 5HBCA 3T9VA 4F2OA 4ZEIA 2NOOA 4NF5A 3VDFA 1NNPA 4PFTA 1B52A 5L9SA 3B6QA 5FHMA 5ISUA 1XC1A 1FW0A 1S9TA 3MP8A 3DLNA 2FA7A 3O28A 4ND9A 2ZNUA 2O7IA 4GLIA 3KZGA 4P0IA 4F29A 1O64A 1SBPA 2Q9TA 1DMBA 2I4CA 3M8UA 5TP9A 2Y7IA 1ZIUA 3KJ7A 2F6PA 2FNCA 1AMFA 2X26A 4GOTA 2Y84A 1OVBA 2GHAA 4H0WA 3MC2A 4XKPA 3R7XA 3V5AA 4EF1A 3O66A 1ZLQA 3S2VA 3VXBA 1SW1A 3PUVE 2E1SA 5BUUA 1NNKA 2Z8DA 1D3KA 3CIJA 4YMBA 2DXRA 1A54A 1B5JA 3O6GA 1MM6A 3KBRA 1OQGA 3GLBA 1M5DA 2V3UA 4R74A 4N6PA 2REJA 4E0WA 2F97A 2HQ0A 5TPAB 1A55A 1LLSA 4KCDA 2DVCA 4NF5B 5DVJA 3RTFB 3TDJA 5H8NB 2NXOA 1I6QA 4NTLA 4RA1A 3U1OA 3O97A 5B70A 1FQDA 1ZJLA 1JETA 1DOTA 3N6UA 4EXKA 2F36A 4POXA 1VFDA 1GGGA 1B40A 4OEVA 3VLUA 5AA4B 4Q5TA 3EHTA 1VR5A 3HSTA 1Y4CA 4PE5B 5F7VA 4RXLA 1OIBA 4JB7A 3VVDA 1H76A 1SVXB 1PBPA 1L5TA 1US4A 1EZPA 1B7UA 3BKIB 4R9GA 4F3GA 2O1MA 4KCCA 3RUMA 3JYRA 3U72A 2QRYA 3L6GA 4YKKA 2D5WA 4YB7A 1JVXA 2REGA 3K1PA 3K6VA 3TAJA 2ONRA 5DVFA 2H99A 3FGSA 3FXQA 3IOTA 4ZEDA 5CC2A 3H6VA 3TTMA 3K1NA 3AXFA 4R6HA 4F39A 4Q30B 3G3GA 3QSLA 2XXWA 2R9JA 2RKMA 2OK2A 1GTKA 4PFUA 4R73A 2X7PA 5KZTA 1WODA 1MRPA 4MF3A 1MPBA 1JNFA 4NMYA 3GZGA 4YB5A 4EUOA 1NNTA 1AIVA 3FJMA 4JBZA 4NWDA 3SKPA 1H45A 5AA4A 1N3XA 2G93A 3E3KA 4Q8RA 1N7XA 4LUBA 3PUYE 3KN3A 2B65A 3K0VA 1B3LA 3MUQA 4KYEA 3SDFA 3TTLA 3IAZA 1OVTA 3IK6B 4U1ZA 2XHDA 3MZBA 4R9FA 3MVWA 1IIWA 1UTBB 2D21A 1LAGE 2Q2AA 3SEVA 3TCGA 3K6WA 1Y9UA 4X1BA 3G3HA 3IB2A 3S9LC 3PGFA 1P1QA 4PETA 2ZNSA 3Q28A 5L9MA 3TELA 3FVNA 1XOCA 2OBGA 3O29A 5H8HB 5K2XA 5A5XB 3T9HB 2HZKA 2F34A 1OLAA 3G7WA 1MH3A 1MY1A 3OO6A 4IGRA 3G3FA 4QFKA 4NF8B 5H8NA 5ICTA 3CSBA 3O9PA 1VSOA 3W9VA 2DSFA 4JWOA 4EXLA 3K2DA 4F3SA 1UTHA 1FCKA 2F7CA 2QS4A 1GV8A 1B2HA 2W7YA 2XD2A 3OXNA 4PP0A 5I59B 3Q29A 2I6EA 4HTGA 4KR5A 4FECA 3TCHA 1LAHE 2HFBA 3A3UA 3U92A 4U21A 2UVHA 5TU0A 2AL4A 2KLFA 2P0SA 4OTEA 2DXYA 3H03A 1O7TA 2DWHA 1OQHA 3F11A 4BLAA 3I5OA 3N5LA 3SEYA 3IJXB 4IO2A 1NH8A 1LBCA 1N0TA 2VOZA 3MZ1A 4GL0A 4MBPA 1IZ1A 2QL3A 3SEXA 3QXMA 1IXCA 3RLFE 2XX7A 2B3BA 3I3VA 3OD7A 2YPNA 4IO3A 3TTKA 2UVJA 5JTYA 3IX1A 4H8IA 3IORA 1LAXA 2PT2A 3GXAA 5M2VA 2H4IA 3LSWA 4WKMA 2PMSA 1NH7A 2V84A 3ECRA 3RT8A 2NUVA 3GBBA 3LSFB 3CFLA 4XKQA 1UTHB 1KWHA 3FVOA 1LCFA 1SW4A 5DEXA 4R2FA 3OENA 2Y7RA 5I57A 1MXVA 2VGQA 2CMOA 2RC9A 1URSA 4BDLA 2HXWA 3THIA 4JWXA 1FQFA 5JK4A 4OYVA 4GF8A 2XXQA 4WXJA 4I1DA 4RPNA 1D9YA 5DYHA 2OLBA 3B6TA 3DELB 4QF9A 1IXIA 3GBAA 4ELPA 3BFTA 2V3TA 4G8HA 4FIMA 1EZ9A 3UGWA 5B7DA 3FUZA 3DM0A 1B6HA 5EYFA 2XXIA 2WKYA 1IQ7A 3LC8A 4JSOA 4LZ7A 3I6VA 3PV0E 4ELOA 3Q27A 3C31A 2D3IA 3FIRA 4IY6A 4NF8A 3N6TA 4QSEA 3S4UA 3VLWA 4OESA 4R75A 1MY4A 4NE4A 1QUJA 5CMCA 2AYSA 1A8EA 1GR2A 3PUZE 1TWYA 3KFMA 5DEXB 5CBRA 1S50A 2UXAA 1P1NA 3HHGA 1XVYA 4KHZE 4JSDA 1MDP1 1Z7ME 3G3IA 1DTGA 3KN7A 1FTOA 3TFLA 4AB6A 4BDQA 1DSNA 1BP5A 3PPNA 5J1DA 1LFHA 5IAIA 2PVUA 3H06B 3MP6A 1B7ZA 4ZDMA 5ITPA 1M5FA 3PD9A 4PQJA 3C32A 3S9MC 1LB8A 3UA8A 4DE8A 1FQBA 2P2AA 4EDPA 1B9JA 1MXZA 1TT1A 1VFEA 2H9BA 2R6GE 3O6IA 4DXUA 3IO4A 4AB5A 2DE2A 4GXAA 1B1HA 1PDAA 1M5EA 1B4ZA 4TQUQ 2XXHA 4OMBA 1LAFE 4GFRA 3TTRA 3FJGA 1A99A 2XXTA 1BKAA 1AH5A 3CG1A 2Z23A 3EHSA 3KOSA 5JTYB 3TMGA 4EF2A 1IEJA 1MPDA 2UVGA 3UK4A 3OO8A 1QULA 1MY3A 4ZEKA 1F9BA 4FEDA 1H43A 4RNSA 4TOZA 3TPAA 2DWAA 1Y4TA 1DPEA 4UA8A 3ZSFA 2DQVA 3IOVA 1B7HA 1OLCA 3ZKLA 2VD3A 1I6AA 1I69A 2GH9A 4DDDA 3EQ1A 3PMVA 1B3FA 3PD8A 1H44A 3K02A 5CMKA 1Y3QA 2PYYA 1FTLA 1NFTA 2RC8A 3E9XA 2H25A 3LSXA 4H5GA 2DVZA 3D4GA 2RCBA 2Q88A 4H8JA 4HCWA 4KYSA 2M8CA 4ZS9A 3WAEA 1B3HA 4ECFA 3CSGA 2DYXA 1B0LA 4Z0IA 3K6UA 3PPOA 1QKBA 4O3AA 4YICA 3P7IA 1P1OA 4O3CA 5ITOA 3TYHA 2HZLA 1B5IA 3ZKKA 3FJ7A 5IKBA 2RF1A 4K3FA 1DPPA 2F6GA 3R26A 3V8XB 4H5FA 4YKPA 3PPRA 4BDMA 2PBWA 1SYHA 1TFAA 3H3GA 4OFJA 3MWBA 5H8SA 4PFYA 3PPQA 4OFLA 3VVFA 1ELJA 5KDTB 5JEIA 1BTJA 5CM6A 3OSRA 2GRVA 1GVCA 3SESA 2Y7PA 3FVKA 4MFIA 4F1UA 1CB6A 3DP4A 3OEKA 4QFNA 1ZTYA 2X7QA 1N04A 4IO5A 3HO7A 4MLVA 5FHOA 4QFLA 4F3PA 3L6HA 3RGYA 2I0BA 4U1OA 4Q0CA 3MQ9A 4YAHX 3DP6A 5AA1A 2ZYNA 4F3BA 3E4RA 2F5XA 5H8FA 1N7WA 2ZYOA 3CRBA 5AA2D 3V83A 3ILTB 4LP2B 4N07A 3T96B 1TFDA 2XXYA 2XX8A 4XKRA 4F1VA 4N13A 4XXUA 5HPQA 1R6ZA 3MAMA 5ICQA 2UYFA 1Y1MA 2O69A 1XS5A 1BIYA 1Z7NE 4FE8A 5CMMA 4RPOA 3S9EA 2YJPA 4F19A 2DE3A 3RPWA 3RQTA 1PBQA 1IITA 2GHBA 1POY1 3FZVA 1B58A 3K1MA 4NEDA 4QRZA 4KPTA 2NVUB 2QPQA 4F22A 4I62A 4F18A 1T0KA 5TP9B 3RTWB 3KEIA 4H6DA 5DVIA 1MY0A 2ZNTA 1MQDA 4RJZA 2H98A 2ANJA 1LFGA 1MXUA 1B51A 2ZXTA 3MVYA 3QK6A 1FQAA 2UYEA 4KFQA 3BFUA 1QW0A 3FVGA 4U23A 2F7BA 2I48A 3PUXE 4X9TA 4YU0A 5BWJA 1QUKA 1JW5A 2RCAA 3M3KA 4M1VA 2XXVA 3QIMA 2Z8EA 2QS3A 3SEUA 1A7LA 2QS1A 3K6XA 3C4MA 3ONMA 3KN8A 4G4PA 2O68A 4Z7EA 5I58A 3IOUA 1SI1A 1B46A 2XX9A 4LATA 3DP8A 5TPAA 4DLDA 3T22A 3EF7A 3CG3A 1PB8A 3MPKA 3TEPA 2Q2CA 3MJNA 1XHYA 2ONKE 2QSXA 2OWTA 3LBSA 4I8CA 4ZZAA 3TUSA 1UIVA 2Z22A 1YCJA 2HAVA 4X48A 3UN6A 4XTCQ 1MQJA 4GIZA 1B5HA 1PB9A 3K4UA 4DIGA 1JEUA 2RINA 1MDQA 3IR1A 3CR9A 1YAEA 2BJJX 3EN3A 2F35A 5FHNA 4ZEFA 3C34A 2R71A 3CFZA 1USYE 5EHSA 1ANFA 1R1NA 3VXCA 4MH5A 2DWJA 2F78A 1URDA 1Q1KA 2ZYKA 1R9QA 3RY3A 3IB0A 5I56B 5CMBA 1IXHA 1RYXA 4OEUA 4BDNA 2F7AA 4YKJA 1UIUA 4FEBA 4ZE8A 4IO6A 4C1TA 5I58B 3Q26A 4U4XA 4NF6A 4DZ1A 2P1SA 2O6AA 4KQPA 1IXGA 3IO6A 1R9LA 2DWIA 3CFXA 3IJOB 3N94A 4RYAA 1FTMA 4THIA 5HM4B 1UTBA 3SEWA 2F8DA 1EU8A 2ZMBA 4H67A 3O6HA 3OO7A 4G2ZA 4IO7A 4QSDA 3UIFA 3FXRA 1RKMA 3OSQA 5DTBA 1P1UA 5L9OA 3QUJA 4OVJA 4RY1A 1LFIA 5A5XA 2I58A 1FQCA 4RK2A 3ODBA 4XIGQ 2G29A 1QUIA 4OQOA 2I49A 1PB7A 3KSXA 5FTHA 4M4GA 4TLMB 4G68A 3A09A 4QFOA 3BBRA 5AE4A 3HHFA 1VE4A 2O7UA 3N26A 1LCTA 4R2BA 1B3EA 1NMUA 4BDOA 1HSEA 1II5A 1TXFA 2XXXA 3OOAA 1ATGA 5H8HA 5KCJB 4H65A 2I0CA 3PUWE 4U2RA 5K2YA 4XKNA 3VFJA 1MM7A 4LA9A 3A3CA 5EHMA 4UACA 1JW1A 1B3GA 1M5CA 4GL8A 3MVXA 3ILUB 1N84A 3TCFA 2CZLA 3G3JA 5L8DA 4ESXA 4OWDA 3OEMA 1J1NA 1USYH 3SETA 4ZE9A 4NF4A 4KYDA 2NWJA 5I59A 4G8NA 4EQ7A 2UVIA 3KGCA 4F31B 2V25A 3JV9A 3D4CA 4H1XA 4ZZEA 4C1UA 1XVXA 3MZ9A 2ABHA 1I6BA 1B4HA 1SQYA 1Y1ZA 4G8MA 1D9VA 1UQWA 3V89B 4ELRA 3VVEA 4AQ4A 4OXVA 4OHNA 3MW0A 3U94A 5AA3A 1BLFA 3FV1A 3KG2A 4I9DA 1QJMA 1EZOA 4RK9A 4F2QA 5KCJA 3R6UA 4LQ5A 5I2NA 1QKAA 4FAJA 1IUDA 3HN0A 1B0HA 1WDNA 3TZAA 5I57B 3LUYA 3H6WA 2GFEA 3O2AA 3OMBA 4OENA 4R6KA 4FATA 1ZBMA 1OMPA 3EPEA 1JVYA 4YB6A 5CRYA 4DXCA 3KJTA 4IGTA 4JXIA 4P0GA 4MLQA 4OETA 5I2KA 1Q35A 1ZU0A 2XD3A 2OWSA 2V3QA 2XXUA 3FASA 4IO4A 1NL5A 4NF4B 3SERA 2QJEA 4C0RA 4WEDA 1AL3A 2VD2A 1LBBA 1JEVA 1MG1A 2B3FA 4HCYA 4YMAA 2YLNA 4R6YA 5KDTA 4IB2A 4OFOA 2HCAA 2QMWA 4ISUA 4YKIA 1A8FA 4FORA 4OZ9A 1S7YA 4G68B 1YTVA 2ALUA 3MVZA 4ESWA 2A5TB 3H7MA 4FJPA 3ZS6A 3C36A 4P11A 3CI8A 1MQHA 1US5A 3PMXA 3TQWA 3TQLA 3C33A 4YZZA 2QS2A 4LQ2A 1NNFA 1SW2A 1HSLA 1N76A 1P1WA 5H8QA 3U8QA 1Y3NA 4LZ5A 2E0SA 1B32A 3PMWA 4HS7A 3E13X 2DS9A 4O3BA 2V93A 4GD5A 4TLLB 2IA4A 3H6UA 3M3FA 5ELVA 3JZJA 5FTIA 5I2KB 3G3KA 3RT6B 1POTA 1N3WA 3UP9A 1Y3PA 3OO9A 4G68C 4QHQA 4DXBA 1MY2A 4JWYA 4ELQA 3MPLA 3FATA 1PEBA 3IB1A 4F1YA 1HSJA 1FTJA 3M3LA 4QFPA 3QUFA 3VV5A 4X1DA 3LSLA 2XXPA 1PC3A 3T66A 3B6WA 3TKDA 2O84X 3HV1A 2I4BA 3C35A 4G77A 4HW8A 4ONYA 3VLVA 1MXXA 4POWA 1SDXA 3TTNA 4DCYA 3FV2A 4EQ9A 2IEEA 3T93B 3RN8A 3VE1B 1DTZA 5AA2B 3FD3A 2OZZA 1MQIA 3HCQA 3QYTA 2DP8A 4LZ8A 3Q25A 4OERA 2AL5A 5I2NB 1A40A 4R72A 5H8QB 2Q8JA 3IL1B 3TODA 1NKXA 4NWCA 1MS7A 1URGA 3H6TA 3PPPA 1D4NA 2I3VA 4KI0E 1Y20A 1B1XA 1MQGA 5CBSA 3T9UA 5DT6A 2PT1A 1LSTA 3PU5A 1M5BA 3K00A 3W15C 4EQBA 1MH4A 1LB9A 1YPNA 3S9NC 4BDRA 3CVGA 3W9WA 2VHAA 2H5YA 3RNNA 4LVQA 1ZMGA 5F1QA 2Y7WA 1B05A 1O63A 4LONB 2AIXA 2QMXA 1ZKBA 2HAUA 3MP1A 2ESNA 4IY5A 1JW4A 1MXWA 1WVJA 2RC7A 2VP1A 2A5TA 3T9XB 2DOJA 3EHUA 3C9HA 1SI0A 3U93A 4E0XA 5AA2A 2A5SA 2O1LA 5LOMA 3USDA 1FQEA 5I56A 4WEPA 2OCUA 1RYOA 3FXUA 3KSJA 1FTKA 2I3WA 2Z8FA 3QAXA 1XT8A 2THIA 2XXRA 3B7DA 4L17A 4GRKA 4GQOA 1SYIA 3K01A 1SD3A 4ZEBA 1P99A 4NF6B 2LAOA 3UORA 1MPCA 1EH3A 4QSCA 2HEUA 3LR1A 4GVOA 4JDFA 1CE2A 1LGBC 4ZECA 2OJTA
chains in the Genus database with same CATH superfamily
3H4ZA 3MBPA 4NX1A 3KBZA 4GWXA 4KD5A 2DE4A 4GXSB 3OELA 3A29A 4I40A 4NAPA 3TFLA 2FYIA 1QVSA 4ZEIA 2NOOA 4NF5A 3ROJA 1NNPA 1B52A 3B6QA 5FHMA 5ISUA 4GBVA 5I7IA 4F29A 2Y7IA 4GOTA 1AMFA 2Y84A 1OVBA 4XKPA 4P56A 5ET8A 1OQGA 3GLBA 1M5DA 4R74A 2CEXA 3TDJA 1I6QA 1ZJLA 1DOTA 4EXKA 1GGGA 3VLUA 4Q5TA 3EHTA 4PE5B 1OIBA 1SVXB 1EZPA 4F3GA 4KCCA 3JYRA 3L6GA 3FGSA 3H6VA 3K1NA 2XXWA 2R9JA 1AIVA 2X7PA 4MF3A 1MPBA 4YB5A 3FJMA 4NWDA 4Q8RA 3KN3A 4NG7A 3K0VA 4MIJA 4U1ZA 1OVTA 3IK6B 2Q8MA 4GWSA 3MZBA 1IIWA 3TCGA 4X1BA 3TELA 3O29A 5K2XA 3T9HB 1MY1A 4NF8B 5H8NA 5ICTA 3CSBA 3O9PA 1VSOA 3W9VA 3IFCA 4F3SA 5CMKA 1NUWA 2QS4A 3MYUA 4FECA 2CZHA 2DWHA 3IJXB 4MX6A 4GL0A 4MBPA 2QL3A 3LUZA 3OD7A 3I3VA 2YPNA 3TTKA 5JTYA 3IX1A 3IORA 1IMBA 3CFLA 1URSA 4I1DA 4O8MA 2CEYA 4RPNA 5DYHA 2OLBA 3GBAA 4G8HA 1EYJA 3UGWA 1B6HA 3LC8A 3I6VA 4MCOA 3N6TA 4R75A 5CMCA 1GR2A 1VDWA 3KFMA 5DEXB 3HHGA 1XVYA 1MDP1 1DTGA 4BDQA 5J16A 3PPNA 2PVUA 3MP6A 4PDHA 4AS5A 1NV7A 3PD9A 3C32A 3S9MC 4EDPA 4DXUA 1NUXA 4PCDA 4GXAA 4TQUQ 1BKAA 1AH5A 4RNSA 4TOZA 3TPAA 2DWAA 1Y4TA 3IOVA 1B7HA 2VD3A 1I6AA 1I69A 2GH9A 1H44A 1Y3QA 2RC8A 3E9XA 3HFUA 2DVZA 4HCWA 3WAEA 2M8CA 4ECFA 2DYXA 4Z0IA 3K6UA 4YICA 4O3AA 4X8RA 4O3CA 3TYHA 2F3BA 3FJ7A 4H5FA 1TFAA 4OFJA 3MWBA 1GVCA 4MFIA 3DP4A 5FHOA 3L6HA 4U1OA 4Q0CA 4YAHX 5AA1A 2F5XA 5H8FA 4XEQA 3V83A 1TFDA 2XX8A 4N13A 4XXUA 5ICQA 2YJPA 1LBYA 2ZZWA 1PBQA 2GHBA 4DI4B 2NVUB 4F22A 4I62A 5TP9B 4H6DA 4YU0A 5BWJA 4M1VA 2XXVA 2QS3A 1A7LA 3IOUA 4DLDA 3EF7A 2KR0A 3MJNA 3TUSA 2Z22A 1B5HA 3K4UA 4XF5A 3EN3A 3C34A 3CFZA 3VXCA 2ZYKA 5I56B 1KZ8A 1IXHA 1RYXA 2F7AA 4FEBA 3Q26A 1IMFA 4P3LA 1IXGA 2DWIA 3SEWA 3O6HA 3OO7A 4IO7A 3FXRA 1RKMA 5L9OA 4RY1A 2I58A 1FQCA 2WEFA 2G29A 1QUIA 5FTHA 1G0IA 3HHFA 1FPKA 4R2BA 4PGNA 1KA0A 5KCJB 1ATGA 4U2RA 3PUWE 5K2YA 3A3CA 3LV0A 1N84A 1J1NA 3SETA 4ZE9A 4NF4A 3JV9A 3D4CA 1SQYA 4ELRA 4PAFA 1UQWA 4OXVA 5AA3A 1BLFA 3KG2A 1EZOA 1WDNA 5I57B 2MKZA 3LUYA 4FATA 3OMBA 4OENA 3EPEA 1OMPA 4DXCA 4YB6A 3KJTA 4MLQA 1Q35A 1FPEA 2V3QA 1NL5A 4NF4B 4MMPA 3SERA 2QJEA 4WEDA 1LBBA 1JEVA 2B3FA 2QMWA 4ISUA 4PC9A 1US5A 3C33A 1B32A 4TLLB 3M3FA 4QHQA 3VV5A 3B6WA 2O84X 4HW8A 2I4BA 1FPGA 1SDXA 4DCYA 3FV2A 2IEEA 1DTZA 5AA2B 2OZZA 5I2NB 2AL5A 2Q8JA 3IL1B 3TODA 1D4NA 1MQGA 2PT1A 1LSTA 3W15C 1YPNA 4BDRA 1BK4A 1ZMGA 1O63A 4PFRA 4LONB 3MP1A 2HAUA 2ESNA 1WVJA 3C9HA 3USDA 5I56A 3QAXA 4GWUA 4L17A 1SYIA 1SD3A 4QSCA 1EH3A 1SW5A 1QGXA 5I84A 4N8YA 4GWOA 5HBCA 2ONSA 2O51A 1NV3A 4HXVA 4PFTA 5EYHA 1XC1A 1FW0A 1S9TA 4ND9A 4JVCA 2Q9TA 4O7MA 2X26A 3R7XA 4H0WA 3O66A 1SW1A 3PUVE 2Z8DA 1D3KA 4GX6A 1A54A 3KBRA 2V3UA 4N6PA 2ZZVA 5TPAB 1A55A 2WBBA 4KCDA 2DVCA 2XA5A 2NXOA 3KC1A 4NTLA 5ET6A 1FQDA 2JJKA 3N6UA 2F36A 4OVPA 1VFDA 1B40A 1VR5A 2DDKA 1Y4CA 4RXLA 3VVDA 5I3SA 4N4UA 4R9GA 2O1MA 3RPLA 3RUMA 2REGA 3AXFA 4Q30B 3G3GA 1WODA 3GZGA 4EUOA 3BIHA 2B4MA 1N3XA 2G93A 3E3KA 1N7XA 4LUBA 3TTLA 2PFZA 2XHDA 4P47A 1EYIA 4H45A 3PGFA 1P1QA 4PETA 2OBGA 5H8HB 2F34A 1MH3A 4IGRA 5DW8A 2VPOA 2DSFA 4EXLA 3K2DA 1GV8A 5I59B 4PP0A 4HTGA 4KR5A 3U92A 4U21A 2UVHA 2AL4A 2P0SA 3H03A 1OQHA 3F11A 4MNIA 3I5OA 3SEYA 4IO2A 3MZ1A 2VOZA 3QXMA 1IXCA 4IO3A 1LAXA 3GXAA 5M2VA 1NUZA 2H4IA 3LSWA 3ECRA 1NH7A 2NUVA 3LSFB 1FBCA 1LBWA 2WX9A 3FVOA 1SW4A 1FPDA 2Y7RA 5I57A 1MXVA 2HXWA 4OYVA 1D9YA 1KA1A 4QF9A 1IXIA 1EZ9A 3DM0A 5EYFA 2WKYA 4ELOA 2VPNA 4IY6A 4NF8A 3VLWA 4OESA 4PAKA 3PUZE 1TWYA 2UXAA 1P1NA 4KHZE 1Z7ME 3KN7A 4AB6A 1BP5A 3H06B 1B7ZA 1LB8A 3UA8A 4DE8A 1FQBA 1TT1A 4PGPA 1B1HA 1M5EA 1B4ZA 1LAFE 2XXTA 4EF2A 3KOSA 4ZEKA 1F9BA 1LEVA 4UA8A 1OLCA 3PMVA 1B3FA 3PD8A 1AOVA 4NF0A 2PYYA 4XKRA 4F1VA 3D4GA 4ZS9A 4H8JA 3CSGA 1B0LA 1FPJA 1QKBA 4HE1A 3P7IA 5ITOA 4MHFA 5IKBA 4K3FA 4YKPA 4BDMA 2PBWA 5H8SA 1Q9DA 3PPQA 3VVFA 5IZ3A 5CM6A 3OSRA 2Q74A 1CB6A 1N04A 4IO5A 3HO7A 4MLVA 3RGYA 3DP6A 1N7WA 1YZ0A 3T96B 4N07A 1FBGA 1R6ZA 3MAMA 1Y1MA 2O69A 2CZIA 1BIYA 3RPWA 3RQTA 1IITA 3FZVA 4QRZA 4GWYA 1K9ZA 3KEIA 2ZNTA 1MQDA 2H98A 2ANJA 1LFGA 1B51A 3BFUA 3PUXE 1QUKA 1NV6A 3M3KA 3ONMA 5I58A 4Z7EA 3KN8A 3DP8A 1XHYA 2ONKE 4ZZAA 1UIVA 2HAVA 1MQJA 1PB9A 3RYDA 4DIGA 2RINA 4ZEFA 2BJJX 5FHNA 5EHSA 1USYE 4MH5A 1URDA 1Q1KA 3RY3A 4OEUA 4BDNA 4NF6A 4DZ1A 3CFXA 3IJOB 4RYAA 2ZMBA 1G0HA 4QSDA 3D1RA 5DTBA 1LFIA 5A5XA 4TLMB 3A09A 1VE4A 4P9KA 3N26A 1LCTA 1NMUA 1HSEA 1II5A 2I0CA 1MM7A 5EHMA 3TCFA 1USYH 5LDZA 2NWJA 4KYDA 2UVIA 4H1XA 4ZZEA 4MAGA 3MZ9A 2ABHA 1I6BA 2Y5KA 4G8MA 1D9VA 3VVEA 4AS4A 3U94A 4RK9A 5KCJA 5I2NA 3HN0A 2GFEA 4R6KA 5CRYA 1JVYA 5I5PA 4JXIA 4P0GA 5I2KA 2OWSA 4IO4A 3FASA 1AL3A 4HCYA 2YLNA 4PDDA 4FORA 1S7YA 1YTVA 4ESWA 4MNPA 3H7MA 4FJPA 3C36A 3MSTA 1MQHA 3PMXA 3TQLA 4LQ2A 1SW2A 1P1WA 2E0SA 1NI9A 2DS9A 5FTIA 3JZJA 3OO9A 4DXBA 4NQ8A 3MPLA 3FATA 1HSJA 1FTJA 4QFPA 4NGUA 3QUFA 4X1DA 3C35A 2DP8A 4R72A 5H8QB 4X04A 1NKXA 3B8BA 4KI0E 1B1XA 5CBSA 2QVUA 3T9UA 5DT6A 1M5BA 3S9NC 3W9WA 2HHMA 3RNNA 4LVQA 1B05A 2AIXA 1ZKBA 4IY5A 1IMCA 3T9XB 4E0XA 1SI0A 5LOMA 1RDXA 1RYOA 1FTKA 2FIXA 2XWOA 2THIA 4P8BA 1K9YA 3PTYA 1RDZA 2HEUA 4JDFA 3KZGA 1LGBC 4ZECA 4PFWA 3WAFA 2L5VA 2PX1A 4GX3A 5H8FB 2QVRA 2Q89A 5IM2A 4U4SA 3KOTA 3T9VA 4F2OA 3VDFA 2FVZA 3DLNA 2FA7A 3O28A 4P0IA 1NV2A 2I4CA 5TP9A 2F6PA 3MC2A 4OVQA 3S2VA 5BUUA 3CIJA 4YMBA 1B5JA 3O6GA 2F97A 2HQ0A 1LLSA 4RA1A 2FIEA 4O7IA 5B70A 4OEVA 5AA4B 2QFLA 4JB7A 1L5TA 3BKIB 3U72A 2QRYA 4YKKA 2WBDA 1JVXA 3IOTA 4ZEDA 3TTMA 4F39A 4PFUA 1NV4A 3QSLA 2RKMA 2OK2A 5KZTA 1MRPA 1NNTA 3QMFA 3SKPA 1H45A 2OWZA 3PUYE 2B65A 1B3LA 4KYEA 3SDFA 3IAZA 3MVWA 3K6WA 1Y9UA 3Q28A 3FVNA 2HZKA 1FBHA 1OLAA 1FTAA 3G3FA 4QFKA 3KC0A 4JWOA 4N6DA 1B2HA 2W7YA 3OXNA 2HFBA 4GX4A 1O7TA 4BLAA 3N5LA 1NH8A 1LBCA 1N0TA 3RLFE 2XX7A 2B3BA 4H8IA 1NV5A 2B4LA 4XKQA 1KWHA 2VGQA 4BDLA 4NN3A 4JWXA 5JK4A 4GF8A 2XXQA 4WXJA 4DI3D 4PTKA 3T0JA 4ELPA 2V3TA 1LBZA 2XXIA 1IQ7A 4JSOA 3PV0E 3Q27A 4QSEA 3S4UA 1QUJA 1S50A 4PF8A 4JSDA 1FTOA 4UABA 4PQJA 1B9JA 1MXZA 2R6GE 3O6IA 3IO4A 2DE2A 1RDYA 1DCUA 3CHGA 2XXHA 4OMBA 3TTRA 3FJGA 1A99A 3CG1A 2Z23A 3TMGA 1IEJA 3UK4A 1H43A 4N15A 2DQVA 2BJIA 3EQ1A 3K02A 4H5GA 3ZSFA 1NFTA 5T3JA 1B3HA 1P1OA 2RF1A 2F6GA 3PPRA 4PFYA 4OFLA 5KDTB 5JEIA 1BTJA 2GRVA 3SESA 2Y7PA 4F1UA 3OEKA 1ZTYA 2X7QA 5ET7A 2V4CA 4F3BA 3E4RA 3ILTB 2XXYA 1FPIA 1FBDA 1XS5A 1FPLA 5CMMA 3S9EA 5EYGA 1FBEA 1T0KA 5DVIA 4JVDA 2ZXTA 1MXUA 1QW0A 2F7BA 4X9TA 1JW5A 3SEUA 2QS1A 3K6XA 4G4PA 2O68A 2XX9A 5TPAA 3T22A 4I3EA 2PCRA 3TEPA 4O94A 2CZKA 2OWTA 1YCJA 4X48A 4XTCQ 1JEUA 3E79A 3CR9A 1R1NA 1DK4A 3RPLB 4ZE8A 1SPIA 2P1SA 2O6AA 4KQPA 1R9LA 3N94A 1IMEA 4QBAA 2F8DA 4G2ZA 3UIFA 1P1UA 3QUJA 4RK2A 4XIGQ 2I49A 1PB7A 3KSXA 4G68A 4QFOA 3BBRA 1XI6A 4NHBA 5AE4A 1EYKA 2O7UA 4N6KA 1B3EA 2XXXA 3OOAA 4H65A 4XKNA 4LA9A 3SZPA 4GL8A 3MVXA 5IGAA 3ILUB 2CZLA 3G3JA 5L8DA 4ESXA 3OEMA 2WYPA 5A5LA 5I59A 4G8NA 4EQ7A 3KGCA 2V25A 4C1UA 3SEXA 3V89B 4EQ9A 1Y1ZA 4AQ4A 3FV1A 4I9DA 4F2QA 3R6UA 4OA4A 1QKAA 1B0HA 3O2AA 4IGTA 2XD3A 4KXPA 4C0RA 1YXIA 5KDTA 5L9SA 4R6YA 4IB2A 4OFOA 2HCAA 4OZ9A 2ALUA 3MVZA 3GYYA 1AWBA 3ZS6A 2R8TA 4YZZA 2GQ1A 1NNFA 1HSLA 1N76A 5H8QA 2P3VA 4HE0A 3PMWA 4O3BA 2V93A 3H6UA 5ELVA 1N3WA 4ELQA 1FBPA 1MY2A 4JWYA 1CNQA 4F1YA 2P3NA 3LSLA 2XXPA 1PC3A 2F3DA 3T66A 3TKDA 4G77A 4N81A 4GBWA 4ONYA 3VLVA 4POWA 3T93B 3VE1B 4PFIA 3FD3A 3ISPA 4LZ8A 3QYTA 3Q25A 1A40A 4N91A 4NWCA 1MS7A 1URGA 2I3VA 1Y20A 3K00A 4EQBA 1MH4A 1LB9A 2H5YA 5F1QA 2Y7WA 5IZ1A 2QMXA 2VP1A 2A5TA 2DOJA 1FRPA 1FQEA 3FXUA 2Z8FA 1XT8A 2XXRA 3B7DA 4GRKA 4ZEBA 3UORA 3K01A 3LR1A 4DCXA 2Y7KA 3IOWA 1JQFA 1FBFA 4U22A 5CI5A 1MXYA 2ZYMA 3HPIA 1H3DA 3FBPA 3MP8A 2ZNUA 2O7IA 4GLIA 1O64A 1SBPA 1DMBA 3FXBA 3M8UA 1ZIUA 3KJ7A 2FNCA 2GHAA 4EF1A 3V5AA 1ZLQA 3VXBA 2E1SA 1NNKA 2DXRA 4PAIA 1MM6A 2Y5LA 2REJA 4E0WA 3RTFB 5DVJA 4NF5B 5H8NB 3U1OA 3O97A 2WYKA 1JETA 4POXA 3HSTA 5F7VA 1H76A 1PBPA 1US4A 1B7UA 2D5WA 4YB7A 1FSAA 3K1PA 3K6VA 5F24A 4PF6A 2ONRA 3TAJA 5DVFA 2H99A 3FXQA 5CC2A 4R6HA 1GTKA 4R73A 1JNFA 4NMYA 4XFEA 4JBZA 5AA4A 2PFYA 3U65A 4GWWA 2HXRA 3MUQA 4PBQA 4P1EA 3EKIA 4R9FA 1UTBB 2D21A 3SEVA 1LAGE 2Q2AA 3BIGA 1IMDA 3G3HA 3IB2A 3S9LC 5L9MA 2ZNSA 1XOCA 4IR8A 5A5XB 3G7WA 3OO6A 1UTHA 1FCKA 2F7CA 2XD2A 3Q29A 2I6EA 3TCHA 1LAHE 3A3UA 5TU0A 2KLFA 4OTEA 2DXYA 1JP4A 1IZ1A 2UVJA 2PT2A 1DBZA 1NUYA 4WKMA 2PMSA 2QVVA 2V84A 3RT8A 3GBBA 1UTHB 1LCFA 5DEXA 2KQZA 4R2FA 3OENA 1FJ9A 2CMOA 2RC9A 3THIA 1FQFA 1LBVA 4MNCA 5EQ9A 4JVIA 3B6TA 3DELB 3BFTA 4FIMA 5B7DA 3FUZA 4HE2A 5EQ8A 4LZ7A 3C31A 2D3IA 3FIRA 4MEVA 1MY4A 4NE4A 2AYSA 1A8EA 5ESYA 5CBRA 1YYZA 4LN5A 3G3IA 5J1DA 1DSNA 1LFHA 5IAIA 4ZDMA 1M5FA 2P2AA 1VFEA 2H9BA 4AB5A 1PDAA 4OVSA 4GFRA 3EHSA 5JTYB 1MPDA 2UVGA 4FBPA 3OO8A 1QULA 1MY3A 4FEDA 1FJ6A 2OX3A 1DPEA 5IZ3B 3ZKLA 4DDDA 1FTLA 3LSXA 2H25A 4KYSA 2RCBA 2Q88A 5FBPA 2XWVA 5ET5A 3PPOA 2HZLA 1B5IA 1D9QA 3ZKKA 1DPPA 3R26A 3V8XB 4PBHA 1SYHA 3H3GA 1ELJA 3FVKA 4QFNA 4QFLA 4F3PA 2I0BA 3MQ9A 2ZYNA 4MJOA 2HPGA 2ZYOA 3CRBA 5AA2D 4LP2B 5HPQA 2UYFA 2VT5A 1Z7NE 4FE8A 4RPOA 4F19A 2DE3A 2ZZXA 1POY1 4NEDA 1B58A 3K1MA 3T1BA 4KPTA 2QPQA 4F18A 3RTWB 1MY0A 4RJZA 3MVYA 3QK6A 1FQAA 2UYEA 4KFQA 3FVGA 4U23A 2I48A 2RCAA 3QIMA 2Z8EA 3C4MA 1IMAA 1SI1A 1B46A 4LATA 4N17A 4OVTA 3CG3A 1PB8A 3MPKA 2Q2CA 2QSXA 3LBSA 4I8CA 4N8GA 3UN6A 4GIZA 1MDQA 3IR1A 1YAEA 2F35A 2R71A 1INPA 1ANFA 2DWJA 2F78A 1R9QA 3IB0A 5CMBA 4YKJA 4C1TA 1UIUA 5I58B 4IO6A 4U4XA 2XXKA 3IO6A 4PFBA 1FTMA 4THIA 1NV0A 5HM4B 1UTBA 1EU8A 4H67A 3OSQA 1FPFA 3B50A 4OVJA 5EQ7A 3ODBA 4OQOA 4M4GA 1FPBA 4BDOA 1TXFA 5H8HA 3VFJA 4UACA 1JW1A 4H46A 1B3GA 1M5CA 3IFAA 4OWDA 4F31B 1XVXA 3NOHA 1B4HA 1NV1A 4OHNA 3MW0A 2FHYA 1QJMA 4LQ5A 4FAJA 1IUDA 4OVRA 3TZAA 4PE3A 3H6WA 1ZBMA 4OANA 4OETA 1ZU0A 2XXUA 2VD2A 4GWZA 4YMAA 1MG1A 4YKIA 1A8FA 1LBXA 4G68B 4P1LA 2A5TB 4P11A 3CI8A 3TQWA 5EQAA 2QS2A 3U8QA 1Y3NA 4LZ5A 4HS7A 5IZZA 3E13X 4GD5A 2IA4A 3RT6B 5I2KB 3G3KA 1POTA 3UP9A 1Y3PA 4G68C 3IB1A 1PEBA 5ITPA 3M3LA 3E78A 3HV1A 5LTCA 1MXXA 4G61A 3TTNA 3RN8A 2XWKA 4QXDA 1MQIA 3HCQA 4OERA 2XWIA 3H6TA 3PPPA 3PU5A 3CVGA 2VHAA 4I3YA 1JW4A 1MXWA 2RC7A 3U93A 5AA2A 3EHUA 2A5SA 2O1LA 2FBPA 4WEPA 2OCUA 3KSJA 2I3WA 4GQOA 1P99A 4NF6B 2LAOA 1MPCA 4GVOA 1CE2A 2OJTA
chains in the Genus database with same CATH topology
3H4ZA 3MBPA 4PFWA 3WAFA 4KD5A 1SW5A 2PX1A 4DCXA 2Y7KA 3IOWA 2DE4A 5I84A 5H8FB 1JQFA 4GXSB 3OELA 2Q89A 4U22A 1AOVA 5CI5A 1MXYA 4U4SA 2ZYMA 3HPIA 1H3DA 2FYIA 2ONSA 2O51A 3KOTA 1QVSA 4GWOA 5HBCA 3T9VA 4F2OA 4ZEIA 2NOOA 4NF5A 3VDFA 1NNPA 4PFTA 1B52A 5L9SA 3B6QA 5FHMA 5ISUA 1XC1A 1FW0A 1S9TA 3MP8A 3DLNA 2FA7A 3O28A 4ND9A 2ZNUA 2O7IA 4GLIA 3KZGA 4P0IA 4F29A 1O64A 1SBPA 2Q9TA 1DMBA 2I4CA 3M8UA 5TP9A 2Y7IA 1ZIUA 3KJ7A 2F6PA 2FNCA 1AMFA 2X26A 4GOTA 2Y84A 1OVBA 2GHAA 4H0WA 3MC2A 4XKPA 3R7XA 3V5AA 4EF1A 3O66A 1ZLQA 3S2VA 3VXBA 1SW1A 3PUVE 2E1SA 5BUUA 1NNKA 2Z8DA 1D3KA 3CIJA 4YMBA 2DXRA 1A54A 1B5JA 3O6GA 1MM6A 3KBRA 1OQGA 3GLBA 1M5DA 2V3UA 4R74A 4N6PA 2REJA 4E0WA 2F97A 2HQ0A 5TPAB 1A55A 1LLSA 4KCDA 2DVCA 4NF5B 5DVJA 3RTFB 3TDJA 5H8NB 2NXOA 1I6QA 4NTLA 4RA1A 3U1OA 3O97A 5B70A 1FQDA 1ZJLA 1JETA 1DOTA 3N6UA 4EXKA 2F36A 4POXA 1VFDA 1GGGA 1B40A 4OEVA 3VLUA 5AA4B 4Q5TA 3EHTA 1VR5A 3HSTA 1Y4CA 4PE5B 5F7VA 4RXLA 1OIBA 4JB7A 3VVDA 1H76A 1SVXB 1PBPA 1L5TA 1US4A 1EZPA 1B7UA 3BKIB 4R9GA 4F3GA 2O1MA 4KCCA 3RUMA 3JYRA 3U72A 2QRYA 3L6GA 4YKKA 2D5WA 4YB7A 1JVXA 2REGA 3K1PA 3K6VA 3TAJA 2ONRA 5DVFA 2H99A 3FGSA 3FXQA 3IOTA 4ZEDA 5CC2A 3H6VA 3TTMA 3K1NA 3AXFA 4R6HA 4F39A 4Q30B 3G3GA 3QSLA 2XXWA 2R9JA 2RKMA 2OK2A 1GTKA 4PFUA 4R73A 2X7PA 5KZTA 1WODA 1MRPA 4MF3A 1MPBA 1JNFA 4NMYA 3GZGA 4YB5A 4EUOA 1NNTA 1AIVA 3FJMA 4JBZA 4NWDA 3SKPA 1H45A 5AA4A 1N3XA 2G93A 3E3KA 4Q8RA 1N7XA 4LUBA 3PUYE 3KN3A 2B65A 3K0VA 1B3LA 3MUQA 4KYEA 3SDFA 3TTLA 3IAZA 1OVTA 3IK6B 4U1ZA 2XHDA 3MZBA 4R9FA 3MVWA 1IIWA 1UTBB 2D21A 1LAGE 2Q2AA 3SEVA 3TCGA 3K6WA 1Y9UA 4X1BA 3G3HA 3IB2A 3S9LC 3PGFA 1P1QA 4PETA 2ZNSA 3Q28A 5L9MA 3TELA 3FVNA 1XOCA 2OBGA 3O29A 5H8HB 5K2XA 5A5XB 3T9HB 2HZKA 2F34A 1OLAA 3G7WA 1MH3A 1MY1A 3OO6A 4IGRA 3G3FA 4QFKA 4NF8B 5H8NA 5ICTA 3CSBA 3O9PA 1VSOA 3W9VA 2DSFA 4JWOA 4EXLA 3K2DA 4F3SA 1UTHA 1FCKA 2F7CA 2QS4A 1GV8A 1B2HA 2W7YA 2XD2A 3OXNA 4PP0A 5I59B 3Q29A 2I6EA 4HTGA 4KR5A 4FECA 3TCHA 1LAHE 2HFBA 3A3UA 3U92A 4U21A 2UVHA 5TU0A 2AL4A 2KLFA 2P0SA 4OTEA 2DXYA 3H03A 1O7TA 2DWHA 1OQHA 3F11A 4BLAA 3I5OA 3N5LA 3SEYA 3IJXB 4IO2A 1NH8A 1LBCA 1N0TA 2VOZA 3MZ1A 4GL0A 4MBPA 1IZ1A 2QL3A 3SEXA 3QXMA 1IXCA 3RLFE 2XX7A 2B3BA 3I3VA 3OD7A 2YPNA 4IO3A 3TTKA 2UVJA 5JTYA 3IX1A 4H8IA 3IORA 1LAXA 2PT2A 3GXAA 5M2VA 2H4IA 3LSWA 4WKMA 2PMSA 1NH7A 2V84A 3ECRA 3RT8A 2NUVA 3GBBA 3LSFB 3CFLA 4XKQA 1UTHB 1KWHA 3FVOA 1LCFA 1SW4A 5DEXA 4R2FA 3OENA 2Y7RA 5I57A 1MXVA 2VGQA 2CMOA 2RC9A 1URSA 4BDLA 2HXWA 3THIA 4JWXA 1FQFA 5JK4A 4OYVA 4GF8A 2XXQA 4WXJA 4I1DA 4RPNA 1D9YA 5DYHA 2OLBA 3B6TA 3DELB 4QF9A 1IXIA 3GBAA 4ELPA 3BFTA 2V3TA 4G8HA 4FIMA 1EZ9A 3UGWA 5B7DA 3FUZA 3DM0A 1B6HA 5EYFA 2XXIA 2WKYA 1IQ7A 3LC8A 4JSOA 4LZ7A 3I6VA 3PV0E 4ELOA 3Q27A 3C31A 2D3IA 3FIRA 4IY6A 4NF8A 3N6TA 4QSEA 3S4UA 3VLWA 4OESA 4R75A 1MY4A 4NE4A 1QUJA 5CMCA 2AYSA 1A8EA 1GR2A 3PUZE 1TWYA 3KFMA 5DEXB 5CBRA 1S50A 2UXAA 1P1NA 3HHGA 1XVYA 4KHZE 4JSDA 1MDP1 1Z7ME 3G3IA 1DTGA 3KN7A 1FTOA 3TFLA 4AB6A 4BDQA 1DSNA 1BP5A 3PPNA 5J1DA 1LFHA 5IAIA 2PVUA 3H06B 3MP6A 1B7ZA 4ZDMA 5ITPA 1M5FA 3PD9A 4PQJA 3C32A 3S9MC 1LB8A 3UA8A 4DE8A 1FQBA 2P2AA 4EDPA 1B9JA 1MXZA 1TT1A 1VFEA 2H9BA 2R6GE 3O6IA 4DXUA 3IO4A 4AB5A 2DE2A 4GXAA 1B1HA 1PDAA 1M5EA 1B4ZA 4TQUQ 2XXHA 4OMBA 1LAFE 4GFRA 3TTRA 3FJGA 1A99A 2XXTA 1BKAA 1AH5A 3CG1A 2Z23A 3EHSA 3KOSA 5JTYB 3TMGA 4EF2A 1IEJA 1MPDA 2UVGA 3UK4A 3OO8A 1QULA 1MY3A 4ZEKA 1F9BA 4FEDA 1H43A 4RNSA 4TOZA 3TPAA 2DWAA 1Y4TA 1DPEA 4UA8A 3ZSFA 2DQVA 3IOVA 1B7HA 1OLCA 3ZKLA 2VD3A 1I6AA 1I69A 2GH9A 4DDDA 3EQ1A 3PMVA 1B3FA 3PD8A 1H44A 3K02A 5CMKA 1Y3QA 2PYYA 1FTLA 1NFTA 2RC8A 3E9XA 2H25A 3LSXA 4H5GA 2DVZA 3D4GA 2RCBA 2Q88A 4H8JA 4HCWA 4KYSA 2M8CA 4ZS9A 3WAEA 1B3HA 4ECFA 3CSGA 2DYXA 1B0LA 4Z0IA 3K6UA 3PPOA 1QKBA 4O3AA 4YICA 3P7IA 1P1OA 4O3CA 5ITOA 3TYHA 2HZLA 1B5IA 3ZKKA 3FJ7A 5IKBA 2RF1A 4K3FA 1DPPA 2F6GA 3R26A 3V8XB 4H5FA 4YKPA 3PPRA 4BDMA 2PBWA 1SYHA 1TFAA 3H3GA 4OFJA 3MWBA 5H8SA 4PFYA 3PPQA 4OFLA 3VVFA 1ELJA 5KDTB 5JEIA 1BTJA 5CM6A 3OSRA 2GRVA 1GVCA 3SESA 2Y7PA 3FVKA 4MFIA 4F1UA 1CB6A 3DP4A 3OEKA 4QFNA 1ZTYA 2X7QA 1N04A 4IO5A 3HO7A 4MLVA 5FHOA 4QFLA 4F3PA 3L6HA 3RGYA 2I0BA 4U1OA 4Q0CA 3MQ9A 4YAHX 3DP6A 5AA1A 2ZYNA 4F3BA 3E4RA 2F5XA 5H8FA 1N7WA 2ZYOA 3CRBA 5AA2D 3V83A 3ILTB 4LP2B 4N07A 3T96B 1TFDA 2XXYA 2XX8A 4XKRA 4F1VA 4N13A 4XXUA 5HPQA 1R6ZA 3MAMA 5ICQA 2UYFA 1Y1MA 2O69A 1XS5A 1BIYA 1Z7NE 4FE8A 5CMMA 4RPOA 3S9EA 2YJPA 4F19A 2DE3A 3RPWA 3RQTA 1PBQA 1IITA 2GHBA 1POY1 3FZVA 1B58A 3K1MA 4NEDA 4QRZA 4KPTA 2NVUB 2QPQA 4F22A 4I62A 4F18A 1T0KA 5TP9B 3RTWB 3KEIA 4H6DA 5DVIA 1MY0A 2ZNTA 1MQDA 4RJZA 2H98A 2ANJA 1LFGA 1MXUA 1B51A 2ZXTA 3MVYA 3QK6A 1FQAA 2UYEA 4KFQA 3BFUA 1QW0A 3FVGA 4U23A 2F7BA 2I48A 3PUXE 4X9TA 4YU0A 5BWJA 1QUKA 1JW5A 2RCAA 3M3KA 4M1VA 2XXVA 3QIMA 2Z8EA 2QS3A 3SEUA 1A7LA 2QS1A 3K6XA 3C4MA 3ONMA 3KN8A 4G4PA 2O68A 4Z7EA 5I58A 3IOUA 1SI1A 1B46A 2XX9A 4LATA 3DP8A 5TPAA 4DLDA 3T22A 3EF7A 3CG3A 1PB8A 3MPKA 3TEPA 2Q2CA 3MJNA 1XHYA 2ONKE 2QSXA 2OWTA 3LBSA 4I8CA 4ZZAA 3TUSA 1UIVA 2Z22A 1YCJA 2HAVA 4X48A 3UN6A 4XTCQ 1MQJA 4GIZA 1B5HA 1PB9A 3K4UA 4DIGA 1JEUA 2RINA 1MDQA 3IR1A 3CR9A 1YAEA 2BJJX 3EN3A 2F35A 5FHNA 4ZEFA 3C34A 2R71A 3CFZA 1USYE 5EHSA 1ANFA 1R1NA 3VXCA 4MH5A 2DWJA 2F78A 1URDA 1Q1KA 2ZYKA 1R9QA 3RY3A 3IB0A 5I56B 5CMBA 1IXHA 1RYXA 4OEUA 4BDNA 2F7AA 4YKJA 1UIUA 4FEBA 4ZE8A 4IO6A 4C1TA 5I58B 3Q26A 4U4XA 4NF6A 4DZ1A 2P1SA 2O6AA 4KQPA 1IXGA 3IO6A 1R9LA 2DWIA 3CFXA 3IJOB 3N94A 4RYAA 1FTMA 4THIA 5HM4B 1UTBA 3SEWA 2F8DA 1EU8A 2ZMBA 4H67A 3O6HA 3OO7A 4G2ZA 4IO7A 4QSDA 3UIFA 3FXRA 1RKMA 3OSQA 5DTBA 1P1UA 5L9OA 3QUJA 4OVJA 4RY1A 1LFIA 5A5XA 2I58A 1FQCA 4RK2A 3ODBA 4XIGQ 2G29A 1QUIA 4OQOA 2I49A 1PB7A 3KSXA 5FTHA 4M4GA 4TLMB 4G68A 3A09A 4QFOA 3BBRA 5AE4A 3HHFA 1VE4A 2O7UA 3N26A 1LCTA 4R2BA 1B3EA 1NMUA 4BDOA 1HSEA 1II5A 1TXFA 2XXXA 3OOAA 1ATGA 5H8HA 5KCJB 4H65A 2I0CA 3PUWE 4U2RA 5K2YA 4XKNA 3VFJA 1MM7A 4LA9A 3A3CA 5EHMA 4UACA 1JW1A 1B3GA 1M5CA 4GL8A 3MVXA 3ILUB 1N84A 3TCFA 2CZLA 3G3JA 5L8DA 4ESXA 4OWDA 3OEMA 1J1NA 1USYH 3SETA 4ZE9A 4NF4A 4KYDA 2NWJA 5I59A 4G8NA 4EQ7A 2UVIA 3KGCA 4F31B 2V25A 3JV9A 3D4CA 4H1XA 4ZZEA 4C1UA 1XVXA 3MZ9A 2ABHA 1I6BA 1B4HA 1SQYA 1Y1ZA 4G8MA 1D9VA 1UQWA 3V89B 4ELRA 3VVEA 4AQ4A 4OXVA 4OHNA 3MW0A 3U94A 5AA3A 1BLFA 3FV1A 3KG2A 4I9DA 1QJMA 1EZOA 4RK9A 4F2QA 5KCJA 3R6UA 4LQ5A 5I2NA 1QKAA 4FAJA 1IUDA 3HN0A 1B0HA 1WDNA 3TZAA 5I57B 3LUYA 3H6WA 2GFEA 3O2AA 3OMBA 4OENA 4R6KA 4FATA 1ZBMA 1OMPA 3EPEA 1JVYA 4YB6A 5CRYA 4DXCA 3KJTA 4IGTA 4JXIA 4P0GA 4MLQA 4OETA 5I2KA 1Q35A 1ZU0A 2XD3A 2OWSA 2V3QA 2XXUA 3FASA 4IO4A 1NL5A 4NF4B 3SERA 2QJEA 4C0RA 4WEDA 1AL3A 2VD2A 1LBBA 1JEVA 1MG1A 2B3FA 4HCYA 4YMAA 2YLNA 4R6YA 5KDTA 4IB2A 4OFOA 2HCAA 2QMWA 4ISUA 4YKIA 1A8FA 4FORA 4OZ9A 1S7YA 4G68B 1YTVA 2ALUA 3MVZA 4ESWA 2A5TB 3H7MA 4FJPA 3ZS6A 3C36A 4P11A 3CI8A 1MQHA 1US5A 3PMXA 3TQWA 3TQLA 3C33A 4YZZA 2QS2A 4LQ2A 1NNFA 1SW2A 1HSLA 1N76A 1P1WA 5H8QA 3U8QA 1Y3NA 4LZ5A 2E0SA 1B32A 3PMWA 4HS7A 3E13X 2DS9A 4O3BA 2V93A 4GD5A 4TLLB 2IA4A 3H6UA 3M3FA 5ELVA 3JZJA 5FTIA 5I2KB 3G3KA 3RT6B 1POTA 1N3WA 3UP9A 1Y3PA 3OO9A 4G68C 4QHQA 4DXBA 1MY2A 4JWYA 4ELQA 3MPLA 3FATA 1PEBA 3IB1A 4F1YA 1HSJA 1FTJA 3M3LA 4QFPA 3QUFA 3VV5A 4X1DA 3LSLA 2XXPA 1PC3A 3T66A 3B6WA 3TKDA 2O84X 3HV1A 2I4BA 3C35A 4G77A 4HW8A 4ONYA 3VLVA 1MXXA 4POWA 1SDXA 3TTNA 4DCYA 3FV2A 4EQ9A 2IEEA 3T93B 3RN8A 3VE1B 1DTZA 5AA2B 3FD3A 2OZZA 1MQIA 3HCQA 3QYTA 2DP8A 4LZ8A 3Q25A 4OERA 2AL5A 5I2NB 1A40A 4R72A 5H8QB 2Q8JA 3IL1B 3TODA 1NKXA 4NWCA 1MS7A 1URGA 3H6TA 3PPPA 1D4NA 2I3VA 4KI0E 1Y20A 1B1XA 1MQGA 5CBSA 3T9UA 5DT6A 2PT1A 1LSTA 3PU5A 1M5BA 3K00A 3W15C 4EQBA 1MH4A 1LB9A 1YPNA 3S9NC 4BDRA 3CVGA 3W9WA 2VHAA 2H5YA 3RNNA 4LVQA 1ZMGA 5F1QA 2Y7WA 1B05A 1O63A 4LONB 2AIXA 2QMXA 1ZKBA 2HAUA 3MP1A 2ESNA 4IY5A 1JW4A 1MXWA 1WVJA 2RC7A 2VP1A 2A5TA 3T9XB 2DOJA 3EHUA 3C9HA 1SI0A 3U93A 4E0XA 5AA2A 2A5SA 2O1LA 5LOMA 3USDA 1FQEA 5I56A 4WEPA 2OCUA 1RYOA 3FXUA 3KSJA 1FTKA 2I3WA 2Z8FA 3QAXA 1XT8A 2THIA 2XXRA 3B7DA 4L17A 4GRKA 4GQOA 1SYIA 3K01A 1SD3A 4ZEBA 1P99A 4NF6B 2LAOA 3UORA 1MPCA 1EH3A 4QSCA 2HEUA 3LR1A 4GVOA 4JDFA 1CE2A 1LGBC 4ZECA 2OJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4Z A;  3MBP A;  4PFW A;  3WAF A;  4KD5 A;  1SW5 A;  2PX1 A;  4DCX A;  2Y7K A;  3IOW A;  2DE4 A;  5I84 A;  5H8F B;  1JQF A;  4GXS B;  3OEL A;  2Q89 A;  4U22 A;  1AOV A;  5CI5 A;  1MXY A;  4U4S A;  2ZYM A;  3HPI A;  1H3D A;  2FYI A;  2ONS A;  2O51 A;  3KOT A;  1QVS A;  4GWO A;  5HBC A;  3T9V A;  4F2O A;  4ZEI A;  2NOO A;  4NF5 A;  3VDF A;  1NNP A;  4PFT A;  1B52 A;  5L9S A;  3B6Q A;  5FHM A;  5ISU A;  1XC1 A;  1FW0 A;  1S9T A;  3MP8 A;  3DLN A;  2FA7 A;  3O28 A;  4ND9 A;  2ZNU A;  2O7I A;  4GLI A;  3KZG A;  4P0I A;  4F29 A;  1O64 A;  1SBP A;  2Q9T A;  1DMB A;  2I4C A;  3M8U A;  5TP9 A;  2Y7I A;  1ZIU A;  3KJ7 A;  2F6P A;  2FNC A;  1AMF A;  2X26 A;  4GOT A;  2Y84 A;  1OVB A;  2GHA A;  4H0W A;  3MC2 A;  4XKP A;  3R7X A;  3V5A A;  4EF1 A;  3O66 A;  1ZLQ A;  3S2V A;  3VXB A;  1SW1 A;  3PUV E;  2E1S A;  5BUU A;  1NNK A;  2Z8D A;  1D3K A;  3CIJ A;  4YMB A;  2DXR A;  1A54 A;  1B5J A;  3O6G A;  1MM6 A;  3KBR A;  1OQG A;  3GLB A;  1M5D A;  2V3U A;  4R74 A;  4N6P A;  2REJ A;  4E0W A;  2F97 A;  2HQ0 A;  5TPA B;  1A55 A;  1LLS A;  4KCD A;  2DVC A;  4NF5 B;  5DVJ A;  3RTF B;  3TDJ A;  5H8N B;  2NXO A;  1I6Q A;  4NTL A;  4RA1 A;  3U1O A;  3O97 A;  5B70 A;  1FQD A;  1ZJL A;  1JET A;  1DOT A;  3N6U A;  4EXK A;  2F36 A;  4POX A;  1VFD A;  1GGG A;  1B40 A;  4OEV A;  3VLU A;  5AA4 B;  4Q5T A;  3EHT A;  1VR5 A;  3HST A;  1Y4C A;  4PE5 B;  5F7V A;  4RXL A;  1OIB A;  4JB7 A;  3VVD A;  1H76 A;  1SVX B;  1PBP A;  1L5T A;  1US4 A;  1EZP A;  1B7U A;  3BKI B;  4R9G A;  4F3G A;  2O1M A;  4KCC A;  3RUM A;  3JYR A;  3U72 A;  2QRY A;  3L6G A;  4YKK A;  2D5W A;  4YB7 A;  1JVX A;  2REG A;  3K1P A;  3K6V A;  3TAJ A;  2ONR A;  5DVF A;  2H99 A;  3FGS A;  3FXQ A;  3IOT A;  4ZED A;  5CC2 A;  3H6V A;  3TTM A;  3K1N A;  3AXF A;  4R6H A;  4F39 A;  4Q30 B;  3G3G A;  3QSL A;  2XXW A;  2R9J A;  2RKM A;  2OK2 A;  1GTK A;  4PFU A;  4R73 A;  2X7P A;  5KZT A;  1WOD A;  1MRP A;  4MF3 A;  1MPB A;  1JNF A;  4NMY A;  3GZG A;  4YB5 A;  4EUO A;  1NNT A;  1AIV A;  3FJM A;  4JBZ A;  4NWD A;  3SKP A;  1H45 A;  5AA4 A;  1N3X A;  2G93 A;  3E3K A;  4Q8R A;  1N7X A;  4LUB A;  3PUY E;  3KN3 A;  2B65 A;  3K0V A;  1B3L A;  3MUQ A;  4KYE A;  3SDF A;  3TTL A;  3IAZ A;  1OVT A;  3IK6 B;  4U1Z A;  2XHD A;  3MZB A;  4R9F A;  3MVW A;  1IIW A;  1UTB B;  2D21 A;  1LAG E;  2Q2A A;  3SEV A;  3TCG A;  3K6W A;  1Y9U A;  4X1B A;  3G3H A;  3IB2 A;  3S9L C;  3PGF A;  1P1Q A;  4PET A;  2ZNS A;  3Q28 A;  5L9M A;  3TEL A;  3FVN A;  1XOC A;  2OBG A;  3O29 A;  5H8H B;  5K2X A;  5A5X B;  3T9H B;  2HZK A;  2F34 A;  1OLA A;  3G7W A;  1MH3 A;  1MY1 A;  3OO6 A;  4IGR A;  3G3F A;  4QFK A;  4NF8 B;  5H8N A;  5ICT A;  3CSB A;  3O9P A;  1VSO A;  3W9V A;  2DSF A;  4JWO A;  4EXL A;  3K2D A;  4F3S A;  1UTH A;  1FCK A;  2F7C A;  2QS4 A;  1GV8 A;  1B2H A;  2W7Y A;  2XD2 A;  3OXN A;  4PP0 A;  5I59 B;  3Q29 A;  2I6E A;  4HTG A;  4KR5 A;  4FEC A;  3TCH A;  1LAH E;  2HFB A;  3A3U A;  3U92 A;  4U21 A;  2UVH A;  5TU0 A;  2AL4 A;  2KLF A;  2P0S A;  4OTE A;  2DXY A;  3H03 A;  1O7T A;  2DWH A;  1OQH A;  3F11 A;  4BLA A;  3I5O A;  3N5L A;  3SEY A;  3IJX B;  4IO2 A;  1NH8 A;  1LBC A;  1N0T A;  2VOZ A;  3MZ1 A;  4GL0 A;  4MBP A;  1IZ1 A;  2QL3 A;  3SEX A;  3QXM A;  1IXC A;  3RLF E;  2XX7 A;  2B3B A;  3I3V A;  3OD7 A;  2YPN A;  4IO3 A;  3TTK A;  2UVJ A;  5JTY A;  3IX1 A;  4H8I A;  3IOR A;  1LAX A;  2PT2 A;  3GXA A;  5M2V A;  2H4I A;  3LSW A;  4WKM A;  2PMS A;  1NH7 A;  2V84 A;  3ECR A;  3RT8 A;  2NUV A;  3GBB A;  3LSF B;  3CFL A;  4XKQ A;  1UTH B;  1KWH A;  3FVO A;  1LCF A;  1SW4 A;  5DEX A;  4R2F A;  3OEN A;  2Y7R A;  5I57 A;  1MXV A;  2VGQ A;  2CMO A;  2RC9 A;  1URS A;  4BDL A;  2HXW A;  3THI A;  4JWX A;  1FQF A;  5JK4 A;  4OYV A;  4GF8 A;  2XXQ A;  4WXJ A;  4I1D A;  4RPN A;  1D9Y A;  5DYH A;  2OLB A;  3B6T A;  3DEL B;  4QF9 A;  1IXI A;  3GBA A;  4ELP A;  3BFT A;  2V3T A;  4G8H A;  4FIM A;  1EZ9 A;  3UGW A;  5B7D A;  3FUZ A;  3DM0 A;  1B6H A;  5EYF A;  2XXI A;  2WKY A;  1IQ7 A;  3LC8 A;  4JSO A;  4LZ7 A;  3I6V A;  3PV0 E;  4ELO A;  3Q27 A;  3C31 A;  2D3I A;  3FIR A;  4IY6 A;  4NF8 A;  3N6T A;  4QSE A;  3S4U A;  3VLW A;  4OES A;  4R75 A;  1MY4 A;  4NE4 A;  1QUJ A;  5CMC A;  2AYS A;  1A8E A;  1GR2 A;  3PUZ E;  1TWY A;  3KFM A;  5DEX B;  5CBR A;  1S50 A;  2UXA A;  1P1N A;  3HHG A;  1XVY A;  4KHZ E;  4JSD A;  1MDP 1;  1Z7M E;  3G3I A;  1DTG A;  3KN7 A;  1FTO A;  3TFL A;  4AB6 A;  4BDQ A;  1DSN A;  1BP5 A;  3PPN A;  5J1D A;  1LFH A;  5IAI A;  2PVU A;  3H06 B;  3MP6 A;  1B7Z A;  4ZDM A;  5ITP A;  1M5F A;  3PD9 A;  4PQJ A;  3C32 A;  3S9M C;  1LB8 A;  3UA8 A;  4DE8 A;  1FQB A;  2P2A A;  4EDP A;  1B9J A;  1MXZ A;  1TT1 A;  1VFE A;  2H9B A;  2R6G E;  3O6I A;  4DXU A;  3IO4 A;  4AB5 A;  2DE2 A;  4GXA A;  1B1H A;  1PDA A;  1M5E A;  1B4Z A;  4TQU Q;  2XXH A;  4OMB A;  1LAF E;  4GFR A;  3TTR A;  3FJG A;  1A99 A;  2XXT A;  1BKA A;  1AH5 A;  3CG1 A;  2Z23 A;  3EHS A;  3KOS A;  5JTY B;  3TMG A;  4EF2 A;  1IEJ A;  1MPD A;  2UVG A;  3UK4 A;  3OO8 A;  1QUL A;  1MY3 A;  4ZEK A;  1F9B A;  4FED A;  1H43 A;  4RNS A;  4TOZ A;  3TPA A;  2DWA A;  1Y4T A;  1DPE A;  4UA8 A;  3ZSF A;  2DQV A;  3IOV A;  1B7H A;  1OLC A;  3ZKL A;  2VD3 A;  1I6A A;  1I69 A;  2GH9 A;  4DDD A;  3EQ1 A;  3PMV A;  1B3F A;  3PD8 A;  1H44 A;  3K02 A;  5CMK A;  1Y3Q A;  2PYY A;  1FTL A;  1NFT A;  2RC8 A;  3E9X A;  2H25 A;  3LSX A;  4H5G A;  2DVZ A;  3D4G A;  2RCB A;  2Q88 A;  4H8J A;  4HCW A;  4KYS A;  2M8C A;  4ZS9 A;  3WAE A;  1B3H A;  4ECF A;  3CSG A;  2DYX A;  1B0L A;  4Z0I A;  3K6U A;  3PPO A;  1QKB A;  4O3A A;  4YIC A;  3P7I A;  1P1O A;  4O3C A;  5ITO A;  3TYH A;  2HZL A;  1B5I A;  3ZKK A;  3FJ7 A;  5IKB A;  2RF1 A;  4K3F A;  1DPP A;  2F6G A;  3R26 A;  3V8X B;  4H5F A;  4YKP A;  3PPR A;  4BDM A;  2PBW A;  1SYH A;  1TFA A;  3H3G A;  4OFJ A;  3MWB A;  5H8S A;  4PFY A;  3PPQ A;  4OFL A;  3VVF A;  1ELJ A;  5KDT B;  5JEI A;  1BTJ A;  5CM6 A;  3OSR A;  2GRV A;  1GVC A;  3SES A;  2Y7P A;  3FVK A;  4MFI A;  4F1U A;  1CB6 A;  3DP4 A;  3OEK A;  4QFN A;  1ZTY A;  2X7Q A;  1N04 A;  4IO5 A;  3HO7 A;  4MLV A;  5FHO A;  4QFL A;  4F3P A;  3L6H A;  3RGY A;  2I0B A;  4U1O A;  4Q0C A;  3MQ9 A;  4YAH X;  3DP6 A;  5AA1 A;  2ZYN A;  4F3B A;  3E4R A;  2F5X A;  5H8F A;  1N7W A;  2ZYO A;  3CRB A;  5AA2 D;  3V83 A;  3ILT B;  4LP2 B;  4N07 A;  3T96 B;  1TFD A;  2XXY A;  2XX8 A;  4XKR A;  4F1V A;  4N13 A;  4XXU A;  5HPQ A;  1R6Z A;  3MAM A;  5ICQ A;  2UYF A;  1Y1M A;  2O69 A;  1XS5 A;  1BIY A;  1Z7N E;  4FE8 A;  5CMM A;  4RPO A;  3S9E A;  2YJP A;  4F19 A;  2DE3 A;  3RPW A;  3RQT A;  1PBQ A;  1IIT A;  2GHB A;  1POY 1;  3FZV A;  1B58 A;  3K1M A;  4NED A;  4QRZ A;  4KPT A;  2NVU B;  2QPQ A;  4F22 A;  4I62 A;  4F18 A;  1T0K A;  5TP9 B;  3RTW B;  3KEI A;  4H6D A;  5DVI A;  1MY0 A;  2ZNT A;  1MQD A;  4RJZ A;  2H98 A;  2ANJ A;  1LFG A;  1MXU A;  1B51 A;  2ZXT A;  3MVY A;  3QK6 A;  1FQA A;  2UYE A;  4KFQ A;  3BFU A;  1QW0 A;  3FVG A;  4U23 A;  2F7B A;  2I48 A;  3PUX E;  4X9T A;  4YU0 A;  5BWJ A;  1QUK A;  1JW5 A;  2RCA A;  3M3K A;  4M1V A;  2XXV A;  3QIM A;  2Z8E A;  2QS3 A;  3SEU A;  1A7L A;  2QS1 A;  3K6X A;  3C4M A;  3ONM A;  3KN8 A;  4G4P A;  2O68 A;  4Z7E A;  5I58 A;  3IOU A;  1SI1 A;  1B46 A;  2XX9 A;  4LAT A;  3DP8 A;  5TPA A;  4DLD A;  3T22 A;  3EF7 A;  3CG3 A;  1PB8 A;  3MPK A;  3TEP A;  2Q2C A;  3MJN A;  1XHY A;  2ONK E;  2QSX A;  2OWT A;  3LBS A;  4I8C A;  4ZZA A;  3TUS A;  1UIV A;  2Z22 A;  1YCJ A;  2HAV A;  4X48 A;  3UN6 A;  4XTC Q;  1MQJ A;  4GIZ A;  1B5H A;  1PB9 A;  3K4U A;  4DIG A;  1JEU A;  2RIN A;  1MDQ A;  3IR1 A;  3CR9 A;  1YAE A;  2BJJ X;  3EN3 A;  2F35 A;  5FHN A;  4ZEF A;  3C34 A;  2R71 A;  3CFZ A;  1USY E;  5EHS A;  1ANF A;  1R1N A;  3VXC A;  4MH5 A;  2DWJ A;  2F78 A;  1URD A;  1Q1K A;  2ZYK A;  1R9Q A;  3RY3 A;  3IB0 A;  5I56 B;  5CMB A;  1IXH A;  1RYX A;  4OEU A;  4BDN A;  2F7A A;  4YKJ A;  1UIU A;  4FEB A;  4ZE8 A;  4IO6 A;  4C1T A;  5I58 B;  3Q26 A;  4U4X A;  4NF6 A;  4DZ1 A;  2P1S A;  2O6A A;  4KQP A;  1IXG A;  3IO6 A;  1R9L A;  2DWI A;  3CFX A;  3IJO B;  3N94 A;  4RYA A;  1FTM A;  4THI A;  5HM4 B;  1UTB A;  3SEW A;  2F8D A;  1EU8 A;  2ZMB A;  4H67 A;  3O6H A;  3OO7 A;  4G2Z A;  4IO7 A;  4QSD A;  3UIF A;  3FXR A;  1RKM A;  3OSQ A;  5DTB A;  1P1U A;  5L9O A;  3QUJ A;  4OVJ A;  4RY1 A;  1LFI A;  5A5X A;  2I58 A;  1FQC A;  4RK2 A;  3ODB A;  4XIG Q;  2G29 A;  1QUI A;  4OQO A;  2I49 A;  1PB7 A;  3KSX A;  5FTH A;  4M4G A;  4TLM B;  4G68 A;  3A09 A;  4QFO A;  3BBR A;  5AE4 A;  3HHF A;  1VE4 A;  2O7U A;  3N26 A;  1LCT A;  4R2B A;  1B3E A;  1NMU A;  4BDO A;  1HSE A;  1II5 A;  1TXF A;  2XXX A;  3OOA A;  1ATG A;  5H8H A;  5KCJ B;  4H65 A;  2I0C A;  3PUW E;  4U2R A;  5K2Y A;  4XKN A;  3VFJ A;  1MM7 A;  4LA9 A;  3A3C A;  5EHM A;  4UAC A;  1JW1 A;  1B3G A;  1M5C A;  4GL8 A;  3MVX A;  3ILU B;  1N84 A;  3TCF A;  2CZL A;  3G3J A;  5L8D A;  4ESX A;  4OWD A;  3OEM A;  1J1N A;  1USY H;  3SET A;  4ZE9 A;  4NF4 A;  4KYD A;  2NWJ A;  5I59 A;  4G8N A;  4EQ7 A;  2UVI A;  3KGC A;  4F31 B;  2V25 A;  3JV9 A;  3D4C A;  4H1X A;  4ZZE A;  4C1U A;  1XVX A;  3MZ9 A;  2ABH A;  1I6B A;  1B4H A;  1SQY A;  1Y1Z A;  4G8M A;  1D9V A;  1UQW A;  3V89 B;  4ELR A;  3VVE A;  4AQ4 A;  4OXV A;  4OHN A;  3MW0 A;  3U94 A;  5AA3 A;  1BLF A;  3FV1 A;  3KG2 A;  4I9D A;  1QJM A;  1EZO A;  4RK9 A;  4F2Q A;  5KCJ A;  3R6U A;  4LQ5 A;  5I2N A;  1QKA A;  4FAJ A;  1IUD A;  3HN0 A;  1B0H A;  1WDN A;  3TZA A;  5I57 B;  3LUY A;  3H6W A;  2GFE A;  3O2A A;  3OMB A;  4OEN A;  4R6K A;  4FAT A;  1ZBM A;  1OMP A;  3EPE A;  1JVY A;  4YB6 A;  5CRY A;  4DXC A;  3KJT A;  4IGT A;  4JXI A;  4P0G A;  4MLQ A;  4OET A;  5I2K A;  1Q35 A;  1ZU0 A;  2XD3 A;  2OWS A;  2V3Q A;  2XXU A;  3FAS A;  4IO4 A;  1NL5 A;  4NF4 B;  3SER A;  2QJE A;  4C0R A;  4WED A;  1AL3 A;  2VD2 A;  1LBB A;  1JEV A;  1MG1 A;  2B3F A;  4HCY A;  4YMA A;  2YLN A;  4R6Y A;  5KDT A;  4IB2 A;  4OFO A;  2HCA A;  2QMW A;  4ISU A;  4YKI A;  1A8F A;  4FOR A;  4OZ9 A;  1S7Y A;  4G68 B;  1YTV A;  2ALU A;  3MVZ A;  4ESW A;  2A5T B;  3H7M A;  4FJP A;  3ZS6 A;  3C36 A;  4P11 A;  3CI8 A;  1MQH A;  1US5 A;  3PMX A;  3TQW A;  3TQL A;  3C33 A;  4YZZ A;  2QS2 A;  4LQ2 A;  1NNF A;  1SW2 A;  1HSL A;  1N76 A;  1P1W A;  5H8Q A;  3U8Q A;  1Y3N A;  4LZ5 A;  2E0S A;  1B32 A;  3PMW A;  4HS7 A;  3E13 X;  2DS9 A;  4O3B A;  2V93 A;  4GD5 A;  4TLL B;  2IA4 A;  3H6U A;  3M3F A;  5ELV A;  3JZJ A;  5FTI A;  5I2K B;  3G3K A;  3RT6 B;  1POT A;  1N3W A;  3UP9 A;  1Y3P A;  3OO9 A;  4G68 C;  4QHQ A;  4DXB A;  1MY2 A;  4JWY A;  4ELQ A;  3MPL A;  3FAT A;  1PEB A;  3IB1 A;  4F1Y A;  1HSJ A;  1FTJ A;  3M3L A;  4QFP A;  3QUF A;  3VV5 A;  4X1D A;  3LSL A;  2XXP A;  1PC3 A;  3T66 A;  3B6W A;  3TKD A;  2O84 X;  3HV1 A;  2I4B A;  3C35 A;  4G77 A;  4HW8 A;  4ONY A;  3VLV A;  1MXX A;  4POW A;  1SDX A;  3TTN A;  4DCY A;  3FV2 A;  4EQ9 A;  2IEE A;  3T93 B;  3RN8 A;  3VE1 B;  1DTZ A;  5AA2 B;  3FD3 A;  2OZZ A;  1MQI A;  3HCQ A;  3QYT A;  2DP8 A;  4LZ8 A;  3Q25 A;  4OER A;  2AL5 A;  5I2N B;  1A40 A;  4R72 A;  5H8Q B;  2Q8J A;  3IL1 B;  3TOD A;  1NKX A;  4NWC A;  1MS7 A;  1URG A;  3H6T A;  3PPP A;  1D4N A;  2I3V A;  4KI0 E;  1Y20 A;  1B1X A;  1MQG A;  5CBS A;  3T9U A;  5DT6 A;  2PT1 A;  1LST A;  3PU5 A;  1M5B A;  3K00 A;  3W15 C;  4EQB A;  1MH4 A;  1LB9 A;  1YPN A;  3S9N C;  4BDR A;  3CVG A;  3W9W A;  2VHA A;  2H5Y A;  3RNN A;  4LVQ A;  1ZMG A;  5F1Q A;  2Y7W A;  1B05 A;  1O63 A;  4LON B;  2AIX A;  2QMX A;  1ZKB A;  2HAU A;  3MP1 A;  2ESN A;  4IY5 A;  1JW4 A;  1MXW A;  1WVJ A;  2RC7 A;  2VP1 A;  2A5T A;  3T9X B;  2DOJ A;  3EHU A;  3C9H A;  1SI0 A;  3U93 A;  4E0X A;  5AA2 A;  2A5S A;  2O1L A;  5LOM A;  3USD A;  1FQE A;  5I56 A;  4WEP A;  2OCU A;  1RYO A;  3FXU A;  3KSJ A;  1FTK A;  2I3W A;  2Z8F A;  3QAX A;  1XT8 A;  2THI A;  2XXR A;  3B7D A;  4L17 A;  4GRK A;  4GQO A;  1SYI A;  3K01 A;  1SD3 A;  4ZEB A;  1P99 A;  4NF6 B;  2LAO A;  3UOR A;  1MPC A;  1EH3 A;  4QSC A;  2HEU A;  3LR1 A;  4GVO A;  4JDF A;  1CE2 A;  1LGB C;  4ZEC A;  2OJT A; 
#chains in the Genus database with same CATH topology
 3H4Z A;  3MBP A;  4NX1 A;  3KBZ A;  4GWX A;  4KD5 A;  2DE4 A;  4GXS B;  3OEL A;  3A29 A;  4I40 A;  4NAP A;  3TFL A;  2FYI A;  1QVS A;  4ZEI A;  2NOO A;  4NF5 A;  3ROJ A;  1NNP A;  1B52 A;  3B6Q A;  5FHM A;  5ISU A;  4GBV A;  5I7I A;  4F29 A;  2Y7I A;  4GOT A;  1AMF A;  2Y84 A;  1OVB A;  4XKP A;  4P56 A;  5ET8 A;  1OQG A;  3GLB A;  1M5D A;  4R74 A;  2CEX A;  3TDJ A;  1I6Q A;  1ZJL A;  1DOT A;  4EXK A;  1GGG A;  3VLU A;  4Q5T A;  3EHT A;  4PE5 B;  1OIB A;  1SVX B;  1EZP A;  4F3G A;  4KCC A;  3JYR A;  3L6G A;  3FGS A;  3H6V A;  3K1N A;  2XXW A;  2R9J A;  1AIV A;  2X7P A;  4MF3 A;  1MPB A;  4YB5 A;  3FJM A;  4NWD A;  4Q8R A;  3KN3 A;  4NG7 A;  3K0V A;  4MIJ A;  4U1Z A;  1OVT A;  3IK6 B;  2Q8M A;  4GWS A;  3MZB A;  1IIW A;  3TCG A;  4X1B A;  3TEL A;  3O29 A;  5K2X A;  3T9H B;  1MY1 A;  4NF8 B;  5H8N A;  5ICT A;  3CSB A;  3O9P A;  1VSO A;  3W9V A;  3IFC A;  4F3S A;  5CMK A;  1NUW A;  2QS4 A;  3MYU A;  4FEC A;  2CZH A;  2DWH A;  3IJX B;  4MX6 A;  4GL0 A;  4MBP A;  2QL3 A;  3LUZ A;  3OD7 A;  3I3V A;  2YPN A;  3TTK A;  5JTY A;  3IX1 A;  3IOR A;  1IMB A;  3CFL A;  1URS A;  4I1D A;  4O8M A;  2CEY A;  4RPN A;  5DYH A;  2OLB A;  3GBA A;  4G8H A;  1EYJ A;  3UGW A;  1B6H A;  3LC8 A;  3I6V A;  4MCO A;  3N6T A;  4R75 A;  5CMC A;  1GR2 A;  1VDW A;  3KFM A;  5DEX B;  3HHG A;  1XVY A;  1MDP 1;  1DTG A;  4BDQ A;  5J16 A;  3PPN A;  2PVU A;  3MP6 A;  4PDH A;  4AS5 A;  1NV7 A;  3PD9 A;  3C32 A;  3S9M C;  4EDP A;  4DXU A;  1NUX A;  4PCD A;  4GXA A;  4TQU Q;  1BKA A;  1AH5 A;  4RNS A;  4TOZ A;  3TPA A;  2DWA A;  1Y4T A;  3IOV A;  1B7H A;  2VD3 A;  1I6A A;  1I69 A;  2GH9 A;  1H44 A;  1Y3Q A;  2RC8 A;  3E9X A;  3HFU A;  2DVZ A;  4HCW A;  3WAE A;  2M8C A;  4ECF A;  2DYX A;  4Z0I A;  3K6U A;  4YIC A;  4O3A A;  4X8R A;  4O3C A;  3TYH A;  2F3B A;  3FJ7 A;  4H5F A;  1TFA A;  4OFJ A;  3MWB A;  1GVC A;  4MFI A;  3DP4 A;  5FHO A;  3L6H A;  4U1O A;  4Q0C A;  4YAH X;  5AA1 A;  2F5X A;  5H8F A;  4XEQ A;  3V83 A;  1TFD A;  2XX8 A;  4N13 A;  4XXU A;  5ICQ A;  2YJP A;  1LBY A;  2ZZW A;  1PBQ A;  2GHB A;  4DI4 B;  2NVU B;  4F22 A;  4I62 A;  5TP9 B;  4H6D A;  4YU0 A;  5BWJ A;  4M1V A;  2XXV A;  2QS3 A;  1A7L A;  3IOU A;  4DLD A;  3EF7 A;  2KR0 A;  3MJN A;  3TUS A;  2Z22 A;  1B5H A;  3K4U A;  4XF5 A;  3EN3 A;  3C34 A;  3CFZ A;  3VXC A;  2ZYK A;  5I56 B;  1KZ8 A;  1IXH A;  1RYX A;  2F7A A;  4FEB A;  3Q26 A;  1IMF A;  4P3L A;  1IXG A;  2DWI A;  3SEW A;  3O6H A;  3OO7 A;  4IO7 A;  3FXR A;  1RKM A;  5L9O A;  4RY1 A;  2I58 A;  1FQC A;  2WEF A;  2G29 A;  1QUI A;  5FTH A;  1G0I A;  3HHF A;  1FPK A;  4R2B A;  4PGN A;  1KA0 A;  5KCJ B;  1ATG A;  4U2R A;  3PUW E;  5K2Y A;  3A3C A;  3LV0 A;  1N84 A;  1J1N A;  3SET A;  4ZE9 A;  4NF4 A;  3JV9 A;  3D4C A;  1SQY A;  4ELR A;  4PAF A;  1UQW A;  4OXV A;  5AA3 A;  1BLF A;  3KG2 A;  1EZO A;  1WDN A;  5I57 B;  2MKZ A;  3LUY A;  4FAT A;  3OMB A;  4OEN A;  3EPE A;  1OMP A;  4DXC A;  4YB6 A;  3KJT A;  4MLQ A;  1Q35 A;  1FPE A;  2V3Q A;  1NL5 A;  4NF4 B;  4MMP A;  3SER A;  2QJE A;  4WED A;  1LBB A;  1JEV A;  2B3F A;  2QMW A;  4ISU A;  4PC9 A;  1US5 A;  3C33 A;  1B32 A;  4TLL B;  3M3F A;  4QHQ A;  3VV5 A;  3B6W A;  2O84 X;  4HW8 A;  2I4B A;  1FPG A;  1SDX A;  4DCY A;  3FV2 A;  2IEE A;  1DTZ A;  5AA2 B;  2OZZ A;  5I2N B;  2AL5 A;  2Q8J A;  3IL1 B;  3TOD A;  1D4N A;  1MQG A;  2PT1 A;  1LST A;  3W15 C;  1YPN A;  4BDR A;  1BK4 A;  1ZMG A;  1O63 A;  4PFR A;  4LON B;  3MP1 A;  2HAU A;  2ESN A;  1WVJ A;  3C9H A;  3USD A;  5I56 A;  3QAX A;  4GWU A;  4L17 A;  1SYI A;  1SD3 A;  4QSC A;  1EH3 A;  1SW5 A;  1QGX A;  5I84 A;  4N8Y A;  4GWO A;  5HBC A;  2ONS A;  2O51 A;  1NV3 A;  4HXV A;  4PFT A;  5EYH A;  1XC1 A;  1FW0 A;  1S9T A;  4ND9 A;  4JVC A;  2Q9T A;  4O7M A;  2X26 A;  3R7X A;  4H0W A;  3O66 A;  1SW1 A;  3PUV E;  2Z8D A;  1D3K A;  4GX6 A;  1A54 A;  3KBR A;  2V3U A;  4N6P A;  2ZZV A;  5TPA B;  1A55 A;  2WBB A;  4KCD A;  2DVC A;  2XA5 A;  2NXO A;  3KC1 A;  4NTL A;  5ET6 A;  1FQD A;  2JJK A;  3N6U A;  2F36 A;  4OVP A;  1VFD A;  1B40 A;  1VR5 A;  2DDK A;  1Y4C A;  4RXL A;  3VVD A;  5I3S A;  4N4U A;  4R9G A;  2O1M A;  3RPL A;  3RUM A;  2REG A;  3AXF A;  4Q30 B;  3G3G A;  1WOD A;  3GZG A;  4EUO A;  3BIH A;  2B4M A;  1N3X A;  2G93 A;  3E3K A;  1N7X A;  4LUB A;  3TTL A;  2PFZ A;  2XHD A;  4P47 A;  1EYI A;  4H45 A;  3PGF A;  1P1Q A;  4PET A;  2OBG A;  5H8H B;  2F34 A;  1MH3 A;  4IGR A;  5DW8 A;  2VPO A;  2DSF A;  4EXL A;  3K2D A;  1GV8 A;  5I59 B;  4PP0 A;  4HTG A;  4KR5 A;  3U92 A;  4U21 A;  2UVH A;  2AL4 A;  2P0S A;  3H03 A;  1OQH A;  3F11 A;  4MNI A;  3I5O A;  3SEY A;  4IO2 A;  3MZ1 A;  2VOZ A;  3QXM A;  1IXC A;  4IO3 A;  1LAX A;  3GXA A;  5M2V A;  1NUZ A;  2H4I A;  3LSW A;  3ECR A;  1NH7 A;  2NUV A;  3LSF B;  1FBC A;  1LBW A;  2WX9 A;  3FVO A;  1SW4 A;  1FPD A;  2Y7R A;  5I57 A;  1MXV A;  2HXW A;  4OYV A;  1D9Y A;  1KA1 A;  4QF9 A;  1IXI A;  1EZ9 A;  3DM0 A;  5EYF A;  2WKY A;  4ELO A;  2VPN A;  4IY6 A;  4NF8 A;  3VLW A;  4OES A;  4PAK A;  3PUZ E;  1TWY A;  2UXA A;  1P1N A;  4KHZ E;  1Z7M E;  3KN7 A;  4AB6 A;  1BP5 A;  3H06 B;  1B7Z A;  1LB8 A;  3UA8 A;  4DE8 A;  1FQB A;  1TT1 A;  4PGP A;  1B1H A;  1M5E A;  1B4Z A;  1LAF E;  2XXT A;  4EF2 A;  3KOS A;  4ZEK A;  1F9B A;  1LEV A;  4UA8 A;  1OLC A;  3PMV A;  1B3F A;  3PD8 A;  1AOV A;  4NF0 A;  2PYY A;  4XKR A;  4F1V A;  3D4G A;  4ZS9 A;  4H8J A;  3CSG A;  1B0L A;  1FPJ A;  1QKB A;  4HE1 A;  3P7I A;  5ITO A;  4MHF A;  5IKB A;  4K3F A;  4YKP A;  4BDM A;  2PBW A;  5H8S A;  1Q9D A;  3PPQ A;  3VVF A;  5IZ3 A;  5CM6 A;  3OSR A;  2Q74 A;  1CB6 A;  1N04 A;  4IO5 A;  3HO7 A;  4MLV A;  3RGY A;  3DP6 A;  1N7W A;  1YZ0 A;  3T96 B;  4N07 A;  1FBG A;  1R6Z A;  3MAM A;  1Y1M A;  2O69 A;  2CZI A;  1BIY A;  3RPW A;  3RQT A;  1IIT A;  3FZV A;  4QRZ A;  4GWY A;  1K9Z A;  3KEI A;  2ZNT A;  1MQD A;  2H98 A;  2ANJ A;  1LFG A;  1B51 A;  3BFU A;  3PUX E;  1QUK A;  1NV6 A;  3M3K A;  3ONM A;  5I58 A;  4Z7E A;  3KN8 A;  3DP8 A;  1XHY A;  2ONK E;  4ZZA A;  1UIV A;  2HAV A;  1MQJ A;  1PB9 A;  3RYD A;  4DIG A;  2RIN A;  4ZEF A;  2BJJ X;  5FHN A;  5EHS A;  1USY E;  4MH5 A;  1URD A;  1Q1K A;  3RY3 A;  4OEU A;  4BDN A;  4NF6 A;  4DZ1 A;  3CFX A;  3IJO B;  4RYA A;  2ZMB A;  1G0H A;  4QSD A;  3D1R A;  5DTB A;  1LFI A;  5A5X A;  4TLM B;  3A09 A;  1VE4 A;  4P9K A;  3N26 A;  1LCT A;  1NMU A;  1HSE A;  1II5 A;  2I0C A;  1MM7 A;  5EHM A;  3TCF A;  1USY H;  5LDZ A;  2NWJ A;  4KYD A;  2UVI A;  4H1X A;  4ZZE A;  4MAG A;  3MZ9 A;  2ABH A;  1I6B A;  2Y5K A;  4G8M A;  1D9V A;  3VVE A;  4AS4 A;  3U94 A;  4RK9 A;  5KCJ A;  5I2N A;  3HN0 A;  2GFE A;  4R6K A;  5CRY A;  1JVY A;  5I5P A;  4JXI A;  4P0G A;  5I2K A;  2OWS A;  4IO4 A;  3FAS A;  1AL3 A;  4HCY A;  2YLN A;  4PDD A;  4FOR A;  1S7Y A;  1YTV A;  4ESW A;  4MNP A;  3H7M A;  4FJP A;  3C36 A;  3MST A;  1MQH A;  3PMX A;  3TQL A;  4LQ2 A;  1SW2 A;  1P1W A;  2E0S A;  1NI9 A;  2DS9 A;  5FTI A;  3JZJ A;  3OO9 A;  4DXB A;  4NQ8 A;  3MPL A;  3FAT A;  1HSJ A;  1FTJ A;  4QFP A;  4NGU A;  3QUF A;  4X1D A;  3C35 A;  2DP8 A;  4R72 A;  5H8Q B;  4X04 A;  1NKX A;  3B8B A;  4KI0 E;  1B1X A;  5CBS A;  2QVU A;  3T9U A;  5DT6 A;  1M5B A;  3S9N C;  3W9W A;  2HHM A;  3RNN A;  4LVQ A;  1B05 A;  2AIX A;  1ZKB A;  4IY5 A;  1IMC A;  3T9X B;  4E0X A;  1SI0 A;  5LOM A;  1RDX A;  1RYO A;  1FTK A;  2FIX A;  2XWO A;  2THI A;  4P8B A;  1K9Y A;  3PTY A;  1RDZ A;  2HEU A;  4JDF A;  3KZG A;  1LGB C;  4ZEC A;  4PFW A;  3WAF A;  2L5V A;  2PX1 A;  4GX3 A;  5H8F B;  2QVR A;  2Q89 A;  5IM2 A;  4U4S A;  3KOT A;  3T9V A;  4F2O A;  3VDF A;  2FVZ A;  3DLN A;  2FA7 A;  3O28 A;  4P0I A;  1NV2 A;  2I4C A;  5TP9 A;  2F6P A;  3MC2 A;  4OVQ A;  3S2V A;  5BUU A;  3CIJ A;  4YMB A;  1B5J A;  3O6G A;  2F97 A;  2HQ0 A;  1LLS A;  4RA1 A;  2FIE A;  4O7I A;  5B70 A;  4OEV A;  5AA4 B;  2QFL A;  4JB7 A;  1L5T A;  3BKI B;  3U72 A;  2QRY A;  4YKK A;  2WBD A;  1JVX A;  3IOT A;  4ZED A;  3TTM A;  4F39 A;  4PFU A;  1NV4 A;  3QSL A;  2RKM A;  2OK2 A;  5KZT A;  1MRP A;  1NNT A;  3QMF A;  3SKP A;  1H45 A;  2OWZ A;  3PUY E;  2B65 A;  1B3L A;  4KYE A;  3SDF A;  3IAZ A;  3MVW A;  3K6W A;  1Y9U A;  3Q28 A;  3FVN A;  2HZK A;  1FBH A;  1OLA A;  1FTA A;  3G3F A;  4QFK A;  3KC0 A;  4JWO A;  4N6D A;  1B2H A;  2W7Y A;  3OXN A;  2HFB A;  4GX4 A;  1O7T A;  4BLA A;  3N5L A;  1NH8 A;  1LBC A;  1N0T A;  3RLF E;  2XX7 A;  2B3B A;  4H8I A;  1NV5 A;  2B4L A;  4XKQ A;  1KWH A;  2VGQ A;  4BDL A;  4NN3 A;  4JWX A;  5JK4 A;  4GF8 A;  2XXQ A;  4WXJ A;  4DI3 D;  4PTK A;  3T0J A;  4ELP A;  2V3T A;  1LBZ A;  2XXI A;  1IQ7 A;  4JSO A;  3PV0 E;  3Q27 A;  4QSE A;  3S4U A;  1QUJ A;  1S50 A;  4PF8 A;  4JSD A;  1FTO A;  4UAB A;  4PQJ A;  1B9J A;  1MXZ A;  2R6G E;  3O6I A;  3IO4 A;  2DE2 A;  1RDY A;  1DCU A;  3CHG A;  2XXH A;  4OMB A;  3TTR A;  3FJG A;  1A99 A;  3CG1 A;  2Z23 A;  3TMG A;  1IEJ A;  3UK4 A;  1H43 A;  4N15 A;  2DQV A;  2BJI A;  3EQ1 A;  3K02 A;  4H5G A;  3ZSF A;  1NFT A;  5T3J A;  1B3H A;  1P1O A;  2RF1 A;  2F6G A;  3PPR A;  4PFY A;  4OFL A;  5KDT B;  5JEI A;  1BTJ A;  2GRV A;  3SES A;  2Y7P A;  4F1U A;  3OEK A;  1ZTY A;  2X7Q A;  5ET7 A;  2V4C A;  4F3B A;  3E4R A;  3ILT B;  2XXY A;  1FPI A;  1FBD A;  1XS5 A;  1FPL A;  5CMM A;  3S9E A;  5EYG A;  1FBE A;  1T0K A;  5DVI A;  4JVD A;  2ZXT A;  1MXU A;  1QW0 A;  2F7B A;  4X9T A;  1JW5 A;  3SEU A;  2QS1 A;  3K6X A;  4G4P A;  2O68 A;  2XX9 A;  5TPA A;  3T22 A;  4I3E A;  2PCR A;  3TEP A;  4O94 A;  2CZK A;  2OWT A;  1YCJ A;  4X48 A;  4XTC Q;  1JEU A;  3E79 A;  3CR9 A;  1R1N A;  1DK4 A;  3RPL B;  4ZE8 A;  1SPI A;  2P1S A;  2O6A A;  4KQP A;  1R9L A;  3N94 A;  1IME A;  4QBA A;  2F8D A;  4G2Z A;  3UIF A;  1P1U A;  3QUJ A;  4RK2 A;  4XIG Q;  2I49 A;  1PB7 A;  3KSX A;  4G68 A;  4QFO A;  3BBR A;  1XI6 A;  4NHB A;  5AE4 A;  1EYK A;  2O7U A;  4N6K A;  1B3E A;  2XXX A;  3OOA A;  4H65 A;  4XKN A;  4LA9 A;  3SZP A;  4GL8 A;  3MVX A;  5IGA A;  3ILU B;  2CZL A;  3G3J A;  5L8D A;  4ESX A;  3OEM A;  2WYP A;  5A5L A;  5I59 A;  4G8N A;  4EQ7 A;  3KGC A;  2V25 A;  4C1U A;  3SEX A;  3V89 B;  4EQ9 A;  1Y1Z A;  4AQ4 A;  3FV1 A;  4I9D A;  4F2Q A;  3R6U A;  4OA4 A;  1QKA A;  1B0H A;  3O2A A;  4IGT A;  2XD3 A;  4KXP A;  4C0R A;  1YXI A;  5KDT A;  5L9S A;  4R6Y A;  4IB2 A;  4OFO A;  2HCA A;  4OZ9 A;  2ALU A;  3MVZ A;  3GYY A;  1AWB A;  3ZS6 A;  2R8T A;  4YZZ A;  2GQ1 A;  1NNF A;  1HSL A;  1N76 A;  5H8Q A;  2P3V A;  4HE0 A;  3PMW A;  4O3B A;  2V93 A;  3H6U A;  5ELV A;  1N3W A;  4ELQ A;  1FBP A;  1MY2 A;  4JWY A;  1CNQ A;  4F1Y A;  2P3N A;  3LSL A;  2XXP A;  1PC3 A;  2F3D A;  3T66 A;  3TKD A;  4G77 A;  4N81 A;  4GBW A;  4ONY A;  3VLV A;  4POW A;  3T93 B;  3VE1 B;  4PFI A;  3FD3 A;  3ISP A;  4LZ8 A;  3QYT A;  3Q25 A;  1A40 A;  4N91 A;  4NWC A;  1MS7 A;  1URG A;  2I3V A;  1Y20 A;  3K00 A;  4EQB A;  1MH4 A;  1LB9 A;  2H5Y A;  5F1Q A;  2Y7W A;  5IZ1 A;  2QMX A;  2VP1 A;  2A5T A;  2DOJ A;  1FRP A;  1FQE A;  3FXU A;  2Z8F A;  1XT8 A;  2XXR A;  3B7D A;  4GRK A;  4ZEB A;  3UOR A;  3K01 A;  3LR1 A;  4DCX A;  2Y7K A;  3IOW A;  1JQF A;  1FBF A;  4U22 A;  5CI5 A;  1MXY A;  2ZYM A;  3HPI A;  1H3D A;  3FBP A;  3MP8 A;  2ZNU A;  2O7I A;  4GLI A;  1O64 A;  1SBP A;  1DMB A;  3FXB A;  3M8U A;  1ZIU A;  3KJ7 A;  2FNC A;  2GHA A;  4EF1 A;  3V5A A;  1ZLQ A;  3VXB A;  2E1S A;  1NNK A;  2DXR A;  4PAI A;  1MM6 A;  2Y5L A;  2REJ A;  4E0W A;  3RTF B;  5DVJ A;  4NF5 B;  5H8N B;  3U1O A;  3O97 A;  2WYK A;  1JET A;  4POX A;  3HST A;  5F7V A;  1H76 A;  1PBP A;  1US4 A;  1B7U A;  2D5W A;  4YB7 A;  1FSA A;  3K1P A;  3K6V A;  5F24 A;  4PF6 A;  2ONR A;  3TAJ A;  5DVF A;  2H99 A;  3FXQ A;  5CC2 A;  4R6H A;  1GTK A;  4R73 A;  1JNF A;  4NMY A;  4XFE A;  4JBZ A;  5AA4 A;  2PFY A;  3U65 A;  4GWW A;  2HXR A;  3MUQ A;  4PBQ A;  4P1E A;  3EKI A;  4R9F A;  1UTB B;  2D21 A;  3SEV A;  1LAG E;  2Q2A A;  3BIG A;  1IMD A;  3G3H A;  3IB2 A;  3S9L C;  5L9M A;  2ZNS A;  1XOC A;  4IR8 A;  5A5X B;  3G7W A;  3OO6 A;  1UTH A;  1FCK A;  2F7C A;  2XD2 A;  3Q29 A;  2I6E A;  3TCH A;  1LAH E;  3A3U A;  5TU0 A;  2KLF A;  4OTE A;  2DXY A;  1JP4 A;  1IZ1 A;  2UVJ A;  2PT2 A;  1DBZ A;  1NUY A;  4WKM A;  2PMS A;  2QVV A;  2V84 A;  3RT8 A;  3GBB A;  1UTH B;  1LCF A;  5DEX A;  2KQZ A;  4R2F A;  3OEN A;  1FJ9 A;  2CMO A;  2RC9 A;  3THI A;  1FQF A;  1LBV A;  4MNC A;  5EQ9 A;  4JVI A;  3B6T A;  3DEL B;  3BFT A;  4FIM A;  5B7D A;  3FUZ A;  4HE2 A;  5EQ8 A;  4LZ7 A;  3C31 A;  2D3I A;  3FIR A;  4MEV A;  1MY4 A;  4NE4 A;  2AYS A;  1A8E A;  5ESY A;  5CBR A;  1YYZ A;  4LN5 A;  3G3I A;  5J1D A;  1DSN A;  1LFH A;  5IAI A;  4ZDM A;  1M5F A;  2P2A A;  1VFE A;  2H9B A;  4AB5 A;  1PDA A;  4OVS A;  4GFR A;  3EHS A;  5JTY B;  1MPD A;  2UVG A;  4FBP A;  3OO8 A;  1QUL A;  1MY3 A;  4FED A;  1FJ6 A;  2OX3 A;  1DPE A;  5IZ3 B;  3ZKL A;  4DDD A;  1FTL A;  3LSX A;  2H25 A;  4KYS A;  2RCB A;  2Q88 A;  5FBP A;  2XWV A;  5ET5 A;  3PPO A;  2HZL A;  1B5I A;  1D9Q A;  3ZKK A;  1DPP A;  3R26 A;  3V8X B;  4PBH A;  1SYH A;  3H3G A;  1ELJ A;  3FVK A;  4QFN A;  4QFL A;  4F3P A;  2I0B A;  3MQ9 A;  2ZYN A;  4MJO A;  2HPG A;  2ZYO A;  3CRB A;  5AA2 D;  4LP2 B;  5HPQ A;  2UYF A;  2VT5 A;  1Z7N E;  4FE8 A;  4RPO A;  4F19 A;  2DE3 A;  2ZZX A;  1POY 1;  4NED A;  1B58 A;  3K1M A;  3T1B A;  4KPT A;  2QPQ A;  4F18 A;  3RTW B;  1MY0 A;  4RJZ A;  3MVY A;  3QK6 A;  1FQA A;  2UYE A;  4KFQ A;  3FVG A;  4U23 A;  2I48 A;  2RCA A;  3QIM A;  2Z8E A;  3C4M A;  1IMA A;  1SI1 A;  1B46 A;  4LAT A;  4N17 A;  4OVT A;  3CG3 A;  1PB8 A;  3MPK A;  2Q2C A;  2QSX A;  3LBS A;  4I8C A;  4N8G A;  3UN6 A;  4GIZ A;  1MDQ A;  3IR1 A;  1YAE A;  2F35 A;  2R71 A;  1INP A;  1ANF A;  2DWJ A;  2F78 A;  1R9Q A;  3IB0 A;  5CMB A;  4YKJ A;  4C1T A;  1UIU A;  5I58 B;  4IO6 A;  4U4X A;  2XXK A;  3IO6 A;  4PFB A;  1FTM A;  4THI A;  1NV0 A;  5HM4 B;  1UTB A;  1EU8 A;  4H67 A;  3OSQ A;  1FPF A;  3B50 A;  4OVJ A;  5EQ7 A;  3ODB A;  4OQO A;  4M4G A;  1FPB A;  4BDO A;  1TXF A;  5H8H A;  3VFJ A;  4UAC A;  1JW1 A;  4H46 A;  1B3G A;  1M5C A;  3IFA A;  4OWD A;  4F31 B;  1XVX A;  3NOH A;  1B4H A;  1NV1 A;  4OHN A;  3MW0 A;  2FHY A;  1QJM A;  4LQ5 A;  4FAJ A;  1IUD A;  4OVR A;  3TZA A;  4PE3 A;  3H6W A;  1ZBM A;  4OAN A;  4OET A;  1ZU0 A;  2XXU A;  2VD2 A;  4GWZ A;  4YMA A;  1MG1 A;  4YKI A;  1A8F A;  1LBX A;  4G68 B;  4P1L A;  2A5T B;  4P11 A;  3CI8 A;  3TQW A;  5EQA A;  2QS2 A;  3U8Q A;  1Y3N A;  4LZ5 A;  4HS7 A;  5IZZ A;  3E13 X;  4GD5 A;  2IA4 A;  3RT6 B;  5I2K B;  3G3K A;  1POT A;  3UP9 A;  1Y3P A;  4G68 C;  3IB1 A;  1PEB A;  5ITP A;  3M3L A;  3E78 A;  3HV1 A;  5LTC A;  1MXX A;  4G61 A;  3TTN A;  3RN8 A;  2XWK A;  4QXD A;  1MQI A;  3HCQ A;  4OER A;  2XWI A;  3H6T A;  3PPP A;  3PU5 A;  3CVG A;  2VHA A;  4I3Y A;  1JW4 A;  1MXW A;  2RC7 A;  3U93 A;  5AA2 A;  3EHU A;  2A5S A;  2O1L A;  2FBP A;  4WEP A;  2OCU A;  3KSJ A;  2I3W A;  4GQO A;  1P99 A;  4NF6 B;  2LAO A;  1MPC A;  4GVO A;  1CE2 A;  2OJT A; 
#chains in the Genus database with same CATH homology
 3H4Z A;  3MBP A;  4PFW A;  3WAF A;  4KD5 A;  1SW5 A;  2PX1 A;  4DCX A;  2Y7K A;  3IOW A;  2DE4 A;  5I84 A;  5H8F B;  1JQF A;  4GXS B;  3OEL A;  2Q89 A;  4U22 A;  1AOV A;  5CI5 A;  1MXY A;  4U4S A;  2ZYM A;  3HPI A;  1H3D A;  2FYI A;  2ONS A;  2O51 A;  3KOT A;  1QVS A;  4GWO A;  5HBC A;  3T9V A;  4F2O A;  4ZEI A;  2NOO A;  4NF5 A;  3VDF A;  1NNP A;  4PFT A;  1B52 A;  5L9S A;  3B6Q A;  5FHM A;  5ISU A;  1XC1 A;  1FW0 A;  1S9T A;  3MP8 A;  3DLN A;  2FA7 A;  3O28 A;  4ND9 A;  2ZNU A;  2O7I A;  4GLI A;  3KZG A;  4P0I A;  4F29 A;  1O64 A;  1SBP A;  2Q9T A;  1DMB A;  2I4C A;  3M8U A;  5TP9 A;  2Y7I A;  1ZIU A;  3KJ7 A;  2F6P A;  2FNC A;  1AMF A;  2X26 A;  4GOT A;  2Y84 A;  1OVB A;  2GHA A;  4H0W A;  3MC2 A;  4XKP A;  3R7X A;  3V5A A;  4EF1 A;  3O66 A;  1ZLQ A;  3S2V A;  3VXB A;  1SW1 A;  3PUV E;  2E1S A;  5BUU A;  1NNK A;  2Z8D A;  1D3K A;  3CIJ A;  4YMB A;  2DXR A;  1A54 A;  1B5J A;  3O6G A;  1MM6 A;  3KBR A;  1OQG A;  3GLB A;  1M5D A;  2V3U A;  4R74 A;  4N6P A;  2REJ A;  4E0W A;  2F97 A;  2HQ0 A;  5TPA B;  1A55 A;  1LLS A;  4KCD A;  2DVC A;  4NF5 B;  5DVJ A;  3RTF B;  3TDJ A;  5H8N B;  2NXO A;  1I6Q A;  4NTL A;  4RA1 A;  3U1O A;  3O97 A;  5B70 A;  1FQD A;  1ZJL A;  1JET A;  1DOT A;  3N6U A;  4EXK A;  2F36 A;  4POX A;  1VFD A;  1GGG A;  1B40 A;  4OEV A;  3VLU A;  5AA4 B;  4Q5T A;  3EHT A;  1VR5 A;  3HST A;  1Y4C A;  4PE5 B;  5F7V A;  4RXL A;  1OIB A;  4JB7 A;  3VVD A;  1H76 A;  1SVX B;  1PBP A;  1L5T A;  1US4 A;  1EZP A;  1B7U A;  3BKI B;  4R9G A;  4F3G A;  2O1M A;  4KCC A;  3RUM A;  3JYR A;  3U72 A;  2QRY A;  3L6G A;  4YKK A;  2D5W A;  4YB7 A;  1JVX A;  2REG A;  3K1P A;  3K6V A;  3TAJ A;  2ONR A;  5DVF A;  2H99 A;  3FGS A;  3FXQ A;  3IOT A;  4ZED A;  5CC2 A;  3H6V A;  3TTM A;  3K1N A;  3AXF A;  4R6H A;  4F39 A;  4Q30 B;  3G3G A;  3QSL A;  2XXW A;  2R9J A;  2RKM A;  2OK2 A;  1GTK A;  4PFU A;  4R73 A;  2X7P A;  5KZT A;  1WOD A;  1MRP A;  4MF3 A;  1MPB A;  1JNF A;  4NMY A;  3GZG A;  4YB5 A;  4EUO A;  1NNT A;  1AIV A;  3FJM A;  4JBZ A;  4NWD A;  3SKP A;  1H45 A;  5AA4 A;  1N3X A;  2G93 A;  3E3K A;  4Q8R A;  1N7X A;  4LUB A;  3PUY E;  3KN3 A;  2B65 A;  3K0V A;  1B3L A;  3MUQ A;  4KYE A;  3SDF A;  3TTL A;  3IAZ A;  1OVT A;  3IK6 B;  4U1Z A;  2XHD A;  3MZB A;  4R9F A;  3MVW A;  1IIW A;  1UTB B;  2D21 A;  1LAG E;  2Q2A A;  3SEV A;  3TCG A;  3K6W A;  1Y9U A;  4X1B A;  3G3H A;  3IB2 A;  3S9L C;  3PGF A;  1P1Q A;  4PET A;  2ZNS A;  3Q28 A;  5L9M A;  3TEL A;  3FVN A;  1XOC A;  2OBG A;  3O29 A;  5H8H B;  5K2X A;  5A5X B;  3T9H B;  2HZK A;  2F34 A;  1OLA A;  3G7W A;  1MH3 A;  1MY1 A;  3OO6 A;  4IGR A;  3G3F A;  4QFK A;  4NF8 B;  5H8N A;  5ICT A;  3CSB A;  3O9P A;  1VSO A;  3W9V A;  2DSF A;  4JWO A;  4EXL A;  3K2D A;  4F3S A;  1UTH A;  1FCK A;  2F7C A;  2QS4 A;  1GV8 A;  1B2H A;  2W7Y A;  2XD2 A;  3OXN A;  4PP0 A;  5I59 B;  3Q29 A;  2I6E A;  4HTG A;  4KR5 A;  4FEC A;  3TCH A;  1LAH E;  2HFB A;  3A3U A;  3U92 A;  4U21 A;  2UVH A;  5TU0 A;  2AL4 A;  2KLF A;  2P0S A;  4OTE A;  2DXY A;  3H03 A;  1O7T A;  2DWH A;  1OQH A;  3F11 A;  4BLA A;  3I5O A;  3N5L A;  3SEY A;  3IJX B;  4IO2 A;  1NH8 A;  1LBC A;  1N0T A;  2VOZ A;  3MZ1 A;  4GL0 A;  4MBP A;  1IZ1 A;  2QL3 A;  3SEX A;  3QXM A;  1IXC A;  3RLF E;  2XX7 A;  2B3B A;  3I3V A;  3OD7 A;  2YPN A;  4IO3 A;  3TTK A;  2UVJ A;  5JTY A;  3IX1 A;  4H8I A;  3IOR A;  1LAX A;  2PT2 A;  3GXA A;  5M2V A;  2H4I A;  3LSW A;  4WKM A;  2PMS A;  1NH7 A;  2V84 A;  3ECR A;  3RT8 A;  2NUV A;  3GBB A;  3LSF B;  3CFL A;  4XKQ A;  1UTH B;  1KWH A;  3FVO A;  1LCF A;  1SW4 A;  5DEX A;  4R2F A;  3OEN A;  2Y7R A;  5I57 A;  1MXV A;  2VGQ A;  2CMO A;  2RC9 A;  1URS A;  4BDL A;  2HXW A;  3THI A;  4JWX A;  1FQF A;  5JK4 A;  4OYV A;  4GF8 A;  2XXQ A;  4WXJ A;  4I1D A;  4RPN A;  1D9Y A;  5DYH A;  2OLB A;  3B6T A;  3DEL B;  4QF9 A;  1IXI A;  3GBA A;  4ELP A;  3BFT A;  2V3T A;  4G8H A;  4FIM A;  1EZ9 A;  3UGW A;  5B7D A;  3FUZ A;  3DM0 A;  1B6H A;  5EYF A;  2XXI A;  2WKY A;  1IQ7 A;  3LC8 A;  4JSO A;  4LZ7 A;  3I6V A;  3PV0 E;  4ELO A;  3Q27 A;  3C31 A;  2D3I A;  3FIR A;  4IY6 A;  4NF8 A;  3N6T A;  4QSE A;  3S4U A;  3VLW A;  4OES A;  4R75 A;  1MY4 A;  4NE4 A;  1QUJ A;  5CMC A;  2AYS A;  1A8E A;  1GR2 A;  3PUZ E;  1TWY A;  3KFM A;  5DEX B;  5CBR A;  1S50 A;  2UXA A;  1P1N A;  3HHG A;  1XVY A;  4KHZ E;  4JSD A;  1MDP 1;  1Z7M E;  3G3I A;  1DTG A;  3KN7 A;  1FTO A;  3TFL A;  4AB6 A;  4BDQ A;  1DSN A;  1BP5 A;  3PPN A;  5J1D A;  1LFH A;  5IAI A;  2PVU A;  3H06 B;  3MP6 A;  1B7Z A;  4ZDM A;  5ITP A;  1M5F A;  3PD9 A;  4PQJ A;  3C32 A;  3S9M C;  1LB8 A;  3UA8 A;  4DE8 A;  1FQB A;  2P2A A;  4EDP A;  1B9J A;  1MXZ A;  1TT1 A;  1VFE A;  2H9B A;  2R6G E;  3O6I A;  4DXU A;  3IO4 A;  4AB5 A;  2DE2 A;  4GXA A;  1B1H A;  1PDA A;  1M5E A;  1B4Z A;  4TQU Q;  2XXH A;  4OMB A;  1LAF E;  4GFR A;  3TTR A;  3FJG A;  1A99 A;  2XXT A;  1BKA A;  1AH5 A;  3CG1 A;  2Z23 A;  3EHS A;  3KOS A;  5JTY B;  3TMG A;  4EF2 A;  1IEJ A;  1MPD A;  2UVG A;  3UK4 A;  3OO8 A;  1QUL A;  1MY3 A;  4ZEK A;  1F9B A;  4FED A;  1H43 A;  4RNS A;  4TOZ A;  3TPA A;  2DWA A;  1Y4T A;  1DPE A;  4UA8 A;  3ZSF A;  2DQV A;  3IOV A;  1B7H A;  1OLC A;  3ZKL A;  2VD3 A;  1I6A A;  1I69 A;  2GH9 A;  4DDD A;  3EQ1 A;  3PMV A;  1B3F A;  3PD8 A;  1H44 A;  3K02 A;  5CMK A;  1Y3Q A;  2PYY A;  1FTL A;  1NFT A;  2RC8 A;  3E9X A;  2H25 A;  3LSX A;  4H5G A;  2DVZ A;  3D4G A;  2RCB A;  2Q88 A;  4H8J A;  4HCW A;  4KYS A;  2M8C A;  4ZS9 A;  3WAE A;  1B3H A;  4ECF A;  3CSG A;  2DYX A;  1B0L A;  4Z0I A;  3K6U A;  3PPO A;  1QKB A;  4O3A A;  4YIC A;  3P7I A;  1P1O A;  4O3C A;  5ITO A;  3TYH A;  2HZL A;  1B5I A;  3ZKK A;  3FJ7 A;  5IKB A;  2RF1 A;  4K3F A;  1DPP A;  2F6G A;  3R26 A;  3V8X B;  4H5F A;  4YKP A;  3PPR A;  4BDM A;  2PBW A;  1SYH A;  1TFA A;  3H3G A;  4OFJ A;  3MWB A;  5H8S A;  4PFY A;  3PPQ A;  4OFL A;  3VVF A;  1ELJ A;  5KDT B;  5JEI A;  1BTJ A;  5CM6 A;  3OSR A;  2GRV A;  1GVC A;  3SES A;  2Y7P A;  3FVK A;  4MFI A;  4F1U A;  1CB6 A;  3DP4 A;  3OEK A;  4QFN A;  1ZTY A;  2X7Q A;  1N04 A;  4IO5 A;  3HO7 A;  4MLV A;  5FHO A;  4QFL A;  4F3P A;  3L6H A;  3RGY A;  2I0B A;  4U1O A;  4Q0C A;  3MQ9 A;  4YAH X;  3DP6 A;  5AA1 A;  2ZYN A;  4F3B A;  3E4R A;  2F5X A;  5H8F A;  1N7W A;  2ZYO A;  3CRB A;  5AA2 D;  3V83 A;  3ILT B;  4LP2 B;  4N07 A;  3T96 B;  1TFD A;  2XXY A;  2XX8 A;  4XKR A;  4F1V A;  4N13 A;  4XXU A;  5HPQ A;  1R6Z A;  3MAM A;  5ICQ A;  2UYF A;  1Y1M A;  2O69 A;  1XS5 A;  1BIY A;  1Z7N E;  4FE8 A;  5CMM A;  4RPO A;  3S9E A;  2YJP A;  4F19 A;  2DE3 A;  3RPW A;  3RQT A;  1PBQ A;  1IIT A;  2GHB A;  1POY 1;  3FZV A;  1B58 A;  3K1M A;  4NED A;  4QRZ A;  4KPT A;  2NVU B;  2QPQ A;  4F22 A;  4I62 A;  4F18 A;  1T0K A;  5TP9 B;  3RTW B;  3KEI A;  4H6D A;  5DVI A;  1MY0 A;  2ZNT A;  1MQD A;  4RJZ A;  2H98 A;  2ANJ A;  1LFG A;  1MXU A;  1B51 A;  2ZXT A;  3MVY A;  3QK6 A;  1FQA A;  2UYE A;  4KFQ A;  3BFU A;  1QW0 A;  3FVG A;  4U23 A;  2F7B A;  2I48 A;  3PUX E;  4X9T A;  4YU0 A;  5BWJ A;  1QUK A;  1JW5 A;  2RCA A;  3M3K A;  4M1V A;  2XXV A;  3QIM A;  2Z8E A;  2QS3 A;  3SEU A;  1A7L A;  2QS1 A;  3K6X A;  3C4M A;  3ONM A;  3KN8 A;  4G4P A;  2O68 A;  4Z7E A;  5I58 A;  3IOU A;  1SI1 A;  1B46 A;  2XX9 A;  4LAT A;  3DP8 A;  5TPA A;  4DLD A;  3T22 A;  3EF7 A;  3CG3 A;  1PB8 A;  3MPK A;  3TEP A;  2Q2C A;  3MJN A;  1XHY A;  2ONK E;  2QSX A;  2OWT A;  3LBS A;  4I8C A;  4ZZA A;  3TUS A;  1UIV A;  2Z22 A;  1YCJ A;  2HAV A;  4X48 A;  3UN6 A;  4XTC Q;  1MQJ A;  4GIZ A;  1B5H A;  1PB9 A;  3K4U A;  4DIG A;  1JEU A;  2RIN A;  1MDQ A;  3IR1 A;  3CR9 A;  1YAE A;  2BJJ X;  3EN3 A;  2F35 A;  5FHN A;  4ZEF A;  3C34 A;  2R71 A;  3CFZ A;  1USY E;  5EHS A;  1ANF A;  1R1N A;  3VXC A;  4MH5 A;  2DWJ A;  2F78 A;  1URD A;  1Q1K A;  2ZYK A;  1R9Q A;  3RY3 A;  3IB0 A;  5I56 B;  5CMB A;  1IXH A;  1RYX A;  4OEU A;  4BDN A;  2F7A A;  4YKJ A;  1UIU A;  4FEB A;  4ZE8 A;  4IO6 A;  4C1T A;  5I58 B;  3Q26 A;  4U4X A;  4NF6 A;  4DZ1 A;  2P1S A;  2O6A A;  4KQP A;  1IXG A;  3IO6 A;  1R9L A;  2DWI A;  3CFX A;  3IJO B;  3N94 A;  4RYA A;  1FTM A;  4THI A;  5HM4 B;  1UTB A;  3SEW A;  2F8D A;  1EU8 A;  2ZMB A;  4H67 A;  3O6H A;  3OO7 A;  4G2Z A;  4IO7 A;  4QSD A;  3UIF A;  3FXR A;  1RKM A;  3OSQ A;  5DTB A;  1P1U A;  5L9O A;  3QUJ A;  4OVJ A;  4RY1 A;  1LFI A;  5A5X A;  2I58 A;  1FQC A;  4RK2 A;  3ODB A;  4XIG Q;  2G29 A;  1QUI A;  4OQO A;  2I49 A;  1PB7 A;  3KSX A;  5FTH A;  4M4G A;  4TLM B;  4G68 A;  3A09 A;  4QFO A;  3BBR A;  5AE4 A;  3HHF A;  1VE4 A;  2O7U A;  3N26 A;  1LCT A;  4R2B A;  1B3E A;  1NMU A;  4BDO A;  1HSE A;  1II5 A;  1TXF A;  2XXX A;  3OOA A;  1ATG A;  5H8H A;  5KCJ B;  4H65 A;  2I0C A;  3PUW E;  4U2R A;  5K2Y A;  4XKN A;  3VFJ A;  1MM7 A;  4LA9 A;  3A3C A;  5EHM A;  4UAC A;  1JW1 A;  1B3G A;  1M5C A;  4GL8 A;  3MVX A;  3ILU B;  1N84 A;  3TCF A;  2CZL A;  3G3J A;  5L8D A;  4ESX A;  4OWD A;  3OEM A;  1J1N A;  1USY H;  3SET A;  4ZE9 A;  4NF4 A;  4KYD A;  2NWJ A;  5I59 A;  4G8N A;  4EQ7 A;  2UVI A;  3KGC A;  4F31 B;  2V25 A;  3JV9 A;  3D4C A;  4H1X A;  4ZZE A;  4C1U A;  1XVX A;  3MZ9 A;  2ABH A;  1I6B A;  1B4H A;  1SQY A;  1Y1Z A;  4G8M A;  1D9V A;  1UQW A;  3V89 B;  4ELR A;  3VVE A;  4AQ4 A;  4OXV A;  4OHN A;  3MW0 A;  3U94 A;  5AA3 A;  1BLF A;  3FV1 A;  3KG2 A;  4I9D A;  1QJM A;  1EZO A;  4RK9 A;  4F2Q A;  5KCJ A;  3R6U A;  4LQ5 A;  5I2N A;  1QKA A;  4FAJ A;  1IUD A;  3HN0 A;  1B0H A;  1WDN A;  3TZA A;  5I57 B;  3LUY A;  3H6W A;  2GFE A;  3O2A A;  3OMB A;  4OEN A;  4R6K A;  4FAT A;  1ZBM A;  1OMP A;  3EPE A;  1JVY A;  4YB6 A;  5CRY A;  4DXC A;  3KJT A;  4IGT A;  4JXI A;  4P0G A;  4MLQ A;  4OET A;  5I2K A;  1Q35 A;  1ZU0 A;  2XD3 A;  2OWS A;  2V3Q A;  2XXU A;  3FAS A;  4IO4 A;  1NL5 A;  4NF4 B;  3SER A;  2QJE A;  4C0R A;  4WED A;  1AL3 A;  2VD2 A;  1LBB A;  1JEV A;  1MG1 A;  2B3F A;  4HCY A;  4YMA A;  2YLN A;  4R6Y A;  5KDT A;  4IB2 A;  4OFO A;  2HCA A;  2QMW A;  4ISU A;  4YKI A;  1A8F A;  4FOR A;  4OZ9 A;  1S7Y A;  4G68 B;  1YTV A;  2ALU A;  3MVZ A;  4ESW A;  2A5T B;  3H7M A;  4FJP A;  3ZS6 A;  3C36 A;  4P11 A;  3CI8 A;  1MQH A;  1US5 A;  3PMX A;  3TQW A;  3TQL A;  3C33 A;  4YZZ A;  2QS2 A;  4LQ2 A;  1NNF A;  1SW2 A;  1HSL A;  1N76 A;  1P1W A;  5H8Q A;  3U8Q A;  1Y3N A;  4LZ5 A;  2E0S A;  1B32 A;  3PMW A;  4HS7 A;  3E13 X;  2DS9 A;  4O3B A;  2V93 A;  4GD5 A;  4TLL B;  2IA4 A;  3H6U A;  3M3F A;  5ELV A;  3JZJ A;  5FTI A;  5I2K B;  3G3K A;  3RT6 B;  1POT A;  1N3W A;  3UP9 A;  1Y3P A;  3OO9 A;  4G68 C;  4QHQ A;  4DXB A;  1MY2 A;  4JWY A;  4ELQ A;  3MPL A;  3FAT A;  1PEB A;  3IB1 A;  4F1Y A;  1HSJ A;  1FTJ A;  3M3L A;  4QFP A;  3QUF A;  3VV5 A;  4X1D A;  3LSL A;  2XXP A;  1PC3 A;  3T66 A;  3B6W A;  3TKD A;  2O84 X;  3HV1 A;  2I4B A;  3C35 A;  4G77 A;  4HW8 A;  4ONY A;  3VLV A;  1MXX A;  4POW A;  1SDX A;  3TTN A;  4DCY A;  3FV2 A;  4EQ9 A;  2IEE A;  3T93 B;  3RN8 A;  3VE1 B;  1DTZ A;  5AA2 B;  3FD3 A;  2OZZ A;  1MQI A;  3HCQ A;  3QYT A;  2DP8 A;  4LZ8 A;  3Q25 A;  4OER A;  2AL5 A;  5I2N B;  1A40 A;  4R72 A;  5H8Q B;  2Q8J A;  3IL1 B;  3TOD A;  1NKX A;  4NWC A;  1MS7 A;  1URG A;  3H6T A;  3PPP A;  1D4N A;  2I3V A;  4KI0 E;  1Y20 A;  1B1X A;  1MQG A;  5CBS A;  3T9U A;  5DT6 A;  2PT1 A;  1LST A;  3PU5 A;  1M5B A;  3K00 A;  3W15 C;  4EQB A;  1MH4 A;  1LB9 A;  1YPN A;  3S9N C;  4BDR A;  3CVG A;  3W9W A;  2VHA A;  2H5Y A;  3RNN A;  4LVQ A;  1ZMG A;  5F1Q A;  2Y7W A;  1B05 A;  1O63 A;  4LON B;  2AIX A;  2QMX A;  1ZKB A;  2HAU A;  3MP1 A;  2ESN A;  4IY5 A;  1JW4 A;  1MXW A;  1WVJ A;  2RC7 A;  2VP1 A;  2A5T A;  3T9X B;  2DOJ A;  3EHU A;  3C9H A;  1SI0 A;  3U93 A;  4E0X A;  5AA2 A;  2A5S A;  2O1L A;  5LOM A;  3USD A;  1FQE A;  5I56 A;  4WEP A;  2OCU A;  1RYO A;  3FXU A;  3KSJ A;  1FTK A;  2I3W A;  2Z8F A;  3QAX A;  1XT8 A;  2THI A;  2XXR A;  3B7D A;  4L17 A;  4GRK A;  4GQO A;  1SYI A;  3K01 A;  1SD3 A;  4ZEB A;  1P99 A;  4NF6 B;  2LAO A;  3UOR A;  1MPC A;  1EH3 A;  4QSC A;  2HEU A;  3LR1 A;  4GVO A;  4JDF A;  1CE2 A;  1LGB C;  4ZEC A;  2OJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...