5L9OA

Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
DNPLGLIDPTTISVGTMGDAKPYAFTTADGNFTGFDIELFLNVAGRLGFKKEQVVFTGQEFSALMPSVANGRFDVAAAAIGTTAKRKETVDFSDGYLAGFLSVLTSEAGITDAAGLKGKRLGVVQGTLQEIYAEKNFAGTDLVKFPDNNSAVSALNNGTVDAHFLDFEAAKDYSARYPALKIAVNIPSFDAPAGFVIRKGNDALRNALDKGLKEAMQDGTWKKLHEKWFPGTPMPAAYLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Deoxyfructosyl-amino Acid Transporter Periplasmic Binding Pr
publication title Structural Basis for High Specificity of Amadori Compound and Mannopine Opine Binding in Bacterial Pathogens.
pubmed doi rcsb
source organism Agrobacterium fabrum (strain c58 / atcc 33970)
total genus 73
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5l9oA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5l9oA02
1IEJA 4HTGA 1IXIA 3B6TA 3O28A 1JVYA 3H3GA 3ZKLA 1LAGE 4BLAA 4FE8A 2OLBA 4HCWA 4U21A 4JBZA 1MXZA 1OVBA 2VD2A 4ZZEA 4OEUA 4KYSA 1H76A 3HCQA 3KJ7A 4OYVA 2NUVA 1JW4A 3CRBA 3GZGA 4WXJA 4ELPA 2OWSA 2V3TA 3RQTA 5AA2D 4ISUA 4AB6A 3LSWA 2XD3A 2REGA 2NVUB 4YU0A 4UACA 3PMVA 1NNKA 4PQJA 1UIVA 4EQ7A 4IO2A 3Q26A 2VHAA 1S50A 3PPQA 3V83A 4KPTA 2F7BA 3DP6A 4IO7A 2ONRA 5KDTB 2IEEA 4NF4A 4BDOA 2I4CA 4R2FA 3TAJA 4HCYA 1B05A 3R26A 5FHMA 3RN8A 3UP9A 3MP8A 1ZMGA 1IQ7A 3PV0E 2XHDA 3W9VA 3H6TA 3OO9A 1D3KA 3O9PA 3E9XA 1GTKA 3SETA 1MXUA 4KD5A 2REJA 1FQEA 1D4NA 3PUWE 4JWOA 3VVEA 1RKMA 5DVIA 1MRPA 1QUKA 3QUJA 2DWAA 3LR1A 4RPOA 1I69A 4I9DA 5H8NB 4G8MA 4OERA 1OVTA 3T96B 4DZ1A 1FTKA 4EF2A 4R75A 3CIJA 1IIWA 2F34A 4YKJA 4R72A 1LFGA 5DEXA 3HN0A 4U4SA 3UA8A 3PD8A 3PUVE 1SQYA 5AE4A 3OSRA 3PGFA 3K02A 3OXNA 3THIA 5CBRA 3BFTA 1PC3A 3VE1B 4YKKA 2UVHA 4RJZA 1LLSA 1MXWA 4YKIA 1MQIA 4H65A 3C32A 2I0CA 3BKIB 3S9NC 1LCFA 4NEDA 4JB7A 3S9EA 1MXXA 4MBPA 2F7AA 3O97A 2HZKA 1LB9A 3VV5A 2Y7IA 3EN3A 5ITOA 3PMWA 5JEIA 1LFIA 1LFHA 4R9FA 1B3GA 1ZJLA 4KR5A 4BDRA 3B6WA 4NF5A 3EHUA 3EHSA 5AA1A 3QUFA 4ZDMA 2DWHA 2H9BA 4WEPA 3O29A 4NF6B 3KJTA 3HHGA 1UTBA 4QFKA 4ESXA 1VFEA 1IXHA 4ELRA 4JWXA 2VGQA 1URDA 2F6PA 1M5BA 1I6BA 3H6UA 3U8QA 1YTVA 3K4UA 5LOMA 2H99A 4BDQA 2O1MA 1B5IA 4OZ9A 3CG3A 4QFNA 1B1HA 4H8JA 5AA2A 3TFLA 1EZPA 3DELB 4LZ7A 3I5OA 1AH5A 3RT8A 3M3KA 1MS7A 5HPQA 3H06B 1VFDA 1OLAA 1POTA 1LB8A 2OZZA 4POXA 4Z7EA 2QS4A 1B7ZA 2DE3A 4F22A 2ANJA 1PDAA 1RYXA 4C1TA 1LCTA 1DMBA 3S9MC 5B7DA 2QS3A 4ZEDA 2O51A 3K00A 4OQOA 4R6YA 5H8QB 2Q8JA 1P1WA 4XKNA 1J1NA 1YAEA 5EHMA 4R74A 3TQWA 3O6IA 1B2HA 4YB7A 3IO4A 3F11A 2XXRA 4PFUA 3U92A 5CMKA 3LSFB 5TP9B 4LONB 3R7XA 4G4PA 2FYIA 3PUYE 1OMPA 3TDJA 4H5FA 5FHNA 1AL3A 1Y3PA 3FASA 4IO6A 3JZJA 1WDNA 1NFTA 1M5FA 1N3XA 3DP8A 3T66A 2D21A 4F3PA 1N7XA 4WEDA 5BWJA 3IL1B 2ONKE 4PE5B 4H6DA 1AOVA 3UN6A 2V3UA 3A09A 3MQ9A 1FTLA 1UIUA 1CB6A 3GBBA 4R6HA 4KCDA 1BTJA 4NF8A 5HM4B 1PBQA 3Q27A 3TPAA 1SW2A 3KN8A 5TPAB 1B3EA 4H1XA 1S7YA 1B1XA 4ZZAA 4JSDA 3RNNA 4THIA 3TMGA 4WKMA 3KBRA 1R1NA 3MC2A 3B7DA 3EQ1A 3IO6A 4PFWA 4FIMA 3N26A 2UXAA 2H4IA 3VDFA 1Q35A 2HXWA 1YCJA 4N6PA 5I2NA 1MH3A 1EU8A 1R9LA 1MY0A 2R6GE 3G3IA 3MPLA 1T0KA 4YAHX 2XXTA 1B4ZA 3HV1A 1ZIUA 4X1DA 1GV8A 2R9JA 3V89B 2UVGA 4DXCA 1B32A 4F39A 4O3AA 3PPRA 2P2AA 4DIGA 2X26A 4DCYA 2ZYOA 4PFYA 2I49A 5KDTA 3K6WA 5DTBA 3TODA 2DYXA 4IO4A 1DTGA 4O3CA 1GR2A 1GGGA 2Y7WA 1B3FA 1AMFA 1OLCA 1Z7ME 4DLDA 2XX9A 3TTMA 3IOUA 2B3FA 2LAOA 4NF8B 3FVGA 3IORA 5H8HA 3OSQA 1TT1A 1NNFA 4R2BA 4GXAA 1N76A 4AQ4A 1P1OA 1FQBA 5H8NA 5CMBA 2ALUA 3RPWA 2O84X 3CFXA 3O6GA 3UIFA 4FEDA 4HW8A 4F29A 3RTFB 4OMBA 3U72A 5ISUA 4F1YA 3SESA 3Q25A 1MM6A 1LAHE 5I2NB 2F5XA 1A8FA 3MP1A 4RA1A 3CR9A 4EDPA 3K0VA 3PPOA 2B65A 2ESNA 2PMSA 5BUUA 1IXGA 2A5TB 2ZMBA 1OQGA 4QSDA 1NNTA 4E0WA 1MXVA 4OETA 1IITA 3T9UA 1UTHB 1XS5A 2O6AA 3KN7A 4DXBA 2RCBA 2XXIA 4GRKA 3KN3A 1NH8A 1WODA 3KSXA 1O64A 2B3BA 3ZS6A 4HS7A 1JNFA 1Y1MA 4QFPA 4TLLB 1B4HA 2XXXA 1RYOA 4QFOA 1POY1 2WKYA 4GOTA 4YZZA 3TTKA 3KSJA 3SERA 3FV1A 3G3KA 2I48A 4Q0CA 3IK6B 3CSGA 2DS9A 2V3QA 4MLVA 4U2RA 5H8HB 1R9QA 4NF6A 3ECRA 1NNPA 1MPCA 4QF9A 4X1BA 1F9BA 1LAXA 1XVXA 4PETA 4F1UA 2GH9A 2XX7A 5FHOA 2ZNUA 3MVWA 3ZKKA 2XD2A 2O69A 1FTMA 3TKDA 4U23A 4PP0A 2H98A 1MPBA 3IB2A 3SEXA 2DE2A 4LQ5A 3MUQA 1LGBC 4Q8RA 4NWDA 3FXRA 3H7MA 2O1LA 2OWTA 1BKAA 5H8FA 3IX1A 2V25A 4XTCQ 3QYTA 3FXQA 3KEIA 1DOTA 1XOCA 2X7PA 4LA9A 3M3LA 4JDFA 2H25A 2PYYA 5TU0A 3I3VA 1B46A 1QULA 3HSTA 4MFIA 4ZEKA 3PPPA 3KFMA 1LBBA 2HFBA 2I3WA 4XKRA 5FTIA 4IB2A 2Y7KA 1URGA 5H8QA 1USYH 3N94A 4YMBA 3LBSA 2CZLA 1B5JA 1B58A 4BDMA 1B40A 1VSOA 4FJPA 1JQFA 3K1NA 3RTWB 4Q30B 5TP9A 2UYEA 3C4MA 4FECA 1B5HA 1ATGA 4OHNA 2O7UA 5JK4A 1IZ1A 4I8CA 2DXYA 1TFDA 1SVXB 3BFUA 3MZ9A 2H5YA 2Q2CA 5CM6A 2HEUA 3T9VA 3KGCA 1US4A 1QJMA 3CG1A 2XXUA 4EQBA 5IKBA 3DP4A 1PB8A 1SYIA 3PUZE 1FW0A 3VLWA 1PBPA 2RC7A 4GD5A 1N3WA 4X9TA 3HPIA 1OIBA 2XXPA 3G3HA 3S2VA 1PB9A 4Z0IA 4KCCA 1BIYA 3TZAA 1ZLQA 2RC9A 3HHFA 3MZBA 1MY4A 5TPAA 4YICA 1XT8A 1B9JA 3JV9A 5H8FB 1QUJA 4ECFA 4NWCA 1N84A 3M3FA 3OEMA 4F31B 3IR1A 4OXVA 2DXRA 5KZTA 2QL3A 4ZEBA 2Q2AA 5AA4A 4R9GA 5I59A 4F1VA 3TTRA 3IJOB 3SEUA 5CI5A 3FVOA 4EXKA 2ONSA 4RY1A 5H8SA 1A7LA 5K2YA 2XXYA 3N6TA 4H8IA 4OESA 5ICQA 1MDQA 3TCFA 5A5XB 2G93A 4U22A 2RKMA 3KG2A 3A3UA 1CE2A 2F78A 4RYAA 4I62A 2AL4A 3CI8A 3QAXA 3PPNA 4M1VA 4L17A 3PU5A 3LUYA 3MW0A 4GQOA 4IY5A 3CFZA 3MZ1A 4ZECA 4QHQA 4MF3A 1A40A 2ZYNA 1SBPA 3M8UA 5M2VA 3VXBA 4U1ZA 4F3GA 2X7QA 1EZ9A 3O2AA 1I6QA 4DDDA 3A3CA 4EXLA 3FXUA 2DVZA 1P1NA 2ZYKA 4RPNA 1SW1A 1ANFA 1LAFE 3FATA 4FEBA 1I6AA 1FTJA 2RINA 1MPDA 1NMUA 4G68B 1N04A 3MWBA 2HQ0A 2GRVA 3LC8A 2DSFA 3FJGA 1NH7A 2YLNA 3OOAA 5HBCA 5I56A 4P11A 3OENA 4DXUA 3K2DA 4IO5A 4C0RA 3P7IA 1ZKBA 1BP5A 2NWJA 4DCXA 1JEVA 4LQ2A 3FV2A 5AA4B 1Y1ZA 3QXMA 5L9SA 1MY1A 5I59B 2XX8A 4YB6A 5EHSA 2OJTA 2Z23A 4U1OA 1QUIA 3T93B 3FUZA 4OFLA 1MDP1 2DOJA 3WAEA 2QRYA 1DPEA 2QJEA 2A5TA 3UGWA 4XKQA 1MG1A 1SW4A 3GBAA 1UTHA 4G77A 2I6EA 1Y3NA 1SI0A 3IB1A 1ZTYA 1H3DA 3H6VA 3OO6A 3USDA 4RXLA 1HSEA 3UK4A 4EQ9A 3RLFE 2XXQA 3SEVA 4P0IA 3PD9A 3H03A 4U4XA 2I4BA 3N5LA 3RT6B 2XXWA 1N7WA 3TEPA 2QS1A 2DQVA 3OELA 5KCJA 3S9LC 3FJ7A 4XKPA 1A99A 1MXYA 1TWYA 3C31A 2XXHA 3R6UA 1PB7A 5FTHA 2IA4A 4ELQA 4YKPA 3EPEA 5JTYB 1FQCA 1H43A 3VVDA 1QW0A 3H4ZA 2A5SA 2CMOA 3T9HB 4GXSB 3ILTB 4RK9A 4GWOA 3CVGA 5ELVA 5I56B 5L9OA 5B70A 3FZVA 5AA3A 1Y4CA 2AIXA 3K6UA 1D9VA 1MQDA 4R73A 2DWJA 3QIMA 2OK2A 1IXCA 3G7WA 3E13X 4KFQA 3O6HA 1SI1A 2NXOA 2PVUA 4EF1A 4QRZA 4EUOA 3ILUB 3TUSA 1B51A 1D9YA 1DPPA 2G29A 2R71A 3C34A 1M5EA 1JW5A 5I2KB 2O7IA 3SDFA 3MVXA 3OEKA 1O63A 4XXUA 4H5GA 3EHTA 3KOSA 3VFJA 3D4GA 3N6UA 3TTLA 3RY3A 1VE4A 2E0SA 3FD3A 2RF1A 4F3BA 1YPNA 1S9TA 2HAUA 3DM0A 2HCAA 4TOZA 3VXCA 4F18A 3IAZA 1P1QA 2I0BA 3I6VA 1II5A 4IGTA 4ND9A 2XXVA 3VLVA 2Y7RA 4IY6A 2Z8EA 3IOWA 4ZEIA 2E1SA 1Q1KA 5KCJB 1MY2A 4UA8A 3LSLA 2GHBA 3IB0A 2PT1A 1P99A 3AXFA 4DE8A 3T22A 3CSBA 2QSXA 1EH3A 3FVNA 2D5WA 4GF8A 1LBCA 4MLQA 3S4UA 1XC1A 3K01A 1PEBA 3SKPA 2RC8A 3W15C 2QS2A 1ZBMA 4KHZE 5DT6A 3TCGA 1P1UA 4GVOA 3FVKA 2HAVA 4KQPA 4I1DA 1DTZA 1KWHA 3OO7A 4OVJA 3FGSA 1US5A 4OFOA 2THIA 1O7TA 3G3JA 3U94A 1TXFA 1B0LA 1EZOA 1A54A 4OWDA 3FIRA 4ZE8A 5L8DA 1B3HA 3MBPA 2ZNTA 4POWA 4GLIA 3V8XB 4E0XA 4M4GA 2ZNSA 1M5CA 1QVSA 3ZSFA 4F3SA 1A55A 4GL0A 1ZU0A 3C35A 4RNSA 4ESWA 2Q88A 1H45A 4JSOA 2F36A 1HSLA 3RGYA 4K3FA 4Q5TA 1GVCA 5I57A 3K1PA 5I58A 3SEWA 2ZYMA 1MM7A 2F8DA 3G3GA 2Z8FA 2ABHA 2UYFA 5A5XA 4R6KA 1FCKA 3PUXE 1QKAA 3V5AA 4YMAA 5DVFA 1MQHA 1N0TA 1Y9UA 4TLMB 3H6WA 4NF4B 4H0WA 1TFAA 3U93A 5CC2A 4LVQA 4ZE9A 4F2OA 1USYE 2Q9TA 1NL5A 3ONMA 1FQFA 2F7CA 3TCHA 1URSA 3GLBA 2PBWA 5F1QA 3WAFA 4ZEFA 5L9MA 1JW1A 1OQHA 4LZ8A 4KYDA 4QSCA 2AYSA 1Z7NE 2Y7PA 4X48A 5DVJA 5DYHA 4G2ZA 4KI0E 2FA7A 4G8HA 1B52A 1SD3A 4RK2A 1JEUA 4LATA 2OBGA 1Y4TA 3K1MA 3CFLA 5J1DA 4FAJA 4G68A 4ONYA 3MP6A 1JETA 4JXIA 2YPNA 5DEXB 2VD3A 3IJXB 1M5DA 1VR5A 5I84A 2Q89A 2F35A 2V93A 3MVZA 4QSEA 3KZGA 1L5TA 2ZXTA 4GL8A 5F7VA 3JYRA 1B0HA 4N07A 3SEYA 1Y3QA 4O3BA 3TELA 2HZLA 3C33A 5I57B 4F2QA 3HO7A 1FQDA 5I58B 1QKBA 3GXAA 2F97A 2Z8DA 5EYFA 4OTEA 3OD7A 3IOTA 2F6GA 3W9WA 1H44A 3TYHA 1SW5A 1XVYA 1B7HA 3D4CA 3MPKA 3E3KA 3BBRA 2GHAA 1NKXA 1LSTA 3MVYA 3FJMA 1FQAA 4BDNA 2NOOA 3TTNA 5ICTA 2QMWA 3VLUA 3K6XA 1MH4A 2D3IA 4GFRA 4LZ5A 1SDXA 3B6QA 4NF5B 1FTOA 4MH5A 3L6HA 1R6ZA 2QPQA 4PFTA 4F19A 3O66A 2KLFA 4OFJA 2GFEA 2DWIA 1JVXA 2QMXA 3E4RA 4OENA 3VVFA 3Q28A 2DE4A 2W7YA 1UTBB 2P0SA 4IO3A 4N13A 3RUMA 3LSXA 5JTYA 2Z22A 1B3LA 4LUBA 2V84A 2O68A 2VOZA 1MY3A 4JWYA 1SYHA 3TQLA 2YJPA 4P0GA 3KOTA 3MAMA 5AA2B 1A8EA 3IOVA 2OCUA 4LP2B 4NTLA 4ZS9A 5ITPA 2I3VA 1IUDA 4OEVA 1Y20A 4IGRA 1B7UA 3MJNA 4AB5A 3EF7A 2DVCA 2FNCA 5CMMA 2PT2A 5I2KA 3PMXA 5CBSA 3L6GA 3G3FA 3QSLA 4XIGQ 3K6VA 2AL5A 2VP1A 3T9XB 4TQUQ 4G8NA 4NMYA 1MQJA 4FATA 3ODBA 1AIVA 1DSNA 1HSJA 1MQGA 2P1SA 4YB5A 5K2XA 4H67A 4ELOA 1UQWA 2UVIA 2I58A 3OO8A 4QFLA 4G68C 4BDLA 2Y84A 2BJJX 4GIZA 4C1UA 4NE4A 3Q29A 1XHYA 2M8CA 1WVJA 2RCAA 5CMCA 1B6HA 2PX1A 3U1OA 5CRYA 2UVJA 5IAIA 3QK6A 3OMBA 1BLFA 3UORA 4FORA 3C9HA 2DP8A 1ELJA 3C36A 3DLNA 4KYEA
chains in the Genus database with same CATH superfamily
5EQ8A 1IEJA 4HTGA 1IXIA 3B6TA 3O28A 1JVYA 3H3GA 3ZKLA 1LAGE 4BLAA 4FE8A 2OLBA 2WYPA 4HCWA 4U21A 4JBZA 4PFRA 1MXZA 1OVBA 2VD2A 4ZZEA 4OEUA 4KYSA 1H76A 1DK4A 1LBVA 3HCQA 3NOHA 3KJ7A 4OYVA 2NUVA 1JW4A 3CRBA 3GZGA 4WXJA 4ELPA 2OWSA 3HFUA 1IMAA 2V3TA 4AS4A 3RQTA 5AA2D 4ISUA 4AB6A 3LSWA 2XD3A 2GQ1A 2REGA 2NVUB 5IZZA 4YU0A 4OVPA 4UACA 3PMVA 1NNKA 4PQJA 1UIVA 4EQ7A 4IO2A 4FBPA 3Q26A 2VHAA 3T1BA 1S50A 3PPQA 2CZKA 3V83A 4KPTA 2F7BA 3DP6A 4IO7A 2ONRA 2WX9A 5KDTB 2IEEA 4I3YA 4NF4A 4QBAA 4BDOA 2I4CA 4R2FA 1RDXA 3TAJA 4HCYA 1B05A 3R26A 5FHMA 3RN8A 2QFLA 3UP9A 3MP8A 1ZMGA 1IQ7A 3PV0E 2XHDA 3W9VA 3H6TA 3OO9A 1D3KA 3O9PA 3E9XA 1GTKA 4NQ8A 3SETA 1MXUA 4KD5A 2REJA 4PAFA 1FQEA 1D4NA 3PUWE 4JWOA 3VVEA 1RKMA 5DVIA 1MRPA 1QUKA 3QUJA 4NX1A 2DWAA 3LR1A 1BK4A 4RPOA 1I69A 2QVVA 4I9DA 5H8NB 4G8MA 4OERA 1OVTA 3T96B 4DZ1A 1FTKA 4EF2A 4R75A 4PF6A 3CIJA 1IIWA 4PGPA 2F34A 3IFAA 4YKJA 4R72A 1LFGA 5DEXA 3HN0A 4U4SA 3UA8A 3PD8A 3PUVE 1SQYA 4XF5A 5AE4A 3OSRA 3PGFA 3K02A 3OXNA 3THIA 5CBRA 3BFTA 1PC3A 1EYIA 2BJIA 3VE1B 4YKKA 2UVHA 1FPBA 4NN3A 4RJZA 1LLSA 1YYZA 1MXWA 4YKIA 1MQIA 4H65A 3C32A 2I0CA 3BKIB 3S9NC 1LCFA 5ET7A 4NEDA 4JB7A 3S9EA 1MXXA 4MBPA 2F7AA 2XXKA 3O97A 2HZKA 2B4LA 1LB9A 3VV5A 2Y7IA 4OA4A 3EN3A 5ITOA 3PMWA 5JEIA 1NI9A 2XWKA 1LFIA 1LFHA 4N8GA 4R9FA 1B3GA 1ZJLA 4KR5A 2WYKA 4BDRA 3B6WA 4NF5A 3EHUA 3EHSA 5AA1A 3QUFA 1FPFA 4ZDMA 2DWHA 2H9BA 1FTAA 4HXVA 4WEPA 3O29A 4NF6B 5IZ3B 1LBWA 3KJTA 3HHGA 3PTYA 1UTBA 4QFKA 4ESXA 1VFEA 1IXHA 2CZIA 4ELRA 2F3DA 4JWXA 4XEQA 4GWWA 2VGQA 2V4CA 1URDA 2F6PA 1M5BA 1I6BA 1YZ0A 1NUWA 3H6UA 3U8QA 1YTVA 3K4UA 1NV1A 5LOMA 2H99A 4BDQA 2O1MA 1B5IA 4OZ9A 3CG3A 4QFNA 1B1HA 4H8JA 5AA2A 3TFLA 1EZPA 3DELB 4X04A 4LZ7A 3I5OA 1AH5A 4N8YA 3RT8A 3M3KA 1MS7A 3MYUA 4MHFA 5HPQA 3H06B 4N4UA 1VFDA 1NUYA 1OLAA 1POTA 1LB8A 2OZZA 4POXA 5I5PA 4Z7EA 2QS4A 1B7ZA 2DE3A 4P56A 4F22A 2ANJA 1PDAA 1RYXA 4PBHA 4C1TA 4I3EA 1LCTA 1DMBA 1FJ6A 3S9MC 5B7DA 1LBZA 2QS3A 4ZEDA 2O51A 3K00A 4OQOA 4R6YA 5H8QB 2Q8JA 1P1WA 4XKNA 3T0JA 1J1NA 1YAEA 5EHMA 4R74A 3TQWA 3O6IA 1B2HA 4YB7A 3IO4A 3F11A 4OVTA 2XXRA 4MJOA 4PFUA 3U92A 5CMKA 3LSFB 5TP9B 4LONB 3R7XA 4G4PA 5EYGA 2FYIA 3PUYE 1OMPA 3TDJA 4G61A 4H5FA 5FHNA 1AL3A 4O7MA 1Y3PA 3FASA 4KXPA 1IMFA 4IO6A 3JZJA 1WDNA 4HE0A 1NFTA 3U65A 1M5FA 1N3XA 2L5VA 3DP8A 3T66A 1YXIA 2D21A 4F3PA 1N7XA 4WEDA 4P3LA 5BWJA 3IL1B 2ONKE 4PE5B 4H6DA 1AOVA 2CZHA 3UN6A 2V3UA 3A09A 3MQ9A 1FTLA 1UIUA 1CB6A 3GBBA 4R6HA 4KCDA 1BTJA 3BIHA 3IFCA 4NF8A 5ESYA 5HM4B 1PBQA 3Q27A 3TPAA 1SW2A 3KN8A 5TPAB 1B3EA 4H1XA 1S7YA 1B1XA 4ZZAA 4JSDA 3RNNA 2FIEA 4THIA 3TMGA 4WKMA 3KBRA 1FBGA 1R1NA 3MC2A 1K9YA 3B7DA 3EQ1A 2CEXA 3IO6A 4PFWA 4FIMA 3N26A 2UXAA 2H4IA 3VDFA 1Q35A 1KA1A 2HXWA 1YCJA 4N6PA 5I2NA 1MH3A 1EU8A 1R9LA 4HE2A 1MY0A 2R6GE 3G3IA 3MPLA 4GX6A 1T0KA 4NAPA 4YAHX 2XXTA 1B4ZA 3HV1A 1ZIUA 4X1DA 1GV8A 2R9JA 4GWYA 3V89B 2UVGA 4DXCA 1B32A 4F39A 4O3AA 4P8BA 3PPRA 2P2AA 4DIGA 2X26A 4DCYA 2FHYA 2ZYOA 4MNPA 4PFYA 2I49A 5KDTA 3K6WA 5DTBA 3TODA 2DYXA 4IO4A 1DTGA 1FPGA 3E78A 4O3CA 1GR2A 1GGGA 2Y7WA 1B3FA 1AMFA 1OLCA 1Z7ME 4DLDA 2XX9A 2KQZA 3TTMA 4GX4A 3IOUA 2B3FA 2LAOA 4NF8B 3FVGA 3IORA 5H8HA 3OSQA 1TT1A 1NNFA 4R2BA 4PBQA 4GXAA 1N76A 4AQ4A 1P1OA 1FQBA 5H8NA 4NG7A 4XFEA 5CMBA 2ALUA 4JVCA 4N15A 5ET8A 3RPWA 2O84X 3CFXA 3O6GA 3UIFA 2R8TA 4FEDA 4MIJA 4HW8A 4F29A 3RTFB 4OMBA 3U72A 1FPJA 5ISUA 4F1YA 3SESA 3Q25A 1MM6A 1LAHE 5I2NB 2F5XA 1A8FA 4GWZA 3MP1A 4RA1A 3CR9A 4EDPA 4NGUA 3K0VA 5IZ1A 3PPOA 2B65A 2ESNA 2PFYA 2PMSA 5DW8A 5BUUA 1IXGA 2A5TB 2ZMBA 1OQGA 4QSDA 1NNTA 4E0WA 1MXVA 4OETA 1IITA 3T9UA 1UTHB 1XS5A 2O6AA 3KN7A 4P1EA 4DXBA 2RCBA 4MCOA 2XXIA 4GRKA 3KN3A 1NH8A 1WODA 3KSXA 2QVRA 3GYYA 1O64A 4P1LA 2B3BA 3ZS6A 4HS7A 1JNFA 3B8BA 1Y1MA 4QFPA 4TLLB 1B4HA 2XXXA 4P9KA 1RYOA 4QFOA 1POY1 2WKYA 4GOTA 4YZZA 1FBEA 3TTKA 3KSJA 3FV1A 3SERA 3G3KA 2I48A 4Q0CA 3IK6B 3CSGA 4JVIA 2DS9A 2V3QA 4MLVA 4U2RA 5H8HB 1R9QA 4NF6A 3ECRA 1NNPA 5IZ3A 1MPCA 4QF9A 4MX6A 4X1BA 1F9BA 1LAXA 1JP4A 1XVXA 4PETA 4F1UA 4GWSA 2GH9A 2XX7A 5FHOA 1FJ9A 2ZNUA 3MVWA 3ZKKA 2XD2A 2O69A 1FTMA 4NF0A 3TKDA 4U23A 4PP0A 2H98A 2HPGA 2P3NA 1MPBA 3IB2A 3SEXA 2DE2A 4LQ5A 3MUQA 1LGBC 4Q8RA 4NWDA 3FXRA 3H7MA 2O1LA 2OWTA 1BKAA 5H8FA 3IX1A 2V25A 4MNCA 3QYTA 4XTCQ 3FXQA 3KEIA 1DOTA 1XOCA 2X7PA 4LA9A 3M3LA 4JDFA 2H25A 2PYYA 5TU0A 3I3VA 4OANA 1B46A 1QULA 3HSTA 1FPDA 4MFIA 3FXBA 1FBHA 4H46A 4X8RA 4ZEKA 5EQ7A 3PPPA 2HXRA 3KFMA 1LBBA 2HFBA 2I3WA 4XKRA 5FTIA 4IB2A 2Y7KA 1NUXA 1URGA 5EYHA 5H8QA 2VPOA 1USYH 3N94A 4YMBA 3LBSA 2CZLA 1B5JA 1B58A 4BDMA 1B40A 1VSOA 4FJPA 1JQFA 3K1NA 3RTWB 4Q30B 5TP9A 2UYEA 3C4MA 4PC9A 1FPIA 4FECA 1B5HA 1ATGA 4OHNA 2O7UA 5JK4A 1IZ1A 4I8CA 2DXYA 1TFDA 3FBPA 1SVXB 3BFUA 3MZ9A 2H5YA 2FBPA 2Q2CA 5CM6A 3BIGA 2HEUA 3T9VA 3KGCA 1US4A 1QJMA 4OVRA 3CG1A 2XXUA 4EQBA 5IKBA 3DP4A 1PB8A 1SYIA 3PUZE 1FW0A 3VLWA 1PBPA 1NV6A 3DLNA 2RC7A 4GD5A 1N3WA 4X9TA 3HPIA 1OIBA 2XXPA 3G3HA 3S2VA 1PB9A 4Z0IA 4KCCA 3RYDA 1BIYA 3TZAA 1IMCA 1ZLQA 2RC9A 3HHFA 3MZBA 1MY4A 3KC0A 5TPAA 5I7IA 1KA0A 4YICA 1XT8A 2QVUA 1IMEA 1B9JA 3JV9A 5H8FB 1QUJA 4ECFA 4NWCA 1N84A 3M3FA 3OEMA 4F31B 3IR1A 4GWXA 4OXVA 2DXRA 5KZTA 2QL3A 4ZEBA 5F24A 2Q2AA 5AA4A 1AWBA 4R9GA 5I59A 3D1RA 3LV0A 4F1VA 1EYJA 3TTRA 3IJOB 2PCRA 3SEUA 5CI5A 3FVOA 2ZZXA 4EXKA 2ONSA 1NV3A 4RY1A 5H8SA 1A7LA 5K2YA 2XXYA 4NHBA 5ET5A 3N6TA 4H8IA 4OESA 1FBPA 5ICQA 1MDQA 3TCFA 5A5XB 2G93A 4PCDA 4U22A 1KZ8A 2RKMA 3KG2A 3A3UA 5A5LA 1CE2A 2F78A 4RYAA 4I62A 2AL4A 3CI8A 3QAXA 4N6KA 1SPIA 3PPNA 4M1VA 4L17A 4AS5A 3PU5A 3LUYA 2OX3A 3MW0A 4GQOA 4IY5A 3CFZA 3MZ1A 4ZECA 4QHQA 4MF3A 1A40A 2ZYNA 1SBPA 3M8UA 5M2VA 2KR0A 3VXBA 4U1ZA 4F3GA 2X7QA 1EZ9A 3O2AA 1I6QA 4DDDA 3A3CA 4EXLA 3FXUA 2DVZA 4PTKA 1G0HA 1P1NA 5J16A 2ZYKA 4RPNA 1SW1A 1ANFA 1LAFE 3FATA 4FEBA 1I6AA 3LUZA 1FTJA 2RINA 1MPDA 1NMUA 4G68B 1N04A 4MNIA 3MWBA 1FBDA 2HQ0A 2GRVA 3LC8A 1FPKA 2DSFA 3FJGA 1NH7A 2YLNA 3OOAA 5HBCA 5I56A 1RDZA 4P11A 3OENA 4DXUA 3K2DA 4PF8A 4IO5A 4C0RA 3P7IA 1ZKBA 1BP5A 4DI3D 2NWJA 4DCXA 1JEVA 4LQ2A 3FV2A 5AA4B 1Y1ZA 3QXMA 5L9SA 1MY1A 5I59B 2FIXA 2XX8A 4YB6A 5EHSA 3B50A 2OJTA 2Z23A 1NV5A 4U1OA 1QUIA 5FBPA 5IGAA 3T93B 3FUZA 4PE3A 4OFLA 1MDP1 2DOJA 3WAEA 2QRYA 1DPEA 2QJEA 2F3BA 2A5TA 3UGWA 4XKQA 1MG1A 4O8MA 1SW4A 3GBAA 1UTHA 4G77A 5LDZA 2I6EA 3SZPA 1Y3NA 1SI0A 3IB1A 1ZTYA 1H3DA 3H6VA 3OO6A 3USDA 4GBWA 4RXLA 1FRPA 1LEVA 1HSEA 3UK4A 4EQ9A 3RLFE 2XXQA 4GWUA 3SEVA 4P0IA 3PD9A 4PAIA 3H03A 4U4XA 2I4BA 3N5LA 3RT6B 2XXWA 1N7WA 3TEPA 2QS1A 2DQVA 3OELA 5KCJA 3S9LC 3FJ7A 4XKPA 1A99A 1MXYA 1TWYA 3C31A 2XXHA 3R6UA 1PB7A 2XWOA 5FTHA 2IA4A 4ELQA 4YKPA 3EPEA 5JTYB 3CHGA 1FQCA 1H43A 3VVDA 1QW0A 3H4ZA 2A5SA 2CMOA 3T9HB 3MSTA 4GXSB 3ILTB 4RK9A 4GWOA 3CVGA 5ELVA 4IR8A 5I56B 5L9OA 5B70A 1FBFA 3FZVA 5AA3A 1Y4CA 2AIXA 3K6UA 1D9VA 1MQDA 4R73A 4UABA 2DWJA 2WBBA 3QIMA 2OK2A 1IXCA 4H45A 4PGNA 3G7WA 3E13X 4KFQA 3O6HA 1SI1A 2NXOA 2PVUA 4EF1A 1RDYA 4QRZA 4EUOA 3ILUB 3TUSA 1B51A 1D9YA 1DPPA 2G29A 1FSAA 2R71A 3C34A 1M5EA 1JW5A 5I2KB 2O7IA 3SDFA 3MVXA 3OEKA 1O63A 4XXUA 1LBXA 4H5GA 3EHTA 3KOSA 3VFJA 3D4GA 3N6UA 3TTLA 4QXDA 3RY3A 1VE4A 2E0SA 3FD3A 2RF1A 4F3BA 1YPNA 1S9TA 2HAUA 3DM0A 2HCAA 2ZZWA 2JJKA 4TOZA 3VXCA 4F18A 3IAZA 1P1QA 2I0BA 3I6VA 1II5A 4IGTA 4ND9A 1Q9DA 2XXVA 3VLVA 2Y7RA 4IY6A 2Z8EA 3IOWA 4ZEIA 2E1SA 1Q1KA 5KCJB 4O94A 1INPA 1MY2A 4UA8A 3LSLA 2GHBA 3IB0A 3ISPA 2PT1A 1P99A 3AXFA 4DE8A 3T22A 3CSBA 2QSXA 4PDHA 1EH3A 3FVNA 3A29A 1IMDA 2D5WA 4GF8A 1LBCA 4MLQA 3S4UA 1XC1A 3K01A 1PEBA 2OWZA 3SKPA 2RC8A 3KBZA 3W15C 2QS2A 1ZBMA 2XA5A 4KHZE 4I40A 5DT6A 3TCGA 1P1UA 4GVOA 3FVKA 2HAVA 4KQPA 2P3VA 4I1DA 4N91A 1DTZA 2Y5LA 1KWHA 2Y5KA 3OO7A 4OVSA 4OVJA 3FGSA 1US5A 4OFOA 2THIA 1O7TA 2WBDA 3G3JA 3U94A 1TXFA 1B0LA 1EZOA 1A54A 4OWDA 3FIRA 4ZE8A 5L8DA 1B3HA 3MBPA 2ZNTA 4POWA 1FPLA 4GLIA 3V8XB 4E0XA 4M4GA 2ZNSA 1M5CA 1QVSA 2Q8MA 3ZSFA 4F3SA 1A55A 4GL0A 1ZU0A 3C35A 4RNSA 4ESWA 2Q88A 1H45A 5EQ9A 4JSOA 2F36A 1HSLA 4PFBA 3RGYA 4MMPA 4GX3A 4K3FA 4Q5TA 1GVCA 5I57A 3K1PA 5I58A 3SEWA 2ZYMA 1MM7A 2F8DA 3G3GA 2Z8FA 4GBVA 2ABHA 2UYFA 5A5XA 4R6KA 1FCKA 3PUXE 1QKAA 4N17A 3V5AA 4YMAA 5DVFA 1MQHA 1N0TA 1Y9UA 4TLMB 3H6WA 1FPEA 4NF4B 4H0WA 1TFAA 3U93A 5CC2A 1QGXA 4LN5A 4LVQA 5IM2A 4ZE9A 4F2OA 2Q9TA 1NL5A 3ONMA 1FQFA 1EYKA 2F7CA 3TCHA 1URSA 1NV0A 3GLBA 2PBWA 5F1QA 1DBZA 2VT5A 1VDWA 3WAFA 4ZEFA 5L9MA 5LTCA 1JW1A 1OQHA 4LZ8A 3KC1A 4KYDA 4QSCA 2AYSA 1Z7NE 2Y7PA 4X48A 5DVJA 5DYHA 1CNQA 4G2ZA 4KI0E 2FA7A 4G8HA 1B52A 1SD3A 4RK2A 1JEUA 4LATA 2OBGA 1Y4TA 3K1MA 3CFLA 5J1DA 1NV4A 4FAJA 4G68A 4ONYA 3MP6A 1JETA 4JXIA 2YPNA 1G0IA 5DEXB 2ZZVA 2VD3A 3IJXB 1M5DA 1VR5A 4N6DA 5I84A 2B4MA 2Q89A 2F35A 2V93A 3MVZA 4QSEA 3KZGA 1L5TA 2ZXTA 4GL8A 5F7VA 3JYRA 1B0HA 4N07A 3SEYA 1Y3QA 4O3BA 3TELA 2DDKA 2HZLA 2VPNA 3C33A 5I57B 4F2QA 3HO7A 1FQDA 2CEYA 5I58B 1QKBA 3GXAA 1NV7A 2F97A 2Z8DA 5EYFA 4OTEA 3OD7A 3IOTA 2F6GA 3W9WA 1H44A 3TYHA 1SW5A 1XVYA 1B7HA 2XWVA 3D4CA 3MPKA 3E3KA 3BBRA 2GHAA 1NKXA 1LSTA 3MVYA 5T3JA 2Q74A 3FJMA 1FQAA 1NV2A 2NOOA 4BDNA 3TTNA 5ICTA 2QMWA 3VLUA 3K6XA 1MH4A 2D3IA 4GFRA 4LZ5A 1SDXA 3B6QA 4NF5B 1K9ZA 4DI4B 1FTOA 4MH5A 3L6HA 1R6ZA 2QPQA 4PFTA 4F19A 3O66A 4PAKA 2KLFA 4OFJA 1FBCA 2GFEA 2DWIA 1JVXA 3ROJA 2QMXA 3E4RA 4OENA 3VVFA 3Q28A 4O7IA 1XI6A 2DE4A 1DCUA 2W7YA 1UTBB 2P0SA 4IO3A 4MEVA 2WEFA 4N13A 3RPLA 3RUMA 3LSXA 5JTYA 3EKIA 2Z22A 1B3LA 4LUBA 1D9QA 5EQAA 2V84A 2O68A 2VOZA 2XWIA 1MY3A 4JWYA 1SYHA 3TQLA 2YJPA 4P0GA 4PFIA 3KOTA 3MAMA 5AA2B 1A8EA 3IOVA 2OCUA 4LP2B 4NTLA 4ZS9A 5ITPA 1NUZA 2I3VA 1IUDA 4OEVA 4MAGA 1LBYA 4OVQA 1Y20A 4IGRA 1B7UA 3MJNA 5I3SA 4AB5A 4P47A 3EF7A 2DVCA 2FNCA 5CMMA 2PT2A 2MKZA 5I2KA 3PMXA 5CBSA 3L6GA 3G3FA 3QSLA 2PFZA 4XIGQ 3K6VA 2AL5A 2VP1A 3T9XB 4TQUQ 4G8NA 4NMYA 1MQJA 4FATA 3ODBA 1AIVA 1DSNA 1HSJA 1MQGA 2P1SA 4YB5A 5K2XA 4H67A 4ELOA 1UQWA 4PDDA 2UVIA 2I58A 3OO8A 2HHMA 4QFLA 4G68C 2FVZA 4BDLA 1IMBA 2Y84A 2BJJX 4GIZA 4C1UA 4NE4A 3QMFA 4HE1A 3Q29A 1XHYA 2M8CA 1WVJA 2RCAA 5CMCA 1B6HA 2PX1A 5ET6A 3RPLB 3U1OA 5CRYA 2UVJA 5IAIA 4N81A 3QK6A 3OMBA 1BLFA 3UORA 4FORA 3C9HA 2DP8A 4JVDA 1ELJA 3E79A 3C36A 1USYE 4KYEA
chains in the Genus database with same CATH topology
1IEJA 4HTGA 1IXIA 3B6TA 3O28A 1JVYA 3H3GA 3ZKLA 1LAGE 4BLAA 4FE8A 2OLBA 4HCWA 4U21A 4JBZA 1MXZA 1OVBA 2VD2A 4ZZEA 4OEUA 4KYSA 1H76A 3HCQA 3KJ7A 4OYVA 2NUVA 1JW4A 3CRBA 3GZGA 4WXJA 4ELPA 2OWSA 2V3TA 3RQTA 5AA2D 4ISUA 4AB6A 3LSWA 2XD3A 2REGA 2NVUB 4YU0A 4UACA 3PMVA 1NNKA 4PQJA 1UIVA 4EQ7A 4IO2A 3Q26A 2VHAA 1S50A 3PPQA 3V83A 4KPTA 2F7BA 3DP6A 4IO7A 2ONRA 5KDTB 2IEEA 4NF4A 4BDOA 2I4CA 4R2FA 3TAJA 4HCYA 1B05A 3R26A 5FHMA 3RN8A 3UP9A 3MP8A 1ZMGA 1IQ7A 3PV0E 2XHDA 3W9VA 3H6TA 3OO9A 1D3KA 3O9PA 3E9XA 1GTKA 3SETA 1MXUA 4KD5A 2REJA 1FQEA 1D4NA 3PUWE 4JWOA 3VVEA 1RKMA 5DVIA 1MRPA 1QUKA 3QUJA 2DWAA 3LR1A 4RPOA 1I69A 4I9DA 5H8NB 4G8MA 4OERA 1OVTA 3T96B 4DZ1A 1FTKA 4EF2A 4R75A 3CIJA 1IIWA 2F34A 4YKJA 4R72A 1LFGA 5DEXA 3HN0A 4U4SA 3UA8A 3PD8A 3PUVE 1SQYA 5AE4A 3OSRA 3PGFA 3K02A 3OXNA 3THIA 5CBRA 3BFTA 1PC3A 3VE1B 4YKKA 2UVHA 4RJZA 1LLSA 1MXWA 4YKIA 1MQIA 4H65A 3C32A 2I0CA 3BKIB 3S9NC 1LCFA 4NEDA 4JB7A 3S9EA 1MXXA 4MBPA 2F7AA 3O97A 2HZKA 1LB9A 3VV5A 2Y7IA 3EN3A 5ITOA 3PMWA 5JEIA 1LFIA 1LFHA 4R9FA 1B3GA 1ZJLA 4KR5A 4BDRA 3B6WA 4NF5A 3EHUA 3EHSA 5AA1A 3QUFA 4ZDMA 2DWHA 2H9BA 4WEPA 3O29A 4NF6B 3KJTA 3HHGA 1UTBA 4QFKA 4ESXA 1VFEA 1IXHA 4ELRA 4JWXA 2VGQA 1URDA 2F6PA 1M5BA 1I6BA 3H6UA 3U8QA 1YTVA 3K4UA 5LOMA 2H99A 4BDQA 2O1MA 1B5IA 4OZ9A 3CG3A 4QFNA 1B1HA 4H8JA 5AA2A 3TFLA 1EZPA 3DELB 4LZ7A 3I5OA 1AH5A 3RT8A 3M3KA 1MS7A 5HPQA 3H06B 1VFDA 1OLAA 1POTA 1LB8A 2OZZA 4POXA 4Z7EA 2QS4A 1B7ZA 2DE3A 4F22A 2ANJA 1PDAA 1RYXA 4C1TA 1LCTA 1DMBA 3S9MC 5B7DA 2QS3A 4ZEDA 2O51A 3K00A 4OQOA 4R6YA 5H8QB 2Q8JA 1P1WA 4XKNA 1J1NA 1YAEA 5EHMA 4R74A 3TQWA 3O6IA 1B2HA 4YB7A 3IO4A 3F11A 2XXRA 4PFUA 3U92A 5CMKA 3LSFB 5TP9B 4LONB 3R7XA 4G4PA 2FYIA 3PUYE 1OMPA 3TDJA 4H5FA 5FHNA 1AL3A 1Y3PA 3FASA 4IO6A 3JZJA 1WDNA 1NFTA 1M5FA 1N3XA 3DP8A 3T66A 2D21A 4F3PA 1N7XA 4WEDA 5BWJA 3IL1B 2ONKE 4PE5B 4H6DA 1AOVA 3UN6A 2V3UA 3A09A 3MQ9A 1FTLA 1UIUA 1CB6A 3GBBA 4R6HA 4KCDA 1BTJA 4NF8A 5HM4B 1PBQA 3Q27A 3TPAA 1SW2A 3KN8A 5TPAB 1B3EA 4H1XA 1S7YA 1B1XA 4ZZAA 4JSDA 3RNNA 4THIA 3TMGA 4WKMA 3KBRA 1R1NA 3MC2A 3B7DA 3EQ1A 3IO6A 4PFWA 4FIMA 3N26A 2UXAA 2H4IA 3VDFA 1Q35A 2HXWA 1YCJA 4N6PA 5I2NA 1MH3A 1EU8A 1R9LA 1MY0A 2R6GE 3G3IA 3MPLA 1T0KA 4YAHX 2XXTA 1B4ZA 3HV1A 1ZIUA 4X1DA 1GV8A 2R9JA 3V89B 2UVGA 4DXCA 1B32A 4F39A 4O3AA 3PPRA 2P2AA 4DIGA 2X26A 4DCYA 2ZYOA 4PFYA 2I49A 5KDTA 3K6WA 5DTBA 3TODA 2DYXA 4IO4A 1DTGA 4O3CA 1GR2A 1GGGA 2Y7WA 1B3FA 1AMFA 1OLCA 1Z7ME 4DLDA 2XX9A 3TTMA 3IOUA 2B3FA 2LAOA 4NF8B 3FVGA 3IORA 5H8HA 3OSQA 1TT1A 1NNFA 4R2BA 4GXAA 1N76A 4AQ4A 1P1OA 1FQBA 5H8NA 5CMBA 2ALUA 3RPWA 2O84X 3CFXA 3O6GA 3UIFA 4FEDA 4HW8A 4F29A 3RTFB 4OMBA 3U72A 5ISUA 4F1YA 3SESA 3Q25A 1MM6A 1LAHE 5I2NB 2F5XA 1A8FA 3MP1A 4RA1A 3CR9A 4EDPA 3K0VA 3PPOA 2B65A 2ESNA 2PMSA 5BUUA 1IXGA 2A5TB 2ZMBA 1OQGA 4QSDA 1NNTA 4E0WA 1MXVA 4OETA 1IITA 3T9UA 1UTHB 1XS5A 2O6AA 3KN7A 4DXBA 2RCBA 2XXIA 4GRKA 3KN3A 1NH8A 1WODA 3KSXA 1O64A 2B3BA 3ZS6A 4HS7A 1JNFA 1Y1MA 4QFPA 4TLLB 1B4HA 2XXXA 1RYOA 4QFOA 1POY1 2WKYA 4GOTA 4YZZA 3TTKA 3KSJA 3SERA 3FV1A 3G3KA 2I48A 4Q0CA 3IK6B 3CSGA 2DS9A 2V3QA 4MLVA 4U2RA 5H8HB 1R9QA 4NF6A 3ECRA 1NNPA 1MPCA 4QF9A 4X1BA 1F9BA 1LAXA 1XVXA 4PETA 4F1UA 2GH9A 2XX7A 5FHOA 2ZNUA 3MVWA 3ZKKA 2XD2A 2O69A 1FTMA 3TKDA 4U23A 4PP0A 2H98A 1MPBA 3IB2A 3SEXA 2DE2A 4LQ5A 3MUQA 1LGBC 4Q8RA 4NWDA 3FXRA 3H7MA 2O1LA 2OWTA 1BKAA 5H8FA 3IX1A 2V25A 4XTCQ 3QYTA 3FXQA 3KEIA 1DOTA 1XOCA 2X7PA 4LA9A 3M3LA 4JDFA 2H25A 2PYYA 5TU0A 3I3VA 1B46A 1QULA 3HSTA 4MFIA 4ZEKA 3PPPA 3KFMA 1LBBA 2HFBA 2I3WA 4XKRA 5FTIA 4IB2A 2Y7KA 1URGA 5H8QA 1USYH 3N94A 4YMBA 3LBSA 2CZLA 1B5JA 1B58A 4BDMA 1B40A 1VSOA 4FJPA 1JQFA 3K1NA 3RTWB 4Q30B 5TP9A 2UYEA 3C4MA 4FECA 1B5HA 1ATGA 4OHNA 2O7UA 5JK4A 1IZ1A 4I8CA 2DXYA 1TFDA 1SVXB 3BFUA 3MZ9A 2H5YA 2Q2CA 5CM6A 2HEUA 3T9VA 3KGCA 1US4A 1QJMA 3CG1A 2XXUA 4EQBA 5IKBA 3DP4A 1PB8A 1SYIA 3PUZE 1FW0A 3VLWA 1PBPA 2RC7A 4GD5A 1N3WA 4X9TA 3HPIA 1OIBA 2XXPA 3G3HA 3S2VA 1PB9A 4Z0IA 4KCCA 1BIYA 3TZAA 1ZLQA 2RC9A 3HHFA 3MZBA 1MY4A 5TPAA 4YICA 1XT8A 1B9JA 3JV9A 5H8FB 1QUJA 4ECFA 4NWCA 1N84A 3M3FA 3OEMA 4F31B 3IR1A 4OXVA 2DXRA 5KZTA 2QL3A 4ZEBA 2Q2AA 5AA4A 4R9GA 5I59A 4F1VA 3TTRA 3IJOB 3SEUA 5CI5A 3FVOA 4EXKA 2ONSA 4RY1A 5H8SA 1A7LA 5K2YA 2XXYA 3N6TA 4H8IA 4OESA 5ICQA 1MDQA 3TCFA 5A5XB 2G93A 4U22A 2RKMA 3KG2A 3A3UA 1CE2A 2F78A 4RYAA 4I62A 2AL4A 3CI8A 3QAXA 3PPNA 4M1VA 4L17A 3PU5A 3LUYA 3MW0A 4GQOA 4IY5A 3CFZA 3MZ1A 4ZECA 4QHQA 4MF3A 1A40A 2ZYNA 1SBPA 3M8UA 5M2VA 3VXBA 4U1ZA 4F3GA 2X7QA 1EZ9A 3O2AA 1I6QA 4DDDA 3A3CA 4EXLA 3FXUA 2DVZA 1P1NA 2ZYKA 4RPNA 1SW1A 1ANFA 1LAFE 3FATA 4FEBA 1I6AA 1FTJA 2RINA 1MPDA 1NMUA 4G68B 1N04A 3MWBA 2HQ0A 2GRVA 3LC8A 2DSFA 3FJGA 1NH7A 2YLNA 3OOAA 5HBCA 5I56A 4P11A 3OENA 4DXUA 3K2DA 4IO5A 4C0RA 3P7IA 1ZKBA 1BP5A 2NWJA 4DCXA 1JEVA 4LQ2A 3FV2A 5AA4B 1Y1ZA 3QXMA 5L9SA 1MY1A 5I59B 2XX8A 4YB6A 5EHSA 2OJTA 2Z23A 4U1OA 1QUIA 3T93B 3FUZA 4OFLA 1MDP1 2DOJA 3WAEA 2QRYA 1DPEA 2QJEA 2A5TA 3UGWA 4XKQA 1MG1A 1SW4A 3GBAA 1UTHA 4G77A 2I6EA 1Y3NA 1SI0A 3IB1A 1ZTYA 1H3DA 3H6VA 3OO6A 3USDA 4RXLA 1HSEA 3UK4A 4EQ9A 3RLFE 2XXQA 3SEVA 4P0IA 3PD9A 3H03A 4U4XA 2I4BA 3N5LA 3RT6B 2XXWA 1N7WA 3TEPA 2QS1A 2DQVA 3OELA 5KCJA 3S9LC 3FJ7A 4XKPA 1A99A 1MXYA 1TWYA 3C31A 2XXHA 3R6UA 1PB7A 5FTHA 2IA4A 4ELQA 4YKPA 3EPEA 5JTYB 1FQCA 1H43A 3VVDA 1QW0A 3H4ZA 2A5SA 2CMOA 3T9HB 4GXSB 3ILTB 4RK9A 4GWOA 3CVGA 5ELVA 5I56B 5L9OA 5B70A 3FZVA 5AA3A 1Y4CA 2AIXA 3K6UA 1D9VA 1MQDA 4R73A 2DWJA 3QIMA 2OK2A 1IXCA 3G7WA 3E13X 4KFQA 3O6HA 1SI1A 2NXOA 2PVUA 4EF1A 4QRZA 4EUOA 3ILUB 3TUSA 1B51A 1D9YA 1DPPA 2G29A 2R71A 3C34A 1M5EA 1JW5A 5I2KB 2O7IA 3SDFA 3MVXA 3OEKA 1O63A 4XXUA 4H5GA 3EHTA 3KOSA 3VFJA 3D4GA 3N6UA 3TTLA 3RY3A 1VE4A 2E0SA 3FD3A 2RF1A 4F3BA 1YPNA 1S9TA 2HAUA 3DM0A 2HCAA 4TOZA 3VXCA 4F18A 3IAZA 1P1QA 2I0BA 3I6VA 1II5A 4IGTA 4ND9A 2XXVA 3VLVA 2Y7RA 4IY6A 2Z8EA 3IOWA 4ZEIA 2E1SA 1Q1KA 5KCJB 1MY2A 4UA8A 3LSLA 2GHBA 3IB0A 2PT1A 1P99A 3AXFA 4DE8A 3T22A 3CSBA 2QSXA 1EH3A 3FVNA 2D5WA 4GF8A 1LBCA 4MLQA 3S4UA 1XC1A 3K01A 1PEBA 3SKPA 2RC8A 3W15C 2QS2A 1ZBMA 4KHZE 5DT6A 3TCGA 1P1UA 4GVOA 3FVKA 2HAVA 4KQPA 4I1DA 1DTZA 1KWHA 3OO7A 4OVJA 3FGSA 1US5A 4OFOA 2THIA 1O7TA 3G3JA 3U94A 1TXFA 1B0LA 1EZOA 1A54A 4OWDA 3FIRA 4ZE8A 5L8DA 1B3HA 3MBPA 2ZNTA 4POWA 4GLIA 3V8XB 4E0XA 4M4GA 2ZNSA 1M5CA 1QVSA 3ZSFA 4F3SA 1A55A 4GL0A 1ZU0A 3C35A 4RNSA 4ESWA 2Q88A 1H45A 4JSOA 2F36A 1HSLA 3RGYA 4K3FA 4Q5TA 1GVCA 5I57A 3K1PA 5I58A 3SEWA 2ZYMA 1MM7A 2F8DA 3G3GA 2Z8FA 2ABHA 2UYFA 5A5XA 4R6KA 1FCKA 3PUXE 1QKAA 3V5AA 4YMAA 5DVFA 1MQHA 1N0TA 1Y9UA 4TLMB 3H6WA 4NF4B 4H0WA 1TFAA 3U93A 5CC2A 4LVQA 4ZE9A 4F2OA 1USYE 2Q9TA 1NL5A 3ONMA 1FQFA 2F7CA 3TCHA 1URSA 3GLBA 2PBWA 5F1QA 3WAFA 4ZEFA 5L9MA 1JW1A 1OQHA 4LZ8A 4KYDA 4QSCA 2AYSA 1Z7NE 2Y7PA 4X48A 5DVJA 5DYHA 4G2ZA 4KI0E 2FA7A 4G8HA 1B52A 1SD3A 4RK2A 1JEUA 4LATA 2OBGA 1Y4TA 3K1MA 3CFLA 5J1DA 4FAJA 4G68A 4ONYA 3MP6A 1JETA 4JXIA 2YPNA 5DEXB 2VD3A 3IJXB 1M5DA 1VR5A 5I84A 2Q89A 2F35A 2V93A 3MVZA 4QSEA 3KZGA 1L5TA 2ZXTA 4GL8A 5F7VA 3JYRA 1B0HA 4N07A 3SEYA 1Y3QA 4O3BA 3TELA 2HZLA 3C33A 5I57B 4F2QA 3HO7A 1FQDA 5I58B 1QKBA 3GXAA 2F97A 2Z8DA 5EYFA 4OTEA 3OD7A 3IOTA 2F6GA 3W9WA 1H44A 3TYHA 1SW5A 1XVYA 1B7HA 3D4CA 3MPKA 3E3KA 3BBRA 2GHAA 1NKXA 1LSTA 3MVYA 3FJMA 1FQAA 4BDNA 2NOOA 3TTNA 5ICTA 2QMWA 3VLUA 3K6XA 1MH4A 2D3IA 4GFRA 4LZ5A 1SDXA 3B6QA 4NF5B 1FTOA 4MH5A 3L6HA 1R6ZA 2QPQA 4PFTA 4F19A 3O66A 2KLFA 4OFJA 2GFEA 2DWIA 1JVXA 2QMXA 3E4RA 4OENA 3VVFA 3Q28A 2DE4A 2W7YA 1UTBB 2P0SA 4IO3A 4N13A 3RUMA 3LSXA 5JTYA 2Z22A 1B3LA 4LUBA 2V84A 2O68A 2VOZA 1MY3A 4JWYA 1SYHA 3TQLA 2YJPA 4P0GA 3KOTA 3MAMA 5AA2B 1A8EA 3IOVA 2OCUA 4LP2B 4NTLA 4ZS9A 5ITPA 2I3VA 1IUDA 4OEVA 1Y20A 4IGRA 1B7UA 3MJNA 4AB5A 3EF7A 2DVCA 2FNCA 5CMMA 2PT2A 5I2KA 3PMXA 5CBSA 3L6GA 3G3FA 3QSLA 4XIGQ 3K6VA 2AL5A 2VP1A 3T9XB 4TQUQ 4G8NA 4NMYA 1MQJA 4FATA 3ODBA 1AIVA 1DSNA 1HSJA 1MQGA 2P1SA 4YB5A 5K2XA 4H67A 4ELOA 1UQWA 2UVIA 2I58A 3OO8A 4QFLA 4G68C 4BDLA 2Y84A 2BJJX 4GIZA 4C1UA 4NE4A 3Q29A 1XHYA 2M8CA 1WVJA 2RCAA 5CMCA 1B6HA 2PX1A 3U1OA 5CRYA 2UVJA 5IAIA 3QK6A 3OMBA 1BLFA 3UORA 4FORA 3C9HA 2DP8A 1ELJA 3C36A 3DLNA 4KYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IEJ A;  4HTG A;  1IXI A;  3B6T A;  3O28 A;  1JVY A;  3H3G A;  3ZKL A;  1LAG E;  4BLA A;  4FE8 A;  2OLB A;  4HCW A;  4U21 A;  4JBZ A;  1MXZ A;  1OVB A;  2VD2 A;  4ZZE A;  4OEU A;  4KYS A;  1H76 A;  3HCQ A;  3KJ7 A;  4OYV A;  2NUV A;  1JW4 A;  3CRB A;  3GZG A;  4WXJ A;  4ELP A;  2OWS A;  2V3T A;  3RQT A;  5AA2 D;  4ISU A;  4AB6 A;  3LSW A;  2XD3 A;  2REG A;  2NVU B;  4YU0 A;  4UAC A;  3PMV A;  1NNK A;  4PQJ A;  1UIV A;  4EQ7 A;  4IO2 A;  3Q26 A;  2VHA A;  1S50 A;  3PPQ A;  3V83 A;  4KPT A;  2F7B A;  3DP6 A;  4IO7 A;  2ONR A;  5KDT B;  2IEE A;  4NF4 A;  4BDO A;  2I4C A;  4R2F A;  3TAJ A;  4HCY A;  1B05 A;  3R26 A;  5FHM A;  3RN8 A;  3UP9 A;  3MP8 A;  1ZMG A;  1IQ7 A;  3PV0 E;  2XHD A;  3W9V A;  3H6T A;  3OO9 A;  1D3K A;  3O9P A;  3E9X A;  1GTK A;  3SET A;  1MXU A;  4KD5 A;  2REJ A;  1FQE A;  1D4N A;  3PUW E;  4JWO A;  3VVE A;  1RKM A;  5DVI A;  1MRP A;  1QUK A;  3QUJ A;  2DWA A;  3LR1 A;  4RPO A;  1I69 A;  4I9D A;  5H8N B;  4G8M A;  4OER A;  1OVT A;  3T96 B;  4DZ1 A;  1FTK A;  4EF2 A;  4R75 A;  3CIJ A;  1IIW A;  2F34 A;  4YKJ A;  4R72 A;  1LFG A;  5DEX A;  3HN0 A;  4U4S A;  3UA8 A;  3PD8 A;  3PUV E;  1SQY A;  5AE4 A;  3OSR A;  3PGF A;  3K02 A;  3OXN A;  3THI A;  5CBR A;  3BFT A;  1PC3 A;  3VE1 B;  4YKK A;  2UVH A;  4RJZ A;  1LLS A;  1MXW A;  4YKI A;  1MQI A;  4H65 A;  3C32 A;  2I0C A;  3BKI B;  3S9N C;  1LCF A;  4NED A;  4JB7 A;  3S9E A;  1MXX A;  4MBP A;  2F7A A;  3O97 A;  2HZK A;  1LB9 A;  3VV5 A;  2Y7I A;  3EN3 A;  5ITO A;  3PMW A;  5JEI A;  1LFI A;  1LFH A;  4R9F A;  1B3G A;  1ZJL A;  4KR5 A;  4BDR A;  3B6W A;  4NF5 A;  3EHU A;  3EHS A;  5AA1 A;  3QUF A;  4ZDM A;  2DWH A;  2H9B A;  4WEP A;  3O29 A;  4NF6 B;  3KJT A;  3HHG A;  1UTB A;  4QFK A;  4ESX A;  1VFE A;  1IXH A;  4ELR A;  4JWX A;  2VGQ A;  1URD A;  2F6P A;  1M5B A;  1I6B A;  3H6U A;  3U8Q A;  1YTV A;  3K4U A;  5LOM A;  2H99 A;  4BDQ A;  2O1M A;  1B5I A;  4OZ9 A;  3CG3 A;  4QFN A;  1B1H A;  4H8J A;  5AA2 A;  3TFL A;  1EZP A;  3DEL B;  4LZ7 A;  3I5O A;  1AH5 A;  3RT8 A;  3M3K A;  1MS7 A;  5HPQ A;  3H06 B;  1VFD A;  1OLA A;  1POT A;  1LB8 A;  2OZZ A;  4POX A;  4Z7E A;  2QS4 A;  1B7Z A;  2DE3 A;  4F22 A;  2ANJ A;  1PDA A;  1RYX A;  4C1T A;  1LCT A;  1DMB A;  3S9M C;  5B7D A;  2QS3 A;  4ZED A;  2O51 A;  3K00 A;  4OQO A;  4R6Y A;  5H8Q B;  2Q8J A;  1P1W A;  4XKN A;  1J1N A;  1YAE A;  5EHM A;  4R74 A;  3TQW A;  3O6I A;  1B2H A;  4YB7 A;  3IO4 A;  3F11 A;  2XXR A;  4PFU A;  3U92 A;  5CMK A;  3LSF B;  5TP9 B;  4LON B;  3R7X A;  4G4P A;  2FYI A;  3PUY E;  1OMP A;  3TDJ A;  4H5F A;  5FHN A;  1AL3 A;  1Y3P A;  3FAS A;  4IO6 A;  3JZJ A;  1WDN A;  1NFT A;  1M5F A;  1N3X A;  3DP8 A;  3T66 A;  2D21 A;  4F3P A;  1N7X A;  4WED A;  5BWJ A;  3IL1 B;  2ONK E;  4PE5 B;  4H6D A;  1AOV A;  3UN6 A;  2V3U A;  3A09 A;  3MQ9 A;  1FTL A;  1UIU A;  1CB6 A;  3GBB A;  4R6H A;  4KCD A;  1BTJ A;  4NF8 A;  5HM4 B;  1PBQ A;  3Q27 A;  3TPA A;  1SW2 A;  3KN8 A;  5TPA B;  1B3E A;  4H1X A;  1S7Y A;  1B1X A;  4ZZA A;  4JSD A;  3RNN A;  4THI A;  3TMG A;  4WKM A;  3KBR A;  1R1N A;  3MC2 A;  3B7D A;  3EQ1 A;  3IO6 A;  4PFW A;  4FIM A;  3N26 A;  2UXA A;  2H4I A;  3VDF A;  1Q35 A;  2HXW A;  1YCJ A;  4N6P A;  5I2N A;  1MH3 A;  1EU8 A;  1R9L A;  1MY0 A;  2R6G E;  3G3I A;  3MPL A;  1T0K A;  4YAH X;  2XXT A;  1B4Z A;  3HV1 A;  1ZIU A;  4X1D A;  1GV8 A;  2R9J A;  3V89 B;  2UVG A;  4DXC A;  1B32 A;  4F39 A;  4O3A A;  3PPR A;  2P2A A;  4DIG A;  2X26 A;  4DCY A;  2ZYO A;  4PFY A;  2I49 A;  5KDT A;  3K6W A;  5DTB A;  3TOD A;  2DYX A;  4IO4 A;  1DTG A;  4O3C A;  1GR2 A;  1GGG A;  2Y7W A;  1B3F A;  1AMF A;  1OLC A;  1Z7M E;  4DLD A;  2XX9 A;  3TTM A;  3IOU A;  2B3F A;  2LAO A;  4NF8 B;  3FVG A;  3IOR A;  5H8H A;  3OSQ A;  1TT1 A;  1NNF A;  4R2B A;  4GXA A;  1N76 A;  4AQ4 A;  1P1O A;  1FQB A;  5H8N A;  5CMB A;  2ALU A;  3RPW A;  2O84 X;  3CFX A;  3O6G A;  3UIF A;  4FED A;  4HW8 A;  4F29 A;  3RTF B;  4OMB A;  3U72 A;  5ISU A;  4F1Y A;  3SES A;  3Q25 A;  1MM6 A;  1LAH E;  5I2N B;  2F5X A;  1A8F A;  3MP1 A;  4RA1 A;  3CR9 A;  4EDP A;  3K0V A;  3PPO A;  2B65 A;  2ESN A;  2PMS A;  5BUU A;  1IXG A;  2A5T B;  2ZMB A;  1OQG A;  4QSD A;  1NNT A;  4E0W A;  1MXV A;  4OET A;  1IIT A;  3T9U A;  1UTH B;  1XS5 A;  2O6A A;  3KN7 A;  4DXB A;  2RCB A;  2XXI A;  4GRK A;  3KN3 A;  1NH8 A;  1WOD A;  3KSX A;  1O64 A;  2B3B A;  3ZS6 A;  4HS7 A;  1JNF A;  1Y1M A;  4QFP A;  4TLL B;  1B4H A;  2XXX A;  1RYO A;  4QFO A;  1POY 1;  2WKY A;  4GOT A;  4YZZ A;  3TTK A;  3KSJ A;  3SER A;  3FV1 A;  3G3K A;  2I48 A;  4Q0C A;  3IK6 B;  3CSG A;  2DS9 A;  2V3Q A;  4MLV A;  4U2R A;  5H8H B;  1R9Q A;  4NF6 A;  3ECR A;  1NNP A;  1MPC A;  4QF9 A;  4X1B A;  1F9B A;  1LAX A;  1XVX A;  4PET A;  4F1U A;  2GH9 A;  2XX7 A;  5FHO A;  2ZNU A;  3MVW A;  3ZKK A;  2XD2 A;  2O69 A;  1FTM A;  3TKD A;  4U23 A;  4PP0 A;  2H98 A;  1MPB A;  3IB2 A;  3SEX A;  2DE2 A;  4LQ5 A;  3MUQ A;  1LGB C;  4Q8R A;  4NWD A;  3FXR A;  3H7M A;  2O1L A;  2OWT A;  1BKA A;  5H8F A;  3IX1 A;  2V25 A;  4XTC Q;  3QYT A;  3FXQ A;  3KEI A;  1DOT A;  1XOC A;  2X7P A;  4LA9 A;  3M3L A;  4JDF A;  2H25 A;  2PYY A;  5TU0 A;  3I3V A;  1B46 A;  1QUL A;  3HST A;  4MFI A;  4ZEK A;  3PPP A;  3KFM A;  1LBB A;  2HFB A;  2I3W A;  4XKR A;  5FTI A;  4IB2 A;  2Y7K A;  1URG A;  5H8Q A;  1USY H;  3N94 A;  4YMB A;  3LBS A;  2CZL A;  1B5J A;  1B58 A;  4BDM A;  1B40 A;  1VSO A;  4FJP A;  1JQF A;  3K1N A;  3RTW B;  4Q30 B;  5TP9 A;  2UYE A;  3C4M A;  4FEC A;  1B5H A;  1ATG A;  4OHN A;  2O7U A;  5JK4 A;  1IZ1 A;  4I8C A;  2DXY A;  1TFD A;  1SVX B;  3BFU A;  3MZ9 A;  2H5Y A;  2Q2C A;  5CM6 A;  2HEU A;  3T9V A;  3KGC A;  1US4 A;  1QJM A;  3CG1 A;  2XXU A;  4EQB A;  5IKB A;  3DP4 A;  1PB8 A;  1SYI A;  3PUZ E;  1FW0 A;  3VLW A;  1PBP A;  2RC7 A;  4GD5 A;  1N3W A;  4X9T A;  3HPI A;  1OIB A;  2XXP A;  3G3H A;  3S2V A;  1PB9 A;  4Z0I A;  4KCC A;  1BIY A;  3TZA A;  1ZLQ A;  2RC9 A;  3HHF A;  3MZB A;  1MY4 A;  5TPA A;  4YIC A;  1XT8 A;  1B9J A;  3JV9 A;  5H8F B;  1QUJ A;  4ECF A;  4NWC A;  1N84 A;  3M3F A;  3OEM A;  4F31 B;  3IR1 A;  4OXV A;  2DXR A;  5KZT A;  2QL3 A;  4ZEB A;  2Q2A A;  5AA4 A;  4R9G A;  5I59 A;  4F1V A;  3TTR A;  3IJO B;  3SEU A;  5CI5 A;  3FVO A;  4EXK A;  2ONS A;  4RY1 A;  5H8S A;  1A7L A;  5K2Y A;  2XXY A;  3N6T A;  4H8I A;  4OES A;  5ICQ A;  1MDQ A;  3TCF A;  5A5X B;  2G93 A;  4U22 A;  2RKM A;  3KG2 A;  3A3U A;  1CE2 A;  2F78 A;  4RYA A;  4I62 A;  2AL4 A;  3CI8 A;  3QAX A;  3PPN A;  4M1V A;  4L17 A;  3PU5 A;  3LUY A;  3MW0 A;  4GQO A;  4IY5 A;  3CFZ A;  3MZ1 A;  4ZEC A;  4QHQ A;  4MF3 A;  1A40 A;  2ZYN A;  1SBP A;  3M8U A;  5M2V A;  3VXB A;  4U1Z A;  4F3G A;  2X7Q A;  1EZ9 A;  3O2A A;  1I6Q A;  4DDD A;  3A3C A;  4EXL A;  3FXU A;  2DVZ A;  1P1N A;  2ZYK A;  4RPN A;  1SW1 A;  1ANF A;  1LAF E;  3FAT A;  4FEB A;  1I6A A;  1FTJ A;  2RIN A;  1MPD A;  1NMU A;  4G68 B;  1N04 A;  3MWB A;  2HQ0 A;  2GRV A;  3LC8 A;  2DSF A;  3FJG A;  1NH7 A;  2YLN A;  3OOA A;  5HBC A;  5I56 A;  4P11 A;  3OEN A;  4DXU A;  3K2D A;  4IO5 A;  4C0R A;  3P7I A;  1ZKB A;  1BP5 A;  2NWJ A;  4DCX A;  1JEV A;  4LQ2 A;  3FV2 A;  5AA4 B;  1Y1Z A;  3QXM A;  5L9S A;  1MY1 A;  5I59 B;  2XX8 A;  4YB6 A;  5EHS A;  2OJT A;  2Z23 A;  4U1O A;  1QUI A;  3T93 B;  3FUZ A;  4OFL A;  1MDP 1;  2DOJ A;  3WAE A;  2QRY A;  1DPE A;  2QJE A;  2A5T A;  3UGW A;  4XKQ A;  1MG1 A;  1SW4 A;  3GBA A;  1UTH A;  4G77 A;  2I6E A;  1Y3N A;  1SI0 A;  3IB1 A;  1ZTY A;  1H3D A;  3H6V A;  3OO6 A;  3USD A;  4RXL A;  1HSE A;  3UK4 A;  4EQ9 A;  3RLF E;  2XXQ A;  3SEV A;  4P0I A;  3PD9 A;  3H03 A;  4U4X A;  2I4B A;  3N5L A;  3RT6 B;  2XXW A;  1N7W A;  3TEP A;  2QS1 A;  2DQV A;  3OEL A;  5KCJ A;  3S9L C;  3FJ7 A;  4XKP A;  1A99 A;  1MXY A;  1TWY A;  3C31 A;  2XXH A;  3R6U A;  1PB7 A;  5FTH A;  2IA4 A;  4ELQ A;  4YKP A;  3EPE A;  5JTY B;  1FQC A;  1H43 A;  3VVD A;  1QW0 A;  3H4Z A;  2A5S A;  2CMO A;  3T9H B;  4GXS B;  3ILT B;  4RK9 A;  4GWO A;  3CVG A;  5ELV A;  5I56 B;  5L9O A;  5B70 A;  3FZV A;  5AA3 A;  1Y4C A;  2AIX A;  3K6U A;  1D9V A;  1MQD A;  4R73 A;  2DWJ A;  3QIM A;  2OK2 A;  1IXC A;  3G7W A;  3E13 X;  4KFQ A;  3O6H A;  1SI1 A;  2NXO A;  2PVU A;  4EF1 A;  4QRZ A;  4EUO A;  3ILU B;  3TUS A;  1B51 A;  1D9Y A;  1DPP A;  2G29 A;  2R71 A;  3C34 A;  1M5E A;  1JW5 A;  5I2K B;  2O7I A;  3SDF A;  3MVX A;  3OEK A;  1O63 A;  4XXU A;  4H5G A;  3EHT A;  3KOS A;  3VFJ A;  3D4G A;  3N6U A;  3TTL A;  3RY3 A;  1VE4 A;  2E0S A;  3FD3 A;  2RF1 A;  4F3B A;  1YPN A;  1S9T A;  2HAU A;  3DM0 A;  2HCA A;  4TOZ A;  3VXC A;  4F18 A;  3IAZ A;  1P1Q A;  2I0B A;  3I6V A;  1II5 A;  4IGT A;  4ND9 A;  2XXV A;  3VLV A;  2Y7R A;  4IY6 A;  2Z8E A;  3IOW A;  4ZEI A;  2E1S A;  1Q1K A;  5KCJ B;  1MY2 A;  4UA8 A;  3LSL A;  2GHB A;  3IB0 A;  2PT1 A;  1P99 A;  3AXF A;  4DE8 A;  3T22 A;  3CSB A;  2QSX A;  1EH3 A;  3FVN A;  2D5W A;  4GF8 A;  1LBC A;  4MLQ A;  3S4U A;  1XC1 A;  3K01 A;  1PEB A;  3SKP A;  2RC8 A;  3W15 C;  2QS2 A;  1ZBM A;  4KHZ E;  5DT6 A;  3TCG A;  1P1U A;  4GVO A;  3FVK A;  2HAV A;  4KQP A;  4I1D A;  1DTZ A;  1KWH A;  3OO7 A;  4OVJ A;  3FGS A;  1US5 A;  4OFO A;  2THI A;  1O7T A;  3G3J A;  3U94 A;  1TXF A;  1B0L A;  1EZO A;  1A54 A;  4OWD A;  3FIR A;  4ZE8 A;  5L8D A;  1B3H A;  3MBP A;  2ZNT A;  4POW A;  4GLI A;  3V8X B;  4E0X A;  4M4G A;  2ZNS A;  1M5C A;  1QVS A;  3ZSF A;  4F3S A;  1A55 A;  4GL0 A;  1ZU0 A;  3C35 A;  4RNS A;  4ESW A;  2Q88 A;  1H45 A;  4JSO A;  2F36 A;  1HSL A;  3RGY A;  4K3F A;  4Q5T A;  1GVC A;  5I57 A;  3K1P A;  5I58 A;  3SEW A;  2ZYM A;  1MM7 A;  2F8D A;  3G3G A;  2Z8F A;  2ABH A;  2UYF A;  5A5X A;  4R6K A;  1FCK A;  3PUX E;  1QKA A;  3V5A A;  4YMA A;  5DVF A;  1MQH A;  1N0T A;  1Y9U A;  4TLM B;  3H6W A;  4NF4 B;  4H0W A;  1TFA A;  3U93 A;  5CC2 A;  4LVQ A;  4ZE9 A;  4F2O A;  1USY E;  2Q9T A;  1NL5 A;  3ONM A;  1FQF A;  2F7C A;  3TCH A;  1URS A;  3GLB A;  2PBW A;  5F1Q A;  3WAF A;  4ZEF A;  5L9M A;  1JW1 A;  1OQH A;  4LZ8 A;  4KYD A;  4QSC A;  2AYS A;  1Z7N E;  2Y7P A;  4X48 A;  5DVJ A;  5DYH A;  4G2Z A;  4KI0 E;  2FA7 A;  4G8H A;  1B52 A;  1SD3 A;  4RK2 A;  1JEU A;  4LAT A;  2OBG A;  1Y4T A;  3K1M A;  3CFL A;  5J1D A;  4FAJ A;  4G68 A;  4ONY A;  3MP6 A;  1JET A;  4JXI A;  2YPN A;  5DEX B;  2VD3 A;  3IJX B;  1M5D A;  1VR5 A;  5I84 A;  2Q89 A;  2F35 A;  2V93 A;  3MVZ A;  4QSE A;  3KZG A;  1L5T A;  2ZXT A;  4GL8 A;  5F7V A;  3JYR A;  1B0H A;  4N07 A;  3SEY A;  1Y3Q A;  4O3B A;  3TEL A;  2HZL A;  3C33 A;  5I57 B;  4F2Q A;  3HO7 A;  1FQD A;  5I58 B;  1QKB A;  3GXA A;  2F97 A;  2Z8D A;  5EYF A;  4OTE A;  3OD7 A;  3IOT A;  2F6G A;  3W9W A;  1H44 A;  3TYH A;  1SW5 A;  1XVY A;  1B7H A;  3D4C A;  3MPK A;  3E3K A;  3BBR A;  2GHA A;  1NKX A;  1LST A;  3MVY A;  3FJM A;  1FQA A;  4BDN A;  2NOO A;  3TTN A;  5ICT A;  2QMW A;  3VLU A;  3K6X A;  1MH4 A;  2D3I A;  4GFR A;  4LZ5 A;  1SDX A;  3B6Q A;  4NF5 B;  1FTO A;  4MH5 A;  3L6H A;  1R6Z A;  2QPQ A;  4PFT A;  4F19 A;  3O66 A;  2KLF A;  4OFJ A;  2GFE A;  2DWI A;  1JVX A;  2QMX A;  3E4R A;  4OEN A;  3VVF A;  3Q28 A;  2DE4 A;  2W7Y A;  1UTB B;  2P0S A;  4IO3 A;  4N13 A;  3RUM A;  3LSX A;  5JTY A;  2Z22 A;  1B3L A;  4LUB A;  2V84 A;  2O68 A;  2VOZ A;  1MY3 A;  4JWY A;  1SYH A;  3TQL A;  2YJP A;  4P0G A;  3KOT A;  3MAM A;  5AA2 B;  1A8E A;  3IOV A;  2OCU A;  4LP2 B;  4NTL A;  4ZS9 A;  5ITP A;  2I3V A;  1IUD A;  4OEV A;  1Y20 A;  4IGR A;  1B7U A;  3MJN A;  4AB5 A;  3EF7 A;  2DVC A;  2FNC A;  5CMM A;  2PT2 A;  5I2K A;  3PMX A;  5CBS A;  3L6G A;  3G3F A;  3QSL A;  4XIG Q;  3K6V A;  2AL5 A;  2VP1 A;  3T9X B;  4TQU Q;  4G8N A;  4NMY A;  1MQJ A;  4FAT A;  3ODB A;  1AIV A;  1DSN A;  1HSJ A;  1MQG A;  2P1S A;  4YB5 A;  5K2X A;  4H67 A;  4ELO A;  1UQW A;  2UVI A;  2I58 A;  3OO8 A;  4QFL A;  4G68 C;  4BDL A;  2Y84 A;  2BJJ X;  4GIZ A;  4C1U A;  4NE4 A;  3Q29 A;  1XHY A;  2M8C A;  1WVJ A;  2RCA A;  5CMC A;  1B6H A;  2PX1 A;  3U1O A;  5CRY A;  2UVJ A;  5IAI A;  3QK6 A;  3OMB A;  1BLF A;  3UOR A;  4FOR A;  3C9H A;  2DP8 A;  1ELJ A;  3C36 A;  3DLN A;  4KYE A; 
#chains in the Genus database with same CATH topology
 5EQ8 A;  1IEJ A;  4HTG A;  1IXI A;  3B6T A;  3O28 A;  1JVY A;  3H3G A;  3ZKL A;  1LAG E;  4BLA A;  4FE8 A;  2OLB A;  2WYP A;  4HCW A;  4U21 A;  4JBZ A;  4PFR A;  1MXZ A;  1OVB A;  2VD2 A;  4ZZE A;  4OEU A;  4KYS A;  1H76 A;  1DK4 A;  1LBV A;  3HCQ A;  3NOH A;  3KJ7 A;  4OYV A;  2NUV A;  1JW4 A;  3CRB A;  3GZG A;  4WXJ A;  4ELP A;  2OWS A;  3HFU A;  1IMA A;  2V3T A;  4AS4 A;  3RQT A;  5AA2 D;  4ISU A;  4AB6 A;  3LSW A;  2XD3 A;  2GQ1 A;  2REG A;  2NVU B;  5IZZ A;  4YU0 A;  4OVP A;  4UAC A;  3PMV A;  1NNK A;  4PQJ A;  1UIV A;  4EQ7 A;  4IO2 A;  4FBP A;  3Q26 A;  2VHA A;  3T1B A;  1S50 A;  3PPQ A;  2CZK A;  3V83 A;  4KPT A;  2F7B A;  3DP6 A;  4IO7 A;  2ONR A;  2WX9 A;  5KDT B;  2IEE A;  4I3Y A;  4NF4 A;  4QBA A;  4BDO A;  2I4C A;  4R2F A;  1RDX A;  3TAJ A;  4HCY A;  1B05 A;  3R26 A;  5FHM A;  3RN8 A;  2QFL A;  3UP9 A;  3MP8 A;  1ZMG A;  1IQ7 A;  3PV0 E;  2XHD A;  3W9V A;  3H6T A;  3OO9 A;  1D3K A;  3O9P A;  3E9X A;  1GTK A;  4NQ8 A;  3SET A;  1MXU A;  4KD5 A;  2REJ A;  4PAF A;  1FQE A;  1D4N A;  3PUW E;  4JWO A;  3VVE A;  1RKM A;  5DVI A;  1MRP A;  1QUK A;  3QUJ A;  4NX1 A;  2DWA A;  3LR1 A;  1BK4 A;  4RPO A;  1I69 A;  2QVV A;  4I9D A;  5H8N B;  4G8M A;  4OER A;  1OVT A;  3T96 B;  4DZ1 A;  1FTK A;  4EF2 A;  4R75 A;  4PF6 A;  3CIJ A;  1IIW A;  4PGP A;  2F34 A;  3IFA A;  4YKJ A;  4R72 A;  1LFG A;  5DEX A;  3HN0 A;  4U4S A;  3UA8 A;  3PD8 A;  3PUV E;  1SQY A;  4XF5 A;  5AE4 A;  3OSR A;  3PGF A;  3K02 A;  3OXN A;  3THI A;  5CBR A;  3BFT A;  1PC3 A;  1EYI A;  2BJI A;  3VE1 B;  4YKK A;  2UVH A;  1FPB A;  4NN3 A;  4RJZ A;  1LLS A;  1YYZ A;  1MXW A;  4YKI A;  1MQI A;  4H65 A;  3C32 A;  2I0C A;  3BKI B;  3S9N C;  1LCF A;  5ET7 A;  4NED A;  4JB7 A;  3S9E A;  1MXX A;  4MBP A;  2F7A A;  2XXK A;  3O97 A;  2HZK A;  2B4L A;  1LB9 A;  3VV5 A;  2Y7I A;  4OA4 A;  3EN3 A;  5ITO A;  3PMW A;  5JEI A;  1NI9 A;  2XWK A;  1LFI A;  1LFH A;  4N8G A;  4R9F A;  1B3G A;  1ZJL A;  4KR5 A;  2WYK A;  4BDR A;  3B6W A;  4NF5 A;  3EHU A;  3EHS A;  5AA1 A;  3QUF A;  1FPF A;  4ZDM A;  2DWH A;  2H9B A;  1FTA A;  4HXV A;  4WEP A;  3O29 A;  4NF6 B;  5IZ3 B;  1LBW A;  3KJT A;  3HHG A;  3PTY A;  1UTB A;  4QFK A;  4ESX A;  1VFE A;  1IXH A;  2CZI A;  4ELR A;  2F3D A;  4JWX A;  4XEQ A;  4GWW A;  2VGQ A;  2V4C A;  1URD A;  2F6P A;  1M5B A;  1I6B A;  1YZ0 A;  1NUW A;  3H6U A;  3U8Q A;  1YTV A;  3K4U A;  1NV1 A;  5LOM A;  2H99 A;  4BDQ A;  2O1M A;  1B5I A;  4OZ9 A;  3CG3 A;  4QFN A;  1B1H A;  4H8J A;  5AA2 A;  3TFL A;  1EZP A;  3DEL B;  4X04 A;  4LZ7 A;  3I5O A;  1AH5 A;  4N8Y A;  3RT8 A;  3M3K A;  1MS7 A;  3MYU A;  4MHF A;  5HPQ A;  3H06 B;  4N4U A;  1VFD A;  1NUY A;  1OLA A;  1POT A;  1LB8 A;  2OZZ A;  4POX A;  5I5P A;  4Z7E A;  2QS4 A;  1B7Z A;  2DE3 A;  4P56 A;  4F22 A;  2ANJ A;  1PDA A;  1RYX A;  4PBH A;  4C1T A;  4I3E A;  1LCT A;  1DMB A;  1FJ6 A;  3S9M C;  5B7D A;  1LBZ A;  2QS3 A;  4ZED A;  2O51 A;  3K00 A;  4OQO A;  4R6Y A;  5H8Q B;  2Q8J A;  1P1W A;  4XKN A;  3T0J A;  1J1N A;  1YAE A;  5EHM A;  4R74 A;  3TQW A;  3O6I A;  1B2H A;  4YB7 A;  3IO4 A;  3F11 A;  4OVT A;  2XXR A;  4MJO A;  4PFU A;  3U92 A;  5CMK A;  3LSF B;  5TP9 B;  4LON B;  3R7X A;  4G4P A;  5EYG A;  2FYI A;  3PUY E;  1OMP A;  3TDJ A;  4G61 A;  4H5F A;  5FHN A;  1AL3 A;  4O7M A;  1Y3P A;  3FAS A;  4KXP A;  1IMF A;  4IO6 A;  3JZJ A;  1WDN A;  4HE0 A;  1NFT A;  3U65 A;  1M5F A;  1N3X A;  2L5V A;  3DP8 A;  3T66 A;  1YXI A;  2D21 A;  4F3P A;  1N7X A;  4WED A;  4P3L A;  5BWJ A;  3IL1 B;  2ONK E;  4PE5 B;  4H6D A;  1AOV A;  2CZH A;  3UN6 A;  2V3U A;  3A09 A;  3MQ9 A;  1FTL A;  1UIU A;  1CB6 A;  3GBB A;  4R6H A;  4KCD A;  1BTJ A;  3BIH A;  3IFC A;  4NF8 A;  5ESY A;  5HM4 B;  1PBQ A;  3Q27 A;  3TPA A;  1SW2 A;  3KN8 A;  5TPA B;  1B3E A;  4H1X A;  1S7Y A;  1B1X A;  4ZZA A;  4JSD A;  3RNN A;  2FIE A;  4THI A;  3TMG A;  4WKM A;  3KBR A;  1FBG A;  1R1N A;  3MC2 A;  1K9Y A;  3B7D A;  3EQ1 A;  2CEX A;  3IO6 A;  4PFW A;  4FIM A;  3N26 A;  2UXA A;  2H4I A;  3VDF A;  1Q35 A;  1KA1 A;  2HXW A;  1YCJ A;  4N6P A;  5I2N A;  1MH3 A;  1EU8 A;  1R9L A;  4HE2 A;  1MY0 A;  2R6G E;  3G3I A;  3MPL A;  4GX6 A;  1T0K A;  4NAP A;  4YAH X;  2XXT A;  1B4Z A;  3HV1 A;  1ZIU A;  4X1D A;  1GV8 A;  2R9J A;  4GWY A;  3V89 B;  2UVG A;  4DXC A;  1B32 A;  4F39 A;  4O3A A;  4P8B A;  3PPR A;  2P2A A;  4DIG A;  2X26 A;  4DCY A;  2FHY A;  2ZYO A;  4MNP A;  4PFY A;  2I49 A;  5KDT A;  3K6W A;  5DTB A;  3TOD A;  2DYX A;  4IO4 A;  1DTG A;  1FPG A;  3E78 A;  4O3C A;  1GR2 A;  1GGG A;  2Y7W A;  1B3F A;  1AMF A;  1OLC A;  1Z7M E;  4DLD A;  2XX9 A;  2KQZ A;  3TTM A;  4GX4 A;  3IOU A;  2B3F A;  2LAO A;  4NF8 B;  3FVG A;  3IOR A;  5H8H A;  3OSQ A;  1TT1 A;  1NNF A;  4R2B A;  4PBQ A;  4GXA A;  1N76 A;  4AQ4 A;  1P1O A;  1FQB A;  5H8N A;  4NG7 A;  4XFE A;  5CMB A;  2ALU A;  4JVC A;  4N15 A;  5ET8 A;  3RPW A;  2O84 X;  3CFX A;  3O6G A;  3UIF A;  2R8T A;  4FED A;  4MIJ A;  4HW8 A;  4F29 A;  3RTF B;  4OMB A;  3U72 A;  1FPJ A;  5ISU A;  4F1Y A;  3SES A;  3Q25 A;  1MM6 A;  1LAH E;  5I2N B;  2F5X A;  1A8F A;  4GWZ A;  3MP1 A;  4RA1 A;  3CR9 A;  4EDP A;  4NGU A;  3K0V A;  5IZ1 A;  3PPO A;  2B65 A;  2ESN A;  2PFY A;  2PMS A;  5DW8 A;  5BUU A;  1IXG A;  2A5T B;  2ZMB A;  1OQG A;  4QSD A;  1NNT A;  4E0W A;  1MXV A;  4OET A;  1IIT A;  3T9U A;  1UTH B;  1XS5 A;  2O6A A;  3KN7 A;  4P1E A;  4DXB A;  2RCB A;  4MCO A;  2XXI A;  4GRK A;  3KN3 A;  1NH8 A;  1WOD A;  3KSX A;  2QVR A;  3GYY A;  1O64 A;  4P1L A;  2B3B A;  3ZS6 A;  4HS7 A;  1JNF A;  3B8B A;  1Y1M A;  4QFP A;  4TLL B;  1B4H A;  2XXX A;  4P9K A;  1RYO A;  4QFO A;  1POY 1;  2WKY A;  4GOT A;  4YZZ A;  1FBE A;  3TTK A;  3KSJ A;  3FV1 A;  3SER A;  3G3K A;  2I48 A;  4Q0C A;  3IK6 B;  3CSG A;  4JVI A;  2DS9 A;  2V3Q A;  4MLV A;  4U2R A;  5H8H B;  1R9Q A;  4NF6 A;  3ECR A;  1NNP A;  5IZ3 A;  1MPC A;  4QF9 A;  4MX6 A;  4X1B A;  1F9B A;  1LAX A;  1JP4 A;  1XVX A;  4PET A;  4F1U A;  4GWS A;  2GH9 A;  2XX7 A;  5FHO A;  1FJ9 A;  2ZNU A;  3MVW A;  3ZKK A;  2XD2 A;  2O69 A;  1FTM A;  4NF0 A;  3TKD A;  4U23 A;  4PP0 A;  2H98 A;  2HPG A;  2P3N A;  1MPB A;  3IB2 A;  3SEX A;  2DE2 A;  4LQ5 A;  3MUQ A;  1LGB C;  4Q8R A;  4NWD A;  3FXR A;  3H7M A;  2O1L A;  2OWT A;  1BKA A;  5H8F A;  3IX1 A;  2V25 A;  4MNC A;  3QYT A;  4XTC Q;  3FXQ A;  3KEI A;  1DOT A;  1XOC A;  2X7P A;  4LA9 A;  3M3L A;  4JDF A;  2H25 A;  2PYY A;  5TU0 A;  3I3V A;  4OAN A;  1B46 A;  1QUL A;  3HST A;  1FPD A;  4MFI A;  3FXB A;  1FBH A;  4H46 A;  4X8R A;  4ZEK A;  5EQ7 A;  3PPP A;  2HXR A;  3KFM A;  1LBB A;  2HFB A;  2I3W A;  4XKR A;  5FTI A;  4IB2 A;  2Y7K A;  1NUX A;  1URG A;  5EYH A;  5H8Q A;  2VPO A;  1USY H;  3N94 A;  4YMB A;  3LBS A;  2CZL A;  1B5J A;  1B58 A;  4BDM A;  1B40 A;  1VSO A;  4FJP A;  1JQF A;  3K1N A;  3RTW B;  4Q30 B;  5TP9 A;  2UYE A;  3C4M A;  4PC9 A;  1FPI A;  4FEC A;  1B5H A;  1ATG A;  4OHN A;  2O7U A;  5JK4 A;  1IZ1 A;  4I8C A;  2DXY A;  1TFD A;  3FBP A;  1SVX B;  3BFU A;  3MZ9 A;  2H5Y A;  2FBP A;  2Q2C A;  5CM6 A;  3BIG A;  2HEU A;  3T9V A;  3KGC A;  1US4 A;  1QJM A;  4OVR A;  3CG1 A;  2XXU A;  4EQB A;  5IKB A;  3DP4 A;  1PB8 A;  1SYI A;  3PUZ E;  1FW0 A;  3VLW A;  1PBP A;  1NV6 A;  3DLN A;  2RC7 A;  4GD5 A;  1N3W A;  4X9T A;  3HPI A;  1OIB A;  2XXP A;  3G3H A;  3S2V A;  1PB9 A;  4Z0I A;  4KCC A;  3RYD A;  1BIY A;  3TZA A;  1IMC A;  1ZLQ A;  2RC9 A;  3HHF A;  3MZB A;  1MY4 A;  3KC0 A;  5TPA A;  5I7I A;  1KA0 A;  4YIC A;  1XT8 A;  2QVU A;  1IME A;  1B9J A;  3JV9 A;  5H8F B;  1QUJ A;  4ECF A;  4NWC A;  1N84 A;  3M3F A;  3OEM A;  4F31 B;  3IR1 A;  4GWX A;  4OXV A;  2DXR A;  5KZT A;  2QL3 A;  4ZEB A;  5F24 A;  2Q2A A;  5AA4 A;  1AWB A;  4R9G A;  5I59 A;  3D1R A;  3LV0 A;  4F1V A;  1EYJ A;  3TTR A;  3IJO B;  2PCR A;  3SEU A;  5CI5 A;  3FVO A;  2ZZX A;  4EXK A;  2ONS A;  1NV3 A;  4RY1 A;  5H8S A;  1A7L A;  5K2Y A;  2XXY A;  4NHB A;  5ET5 A;  3N6T A;  4H8I A;  4OES A;  1FBP A;  5ICQ A;  1MDQ A;  3TCF A;  5A5X B;  2G93 A;  4PCD A;  4U22 A;  1KZ8 A;  2RKM A;  3KG2 A;  3A3U A;  5A5L A;  1CE2 A;  2F78 A;  4RYA A;  4I62 A;  2AL4 A;  3CI8 A;  3QAX A;  4N6K A;  1SPI A;  3PPN A;  4M1V A;  4L17 A;  4AS5 A;  3PU5 A;  3LUY A;  2OX3 A;  3MW0 A;  4GQO A;  4IY5 A;  3CFZ A;  3MZ1 A;  4ZEC A;  4QHQ A;  4MF3 A;  1A40 A;  2ZYN A;  1SBP A;  3M8U A;  5M2V A;  2KR0 A;  3VXB A;  4U1Z A;  4F3G A;  2X7Q A;  1EZ9 A;  3O2A A;  1I6Q A;  4DDD A;  3A3C A;  4EXL A;  3FXU A;  2DVZ A;  4PTK A;  1G0H A;  1P1N A;  5J16 A;  2ZYK A;  4RPN A;  1SW1 A;  1ANF A;  1LAF E;  3FAT A;  4FEB A;  1I6A A;  3LUZ A;  1FTJ A;  2RIN A;  1MPD A;  1NMU A;  4G68 B;  1N04 A;  4MNI A;  3MWB A;  1FBD A;  2HQ0 A;  2GRV A;  3LC8 A;  1FPK A;  2DSF A;  3FJG A;  1NH7 A;  2YLN A;  3OOA A;  5HBC A;  5I56 A;  1RDZ A;  4P11 A;  3OEN A;  4DXU A;  3K2D A;  4PF8 A;  4IO5 A;  4C0R A;  3P7I A;  1ZKB A;  1BP5 A;  4DI3 D;  2NWJ A;  4DCX A;  1JEV A;  4LQ2 A;  3FV2 A;  5AA4 B;  1Y1Z A;  3QXM A;  5L9S A;  1MY1 A;  5I59 B;  2FIX A;  2XX8 A;  4YB6 A;  5EHS A;  3B50 A;  2OJT A;  2Z23 A;  1NV5 A;  4U1O A;  1QUI A;  5FBP A;  5IGA A;  3T93 B;  3FUZ A;  4PE3 A;  4OFL A;  1MDP 1;  2DOJ A;  3WAE A;  2QRY A;  1DPE A;  2QJE A;  2F3B A;  2A5T A;  3UGW A;  4XKQ A;  1MG1 A;  4O8M A;  1SW4 A;  3GBA A;  1UTH A;  4G77 A;  5LDZ A;  2I6E A;  3SZP A;  1Y3N A;  1SI0 A;  3IB1 A;  1ZTY A;  1H3D A;  3H6V A;  3OO6 A;  3USD A;  4GBW A;  4RXL A;  1FRP A;  1LEV A;  1HSE A;  3UK4 A;  4EQ9 A;  3RLF E;  2XXQ A;  4GWU A;  3SEV A;  4P0I A;  3PD9 A;  4PAI A;  3H03 A;  4U4X A;  2I4B A;  3N5L A;  3RT6 B;  2XXW A;  1N7W A;  3TEP A;  2QS1 A;  2DQV A;  3OEL A;  5KCJ A;  3S9L C;  3FJ7 A;  4XKP A;  1A99 A;  1MXY A;  1TWY A;  3C31 A;  2XXH A;  3R6U A;  1PB7 A;  2XWO A;  5FTH A;  2IA4 A;  4ELQ A;  4YKP A;  3EPE A;  5JTY B;  3CHG A;  1FQC A;  1H43 A;  3VVD A;  1QW0 A;  3H4Z A;  2A5S A;  2CMO A;  3T9H B;  3MST A;  4GXS B;  3ILT B;  4RK9 A;  4GWO A;  3CVG A;  5ELV A;  4IR8 A;  5I56 B;  5L9O A;  5B70 A;  1FBF A;  3FZV A;  5AA3 A;  1Y4C A;  2AIX A;  3K6U A;  1D9V A;  1MQD A;  4R73 A;  4UAB A;  2DWJ A;  2WBB A;  3QIM A;  2OK2 A;  1IXC A;  4H45 A;  4PGN A;  3G7W A;  3E13 X;  4KFQ A;  3O6H A;  1SI1 A;  2NXO A;  2PVU A;  4EF1 A;  1RDY A;  4QRZ A;  4EUO A;  3ILU B;  3TUS A;  1B51 A;  1D9Y A;  1DPP A;  2G29 A;  1FSA A;  2R71 A;  3C34 A;  1M5E A;  1JW5 A;  5I2K B;  2O7I A;  3SDF A;  3MVX A;  3OEK A;  1O63 A;  4XXU A;  1LBX A;  4H5G A;  3EHT A;  3KOS A;  3VFJ A;  3D4G A;  3N6U A;  3TTL A;  4QXD A;  3RY3 A;  1VE4 A;  2E0S A;  3FD3 A;  2RF1 A;  4F3B A;  1YPN A;  1S9T A;  2HAU A;  3DM0 A;  2HCA A;  2ZZW A;  2JJK A;  4TOZ A;  3VXC A;  4F18 A;  3IAZ A;  1P1Q A;  2I0B A;  3I6V A;  1II5 A;  4IGT A;  4ND9 A;  1Q9D A;  2XXV A;  3VLV A;  2Y7R A;  4IY6 A;  2Z8E A;  3IOW A;  4ZEI A;  2E1S A;  1Q1K A;  5KCJ B;  4O94 A;  1INP A;  1MY2 A;  4UA8 A;  3LSL A;  2GHB A;  3IB0 A;  3ISP A;  2PT1 A;  1P99 A;  3AXF A;  4DE8 A;  3T22 A;  3CSB A;  2QSX A;  4PDH A;  1EH3 A;  3FVN A;  3A29 A;  1IMD A;  2D5W A;  4GF8 A;  1LBC A;  4MLQ A;  3S4U A;  1XC1 A;  3K01 A;  1PEB A;  2OWZ A;  3SKP A;  2RC8 A;  3KBZ A;  3W15 C;  2QS2 A;  1ZBM A;  2XA5 A;  4KHZ E;  4I40 A;  5DT6 A;  3TCG A;  1P1U A;  4GVO A;  3FVK A;  2HAV A;  4KQP A;  2P3V A;  4I1D A;  4N91 A;  1DTZ A;  2Y5L A;  1KWH A;  2Y5K A;  3OO7 A;  4OVS A;  4OVJ A;  3FGS A;  1US5 A;  4OFO A;  2THI A;  1O7T A;  2WBD A;  3G3J A;  3U94 A;  1TXF A;  1B0L A;  1EZO A;  1A54 A;  4OWD A;  3FIR A;  4ZE8 A;  5L8D A;  1B3H A;  3MBP A;  2ZNT A;  4POW A;  1FPL A;  4GLI A;  3V8X B;  4E0X A;  4M4G A;  2ZNS A;  1M5C A;  1QVS A;  2Q8M A;  3ZSF A;  4F3S A;  1A55 A;  4GL0 A;  1ZU0 A;  3C35 A;  4RNS A;  4ESW A;  2Q88 A;  1H45 A;  5EQ9 A;  4JSO A;  2F36 A;  1HSL A;  4PFB A;  3RGY A;  4MMP A;  4GX3 A;  4K3F A;  4Q5T A;  1GVC A;  5I57 A;  3K1P A;  5I58 A;  3SEW A;  2ZYM A;  1MM7 A;  2F8D A;  3G3G A;  2Z8F A;  4GBV A;  2ABH A;  2UYF A;  5A5X A;  4R6K A;  1FCK A;  3PUX E;  1QKA A;  4N17 A;  3V5A A;  4YMA A;  5DVF A;  1MQH A;  1N0T A;  1Y9U A;  4TLM B;  3H6W A;  1FPE A;  4NF4 B;  4H0W A;  1TFA A;  3U93 A;  5CC2 A;  1QGX A;  4LN5 A;  4LVQ A;  5IM2 A;  4ZE9 A;  4F2O A;  2Q9T A;  1NL5 A;  3ONM A;  1FQF A;  1EYK A;  2F7C A;  3TCH A;  1URS A;  1NV0 A;  3GLB A;  2PBW A;  5F1Q A;  1DBZ A;  2VT5 A;  1VDW A;  3WAF A;  4ZEF A;  5L9M A;  5LTC A;  1JW1 A;  1OQH A;  4LZ8 A;  3KC1 A;  4KYD A;  4QSC A;  2AYS A;  1Z7N E;  2Y7P A;  4X48 A;  5DVJ A;  5DYH A;  1CNQ A;  4G2Z A;  4KI0 E;  2FA7 A;  4G8H A;  1B52 A;  1SD3 A;  4RK2 A;  1JEU A;  4LAT A;  2OBG A;  1Y4T A;  3K1M A;  3CFL A;  5J1D A;  1NV4 A;  4FAJ A;  4G68 A;  4ONY A;  3MP6 A;  1JET A;  4JXI A;  2YPN A;  1G0I A;  5DEX B;  2ZZV A;  2VD3 A;  3IJX B;  1M5D A;  1VR5 A;  4N6D A;  5I84 A;  2B4M A;  2Q89 A;  2F35 A;  2V93 A;  3MVZ A;  4QSE A;  3KZG A;  1L5T A;  2ZXT A;  4GL8 A;  5F7V A;  3JYR A;  1B0H A;  4N07 A;  3SEY A;  1Y3Q A;  4O3B A;  3TEL A;  2DDK A;  2HZL A;  2VPN A;  3C33 A;  5I57 B;  4F2Q A;  3HO7 A;  1FQD A;  2CEY A;  5I58 B;  1QKB A;  3GXA A;  1NV7 A;  2F97 A;  2Z8D A;  5EYF A;  4OTE A;  3OD7 A;  3IOT A;  2F6G A;  3W9W A;  1H44 A;  3TYH A;  1SW5 A;  1XVY A;  1B7H A;  2XWV A;  3D4C A;  3MPK A;  3E3K A;  3BBR A;  2GHA A;  1NKX A;  1LST A;  3MVY A;  5T3J A;  2Q74 A;  3FJM A;  1FQA A;  1NV2 A;  2NOO A;  4BDN A;  3TTN A;  5ICT A;  2QMW A;  3VLU A;  3K6X A;  1MH4 A;  2D3I A;  4GFR A;  4LZ5 A;  1SDX A;  3B6Q A;  4NF5 B;  1K9Z A;  4DI4 B;  1FTO A;  4MH5 A;  3L6H A;  1R6Z A;  2QPQ A;  4PFT A;  4F19 A;  3O66 A;  4PAK A;  2KLF A;  4OFJ A;  1FBC A;  2GFE A;  2DWI A;  1JVX A;  3ROJ A;  2QMX A;  3E4R A;  4OEN A;  3VVF A;  3Q28 A;  4O7I A;  1XI6 A;  2DE4 A;  1DCU A;  2W7Y A;  1UTB B;  2P0S A;  4IO3 A;  4MEV A;  2WEF A;  4N13 A;  3RPL A;  3RUM A;  3LSX A;  5JTY A;  3EKI A;  2Z22 A;  1B3L A;  4LUB A;  1D9Q A;  5EQA A;  2V84 A;  2O68 A;  2VOZ A;  2XWI A;  1MY3 A;  4JWY A;  1SYH A;  3TQL A;  2YJP A;  4P0G A;  4PFI A;  3KOT A;  3MAM A;  5AA2 B;  1A8E A;  3IOV A;  2OCU A;  4LP2 B;  4NTL A;  4ZS9 A;  5ITP A;  1NUZ A;  2I3V A;  1IUD A;  4OEV A;  4MAG A;  1LBY A;  4OVQ A;  1Y20 A;  4IGR A;  1B7U A;  3MJN A;  5I3S A;  4AB5 A;  4P47 A;  3EF7 A;  2DVC A;  2FNC A;  5CMM A;  2PT2 A;  2MKZ A;  5I2K A;  3PMX A;  5CBS A;  3L6G A;  3G3F A;  3QSL A;  2PFZ A;  4XIG Q;  3K6V A;  2AL5 A;  2VP1 A;  3T9X B;  4TQU Q;  4G8N A;  4NMY A;  1MQJ A;  4FAT A;  3ODB A;  1AIV A;  1DSN A;  1HSJ A;  1MQG A;  2P1S A;  4YB5 A;  5K2X A;  4H67 A;  4ELO A;  1UQW A;  4PDD A;  2UVI A;  2I58 A;  3OO8 A;  2HHM A;  4QFL A;  4G68 C;  2FVZ A;  4BDL A;  1IMB A;  2Y84 A;  2BJJ X;  4GIZ A;  4C1U A;  4NE4 A;  3QMF A;  4HE1 A;  3Q29 A;  1XHY A;  2M8C A;  1WVJ A;  2RCA A;  5CMC A;  1B6H A;  2PX1 A;  5ET6 A;  3RPL B;  3U1O A;  5CRY A;  2UVJ A;  5IAI A;  4N81 A;  3QK6 A;  3OMB A;  1BLF A;  3UOR A;  4FOR A;  3C9H A;  2DP8 A;  4JVD A;  1ELJ A;  3E79 A;  3C36 A;  1USY E;  4KYE A; 
#chains in the Genus database with same CATH homology
 1IEJ A;  4HTG A;  1IXI A;  3B6T A;  3O28 A;  1JVY A;  3H3G A;  3ZKL A;  1LAG E;  4BLA A;  4FE8 A;  2OLB A;  4HCW A;  4U21 A;  4JBZ A;  1MXZ A;  1OVB A;  2VD2 A;  4ZZE A;  4OEU A;  4KYS A;  1H76 A;  3HCQ A;  3KJ7 A;  4OYV A;  2NUV A;  1JW4 A;  3CRB A;  3GZG A;  4WXJ A;  4ELP A;  2OWS A;  2V3T A;  3RQT A;  5AA2 D;  4ISU A;  4AB6 A;  3LSW A;  2XD3 A;  2REG A;  2NVU B;  4YU0 A;  4UAC A;  3PMV A;  1NNK A;  4PQJ A;  1UIV A;  4EQ7 A;  4IO2 A;  3Q26 A;  2VHA A;  1S50 A;  3PPQ A;  3V83 A;  4KPT A;  2F7B A;  3DP6 A;  4IO7 A;  2ONR A;  5KDT B;  2IEE A;  4NF4 A;  4BDO A;  2I4C A;  4R2F A;  3TAJ A;  4HCY A;  1B05 A;  3R26 A;  5FHM A;  3RN8 A;  3UP9 A;  3MP8 A;  1ZMG A;  1IQ7 A;  3PV0 E;  2XHD A;  3W9V A;  3H6T A;  3OO9 A;  1D3K A;  3O9P A;  3E9X A;  1GTK A;  3SET A;  1MXU A;  4KD5 A;  2REJ A;  1FQE A;  1D4N A;  3PUW E;  4JWO A;  3VVE A;  1RKM A;  5DVI A;  1MRP A;  1QUK A;  3QUJ A;  2DWA A;  3LR1 A;  4RPO A;  1I69 A;  4I9D A;  5H8N B;  4G8M A;  4OER A;  1OVT A;  3T96 B;  4DZ1 A;  1FTK A;  4EF2 A;  4R75 A;  3CIJ A;  1IIW A;  2F34 A;  4YKJ A;  4R72 A;  1LFG A;  5DEX A;  3HN0 A;  4U4S A;  3UA8 A;  3PD8 A;  3PUV E;  1SQY A;  5AE4 A;  3OSR A;  3PGF A;  3K02 A;  3OXN A;  3THI A;  5CBR A;  3BFT A;  1PC3 A;  3VE1 B;  4YKK A;  2UVH A;  4RJZ A;  1LLS A;  1MXW A;  4YKI A;  1MQI A;  4H65 A;  3C32 A;  2I0C A;  3BKI B;  3S9N C;  1LCF A;  4NED A;  4JB7 A;  3S9E A;  1MXX A;  4MBP A;  2F7A A;  3O97 A;  2HZK A;  1LB9 A;  3VV5 A;  2Y7I A;  3EN3 A;  5ITO A;  3PMW A;  5JEI A;  1LFI A;  1LFH A;  4R9F A;  1B3G A;  1ZJL A;  4KR5 A;  4BDR A;  3B6W A;  4NF5 A;  3EHU A;  3EHS A;  5AA1 A;  3QUF A;  4ZDM A;  2DWH A;  2H9B A;  4WEP A;  3O29 A;  4NF6 B;  3KJT A;  3HHG A;  1UTB A;  4QFK A;  4ESX A;  1VFE A;  1IXH A;  4ELR A;  4JWX A;  2VGQ A;  1URD A;  2F6P A;  1M5B A;  1I6B A;  3H6U A;  3U8Q A;  1YTV A;  3K4U A;  5LOM A;  2H99 A;  4BDQ A;  2O1M A;  1B5I A;  4OZ9 A;  3CG3 A;  4QFN A;  1B1H A;  4H8J A;  5AA2 A;  3TFL A;  1EZP A;  3DEL B;  4LZ7 A;  3I5O A;  1AH5 A;  3RT8 A;  3M3K A;  1MS7 A;  5HPQ A;  3H06 B;  1VFD A;  1OLA A;  1POT A;  1LB8 A;  2OZZ A;  4POX A;  4Z7E A;  2QS4 A;  1B7Z A;  2DE3 A;  4F22 A;  2ANJ A;  1PDA A;  1RYX A;  4C1T A;  1LCT A;  1DMB A;  3S9M C;  5B7D A;  2QS3 A;  4ZED A;  2O51 A;  3K00 A;  4OQO A;  4R6Y A;  5H8Q B;  2Q8J A;  1P1W A;  4XKN A;  1J1N A;  1YAE A;  5EHM A;  4R74 A;  3TQW A;  3O6I A;  1B2H A;  4YB7 A;  3IO4 A;  3F11 A;  2XXR A;  4PFU A;  3U92 A;  5CMK A;  3LSF B;  5TP9 B;  4LON B;  3R7X A;  4G4P A;  2FYI A;  3PUY E;  1OMP A;  3TDJ A;  4H5F A;  5FHN A;  1AL3 A;  1Y3P A;  3FAS A;  4IO6 A;  3JZJ A;  1WDN A;  1NFT A;  1M5F A;  1N3X A;  3DP8 A;  3T66 A;  2D21 A;  4F3P A;  1N7X A;  4WED A;  5BWJ A;  3IL1 B;  2ONK E;  4PE5 B;  4H6D A;  1AOV A;  3UN6 A;  2V3U A;  3A09 A;  3MQ9 A;  1FTL A;  1UIU A;  1CB6 A;  3GBB A;  4R6H A;  4KCD A;  1BTJ A;  4NF8 A;  5HM4 B;  1PBQ A;  3Q27 A;  3TPA A;  1SW2 A;  3KN8 A;  5TPA B;  1B3E A;  4H1X A;  1S7Y A;  1B1X A;  4ZZA A;  4JSD A;  3RNN A;  4THI A;  3TMG A;  4WKM A;  3KBR A;  1R1N A;  3MC2 A;  3B7D A;  3EQ1 A;  3IO6 A;  4PFW A;  4FIM A;  3N26 A;  2UXA A;  2H4I A;  3VDF A;  1Q35 A;  2HXW A;  1YCJ A;  4N6P A;  5I2N A;  1MH3 A;  1EU8 A;  1R9L A;  1MY0 A;  2R6G E;  3G3I A;  3MPL A;  1T0K A;  4YAH X;  2XXT A;  1B4Z A;  3HV1 A;  1ZIU A;  4X1D A;  1GV8 A;  2R9J A;  3V89 B;  2UVG A;  4DXC A;  1B32 A;  4F39 A;  4O3A A;  3PPR A;  2P2A A;  4DIG A;  2X26 A;  4DCY A;  2ZYO A;  4PFY A;  2I49 A;  5KDT A;  3K6W A;  5DTB A;  3TOD A;  2DYX A;  4IO4 A;  1DTG A;  4O3C A;  1GR2 A;  1GGG A;  2Y7W A;  1B3F A;  1AMF A;  1OLC A;  1Z7M E;  4DLD A;  2XX9 A;  3TTM A;  3IOU A;  2B3F A;  2LAO A;  4NF8 B;  3FVG A;  3IOR A;  5H8H A;  3OSQ A;  1TT1 A;  1NNF A;  4R2B A;  4GXA A;  1N76 A;  4AQ4 A;  1P1O A;  1FQB A;  5H8N A;  5CMB A;  2ALU A;  3RPW A;  2O84 X;  3CFX A;  3O6G A;  3UIF A;  4FED A;  4HW8 A;  4F29 A;  3RTF B;  4OMB A;  3U72 A;  5ISU A;  4F1Y A;  3SES A;  3Q25 A;  1MM6 A;  1LAH E;  5I2N B;  2F5X A;  1A8F A;  3MP1 A;  4RA1 A;  3CR9 A;  4EDP A;  3K0V A;  3PPO A;  2B65 A;  2ESN A;  2PMS A;  5BUU A;  1IXG A;  2A5T B;  2ZMB A;  1OQG A;  4QSD A;  1NNT A;  4E0W A;  1MXV A;  4OET A;  1IIT A;  3T9U A;  1UTH B;  1XS5 A;  2O6A A;  3KN7 A;  4DXB A;  2RCB A;  2XXI A;  4GRK A;  3KN3 A;  1NH8 A;  1WOD A;  3KSX A;  1O64 A;  2B3B A;  3ZS6 A;  4HS7 A;  1JNF A;  1Y1M A;  4QFP A;  4TLL B;  1B4H A;  2XXX A;  1RYO A;  4QFO A;  1POY 1;  2WKY A;  4GOT A;  4YZZ A;  3TTK A;  3KSJ A;  3SER A;  3FV1 A;  3G3K A;  2I48 A;  4Q0C A;  3IK6 B;  3CSG A;  2DS9 A;  2V3Q A;  4MLV A;  4U2R A;  5H8H B;  1R9Q A;  4NF6 A;  3ECR A;  1NNP A;  1MPC A;  4QF9 A;  4X1B A;  1F9B A;  1LAX A;  1XVX A;  4PET A;  4F1U A;  2GH9 A;  2XX7 A;  5FHO A;  2ZNU A;  3MVW A;  3ZKK A;  2XD2 A;  2O69 A;  1FTM A;  3TKD A;  4U23 A;  4PP0 A;  2H98 A;  1MPB A;  3IB2 A;  3SEX A;  2DE2 A;  4LQ5 A;  3MUQ A;  1LGB C;  4Q8R A;  4NWD A;  3FXR A;  3H7M A;  2O1L A;  2OWT A;  1BKA A;  5H8F A;  3IX1 A;  2V25 A;  4XTC Q;  3QYT A;  3FXQ A;  3KEI A;  1DOT A;  1XOC A;  2X7P A;  4LA9 A;  3M3L A;  4JDF A;  2H25 A;  2PYY A;  5TU0 A;  3I3V A;  1B46 A;  1QUL A;  3HST A;  4MFI A;  4ZEK A;  3PPP A;  3KFM A;  1LBB A;  2HFB A;  2I3W A;  4XKR A;  5FTI A;  4IB2 A;  2Y7K A;  1URG A;  5H8Q A;  1USY H;  3N94 A;  4YMB A;  3LBS A;  2CZL A;  1B5J A;  1B58 A;  4BDM A;  1B40 A;  1VSO A;  4FJP A;  1JQF A;  3K1N A;  3RTW B;  4Q30 B;  5TP9 A;  2UYE A;  3C4M A;  4FEC A;  1B5H A;  1ATG A;  4OHN A;  2O7U A;  5JK4 A;  1IZ1 A;  4I8C A;  2DXY A;  1TFD A;  1SVX B;  3BFU A;  3MZ9 A;  2H5Y A;  2Q2C A;  5CM6 A;  2HEU A;  3T9V A;  3KGC A;  1US4 A;  1QJM A;  3CG1 A;  2XXU A;  4EQB A;  5IKB A;  3DP4 A;  1PB8 A;  1SYI A;  3PUZ E;  1FW0 A;  3VLW A;  1PBP A;  2RC7 A;  4GD5 A;  1N3W A;  4X9T A;  3HPI A;  1OIB A;  2XXP A;  3G3H A;  3S2V A;  1PB9 A;  4Z0I A;  4KCC A;  1BIY A;  3TZA A;  1ZLQ A;  2RC9 A;  3HHF A;  3MZB A;  1MY4 A;  5TPA A;  4YIC A;  1XT8 A;  1B9J A;  3JV9 A;  5H8F B;  1QUJ A;  4ECF A;  4NWC A;  1N84 A;  3M3F A;  3OEM A;  4F31 B;  3IR1 A;  4OXV A;  2DXR A;  5KZT A;  2QL3 A;  4ZEB A;  2Q2A A;  5AA4 A;  4R9G A;  5I59 A;  4F1V A;  3TTR A;  3IJO B;  3SEU A;  5CI5 A;  3FVO A;  4EXK A;  2ONS A;  4RY1 A;  5H8S A;  1A7L A;  5K2Y A;  2XXY A;  3N6T A;  4H8I A;  4OES A;  5ICQ A;  1MDQ A;  3TCF A;  5A5X B;  2G93 A;  4U22 A;  2RKM A;  3KG2 A;  3A3U A;  1CE2 A;  2F78 A;  4RYA A;  4I62 A;  2AL4 A;  3CI8 A;  3QAX A;  3PPN A;  4M1V A;  4L17 A;  3PU5 A;  3LUY A;  3MW0 A;  4GQO A;  4IY5 A;  3CFZ A;  3MZ1 A;  4ZEC A;  4QHQ A;  4MF3 A;  1A40 A;  2ZYN A;  1SBP A;  3M8U A;  5M2V A;  3VXB A;  4U1Z A;  4F3G A;  2X7Q A;  1EZ9 A;  3O2A A;  1I6Q A;  4DDD A;  3A3C A;  4EXL A;  3FXU A;  2DVZ A;  1P1N A;  2ZYK A;  4RPN A;  1SW1 A;  1ANF A;  1LAF E;  3FAT A;  4FEB A;  1I6A A;  1FTJ A;  2RIN A;  1MPD A;  1NMU A;  4G68 B;  1N04 A;  3MWB A;  2HQ0 A;  2GRV A;  3LC8 A;  2DSF A;  3FJG A;  1NH7 A;  2YLN A;  3OOA A;  5HBC A;  5I56 A;  4P11 A;  3OEN A;  4DXU A;  3K2D A;  4IO5 A;  4C0R A;  3P7I A;  1ZKB A;  1BP5 A;  2NWJ A;  4DCX A;  1JEV A;  4LQ2 A;  3FV2 A;  5AA4 B;  1Y1Z A;  3QXM A;  5L9S A;  1MY1 A;  5I59 B;  2XX8 A;  4YB6 A;  5EHS A;  2OJT A;  2Z23 A;  4U1O A;  1QUI A;  3T93 B;  3FUZ A;  4OFL A;  1MDP 1;  2DOJ A;  3WAE A;  2QRY A;  1DPE A;  2QJE A;  2A5T A;  3UGW A;  4XKQ A;  1MG1 A;  1SW4 A;  3GBA A;  1UTH A;  4G77 A;  2I6E A;  1Y3N A;  1SI0 A;  3IB1 A;  1ZTY A;  1H3D A;  3H6V A;  3OO6 A;  3USD A;  4RXL A;  1HSE A;  3UK4 A;  4EQ9 A;  3RLF E;  2XXQ A;  3SEV A;  4P0I A;  3PD9 A;  3H03 A;  4U4X A;  2I4B A;  3N5L A;  3RT6 B;  2XXW A;  1N7W A;  3TEP A;  2QS1 A;  2DQV A;  3OEL A;  5KCJ A;  3S9L C;  3FJ7 A;  4XKP A;  1A99 A;  1MXY A;  1TWY A;  3C31 A;  2XXH A;  3R6U A;  1PB7 A;  5FTH A;  2IA4 A;  4ELQ A;  4YKP A;  3EPE A;  5JTY B;  1FQC A;  1H43 A;  3VVD A;  1QW0 A;  3H4Z A;  2A5S A;  2CMO A;  3T9H B;  4GXS B;  3ILT B;  4RK9 A;  4GWO A;  3CVG A;  5ELV A;  5I56 B;  5L9O A;  5B70 A;  3FZV A;  5AA3 A;  1Y4C A;  2AIX A;  3K6U A;  1D9V A;  1MQD A;  4R73 A;  2DWJ A;  3QIM A;  2OK2 A;  1IXC A;  3G7W A;  3E13 X;  4KFQ A;  3O6H A;  1SI1 A;  2NXO A;  2PVU A;  4EF1 A;  4QRZ A;  4EUO A;  3ILU B;  3TUS A;  1B51 A;  1D9Y A;  1DPP A;  2G29 A;  2R71 A;  3C34 A;  1M5E A;  1JW5 A;  5I2K B;  2O7I A;  3SDF A;  3MVX A;  3OEK A;  1O63 A;  4XXU A;  4H5G A;  3EHT A;  3KOS A;  3VFJ A;  3D4G A;  3N6U A;  3TTL A;  3RY3 A;  1VE4 A;  2E0S A;  3FD3 A;  2RF1 A;  4F3B A;  1YPN A;  1S9T A;  2HAU A;  3DM0 A;  2HCA A;  4TOZ A;  3VXC A;  4F18 A;  3IAZ A;  1P1Q A;  2I0B A;  3I6V A;  1II5 A;  4IGT A;  4ND9 A;  2XXV A;  3VLV A;  2Y7R A;  4IY6 A;  2Z8E A;  3IOW A;  4ZEI A;  2E1S A;  1Q1K A;  5KCJ B;  1MY2 A;  4UA8 A;  3LSL A;  2GHB A;  3IB0 A;  2PT1 A;  1P99 A;  3AXF A;  4DE8 A;  3T22 A;  3CSB A;  2QSX A;  1EH3 A;  3FVN A;  2D5W A;  4GF8 A;  1LBC A;  4MLQ A;  3S4U A;  1XC1 A;  3K01 A;  1PEB A;  3SKP A;  2RC8 A;  3W15 C;  2QS2 A;  1ZBM A;  4KHZ E;  5DT6 A;  3TCG A;  1P1U A;  4GVO A;  3FVK A;  2HAV A;  4KQP A;  4I1D A;  1DTZ A;  1KWH A;  3OO7 A;  4OVJ A;  3FGS A;  1US5 A;  4OFO A;  2THI A;  1O7T A;  3G3J A;  3U94 A;  1TXF A;  1B0L A;  1EZO A;  1A54 A;  4OWD A;  3FIR A;  4ZE8 A;  5L8D A;  1B3H A;  3MBP A;  2ZNT A;  4POW A;  4GLI A;  3V8X B;  4E0X A;  4M4G A;  2ZNS A;  1M5C A;  1QVS A;  3ZSF A;  4F3S A;  1A55 A;  4GL0 A;  1ZU0 A;  3C35 A;  4RNS A;  4ESW A;  2Q88 A;  1H45 A;  4JSO A;  2F36 A;  1HSL A;  3RGY A;  4K3F A;  4Q5T A;  1GVC A;  5I57 A;  3K1P A;  5I58 A;  3SEW A;  2ZYM A;  1MM7 A;  2F8D A;  3G3G A;  2Z8F A;  2ABH A;  2UYF A;  5A5X A;  4R6K A;  1FCK A;  3PUX E;  1QKA A;  3V5A A;  4YMA A;  5DVF A;  1MQH A;  1N0T A;  1Y9U A;  4TLM B;  3H6W A;  4NF4 B;  4H0W A;  1TFA A;  3U93 A;  5CC2 A;  4LVQ A;  4ZE9 A;  4F2O A;  1USY E;  2Q9T A;  1NL5 A;  3ONM A;  1FQF A;  2F7C A;  3TCH A;  1URS A;  3GLB A;  2PBW A;  5F1Q A;  3WAF A;  4ZEF A;  5L9M A;  1JW1 A;  1OQH A;  4LZ8 A;  4KYD A;  4QSC A;  2AYS A;  1Z7N E;  2Y7P A;  4X48 A;  5DVJ A;  5DYH A;  4G2Z A;  4KI0 E;  2FA7 A;  4G8H A;  1B52 A;  1SD3 A;  4RK2 A;  1JEU A;  4LAT A;  2OBG A;  1Y4T A;  3K1M A;  3CFL A;  5J1D A;  4FAJ A;  4G68 A;  4ONY A;  3MP6 A;  1JET A;  4JXI A;  2YPN A;  5DEX B;  2VD3 A;  3IJX B;  1M5D A;  1VR5 A;  5I84 A;  2Q89 A;  2F35 A;  2V93 A;  3MVZ A;  4QSE A;  3KZG A;  1L5T A;  2ZXT A;  4GL8 A;  5F7V A;  3JYR A;  1B0H A;  4N07 A;  3SEY A;  1Y3Q A;  4O3B A;  3TEL A;  2HZL A;  3C33 A;  5I57 B;  4F2Q A;  3HO7 A;  1FQD A;  5I58 B;  1QKB A;  3GXA A;  2F97 A;  2Z8D A;  5EYF A;  4OTE A;  3OD7 A;  3IOT A;  2F6G A;  3W9W A;  1H44 A;  3TYH A;  1SW5 A;  1XVY A;  1B7H A;  3D4C A;  3MPK A;  3E3K A;  3BBR A;  2GHA A;  1NKX A;  1LST A;  3MVY A;  3FJM A;  1FQA A;  4BDN A;  2NOO A;  3TTN A;  5ICT A;  2QMW A;  3VLU A;  3K6X A;  1MH4 A;  2D3I A;  4GFR A;  4LZ5 A;  1SDX A;  3B6Q A;  4NF5 B;  1FTO A;  4MH5 A;  3L6H A;  1R6Z A;  2QPQ A;  4PFT A;  4F19 A;  3O66 A;  2KLF A;  4OFJ A;  2GFE A;  2DWI A;  1JVX A;  2QMX A;  3E4R A;  4OEN A;  3VVF A;  3Q28 A;  2DE4 A;  2W7Y A;  1UTB B;  2P0S A;  4IO3 A;  4N13 A;  3RUM A;  3LSX A;  5JTY A;  2Z22 A;  1B3L A;  4LUB A;  2V84 A;  2O68 A;  2VOZ A;  1MY3 A;  4JWY A;  1SYH A;  3TQL A;  2YJP A;  4P0G A;  3KOT A;  3MAM A;  5AA2 B;  1A8E A;  3IOV A;  2OCU A;  4LP2 B;  4NTL A;  4ZS9 A;  5ITP A;  2I3V A;  1IUD A;  4OEV A;  1Y20 A;  4IGR A;  1B7U A;  3MJN A;  4AB5 A;  3EF7 A;  2DVC A;  2FNC A;  5CMM A;  2PT2 A;  5I2K A;  3PMX A;  5CBS A;  3L6G A;  3G3F A;  3QSL A;  4XIG Q;  3K6V A;  2AL5 A;  2VP1 A;  3T9X B;  4TQU Q;  4G8N A;  4NMY A;  1MQJ A;  4FAT A;  3ODB A;  1AIV A;  1DSN A;  1HSJ A;  1MQG A;  2P1S A;  4YB5 A;  5K2X A;  4H67 A;  4ELO A;  1UQW A;  2UVI A;  2I58 A;  3OO8 A;  4QFL A;  4G68 C;  4BDL A;  2Y84 A;  2BJJ X;  4GIZ A;  4C1U A;  4NE4 A;  3Q29 A;  1XHY A;  2M8C A;  1WVJ A;  2RCA A;  5CMC A;  1B6H A;  2PX1 A;  3U1O A;  5CRY A;  2UVJ A;  5IAI A;  3QK6 A;  3OMB A;  1BLF A;  3UOR A;  4FOR A;  3C9H A;  2DP8 A;  1ELJ A;  3C36 A;  3DLN A;  4KYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...