3R6UA

Crystal structure of choline binding protein opubc from bacillus subtilis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
QTIKIGAQSMSESEIIASMLGQLIEHHTDLKTTTIKNLGSNAVQQQALMNGEIDIAATRYTGDALTGTLRMEPEKDPDKALALTQREFKKRYDLKWYDSYGFDNTYAFTVSKELADQYHLETVSDVKKWAPQLKLGVDNYWMKLKGNGYQDFTKTYGMTFGGTYPMQIGLVYDAVKSGKMDIVLAYSTDGRIKSYGLKMLKDDKQFFPPYDCSPVVPEKVLKEHPELEGIIKKMLGKIDTATMQELNYEVDGNLKEPSVVAKEYLEKHRYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Choline-binding protein
publication title The Crystal Structure of the Substrate-Binding Protein OpuBC from Bacillus subtilis in Complex with Choline.
pubmed doi rcsb
molecule tags Transport protein
total genus 97
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3r6uA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3r6uA02
1SW1A 1FTLA 1TXFA 3GZGA 5AA4A 3TEPA 4UA8A 2H98A 3THIA 3IOWA 3IX1A 2OWSA 2H4IA 1TFAA 3VLUA 1JW5A 2NUVA 5CRYA 1IZ1A 2V84A 5KCJB 1A99A 4EF2A 4YB6A 1M5FA 5DT6A 1ZU0A 4GXAA 4YKPA 1EZ9A 3KOTA 3LR1A 4G8NA 1LFGA 2R9JA 2LAOA 4Q8RA 4FATA 2ZYOA 5ICTA 3CFLA 4JWXA 2ZYMA 3N6TA 4DXBA 3VDFA 4IY5A 2I3VA 5LOMA 3K6VA 3MQ9A 2UYFA 2CMOA 1ZBMA 3PPQA 3LC8A 1UTHB 1P1UA 3TFLA 3H4ZA 2PT1A 2HQ0A 4OQOA 3OELA 5AA2B 5TP9B 2A5TB 4ISUA 4JSDA 3SEVA 2XXYA 3A3UA 5I56A 3H03A 1VFDA 3U93A 3LBSA 3FV1A 1A8FA 4FECA 4U21A 3KEIA 3RTWB 3VVDA 5I2KA 4MF3A 4GFRA 5DEXA 5L9MA 3RLFE 4NF8A 1M5DA 5CI5A 5JK4A 1QVSA 3K0VA 3V8XB 3Q25A 1PC3A 4OXVA 3TMGA 1FQCA 4GRKA 4NWDA 3TPAA 1OLAA 2XXUA 5FHMA 2NXOA 4PP0A 5ELVA 2F78A 5A5XB 4QFKA 5FHOA 2P2AA 4ZEKA 3IK6B 2DS9A 4ND9A 5ICQA 2YPNA 4NF6B 2ONKE 2QMXA 2OBGA 4L17A 3K02A 2DP8A 4RPNA 5JTYA 3FVGA 4LZ5A 4TOZA 4POWA 4G8MA 1B51A 3QUJA 3TZAA 2WKYA 3GBAA 3TODA 3O6IA 4ZEIA 2OK2A 1IQ7A 5I57A 3PMWA 3IORA 5B70A 4OERA 1MPCA 2RC9A 1POTA 2F7AA 4I62A 1LAGE 2DOJA 4NEDA 2V3TA 3T9HB 1DTGA 2VHAA 4F39A 1B0HA 2I3WA 4OFJA 4PE5B 2OWTA 3S9MC 5K2YA 4G8HA 3H06B 4IGTA 4U1OA 1MPBA 3RNNA 2XX8A 2XXHA 3E3KA 2PT2A 1NFTA 2Q2AA 3K2DA 3P7IA 3TTMA 1Y1MA 4LA9A 1MY0A 2FA7A 3TTLA 2I0CA 3IB1A 3K01A 1II5A 2F36A 1I6BA 4RA1A 4C1UA 3M8UA 3H6WA 1B05A 2ONRA 3EPEA 1MQJA 3DM0A 1RYOA 1NNTA 1CB6A 1JVYA 4EXLA 1XS5A 1N76A 2I4CA 3SKPA 3VLVA 1D3KA 4OEUA 2ABHA 3TTKA 3RN8A 3TDJA 5K2XA 3O97A 4ZEFA 3PUYE 2G29A 2Y7WA 1FTKA 3HPIA 2XXWA 3V5AA 3BFUA 5ITOA 4JBZA 2O1MA 2HFBA 3CFXA 3FJ7A 4N13A 4AQ4A 3U8QA 4RXLA 5BWJA 1IXIA 2Y7IA 3TCFA 3F11A 3BFTA 3WAEA 4YB7A 5DVJA 5M2VA 1MY2A 4E0XA 2YJPA 4Z7EA 1VFEA 3O28A 1WVJA 4JB7A 3BKIB 1US5A 4WEDA 3C35A 5I59A 1QKAA 1ZKBA 2V93A 4GQOA 5HBCA 1FCKA 3CRBA 4ZDMA 4QFNA 4YKKA 1B32A 5TPAB 3QSLA 2H25A 4NWCA 1H44A 3KN7A 3FASA 2AYSA 3E4RA 3FJGA 3S9EA 2PVUA 1ZJLA 3GBBA 1URGA 3CSGA 4FJPA 1H43A 5KDTB 2D3IA 3KN3A 3RY3A 1UTBA 2DXRA 2Y7KA 2YLNA 1IXHA 2Z22A 4KCCA 4IB2A 5KZTA 5IKBA 4EXKA 4OESA 3HHFA 4IO2A 1QUJA 1P1QA 2V25A 5CC2A 4MLQA 3OSRA 1SDXA 3KJ7A 4F1UA 4DZ1A 1URSA 2XXPA 4G68B 4GLIA 4FIMA 4NF4A 3C31A 1M5CA 3QK6A 4OFOA 3VV5A 3MZ9A 2DE3A 1AOVA 4KHZE 4OETA 3C9HA 4FORA 1PDAA 3R7XA 2UVJA 4HCWA 4R2FA 3FIRA 4X1DA 3C34A 1M5EA 4KYDA 1B46A 5H8HA 2Q9TA 1L5TA 4OMBA 1N3XA 1RKMA 3PMVA 4HCYA 4LQ5A 1EZOA 2QJEA 4IO3A 2ONSA 3IL1B 1JVXA 4IGRA 5CMCA 1FQEA 1GVCA 1I6AA 2QMWA 3G3FA 3IOUA 1PB9A 2F35A 3D4GA 1DOTA 4N07A 2XD3A 3O2AA 1USYH 2XXXA 4PFTA 5L9SA 1MQDA 4F19A 4OENA 1Y3NA 2GHAA 4M4GA 3MP8A 1TFDA 3IJOB 3OO9A 1FQAA 2PMSA 3FVKA 4U1ZA 1DPEA 1EU8A 3ZS6A 2ZNTA 3IO4A 3QIMA 2NOOA 2F6GA 1MM6A 1QKBA 3U92A 3U94A 2DYXA 4ZEDA 4RPOA 4ELOA 3BBRA 3JV9A 5IAIA 5ITPA 2OZZA 1N84A 3USDA 1B7ZA 3C36A 1XC1A 3S2VA 5FTIA 4LZ8A 4H5GA 4C0RA 5L8DA 1Q35A 4EUOA 5AA2D 1NNFA 5DYHA 3ILTB 1FTMA 4R9FA 3ILUB 1FQFA 5F7VA 2ZMBA 4UACA 4ZE8A 1AH5A 3KBRA 4X9TA 3N6UA 3TKDA 3B6WA 1P99A 1MH3A 3RPWA 1GTKA 2HXWA 5I84A 5DVFA 4OTEA 1QULA 4RNSA 1Y9UA 5CM6A 3E13X 4TLMB 3MP1A 3CSBA 2H99A 1VE4A 3DELB 4KPTA 5H8QB 1JETA 5H8NA 1KWHA 3IB2A 4IO6A 4XKNA 4G77A 3SETA 4YMAA 1OQHA 4LONB 2UYEA 1FQDA 3RGYA 5EHSA 1SD3A 4M1VA 3V83A 3LSWA 1AL3A 4GL8A 4IY6A 2O7IA 2I6EA 3KSJA 4K3FA 2I0BA 2OJTA 4KI0E 4I1DA 1B40A 3VE1B 3PUXE 4F1YA 3L6HA 2GHBA 1N3WA 4U4SA 3MPKA 1ZIUA 3IJXB 1SYIA 2RF1A 3I5OA 1MY4A 3OEMA 5AA1A 4THIA 3JZJA 3UK4A 1H45A 4XKQA 1ZTYA 1LFHA 2XHDA 3RTFB 3K1MA 2VP1A 3B6TA 4H8JA 3LSLA 1JNFA 3MP6A 2ZXTA 4ZS9A 3U1OA 4X1BA 3O9PA 1OQGA 3OOAA 1JW4A 3IR1A 4FE8A 1MH4A 1MM7A 4XKRA 2PBWA 3MVXA 3IOTA 1SBPA 1BTJA 2F8DA 4EQ7A 4Z0IA 3H3GA 1NNKA 3G3IA 2IEEA 3KZGA 1EH3A 3UGWA 3UP9A 2ZNSA 3R26A 2REJA 3PV0E 1JEUA 4KQPA 3T66A 5HM4B 2NVUB 1A40A 5DVIA 1MS7A 1VR5A 3CVGA 2DWAA 5TU0A 2M8CA 3DP6A 2Q2CA 2QS3A 2QL3A 3K6UA 3W9WA 3UORA 4H67A 4MLVA 3HSTA 3T93B 3VVFA 1NNPA 5L9OA 1FW0A 1B3GA 4YMBA 1USYE 1MDQA 4F3GA 4I8CA 4P0GA 3D4CA 1S50A 3T9XB 4QSDA 4MBPA 4GXSB 4HW8A 3TQWA 1J1NA 2XXRA 3LSXA 3C4MA 5H8FA 2ZNUA 3QAXA 2UXAA 1BKAA 4BDNA 4DE8A 3PPRA 3E9XA 2ZYNA 1MY3A 5AA4B 4RY1A 3EHUA 4BLAA 4DCYA 1GR2A 4OHNA 4ESWA 4OFLA 2QS2A 4R2BA 1Z7ME 3AXFA 2V3QA 3UIFA 1R9QA 3HO7A 3CFZA 1XVYA 1F9BA 4IO7A 3TTNA 1FQBA 4WKMA 4GVOA 1Y3PA 3PPOA 3RUMA 1OMPA 4ELQA 4GL0A 1SQYA 5AA3A 3K1NA 4AB5A 1SVXB 3S9NC 3ECRA 2PYYA 2Y7PA 1S7YA 4R72A 3K6WA 3VFJA 2UVHA 3K1PA 1XOCA 4Q30B 1BLFA 5KCJA 4NE4A 2XXVA 2O6AA 3FATA 3EHTA 3A09A 1NKXA 4G68C 3MAMA 3RT8A 1NMUA 1XHYA 1OVTA 2QRYA 3A3CA 5I56B 4DDDA 3OXNA 5I2KB 4QRZA 3FJMA 4LQ2A 4NMYA 3DLNA 4PQJA 5DEXB 4NF8B 1QW0A 3G3HA 1B6HA 2X7PA 1SI0A 4H8IA 1R1NA 3G3KA 3LSFB 1Y1ZA 2QS1A 1A7LA 1YCJA 1Y20A 2REGA 3MUQA 3TTRA 4QF9A 1OIBA 3PU5A 2Z8DA 5AA2A 1SYHA 3C32A 5TP9A 4E0WA 1JW1A 2THIA 2Q89A 4PFWA 3FZVA 1LB8A 1ZMGA 5J1DA 2AL4A 2B3BA 4ZE9A 5EHMA 3G3JA 4MFIA 2Z23A 2DE2A 1O63A 5CBSA 4F3PA 3PUZE 2DWIA 2RC7A 4F18A 4WEPA 3M3FA 4GOTA 3MC2A 3OEKA 3N26A 5JTYB 4H1XA 3JYRA 4BDMA 3HV1A 1B3LA 4XIGQ 1QJMA 2B3FA 2H9BA 3L6GA 3M3LA 2O84X 3MZ1A 1ATGA 1A8EA 2VD2A 2BJJX 5I57B 5ISUA 4GWOA 3KOSA 1BIYA 1Y4TA 3OO6A 2FYIA 1IUDA 4NF6A 1PB7A 2F5XA 3S4UA 1B4ZA 4QFLA 4O3AA 1QUIA 5CMBA 4QSCA 1US4A 1XT8A 2F6PA 2OCUA 3T96B 5CBRA 1B7UA 3B7DA 3K6XA 4KR5A 4DIGA 1B4HA 4FEBA 2PX1A 3CI8A 3O29A 2HAUA 1H76A 3N94A 4YICA 1URDA 4F29A 3FVOA 4JDFA 2AL5A 2ALUA 4OWDA 3PMXA 1NL5A 2Q8JA 5I58A 1YPNA 3H6TA 4ONYA 1POY1 2F34A 1MXYA 4XXUA 4TQUQ 4U23A 4ESXA 4P0IA 1MQHA 1UQWA 1B5IA 1MXUA 4N6PA 2ANJA 4YKJA 4I9DA 3KG2A 4DCXA 4OZ9A 1O64A 1P1OA 3Q26A 1MRPA 4JWYA 1LAXA 3S9LC 2F7CA 1VSOA 2RC8A 1T0KA 4U22A 4POXA 3FXRA 4JSOA 3EN3A 2GFEA 1FTJA 3PD8A 4H5FA 3M3KA 1N04A 4R75A 1FTOA 3KGCA 2GRVA 3TCGA 1IIWA 4U4XA 4AB6A 3DP4A 1B3HA 3HHGA 2DWHA 1WDNA 2XD2A 4R9GA 4RK9A 1S9TA 2RCAA 4F31B 3PD9A 5I59B 3EHSA 4HS7A 3FD3A 1NH8A 3PUWE 4BDLA 4LZ7A 2HZLA 4FEDA 3T22A 2XX7A 3PUVE 2ZYKA 3MZBA 1Q1KA 2XXQA 2CZLA 2V3UA 4YB5A 4ZECA 2VGQA 3DP8A 1ELJA 1A55A 4P11A 4LUBA 3MBPA 2Z8FA 1UIUA 4LP2B 2B65A 1IITA 4OVJA 1UTBB 4H6DA 1B3EA 4ELRA 3B6QA 4Q5TA 4DXUA 4YU0A 3FV2A 2DE4A 2O1LA 2DSFA 3PPPA 1I6QA 1BP5A 1R9LA 1IXGA 2X7QA 5FHNA 1N0TA 5B7DA 2DWJA 5TPAA 4NF5A 1LAHE 4G2ZA 3KFMA 2F7BA 1B5HA 3IOVA 1OLCA 3CG1A 4LVQA 3OO7A 2Y84A 1LB9A 4YKIA 5KDTA 4NF4B 4YAHX 4R6YA 4QHQA 3FXUA 2DVZA 2G93A 1RYXA 4F1VA 2OLBA 4XKPA 1LBCA 1LAFE 4KYSA 4R73A 1MDP1 3VXBA 1O7TA 2HCAA 4R6KA 4KD5A 4GIZA 4EQBA 1TT1A 5H8HB 1DTZA 3TYHA 5JEIA 4G68A 3KJTA 1UIVA 3ZSFA 1SI1A 3T9UA 1B5JA 3SEYA 4RYAA 5I2NA 1MQGA 4TLLB 3HCQA 4EDPA 2I4BA 4IO5A 1PEBA 4R6HA 3OSQA 4U2RA 3K00A 4RK2A 2IA4A 2DXYA 1HSEA 3H6UA 2ESNA 4QSEA 3O66A 4RJZA 4PFYA 2XX9A 3OO8A 2X26A 4LATA 3PPNA 4KCDA 5I58B 3MVWA 3CIJA 3SEUA 1MPDA 2I48A 2HEUA 3ODBA 2KLFA 1N7XA 3FXQA 3I3VA 4ZZEA 4HTGA 1CE2A 3ONMA 5AE4A 3EF7A 1PB8A 3KSXA 1N7WA 1MXXA 3H7MA 3QUFA 4PETA 3W15C 3OMBA 1WODA 2UVGA 4QFPA 1EZPA 1OVBA 3Q28A 1YAEA 2UVIA 3T9VA 1HSJA 3IB0A 3UA8A 1R6ZA 4GD5A 5CMKA 4X48A 2RKMA 4QFOA 2NWJA 1PBPA 3O6GA 1Z7NE 2D21A 2FNCA 2H5YA 1LCTA 2A5SA 2QPQA 2XXTA 1JEVA 4DXCA 3IO6A 1LFIA 3MVYA 2I58A 3ZKLA 4EQ9A 1B58A 3G3GA 1MG1A 3RQTA 1P1WA 3QXMA 2O7UA 3V89B 3MWBA 1ANFA 5F1QA 3GLBA 4BDOA 3GXAA 4H65A 2Z8EA 1DSNA 3N5LA 4F3BA 2XXIA 3SESA 4O3BA 2RCBA 1MQIA 5H8NB 4GF8A 2VD3A 2P1SA 3EQ1A 2HZKA 3FVNA 3C33A 3MVZA 4OEVA 3WAFA 4F2OA 4F22A 2O68A 1GGGA 1TWYA 1DMBA 5DTBA 1IXCA 1QUKA 4EF1A 3VXCA 1LCFA 2D5WA 4JXIA 3K4UA 2DQVA 4NF5B 4YZZA 1UTHA 2AIXA 5H8QA 3ZKKA 4C1TA 1B1HA 4NTLA 2HAVA 3VLWA 3TAJA 1SW2A 2A5TA 3CR9A 1YTVA 4Q0CA 1A54A 1GV8A 1MXVA 2Q88A 1MXZA 2R6GE 1B7HA 1B9JA 5HPQA 1D4NA 1DPPA 4KFQA 2VOZA 2QS4A 3TUSA 2RINA 3SDFA 3IAZA 3Q29A 4R74A 4XTCQ 4FAJA 3RT6B 4ZZAA 3G7WA 2P0SA 2O51A 3MPLA 1AMFA 1LBBA 2O69A 3PGFA 5A5XA 3UN6A 1LSTA 4PFUA 1B1XA 3Q27A 5I2NB 1LGBC 1LLSA 2DVCA 3FUZA 1NH7A 2W7YA 3CG3A 3TQLA 3OENA 1I69A 3VVEA 1MXWA 1Y4CA 1B2HA 5H8SA 1H3DA 1M5BA 3LUYA 1PBQA 4BDQA 1MY1A 5FTHA 1IEJA 4F3SA 2QSXA 3SEXA 2E0SA 3SERA 4DLDA 4KYEA 4G4PA 4BDRA 1JQFA 2F97A 3HN0A 3FGSA 4OYVA 4IO4A 1P1NA 1ZLQA 1D9VA 5CMMA 2I49A 2R71A 1B52A 3TCHA 3H6VA 3W9VA 4WXJA 3MW0A 4ECFA 5EYFA 4JWOA 3OD7A 4MH5A 3R6UA 5H8FB 1XVXA 4ELPA 3MJNA 1D9YA 1HSLA 3SEWA 3TELA 4H0WA 3KN8A 1SW5A 3QYTA 1B0LA 2GH9A 3O6HA 5BUUA 4F2QA 3U72A 1AIVA 4O3CA 2E1SA 1SW4A 4ZEBA 1Y3QA 3I6VA 1B3FA 2Y7RA
chains in the Genus database with same CATH superfamily
1SW1A 1FTLA 1TXFA 3GZGA 5AA4A 3TEPA 4UA8A 2H98A 1EYKA 3THIA 3IOWA 3IX1A 2OWSA 2H4IA 1TFAA 3VLUA 1JW5A 2NUVA 5CRYA 1IZ1A 2V84A 5KCJB 1A99A 4EF2A 4YB6A 1M5FA 5DT6A 4PBHA 1ZU0A 4GXAA 4N8YA 4YKPA 1EZ9A 3KOTA 3LR1A 4G8NA 1LFGA 2R9JA 4GWSA 2LAOA 4Q8RA 1FPIA 2WX9A 4FATA 2ZYOA 5ICTA 3CFLA 4JWXA 2ZYMA 3N6TA 4DXBA 3VDFA 4IY5A 2I3VA 2CEXA 5LOMA 3K6VA 3MQ9A 2UYFA 2CMOA 1ZBMA 3PPQA 3LC8A 1UTHB 1P1UA 3TFLA 3B8BA 2PT1A 3H4ZA 2HQ0A 4OQOA 3OELA 5AA2B 5TP9B 2A5TB 4ISUA 4JSDA 3SEVA 2XXYA 3A3UA 5I56A 3H03A 1VFDA 3U93A 3LBSA 3FV1A 1A8FA 4FECA 4U21A 3KEIA 3RTWB 3VVDA 5I2KA 2CZIA 4MF3A 4GFRA 5DEXA 5L9MA 3RLFE 4NF8A 1M5DA 5CI5A 5JK4A 1QVSA 3K0VA 3V8XB 2FIEA 3Q25A 4MX6A 1PC3A 4OVRA 4OXVA 1INPA 3TMGA 1FQCA 4GRKA 4NWDA 3TPAA 1OLAA 2XXUA 3PTYA 1KZ8A 5FHMA 2NXOA 4PP0A 5ELVA 2F78A 5A5XB 3E79A 4QFKA 4X8RA 4PFIA 4XF5A 5FHOA 5LTCA 2P2AA 2VPOA 4ZEKA 3IK6B 2DS9A 4ND9A 5ICQA 3NOHA 1NV6A 2YPNA 4LN5A 5J16A 4NF6B 2ONKE 1IMCA 2QMXA 4MIJA 2OBGA 5EYGA 4L17A 3K02A 2DP8A 4RPNA 1CNQA 5JTYA 3FVGA 4OVPA 4LZ5A 4TOZA 4POWA 4G8MA 1B51A 3QUJA 3TZAA 2WKYA 3GBAA 3TODA 3O6IA 4ZEIA 2OK2A 1IQ7A 5I57A 3PMWA 3IORA 4NN3A 5B70A 4OERA 1MPCA 2Y5LA 2RC9A 1POTA 2F7AA 2XWIA 4I62A 1LAGE 2DOJA 4NEDA 2V3TA 3T9HB 1DTGA 1FJ9A 2VHAA 4F39A 1B0HA 2I3WA 4OFJA 4PE5B 2OWTA 2WYPA 4PF8A 3S9MC 5K2YA 4G8HA 3H06B 4IGTA 4U1OA 1MPBA 2Q74A 3RNNA 2XX8A 2XXHA 3E3KA 2PT2A 1NFTA 2B4LA 2Q2AA 3K2DA 1LBXA 3P7IA 3TTMA 1FBPA 4DI4B 4G61A 1Y1MA 4LA9A 1MY0A 2FA7A 3TTLA 3MSTA 2PCRA 1FPEA 2I0CA 1IMBA 1FBHA 3IB1A 3K01A 1II5A 2F36A 2ZZWA 1I6BA 4RA1A 4C1UA 3M8UA 3H6WA 1B05A 2ONRA 3EPEA 1MQJA 3DM0A 1RYOA 1NNTA 1CB6A 1JVYA 1LBZA 4EXLA 1XS5A 1N76A 2I4CA 3SKPA 3VLVA 1D3KA 4OEUA 2ABHA 1Q9DA 3TTKA 3RN8A 3TDJA 5K2XA 3O97A 4ZEFA 3PUYE 2G29A 2Y7WA 1FTKA 3HPIA 2XXWA 3V5AA 3BFUA 5ITOA 4JBZA 2O1MA 2HFBA 4NQ8A 3CFXA 3FJ7A 4N13A 4PE3A 4AQ4A 3U8QA 4RXLA 5BWJA 1IXIA 2Y7IA 3TCFA 3F11A 3BFTA 3WAEA 1FBGA 4YB7A 5DVJA 5M2VA 1MY2A 4E0XA 2YJPA 5LDZA 5EQ8A 4Z7EA 1VFEA 3O28A 1WVJA 4JB7A 3BKIB 1US5A 4WEDA 3C35A 5I59A 1QKAA 1ZKBA 2V93A 4GQOA 5HBCA 4NGUA 1FCKA 3CRBA 3IFCA 4ZDMA 4QFNA 4YKKA 1B32A 5TPAB 4MCOA 3QSLA 2XWKA 2H25A 4NWCA 1H44A 3KN7A 3FASA 2AYSA 3E4RA 3FJGA 3S9EA 2PVUA 3CHGA 1ZJLA 2BJIA 3GBBA 1URGA 3CSGA 4FJPA 1H43A 2P3VA 5KDTB 2D3IA 3KN3A 3RY3A 1UTBA 2DXRA 2Y7KA 2YLNA 1IXHA 1NI9A 2Z22A 4KCCA 4IB2A 5KZTA 5IKBA 2VT5A 4EXKA 4OESA 3HHFA 4IO2A 1QUJA 1P1QA 2V25A 5CC2A 4MLQA 3OSRA 1SDXA 3KJ7A 4F1UA 3FXBA 4DZ1A 5EYHA 1URSA 2XXPA 4G68B 4GLIA 4FIMA 4NF4A 3C31A 4IR8A 1M5CA 3QK6A 4OFOA 3VV5A 3MZ9A 2DE3A 1AOVA 4KHZE 5F24A 4OETA 3C9HA 4FORA 1PDAA 3R7XA 2UVJA 4HCWA 1NUXA 4R2FA 3FIRA 4X1DA 3C34A 1M5EA 4PDHA 4KYDA 1B46A 5H8HA 5IM2A 2Q9TA 1L5TA 4OMBA 1N3XA 3RPLA 4OA4A 1RKMA 3PMVA 4HCYA 4LQ5A 1EZOA 2QJEA 5EQ7A 4IO3A 2ONSA 4PGPA 3IL1B 1JVXA 3GYYA 4IGRA 5CMCA 1FQEA 1GVCA 1I6AA 2QMWA 3G3FA 3IOUA 1PB9A 2F35A 3D4GA 1DOTA 4N07A 2XD3A 3O2AA 3T1BA 1USYH 2XXXA 4N8GA 4PFTA 5L9SA 1MQDA 4F19A 4OENA 1Y3NA 2GHAA 4M4GA 3MP8A 1TFDA 3IJOB 3OO9A 1FQAA 2PMSA 3FVKA 4U1ZA 1DPEA 2CZKA 1EU8A 3ZS6A 2ZNTA 3IO4A 3QIMA 2NOOA 2F6GA 1MM6A 1QKBA 3U92A 1FTAA 3U94A 2DYXA 4ZEDA 4RPOA 4ELOA 3BBRA 3JV9A 5IAIA 1KA0A 4GX4A 5ITPA 2F3BA 2OZZA 1N84A 3USDA 1B7ZA 3C36A 4N6DA 2QVUA 1XC1A 4OVTA 3S2VA 5IZ3A 5FTIA 4PGNA 4LZ8A 4H5GA 4C0RA 5L8DA 1Q35A 4EUOA 5AA2D 1NNFA 4MMPA 1IMDA 5DYHA 3ILTB 1FTMA 4R9FA 3ILUB 4AS4A 1FQFA 5F7VA 3E78A 2ZMBA 4UACA 4ZE8A 1AH5A 3KBRA 4X9TA 3N6UA 4N81A 3TKDA 3B6WA 1P99A 1MH3A 3RPWA 1GTKA 5IGAA 2OX3A 2HXWA 5I84A 5DVFA 4OTEA 3HFUA 1QULA 4RNSA 1Y9UA 5CM6A 3E13X 4TLMB 3MP1A 3CSBA 2H99A 1VE4A 3DELB 4KPTA 5H8QB 4PAKA 1NV1A 4GX6A 1JETA 1LEVA 5H8NA 1KWHA 3IB2A 4IO6A 4XKNA 4G77A 3SETA 4YMAA 1OQHA 4LONB 2UYEA 5FBPA 1FQDA 3RGYA 5EHSA 1SD3A 4M1VA 3V83A 3LSWA 1AL3A 4GL8A 4IY6A 2O7IA 2I6EA 3KSJA 4K3FA 2I0BA 4OVSA 4O7IA 2L5VA 2OJTA 4KI0E 4I1DA 1B40A 3VE1B 3PUXE 4F1YA 3L6HA 2GHBA 1FBFA 1NUYA 1N3WA 4U4SA 3MPKA 1DBZA 1ZIUA 3IJXB 1SYIA 2RF1A 3I5OA 1MY4A 3OEMA 5AA1A 4THIA 4GWWA 3JZJA 3UK4A 1H45A 4XKQA 1ZTYA 2DDKA 1LFHA 4GWUA 2QFLA 2XHDA 3RTFB 3K1MA 4NAPA 2VP1A 3B6TA 4H8JA 1EYJA 3LSLA 1JNFA 2HHMA 1YXIA 3MP6A 3BIHA 2ZXTA 2JJKA 4ZS9A 3U1OA 4X1BA 3SZPA 2PFZA 3O9PA 2HPGA 1OQGA 3OOAA 1JW4A 3IR1A 3RPLB 4FE8A 1MH4A 1MM7A 4XKRA 2PBWA 3MVXA 3IOTA 1SBPA 1BTJA 2F8DA 4EQ7A 4Z0IA 3H3GA 1NV5A 1NNKA 1NV2A 3G3IA 2IEEA 4P8BA 3KZGA 1EH3A 3UGWA 3UP9A 2ZNSA 3R26A 2REJA 3PV0E 1JEUA 1RDZA 4KQPA 3T66A 5HM4B 2NVUB 1A40A 2HXRA 4N4UA 5DVIA 1MS7A 1VR5A 3CVGA 2DWAA 5TU0A 2M8CA 3DP6A 2Q2CA 2QS3A 2QL3A 3K6UA 1FPLA 4UABA 3W9WA 3UORA 3FBPA 4H67A 4MLVA 5ET6A 3HSTA 3T93B 3VVFA 1NNPA 5L9OA 1FW0A 1K9ZA 1B3GA 4MJOA 4YMBA 1USYE 1MDQA 1FPFA 4I8CA 4F3GA 3B50A 2GQ1A 4P0GA 1FBEA 3D4CA 1S50A 3T9XB 4QSDA 4MBPA 4GXSB 4HW8A 3TQWA 1J1NA 2XXRA 3LSXA 4GBWA 3C4MA 5H8FA 4QXDA 2ZNUA 3QAXA 2UXAA 1BKAA 4BDNA 4DE8A 3PPRA 3E9XA 2ZYNA 1MY3A 5AA4B 4RY1A 3QMFA 3EHUA 1NV3A 4BLAA 4DCYA 5IZ3B 1GR2A 4OHNA 4ESWA 4OFLA 3MYUA 2QS2A 4R2BA 1Z7ME 3AXFA 2V3QA 3UIFA 1R9QA 3HO7A 1YYZA 4PFRA 3CFZA 1XVYA 4PAIA 4MEVA 1F9BA 4IO7A 3TTNA 1FQBA 4WKMA 5I3SA 4GVOA 1Y3PA 4N91A 3PPOA 3RUMA 1OMPA 4MNIA 4ELQA 4GL0A 1SQYA 5AA3A 3K1NA 4AB5A 1SVXB 3S9NC 3ECRA 2PYYA 2CEYA 2Y7PA 1S7YA 4R72A 3K6WA 3VFJA 2QVVA 2UVHA 3K1PA 1XOCA 4Q30B 1BLFA 5KCJA 4NE4A 2XXVA 2O6AA 4PAFA 3FATA 3EHTA 3A09A 1NKXA 4P1LA 4NHBA 4G68C 4GWZA 4AS5A 3MAMA 3RT8A 1NMUA 3KC1A 1XHYA 1OVTA 2QRYA 1NV7A 3A3CA 1LBVA 5I56B 4H46A 4DDDA 3OXNA 5I2KB 4QRZA 4P9KA 3FJMA 4LQ2A 4NMYA 3U65A 3DLNA 2WYKA 4PQJA 5DEXB 4NF8B 1QW0A 3G3HA 1B6HA 2X7PA 1SI0A 4H8IA 1R1NA 3KC0A 3G3KA 3LSFB 1Y1ZA 2QS1A 4OVQA 5I7IA 1A7LA 1YCJA 1Y20A 2REGA 3MUQA 4XFEA 3TTRA 4QF9A 1OIBA 3PU5A 2Z8DA 5AA2A 1SYHA 3C32A 5TP9A 4E0WA 1JW1A 1IMFA 2THIA 2Q89A 4PFWA 3FZVA 1LB8A 1ZMGA 5J1DA 2AL4A 2B3BA 4ZE9A 5EHMA 4GWYA 3G3JA 4MFIA 2Z23A 2DE2A 1O63A 5CBSA 3EKIA 4F3PA 2ZZXA 3PUZE 2DWIA 2RC7A 4F18A 1AWBA 4WEPA 3M3FA 4GOTA 3MC2A 3OEKA 3N26A 5JTYB 4H1XA 3JYRA 2FHYA 3KBZA 4BDMA 3HV1A 1B3LA 4XIGQ 4OANA 4X04A 1QJMA 2B3FA 2H9BA 3L6GA 3M3LA 4JVCA 5ET5A 2O84X 3MZ1A 1ATGA 1A8EA 2VD2A 2BJJX 5I57B 5ISUA 4GWOA 3KOSA 1BIYA 1Y4TA 3OO6A 2FYIA 1IUDA 4NF6A 1PB7A 1XI6A 4KXPA 2R8TA 4PCDA 2F5XA 3S4UA 1B4ZA 2V4CA 4QFLA 2QVRA 4I3YA 4O3AA 1QUIA 5CMBA 4JVDA 4QSCA 2XA5A 1US4A 1XT8A 2F6PA 2OCUA 3T96B 5CBRA 1B7UA 1FJ6A 2Y5KA 3B7DA 3K6XA 4KR5A 4DIGA 1B4HA 4FEBA 2MKZA 2PX1A 1FPGA 3CI8A 3O29A 2HAUA 1H76A 2XWVA 3N94A 4HE2A 2VPNA 4YICA 1URDA 4F29A 3FVOA 4JDFA 2AL5A 2ALUA 4OWDA 3PMXA 1NL5A 2Q8JA 5I58A 4N17A 5IZ1A 1YPNA 3BIGA 3H6TA 4ONYA 1POY1 2F34A 1MXYA 4XXUA 4TQUQ 4U23A 4ESXA 4P0IA 1MQHA 1SPIA 1UQWA 1B5IA 1MXUA 4N6PA 4GX3A 1LBWA 2ANJA 4YKJA 4I9DA 3KG2A 4DCXA 2FBPA 4OZ9A 1O64A 1RDYA 1P1OA 4MAGA 4GWXA 3Q26A 1NV4A 1MRPA 4JWYA 2B4MA 1LAXA 3S9LC 2F7CA 1VSOA 2RC8A 1T0KA 4U22A 4POXA 3FXRA 5EQ9A 4JSOA 3EN3A 2GFEA 1FTJA 3PD8A 4H5FA 3M3KA 1N04A 4R75A 1FTOA 3KGCA 2GRVA 3TCGA 1IIWA 4U4XA 2PFYA 4AB6A 3DP4A 1B3HA 3HHGA 2DWHA 1WDNA 2XD2A 4R9GA 4RK9A 1S9TA 2RCAA 4F31B 5ET8A 3PD9A 5I59B 3EHSA 4HS7A 3FD3A 1NH8A 3PUWE 4BDLA 4LZ7A 2HZLA 4FEDA 1DK4A 3T22A 2XX7A 3PUVE 2ZYKA 3MZBA 4PBQA 1Q1KA 2XXQA 2CZLA 2V3UA 4YB5A 4ZECA 2VGQA 3DP8A 1ELJA 1A55A 4P11A 4LUBA 3MBPA 2Z8FA 1UIUA 4LP2B 4P56A 2B65A 1IITA 2ZZVA 4OVJA 1UTBB 4H6DA 1B3EA 3IFAA 4ELRA 3B6QA 5IZZA 4Q5TA 4DXUA 4YU0A 1YZ0A 3FV2A 2DE4A 2O1LA 2DSFA 3D1RA 3PPPA 1I6QA 1BP5A 1R9LA 1IXGA 2X7QA 5FHNA 1N0TA 2DWJA 5B7DA 2OWZA 1FRPA 5TPAA 4NF5A 1LAHE 4G2ZA 3KFMA 2F7BA 4PF6A 1B5HA 3IOVA 4H45A 1OLCA 1QGXA 3CG1A 4LVQA 3OO7A 3T0JA 2Y84A 1LB9A 4YKIA 5KDTA 1K9YA 4NF4B 4YAHX 4R6YA 4QHQA 3FXUA 2DVZA 4PFBA 2G93A 1RYXA 5ESYA 4F1VA 2OLBA 4XKPA 1LBCA 1LAFE 4KYSA 4R73A 1KA1A 1MDP1 2FVZA 3VXBA 1O7TA 2HCAA 4R6KA 4KD5A 4GIZA 4EQBA 1TT1A 5H8HB 1DTZA 4NG7A 4N15A 1BK4A 4FBPA 2KR0A 3TYHA 2P3NA 5JEIA 4G68A 3KJTA 1UIVA 3ZSFA 1SI1A 3T9UA 1B5JA 3SEYA 4RYAA 5I2NA 1MQGA 4TLLB 1NUWA 3HCQA 4EDPA 2I4BA 1FSAA 4IO5A 1PEBA 4R6HA 4O8MA 3OSQA 4U2RA 3K00A 4RK2A 1DCUA 2IA4A 2DXYA 1HSEA 5DW8A 3H6UA 5T3JA 2ESNA 4QSEA 3O66A 4RJZA 4PFYA 2XX9A 3OO8A 2X26A 4NX1A 4LATA 3PPNA 4KCDA 5I58B 3MVWA 3CIJA 4HE1A 3SEUA 1MPDA 2I48A 2HEUA 2KQZA 2KLFA 1N7XA 3ODBA 3FXQA 3I3VA 4ZZEA 4HTGA 1CE2A 3ONMA 5AE4A 3EF7A 1PB8A 3KSXA 1N7WA 1MXXA 3H7MA 3QUFA 4PETA 3W15C 3OMBA 1IMEA 1WODA 2UVGA 4QFPA 1FPBA 1EZPA 1OVBA 3Q28A 1YAEA 2UVIA 3T9VA 1HSJA 3IB0A 3UA8A 1R6ZA 4PTKA 4P1EA 4GD5A 5CMKA 4X48A 2RKMA 4QFOA 2NWJA 4PC9A 1PBPA 3O6GA 2FIXA 4O94A 1Z7NE 2D21A 1NUZA 2FNCA 2H5YA 1LCTA 2WBBA 2WEFA 4P3LA 5I5PA 2A5SA 1FPKA 2QPQA 2XXTA 1JEVA 4DXCA 3IO6A 1LFIA 3MVYA 2I58A 3ZKLA 4EQ9A 1B58A 1FPDA 3G3GA 1MG1A 3RQTA 1P1WA 3QXMA 2O7UA 3V89B 3MWBA 1ANFA 5F1QA 1FPJA 4HE0A 3LUZA 3GLBA 4BDOA 1G0HA 3GXAA 4H65A 2Z8EA 1DSNA 3N5LA 4F3BA 2XXIA 3SESA 4O3BA 2RCBA 1MQIA 5H8NB 4GF8A 2VD3A 4XEQA 2P1SA 3EQ1A 2HZKA 3FVNA 3C33A 3MVZA 4OEVA 3WAFA 4F2OA 2F3DA 1LBYA 2WBDA 4F22A 2O68A 4JVIA 1GGGA 1TWYA 1DMBA 5DTBA 1IXCA 1QUKA 4MNPA 4EF1A 3VXCA 1LCFA 2D5WA 4JXIA 3K4UA 2DQVA 4P47A 1G0IA 4NF5B 4YZZA 1UTHA 2AIXA 5H8QA 3ZKKA 4C1TA 1B1HA 4NTLA 2HAVA 4I3EA 3VLWA 3TAJA 1SW2A 2A5TA 3CR9A 1YTVA 4Q0CA 3ISPA 1A54A 1GV8A 1MXVA 3ROJA 2Q88A 1MXZA 2R6GE 4O7MA 1B7HA 1B9JA 5HPQA 1D4NA 1DPPA 4KFQA 2VOZA 2QS4A 3TUSA 1FBCA 4I40A 2RINA 3SDFA 3IAZA 4QBAA 4MNCA 3Q29A 4R74A 4XTCQ 4FAJA 3RT6B 4ZZAA 2CZHA 3G7WA 2P0SA 2O51A 3MPLA 1EYIA 4DI3D 1AMFA 4HXVA 1LBBA 4N6KA 2O69A 3PGFA 5A5XA 3UN6A 1LSTA 4PFUA 1B1XA 3Q27A 5I2NB 1LGBC 1LLSA 2DVCA 3FUZA 1NH7A 2W7YA 1VDWA 3CG3A 3TQLA 1D9QA 3OENA 1I69A 3VVEA 1MXWA 1Y4CA 1B2HA 5H8SA 4PDDA 5A5LA 1JP4A 1H3DA 1M5BA 3LUYA 1IMAA 1PBQA 4BDQA 1MY1A 5FTHA 1IEJA 4F3SA 2QSXA 3SEXA 2E0SA 3SERA 4DLDA 4KYEA 4G4PA 4BDRA 1JQFA 2F97A 3HN0A 3FGSA 4OYVA 1NV0A 4IO4A 1P1NA 1ZLQA 1D9VA 5CMMA 4MHFA 2I49A 2R71A 1B52A 3TCHA 3H6VA 3W9VA 4WXJA 3MW0A 4ECFA 1FBDA 5EYFA 4JWOA 3OD7A 4MH5A 3R6UA 5H8FB 1XVXA 4ELPA 3MJNA 1D9YA 1HSLA 3SEWA 3TELA 3LV0A 2XXKA 4H0WA 3A29A 1RDXA 3KN8A 1SW5A 3QYTA 1B0LA 2GH9A 5EQAA 3O6HA 4GBVA 4NF0A 5BUUA 2XWOA 4F2QA 3U72A 1AIVA 3RYDA 4O3CA 2E1SA 1SW4A 2Q8MA 4ZEBA 5ET7A 1Y3QA 3I6VA 1B3FA 2Y7RA
chains in the Genus database with same CATH topology
1SW1A 1FTLA 1TXFA 3GZGA 5AA4A 3TEPA 4UA8A 2H98A 3THIA 3IOWA 3IX1A 2OWSA 2H4IA 1TFAA 3VLUA 1JW5A 2NUVA 5CRYA 1IZ1A 2V84A 5KCJB 1A99A 4EF2A 4YB6A 1M5FA 5DT6A 1ZU0A 4GXAA 4YKPA 1EZ9A 3KOTA 3LR1A 4G8NA 1LFGA 2R9JA 2LAOA 4Q8RA 4FATA 2ZYOA 5ICTA 3CFLA 4JWXA 2ZYMA 3N6TA 4DXBA 3VDFA 4IY5A 2I3VA 5LOMA 3K6VA 3MQ9A 2UYFA 2CMOA 1ZBMA 3PPQA 3LC8A 1UTHB 1P1UA 3TFLA 3H4ZA 2PT1A 2HQ0A 4OQOA 3OELA 5AA2B 5TP9B 2A5TB 4ISUA 4JSDA 3SEVA 2XXYA 3A3UA 5I56A 3H03A 1VFDA 3U93A 3LBSA 3FV1A 1A8FA 4FECA 4U21A 3KEIA 3RTWB 3VVDA 5I2KA 4MF3A 4GFRA 5DEXA 5L9MA 3RLFE 4NF8A 1M5DA 5CI5A 5JK4A 1QVSA 3K0VA 3V8XB 3Q25A 1PC3A 4OXVA 3TMGA 1FQCA 4GRKA 4NWDA 3TPAA 1OLAA 2XXUA 5FHMA 2NXOA 4PP0A 5ELVA 2F78A 5A5XB 4QFKA 5FHOA 2P2AA 4ZEKA 3IK6B 2DS9A 4ND9A 5ICQA 2YPNA 4NF6B 2ONKE 2QMXA 2OBGA 4L17A 3K02A 2DP8A 4RPNA 5JTYA 3FVGA 4LZ5A 4TOZA 4POWA 4G8MA 1B51A 3QUJA 3TZAA 2WKYA 3GBAA 3TODA 3O6IA 4ZEIA 2OK2A 1IQ7A 5I57A 3PMWA 3IORA 5B70A 4OERA 1MPCA 2RC9A 1POTA 2F7AA 4I62A 1LAGE 2DOJA 4NEDA 2V3TA 3T9HB 1DTGA 2VHAA 4F39A 1B0HA 2I3WA 4OFJA 4PE5B 2OWTA 3S9MC 5K2YA 4G8HA 3H06B 4IGTA 4U1OA 1MPBA 3RNNA 2XX8A 2XXHA 3E3KA 2PT2A 1NFTA 2Q2AA 3K2DA 3P7IA 3TTMA 1Y1MA 4LA9A 1MY0A 2FA7A 3TTLA 2I0CA 3IB1A 3K01A 1II5A 2F36A 1I6BA 4RA1A 4C1UA 3M8UA 3H6WA 1B05A 2ONRA 3EPEA 1MQJA 3DM0A 1RYOA 1NNTA 1CB6A 1JVYA 4EXLA 1XS5A 1N76A 2I4CA 3SKPA 3VLVA 1D3KA 4OEUA 2ABHA 3TTKA 3RN8A 3TDJA 5K2XA 3O97A 4ZEFA 3PUYE 2G29A 2Y7WA 1FTKA 3HPIA 2XXWA 3V5AA 3BFUA 5ITOA 4JBZA 2O1MA 2HFBA 3CFXA 3FJ7A 4N13A 4AQ4A 3U8QA 4RXLA 5BWJA 1IXIA 2Y7IA 3TCFA 3F11A 3BFTA 3WAEA 4YB7A 5DVJA 5M2VA 1MY2A 4E0XA 2YJPA 4Z7EA 1VFEA 3O28A 1WVJA 4JB7A 3BKIB 1US5A 4WEDA 3C35A 5I59A 1QKAA 1ZKBA 2V93A 4GQOA 5HBCA 1FCKA 3CRBA 4ZDMA 4QFNA 4YKKA 1B32A 5TPAB 3QSLA 2H25A 4NWCA 1H44A 3KN7A 3FASA 2AYSA 3E4RA 3FJGA 3S9EA 2PVUA 1ZJLA 3GBBA 1URGA 3CSGA 4FJPA 1H43A 5KDTB 2D3IA 3KN3A 3RY3A 1UTBA 2DXRA 2Y7KA 2YLNA 1IXHA 2Z22A 4KCCA 4IB2A 5KZTA 5IKBA 4EXKA 4OESA 3HHFA 4IO2A 1QUJA 1P1QA 2V25A 5CC2A 4MLQA 3OSRA 1SDXA 3KJ7A 4F1UA 4DZ1A 1URSA 2XXPA 4G68B 4GLIA 4FIMA 4NF4A 3C31A 1M5CA 3QK6A 4OFOA 3VV5A 3MZ9A 2DE3A 1AOVA 4KHZE 4OETA 3C9HA 4FORA 1PDAA 3R7XA 2UVJA 4HCWA 4R2FA 3FIRA 4X1DA 3C34A 1M5EA 4KYDA 1B46A 5H8HA 2Q9TA 1L5TA 4OMBA 1N3XA 1RKMA 3PMVA 4HCYA 4LQ5A 1EZOA 2QJEA 4IO3A 2ONSA 3IL1B 1JVXA 4IGRA 5CMCA 1FQEA 1GVCA 1I6AA 2QMWA 3G3FA 3IOUA 1PB9A 2F35A 3D4GA 1DOTA 4N07A 2XD3A 3O2AA 1USYH 2XXXA 4PFTA 5L9SA 1MQDA 4F19A 4OENA 1Y3NA 2GHAA 4M4GA 3MP8A 1TFDA 3IJOB 3OO9A 1FQAA 2PMSA 3FVKA 4U1ZA 1DPEA 1EU8A 3ZS6A 2ZNTA 3IO4A 3QIMA 2NOOA 2F6GA 1MM6A 1QKBA 3U92A 3U94A 2DYXA 4ZEDA 4RPOA 4ELOA 3BBRA 3JV9A 5IAIA 5ITPA 2OZZA 1N84A 3USDA 1B7ZA 3C36A 1XC1A 3S2VA 5FTIA 4LZ8A 4H5GA 4C0RA 5L8DA 1Q35A 4EUOA 5AA2D 1NNFA 5DYHA 3ILTB 1FTMA 4R9FA 3ILUB 1FQFA 5F7VA 2ZMBA 4UACA 4ZE8A 1AH5A 3KBRA 4X9TA 3N6UA 3TKDA 3B6WA 1P99A 1MH3A 3RPWA 1GTKA 2HXWA 5I84A 5DVFA 4OTEA 1QULA 4RNSA 1Y9UA 5CM6A 3E13X 4TLMB 3MP1A 3CSBA 2H99A 1VE4A 3DELB 4KPTA 5H8QB 1JETA 5H8NA 1KWHA 3IB2A 4IO6A 4XKNA 4G77A 3SETA 4YMAA 1OQHA 4LONB 2UYEA 1FQDA 3RGYA 5EHSA 1SD3A 4M1VA 3V83A 3LSWA 1AL3A 4GL8A 4IY6A 2O7IA 2I6EA 3KSJA 4K3FA 2I0BA 2OJTA 4KI0E 4I1DA 1B40A 3VE1B 3PUXE 4F1YA 3L6HA 2GHBA 1N3WA 4U4SA 3MPKA 1ZIUA 3IJXB 1SYIA 2RF1A 3I5OA 1MY4A 3OEMA 5AA1A 4THIA 3JZJA 3UK4A 1H45A 4XKQA 1ZTYA 1LFHA 2XHDA 3RTFB 3K1MA 2VP1A 3B6TA 4H8JA 3LSLA 1JNFA 3MP6A 2ZXTA 4ZS9A 3U1OA 4X1BA 3O9PA 1OQGA 3OOAA 1JW4A 3IR1A 4FE8A 1MH4A 1MM7A 4XKRA 2PBWA 3MVXA 3IOTA 1SBPA 1BTJA 2F8DA 4EQ7A 4Z0IA 3H3GA 1NNKA 3G3IA 2IEEA 3KZGA 1EH3A 3UGWA 3UP9A 2ZNSA 3R26A 2REJA 3PV0E 1JEUA 4KQPA 3T66A 5HM4B 2NVUB 1A40A 5DVIA 1MS7A 1VR5A 3CVGA 2DWAA 5TU0A 2M8CA 3DP6A 2Q2CA 2QS3A 2QL3A 3K6UA 3W9WA 3UORA 4H67A 4MLVA 3HSTA 3T93B 3VVFA 1NNPA 5L9OA 1FW0A 1B3GA 4YMBA 1USYE 1MDQA 4F3GA 4I8CA 4P0GA 3D4CA 1S50A 3T9XB 4QSDA 4MBPA 4GXSB 4HW8A 3TQWA 1J1NA 2XXRA 3LSXA 3C4MA 5H8FA 2ZNUA 3QAXA 2UXAA 1BKAA 4BDNA 4DE8A 3PPRA 3E9XA 2ZYNA 1MY3A 5AA4B 4RY1A 3EHUA 4BLAA 4DCYA 1GR2A 4OHNA 4ESWA 4OFLA 2QS2A 4R2BA 1Z7ME 3AXFA 2V3QA 3UIFA 1R9QA 3HO7A 3CFZA 1XVYA 1F9BA 4IO7A 3TTNA 1FQBA 4WKMA 4GVOA 1Y3PA 3PPOA 3RUMA 1OMPA 4ELQA 4GL0A 1SQYA 5AA3A 3K1NA 4AB5A 1SVXB 3S9NC 3ECRA 2PYYA 2Y7PA 1S7YA 4R72A 3K6WA 3VFJA 2UVHA 3K1PA 1XOCA 4Q30B 1BLFA 5KCJA 4NE4A 2XXVA 2O6AA 3FATA 3EHTA 3A09A 1NKXA 4G68C 3MAMA 3RT8A 1NMUA 1XHYA 1OVTA 2QRYA 3A3CA 5I56B 4DDDA 3OXNA 5I2KB 4QRZA 3FJMA 4LQ2A 4NMYA 3DLNA 4PQJA 5DEXB 4NF8B 1QW0A 3G3HA 1B6HA 2X7PA 1SI0A 4H8IA 1R1NA 3G3KA 3LSFB 1Y1ZA 2QS1A 1A7LA 1YCJA 1Y20A 2REGA 3MUQA 3TTRA 4QF9A 1OIBA 3PU5A 2Z8DA 5AA2A 1SYHA 3C32A 5TP9A 4E0WA 1JW1A 2THIA 2Q89A 4PFWA 3FZVA 1LB8A 1ZMGA 5J1DA 2AL4A 2B3BA 4ZE9A 5EHMA 3G3JA 4MFIA 2Z23A 2DE2A 1O63A 5CBSA 4F3PA 3PUZE 2DWIA 2RC7A 4F18A 4WEPA 3M3FA 4GOTA 3MC2A 3OEKA 3N26A 5JTYB 4H1XA 3JYRA 4BDMA 3HV1A 1B3LA 4XIGQ 1QJMA 2B3FA 2H9BA 3L6GA 3M3LA 2O84X 3MZ1A 1ATGA 1A8EA 2VD2A 2BJJX 5I57B 5ISUA 4GWOA 3KOSA 1BIYA 1Y4TA 3OO6A 2FYIA 1IUDA 4NF6A 1PB7A 2F5XA 3S4UA 1B4ZA 4QFLA 4O3AA 1QUIA 5CMBA 4QSCA 1US4A 1XT8A 2F6PA 2OCUA 3T96B 5CBRA 1B7UA 3B7DA 3K6XA 4KR5A 4DIGA 1B4HA 4FEBA 2PX1A 3CI8A 3O29A 2HAUA 1H76A 3N94A 4YICA 1URDA 4F29A 3FVOA 4JDFA 2AL5A 2ALUA 4OWDA 3PMXA 1NL5A 2Q8JA 5I58A 1YPNA 3H6TA 4ONYA 1POY1 2F34A 1MXYA 4XXUA 4TQUQ 4U23A 4ESXA 4P0IA 1MQHA 1UQWA 1B5IA 1MXUA 4N6PA 2ANJA 4YKJA 4I9DA 3KG2A 4DCXA 4OZ9A 1O64A 1P1OA 3Q26A 1MRPA 4JWYA 1LAXA 3S9LC 2F7CA 1VSOA 2RC8A 1T0KA 4U22A 4POXA 3FXRA 4JSOA 3EN3A 2GFEA 1FTJA 3PD8A 4H5FA 3M3KA 1N04A 4R75A 1FTOA 3KGCA 2GRVA 3TCGA 1IIWA 4U4XA 4AB6A 3DP4A 1B3HA 3HHGA 2DWHA 1WDNA 2XD2A 4R9GA 4RK9A 1S9TA 2RCAA 4F31B 3PD9A 5I59B 3EHSA 4HS7A 3FD3A 1NH8A 3PUWE 4BDLA 4LZ7A 2HZLA 4FEDA 3T22A 2XX7A 3PUVE 2ZYKA 3MZBA 1Q1KA 2XXQA 2CZLA 2V3UA 4YB5A 4ZECA 2VGQA 3DP8A 1ELJA 1A55A 4P11A 4LUBA 3MBPA 2Z8FA 1UIUA 4LP2B 2B65A 1IITA 4OVJA 1UTBB 4H6DA 1B3EA 4ELRA 3B6QA 4Q5TA 4DXUA 4YU0A 3FV2A 2DE4A 2O1LA 2DSFA 3PPPA 1I6QA 1BP5A 1R9LA 1IXGA 2X7QA 5FHNA 1N0TA 5B7DA 2DWJA 5TPAA 4NF5A 1LAHE 4G2ZA 3KFMA 2F7BA 1B5HA 3IOVA 1OLCA 3CG1A 4LVQA 3OO7A 2Y84A 1LB9A 4YKIA 5KDTA 4NF4B 4YAHX 4R6YA 4QHQA 3FXUA 2DVZA 2G93A 1RYXA 4F1VA 2OLBA 4XKPA 1LBCA 1LAFE 4KYSA 4R73A 1MDP1 3VXBA 1O7TA 2HCAA 4R6KA 4KD5A 4GIZA 4EQBA 1TT1A 5H8HB 1DTZA 3TYHA 5JEIA 4G68A 3KJTA 1UIVA 3ZSFA 1SI1A 3T9UA 1B5JA 3SEYA 4RYAA 5I2NA 1MQGA 4TLLB 3HCQA 4EDPA 2I4BA 4IO5A 1PEBA 4R6HA 3OSQA 4U2RA 3K00A 4RK2A 2IA4A 2DXYA 1HSEA 3H6UA 2ESNA 4QSEA 3O66A 4RJZA 4PFYA 2XX9A 3OO8A 2X26A 4LATA 3PPNA 4KCDA 5I58B 3MVWA 3CIJA 3SEUA 1MPDA 2I48A 2HEUA 3ODBA 2KLFA 1N7XA 3FXQA 3I3VA 4ZZEA 4HTGA 1CE2A 3ONMA 5AE4A 3EF7A 1PB8A 3KSXA 1N7WA 1MXXA 3H7MA 3QUFA 4PETA 3W15C 3OMBA 1WODA 2UVGA 4QFPA 1EZPA 1OVBA 3Q28A 1YAEA 2UVIA 3T9VA 1HSJA 3IB0A 3UA8A 1R6ZA 4GD5A 5CMKA 4X48A 2RKMA 4QFOA 2NWJA 1PBPA 3O6GA 1Z7NE 2D21A 2FNCA 2H5YA 1LCTA 2A5SA 2QPQA 2XXTA 1JEVA 4DXCA 3IO6A 1LFIA 3MVYA 2I58A 3ZKLA 4EQ9A 1B58A 3G3GA 1MG1A 3RQTA 1P1WA 3QXMA 2O7UA 3V89B 3MWBA 1ANFA 5F1QA 3GLBA 4BDOA 3GXAA 4H65A 2Z8EA 1DSNA 3N5LA 4F3BA 2XXIA 3SESA 4O3BA 2RCBA 1MQIA 5H8NB 4GF8A 2VD3A 2P1SA 3EQ1A 2HZKA 3FVNA 3C33A 3MVZA 4OEVA 3WAFA 4F2OA 4F22A 2O68A 1GGGA 1TWYA 1DMBA 5DTBA 1IXCA 1QUKA 4EF1A 3VXCA 1LCFA 2D5WA 4JXIA 3K4UA 2DQVA 4NF5B 4YZZA 1UTHA 2AIXA 5H8QA 3ZKKA 4C1TA 1B1HA 4NTLA 2HAVA 3VLWA 3TAJA 1SW2A 2A5TA 3CR9A 1YTVA 4Q0CA 1A54A 1GV8A 1MXVA 2Q88A 1MXZA 2R6GE 1B7HA 1B9JA 5HPQA 1D4NA 1DPPA 4KFQA 2VOZA 2QS4A 3TUSA 2RINA 3SDFA 3IAZA 3Q29A 4R74A 4XTCQ 4FAJA 3RT6B 4ZZAA 3G7WA 2P0SA 2O51A 3MPLA 1AMFA 1LBBA 2O69A 3PGFA 5A5XA 3UN6A 1LSTA 4PFUA 1B1XA 3Q27A 5I2NB 1LGBC 1LLSA 2DVCA 3FUZA 1NH7A 2W7YA 3CG3A 3TQLA 3OENA 1I69A 3VVEA 1MXWA 1Y4CA 1B2HA 5H8SA 1H3DA 1M5BA 3LUYA 1PBQA 4BDQA 1MY1A 5FTHA 1IEJA 4F3SA 2QSXA 3SEXA 2E0SA 3SERA 4DLDA 4KYEA 4G4PA 4BDRA 1JQFA 2F97A 3HN0A 3FGSA 4OYVA 4IO4A 1P1NA 1ZLQA 1D9VA 5CMMA 2I49A 2R71A 1B52A 3TCHA 3H6VA 3W9VA 4WXJA 3MW0A 4ECFA 5EYFA 4JWOA 3OD7A 4MH5A 3R6UA 5H8FB 1XVXA 4ELPA 3MJNA 1D9YA 1HSLA 3SEWA 3TELA 4H0WA 3KN8A 1SW5A 3QYTA 1B0LA 2GH9A 3O6HA 5BUUA 4F2QA 3U72A 1AIVA 4O3CA 2E1SA 1SW4A 4ZEBA 1Y3QA 3I6VA 1B3FA 2Y7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SW1 A;  1FTL A;  1TXF A;  3GZG A;  5AA4 A;  3TEP A;  4UA8 A;  2H98 A;  3THI A;  3IOW A;  3IX1 A;  2OWS A;  2H4I A;  1TFA A;  3VLU A;  1JW5 A;  2NUV A;  5CRY A;  1IZ1 A;  2V84 A;  5KCJ B;  1A99 A;  4EF2 A;  4YB6 A;  1M5F A;  5DT6 A;  1ZU0 A;  4GXA A;  4YKP A;  1EZ9 A;  3KOT A;  3LR1 A;  4G8N A;  1LFG A;  2R9J A;  2LAO A;  4Q8R A;  4FAT A;  2ZYO A;  5ICT A;  3CFL A;  4JWX A;  2ZYM A;  3N6T A;  4DXB A;  3VDF A;  4IY5 A;  2I3V A;  5LOM A;  3K6V A;  3MQ9 A;  2UYF A;  2CMO A;  1ZBM A;  3PPQ A;  3LC8 A;  1UTH B;  1P1U A;  3TFL A;  3H4Z A;  2PT1 A;  2HQ0 A;  4OQO A;  3OEL A;  5AA2 B;  5TP9 B;  2A5T B;  4ISU A;  4JSD A;  3SEV A;  2XXY A;  3A3U A;  5I56 A;  3H03 A;  1VFD A;  3U93 A;  3LBS A;  3FV1 A;  1A8F A;  4FEC A;  4U21 A;  3KEI A;  3RTW B;  3VVD A;  5I2K A;  4MF3 A;  4GFR A;  5DEX A;  5L9M A;  3RLF E;  4NF8 A;  1M5D A;  5CI5 A;  5JK4 A;  1QVS A;  3K0V A;  3V8X B;  3Q25 A;  1PC3 A;  4OXV A;  3TMG A;  1FQC A;  4GRK A;  4NWD A;  3TPA A;  1OLA A;  2XXU A;  5FHM A;  2NXO A;  4PP0 A;  5ELV A;  2F78 A;  5A5X B;  4QFK A;  5FHO A;  2P2A A;  4ZEK A;  3IK6 B;  2DS9 A;  4ND9 A;  5ICQ A;  2YPN A;  4NF6 B;  2ONK E;  2QMX A;  2OBG A;  4L17 A;  3K02 A;  2DP8 A;  4RPN A;  5JTY A;  3FVG A;  4LZ5 A;  4TOZ A;  4POW A;  4G8M A;  1B51 A;  3QUJ A;  3TZA A;  2WKY A;  3GBA A;  3TOD A;  3O6I A;  4ZEI A;  2OK2 A;  1IQ7 A;  5I57 A;  3PMW A;  3IOR A;  5B70 A;  4OER A;  1MPC A;  2RC9 A;  1POT A;  2F7A A;  4I62 A;  1LAG E;  2DOJ A;  4NED A;  2V3T A;  3T9H B;  1DTG A;  2VHA A;  4F39 A;  1B0H A;  2I3W A;  4OFJ A;  4PE5 B;  2OWT A;  3S9M C;  5K2Y A;  4G8H A;  3H06 B;  4IGT A;  4U1O A;  1MPB A;  3RNN A;  2XX8 A;  2XXH A;  3E3K A;  2PT2 A;  1NFT A;  2Q2A A;  3K2D A;  3P7I A;  3TTM A;  1Y1M A;  4LA9 A;  1MY0 A;  2FA7 A;  3TTL A;  2I0C A;  3IB1 A;  3K01 A;  1II5 A;  2F36 A;  1I6B A;  4RA1 A;  4C1U A;  3M8U A;  3H6W A;  1B05 A;  2ONR A;  3EPE A;  1MQJ A;  3DM0 A;  1RYO A;  1NNT A;  1CB6 A;  1JVY A;  4EXL A;  1XS5 A;  1N76 A;  2I4C A;  3SKP A;  3VLV A;  1D3K A;  4OEU A;  2ABH A;  3TTK A;  3RN8 A;  3TDJ A;  5K2X A;  3O97 A;  4ZEF A;  3PUY E;  2G29 A;  2Y7W A;  1FTK A;  3HPI A;  2XXW A;  3V5A A;  3BFU A;  5ITO A;  4JBZ A;  2O1M A;  2HFB A;  3CFX A;  3FJ7 A;  4N13 A;  4AQ4 A;  3U8Q A;  4RXL A;  5BWJ A;  1IXI A;  2Y7I A;  3TCF A;  3F11 A;  3BFT A;  3WAE A;  4YB7 A;  5DVJ A;  5M2V A;  1MY2 A;  4E0X A;  2YJP A;  4Z7E A;  1VFE A;  3O28 A;  1WVJ A;  4JB7 A;  3BKI B;  1US5 A;  4WED A;  3C35 A;  5I59 A;  1QKA A;  1ZKB A;  2V93 A;  4GQO A;  5HBC A;  1FCK A;  3CRB A;  4ZDM A;  4QFN A;  4YKK A;  1B32 A;  5TPA B;  3QSL A;  2H25 A;  4NWC A;  1H44 A;  3KN7 A;  3FAS A;  2AYS A;  3E4R A;  3FJG A;  3S9E A;  2PVU A;  1ZJL A;  3GBB A;  1URG A;  3CSG A;  4FJP A;  1H43 A;  5KDT B;  2D3I A;  3KN3 A;  3RY3 A;  1UTB A;  2DXR A;  2Y7K A;  2YLN A;  1IXH A;  2Z22 A;  4KCC A;  4IB2 A;  5KZT A;  5IKB A;  4EXK A;  4OES A;  3HHF A;  4IO2 A;  1QUJ A;  1P1Q A;  2V25 A;  5CC2 A;  4MLQ A;  3OSR A;  1SDX A;  3KJ7 A;  4F1U A;  4DZ1 A;  1URS A;  2XXP A;  4G68 B;  4GLI A;  4FIM A;  4NF4 A;  3C31 A;  1M5C A;  3QK6 A;  4OFO A;  3VV5 A;  3MZ9 A;  2DE3 A;  1AOV A;  4KHZ E;  4OET A;  3C9H A;  4FOR A;  1PDA A;  3R7X A;  2UVJ A;  4HCW A;  4R2F A;  3FIR A;  4X1D A;  3C34 A;  1M5E A;  4KYD A;  1B46 A;  5H8H A;  2Q9T A;  1L5T A;  4OMB A;  1N3X A;  1RKM A;  3PMV A;  4HCY A;  4LQ5 A;  1EZO A;  2QJE A;  4IO3 A;  2ONS A;  3IL1 B;  1JVX A;  4IGR A;  5CMC A;  1FQE A;  1GVC A;  1I6A A;  2QMW A;  3G3F A;  3IOU A;  1PB9 A;  2F35 A;  3D4G A;  1DOT A;  4N07 A;  2XD3 A;  3O2A A;  1USY H;  2XXX A;  4PFT A;  5L9S A;  1MQD A;  4F19 A;  4OEN A;  1Y3N A;  2GHA A;  4M4G A;  3MP8 A;  1TFD A;  3IJO B;  3OO9 A;  1FQA A;  2PMS A;  3FVK A;  4U1Z A;  1DPE A;  1EU8 A;  3ZS6 A;  2ZNT A;  3IO4 A;  3QIM A;  2NOO A;  2F6G A;  1MM6 A;  1QKB A;  3U92 A;  3U94 A;  2DYX A;  4ZED A;  4RPO A;  4ELO A;  3BBR A;  3JV9 A;  5IAI A;  5ITP A;  2OZZ A;  1N84 A;  3USD A;  1B7Z A;  3C36 A;  1XC1 A;  3S2V A;  5FTI A;  4LZ8 A;  4H5G A;  4C0R A;  5L8D A;  1Q35 A;  4EUO A;  5AA2 D;  1NNF A;  5DYH A;  3ILT B;  1FTM A;  4R9F A;  3ILU B;  1FQF A;  5F7V A;  2ZMB A;  4UAC A;  4ZE8 A;  1AH5 A;  3KBR A;  4X9T A;  3N6U A;  3TKD A;  3B6W A;  1P99 A;  1MH3 A;  3RPW A;  1GTK A;  2HXW A;  5I84 A;  5DVF A;  4OTE A;  1QUL A;  4RNS A;  1Y9U A;  5CM6 A;  3E13 X;  4TLM B;  3MP1 A;  3CSB A;  2H99 A;  1VE4 A;  3DEL B;  4KPT A;  5H8Q B;  1JET A;  5H8N A;  1KWH A;  3IB2 A;  4IO6 A;  4XKN A;  4G77 A;  3SET A;  4YMA A;  1OQH A;  4LON B;  2UYE A;  1FQD A;  3RGY A;  5EHS A;  1SD3 A;  4M1V A;  3V83 A;  3LSW A;  1AL3 A;  4GL8 A;  4IY6 A;  2O7I A;  2I6E A;  3KSJ A;  4K3F A;  2I0B A;  2OJT A;  4KI0 E;  4I1D A;  1B40 A;  3VE1 B;  3PUX E;  4F1Y A;  3L6H A;  2GHB A;  1N3W A;  4U4S A;  3MPK A;  1ZIU A;  3IJX B;  1SYI A;  2RF1 A;  3I5O A;  1MY4 A;  3OEM A;  5AA1 A;  4THI A;  3JZJ A;  3UK4 A;  1H45 A;  4XKQ A;  1ZTY A;  1LFH A;  2XHD A;  3RTF B;  3K1M A;  2VP1 A;  3B6T A;  4H8J A;  3LSL A;  1JNF A;  3MP6 A;  2ZXT A;  4ZS9 A;  3U1O A;  4X1B A;  3O9P A;  1OQG A;  3OOA A;  1JW4 A;  3IR1 A;  4FE8 A;  1MH4 A;  1MM7 A;  4XKR A;  2PBW A;  3MVX A;  3IOT A;  1SBP A;  1BTJ A;  2F8D A;  4EQ7 A;  4Z0I A;  3H3G A;  1NNK A;  3G3I A;  2IEE A;  3KZG A;  1EH3 A;  3UGW A;  3UP9 A;  2ZNS A;  3R26 A;  2REJ A;  3PV0 E;  1JEU A;  4KQP A;  3T66 A;  5HM4 B;  2NVU B;  1A40 A;  5DVI A;  1MS7 A;  1VR5 A;  3CVG A;  2DWA A;  5TU0 A;  2M8C A;  3DP6 A;  2Q2C A;  2QS3 A;  2QL3 A;  3K6U A;  3W9W A;  3UOR A;  4H67 A;  4MLV A;  3HST A;  3T93 B;  3VVF A;  1NNP A;  5L9O A;  1FW0 A;  1B3G A;  4YMB A;  1USY E;  1MDQ A;  4F3G A;  4I8C A;  4P0G A;  3D4C A;  1S50 A;  3T9X B;  4QSD A;  4MBP A;  4GXS B;  4HW8 A;  3TQW A;  1J1N A;  2XXR A;  3LSX A;  3C4M A;  5H8F A;  2ZNU A;  3QAX A;  2UXA A;  1BKA A;  4BDN A;  4DE8 A;  3PPR A;  3E9X A;  2ZYN A;  1MY3 A;  5AA4 B;  4RY1 A;  3EHU A;  4BLA A;  4DCY A;  1GR2 A;  4OHN A;  4ESW A;  4OFL A;  2QS2 A;  4R2B A;  1Z7M E;  3AXF A;  2V3Q A;  3UIF A;  1R9Q A;  3HO7 A;  3CFZ A;  1XVY A;  1F9B A;  4IO7 A;  3TTN A;  1FQB A;  4WKM A;  4GVO A;  1Y3P A;  3PPO A;  3RUM A;  1OMP A;  4ELQ A;  4GL0 A;  1SQY A;  5AA3 A;  3K1N A;  4AB5 A;  1SVX B;  3S9N C;  3ECR A;  2PYY A;  2Y7P A;  1S7Y A;  4R72 A;  3K6W A;  3VFJ A;  2UVH A;  3K1P A;  1XOC A;  4Q30 B;  1BLF A;  5KCJ A;  4NE4 A;  2XXV A;  2O6A A;  3FAT A;  3EHT A;  3A09 A;  1NKX A;  4G68 C;  3MAM A;  3RT8 A;  1NMU A;  1XHY A;  1OVT A;  2QRY A;  3A3C A;  5I56 B;  4DDD A;  3OXN A;  5I2K B;  4QRZ A;  3FJM A;  4LQ2 A;  4NMY A;  3DLN A;  4PQJ A;  5DEX B;  4NF8 B;  1QW0 A;  3G3H A;  1B6H A;  2X7P A;  1SI0 A;  4H8I A;  1R1N A;  3G3K A;  3LSF B;  1Y1Z A;  2QS1 A;  1A7L A;  1YCJ A;  1Y20 A;  2REG A;  3MUQ A;  3TTR A;  4QF9 A;  1OIB A;  3PU5 A;  2Z8D A;  5AA2 A;  1SYH A;  3C32 A;  5TP9 A;  4E0W A;  1JW1 A;  2THI A;  2Q89 A;  4PFW A;  3FZV A;  1LB8 A;  1ZMG A;  5J1D A;  2AL4 A;  2B3B A;  4ZE9 A;  5EHM A;  3G3J A;  4MFI A;  2Z23 A;  2DE2 A;  1O63 A;  5CBS A;  4F3P A;  3PUZ E;  2DWI A;  2RC7 A;  4F18 A;  4WEP A;  3M3F A;  4GOT A;  3MC2 A;  3OEK A;  3N26 A;  5JTY B;  4H1X A;  3JYR A;  4BDM A;  3HV1 A;  1B3L A;  4XIG Q;  1QJM A;  2B3F A;  2H9B A;  3L6G A;  3M3L A;  2O84 X;  3MZ1 A;  1ATG A;  1A8E A;  2VD2 A;  2BJJ X;  5I57 B;  5ISU A;  4GWO A;  3KOS A;  1BIY A;  1Y4T A;  3OO6 A;  2FYI A;  1IUD A;  4NF6 A;  1PB7 A;  2F5X A;  3S4U A;  1B4Z A;  4QFL A;  4O3A A;  1QUI A;  5CMB A;  4QSC A;  1US4 A;  1XT8 A;  2F6P A;  2OCU A;  3T96 B;  5CBR A;  1B7U A;  3B7D A;  3K6X A;  4KR5 A;  4DIG A;  1B4H A;  4FEB A;  2PX1 A;  3CI8 A;  3O29 A;  2HAU A;  1H76 A;  3N94 A;  4YIC A;  1URD A;  4F29 A;  3FVO A;  4JDF A;  2AL5 A;  2ALU A;  4OWD A;  3PMX A;  1NL5 A;  2Q8J A;  5I58 A;  1YPN A;  3H6T A;  4ONY A;  1POY 1;  2F34 A;  1MXY A;  4XXU A;  4TQU Q;  4U23 A;  4ESX A;  4P0I A;  1MQH A;  1UQW A;  1B5I A;  1MXU A;  4N6P A;  2ANJ A;  4YKJ A;  4I9D A;  3KG2 A;  4DCX A;  4OZ9 A;  1O64 A;  1P1O A;  3Q26 A;  1MRP A;  4JWY A;  1LAX A;  3S9L C;  2F7C A;  1VSO A;  2RC8 A;  1T0K A;  4U22 A;  4POX A;  3FXR A;  4JSO A;  3EN3 A;  2GFE A;  1FTJ A;  3PD8 A;  4H5F A;  3M3K A;  1N04 A;  4R75 A;  1FTO A;  3KGC A;  2GRV A;  3TCG A;  1IIW A;  4U4X A;  4AB6 A;  3DP4 A;  1B3H A;  3HHG A;  2DWH A;  1WDN A;  2XD2 A;  4R9G A;  4RK9 A;  1S9T A;  2RCA A;  4F31 B;  3PD9 A;  5I59 B;  3EHS A;  4HS7 A;  3FD3 A;  1NH8 A;  3PUW E;  4BDL A;  4LZ7 A;  2HZL A;  4FED A;  3T22 A;  2XX7 A;  3PUV E;  2ZYK A;  3MZB A;  1Q1K A;  2XXQ A;  2CZL A;  2V3U A;  4YB5 A;  4ZEC A;  2VGQ A;  3DP8 A;  1ELJ A;  1A55 A;  4P11 A;  4LUB A;  3MBP A;  2Z8F A;  1UIU A;  4LP2 B;  2B65 A;  1IIT A;  4OVJ A;  1UTB B;  4H6D A;  1B3E A;  4ELR A;  3B6Q A;  4Q5T A;  4DXU A;  4YU0 A;  3FV2 A;  2DE4 A;  2O1L A;  2DSF A;  3PPP A;  1I6Q A;  1BP5 A;  1R9L A;  1IXG A;  2X7Q A;  5FHN A;  1N0T A;  5B7D A;  2DWJ A;  5TPA A;  4NF5 A;  1LAH E;  4G2Z A;  3KFM A;  2F7B A;  1B5H A;  3IOV A;  1OLC A;  3CG1 A;  4LVQ A;  3OO7 A;  2Y84 A;  1LB9 A;  4YKI A;  5KDT A;  4NF4 B;  4YAH X;  4R6Y A;  4QHQ A;  3FXU A;  2DVZ A;  2G93 A;  1RYX A;  4F1V A;  2OLB A;  4XKP A;  1LBC A;  1LAF E;  4KYS A;  4R73 A;  1MDP 1;  3VXB A;  1O7T A;  2HCA A;  4R6K A;  4KD5 A;  4GIZ A;  4EQB A;  1TT1 A;  5H8H B;  1DTZ A;  3TYH A;  5JEI A;  4G68 A;  3KJT A;  1UIV A;  3ZSF A;  1SI1 A;  3T9U A;  1B5J A;  3SEY A;  4RYA A;  5I2N A;  1MQG A;  4TLL B;  3HCQ A;  4EDP A;  2I4B A;  4IO5 A;  1PEB A;  4R6H A;  3OSQ A;  4U2R A;  3K00 A;  4RK2 A;  2IA4 A;  2DXY A;  1HSE A;  3H6U A;  2ESN A;  4QSE A;  3O66 A;  4RJZ A;  4PFY A;  2XX9 A;  3OO8 A;  2X26 A;  4LAT A;  3PPN A;  4KCD A;  5I58 B;  3MVW A;  3CIJ A;  3SEU A;  1MPD A;  2I48 A;  2HEU A;  3ODB A;  2KLF A;  1N7X A;  3FXQ A;  3I3V A;  4ZZE A;  4HTG A;  1CE2 A;  3ONM A;  5AE4 A;  3EF7 A;  1PB8 A;  3KSX A;  1N7W A;  1MXX A;  3H7M A;  3QUF A;  4PET A;  3W15 C;  3OMB A;  1WOD A;  2UVG A;  4QFP A;  1EZP A;  1OVB A;  3Q28 A;  1YAE A;  2UVI A;  3T9V A;  1HSJ A;  3IB0 A;  3UA8 A;  1R6Z A;  4GD5 A;  5CMK A;  4X48 A;  2RKM A;  4QFO A;  2NWJ A;  1PBP A;  3O6G A;  1Z7N E;  2D21 A;  2FNC A;  2H5Y A;  1LCT A;  2A5S A;  2QPQ A;  2XXT A;  1JEV A;  4DXC A;  3IO6 A;  1LFI A;  3MVY A;  2I58 A;  3ZKL A;  4EQ9 A;  1B58 A;  3G3G A;  1MG1 A;  3RQT A;  1P1W A;  3QXM A;  2O7U A;  3V89 B;  3MWB A;  1ANF A;  5F1Q A;  3GLB A;  4BDO A;  3GXA A;  4H65 A;  2Z8E A;  1DSN A;  3N5L A;  4F3B A;  2XXI A;  3SES A;  4O3B A;  2RCB A;  1MQI A;  5H8N B;  4GF8 A;  2VD3 A;  2P1S A;  3EQ1 A;  2HZK A;  3FVN A;  3C33 A;  3MVZ A;  4OEV A;  3WAF A;  4F2O A;  4F22 A;  2O68 A;  1GGG A;  1TWY A;  1DMB A;  5DTB A;  1IXC A;  1QUK A;  4EF1 A;  3VXC A;  1LCF A;  2D5W A;  4JXI A;  3K4U A;  2DQV A;  4NF5 B;  4YZZ A;  1UTH A;  2AIX A;  5H8Q A;  3ZKK A;  4C1T A;  1B1H A;  4NTL A;  2HAV A;  3VLW A;  3TAJ A;  1SW2 A;  2A5T A;  3CR9 A;  1YTV A;  4Q0C A;  1A54 A;  1GV8 A;  1MXV A;  2Q88 A;  1MXZ A;  2R6G E;  1B7H A;  1B9J A;  5HPQ A;  1D4N A;  1DPP A;  4KFQ A;  2VOZ A;  2QS4 A;  3TUS A;  2RIN A;  3SDF A;  3IAZ A;  3Q29 A;  4R74 A;  4XTC Q;  4FAJ A;  3RT6 B;  4ZZA A;  3G7W A;  2P0S A;  2O51 A;  3MPL A;  1AMF A;  1LBB A;  2O69 A;  3PGF A;  5A5X A;  3UN6 A;  1LST A;  4PFU A;  1B1X A;  3Q27 A;  5I2N B;  1LGB C;  1LLS A;  2DVC A;  3FUZ A;  1NH7 A;  2W7Y A;  3CG3 A;  3TQL A;  3OEN A;  1I69 A;  3VVE A;  1MXW A;  1Y4C A;  1B2H A;  5H8S A;  1H3D A;  1M5B A;  3LUY A;  1PBQ A;  4BDQ A;  1MY1 A;  5FTH A;  1IEJ A;  4F3S A;  2QSX A;  3SEX A;  2E0S A;  3SER A;  4DLD A;  4KYE A;  4G4P A;  4BDR A;  1JQF A;  2F97 A;  3HN0 A;  3FGS A;  4OYV A;  4IO4 A;  1P1N A;  1ZLQ A;  1D9V A;  5CMM A;  2I49 A;  2R71 A;  1B52 A;  3TCH A;  3H6V A;  3W9V A;  4WXJ A;  3MW0 A;  4ECF A;  5EYF A;  4JWO A;  3OD7 A;  4MH5 A;  3R6U A;  5H8F B;  1XVX A;  4ELP A;  3MJN A;  1D9Y A;  1HSL A;  3SEW A;  3TEL A;  4H0W A;  3KN8 A;  1SW5 A;  3QYT A;  1B0L A;  2GH9 A;  3O6H A;  5BUU A;  4F2Q A;  3U72 A;  1AIV A;  4O3C A;  2E1S A;  1SW4 A;  4ZEB A;  1Y3Q A;  3I6V A;  1B3F A;  2Y7R A; 
#chains in the Genus database with same CATH topology
 1SW1 A;  1FTL A;  1TXF A;  3GZG A;  5AA4 A;  3TEP A;  4UA8 A;  2H98 A;  1EYK A;  3THI A;  3IOW A;  3IX1 A;  2OWS A;  2H4I A;  1TFA A;  3VLU A;  1JW5 A;  2NUV A;  5CRY A;  1IZ1 A;  2V84 A;  5KCJ B;  1A99 A;  4EF2 A;  4YB6 A;  1M5F A;  5DT6 A;  4PBH A;  1ZU0 A;  4GXA A;  4N8Y A;  4YKP A;  1EZ9 A;  3KOT A;  3LR1 A;  4G8N A;  1LFG A;  2R9J A;  4GWS A;  2LAO A;  4Q8R A;  1FPI A;  2WX9 A;  4FAT A;  2ZYO A;  5ICT A;  3CFL A;  4JWX A;  2ZYM A;  3N6T A;  4DXB A;  3VDF A;  4IY5 A;  2I3V A;  2CEX A;  5LOM A;  3K6V A;  3MQ9 A;  2UYF A;  2CMO A;  1ZBM A;  3PPQ A;  3LC8 A;  1UTH B;  1P1U A;  3TFL A;  3B8B A;  2PT1 A;  3H4Z A;  2HQ0 A;  4OQO A;  3OEL A;  5AA2 B;  5TP9 B;  2A5T B;  4ISU A;  4JSD A;  3SEV A;  2XXY A;  3A3U A;  5I56 A;  3H03 A;  1VFD A;  3U93 A;  3LBS A;  3FV1 A;  1A8F A;  4FEC A;  4U21 A;  3KEI A;  3RTW B;  3VVD A;  5I2K A;  2CZI A;  4MF3 A;  4GFR A;  5DEX A;  5L9M A;  3RLF E;  4NF8 A;  1M5D A;  5CI5 A;  5JK4 A;  1QVS A;  3K0V A;  3V8X B;  2FIE A;  3Q25 A;  4MX6 A;  1PC3 A;  4OVR A;  4OXV A;  1INP A;  3TMG A;  1FQC A;  4GRK A;  4NWD A;  3TPA A;  1OLA A;  2XXU A;  3PTY A;  1KZ8 A;  5FHM A;  2NXO A;  4PP0 A;  5ELV A;  2F78 A;  5A5X B;  3E79 A;  4QFK A;  4X8R A;  4PFI A;  4XF5 A;  5FHO A;  5LTC A;  2P2A A;  2VPO A;  4ZEK A;  3IK6 B;  2DS9 A;  4ND9 A;  5ICQ A;  3NOH A;  1NV6 A;  2YPN A;  4LN5 A;  5J16 A;  4NF6 B;  2ONK E;  1IMC A;  2QMX A;  4MIJ A;  2OBG A;  5EYG A;  4L17 A;  3K02 A;  2DP8 A;  4RPN A;  1CNQ A;  5JTY A;  3FVG A;  4OVP A;  4LZ5 A;  4TOZ A;  4POW A;  4G8M A;  1B51 A;  3QUJ A;  3TZA A;  2WKY A;  3GBA A;  3TOD A;  3O6I A;  4ZEI A;  2OK2 A;  1IQ7 A;  5I57 A;  3PMW A;  3IOR A;  4NN3 A;  5B70 A;  4OER A;  1MPC A;  2Y5L A;  2RC9 A;  1POT A;  2F7A A;  2XWI A;  4I62 A;  1LAG E;  2DOJ A;  4NED A;  2V3T A;  3T9H B;  1DTG A;  1FJ9 A;  2VHA A;  4F39 A;  1B0H A;  2I3W A;  4OFJ A;  4PE5 B;  2OWT A;  2WYP A;  4PF8 A;  3S9M C;  5K2Y A;  4G8H A;  3H06 B;  4IGT A;  4U1O A;  1MPB A;  2Q74 A;  3RNN A;  2XX8 A;  2XXH A;  3E3K A;  2PT2 A;  1NFT A;  2B4L A;  2Q2A A;  3K2D A;  1LBX A;  3P7I A;  3TTM A;  1FBP A;  4DI4 B;  4G61 A;  1Y1M A;  4LA9 A;  1MY0 A;  2FA7 A;  3TTL A;  3MST A;  2PCR A;  1FPE A;  2I0C A;  1IMB A;  1FBH A;  3IB1 A;  3K01 A;  1II5 A;  2F36 A;  2ZZW A;  1I6B A;  4RA1 A;  4C1U A;  3M8U A;  3H6W A;  1B05 A;  2ONR A;  3EPE A;  1MQJ A;  3DM0 A;  1RYO A;  1NNT A;  1CB6 A;  1JVY A;  1LBZ A;  4EXL A;  1XS5 A;  1N76 A;  2I4C A;  3SKP A;  3VLV A;  1D3K A;  4OEU A;  2ABH A;  1Q9D A;  3TTK A;  3RN8 A;  3TDJ A;  5K2X A;  3O97 A;  4ZEF A;  3PUY E;  2G29 A;  2Y7W A;  1FTK A;  3HPI A;  2XXW A;  3V5A A;  3BFU A;  5ITO A;  4JBZ A;  2O1M A;  2HFB A;  4NQ8 A;  3CFX A;  3FJ7 A;  4N13 A;  4PE3 A;  4AQ4 A;  3U8Q A;  4RXL A;  5BWJ A;  1IXI A;  2Y7I A;  3TCF A;  3F11 A;  3BFT A;  3WAE A;  1FBG A;  4YB7 A;  5DVJ A;  5M2V A;  1MY2 A;  4E0X A;  2YJP A;  5LDZ A;  5EQ8 A;  4Z7E A;  1VFE A;  3O28 A;  1WVJ A;  4JB7 A;  3BKI B;  1US5 A;  4WED A;  3C35 A;  5I59 A;  1QKA A;  1ZKB A;  2V93 A;  4GQO A;  5HBC A;  4NGU A;  1FCK A;  3CRB A;  3IFC A;  4ZDM A;  4QFN A;  4YKK A;  1B32 A;  5TPA B;  4MCO A;  3QSL A;  2XWK A;  2H25 A;  4NWC A;  1H44 A;  3KN7 A;  3FAS A;  2AYS A;  3E4R A;  3FJG A;  3S9E A;  2PVU A;  3CHG A;  1ZJL A;  2BJI A;  3GBB A;  1URG A;  3CSG A;  4FJP A;  1H43 A;  2P3V A;  5KDT B;  2D3I A;  3KN3 A;  3RY3 A;  1UTB A;  2DXR A;  2Y7K A;  2YLN A;  1IXH A;  1NI9 A;  2Z22 A;  4KCC A;  4IB2 A;  5KZT A;  5IKB A;  2VT5 A;  4EXK A;  4OES A;  3HHF A;  4IO2 A;  1QUJ A;  1P1Q A;  2V25 A;  5CC2 A;  4MLQ A;  3OSR A;  1SDX A;  3KJ7 A;  4F1U A;  3FXB A;  4DZ1 A;  5EYH A;  1URS A;  2XXP A;  4G68 B;  4GLI A;  4FIM A;  4NF4 A;  3C31 A;  4IR8 A;  1M5C A;  3QK6 A;  4OFO A;  3VV5 A;  3MZ9 A;  2DE3 A;  1AOV A;  4KHZ E;  5F24 A;  4OET A;  3C9H A;  4FOR A;  1PDA A;  3R7X A;  2UVJ A;  4HCW A;  1NUX A;  4R2F A;  3FIR A;  4X1D A;  3C34 A;  1M5E A;  4PDH A;  4KYD A;  1B46 A;  5H8H A;  5IM2 A;  2Q9T A;  1L5T A;  4OMB A;  1N3X A;  3RPL A;  4OA4 A;  1RKM A;  3PMV A;  4HCY A;  4LQ5 A;  1EZO A;  2QJE A;  5EQ7 A;  4IO3 A;  2ONS A;  4PGP A;  3IL1 B;  1JVX A;  3GYY A;  4IGR A;  5CMC A;  1FQE A;  1GVC A;  1I6A A;  2QMW A;  3G3F A;  3IOU A;  1PB9 A;  2F35 A;  3D4G A;  1DOT A;  4N07 A;  2XD3 A;  3O2A A;  3T1B A;  1USY H;  2XXX A;  4N8G A;  4PFT A;  5L9S A;  1MQD A;  4F19 A;  4OEN A;  1Y3N A;  2GHA A;  4M4G A;  3MP8 A;  1TFD A;  3IJO B;  3OO9 A;  1FQA A;  2PMS A;  3FVK A;  4U1Z A;  1DPE A;  2CZK A;  1EU8 A;  3ZS6 A;  2ZNT A;  3IO4 A;  3QIM A;  2NOO A;  2F6G A;  1MM6 A;  1QKB A;  3U92 A;  1FTA A;  3U94 A;  2DYX A;  4ZED A;  4RPO A;  4ELO A;  3BBR A;  3JV9 A;  5IAI A;  1KA0 A;  4GX4 A;  5ITP A;  2F3B A;  2OZZ A;  1N84 A;  3USD A;  1B7Z A;  3C36 A;  4N6D A;  2QVU A;  1XC1 A;  4OVT A;  3S2V A;  5IZ3 A;  5FTI A;  4PGN A;  4LZ8 A;  4H5G A;  4C0R A;  5L8D A;  1Q35 A;  4EUO A;  5AA2 D;  1NNF A;  4MMP A;  1IMD A;  5DYH A;  3ILT B;  1FTM A;  4R9F A;  3ILU B;  4AS4 A;  1FQF A;  5F7V A;  3E78 A;  2ZMB A;  4UAC A;  4ZE8 A;  1AH5 A;  3KBR A;  4X9T A;  3N6U A;  4N81 A;  3TKD A;  3B6W A;  1P99 A;  1MH3 A;  3RPW A;  1GTK A;  5IGA A;  2OX3 A;  2HXW A;  5I84 A;  5DVF A;  4OTE A;  3HFU A;  1QUL A;  4RNS A;  1Y9U A;  5CM6 A;  3E13 X;  4TLM B;  3MP1 A;  3CSB A;  2H99 A;  1VE4 A;  3DEL B;  4KPT A;  5H8Q B;  4PAK A;  1NV1 A;  4GX6 A;  1JET A;  1LEV A;  5H8N A;  1KWH A;  3IB2 A;  4IO6 A;  4XKN A;  4G77 A;  3SET A;  4YMA A;  1OQH A;  4LON B;  2UYE A;  5FBP A;  1FQD A;  3RGY A;  5EHS A;  1SD3 A;  4M1V A;  3V83 A;  3LSW A;  1AL3 A;  4GL8 A;  4IY6 A;  2O7I A;  2I6E A;  3KSJ A;  4K3F A;  2I0B A;  4OVS A;  4O7I A;  2L5V A;  2OJT A;  4KI0 E;  4I1D A;  1B40 A;  3VE1 B;  3PUX E;  4F1Y A;  3L6H A;  2GHB A;  1FBF A;  1NUY A;  1N3W A;  4U4S A;  3MPK A;  1DBZ A;  1ZIU A;  3IJX B;  1SYI A;  2RF1 A;  3I5O A;  1MY4 A;  3OEM A;  5AA1 A;  4THI A;  4GWW A;  3JZJ A;  3UK4 A;  1H45 A;  4XKQ A;  1ZTY A;  2DDK A;  1LFH A;  4GWU A;  2QFL A;  2XHD A;  3RTF B;  3K1M A;  4NAP A;  2VP1 A;  3B6T A;  4H8J A;  1EYJ A;  3LSL A;  1JNF A;  2HHM A;  1YXI A;  3MP6 A;  3BIH A;  2ZXT A;  2JJK A;  4ZS9 A;  3U1O A;  4X1B A;  3SZP A;  2PFZ A;  3O9P A;  2HPG A;  1OQG A;  3OOA A;  1JW4 A;  3IR1 A;  3RPL B;  4FE8 A;  1MH4 A;  1MM7 A;  4XKR A;  2PBW A;  3MVX A;  3IOT A;  1SBP A;  1BTJ A;  2F8D A;  4EQ7 A;  4Z0I A;  3H3G A;  1NV5 A;  1NNK A;  1NV2 A;  3G3I A;  2IEE A;  4P8B A;  3KZG A;  1EH3 A;  3UGW A;  3UP9 A;  2ZNS A;  3R26 A;  2REJ A;  3PV0 E;  1JEU A;  1RDZ A;  4KQP A;  3T66 A;  5HM4 B;  2NVU B;  1A40 A;  2HXR A;  4N4U A;  5DVI A;  1MS7 A;  1VR5 A;  3CVG A;  2DWA A;  5TU0 A;  2M8C A;  3DP6 A;  2Q2C A;  2QS3 A;  2QL3 A;  3K6U A;  1FPL A;  4UAB A;  3W9W A;  3UOR A;  3FBP A;  4H67 A;  4MLV A;  5ET6 A;  3HST A;  3T93 B;  3VVF A;  1NNP A;  5L9O A;  1FW0 A;  1K9Z A;  1B3G A;  4MJO A;  4YMB A;  1USY E;  1MDQ A;  1FPF A;  4I8C A;  4F3G A;  3B50 A;  2GQ1 A;  4P0G A;  1FBE A;  3D4C A;  1S50 A;  3T9X B;  4QSD A;  4MBP A;  4GXS B;  4HW8 A;  3TQW A;  1J1N A;  2XXR A;  3LSX A;  4GBW A;  3C4M A;  5H8F A;  4QXD A;  2ZNU A;  3QAX A;  2UXA A;  1BKA A;  4BDN A;  4DE8 A;  3PPR A;  3E9X A;  2ZYN A;  1MY3 A;  5AA4 B;  4RY1 A;  3QMF A;  3EHU A;  1NV3 A;  4BLA A;  4DCY A;  5IZ3 B;  1GR2 A;  4OHN A;  4ESW A;  4OFL A;  3MYU A;  2QS2 A;  4R2B A;  1Z7M E;  3AXF A;  2V3Q A;  3UIF A;  1R9Q A;  3HO7 A;  1YYZ A;  4PFR A;  3CFZ A;  1XVY A;  4PAI A;  4MEV A;  1F9B A;  4IO7 A;  3TTN A;  1FQB A;  4WKM A;  5I3S A;  4GVO A;  1Y3P A;  4N91 A;  3PPO A;  3RUM A;  1OMP A;  4MNI A;  4ELQ A;  4GL0 A;  1SQY A;  5AA3 A;  3K1N A;  4AB5 A;  1SVX B;  3S9N C;  3ECR A;  2PYY A;  2CEY A;  2Y7P A;  1S7Y A;  4R72 A;  3K6W A;  3VFJ A;  2QVV A;  2UVH A;  3K1P A;  1XOC A;  4Q30 B;  1BLF A;  5KCJ A;  4NE4 A;  2XXV A;  2O6A A;  4PAF A;  3FAT A;  3EHT A;  3A09 A;  1NKX A;  4P1L A;  4NHB A;  4G68 C;  4GWZ A;  4AS5 A;  3MAM A;  3RT8 A;  1NMU A;  3KC1 A;  1XHY A;  1OVT A;  2QRY A;  1NV7 A;  3A3C A;  1LBV A;  5I56 B;  4H46 A;  4DDD A;  3OXN A;  5I2K B;  4QRZ A;  4P9K A;  3FJM A;  4LQ2 A;  4NMY A;  3U65 A;  3DLN A;  2WYK A;  4PQJ A;  5DEX B;  4NF8 B;  1QW0 A;  3G3H A;  1B6H A;  2X7P A;  1SI0 A;  4H8I A;  1R1N A;  3KC0 A;  3G3K A;  3LSF B;  1Y1Z A;  2QS1 A;  4OVQ A;  5I7I A;  1A7L A;  1YCJ A;  1Y20 A;  2REG A;  3MUQ A;  4XFE A;  3TTR A;  4QF9 A;  1OIB A;  3PU5 A;  2Z8D A;  5AA2 A;  1SYH A;  3C32 A;  5TP9 A;  4E0W A;  1JW1 A;  1IMF A;  2THI A;  2Q89 A;  4PFW A;  3FZV A;  1LB8 A;  1ZMG A;  5J1D A;  2AL4 A;  2B3B A;  4ZE9 A;  5EHM A;  4GWY A;  3G3J A;  4MFI A;  2Z23 A;  2DE2 A;  1O63 A;  5CBS A;  3EKI A;  4F3P A;  2ZZX A;  3PUZ E;  2DWI A;  2RC7 A;  4F18 A;  1AWB A;  4WEP A;  3M3F A;  4GOT A;  3MC2 A;  3OEK A;  3N26 A;  5JTY B;  4H1X A;  3JYR A;  2FHY A;  3KBZ A;  4BDM A;  3HV1 A;  1B3L A;  4XIG Q;  4OAN A;  4X04 A;  1QJM A;  2B3F A;  2H9B A;  3L6G A;  3M3L A;  4JVC A;  5ET5 A;  2O84 X;  3MZ1 A;  1ATG A;  1A8E A;  2VD2 A;  2BJJ X;  5I57 B;  5ISU A;  4GWO A;  3KOS A;  1BIY A;  1Y4T A;  3OO6 A;  2FYI A;  1IUD A;  4NF6 A;  1PB7 A;  1XI6 A;  4KXP A;  2R8T A;  4PCD A;  2F5X A;  3S4U A;  1B4Z A;  2V4C A;  4QFL A;  2QVR A;  4I3Y A;  4O3A A;  1QUI A;  5CMB A;  4JVD A;  4QSC A;  2XA5 A;  1US4 A;  1XT8 A;  2F6P A;  2OCU A;  3T96 B;  5CBR A;  1B7U A;  1FJ6 A;  2Y5K A;  3B7D A;  3K6X A;  4KR5 A;  4DIG A;  1B4H A;  4FEB A;  2MKZ A;  2PX1 A;  1FPG A;  3CI8 A;  3O29 A;  2HAU A;  1H76 A;  2XWV A;  3N94 A;  4HE2 A;  2VPN A;  4YIC A;  1URD A;  4F29 A;  3FVO A;  4JDF A;  2AL5 A;  2ALU A;  4OWD A;  3PMX A;  1NL5 A;  2Q8J A;  5I58 A;  4N17 A;  5IZ1 A;  1YPN A;  3BIG A;  3H6T A;  4ONY A;  1POY 1;  2F34 A;  1MXY A;  4XXU A;  4TQU Q;  4U23 A;  4ESX A;  4P0I A;  1MQH A;  1SPI A;  1UQW A;  1B5I A;  1MXU A;  4N6P A;  4GX3 A;  1LBW A;  2ANJ A;  4YKJ A;  4I9D A;  3KG2 A;  4DCX A;  2FBP A;  4OZ9 A;  1O64 A;  1RDY A;  1P1O A;  4MAG A;  4GWX A;  3Q26 A;  1NV4 A;  1MRP A;  4JWY A;  2B4M A;  1LAX A;  3S9L C;  2F7C A;  1VSO A;  2RC8 A;  1T0K A;  4U22 A;  4POX A;  3FXR A;  5EQ9 A;  4JSO A;  3EN3 A;  2GFE A;  1FTJ A;  3PD8 A;  4H5F A;  3M3K A;  1N04 A;  4R75 A;  1FTO A;  3KGC A;  2GRV A;  3TCG A;  1IIW A;  4U4X A;  2PFY A;  4AB6 A;  3DP4 A;  1B3H A;  3HHG A;  2DWH A;  1WDN A;  2XD2 A;  4R9G A;  4RK9 A;  1S9T A;  2RCA A;  4F31 B;  5ET8 A;  3PD9 A;  5I59 B;  3EHS A;  4HS7 A;  3FD3 A;  1NH8 A;  3PUW E;  4BDL A;  4LZ7 A;  2HZL A;  4FED A;  1DK4 A;  3T22 A;  2XX7 A;  3PUV E;  2ZYK A;  3MZB A;  4PBQ A;  1Q1K A;  2XXQ A;  2CZL A;  2V3U A;  4YB5 A;  4ZEC A;  2VGQ A;  3DP8 A;  1ELJ A;  1A55 A;  4P11 A;  4LUB A;  3MBP A;  2Z8F A;  1UIU A;  4LP2 B;  4P56 A;  2B65 A;  1IIT A;  2ZZV A;  4OVJ A;  1UTB B;  4H6D A;  1B3E A;  3IFA A;  4ELR A;  3B6Q A;  5IZZ A;  4Q5T A;  4DXU A;  4YU0 A;  1YZ0 A;  3FV2 A;  2DE4 A;  2O1L A;  2DSF A;  3D1R A;  3PPP A;  1I6Q A;  1BP5 A;  1R9L A;  1IXG A;  2X7Q A;  5FHN A;  1N0T A;  2DWJ A;  5B7D A;  2OWZ A;  1FRP A;  5TPA A;  4NF5 A;  1LAH E;  4G2Z A;  3KFM A;  2F7B A;  4PF6 A;  1B5H A;  3IOV A;  4H45 A;  1OLC A;  1QGX A;  3CG1 A;  4LVQ A;  3OO7 A;  3T0J A;  2Y84 A;  1LB9 A;  4YKI A;  5KDT A;  1K9Y A;  4NF4 B;  4YAH X;  4R6Y A;  4QHQ A;  3FXU A;  2DVZ A;  4PFB A;  2G93 A;  1RYX A;  5ESY A;  4F1V A;  2OLB A;  4XKP A;  1LBC A;  1LAF E;  4KYS A;  4R73 A;  1KA1 A;  1MDP 1;  2FVZ A;  3VXB A;  1O7T A;  2HCA A;  4R6K A;  4KD5 A;  4GIZ A;  4EQB A;  1TT1 A;  5H8H B;  1DTZ A;  4NG7 A;  4N15 A;  1BK4 A;  4FBP A;  2KR0 A;  3TYH A;  2P3N A;  5JEI A;  4G68 A;  3KJT A;  1UIV A;  3ZSF A;  1SI1 A;  3T9U A;  1B5J A;  3SEY A;  4RYA A;  5I2N A;  1MQG A;  4TLL B;  1NUW A;  3HCQ A;  4EDP A;  2I4B A;  1FSA A;  4IO5 A;  1PEB A;  4R6H A;  4O8M A;  3OSQ A;  4U2R A;  3K00 A;  4RK2 A;  1DCU A;  2IA4 A;  2DXY A;  1HSE A;  5DW8 A;  3H6U A;  5T3J A;  2ESN A;  4QSE A;  3O66 A;  4RJZ A;  4PFY A;  2XX9 A;  3OO8 A;  2X26 A;  4NX1 A;  4LAT A;  3PPN A;  4KCD A;  5I58 B;  3MVW A;  3CIJ A;  4HE1 A;  3SEU A;  1MPD A;  2I48 A;  2HEU A;  2KQZ A;  2KLF A;  1N7X A;  3ODB A;  3FXQ A;  3I3V A;  4ZZE A;  4HTG A;  1CE2 A;  3ONM A;  5AE4 A;  3EF7 A;  1PB8 A;  3KSX A;  1N7W A;  1MXX A;  3H7M A;  3QUF A;  4PET A;  3W15 C;  3OMB A;  1IME A;  1WOD A;  2UVG A;  4QFP A;  1FPB A;  1EZP A;  1OVB A;  3Q28 A;  1YAE A;  2UVI A;  3T9V A;  1HSJ A;  3IB0 A;  3UA8 A;  1R6Z A;  4PTK A;  4P1E A;  4GD5 A;  5CMK A;  4X48 A;  2RKM A;  4QFO A;  2NWJ A;  4PC9 A;  1PBP A;  3O6G A;  2FIX A;  4O94 A;  1Z7N E;  2D21 A;  1NUZ A;  2FNC A;  2H5Y A;  1LCT A;  2WBB A;  2WEF A;  4P3L A;  5I5P A;  2A5S A;  1FPK A;  2QPQ A;  2XXT A;  1JEV A;  4DXC A;  3IO6 A;  1LFI A;  3MVY A;  2I58 A;  3ZKL A;  4EQ9 A;  1B58 A;  1FPD A;  3G3G A;  1MG1 A;  3RQT A;  1P1W A;  3QXM A;  2O7U A;  3V89 B;  3MWB A;  1ANF A;  5F1Q A;  1FPJ A;  4HE0 A;  3LUZ A;  3GLB A;  4BDO A;  1G0H A;  3GXA A;  4H65 A;  2Z8E A;  1DSN A;  3N5L A;  4F3B A;  2XXI A;  3SES A;  4O3B A;  2RCB A;  1MQI A;  5H8N B;  4GF8 A;  2VD3 A;  4XEQ A;  2P1S A;  3EQ1 A;  2HZK A;  3FVN A;  3C33 A;  3MVZ A;  4OEV A;  3WAF A;  4F2O A;  2F3D A;  1LBY A;  2WBD A;  4F22 A;  2O68 A;  4JVI A;  1GGG A;  1TWY A;  1DMB A;  5DTB A;  1IXC A;  1QUK A;  4MNP A;  4EF1 A;  3VXC A;  1LCF A;  2D5W A;  4JXI A;  3K4U A;  2DQV A;  4P47 A;  1G0I A;  4NF5 B;  4YZZ A;  1UTH A;  2AIX A;  5H8Q A;  3ZKK A;  4C1T A;  1B1H A;  4NTL A;  2HAV A;  4I3E A;  3VLW A;  3TAJ A;  1SW2 A;  2A5T A;  3CR9 A;  1YTV A;  4Q0C A;  3ISP A;  1A54 A;  1GV8 A;  1MXV A;  3ROJ A;  2Q88 A;  1MXZ A;  2R6G E;  4O7M A;  1B7H A;  1B9J A;  5HPQ A;  1D4N A;  1DPP A;  4KFQ A;  2VOZ A;  2QS4 A;  3TUS A;  1FBC A;  4I40 A;  2RIN A;  3SDF A;  3IAZ A;  4QBA A;  4MNC A;  3Q29 A;  4R74 A;  4XTC Q;  4FAJ A;  3RT6 B;  4ZZA A;  2CZH A;  3G7W A;  2P0S A;  2O51 A;  3MPL A;  1EYI A;  4DI3 D;  1AMF A;  4HXV A;  1LBB A;  4N6K A;  2O69 A;  3PGF A;  5A5X A;  3UN6 A;  1LST A;  4PFU A;  1B1X A;  3Q27 A;  5I2N B;  1LGB C;  1LLS A;  2DVC A;  3FUZ A;  1NH7 A;  2W7Y A;  1VDW A;  3CG3 A;  3TQL A;  1D9Q A;  3OEN A;  1I69 A;  3VVE A;  1MXW A;  1Y4C A;  1B2H A;  5H8S A;  4PDD A;  5A5L A;  1JP4 A;  1H3D A;  1M5B A;  3LUY A;  1IMA A;  1PBQ A;  4BDQ A;  1MY1 A;  5FTH A;  1IEJ A;  4F3S A;  2QSX A;  3SEX A;  2E0S A;  3SER A;  4DLD A;  4KYE A;  4G4P A;  4BDR A;  1JQF A;  2F97 A;  3HN0 A;  3FGS A;  4OYV A;  1NV0 A;  4IO4 A;  1P1N A;  1ZLQ A;  1D9V A;  5CMM A;  4MHF A;  2I49 A;  2R71 A;  1B52 A;  3TCH A;  3H6V A;  3W9V A;  4WXJ A;  3MW0 A;  4ECF A;  1FBD A;  5EYF A;  4JWO A;  3OD7 A;  4MH5 A;  3R6U A;  5H8F B;  1XVX A;  4ELP A;  3MJN A;  1D9Y A;  1HSL A;  3SEW A;  3TEL A;  3LV0 A;  2XXK A;  4H0W A;  3A29 A;  1RDX A;  3KN8 A;  1SW5 A;  3QYT A;  1B0L A;  2GH9 A;  5EQA A;  3O6H A;  4GBV A;  4NF0 A;  5BUU A;  2XWO A;  4F2Q A;  3U72 A;  1AIV A;  3RYD A;  4O3C A;  2E1S A;  1SW4 A;  2Q8M A;  4ZEB A;  5ET7 A;  1Y3Q A;  3I6V A;  1B3F A;  2Y7R A; 
#chains in the Genus database with same CATH homology
 1SW1 A;  1FTL A;  1TXF A;  3GZG A;  5AA4 A;  3TEP A;  4UA8 A;  2H98 A;  3THI A;  3IOW A;  3IX1 A;  2OWS A;  2H4I A;  1TFA A;  3VLU A;  1JW5 A;  2NUV A;  5CRY A;  1IZ1 A;  2V84 A;  5KCJ B;  1A99 A;  4EF2 A;  4YB6 A;  1M5F A;  5DT6 A;  1ZU0 A;  4GXA A;  4YKP A;  1EZ9 A;  3KOT A;  3LR1 A;  4G8N A;  1LFG A;  2R9J A;  2LAO A;  4Q8R A;  4FAT A;  2ZYO A;  5ICT A;  3CFL A;  4JWX A;  2ZYM A;  3N6T A;  4DXB A;  3VDF A;  4IY5 A;  2I3V A;  5LOM A;  3K6V A;  3MQ9 A;  2UYF A;  2CMO A;  1ZBM A;  3PPQ A;  3LC8 A;  1UTH B;  1P1U A;  3TFL A;  3H4Z A;  2PT1 A;  2HQ0 A;  4OQO A;  3OEL A;  5AA2 B;  5TP9 B;  2A5T B;  4ISU A;  4JSD A;  3SEV A;  2XXY A;  3A3U A;  5I56 A;  3H03 A;  1VFD A;  3U93 A;  3LBS A;  3FV1 A;  1A8F A;  4FEC A;  4U21 A;  3KEI A;  3RTW B;  3VVD A;  5I2K A;  4MF3 A;  4GFR A;  5DEX A;  5L9M A;  3RLF E;  4NF8 A;  1M5D A;  5CI5 A;  5JK4 A;  1QVS A;  3K0V A;  3V8X B;  3Q25 A;  1PC3 A;  4OXV A;  3TMG A;  1FQC A;  4GRK A;  4NWD A;  3TPA A;  1OLA A;  2XXU A;  5FHM A;  2NXO A;  4PP0 A;  5ELV A;  2F78 A;  5A5X B;  4QFK A;  5FHO A;  2P2A A;  4ZEK A;  3IK6 B;  2DS9 A;  4ND9 A;  5ICQ A;  2YPN A;  4NF6 B;  2ONK E;  2QMX A;  2OBG A;  4L17 A;  3K02 A;  2DP8 A;  4RPN A;  5JTY A;  3FVG A;  4LZ5 A;  4TOZ A;  4POW A;  4G8M A;  1B51 A;  3QUJ A;  3TZA A;  2WKY A;  3GBA A;  3TOD A;  3O6I A;  4ZEI A;  2OK2 A;  1IQ7 A;  5I57 A;  3PMW A;  3IOR A;  5B70 A;  4OER A;  1MPC A;  2RC9 A;  1POT A;  2F7A A;  4I62 A;  1LAG E;  2DOJ A;  4NED A;  2V3T A;  3T9H B;  1DTG A;  2VHA A;  4F39 A;  1B0H A;  2I3W A;  4OFJ A;  4PE5 B;  2OWT A;  3S9M C;  5K2Y A;  4G8H A;  3H06 B;  4IGT A;  4U1O A;  1MPB A;  3RNN A;  2XX8 A;  2XXH A;  3E3K A;  2PT2 A;  1NFT A;  2Q2A A;  3K2D A;  3P7I A;  3TTM A;  1Y1M A;  4LA9 A;  1MY0 A;  2FA7 A;  3TTL A;  2I0C A;  3IB1 A;  3K01 A;  1II5 A;  2F36 A;  1I6B A;  4RA1 A;  4C1U A;  3M8U A;  3H6W A;  1B05 A;  2ONR A;  3EPE A;  1MQJ A;  3DM0 A;  1RYO A;  1NNT A;  1CB6 A;  1JVY A;  4EXL A;  1XS5 A;  1N76 A;  2I4C A;  3SKP A;  3VLV A;  1D3K A;  4OEU A;  2ABH A;  3TTK A;  3RN8 A;  3TDJ A;  5K2X A;  3O97 A;  4ZEF A;  3PUY E;  2G29 A;  2Y7W A;  1FTK A;  3HPI A;  2XXW A;  3V5A A;  3BFU A;  5ITO A;  4JBZ A;  2O1M A;  2HFB A;  3CFX A;  3FJ7 A;  4N13 A;  4AQ4 A;  3U8Q A;  4RXL A;  5BWJ A;  1IXI A;  2Y7I A;  3TCF A;  3F11 A;  3BFT A;  3WAE A;  4YB7 A;  5DVJ A;  5M2V A;  1MY2 A;  4E0X A;  2YJP A;  4Z7E A;  1VFE A;  3O28 A;  1WVJ A;  4JB7 A;  3BKI B;  1US5 A;  4WED A;  3C35 A;  5I59 A;  1QKA A;  1ZKB A;  2V93 A;  4GQO A;  5HBC A;  1FCK A;  3CRB A;  4ZDM A;  4QFN A;  4YKK A;  1B32 A;  5TPA B;  3QSL A;  2H25 A;  4NWC A;  1H44 A;  3KN7 A;  3FAS A;  2AYS A;  3E4R A;  3FJG A;  3S9E A;  2PVU A;  1ZJL A;  3GBB A;  1URG A;  3CSG A;  4FJP A;  1H43 A;  5KDT B;  2D3I A;  3KN3 A;  3RY3 A;  1UTB A;  2DXR A;  2Y7K A;  2YLN A;  1IXH A;  2Z22 A;  4KCC A;  4IB2 A;  5KZT A;  5IKB A;  4EXK A;  4OES A;  3HHF A;  4IO2 A;  1QUJ A;  1P1Q A;  2V25 A;  5CC2 A;  4MLQ A;  3OSR A;  1SDX A;  3KJ7 A;  4F1U A;  4DZ1 A;  1URS A;  2XXP A;  4G68 B;  4GLI A;  4FIM A;  4NF4 A;  3C31 A;  1M5C A;  3QK6 A;  4OFO A;  3VV5 A;  3MZ9 A;  2DE3 A;  1AOV A;  4KHZ E;  4OET A;  3C9H A;  4FOR A;  1PDA A;  3R7X A;  2UVJ A;  4HCW A;  4R2F A;  3FIR A;  4X1D A;  3C34 A;  1M5E A;  4KYD A;  1B46 A;  5H8H A;  2Q9T A;  1L5T A;  4OMB A;  1N3X A;  1RKM A;  3PMV A;  4HCY A;  4LQ5 A;  1EZO A;  2QJE A;  4IO3 A;  2ONS A;  3IL1 B;  1JVX A;  4IGR A;  5CMC A;  1FQE A;  1GVC A;  1I6A A;  2QMW A;  3G3F A;  3IOU A;  1PB9 A;  2F35 A;  3D4G A;  1DOT A;  4N07 A;  2XD3 A;  3O2A A;  1USY H;  2XXX A;  4PFT A;  5L9S A;  1MQD A;  4F19 A;  4OEN A;  1Y3N A;  2GHA A;  4M4G A;  3MP8 A;  1TFD A;  3IJO B;  3OO9 A;  1FQA A;  2PMS A;  3FVK A;  4U1Z A;  1DPE A;  1EU8 A;  3ZS6 A;  2ZNT A;  3IO4 A;  3QIM A;  2NOO A;  2F6G A;  1MM6 A;  1QKB A;  3U92 A;  3U94 A;  2DYX A;  4ZED A;  4RPO A;  4ELO A;  3BBR A;  3JV9 A;  5IAI A;  5ITP A;  2OZZ A;  1N84 A;  3USD A;  1B7Z A;  3C36 A;  1XC1 A;  3S2V A;  5FTI A;  4LZ8 A;  4H5G A;  4C0R A;  5L8D A;  1Q35 A;  4EUO A;  5AA2 D;  1NNF A;  5DYH A;  3ILT B;  1FTM A;  4R9F A;  3ILU B;  1FQF A;  5F7V A;  2ZMB A;  4UAC A;  4ZE8 A;  1AH5 A;  3KBR A;  4X9T A;  3N6U A;  3TKD A;  3B6W A;  1P99 A;  1MH3 A;  3RPW A;  1GTK A;  2HXW A;  5I84 A;  5DVF A;  4OTE A;  1QUL A;  4RNS A;  1Y9U A;  5CM6 A;  3E13 X;  4TLM B;  3MP1 A;  3CSB A;  2H99 A;  1VE4 A;  3DEL B;  4KPT A;  5H8Q B;  1JET A;  5H8N A;  1KWH A;  3IB2 A;  4IO6 A;  4XKN A;  4G77 A;  3SET A;  4YMA A;  1OQH A;  4LON B;  2UYE A;  1FQD A;  3RGY A;  5EHS A;  1SD3 A;  4M1V A;  3V83 A;  3LSW A;  1AL3 A;  4GL8 A;  4IY6 A;  2O7I A;  2I6E A;  3KSJ A;  4K3F A;  2I0B A;  2OJT A;  4KI0 E;  4I1D A;  1B40 A;  3VE1 B;  3PUX E;  4F1Y A;  3L6H A;  2GHB A;  1N3W A;  4U4S A;  3MPK A;  1ZIU A;  3IJX B;  1SYI A;  2RF1 A;  3I5O A;  1MY4 A;  3OEM A;  5AA1 A;  4THI A;  3JZJ A;  3UK4 A;  1H45 A;  4XKQ A;  1ZTY A;  1LFH A;  2XHD A;  3RTF B;  3K1M A;  2VP1 A;  3B6T A;  4H8J A;  3LSL A;  1JNF A;  3MP6 A;  2ZXT A;  4ZS9 A;  3U1O A;  4X1B A;  3O9P A;  1OQG A;  3OOA A;  1JW4 A;  3IR1 A;  4FE8 A;  1MH4 A;  1MM7 A;  4XKR A;  2PBW A;  3MVX A;  3IOT A;  1SBP A;  1BTJ A;  2F8D A;  4EQ7 A;  4Z0I A;  3H3G A;  1NNK A;  3G3I A;  2IEE A;  3KZG A;  1EH3 A;  3UGW A;  3UP9 A;  2ZNS A;  3R26 A;  2REJ A;  3PV0 E;  1JEU A;  4KQP A;  3T66 A;  5HM4 B;  2NVU B;  1A40 A;  5DVI A;  1MS7 A;  1VR5 A;  3CVG A;  2DWA A;  5TU0 A;  2M8C A;  3DP6 A;  2Q2C A;  2QS3 A;  2QL3 A;  3K6U A;  3W9W A;  3UOR A;  4H67 A;  4MLV A;  3HST A;  3T93 B;  3VVF A;  1NNP A;  5L9O A;  1FW0 A;  1B3G A;  4YMB A;  1USY E;  1MDQ A;  4F3G A;  4I8C A;  4P0G A;  3D4C A;  1S50 A;  3T9X B;  4QSD A;  4MBP A;  4GXS B;  4HW8 A;  3TQW A;  1J1N A;  2XXR A;  3LSX A;  3C4M A;  5H8F A;  2ZNU A;  3QAX A;  2UXA A;  1BKA A;  4BDN A;  4DE8 A;  3PPR A;  3E9X A;  2ZYN A;  1MY3 A;  5AA4 B;  4RY1 A;  3EHU A;  4BLA A;  4DCY A;  1GR2 A;  4OHN A;  4ESW A;  4OFL A;  2QS2 A;  4R2B A;  1Z7M E;  3AXF A;  2V3Q A;  3UIF A;  1R9Q A;  3HO7 A;  3CFZ A;  1XVY A;  1F9B A;  4IO7 A;  3TTN A;  1FQB A;  4WKM A;  4GVO A;  1Y3P A;  3PPO A;  3RUM A;  1OMP A;  4ELQ A;  4GL0 A;  1SQY A;  5AA3 A;  3K1N A;  4AB5 A;  1SVX B;  3S9N C;  3ECR A;  2PYY A;  2Y7P A;  1S7Y A;  4R72 A;  3K6W A;  3VFJ A;  2UVH A;  3K1P A;  1XOC A;  4Q30 B;  1BLF A;  5KCJ A;  4NE4 A;  2XXV A;  2O6A A;  3FAT A;  3EHT A;  3A09 A;  1NKX A;  4G68 C;  3MAM A;  3RT8 A;  1NMU A;  1XHY A;  1OVT A;  2QRY A;  3A3C A;  5I56 B;  4DDD A;  3OXN A;  5I2K B;  4QRZ A;  3FJM A;  4LQ2 A;  4NMY A;  3DLN A;  4PQJ A;  5DEX B;  4NF8 B;  1QW0 A;  3G3H A;  1B6H A;  2X7P A;  1SI0 A;  4H8I A;  1R1N A;  3G3K A;  3LSF B;  1Y1Z A;  2QS1 A;  1A7L A;  1YCJ A;  1Y20 A;  2REG A;  3MUQ A;  3TTR A;  4QF9 A;  1OIB A;  3PU5 A;  2Z8D A;  5AA2 A;  1SYH A;  3C32 A;  5TP9 A;  4E0W A;  1JW1 A;  2THI A;  2Q89 A;  4PFW A;  3FZV A;  1LB8 A;  1ZMG A;  5J1D A;  2AL4 A;  2B3B A;  4ZE9 A;  5EHM A;  3G3J A;  4MFI A;  2Z23 A;  2DE2 A;  1O63 A;  5CBS A;  4F3P A;  3PUZ E;  2DWI A;  2RC7 A;  4F18 A;  4WEP A;  3M3F A;  4GOT A;  3MC2 A;  3OEK A;  3N26 A;  5JTY B;  4H1X A;  3JYR A;  4BDM A;  3HV1 A;  1B3L A;  4XIG Q;  1QJM A;  2B3F A;  2H9B A;  3L6G A;  3M3L A;  2O84 X;  3MZ1 A;  1ATG A;  1A8E A;  2VD2 A;  2BJJ X;  5I57 B;  5ISU A;  4GWO A;  3KOS A;  1BIY A;  1Y4T A;  3OO6 A;  2FYI A;  1IUD A;  4NF6 A;  1PB7 A;  2F5X A;  3S4U A;  1B4Z A;  4QFL A;  4O3A A;  1QUI A;  5CMB A;  4QSC A;  1US4 A;  1XT8 A;  2F6P A;  2OCU A;  3T96 B;  5CBR A;  1B7U A;  3B7D A;  3K6X A;  4KR5 A;  4DIG A;  1B4H A;  4FEB A;  2PX1 A;  3CI8 A;  3O29 A;  2HAU A;  1H76 A;  3N94 A;  4YIC A;  1URD A;  4F29 A;  3FVO A;  4JDF A;  2AL5 A;  2ALU A;  4OWD A;  3PMX A;  1NL5 A;  2Q8J A;  5I58 A;  1YPN A;  3H6T A;  4ONY A;  1POY 1;  2F34 A;  1MXY A;  4XXU A;  4TQU Q;  4U23 A;  4ESX A;  4P0I A;  1MQH A;  1UQW A;  1B5I A;  1MXU A;  4N6P A;  2ANJ A;  4YKJ A;  4I9D A;  3KG2 A;  4DCX A;  4OZ9 A;  1O64 A;  1P1O A;  3Q26 A;  1MRP A;  4JWY A;  1LAX A;  3S9L C;  2F7C A;  1VSO A;  2RC8 A;  1T0K A;  4U22 A;  4POX A;  3FXR A;  4JSO A;  3EN3 A;  2GFE A;  1FTJ A;  3PD8 A;  4H5F A;  3M3K A;  1N04 A;  4R75 A;  1FTO A;  3KGC A;  2GRV A;  3TCG A;  1IIW A;  4U4X A;  4AB6 A;  3DP4 A;  1B3H A;  3HHG A;  2DWH A;  1WDN A;  2XD2 A;  4R9G A;  4RK9 A;  1S9T A;  2RCA A;  4F31 B;  3PD9 A;  5I59 B;  3EHS A;  4HS7 A;  3FD3 A;  1NH8 A;  3PUW E;  4BDL A;  4LZ7 A;  2HZL A;  4FED A;  3T22 A;  2XX7 A;  3PUV E;  2ZYK A;  3MZB A;  1Q1K A;  2XXQ A;  2CZL A;  2V3U A;  4YB5 A;  4ZEC A;  2VGQ A;  3DP8 A;  1ELJ A;  1A55 A;  4P11 A;  4LUB A;  3MBP A;  2Z8F A;  1UIU A;  4LP2 B;  2B65 A;  1IIT A;  4OVJ A;  1UTB B;  4H6D A;  1B3E A;  4ELR A;  3B6Q A;  4Q5T A;  4DXU A;  4YU0 A;  3FV2 A;  2DE4 A;  2O1L A;  2DSF A;  3PPP A;  1I6Q A;  1BP5 A;  1R9L A;  1IXG A;  2X7Q A;  5FHN A;  1N0T A;  5B7D A;  2DWJ A;  5TPA A;  4NF5 A;  1LAH E;  4G2Z A;  3KFM A;  2F7B A;  1B5H A;  3IOV A;  1OLC A;  3CG1 A;  4LVQ A;  3OO7 A;  2Y84 A;  1LB9 A;  4YKI A;  5KDT A;  4NF4 B;  4YAH X;  4R6Y A;  4QHQ A;  3FXU A;  2DVZ A;  2G93 A;  1RYX A;  4F1V A;  2OLB A;  4XKP A;  1LBC A;  1LAF E;  4KYS A;  4R73 A;  1MDP 1;  3VXB A;  1O7T A;  2HCA A;  4R6K A;  4KD5 A;  4GIZ A;  4EQB A;  1TT1 A;  5H8H B;  1DTZ A;  3TYH A;  5JEI A;  4G68 A;  3KJT A;  1UIV A;  3ZSF A;  1SI1 A;  3T9U A;  1B5J A;  3SEY A;  4RYA A;  5I2N A;  1MQG A;  4TLL B;  3HCQ A;  4EDP A;  2I4B A;  4IO5 A;  1PEB A;  4R6H A;  3OSQ A;  4U2R A;  3K00 A;  4RK2 A;  2IA4 A;  2DXY A;  1HSE A;  3H6U A;  2ESN A;  4QSE A;  3O66 A;  4RJZ A;  4PFY A;  2XX9 A;  3OO8 A;  2X26 A;  4LAT A;  3PPN A;  4KCD A;  5I58 B;  3MVW A;  3CIJ A;  3SEU A;  1MPD A;  2I48 A;  2HEU A;  3ODB A;  2KLF A;  1N7X A;  3FXQ A;  3I3V A;  4ZZE A;  4HTG A;  1CE2 A;  3ONM A;  5AE4 A;  3EF7 A;  1PB8 A;  3KSX A;  1N7W A;  1MXX A;  3H7M A;  3QUF A;  4PET A;  3W15 C;  3OMB A;  1WOD A;  2UVG A;  4QFP A;  1EZP A;  1OVB A;  3Q28 A;  1YAE A;  2UVI A;  3T9V A;  1HSJ A;  3IB0 A;  3UA8 A;  1R6Z A;  4GD5 A;  5CMK A;  4X48 A;  2RKM A;  4QFO A;  2NWJ A;  1PBP A;  3O6G A;  1Z7N E;  2D21 A;  2FNC A;  2H5Y A;  1LCT A;  2A5S A;  2QPQ A;  2XXT A;  1JEV A;  4DXC A;  3IO6 A;  1LFI A;  3MVY A;  2I58 A;  3ZKL A;  4EQ9 A;  1B58 A;  3G3G A;  1MG1 A;  3RQT A;  1P1W A;  3QXM A;  2O7U A;  3V89 B;  3MWB A;  1ANF A;  5F1Q A;  3GLB A;  4BDO A;  3GXA A;  4H65 A;  2Z8E A;  1DSN A;  3N5L A;  4F3B A;  2XXI A;  3SES A;  4O3B A;  2RCB A;  1MQI A;  5H8N B;  4GF8 A;  2VD3 A;  2P1S A;  3EQ1 A;  2HZK A;  3FVN A;  3C33 A;  3MVZ A;  4OEV A;  3WAF A;  4F2O A;  4F22 A;  2O68 A;  1GGG A;  1TWY A;  1DMB A;  5DTB A;  1IXC A;  1QUK A;  4EF1 A;  3VXC A;  1LCF A;  2D5W A;  4JXI A;  3K4U A;  2DQV A;  4NF5 B;  4YZZ A;  1UTH A;  2AIX A;  5H8Q A;  3ZKK A;  4C1T A;  1B1H A;  4NTL A;  2HAV A;  3VLW A;  3TAJ A;  1SW2 A;  2A5T A;  3CR9 A;  1YTV A;  4Q0C A;  1A54 A;  1GV8 A;  1MXV A;  2Q88 A;  1MXZ A;  2R6G E;  1B7H A;  1B9J A;  5HPQ A;  1D4N A;  1DPP A;  4KFQ A;  2VOZ A;  2QS4 A;  3TUS A;  2RIN A;  3SDF A;  3IAZ A;  3Q29 A;  4R74 A;  4XTC Q;  4FAJ A;  3RT6 B;  4ZZA A;  3G7W A;  2P0S A;  2O51 A;  3MPL A;  1AMF A;  1LBB A;  2O69 A;  3PGF A;  5A5X A;  3UN6 A;  1LST A;  4PFU A;  1B1X A;  3Q27 A;  5I2N B;  1LGB C;  1LLS A;  2DVC A;  3FUZ A;  1NH7 A;  2W7Y A;  3CG3 A;  3TQL A;  3OEN A;  1I69 A;  3VVE A;  1MXW A;  1Y4C A;  1B2H A;  5H8S A;  1H3D A;  1M5B A;  3LUY A;  1PBQ A;  4BDQ A;  1MY1 A;  5FTH A;  1IEJ A;  4F3S A;  2QSX A;  3SEX A;  2E0S A;  3SER A;  4DLD A;  4KYE A;  4G4P A;  4BDR A;  1JQF A;  2F97 A;  3HN0 A;  3FGS A;  4OYV A;  4IO4 A;  1P1N A;  1ZLQ A;  1D9V A;  5CMM A;  2I49 A;  2R71 A;  1B52 A;  3TCH A;  3H6V A;  3W9V A;  4WXJ A;  3MW0 A;  4ECF A;  5EYF A;  4JWO A;  3OD7 A;  4MH5 A;  3R6U A;  5H8F B;  1XVX A;  4ELP A;  3MJN A;  1D9Y A;  1HSL A;  3SEW A;  3TEL A;  4H0W A;  3KN8 A;  1SW5 A;  3QYT A;  1B0L A;  2GH9 A;  3O6H A;  5BUU A;  4F2Q A;  3U72 A;  1AIV A;  4O3C A;  2E1S A;  1SW4 A;  4ZEB A;  1Y3Q A;  3I6V A;  1B3F A;  2Y7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...