3R6UA

Crystal structure of choline binding protein opubc from bacillus subtilis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
QTIKIGAQSMSESEIIASMLGQLIEHHTDLKTTTIKNLGSNAVQQQALMNGEIDIAATRYTGDALTGTLRMEPEKDPDKALALTQREFKKRYDLKWYDSYGFDNTYAFTVSKELADQYHLETVSDVKKWAPQLKLGVDNYWMKLKGNGYQDFTKTYGMTFGGTYPMQIGLVYDAVKSGKMDIVLAYSTDGRIKSYGLKMLKDDKQFFPPYDCSPVVPEKVLKEHPELEGIIKKMLGKIDTATMQELNYEVDGNLKEPSVVAKEYLEKHRYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Choline-binding protein
publication title The Crystal Structure of the Substrate-Binding Protein OpuBC from Bacillus subtilis in Complex with Choline.
pubmed doi rcsb
total genus 97
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3r6uA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3r6uA02
1XOCA 5KCJB 1H76A 4BDLA 2OZZA 2Q88A 5EHSA 2RKMA 3M3FA 3T93B 1S9TA 2D5WA 5AA2B 3CFXA 4O3AA 3O6IA 3U92A 1UTHB 4JWOA 3TYHA 4OFJA 4ZZAA 5I2NA 4OFOA 1CB6A 4OEVA 2Y7PA 4M1VA 2H9BA 1HSEA 1P1WA 1S7YA 3OO8A 4ZEBA 4QFLA 1P99A 1SD3A 4IO5A 1Y3PA 4ZECA 3PGFA 1TFAA 4BDOA 3LSLA 4F2QA 2FA7A 3BFUA 3C34A 4ELPA 5I57B 5I2NB 1GTKA 1N3WA 1Y4TA 3HV1A 3KFMA 2UYFA 3U1OA 1FQAA 4GL8A 4NF6A 3D4CA 3H6VA 3MQ9A 3MAMA 1A55A 5J1DA 4U2RA 4PFWA 1L5TA 2VHAA 5JTYB 3TFLA 3QAXA 2XXYA 3FV2A 4N6PA 1SVXB 4XKQA 2QS1A 3WAFA 4P11A 1FTJA 1B9JA 3QYTA 3GZGA 3E3KA 4EF2A 3C36A 4U21A 1UTBA 3IJXB 2HCAA 3CRBA 1IEJA 3EHSA 4XIGQ 3VLWA 1DMBA 1B3LA 1NNPA 3PD9A 5ITPA 1DPEA 2NXOA 1PC3A 4K3FA 4EUOA 2DWIA 4IO6A 3LSWA 4Q5TA 1ANFA 4U22A 2ABHA 1FTLA 3OENA 3S9MC 3MWBA 5L9SA 1EZ9A 1N7WA 4KYSA 3EF7A 2PMSA 4THIA 1PEBA 4NF8B 2NVUB 1WDNA 3TCHA 3OMBA 1EZOA 3B6WA 1USYH 2THIA 4DXCA 1MH3A 2I48A 2PYYA 3UN6A 2V3QA 3OD7A 1I6BA 1SI1A 1MXWA 4QRZA 4U1ZA 2GHAA 2FNCA 3IOVA 4RA1A 4GIZA 3TPAA 5CMMA 3TTMA 3LC8A 5FHOA 4X48A 3HHGA 1ZJLA 3PUYE 3G3JA 4H6DA 5I2KB 3TELA 3N94A 4DIGA 3ODBA 3GBBA 2G93A 3EPEA 3O66A 3VFJA 4OENA 1UQWA 1MG1A 4PP0A 5BUUA 4H8JA 3G3IA 1R9LA 1LAFE 4IY5A 2DXRA 4U23A 3HPIA 1ZTYA 3CG1A 3RTWB 5H8QA 4TLMB 1NL5A 5I84A 4MH5A 2OWSA 2PT1A 2YJPA 1ZU0A 5H8FA 1F9BA 3FJ7A 1N0TA 1OIBA 2UVGA 3OSRA 1N04A 4EQ7A 2RC8A 4H67A 4R6HA 3KBRA 1MXUA 4KCCA 3R7XA 2Z8DA 4NF4A 5K2XA 1Y9UA 3PUZE 2HZKA 2XXPA 4ESXA 2A5TB 3SERA 3TDJA 2RC9A 4HCWA 4MLVA 3FGSA 1P1NA 3HN0A 2D21A 5DTBA 1FQBA 1SBPA 2V3TA 3UP9A 1FQFA 4WEDA 1AIVA 2DQVA 4TQUQ 2I49A 5HM4B 1OQGA 3QK6A 4C1TA 3VVDA 5I56B 3IOTA 3ZKLA 2BJJX 5H8HA 1A7LA 3QUFA 4GWOA 3E9XA 1H44A 2IA4A 4F2OA 1RYXA 2Z22A 5CBSA 1JEUA 5TPAB 2PBWA 4ZEKA 1ELJA 4F18A 3T96B 3O97A 3U8QA 3V89B 3FJGA 3MC2A 3G3FA 5KZTA 1N76A 1B3GA 4GXSB 2DXYA 1GGGA 4I8CA 3ONMA 3H6WA 4IO3A 4C1UA 1HSJA 1B5IA 1B7ZA 4EXKA 1PDAA 4MBPA 1P1UA 4WXJA 1B2HA 2XHDA 4F1VA 3U72A 1SYHA 4X1DA 1IXHA 4LZ8A 4PE5B 2V93A 4JDFA 1SQYA 4PFTA 1NKXA 1POY1 2VD2A 1B1HA 4KYDA 3DLNA 1OVTA 2F6PA 3IOUA 3FVOA 2O84X 1JW1A 1EZPA 2X7PA 1IQ7A 2I3VA 4KPTA 2Q2AA 1PB7A 4NTLA 1B5HA 1BLFA 4RXLA 4XKRA 1AL3A 3PUWE 4Q0CA 4X9TA 4R72A 3TQLA 2WKYA 3SEYA 2O69A 4ZE9A 3OEKA 4R2FA 1B3HA 3ZS6A 3RGYA 3CFLA 4TOZA 3B6QA 4P0GA 5ELVA 2F36A 2GFEA 4ONYA 2F8DA 3BFTA 1LFIA 1QKBA 5TP9B 2HXWA 5DEXB 5CMKA 2XX8A 2O7UA 4R9FA 3P7IA 5I58A 1AMFA 3V83A 4F31B 3KOSA 3M8UA 3QIMA 2H25A 4KD5A 3MVYA 4IGTA 3KN3A 2ANJA 1R1NA 5A5XB 2RCAA 1A8EA 4GOTA 1MQGA 5ICTA 3AXFA 1BIYA 4BDMA 5AA1A 4KFQA 3TTRA 3KZGA 4GL0A 1DOTA 2ZMBA 3C9HA 3K01A 3H03A 1POTA 2DP8A 1UIVA 1S50A 1B0HA 4H65A 4BLAA 3FATA 3CVGA 4FEDA 4PETA 1MY2A 4NF5B 5K2YA 1B7UA 5FTHA 3TTKA 1Q1KA 4OWDA 1USYE 4F3GA 2REGA 3MBPA 2FYIA 4U1OA 1O63A 5CBRA 2QMXA 3ZSFA 5I59B 2DWAA 3UORA 2B3FA 1LB9A 1OLCA 2HAUA 4NEDA 4JWYA 1I6AA 3JZJA 2R6GE 4AB5A 4KI0E 4YB7A 4DLDA 3CFZA 4ISUA 3L6HA 4H5GA 4EQBA 2OCUA 2QSXA 5KDTA 4G68B 3HSTA 1LFHA 1R6ZA 2VP1A 1SDXA 2XX7A 3TCGA 1QULA 3FXQA 2XXIA 4G2ZA 2QJEA 2DWHA 4YICA 3S9EA 3B7DA 2ONRA 4H8IA 1MY3A 3W15C 2QRYA 2XXVA 1MXVA 4NWDA 1DPPA 3FZVA 2I3WA 5AA4A 1VFEA 2NWJA 4GF8A 3MP6A 3TZAA 3TKDA 3GBAA 3C33A 3O6GA 1P1OA 5ICQA 3IB1A 1D4NA 3TMGA 4QFPA 1QUJA 2HFBA 2HZLA 3RN8A 1YAEA 4GVOA 5AA4B 3PU5A 3SKPA 4OHNA 4QSEA 3KN7A 4LQ2A 4G68C 1KWHA 3A3CA 3OOAA 4NF6B 4LVQA 1OQHA 4F1YA 4OESA 1A40A 4FE8A 3TUSA 3T9VA 2F5XA 1JEVA 3EHTA 2NOOA 4PQJA 2V25A 5FHMA 1JETA 1EH3A 2DE3A 3V5AA 2XXWA 3O2AA 3PPQA 3ILUB 3D4GA 2ZNTA 3DP8A 1B6HA 3TODA 3G3KA 4JSDA 3PPPA 2PX1A 1UTBB 1Z7ME 3N6UA 3ECRA 4MFIA 1DTZA 3A09A 4GFRA 2UYEA 5DVIA 4IO7A 4FECA 4JWXA 4DZ1A 4OMBA 3RNNA 3IO4A 1SYIA 4LZ5A 4YU0A 3FASA 3IR1A 4X1BA 2GRVA 3CIJA 3MW0A 2F78A 3LSXA 5AA3A 3H7MA 4AQ4A 1OLAA 4JXIA 4ND9A 4AB6A 2HAVA 3GXAA 4ELOA 3CR9A 4KHZE 3Q29A 4BDRA 1SW5A 3S4UA 2V3UA 2Z8FA 3VXCA 3FVKA 3KOTA 2X26A 3RPWA 4FORA 2Y7IA 1MY4A 3K00A 1H45A 4ELQA 3KJ7A 2VOZA 1MQIA 1MQDA 5AE4A 3MVXA 4R6KA 1XC1A 2REJA 4OETA 2R9JA 3VLUA 4N13A 1QUIA 4QSDA 4F3PA 1MXZA 4POWA 4OERA 2F7CA 3O29A 3OO6A 4NWCA 1QJMA 3T66A 1PB8A 3U93A 1YTVA 1FTKA 1NH7A 5H8QB 2Z23A 2UVHA 4OVJA 2HEUA 3LUYA 3Q28A 1B7HA 1Y1MA 5H8FB 1URDA 3I6VA 1MQHA 3VVEA 3KJTA 4G4PA 2PT2A 1HSLA 2F35A 4UACA 4HW8A 4G77A 3K02A 1GVCA 1B58A 2RINA 3FVGA 4HCYA 3TTLA 2I0CA 3VXBA 3W9WA 4OXVA 2Q89A 4NF4B 4ZEDA 4RPOA 3CI8A 3KSJA 4GLIA 4YAHX 1A8FA 3R26A 2ZXTA 3G3GA 5DVFA 1B40A 3USDA 5L9MA 1MXYA 2DE2A 4G8HA 3IOWA 1B51A 1RKMA 1MRPA 1JQFA 3UGWA 1ATGA 1LB8A 3HO7A 4OZ9A 1IXCA 1XT8A 1IXIA 3VE1B 3QXMA 1Y4CA 1US5A 5JEIA 1LCFA 3FJMA 1Q35A 2Y7KA 5H8HB 4F19A 2H98A 2CMOA 1TXFA 4I1DA 2XXQA 4FIMA 2P2AA 1IITA 4DXUA 2YLNA 1UIUA 4RPNA 1QKAA 1MH4A 3ZKKA 3H4ZA 3V8XB 2QMWA 1Y20A 1LBCA 3LR1A 1B5JA 3Q26A 4F3BA 4BDQA 3B6TA 1AOVA 5LOMA 2XXTA 1LLSA 3TCFA 2QPQA 1TFDA 1M5BA 1CE2A 4LA9A 4R6YA 4DDDA 2DE4A 4YKKA 3RT6B 3S9LC 2O51A 1FQDA 4Z0IA 3CSBA 4IY6A 3S2VA 4FATA 1OVBA 1BP5A 3IJOB 3OO7A 4YKIA 3K4UA 3Q25A 1LAGE 2YPNA 3BBRA 2LAOA 4OYVA 1R9QA 4BDNA 4HTGA 5DVJA 4IGRA 4E0WA 5H8NA 2RF1A 3T9HB 5HPQA 1D3KA 2I0BA 5CM6A 4IO4A 1B3FA 2GH9A 5HBCA 3MUQA 2QL3A 1Y3QA 3UIFA 2D3IA 2ALUA 4JB7A 2OWTA 3FIRA 1RYOA 5H8NB 2W7YA 5I58B 2F6GA 2F7AA 3SETA 2I4BA 2ONKE 3K1PA 4NE4A 4Q30B 3FD3A 3BKIB 1XVXA 3EQ1A 2B3BA 1VSOA 5EYFA 1BTJA 3G7WA 1NNFA 5IAIA 4HS7A 3M3LA 1IZ1A 1II5A 1J1NA 1B4ZA 3VV5A 3IAZA 4F39A 3K6XA 4PFUA 1FQCA 3PMXA 4EQ9A 1Y3NA 1P1QA 1JNFA 1URSA 3E13X 1N84A 3W9VA 1NMUA 1MQJA 3H6TA 4H1XA 5M2VA 4Z7EA 1I69A 5KCJA 4EXLA 2O68A 1LAXA 1NH8A 1MS7A 2Y84A 4E0XA 2OJTA 3N6TA 4OQOA 3VVFA 4M4GA 4I9DA 3FXRA 3TAJA 2KLFA 2P1SA 2O7IA 1UTHA 3VDFA 3F11A 1BKAA 3SESA 2ZYMA 4PFYA 3T9XB 5B70A 5JK4A 4F22A 1PBQA 3E4RA 5EHMA 1AH5A 1XHYA 3MP8A 3ILTB 3O28A 3TTNA 2VD3A 3MP1A 2V84A 2X7QA 5KDTB 1MPBA 4F1UA 4H5FA 2DSFA 4YMBA 3K2DA 3MZBA 4XKNA 5I57A 4ZZEA 4L17A 3MZ9A 4G8NA 2ONSA 1MPCA 3K6UA 2R71A 4QFKA 1URGA 1XVYA 1LBBA 2Y7WA 2O1LA 3JYRA 2AL4A 2I6EA 1LCTA 4DCYA 1FTMA 1M5DA 5JTYA 3MVZA 1B32A 1PBPA 4Q8RA 1NNTA 2O1MA 2DS9A 5H8SA 2AYSA 3N5LA 1SW4A 3FV1A 2ZNUA 3O6HA 3KSXA 4ECFA 1FW0A 1IXGA 1JW4A 3GLBA 3KG2A 4RK2A 4NMYA 4WKMA 2QS3A 3LSFB 3H06B 5CMCA 4U4XA 4R74A 2VGQA 2DVCA 4LATA 4YZZA 1SW2A 3I5OA 3RUMA 3DP6A 1B05A 4P0IA 2Q2CA 4FEBA 1NFTA 4QSCA 5AA2D 4QHQA 2H4IA 3FXUA 4NF8A 4KR5A 2ZYNA 3PPOA 3PUVE 5TU0A 4GD5A 3TQWA 3H3GA 2F34A 4LONB 1D9VA 4KYEA 1B46A 1QVSA 3IX1A 3SEXA 3K6VA 4FJPA 1ZLQA 4MLQA 3K6WA 3T22A 3DP4A 3WAEA 4LUBA 5F1QA 3RLFE 1ZIUA 3HCQA 5I2KA 1M5EA 1MY0A 4EDPA 2O6AA 3QUJA 3VLVA 1YPNA 3PD8A 1TWYA 3K0VA 1A99A 1I6QA 3SEUA 5IKBA 1TT1A 4EF1A 1NNKA 1QW0A 1B3EA 1M5FA 1GV8A 4OFLA 1LGBC 3LBSA 4DXBA 5FHNA 4ZE8A 5CMBA 1VR5A 2PVUA 3RT8A 3TEPA 3IO6A 3KN8A 4XKPA 3PMVA 3S9NC 2H5YA 4ELRA 2XD3A 4ZEIA 3FVNA 4ZEFA 2I58A 1DSNA 1A54A 3IORA 2A5TA 2DWJA 3JV9A 1LAHE 5F7VA 2OLBA 4ESWA 2E0SA 2Y7RA 4R2BA 2A5SA 3I3VA 3A3UA 2ESNA 2XXUA 4MF3A 4RYAA 4LQ5A 5CRYA 5B7DA 1MDQA 3SEWA 5ITOA 3K1MA 1JW5A 2F97A 3OSQA 5I56A 1JVYA 4ZS9A 4KQPA 2AL5A 2H99A 3IB0A 4U4SA 3IB2A 2XX9A 4WEPA 3UA8A 4YB5A 5TPAA 4IO2A 1B52A 1H3DA 4O3BA 3U94A 4UA8A 1YCJA 2NUVA 4OTEA 4YKJA 4GQOA 3THIA 4GRKA 4F29A 4FAJA 1M5CA 3OELA 3UK4A 4KCDA 1JVXA 2HQ0A 3EN3A 3IL1B 3L6GA 4TLLB 3CG3A 3HHFA 2Q8JA 3PPNA 3C32A 4RY1A 1VFDA 4QF9A 1PB9A 4RJZA 1OMPA 2F7BA 1N3XA 3DELB 3H6UA 3RQTA 2ZYKA 2Q9TA 2DOJA 1IIWA 4QFNA 4R75A 4POXA 1MPDA 4O3CA 2RC7A 1WVJA 1Y1ZA 2DYXA 2XD2A 4DE8A 4YMAA 2Z8EA 5BWJA 4RK9A 2RCBA 1Z7NE 1ZKBA 1SW1A 4YB6A 4JSOA 2I4CA 3MJNA 3PV0E 3M3KA 2QS4A 1B4HA 1B1XA 4ZDMA 1GR2A 1MY1A 1MM7A 3MPKA 3KEIA 4LP2B 2XXRA 3QSLA 4YKPA 1T0KA 5TP9A 5DEXA 3RY3A 2UXAA 4H0WA 1D9YA 4OEUA 2IEEA 1H43A 2UVIA 1B0LA 3CSGA 3C31A 2DVZA 1VE4A 5DT6A 4XTCQ 4IB2A 5DYHA 2AIXA 5A5XA 3PPRA 3SDFA 3RTFB 3K1NA 5CC2A 1FQEA 3DM0A 3MZ1A 2P0SA 3PUXE 3KGCA 3MVWA 5CI5A 1LFGA 3O9PA 1ZMGA 3IK6B 4C0RA 3MPLA 4N07A 2QS2A 4NF5A 2GHBA 4LZ7A 4G8MA 3OEMA 1SI0A 1O64A 1MXXA 3OXNA 2XXXA 4R73A 2XXHA 5I59A 3PMWA 5ISUA 2B65A 1O7TA 4JBZA 3EHUA 5L9OA 3N26A 2M8CA 2ZNSA 3R6UA 3C35A 1XS5A 2ZYOA 4GXAA 5FTIA 2E1SA 1LSTA 1FTOA 3SEVA 4DCXA 4R9GA 3T9UA 4I62A 1QUKA 4RNSA 1EU8A 3OO9A 4G68A 1ZBMA 3C4MA 2UVJA 1DTGA 3Q27A 4F3SA 2OBGA 1FCKA 4QFOA 5AA2A 3G3HA 1MDP1 5L8DA 2G29A 1WODA 2OK2A 1IUDA 2CZLA 1US4A 1MM6A 3FUZA 1N7XA 4XXUA
chains in the Genus database with same CATH superfamily
4NX1A 1XOCA 5KCJB 1H76A 4BDLA 2OZZA 2Q88A 5EHSA 2RKMA 3M3FA 3T93B 1S9TA 2D5WA 5AA2B 3CFXA 4GX4A 4O3AA 3O6IA 3U92A 1UTHB 5IZ1A 4JWOA 3TYHA 2PFYA 4OFJA 4ZZAA 5I2NA 4OFOA 1CB6A 4OEVA 2Y7PA 4M1VA 3BIHA 2H9BA 1HSEA 1P1WA 1S7YA 3OO8A 4ZEBA 1BK4A 4QFLA 1P99A 1SD3A 4IO5A 1Y3PA 2QVVA 4ZECA 3PGFA 5F24A 1TFAA 4BDOA 3LSLA 4F2QA 2FA7A 3BFUA 3C34A 3LV0A 4ELPA 5I57B 5I2NB 1EYJA 1GTKA 1N3WA 1Y4TA 3HV1A 3ROJA 3KFMA 2UYFA 3U1OA 1FQAA 4GL8A 4NF6A 3D4CA 3H6VA 3MQ9A 1LBWA 3MAMA 1A55A 5J1DA 4U2RA 4PFWA 1L5TA 2VHAA 5JTYB 1NV6A 3TFLA 2VPNA 3QAXA 1FPIA 2XXYA 4PF8A 3FV2A 2CZIA 4N6PA 1G0IA 2FHYA 1SVXB 4XKQA 2QS1A 3WAFA 4PGNA 4P11A 1FTJA 1B9JA 3QYTA 3GZGA 3E3KA 4EF2A 3C36A 4U21A 1UTBA 4OVPA 3U65A 3IJXB 2HCAA 3CRBA 1IEJA 4OVSA 3EHSA 4XIGQ 3VLWA 1DMBA 1B3LA 1FPJA 1NNPA 3PD9A 5ITPA 5DW8A 1DPEA 2NXOA 1PC3A 4K3FA 4EUOA 2DWIA 4IO6A 3LSWA 4Q5TA 1DK4A 4PCDA 1ANFA 4U22A 2ABHA 1FTLA 3OENA 3S9MC 4OVTA 5LTCA 3MWBA 5L9SA 1EZ9A 1N7WA 3FXBA 2V4CA 4KYSA 3EF7A 2PMSA 4THIA 1PEBA 4NF8B 2NVUB 1WDNA 3TCHA 3OMBA 1EZOA 3B6WA 4PAFA 1USYH 2THIA 4DXCA 1MH3A 2I48A 4PC9A 2PYYA 3UN6A 2V3QA 3OD7A 1I6BA 1SI1A 1MXWA 4QRZA 4U1ZA 2GHAA 2FNCA 3IOVA 4RA1A 4GIZA 3TPAA 5CMMA 3TTMA 3LC8A 5FHOA 1FBDA 4X48A 3HHGA 1NUXA 1XI6A 1ZJLA 4MAGA 3PUYE 3G3JA 4H6DA 5I2KB 3TELA 3N94A 4MHFA 4DIGA 4UABA 3ODBA 3GBBA 2BJIA 2G93A 3EPEA 3O66A 3VFJA 4OENA 1UQWA 3B8BA 1MG1A 4PP0A 5BUUA 4MX6A 4H8JA 3G3IA 1R9LA 4P3LA 1LAFE 4IY5A 2DXRA 4U23A 3HPIA 1ZTYA 2XXKA 3CG1A 3RTWB 5H8QA 1K9YA 4TLMB 1NL5A 5I84A 4MH5A 2OWSA 2PT1A 2YJPA 1ZU0A 1IMBA 5H8FA 1F9BA 3FJ7A 1N0TA 2VT5A 1OIBA 2UVGA 4O94A 3OSRA 3IFCA 1N04A 4EQ7A 2FIXA 4GBWA 2RC8A 4H67A 4R6HA 3KBRA 1MXUA 4KCCA 3R7XA 2Z8DA 4NF4A 4XF5A 2FBPA 5EYHA 5K2XA 1Y9UA 3PUZE 2HZKA 2XXPA 4ESXA 2A5TB 3SERA 3TDJA 2RC9A 4HCWA 5EYGA 4MLVA 3FGSA 5ET5A 1P1NA 3HN0A 2D21A 5DTBA 1FQBA 1SBPA 2V3TA 3UP9A 1FQFA 4WEDA 1AIVA 5ET8A 2DQVA 4TQUQ 2I49A 5HM4B 1OQGA 1NV1A 1EYIA 3QK6A 4C1TA 3VVDA 2WBBA 5I56B 3IOTA 3ZKLA 2BJJX 5H8HA 1A7LA 3QUFA 4GWOA 3E9XA 4NN3A 1H44A 2IA4A 4F2OA 1RYXA 2Z22A 5CBSA 1JEUA 5TPAB 2PBWA 4ZEKA 1ELJA 4F18A 3T96B 3O97A 3U8QA 3V89B 3FJGA 3MC2A 3G3FA 5KZTA 1N76A 1B3GA 4GXSB 2DXYA 1GGGA 4I8CA 3ONMA 5IM2A 3H6WA 3RPLB 4I3EA 4IO3A 4C1UA 1HSJA 1B5IA 1B7ZA 4MMPA 4EXKA 1PDAA 4MBPA 2P3VA 1FBPA 1P1UA 4WXJA 1B2HA 4N81A 2XHDA 4F1VA 3U72A 1SYHA 4X1DA 2CEXA 1IXHA 4LZ8A 4PE5B 2V93A 4JDFA 1SQYA 4PFTA 1NKXA 1POY1 2VD2A 1B1HA 4KYDA 3DLNA 1OVTA 2F6PA 3IOUA 3FVOA 2O84X 1JW1A 1EZPA 2X7PA 1IQ7A 2I3VA 4KPTA 2Q2AA 1PB7A 4NTLA 1B5HA 1FBFA 1BLFA 4RXLA 4XKRA 1AL3A 3PUWE 4Q0CA 4X9TA 4R72A 2WKYA 3TQLA 3SEYA 1FSAA 2O69A 4ZE9A 3OEKA 2XWIA 4R2FA 4MCOA 1B3HA 3ZS6A 4AS4A 3CFLA 3RGYA 1QGXA 4TOZA 3B6QA 4P0GA 5ELVA 2F36A 2GFEA 4ONYA 2F8DA 4MNIA 4JVIA 3BFTA 1LFIA 1QKBA 5TP9B 2HXWA 5DEXB 5CMKA 3BIGA 2XX8A 2O7UA 4NAPA 4R9FA 3T1BA 4PDHA 1FTAA 3P7IA 5I58A 1AMFA 5ESYA 3V83A 4F31B 3KOSA 3M8UA 3QIMA 2H25A 4GBVA 4KD5A 2QFLA 4P8BA 3MVYA 4IGTA 3KN3A 2ANJA 1R1NA 5A5XB 3MYUA 2RCAA 1A8EA 4GOTA 1MQGA 5ICTA 3AXFA 4N8YA 4N6DA 1BIYA 4BDMA 5AA1A 4KFQA 3TTRA 3KZGA 4GL0A 1DOTA 2ZMBA 3C9HA 4GWXA 4MJOA 3K01A 3H03A 1POTA 2DP8A 4OA4A 1UIVA 1S50A 1FPDA 1B0HA 4H65A 4BLAA 3FATA 3CVGA 4FEDA 1INPA 4PETA 1MY2A 1YXIA 4NF5B 5K2YA 1B7UA 5FTHA 3TTKA 1Q1KA 4OWDA 1USYE 4F3GA 2REGA 3MBPA 2R8TA 2FYIA 4P47A 4U1OA 1O63A 5CBRA 2QMXA 4P56A 3ZSFA 5I59B 2DWAA 3UORA 2B3FA 1LB9A 1OLCA 3A29A 2HAUA 4NEDA 4JWYA 1I6AA 3JZJA 2R6GE 4AB5A 4KI0E 4YB7A 4GWUA 4DLDA 3CFZA 4ISUA 4N6KA 3L6HA 2B4LA 4H5GA 4EQBA 2OCUA 2QSXA 5KDTA 2HXRA 4G68B 4OVQA 3HSTA 1LFHA 1R6ZA 4GWYA 2VP1A 1NV0A 1SDXA 2XX7A 1NV4A 5I7IA 3TCGA 1QULA 3FXQA 5EQAA 2XXIA 4G2ZA 2QJEA 2DWHA 4YICA 3S9EA 3B7DA 2ONRA 4H8IA 1MY3A 3W15C 2QRYA 2XXVA 1FBEA 1MXVA 4NWDA 1DPPA 3FZVA 2I3WA 1FPBA 5AA4A 1VFEA 2NWJA 4GF8A 2VPOA 3MP6A 3TKDA 3TZAA 3GBAA 3C33A 3O6GA 1P1OA 5ICQA 3IB1A 2MKZA 1LBXA 1D4NA 3TMGA 4QFPA 1QUJA 2HFBA 4X04A 2HZLA 3RN8A 1YAEA 4GVOA 2WEFA 5AA4B 3PU5A 3SKPA 4OHNA 4QSEA 3KN7A 3B50A 4LQ2A 4G68C 1KWHA 4PTKA 3A3CA 3OOAA 4NF6B 1K9ZA 4LVQA 1OQHA 4F1YA 4OESA 1A40A 2CEYA 4FE8A 3TUSA 3T9VA 2F5XA 1JEVA 3EHTA 2NOOA 4PQJA 2V25A 5FHMA 1JETA 1EH3A 2DE3A 3V5AA 4O7MA 2XXWA 3O2AA 3PPQA 3LUZA 5A5LA 3ILUB 3D4GA 2ZNTA 3DP8A 1B6HA 3TODA 3G3KA 4JSDA 5I3SA 3PPPA 2PX1A 1UTBB 1Z7ME 3N6UA 3ECRA 4MFIA 1DTZA 4JVDA 3A09A 4GFRA 2UYEA 5DVIA 1FBHA 4IO7A 4FECA 1JP4A 4JWXA 4DZ1A 4OMBA 3RNNA 3IO4A 1SYIA 1FRPA 4LZ5A 4YU0A 3FASA 3IR1A 4X1BA 1G0HA 2GRVA 3CIJA 3MW0A 2F78A 3IFAA 3LSXA 3KC1A 5AA3A 3H7MA 4AQ4A 1OLAA 4JXIA 4ND9A 4AB6A 2HAVA 3GXAA 4ELOA 3CR9A 4KHZE 3Q29A 3CHGA 4BDRA 1SW5A 3S4UA 2V3UA 2Z8FA 3VXCA 3FVKA 3KOTA 2X26A 3RPWA 4FORA 2Y7IA 1MY4A 3K00A 1H45A 4ELQA 3KJ7A 2VOZA 1MQIA 1MQDA 5AE4A 3MVXA 4R6KA 1XC1A 2REJA 4OETA 2R9JA 3VLUA 4N13A 2XWOA 3D1RA 1QUIA 4QSDA 4F3PA 1MXZA 4G61A 4POWA 4OERA 2F7CA 3O29A 3OO6A 4NWCA 5EQ8A 1QJMA 3T66A 1LEVA 2XWKA 1PB8A 2FVZA 3U93A 5I5PA 1YTVA 1FTKA 1NH7A 5H8QB 2Z23A 2F3BA 2UVHA 4OVRA 4OVJA 2HEUA 3LUYA 3Q28A 1B7HA 1Y1MA 2KR0A 5H8FB 1URDA 3I6VA 1MQHA 3VVEA 3KJTA 4G4PA 2PT2A 1HSLA 2F35A 3EKIA 4UACA 4HW8A 4G77A 3K02A 1GVCA 1B58A 2RINA 3FVGA 4HCYA 3TTLA 2I0CA 4NGUA 4I40A 3VXBA 3W9WA 4DI4B 2Q8MA 4OXVA 2Q89A 4NF4B 4ZEDA 4RPOA 1AWBA 3CI8A 4PFRA 3KSJA 4GLIA 4YAHX 1VDWA 1A8FA 3R26A 2ZXTA 5FBPA 3G3GA 5DVFA 1B40A 3USDA 4HE1A 5L9MA 1MXYA 2DE2A 4G8HA 3IOWA 1B51A 3PTYA 1RKMA 1MRPA 1JQFA 3UGWA 1ATGA 1LB8A 1NUZA 3HO7A 4OZ9A 1IXCA 1XT8A 1IXIA 3VE1B 3QXMA 1Y4CA 1US5A 4GWWA 4P9KA 5JEIA 1LCFA 3FJMA 1IMAA 1Q35A 5IZ3A 2Y7KA 2WBDA 5H8HB 4F19A 2H98A 2CMOA 4DI3D 1TXFA 4I1DA 2XXQA 4FIMA 1EYKA 2P2AA 1IITA 4DXUA 2YLNA 2ZZVA 4N91A 1UIUA 4RPNA 1QKAA 1MH4A 3ZKKA 3H4ZA 3V8XB 2QMWA 1Y20A 1LBCA 3LR1A 1B5JA 3Q26A 4F3BA 4MNCA 4BDQA 5IZ3B 3B6TA 1AOVA 1NV7A 5LOMA 2XXTA 1LLSA 3TCFA 5T3JA 2QPQA 2XWVA 1TFDA 4GWZA 1M5BA 1CE2A 4LA9A 4R6YA 4DDDA 2DE4A 4YKKA 3RT6B 3S9LC 2O51A 1FQDA 4Z0IA 3CSBA 4IY6A 3S2VA 4OANA 4FATA 1OVBA 1BP5A 4XEQA 4GX3A 3IJOB 1KZ8A 1Q9DA 3OO7A 4YKIA 3K4UA 3KBZA 3Q25A 1LAGE 2YPNA 3BBRA 2LAOA 4OYVA 2WYKA 1R9QA 4BDNA 2ZZWA 4HTGA 5DVJA 4IGRA 1SPIA 4E0WA 5H8NA 2RF1A 3T9HB 5HPQA 4NF0A 1D3KA 2I0BA 5CM6A 4IO4A 1B3FA 2GH9A 5HBCA 3MUQA 4KXPA 2QL3A 1Y3QA 3UIFA 2ZZXA 2D3IA 2ALUA 4JB7A 2OWTA 3FIRA 1RYOA 5H8NB 5ET7A 1NUWA 2W7YA 5I58B 2F6GA 3GYYA 2F7AA 1IMFA 3SETA 2I4BA 2ONKE 3K1PA 4NE4A 4HE0A 5J16A 4Q30B 3FD3A 2OWZA 3BKIB 1XVXA 3EQ1A 2B3BA 1VSOA 5EYFA 1BTJA 3G7WA 1NNFA 2HPGA 1RDYA 5IAIA 4HS7A 3M3LA 1IZ1A 1II5A 1J1NA 1B4ZA 3VV5A 3IAZA 4F39A 2JJKA 3K6XA 4PFUA 1FQCA 3PMXA 4EQ9A 1Y3NA 1KA1A 1P1QA 1JNFA 1URSA 3E13X 1N84A 3W9VA 1NMUA 1MQJA 3H6TA 2HHMA 4H1XA 5M2VA 3T0JA 4Z7EA 4HXVA 1I69A 5KCJA 2XA5A 4EXLA 2O68A 1LAXA 1NH8A 1MS7A 2Y84A 4E0XA 2OJTA 3N6TA 4OQOA 3VVFA 4M4GA 4I9DA 3FXRA 4MNPA 3TAJA 2KLFA 2P1SA 2Y5KA 4H46A 2O7IA 1UTHA 3VDFA 3F11A 1BKAA 3SESA 2ZYMA 4PFYA 3T9XB 5B70A 1NUYA 5JK4A 4F22A 1PBQA 3E4RA 5EHMA 1AH5A 1XHYA 3MP8A 3ILTB 3O28A 3TTNA 2VD3A 3KC0A 2WYPA 3MP1A 2V84A 2X7QA 5KDTB 4N15A 1YYZA 1MPBA 4HE2A 4X8RA 4F1UA 4XFEA 4H5FA 2DSFA 4YMBA 3K2DA 3MZBA 4XKNA 5I57A 3E78A 4H45A 4ZZEA 4L17A 3MZ9A 4G8NA 2B4MA 2ONSA 1CNQA 1MPCA 3K6UA 2R71A 4QFKA 1URGA 1XVYA 1LBBA 2Y7WA 4MEVA 2O1LA 3JYRA 2AL4A 2I6EA 4I3YA 1LCTA 4DCYA 1FTMA 2PFZA 1M5DA 1DCUA 5JTYA 3MVZA 1B32A 4O7IA 1FPKA 2CZHA 1PBPA 4N17A 1FJ6A 2OX3A 4Q8RA 1NNTA 2O1MA 2DS9A 5H8SA 2AYSA 3N5LA 1SW4A 2WX9A 3FV1A 2ZNUA 3O6HA 3KSXA 1FBCA 4ECFA 4O8MA 1FW0A 4PE3A 1IXGA 1JW4A 3GLBA 3KG2A 4RK2A 3E79A 4NMYA 4WKMA 2QS3A 3LSFB 1FPFA 3H06B 1FPGA 5CMCA 4U4XA 4R74A 2VGQA 2DVCA 4LATA 4YZZA 1SW2A 3I5OA 3RUMA 3DP6A 1B05A 4P0IA 2Q2CA 4FEBA 1NFTA 4QSCA 5AA2D 4QHQA 2H4IA 3FXUA 4NF8A 4KR5A 2ZYNA 3PPOA 3PUVE 5TU0A 4GD5A 3TQWA 3H3GA 2F34A 4LONB 1D9VA 4KYEA 1B46A 1QVSA 3IX1A 3SEXA 3K6VA 4FJPA 1ZLQA 4MLQA 3K6WA 3T22A 3DP4A 3WAEA 2PCRA 4LUBA 5F1QA 3RLFE 1ZIUA 5IGAA 3HCQA 5I2KA 4JVCA 1M5EA 1MY0A 4EDPA 2O6AA 3QUJA 5IZZA 3VLVA 4PGPA 1YPNA 3PD8A 1TWYA 3K0VA 1A99A 4GWSA 1I6QA 3SEUA 3NOHA 5IKBA 1TT1A 4EF1A 1NNKA 1QW0A 1B3EA 3ISPA 1M5FA 1GV8A 4OFLA 1LGBC 3LBSA 4DXBA 5FHNA 4ZE8A 5CMBA 1VR5A 2PVUA 2KQZA 4PFBA 3RT8A 2P3NA 3TEPA 3IO6A 3KN8A 4XKPA 3PMVA 3SZPA 3S9NC 2H5YA 4ELRA 4QBAA 2XD3A 4ZEIA 3FVNA 1NV2A 1IMEA 4ZEFA 2I58A 1DSNA 1A54A 3IORA 2A5TA 2DWJA 1FBGA 3JV9A 1LAHE 5F7VA 1DBZA 2OLBA 4ESWA 2E0SA 4NHBA 1RDZA 2Y7RA 4R2BA 2A5SA 2CZKA 3I3VA 3A3UA 4N8GA 2ESNA 2XXUA 4MF3A 4RYAA 2Y5LA 4LQ5A 5CRYA 5B7DA 1MDQA 3SEWA 3QMFA 5ITOA 3K1MA 1JW5A 2F97A 3OSQA 4GX6A 4N4UA 5I56A 1NV3A 1JVYA 4ZS9A 4KQPA 2AL5A 2H99A 3IB0A 4U4SA 3IB2A 2XX9A 4WEPA 3UA8A 4YB5A 5TPAA 1IMDA 4IO2A 2L5VA 1B52A 1H3DA 4PBQA 1D9QA 4O3BA 3U94A 4UA8A 1YCJA 4NG7A 2NUVA 4OTEA 4YKJA 4GQOA 3THIA 4GRKA 4F29A 3MSTA 4FAJA 1M5CA 3OELA 3RPLA 3UK4A 4KCDA 1JVXA 2HQ0A 3EN3A 3IL1B 3L6GA 4TLLB 3CG3A 3HHFA 2Q8JA 3PPNA 3C32A 4RY1A 1VFDA 4QF9A 1PB9A 4RJZA 1OMPA 2F7BA 2FIEA 1N3XA 1FJ9A 3DELB 3H6UA 5EQ9A 3RQTA 2QVRA 1NV5A 2ZYKA 2Q9TA 2DOJA 1IIWA 4QFNA 4R75A 4POXA 2Q74A 1MPDA 2DDKA 4O3CA 2RC7A 1WVJA 1Y1ZA 2DYXA 2XD2A 4DE8A 4YMAA 2Z8EA 5BWJA 4RK9A 2RCBA 1Z7NE 1ZKBA 1SW1A 4YB6A 4AS5A 4JSOA 2I4CA 3MJNA 3PV0E 3M3KA 2QS4A 1B4HA 1B1XA 4ZDMA 1GR2A 1MY1A 1MM7A 4PF6A 3MPKA 3KEIA 4LP2B 2XXRA 3QSLA 4YKPA 1T0KA 5TP9A 5DEXA 2QVUA 3RY3A 2UXAA 4H0WA 1D9YA 4OEUA 2IEEA 1H43A 2UVIA 1B0LA 3CSGA 5ET6A 2GQ1A 3C31A 2DVZA 1LBYA 1VE4A 5DT6A 4XTCQ 4IB2A 5DYHA 2AIXA 3RYDA 5A5XA 3PPRA 4NQ8A 3SDFA 3RTFB 3K1NA 4PAIA 5CC2A 1FQEA 3DM0A 5LDZA 1LBVA 3MZ1A 4FBPA 2P0SA 5EQ7A 3PUXE 3KGCA 1LBZA 1KA0A 1FPEA 3MVWA 5CI5A 1LFGA 3O9PA 1ZMGA 4PBHA 3IK6B 4C0RA 3MPLA 4N07A 3HFUA 1YZ0A 2QS2A 4NF5A 2GHBA 4LZ7A 4G8MA 3OEMA 1SI0A 1O64A 4IR8A 4MIJA 1MXXA 3OXNA 2XXXA 4R73A 2XXHA 2F3DA 3PMWA 5I59A 5ISUA 2B65A 1O7TA 4JBZA 3EHUA 1NI9A 5L9OA 3N26A 2M8CA 2ZNSA 1FPLA 3R6UA 3FBPA 4P1LA 3C35A 1XS5A 2ZYOA 4GXAA 5FTIA 2E1SA 1LSTA 1FTOA 3SEVA 4DCXA 4R9GA 3T9UA 4I62A 1IMCA 4LN5A 1QUKA 4RNSA 1EU8A 3OO9A 4QXDA 1RDXA 4G68A 1ZBMA 3C4MA 2UVJA 1DTGA 3Q27A 4F3SA 2OBGA 1FCKA 4QFOA 5AA2A 3G3HA 1MDP1 5L8DA 2G29A 1WODA 2OK2A 4PAKA 1IUDA 4P1EA 2CZLA 1US4A 1MM6A 4PFIA 3FUZA 4PDDA 1N7XA 4XXUA
chains in the Genus database with same CATH topology
1XOCA 5KCJB 1H76A 4BDLA 2OZZA 2Q88A 5EHSA 2RKMA 3M3FA 3T93B 1S9TA 2D5WA 5AA2B 3CFXA 4O3AA 3O6IA 3U92A 1UTHB 4JWOA 3TYHA 4OFJA 4ZZAA 5I2NA 4OFOA 1CB6A 4OEVA 2Y7PA 4M1VA 2H9BA 1HSEA 1P1WA 1S7YA 3OO8A 4ZEBA 4QFLA 1P99A 1SD3A 4IO5A 1Y3PA 4ZECA 3PGFA 1TFAA 4BDOA 3LSLA 4F2QA 2FA7A 3BFUA 3C34A 4ELPA 5I57B 5I2NB 1GTKA 1N3WA 1Y4TA 3HV1A 3KFMA 2UYFA 3U1OA 1FQAA 4GL8A 4NF6A 3D4CA 3H6VA 3MQ9A 3MAMA 1A55A 5J1DA 4U2RA 4PFWA 1L5TA 2VHAA 5JTYB 3TFLA 3QAXA 2XXYA 3FV2A 4N6PA 1SVXB 4XKQA 2QS1A 3WAFA 4P11A 1FTJA 1B9JA 3QYTA 3GZGA 3E3KA 4EF2A 3C36A 4U21A 1UTBA 3IJXB 2HCAA 3CRBA 1IEJA 3EHSA 4XIGQ 3VLWA 1DMBA 1B3LA 1NNPA 3PD9A 5ITPA 1DPEA 2NXOA 1PC3A 4K3FA 4EUOA 2DWIA 4IO6A 3LSWA 4Q5TA 1ANFA 4U22A 2ABHA 1FTLA 3OENA 3S9MC 3MWBA 5L9SA 1EZ9A 1N7WA 4KYSA 3EF7A 2PMSA 4THIA 1PEBA 4NF8B 2NVUB 1WDNA 3TCHA 3OMBA 1EZOA 3B6WA 1USYH 2THIA 4DXCA 1MH3A 2I48A 2PYYA 3UN6A 2V3QA 3OD7A 1I6BA 1SI1A 1MXWA 4QRZA 4U1ZA 2GHAA 2FNCA 3IOVA 4RA1A 4GIZA 3TPAA 5CMMA 3TTMA 3LC8A 5FHOA 4X48A 3HHGA 1ZJLA 3PUYE 3G3JA 4H6DA 5I2KB 3TELA 3N94A 4DIGA 3ODBA 3GBBA 2G93A 3EPEA 3O66A 3VFJA 4OENA 1UQWA 1MG1A 4PP0A 5BUUA 4H8JA 3G3IA 1R9LA 1LAFE 4IY5A 2DXRA 4U23A 3HPIA 1ZTYA 3CG1A 3RTWB 5H8QA 4TLMB 1NL5A 5I84A 4MH5A 2OWSA 2PT1A 2YJPA 1ZU0A 5H8FA 1F9BA 3FJ7A 1N0TA 1OIBA 2UVGA 3OSRA 1N04A 4EQ7A 2RC8A 4H67A 4R6HA 3KBRA 1MXUA 4KCCA 3R7XA 2Z8DA 4NF4A 5K2XA 1Y9UA 3PUZE 2HZKA 2XXPA 4ESXA 2A5TB 3SERA 3TDJA 2RC9A 4HCWA 4MLVA 3FGSA 1P1NA 3HN0A 2D21A 5DTBA 1FQBA 1SBPA 2V3TA 3UP9A 1FQFA 4WEDA 1AIVA 2DQVA 4TQUQ 2I49A 5HM4B 1OQGA 3QK6A 4C1TA 3VVDA 5I56B 3IOTA 3ZKLA 2BJJX 5H8HA 1A7LA 3QUFA 4GWOA 3E9XA 1H44A 2IA4A 4F2OA 1RYXA 2Z22A 5CBSA 1JEUA 5TPAB 2PBWA 4ZEKA 1ELJA 4F18A 3T96B 3O97A 3U8QA 3V89B 3FJGA 3MC2A 3G3FA 5KZTA 1N76A 1B3GA 4GXSB 2DXYA 1GGGA 4I8CA 3ONMA 3H6WA 4IO3A 4C1UA 1HSJA 1B5IA 1B7ZA 4EXKA 1PDAA 4MBPA 1P1UA 4WXJA 1B2HA 2XHDA 4F1VA 3U72A 1SYHA 4X1DA 1IXHA 4LZ8A 4PE5B 2V93A 4JDFA 1SQYA 4PFTA 1NKXA 1POY1 2VD2A 1B1HA 4KYDA 3DLNA 1OVTA 2F6PA 3IOUA 3FVOA 2O84X 1JW1A 1EZPA 2X7PA 1IQ7A 2I3VA 4KPTA 2Q2AA 1PB7A 4NTLA 1B5HA 1BLFA 4RXLA 4XKRA 1AL3A 3PUWE 4Q0CA 4X9TA 4R72A 3TQLA 2WKYA 3SEYA 2O69A 4ZE9A 3OEKA 4R2FA 1B3HA 3ZS6A 3RGYA 3CFLA 4TOZA 3B6QA 4P0GA 5ELVA 2F36A 2GFEA 4ONYA 2F8DA 3BFTA 1LFIA 1QKBA 5TP9B 2HXWA 5DEXB 5CMKA 2XX8A 2O7UA 4R9FA 3P7IA 5I58A 1AMFA 3V83A 4F31B 3KOSA 3M8UA 3QIMA 2H25A 4KD5A 3MVYA 4IGTA 3KN3A 2ANJA 1R1NA 5A5XB 2RCAA 1A8EA 4GOTA 1MQGA 5ICTA 3AXFA 1BIYA 4BDMA 5AA1A 4KFQA 3TTRA 3KZGA 4GL0A 1DOTA 2ZMBA 3C9HA 3K01A 3H03A 1POTA 2DP8A 1UIVA 1S50A 1B0HA 4H65A 4BLAA 3FATA 3CVGA 4FEDA 4PETA 1MY2A 4NF5B 5K2YA 1B7UA 5FTHA 3TTKA 1Q1KA 4OWDA 1USYE 4F3GA 2REGA 3MBPA 2FYIA 4U1OA 1O63A 5CBRA 2QMXA 3ZSFA 5I59B 2DWAA 3UORA 2B3FA 1LB9A 1OLCA 2HAUA 4NEDA 4JWYA 1I6AA 3JZJA 2R6GE 4AB5A 4KI0E 4YB7A 4DLDA 3CFZA 4ISUA 3L6HA 4H5GA 4EQBA 2OCUA 2QSXA 5KDTA 4G68B 3HSTA 1LFHA 1R6ZA 2VP1A 1SDXA 2XX7A 3TCGA 1QULA 3FXQA 2XXIA 4G2ZA 2QJEA 2DWHA 4YICA 3S9EA 3B7DA 2ONRA 4H8IA 1MY3A 3W15C 2QRYA 2XXVA 1MXVA 4NWDA 1DPPA 3FZVA 2I3WA 5AA4A 1VFEA 2NWJA 4GF8A 3MP6A 3TZAA 3TKDA 3GBAA 3C33A 3O6GA 1P1OA 5ICQA 3IB1A 1D4NA 3TMGA 4QFPA 1QUJA 2HFBA 2HZLA 3RN8A 1YAEA 4GVOA 5AA4B 3PU5A 3SKPA 4OHNA 4QSEA 3KN7A 4LQ2A 4G68C 1KWHA 3A3CA 3OOAA 4NF6B 4LVQA 1OQHA 4F1YA 4OESA 1A40A 4FE8A 3TUSA 3T9VA 2F5XA 1JEVA 3EHTA 2NOOA 4PQJA 2V25A 5FHMA 1JETA 1EH3A 2DE3A 3V5AA 2XXWA 3O2AA 3PPQA 3ILUB 3D4GA 2ZNTA 3DP8A 1B6HA 3TODA 3G3KA 4JSDA 3PPPA 2PX1A 1UTBB 1Z7ME 3N6UA 3ECRA 4MFIA 1DTZA 3A09A 4GFRA 2UYEA 5DVIA 4IO7A 4FECA 4JWXA 4DZ1A 4OMBA 3RNNA 3IO4A 1SYIA 4LZ5A 4YU0A 3FASA 3IR1A 4X1BA 2GRVA 3CIJA 3MW0A 2F78A 3LSXA 5AA3A 3H7MA 4AQ4A 1OLAA 4JXIA 4ND9A 4AB6A 2HAVA 3GXAA 4ELOA 3CR9A 4KHZE 3Q29A 4BDRA 1SW5A 3S4UA 2V3UA 2Z8FA 3VXCA 3FVKA 3KOTA 2X26A 3RPWA 4FORA 2Y7IA 1MY4A 3K00A 1H45A 4ELQA 3KJ7A 2VOZA 1MQIA 1MQDA 5AE4A 3MVXA 4R6KA 1XC1A 2REJA 4OETA 2R9JA 3VLUA 4N13A 1QUIA 4QSDA 4F3PA 1MXZA 4POWA 4OERA 2F7CA 3O29A 3OO6A 4NWCA 1QJMA 3T66A 1PB8A 3U93A 1YTVA 1FTKA 1NH7A 5H8QB 2Z23A 2UVHA 4OVJA 2HEUA 3LUYA 3Q28A 1B7HA 1Y1MA 5H8FB 1URDA 3I6VA 1MQHA 3VVEA 3KJTA 4G4PA 2PT2A 1HSLA 2F35A 4UACA 4HW8A 4G77A 3K02A 1GVCA 1B58A 2RINA 3FVGA 4HCYA 3TTLA 2I0CA 3VXBA 3W9WA 4OXVA 2Q89A 4NF4B 4ZEDA 4RPOA 3CI8A 3KSJA 4GLIA 4YAHX 1A8FA 3R26A 2ZXTA 3G3GA 5DVFA 1B40A 3USDA 5L9MA 1MXYA 2DE2A 4G8HA 3IOWA 1B51A 1RKMA 1MRPA 1JQFA 3UGWA 1ATGA 1LB8A 3HO7A 4OZ9A 1IXCA 1XT8A 1IXIA 3VE1B 3QXMA 1Y4CA 1US5A 5JEIA 1LCFA 3FJMA 1Q35A 2Y7KA 5H8HB 4F19A 2H98A 2CMOA 1TXFA 4I1DA 2XXQA 4FIMA 2P2AA 1IITA 4DXUA 2YLNA 1UIUA 4RPNA 1QKAA 1MH4A 3ZKKA 3H4ZA 3V8XB 2QMWA 1Y20A 1LBCA 3LR1A 1B5JA 3Q26A 4F3BA 4BDQA 3B6TA 1AOVA 5LOMA 2XXTA 1LLSA 3TCFA 2QPQA 1TFDA 1M5BA 1CE2A 4LA9A 4R6YA 4DDDA 2DE4A 4YKKA 3RT6B 3S9LC 2O51A 1FQDA 4Z0IA 3CSBA 4IY6A 3S2VA 4FATA 1OVBA 1BP5A 3IJOB 3OO7A 4YKIA 3K4UA 3Q25A 1LAGE 2YPNA 3BBRA 2LAOA 4OYVA 1R9QA 4BDNA 4HTGA 5DVJA 4IGRA 4E0WA 5H8NA 2RF1A 3T9HB 5HPQA 1D3KA 2I0BA 5CM6A 4IO4A 1B3FA 2GH9A 5HBCA 3MUQA 2QL3A 1Y3QA 3UIFA 2D3IA 2ALUA 4JB7A 2OWTA 3FIRA 1RYOA 5H8NB 2W7YA 5I58B 2F6GA 2F7AA 3SETA 2I4BA 2ONKE 3K1PA 4NE4A 4Q30B 3FD3A 3BKIB 1XVXA 3EQ1A 2B3BA 1VSOA 5EYFA 1BTJA 3G7WA 1NNFA 5IAIA 4HS7A 3M3LA 1IZ1A 1II5A 1J1NA 1B4ZA 3VV5A 3IAZA 4F39A 3K6XA 4PFUA 1FQCA 3PMXA 4EQ9A 1Y3NA 1P1QA 1JNFA 1URSA 3E13X 1N84A 3W9VA 1NMUA 1MQJA 3H6TA 4H1XA 5M2VA 4Z7EA 1I69A 5KCJA 4EXLA 2O68A 1LAXA 1NH8A 1MS7A 2Y84A 4E0XA 2OJTA 3N6TA 4OQOA 3VVFA 4M4GA 4I9DA 3FXRA 3TAJA 2KLFA 2P1SA 2O7IA 1UTHA 3VDFA 3F11A 1BKAA 3SESA 2ZYMA 4PFYA 3T9XB 5B70A 5JK4A 4F22A 1PBQA 3E4RA 5EHMA 1AH5A 1XHYA 3MP8A 3ILTB 3O28A 3TTNA 2VD3A 3MP1A 2V84A 2X7QA 5KDTB 1MPBA 4F1UA 4H5FA 2DSFA 4YMBA 3K2DA 3MZBA 4XKNA 5I57A 4ZZEA 4L17A 3MZ9A 4G8NA 2ONSA 1MPCA 3K6UA 2R71A 4QFKA 1URGA 1XVYA 1LBBA 2Y7WA 2O1LA 3JYRA 2AL4A 2I6EA 1LCTA 4DCYA 1FTMA 1M5DA 5JTYA 3MVZA 1B32A 1PBPA 4Q8RA 1NNTA 2O1MA 2DS9A 5H8SA 2AYSA 3N5LA 1SW4A 3FV1A 2ZNUA 3O6HA 3KSXA 4ECFA 1FW0A 1IXGA 1JW4A 3GLBA 3KG2A 4RK2A 4NMYA 4WKMA 2QS3A 3LSFB 3H06B 5CMCA 4U4XA 4R74A 2VGQA 2DVCA 4LATA 4YZZA 1SW2A 3I5OA 3RUMA 3DP6A 1B05A 4P0IA 2Q2CA 4FEBA 1NFTA 4QSCA 5AA2D 4QHQA 2H4IA 3FXUA 4NF8A 4KR5A 2ZYNA 3PPOA 3PUVE 5TU0A 4GD5A 3TQWA 3H3GA 2F34A 4LONB 1D9VA 4KYEA 1B46A 1QVSA 3IX1A 3SEXA 3K6VA 4FJPA 1ZLQA 4MLQA 3K6WA 3T22A 3DP4A 3WAEA 4LUBA 5F1QA 3RLFE 1ZIUA 3HCQA 5I2KA 1M5EA 1MY0A 4EDPA 2O6AA 3QUJA 3VLVA 1YPNA 3PD8A 1TWYA 3K0VA 1A99A 1I6QA 3SEUA 5IKBA 1TT1A 4EF1A 1NNKA 1QW0A 1B3EA 1M5FA 1GV8A 4OFLA 1LGBC 3LBSA 4DXBA 5FHNA 4ZE8A 5CMBA 1VR5A 2PVUA 3RT8A 3TEPA 3IO6A 3KN8A 4XKPA 3PMVA 3S9NC 2H5YA 4ELRA 2XD3A 4ZEIA 3FVNA 4ZEFA 2I58A 1DSNA 1A54A 3IORA 2A5TA 2DWJA 3JV9A 1LAHE 5F7VA 2OLBA 4ESWA 2E0SA 2Y7RA 4R2BA 2A5SA 3I3VA 3A3UA 2ESNA 2XXUA 4MF3A 4RYAA 4LQ5A 5CRYA 5B7DA 1MDQA 3SEWA 5ITOA 3K1MA 1JW5A 2F97A 3OSQA 5I56A 1JVYA 4ZS9A 4KQPA 2AL5A 2H99A 3IB0A 4U4SA 3IB2A 2XX9A 4WEPA 3UA8A 4YB5A 5TPAA 4IO2A 1B52A 1H3DA 4O3BA 3U94A 4UA8A 1YCJA 2NUVA 4OTEA 4YKJA 4GQOA 3THIA 4GRKA 4F29A 4FAJA 1M5CA 3OELA 3UK4A 4KCDA 1JVXA 2HQ0A 3EN3A 3IL1B 3L6GA 4TLLB 3CG3A 3HHFA 2Q8JA 3PPNA 3C32A 4RY1A 1VFDA 4QF9A 1PB9A 4RJZA 1OMPA 2F7BA 1N3XA 3DELB 3H6UA 3RQTA 2ZYKA 2Q9TA 2DOJA 1IIWA 4QFNA 4R75A 4POXA 1MPDA 4O3CA 2RC7A 1WVJA 1Y1ZA 2DYXA 2XD2A 4DE8A 4YMAA 2Z8EA 5BWJA 4RK9A 2RCBA 1Z7NE 1ZKBA 1SW1A 4YB6A 4JSOA 2I4CA 3MJNA 3PV0E 3M3KA 2QS4A 1B4HA 1B1XA 4ZDMA 1GR2A 1MY1A 1MM7A 3MPKA 3KEIA 4LP2B 2XXRA 3QSLA 4YKPA 1T0KA 5TP9A 5DEXA 3RY3A 2UXAA 4H0WA 1D9YA 4OEUA 2IEEA 1H43A 2UVIA 1B0LA 3CSGA 3C31A 2DVZA 1VE4A 5DT6A 4XTCQ 4IB2A 5DYHA 2AIXA 5A5XA 3PPRA 3SDFA 3RTFB 3K1NA 5CC2A 1FQEA 3DM0A 3MZ1A 2P0SA 3PUXE 3KGCA 3MVWA 5CI5A 1LFGA 3O9PA 1ZMGA 3IK6B 4C0RA 3MPLA 4N07A 2QS2A 4NF5A 2GHBA 4LZ7A 4G8MA 3OEMA 1SI0A 1O64A 1MXXA 3OXNA 2XXXA 4R73A 2XXHA 5I59A 3PMWA 5ISUA 2B65A 1O7TA 4JBZA 3EHUA 5L9OA 3N26A 2M8CA 2ZNSA 3R6UA 3C35A 1XS5A 2ZYOA 4GXAA 5FTIA 2E1SA 1LSTA 1FTOA 3SEVA 4DCXA 4R9GA 3T9UA 4I62A 1QUKA 4RNSA 1EU8A 3OO9A 4G68A 1ZBMA 3C4MA 2UVJA 1DTGA 3Q27A 4F3SA 2OBGA 1FCKA 4QFOA 5AA2A 3G3HA 1MDP1 5L8DA 2G29A 1WODA 2OK2A 1IUDA 2CZLA 1US4A 1MM6A 3FUZA 1N7XA 4XXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOC A;  5KCJ B;  1H76 A;  4BDL A;  2OZZ A;  2Q88 A;  5EHS A;  2RKM A;  3M3F A;  3T93 B;  1S9T A;  2D5W A;  5AA2 B;  3CFX A;  4O3A A;  3O6I A;  3U92 A;  1UTH B;  4JWO A;  3TYH A;  4OFJ A;  4ZZA A;  5I2N A;  4OFO A;  1CB6 A;  4OEV A;  2Y7P A;  4M1V A;  2H9B A;  1HSE A;  1P1W A;  1S7Y A;  3OO8 A;  4ZEB A;  4QFL A;  1P99 A;  1SD3 A;  4IO5 A;  1Y3P A;  4ZEC A;  3PGF A;  1TFA A;  4BDO A;  3LSL A;  4F2Q A;  2FA7 A;  3BFU A;  3C34 A;  4ELP A;  5I57 B;  5I2N B;  1GTK A;  1N3W A;  1Y4T A;  3HV1 A;  3KFM A;  2UYF A;  3U1O A;  1FQA A;  4GL8 A;  4NF6 A;  3D4C A;  3H6V A;  3MQ9 A;  3MAM A;  1A55 A;  5J1D A;  4U2R A;  4PFW A;  1L5T A;  2VHA A;  5JTY B;  3TFL A;  3QAX A;  2XXY A;  3FV2 A;  4N6P A;  1SVX B;  4XKQ A;  2QS1 A;  3WAF A;  4P11 A;  1FTJ A;  1B9J A;  3QYT A;  3GZG A;  3E3K A;  4EF2 A;  3C36 A;  4U21 A;  1UTB A;  3IJX B;  2HCA A;  3CRB A;  1IEJ A;  3EHS A;  4XIG Q;  3VLW A;  1DMB A;  1B3L A;  1NNP A;  3PD9 A;  5ITP A;  1DPE A;  2NXO A;  1PC3 A;  4K3F A;  4EUO A;  2DWI A;  4IO6 A;  3LSW A;  4Q5T A;  1ANF A;  4U22 A;  2ABH A;  1FTL A;  3OEN A;  3S9M C;  3MWB A;  5L9S A;  1EZ9 A;  1N7W A;  4KYS A;  3EF7 A;  2PMS A;  4THI A;  1PEB A;  4NF8 B;  2NVU B;  1WDN A;  3TCH A;  3OMB A;  1EZO A;  3B6W A;  1USY H;  2THI A;  4DXC A;  1MH3 A;  2I48 A;  2PYY A;  3UN6 A;  2V3Q A;  3OD7 A;  1I6B A;  1SI1 A;  1MXW A;  4QRZ A;  4U1Z A;  2GHA A;  2FNC A;  3IOV A;  4RA1 A;  4GIZ A;  3TPA A;  5CMM A;  3TTM A;  3LC8 A;  5FHO A;  4X48 A;  3HHG A;  1ZJL A;  3PUY E;  3G3J A;  4H6D A;  5I2K B;  3TEL A;  3N94 A;  4DIG A;  3ODB A;  3GBB A;  2G93 A;  3EPE A;  3O66 A;  3VFJ A;  4OEN A;  1UQW A;  1MG1 A;  4PP0 A;  5BUU A;  4H8J A;  3G3I A;  1R9L A;  1LAF E;  4IY5 A;  2DXR A;  4U23 A;  3HPI A;  1ZTY A;  3CG1 A;  3RTW B;  5H8Q A;  4TLM B;  1NL5 A;  5I84 A;  4MH5 A;  2OWS A;  2PT1 A;  2YJP A;  1ZU0 A;  5H8F A;  1F9B A;  3FJ7 A;  1N0T A;  1OIB A;  2UVG A;  3OSR A;  1N04 A;  4EQ7 A;  2RC8 A;  4H67 A;  4R6H A;  3KBR A;  1MXU A;  4KCC A;  3R7X A;  2Z8D A;  4NF4 A;  5K2X A;  1Y9U A;  3PUZ E;  2HZK A;  2XXP A;  4ESX A;  2A5T B;  3SER A;  3TDJ A;  2RC9 A;  4HCW A;  4MLV A;  3FGS A;  1P1N A;  3HN0 A;  2D21 A;  5DTB A;  1FQB A;  1SBP A;  2V3T A;  3UP9 A;  1FQF A;  4WED A;  1AIV A;  2DQV A;  4TQU Q;  2I49 A;  5HM4 B;  1OQG A;  3QK6 A;  4C1T A;  3VVD A;  5I56 B;  3IOT A;  3ZKL A;  2BJJ X;  5H8H A;  1A7L A;  3QUF A;  4GWO A;  3E9X A;  1H44 A;  2IA4 A;  4F2O A;  1RYX A;  2Z22 A;  5CBS A;  1JEU A;  5TPA B;  2PBW A;  4ZEK A;  1ELJ A;  4F18 A;  3T96 B;  3O97 A;  3U8Q A;  3V89 B;  3FJG A;  3MC2 A;  3G3F A;  5KZT A;  1N76 A;  1B3G A;  4GXS B;  2DXY A;  1GGG A;  4I8C A;  3ONM A;  3H6W A;  4IO3 A;  4C1U A;  1HSJ A;  1B5I A;  1B7Z A;  4EXK A;  1PDA A;  4MBP A;  1P1U A;  4WXJ A;  1B2H A;  2XHD A;  4F1V A;  3U72 A;  1SYH A;  4X1D A;  1IXH A;  4LZ8 A;  4PE5 B;  2V93 A;  4JDF A;  1SQY A;  4PFT A;  1NKX A;  1POY 1;  2VD2 A;  1B1H A;  4KYD A;  3DLN A;  1OVT A;  2F6P A;  3IOU A;  3FVO A;  2O84 X;  1JW1 A;  1EZP A;  2X7P A;  1IQ7 A;  2I3V A;  4KPT A;  2Q2A A;  1PB7 A;  4NTL A;  1B5H A;  1BLF A;  4RXL A;  4XKR A;  1AL3 A;  3PUW E;  4Q0C A;  4X9T A;  4R72 A;  3TQL A;  2WKY A;  3SEY A;  2O69 A;  4ZE9 A;  3OEK A;  4R2F A;  1B3H A;  3ZS6 A;  3RGY A;  3CFL A;  4TOZ A;  3B6Q A;  4P0G A;  5ELV A;  2F36 A;  2GFE A;  4ONY A;  2F8D A;  3BFT A;  1LFI A;  1QKB A;  5TP9 B;  2HXW A;  5DEX B;  5CMK A;  2XX8 A;  2O7U A;  4R9F A;  3P7I A;  5I58 A;  1AMF A;  3V83 A;  4F31 B;  3KOS A;  3M8U A;  3QIM A;  2H25 A;  4KD5 A;  3MVY A;  4IGT A;  3KN3 A;  2ANJ A;  1R1N A;  5A5X B;  2RCA A;  1A8E A;  4GOT A;  1MQG A;  5ICT A;  3AXF A;  1BIY A;  4BDM A;  5AA1 A;  4KFQ A;  3TTR A;  3KZG A;  4GL0 A;  1DOT A;  2ZMB A;  3C9H A;  3K01 A;  3H03 A;  1POT A;  2DP8 A;  1UIV A;  1S50 A;  1B0H A;  4H65 A;  4BLA A;  3FAT A;  3CVG A;  4FED A;  4PET A;  1MY2 A;  4NF5 B;  5K2Y A;  1B7U A;  5FTH A;  3TTK A;  1Q1K A;  4OWD A;  1USY E;  4F3G A;  2REG A;  3MBP A;  2FYI A;  4U1O A;  1O63 A;  5CBR A;  2QMX A;  3ZSF A;  5I59 B;  2DWA A;  3UOR A;  2B3F A;  1LB9 A;  1OLC A;  2HAU A;  4NED A;  4JWY A;  1I6A A;  3JZJ A;  2R6G E;  4AB5 A;  4KI0 E;  4YB7 A;  4DLD A;  3CFZ A;  4ISU A;  3L6H A;  4H5G A;  4EQB A;  2OCU A;  2QSX A;  5KDT A;  4G68 B;  3HST A;  1LFH A;  1R6Z A;  2VP1 A;  1SDX A;  2XX7 A;  3TCG A;  1QUL A;  3FXQ A;  2XXI A;  4G2Z A;  2QJE A;  2DWH A;  4YIC A;  3S9E A;  3B7D A;  2ONR A;  4H8I A;  1MY3 A;  3W15 C;  2QRY A;  2XXV A;  1MXV A;  4NWD A;  1DPP A;  3FZV A;  2I3W A;  5AA4 A;  1VFE A;  2NWJ A;  4GF8 A;  3MP6 A;  3TZA A;  3TKD A;  3GBA A;  3C33 A;  3O6G A;  1P1O A;  5ICQ A;  3IB1 A;  1D4N A;  3TMG A;  4QFP A;  1QUJ A;  2HFB A;  2HZL A;  3RN8 A;  1YAE A;  4GVO A;  5AA4 B;  3PU5 A;  3SKP A;  4OHN A;  4QSE A;  3KN7 A;  4LQ2 A;  4G68 C;  1KWH A;  3A3C A;  3OOA A;  4NF6 B;  4LVQ A;  1OQH A;  4F1Y A;  4OES A;  1A40 A;  4FE8 A;  3TUS A;  3T9V A;  2F5X A;  1JEV A;  3EHT A;  2NOO A;  4PQJ A;  2V25 A;  5FHM A;  1JET A;  1EH3 A;  2DE3 A;  3V5A A;  2XXW A;  3O2A A;  3PPQ A;  3ILU B;  3D4G A;  2ZNT A;  3DP8 A;  1B6H A;  3TOD A;  3G3K A;  4JSD A;  3PPP A;  2PX1 A;  1UTB B;  1Z7M E;  3N6U A;  3ECR A;  4MFI A;  1DTZ A;  3A09 A;  4GFR A;  2UYE A;  5DVI A;  4IO7 A;  4FEC A;  4JWX A;  4DZ1 A;  4OMB A;  3RNN A;  3IO4 A;  1SYI A;  4LZ5 A;  4YU0 A;  3FAS A;  3IR1 A;  4X1B A;  2GRV A;  3CIJ A;  3MW0 A;  2F78 A;  3LSX A;  5AA3 A;  3H7M A;  4AQ4 A;  1OLA A;  4JXI A;  4ND9 A;  4AB6 A;  2HAV A;  3GXA A;  4ELO A;  3CR9 A;  4KHZ E;  3Q29 A;  4BDR A;  1SW5 A;  3S4U A;  2V3U A;  2Z8F A;  3VXC A;  3FVK A;  3KOT A;  2X26 A;  3RPW A;  4FOR A;  2Y7I A;  1MY4 A;  3K00 A;  1H45 A;  4ELQ A;  3KJ7 A;  2VOZ A;  1MQI A;  1MQD A;  5AE4 A;  3MVX A;  4R6K A;  1XC1 A;  2REJ A;  4OET A;  2R9J A;  3VLU A;  4N13 A;  1QUI A;  4QSD A;  4F3P A;  1MXZ A;  4POW A;  4OER A;  2F7C A;  3O29 A;  3OO6 A;  4NWC A;  1QJM A;  3T66 A;  1PB8 A;  3U93 A;  1YTV A;  1FTK A;  1NH7 A;  5H8Q B;  2Z23 A;  2UVH A;  4OVJ A;  2HEU A;  3LUY A;  3Q28 A;  1B7H A;  1Y1M A;  5H8F B;  1URD A;  3I6V A;  1MQH A;  3VVE A;  3KJT A;  4G4P A;  2PT2 A;  1HSL A;  2F35 A;  4UAC A;  4HW8 A;  4G77 A;  3K02 A;  1GVC A;  1B58 A;  2RIN A;  3FVG A;  4HCY A;  3TTL A;  2I0C A;  3VXB A;  3W9W A;  4OXV A;  2Q89 A;  4NF4 B;  4ZED A;  4RPO A;  3CI8 A;  3KSJ A;  4GLI A;  4YAH X;  1A8F A;  3R26 A;  2ZXT A;  3G3G A;  5DVF A;  1B40 A;  3USD A;  5L9M A;  1MXY A;  2DE2 A;  4G8H A;  3IOW A;  1B51 A;  1RKM A;  1MRP A;  1JQF A;  3UGW A;  1ATG A;  1LB8 A;  3HO7 A;  4OZ9 A;  1IXC A;  1XT8 A;  1IXI A;  3VE1 B;  3QXM A;  1Y4C A;  1US5 A;  5JEI A;  1LCF A;  3FJM A;  1Q35 A;  2Y7K A;  5H8H B;  4F19 A;  2H98 A;  2CMO A;  1TXF A;  4I1D A;  2XXQ A;  4FIM A;  2P2A A;  1IIT A;  4DXU A;  2YLN A;  1UIU A;  4RPN A;  1QKA A;  1MH4 A;  3ZKK A;  3H4Z A;  3V8X B;  2QMW A;  1Y20 A;  1LBC A;  3LR1 A;  1B5J A;  3Q26 A;  4F3B A;  4BDQ A;  3B6T A;  1AOV A;  5LOM A;  2XXT A;  1LLS A;  3TCF A;  2QPQ A;  1TFD A;  1M5B A;  1CE2 A;  4LA9 A;  4R6Y A;  4DDD A;  2DE4 A;  4YKK A;  3RT6 B;  3S9L C;  2O51 A;  1FQD A;  4Z0I A;  3CSB A;  4IY6 A;  3S2V A;  4FAT A;  1OVB A;  1BP5 A;  3IJO B;  3OO7 A;  4YKI A;  3K4U A;  3Q25 A;  1LAG E;  2YPN A;  3BBR A;  2LAO A;  4OYV A;  1R9Q A;  4BDN A;  4HTG A;  5DVJ A;  4IGR A;  4E0W A;  5H8N A;  2RF1 A;  3T9H B;  5HPQ A;  1D3K A;  2I0B A;  5CM6 A;  4IO4 A;  1B3F A;  2GH9 A;  5HBC A;  3MUQ A;  2QL3 A;  1Y3Q A;  3UIF A;  2D3I A;  2ALU A;  4JB7 A;  2OWT A;  3FIR A;  1RYO A;  5H8N B;  2W7Y A;  5I58 B;  2F6G A;  2F7A A;  3SET A;  2I4B A;  2ONK E;  3K1P A;  4NE4 A;  4Q30 B;  3FD3 A;  3BKI B;  1XVX A;  3EQ1 A;  2B3B A;  1VSO A;  5EYF A;  1BTJ A;  3G7W A;  1NNF A;  5IAI A;  4HS7 A;  3M3L A;  1IZ1 A;  1II5 A;  1J1N A;  1B4Z A;  3VV5 A;  3IAZ A;  4F39 A;  3K6X A;  4PFU A;  1FQC A;  3PMX A;  4EQ9 A;  1Y3N A;  1P1Q A;  1JNF A;  1URS A;  3E13 X;  1N84 A;  3W9V A;  1NMU A;  1MQJ A;  3H6T A;  4H1X A;  5M2V A;  4Z7E A;  1I69 A;  5KCJ A;  4EXL A;  2O68 A;  1LAX A;  1NH8 A;  1MS7 A;  2Y84 A;  4E0X A;  2OJT A;  3N6T A;  4OQO A;  3VVF A;  4M4G A;  4I9D A;  3FXR A;  3TAJ A;  2KLF A;  2P1S A;  2O7I A;  1UTH A;  3VDF A;  3F11 A;  1BKA A;  3SES A;  2ZYM A;  4PFY A;  3T9X B;  5B70 A;  5JK4 A;  4F22 A;  1PBQ A;  3E4R A;  5EHM A;  1AH5 A;  1XHY A;  3MP8 A;  3ILT B;  3O28 A;  3TTN A;  2VD3 A;  3MP1 A;  2V84 A;  2X7Q A;  5KDT B;  1MPB A;  4F1U A;  4H5F A;  2DSF A;  4YMB A;  3K2D A;  3MZB A;  4XKN A;  5I57 A;  4ZZE A;  4L17 A;  3MZ9 A;  4G8N A;  2ONS A;  1MPC A;  3K6U A;  2R71 A;  4QFK A;  1URG A;  1XVY A;  1LBB A;  2Y7W A;  2O1L A;  3JYR A;  2AL4 A;  2I6E A;  1LCT A;  4DCY A;  1FTM A;  1M5D A;  5JTY A;  3MVZ A;  1B32 A;  1PBP A;  4Q8R A;  1NNT A;  2O1M A;  2DS9 A;  5H8S A;  2AYS A;  3N5L A;  1SW4 A;  3FV1 A;  2ZNU A;  3O6H A;  3KSX A;  4ECF A;  1FW0 A;  1IXG A;  1JW4 A;  3GLB A;  3KG2 A;  4RK2 A;  4NMY A;  4WKM A;  2QS3 A;  3LSF B;  3H06 B;  5CMC A;  4U4X A;  4R74 A;  2VGQ A;  2DVC A;  4LAT A;  4YZZ A;  1SW2 A;  3I5O A;  3RUM A;  3DP6 A;  1B05 A;  4P0I A;  2Q2C A;  4FEB A;  1NFT A;  4QSC A;  5AA2 D;  4QHQ A;  2H4I A;  3FXU A;  4NF8 A;  4KR5 A;  2ZYN A;  3PPO A;  3PUV E;  5TU0 A;  4GD5 A;  3TQW A;  3H3G A;  2F34 A;  4LON B;  1D9V A;  4KYE A;  1B46 A;  1QVS A;  3IX1 A;  3SEX A;  3K6V A;  4FJP A;  1ZLQ A;  4MLQ A;  3K6W A;  3T22 A;  3DP4 A;  3WAE A;  4LUB A;  5F1Q A;  3RLF E;  1ZIU A;  3HCQ A;  5I2K A;  1M5E A;  1MY0 A;  4EDP A;  2O6A A;  3QUJ A;  3VLV A;  1YPN A;  3PD8 A;  1TWY A;  3K0V A;  1A99 A;  1I6Q A;  3SEU A;  5IKB A;  1TT1 A;  4EF1 A;  1NNK A;  1QW0 A;  1B3E A;  1M5F A;  1GV8 A;  4OFL A;  1LGB C;  3LBS A;  4DXB A;  5FHN A;  4ZE8 A;  5CMB A;  1VR5 A;  2PVU A;  3RT8 A;  3TEP A;  3IO6 A;  3KN8 A;  4XKP A;  3PMV A;  3S9N C;  2H5Y A;  4ELR A;  2XD3 A;  4ZEI A;  3FVN A;  4ZEF A;  2I58 A;  1DSN A;  1A54 A;  3IOR A;  2A5T A;  2DWJ A;  3JV9 A;  1LAH E;  5F7V A;  2OLB A;  4ESW A;  2E0S A;  2Y7R A;  4R2B A;  2A5S A;  3I3V A;  3A3U A;  2ESN A;  2XXU A;  4MF3 A;  4RYA A;  4LQ5 A;  5CRY A;  5B7D A;  1MDQ A;  3SEW A;  5ITO A;  3K1M A;  1JW5 A;  2F97 A;  3OSQ A;  5I56 A;  1JVY A;  4ZS9 A;  4KQP A;  2AL5 A;  2H99 A;  3IB0 A;  4U4S A;  3IB2 A;  2XX9 A;  4WEP A;  3UA8 A;  4YB5 A;  5TPA A;  4IO2 A;  1B52 A;  1H3D A;  4O3B A;  3U94 A;  4UA8 A;  1YCJ A;  2NUV A;  4OTE A;  4YKJ A;  4GQO A;  3THI A;  4GRK A;  4F29 A;  4FAJ A;  1M5C A;  3OEL A;  3UK4 A;  4KCD A;  1JVX A;  2HQ0 A;  3EN3 A;  3IL1 B;  3L6G A;  4TLL B;  3CG3 A;  3HHF A;  2Q8J A;  3PPN A;  3C32 A;  4RY1 A;  1VFD A;  4QF9 A;  1PB9 A;  4RJZ A;  1OMP A;  2F7B A;  1N3X A;  3DEL B;  3H6U A;  3RQT A;  2ZYK A;  2Q9T A;  2DOJ A;  1IIW A;  4QFN A;  4R75 A;  4POX A;  1MPD A;  4O3C A;  2RC7 A;  1WVJ A;  1Y1Z A;  2DYX A;  2XD2 A;  4DE8 A;  4YMA A;  2Z8E A;  5BWJ A;  4RK9 A;  2RCB A;  1Z7N E;  1ZKB A;  1SW1 A;  4YB6 A;  4JSO A;  2I4C A;  3MJN A;  3PV0 E;  3M3K A;  2QS4 A;  1B4H A;  1B1X A;  4ZDM A;  1GR2 A;  1MY1 A;  1MM7 A;  3MPK A;  3KEI A;  4LP2 B;  2XXR A;  3QSL A;  4YKP A;  1T0K A;  5TP9 A;  5DEX A;  3RY3 A;  2UXA A;  4H0W A;  1D9Y A;  4OEU A;  2IEE A;  1H43 A;  2UVI A;  1B0L A;  3CSG A;  3C31 A;  2DVZ A;  1VE4 A;  5DT6 A;  4XTC Q;  4IB2 A;  5DYH A;  2AIX A;  5A5X A;  3PPR A;  3SDF A;  3RTF B;  3K1N A;  5CC2 A;  1FQE A;  3DM0 A;  3MZ1 A;  2P0S A;  3PUX E;  3KGC A;  3MVW A;  5CI5 A;  1LFG A;  3O9P A;  1ZMG A;  3IK6 B;  4C0R A;  3MPL A;  4N07 A;  2QS2 A;  4NF5 A;  2GHB A;  4LZ7 A;  4G8M A;  3OEM A;  1SI0 A;  1O64 A;  1MXX A;  3OXN A;  2XXX A;  4R73 A;  2XXH A;  5I59 A;  3PMW A;  5ISU A;  2B65 A;  1O7T A;  4JBZ A;  3EHU A;  5L9O A;  3N26 A;  2M8C A;  2ZNS A;  3R6U A;  3C35 A;  1XS5 A;  2ZYO A;  4GXA A;  5FTI A;  2E1S A;  1LST A;  1FTO A;  3SEV A;  4DCX A;  4R9G A;  3T9U A;  4I62 A;  1QUK A;  4RNS A;  1EU8 A;  3OO9 A;  4G68 A;  1ZBM A;  3C4M A;  2UVJ A;  1DTG A;  3Q27 A;  4F3S A;  2OBG A;  1FCK A;  4QFO A;  5AA2 A;  3G3H A;  1MDP 1;  5L8D A;  2G29 A;  1WOD A;  2OK2 A;  1IUD A;  2CZL A;  1US4 A;  1MM6 A;  3FUZ A;  1N7X A;  4XXU A; 
#chains in the Genus database with same CATH topology
 4NX1 A;  1XOC A;  5KCJ B;  1H76 A;  4BDL A;  2OZZ A;  2Q88 A;  5EHS A;  2RKM A;  3M3F A;  3T93 B;  1S9T A;  2D5W A;  5AA2 B;  3CFX A;  4GX4 A;  4O3A A;  3O6I A;  3U92 A;  1UTH B;  5IZ1 A;  4JWO A;  3TYH A;  2PFY A;  4OFJ A;  4ZZA A;  5I2N A;  4OFO A;  1CB6 A;  4OEV A;  2Y7P A;  4M1V A;  3BIH A;  2H9B A;  1HSE A;  1P1W A;  1S7Y A;  3OO8 A;  4ZEB A;  1BK4 A;  4QFL A;  1P99 A;  1SD3 A;  4IO5 A;  1Y3P A;  2QVV A;  4ZEC A;  3PGF A;  5F24 A;  1TFA A;  4BDO A;  3LSL A;  4F2Q A;  2FA7 A;  3BFU A;  3C34 A;  3LV0 A;  4ELP A;  5I57 B;  5I2N B;  1EYJ A;  1GTK A;  1N3W A;  1Y4T A;  3HV1 A;  3ROJ A;  3KFM A;  2UYF A;  3U1O A;  1FQA A;  4GL8 A;  4NF6 A;  3D4C A;  3H6V A;  3MQ9 A;  1LBW A;  3MAM A;  1A55 A;  5J1D A;  4U2R A;  4PFW A;  1L5T A;  2VHA A;  5JTY B;  1NV6 A;  3TFL A;  2VPN A;  3QAX A;  1FPI A;  2XXY A;  4PF8 A;  3FV2 A;  2CZI A;  4N6P A;  1G0I A;  2FHY A;  1SVX B;  4XKQ A;  2QS1 A;  3WAF A;  4PGN A;  4P11 A;  1FTJ A;  1B9J A;  3QYT A;  3GZG A;  3E3K A;  4EF2 A;  3C36 A;  4U21 A;  1UTB A;  4OVP A;  3U65 A;  3IJX B;  2HCA A;  3CRB A;  1IEJ A;  4OVS A;  3EHS A;  4XIG Q;  3VLW A;  1DMB A;  1B3L A;  1FPJ A;  1NNP A;  3PD9 A;  5ITP A;  5DW8 A;  1DPE A;  2NXO A;  1PC3 A;  4K3F A;  4EUO A;  2DWI A;  4IO6 A;  3LSW A;  4Q5T A;  1DK4 A;  4PCD A;  1ANF A;  4U22 A;  2ABH A;  1FTL A;  3OEN A;  3S9M C;  4OVT A;  5LTC A;  3MWB A;  5L9S A;  1EZ9 A;  1N7W A;  3FXB A;  2V4C A;  4KYS A;  3EF7 A;  2PMS A;  4THI A;  1PEB A;  4NF8 B;  2NVU B;  1WDN A;  3TCH A;  3OMB A;  1EZO A;  3B6W A;  4PAF A;  1USY H;  2THI A;  4DXC A;  1MH3 A;  2I48 A;  4PC9 A;  2PYY A;  3UN6 A;  2V3Q A;  3OD7 A;  1I6B A;  1SI1 A;  1MXW A;  4QRZ A;  4U1Z A;  2GHA A;  2FNC A;  3IOV A;  4RA1 A;  4GIZ A;  3TPA A;  5CMM A;  3TTM A;  3LC8 A;  5FHO A;  1FBD A;  4X48 A;  3HHG A;  1NUX A;  1XI6 A;  1ZJL A;  4MAG A;  3PUY E;  3G3J A;  4H6D A;  5I2K B;  3TEL A;  3N94 A;  4MHF A;  4DIG A;  4UAB A;  3ODB A;  3GBB A;  2BJI A;  2G93 A;  3EPE A;  3O66 A;  3VFJ A;  4OEN A;  1UQW A;  3B8B A;  1MG1 A;  4PP0 A;  5BUU A;  4MX6 A;  4H8J A;  3G3I A;  1R9L A;  4P3L A;  1LAF E;  4IY5 A;  2DXR A;  4U23 A;  3HPI A;  1ZTY A;  2XXK A;  3CG1 A;  3RTW B;  5H8Q A;  1K9Y A;  4TLM B;  1NL5 A;  5I84 A;  4MH5 A;  2OWS A;  2PT1 A;  2YJP A;  1ZU0 A;  1IMB A;  5H8F A;  1F9B A;  3FJ7 A;  1N0T A;  2VT5 A;  1OIB A;  2UVG A;  4O94 A;  3OSR A;  3IFC A;  1N04 A;  4EQ7 A;  2FIX A;  4GBW A;  2RC8 A;  4H67 A;  4R6H A;  3KBR A;  1MXU A;  4KCC A;  3R7X A;  2Z8D A;  4NF4 A;  4XF5 A;  2FBP A;  5EYH A;  5K2X A;  1Y9U A;  3PUZ E;  2HZK A;  2XXP A;  4ESX A;  2A5T B;  3SER A;  3TDJ A;  2RC9 A;  4HCW A;  5EYG A;  4MLV A;  3FGS A;  5ET5 A;  1P1N A;  3HN0 A;  2D21 A;  5DTB A;  1FQB A;  1SBP A;  2V3T A;  3UP9 A;  1FQF A;  4WED A;  1AIV A;  5ET8 A;  2DQV A;  4TQU Q;  2I49 A;  5HM4 B;  1OQG A;  1NV1 A;  1EYI A;  3QK6 A;  4C1T A;  3VVD A;  2WBB A;  5I56 B;  3IOT A;  3ZKL A;  2BJJ X;  5H8H A;  1A7L A;  3QUF A;  4GWO A;  3E9X A;  4NN3 A;  1H44 A;  2IA4 A;  4F2O A;  1RYX A;  2Z22 A;  5CBS A;  1JEU A;  5TPA B;  2PBW A;  4ZEK A;  1ELJ A;  4F18 A;  3T96 B;  3O97 A;  3U8Q A;  3V89 B;  3FJG A;  3MC2 A;  3G3F A;  5KZT A;  1N76 A;  1B3G A;  4GXS B;  2DXY A;  1GGG A;  4I8C A;  3ONM A;  5IM2 A;  3H6W A;  3RPL B;  4I3E A;  4IO3 A;  4C1U A;  1HSJ A;  1B5I A;  1B7Z A;  4MMP A;  4EXK A;  1PDA A;  4MBP A;  2P3V A;  1FBP A;  1P1U A;  4WXJ A;  1B2H A;  4N81 A;  2XHD A;  4F1V A;  3U72 A;  1SYH A;  4X1D A;  2CEX A;  1IXH A;  4LZ8 A;  4PE5 B;  2V93 A;  4JDF A;  1SQY A;  4PFT A;  1NKX A;  1POY 1;  2VD2 A;  1B1H A;  4KYD A;  3DLN A;  1OVT A;  2F6P A;  3IOU A;  3FVO A;  2O84 X;  1JW1 A;  1EZP A;  2X7P A;  1IQ7 A;  2I3V A;  4KPT A;  2Q2A A;  1PB7 A;  4NTL A;  1B5H A;  1FBF A;  1BLF A;  4RXL A;  4XKR A;  1AL3 A;  3PUW E;  4Q0C A;  4X9T A;  4R72 A;  2WKY A;  3TQL A;  3SEY A;  1FSA A;  2O69 A;  4ZE9 A;  3OEK A;  2XWI A;  4R2F A;  4MCO A;  1B3H A;  3ZS6 A;  4AS4 A;  3CFL A;  3RGY A;  1QGX A;  4TOZ A;  3B6Q A;  4P0G A;  5ELV A;  2F36 A;  2GFE A;  4ONY A;  2F8D A;  4MNI A;  4JVI A;  3BFT A;  1LFI A;  1QKB A;  5TP9 B;  2HXW A;  5DEX B;  5CMK A;  3BIG A;  2XX8 A;  2O7U A;  4NAP A;  4R9F A;  3T1B A;  4PDH A;  1FTA A;  3P7I A;  5I58 A;  1AMF A;  5ESY A;  3V83 A;  4F31 B;  3KOS A;  3M8U A;  3QIM A;  2H25 A;  4GBV A;  4KD5 A;  2QFL A;  4P8B A;  3MVY A;  4IGT A;  3KN3 A;  2ANJ A;  1R1N A;  5A5X B;  3MYU A;  2RCA A;  1A8E A;  4GOT A;  1MQG A;  5ICT A;  3AXF A;  4N8Y A;  4N6D A;  1BIY A;  4BDM A;  5AA1 A;  4KFQ A;  3TTR A;  3KZG A;  4GL0 A;  1DOT A;  2ZMB A;  3C9H A;  4GWX A;  4MJO A;  3K01 A;  3H03 A;  1POT A;  2DP8 A;  4OA4 A;  1UIV A;  1S50 A;  1FPD A;  1B0H A;  4H65 A;  4BLA A;  3FAT A;  3CVG A;  4FED A;  1INP A;  4PET A;  1MY2 A;  1YXI A;  4NF5 B;  5K2Y A;  1B7U A;  5FTH A;  3TTK A;  1Q1K A;  4OWD A;  1USY E;  4F3G A;  2REG A;  3MBP A;  2R8T A;  2FYI A;  4P47 A;  4U1O A;  1O63 A;  5CBR A;  2QMX A;  4P56 A;  3ZSF A;  5I59 B;  2DWA A;  3UOR A;  2B3F A;  1LB9 A;  1OLC A;  3A29 A;  2HAU A;  4NED A;  4JWY A;  1I6A A;  3JZJ A;  2R6G E;  4AB5 A;  4KI0 E;  4YB7 A;  4GWU A;  4DLD A;  3CFZ A;  4ISU A;  4N6K A;  3L6H A;  2B4L A;  4H5G A;  4EQB A;  2OCU A;  2QSX A;  5KDT A;  2HXR A;  4G68 B;  4OVQ A;  3HST A;  1LFH A;  1R6Z A;  4GWY A;  2VP1 A;  1NV0 A;  1SDX A;  2XX7 A;  1NV4 A;  5I7I A;  3TCG A;  1QUL A;  3FXQ A;  5EQA A;  2XXI A;  4G2Z A;  2QJE A;  2DWH A;  4YIC A;  3S9E A;  3B7D A;  2ONR A;  4H8I A;  1MY3 A;  3W15 C;  2QRY A;  2XXV A;  1FBE A;  1MXV A;  4NWD A;  1DPP A;  3FZV A;  2I3W A;  1FPB A;  5AA4 A;  1VFE A;  2NWJ A;  4GF8 A;  2VPO A;  3MP6 A;  3TKD A;  3TZA A;  3GBA A;  3C33 A;  3O6G A;  1P1O A;  5ICQ A;  3IB1 A;  2MKZ A;  1LBX A;  1D4N A;  3TMG A;  4QFP A;  1QUJ A;  2HFB A;  4X04 A;  2HZL A;  3RN8 A;  1YAE A;  4GVO A;  2WEF A;  5AA4 B;  3PU5 A;  3SKP A;  4OHN A;  4QSE A;  3KN7 A;  3B50 A;  4LQ2 A;  4G68 C;  1KWH A;  4PTK A;  3A3C A;  3OOA A;  4NF6 B;  1K9Z A;  4LVQ A;  1OQH A;  4F1Y A;  4OES A;  1A40 A;  2CEY A;  4FE8 A;  3TUS A;  3T9V A;  2F5X A;  1JEV A;  3EHT A;  2NOO A;  4PQJ A;  2V25 A;  5FHM A;  1JET A;  1EH3 A;  2DE3 A;  3V5A A;  4O7M A;  2XXW A;  3O2A A;  3PPQ A;  3LUZ A;  5A5L A;  3ILU B;  3D4G A;  2ZNT A;  3DP8 A;  1B6H A;  3TOD A;  3G3K A;  4JSD A;  5I3S A;  3PPP A;  2PX1 A;  1UTB B;  1Z7M E;  3N6U A;  3ECR A;  4MFI A;  1DTZ A;  4JVD A;  3A09 A;  4GFR A;  2UYE A;  5DVI A;  1FBH A;  4IO7 A;  4FEC A;  1JP4 A;  4JWX A;  4DZ1 A;  4OMB A;  3RNN A;  3IO4 A;  1SYI A;  1FRP A;  4LZ5 A;  4YU0 A;  3FAS A;  3IR1 A;  4X1B A;  1G0H A;  2GRV A;  3CIJ A;  3MW0 A;  2F78 A;  3IFA A;  3LSX A;  3KC1 A;  5AA3 A;  3H7M A;  4AQ4 A;  1OLA A;  4JXI A;  4ND9 A;  4AB6 A;  2HAV A;  3GXA A;  4ELO A;  3CR9 A;  4KHZ E;  3Q29 A;  3CHG A;  4BDR A;  1SW5 A;  3S4U A;  2V3U A;  2Z8F A;  3VXC A;  3FVK A;  3KOT A;  2X26 A;  3RPW A;  4FOR A;  2Y7I A;  1MY4 A;  3K00 A;  1H45 A;  4ELQ A;  3KJ7 A;  2VOZ A;  1MQI A;  1MQD A;  5AE4 A;  3MVX A;  4R6K A;  1XC1 A;  2REJ A;  4OET A;  2R9J A;  3VLU A;  4N13 A;  2XWO A;  3D1R A;  1QUI A;  4QSD A;  4F3P A;  1MXZ A;  4G61 A;  4POW A;  4OER A;  2F7C A;  3O29 A;  3OO6 A;  4NWC A;  5EQ8 A;  1QJM A;  3T66 A;  1LEV A;  2XWK A;  1PB8 A;  2FVZ A;  3U93 A;  5I5P A;  1YTV A;  1FTK A;  1NH7 A;  5H8Q B;  2Z23 A;  2F3B A;  2UVH A;  4OVR A;  4OVJ A;  2HEU A;  3LUY A;  3Q28 A;  1B7H A;  1Y1M A;  2KR0 A;  5H8F B;  1URD A;  3I6V A;  1MQH A;  3VVE A;  3KJT A;  4G4P A;  2PT2 A;  1HSL A;  2F35 A;  3EKI A;  4UAC A;  4HW8 A;  4G77 A;  3K02 A;  1GVC A;  1B58 A;  2RIN A;  3FVG A;  4HCY A;  3TTL A;  2I0C A;  4NGU A;  4I40 A;  3VXB A;  3W9W A;  4DI4 B;  2Q8M A;  4OXV A;  2Q89 A;  4NF4 B;  4ZED A;  4RPO A;  1AWB A;  3CI8 A;  4PFR A;  3KSJ A;  4GLI A;  4YAH X;  1VDW A;  1A8F A;  3R26 A;  2ZXT A;  5FBP A;  3G3G A;  5DVF A;  1B40 A;  3USD A;  4HE1 A;  5L9M A;  1MXY A;  2DE2 A;  4G8H A;  3IOW A;  1B51 A;  3PTY A;  1RKM A;  1MRP A;  1JQF A;  3UGW A;  1ATG A;  1LB8 A;  1NUZ A;  3HO7 A;  4OZ9 A;  1IXC A;  1XT8 A;  1IXI A;  3VE1 B;  3QXM A;  1Y4C A;  1US5 A;  4GWW A;  4P9K A;  5JEI A;  1LCF A;  3FJM A;  1IMA A;  1Q35 A;  5IZ3 A;  2Y7K A;  2WBD A;  5H8H B;  4F19 A;  2H98 A;  2CMO A;  4DI3 D;  1TXF A;  4I1D A;  2XXQ A;  4FIM A;  1EYK A;  2P2A A;  1IIT A;  4DXU A;  2YLN A;  2ZZV A;  4N91 A;  1UIU A;  4RPN A;  1QKA A;  1MH4 A;  3ZKK A;  3H4Z A;  3V8X B;  2QMW A;  1Y20 A;  1LBC A;  3LR1 A;  1B5J A;  3Q26 A;  4F3B A;  4MNC A;  4BDQ A;  5IZ3 B;  3B6T A;  1AOV A;  1NV7 A;  5LOM A;  2XXT A;  1LLS A;  3TCF A;  5T3J A;  2QPQ A;  2XWV A;  1TFD A;  4GWZ A;  1M5B A;  1CE2 A;  4LA9 A;  4R6Y A;  4DDD A;  2DE4 A;  4YKK A;  3RT6 B;  3S9L C;  2O51 A;  1FQD A;  4Z0I A;  3CSB A;  4IY6 A;  3S2V A;  4OAN A;  4FAT A;  1OVB A;  1BP5 A;  4XEQ A;  4GX3 A;  3IJO B;  1KZ8 A;  1Q9D A;  3OO7 A;  4YKI A;  3K4U A;  3KBZ A;  3Q25 A;  1LAG E;  2YPN A;  3BBR A;  2LAO A;  4OYV A;  2WYK A;  1R9Q A;  4BDN A;  2ZZW A;  4HTG A;  5DVJ A;  4IGR A;  1SPI A;  4E0W A;  5H8N A;  2RF1 A;  3T9H B;  5HPQ A;  4NF0 A;  1D3K A;  2I0B A;  5CM6 A;  4IO4 A;  1B3F A;  2GH9 A;  5HBC A;  3MUQ A;  4KXP A;  2QL3 A;  1Y3Q A;  3UIF A;  2ZZX A;  2D3I A;  2ALU A;  4JB7 A;  2OWT A;  3FIR A;  1RYO A;  5H8N B;  5ET7 A;  1NUW A;  2W7Y A;  5I58 B;  2F6G A;  3GYY A;  2F7A A;  1IMF A;  3SET A;  2I4B A;  2ONK E;  3K1P A;  4NE4 A;  4HE0 A;  5J16 A;  4Q30 B;  3FD3 A;  2OWZ A;  3BKI B;  1XVX A;  3EQ1 A;  2B3B A;  1VSO A;  5EYF A;  1BTJ A;  3G7W A;  1NNF A;  2HPG A;  1RDY A;  5IAI A;  4HS7 A;  3M3L A;  1IZ1 A;  1II5 A;  1J1N A;  1B4Z A;  3VV5 A;  3IAZ A;  4F39 A;  2JJK A;  3K6X A;  4PFU A;  1FQC A;  3PMX A;  4EQ9 A;  1Y3N A;  1KA1 A;  1P1Q A;  1JNF A;  1URS A;  3E13 X;  1N84 A;  3W9V A;  1NMU A;  1MQJ A;  3H6T A;  2HHM A;  4H1X A;  5M2V A;  3T0J A;  4Z7E A;  4HXV A;  1I69 A;  5KCJ A;  2XA5 A;  4EXL A;  2O68 A;  1LAX A;  1NH8 A;  1MS7 A;  2Y84 A;  4E0X A;  2OJT A;  3N6T A;  4OQO A;  3VVF A;  4M4G A;  4I9D A;  3FXR A;  4MNP A;  3TAJ A;  2KLF A;  2P1S A;  2Y5K A;  4H46 A;  2O7I A;  1UTH A;  3VDF A;  3F11 A;  1BKA A;  3SES A;  2ZYM A;  4PFY A;  3T9X B;  5B70 A;  1NUY A;  5JK4 A;  4F22 A;  1PBQ A;  3E4R A;  5EHM A;  1AH5 A;  1XHY A;  3MP8 A;  3ILT B;  3O28 A;  3TTN A;  2VD3 A;  3KC0 A;  2WYP A;  3MP1 A;  2V84 A;  2X7Q A;  5KDT B;  4N15 A;  1YYZ A;  1MPB A;  4HE2 A;  4X8R A;  4F1U A;  4XFE A;  4H5F A;  2DSF A;  4YMB A;  3K2D A;  3MZB A;  4XKN A;  5I57 A;  3E78 A;  4H45 A;  4ZZE A;  4L17 A;  3MZ9 A;  4G8N A;  2B4M A;  2ONS A;  1CNQ A;  1MPC A;  3K6U A;  2R71 A;  4QFK A;  1URG A;  1XVY A;  1LBB A;  2Y7W A;  4MEV A;  2O1L A;  3JYR A;  2AL4 A;  2I6E A;  4I3Y A;  1LCT A;  4DCY A;  1FTM A;  2PFZ A;  1M5D A;  1DCU A;  5JTY A;  3MVZ A;  1B32 A;  4O7I A;  1FPK A;  2CZH A;  1PBP A;  4N17 A;  1FJ6 A;  2OX3 A;  4Q8R A;  1NNT A;  2O1M A;  2DS9 A;  5H8S A;  2AYS A;  3N5L A;  1SW4 A;  2WX9 A;  3FV1 A;  2ZNU A;  3O6H A;  3KSX A;  1FBC A;  4ECF A;  4O8M A;  1FW0 A;  4PE3 A;  1IXG A;  1JW4 A;  3GLB A;  3KG2 A;  4RK2 A;  3E79 A;  4NMY A;  4WKM A;  2QS3 A;  3LSF B;  1FPF A;  3H06 B;  1FPG A;  5CMC A;  4U4X A;  4R74 A;  2VGQ A;  2DVC A;  4LAT A;  4YZZ A;  1SW2 A;  3I5O A;  3RUM A;  3DP6 A;  1B05 A;  4P0I A;  2Q2C A;  4FEB A;  1NFT A;  4QSC A;  5AA2 D;  4QHQ A;  2H4I A;  3FXU A;  4NF8 A;  4KR5 A;  2ZYN A;  3PPO A;  3PUV E;  5TU0 A;  4GD5 A;  3TQW A;  3H3G A;  2F34 A;  4LON B;  1D9V A;  4KYE A;  1B46 A;  1QVS A;  3IX1 A;  3SEX A;  3K6V A;  4FJP A;  1ZLQ A;  4MLQ A;  3K6W A;  3T22 A;  3DP4 A;  3WAE A;  2PCR A;  4LUB A;  5F1Q A;  3RLF E;  1ZIU A;  5IGA A;  3HCQ A;  5I2K A;  4JVC A;  1M5E A;  1MY0 A;  4EDP A;  2O6A A;  3QUJ A;  5IZZ A;  3VLV A;  4PGP A;  1YPN A;  3PD8 A;  1TWY A;  3K0V A;  1A99 A;  4GWS A;  1I6Q A;  3SEU A;  3NOH A;  5IKB A;  1TT1 A;  4EF1 A;  1NNK A;  1QW0 A;  1B3E A;  3ISP A;  1M5F A;  1GV8 A;  4OFL A;  1LGB C;  3LBS A;  4DXB A;  5FHN A;  4ZE8 A;  5CMB A;  1VR5 A;  2PVU A;  2KQZ A;  4PFB A;  3RT8 A;  2P3N A;  3TEP A;  3IO6 A;  3KN8 A;  4XKP A;  3PMV A;  3SZP A;  3S9N C;  2H5Y A;  4ELR A;  4QBA A;  2XD3 A;  4ZEI A;  3FVN A;  1NV2 A;  1IME A;  4ZEF A;  2I58 A;  1DSN A;  1A54 A;  3IOR A;  2A5T A;  2DWJ A;  1FBG A;  3JV9 A;  1LAH E;  5F7V A;  1DBZ A;  2OLB A;  4ESW A;  2E0S A;  4NHB A;  1RDZ A;  2Y7R A;  4R2B A;  2A5S A;  2CZK A;  3I3V A;  3A3U A;  4N8G A;  2ESN A;  2XXU A;  4MF3 A;  4RYA A;  2Y5L A;  4LQ5 A;  5CRY A;  5B7D A;  1MDQ A;  3SEW A;  3QMF A;  5ITO A;  3K1M A;  1JW5 A;  2F97 A;  3OSQ A;  4GX6 A;  4N4U A;  5I56 A;  1NV3 A;  1JVY A;  4ZS9 A;  4KQP A;  2AL5 A;  2H99 A;  3IB0 A;  4U4S A;  3IB2 A;  2XX9 A;  4WEP A;  3UA8 A;  4YB5 A;  5TPA A;  1IMD A;  4IO2 A;  2L5V A;  1B52 A;  1H3D A;  4PBQ A;  1D9Q A;  4O3B A;  3U94 A;  4UA8 A;  1YCJ A;  4NG7 A;  2NUV A;  4OTE A;  4YKJ A;  4GQO A;  3THI A;  4GRK A;  4F29 A;  3MST A;  4FAJ A;  1M5C A;  3OEL A;  3RPL A;  3UK4 A;  4KCD A;  1JVX A;  2HQ0 A;  3EN3 A;  3IL1 B;  3L6G A;  4TLL B;  3CG3 A;  3HHF A;  2Q8J A;  3PPN A;  3C32 A;  4RY1 A;  1VFD A;  4QF9 A;  1PB9 A;  4RJZ A;  1OMP A;  2F7B A;  2FIE A;  1N3X A;  1FJ9 A;  3DEL B;  3H6U A;  5EQ9 A;  3RQT A;  2QVR A;  1NV5 A;  2ZYK A;  2Q9T A;  2DOJ A;  1IIW A;  4QFN A;  4R75 A;  4POX A;  2Q74 A;  1MPD A;  2DDK A;  4O3C A;  2RC7 A;  1WVJ A;  1Y1Z A;  2DYX A;  2XD2 A;  4DE8 A;  4YMA A;  2Z8E A;  5BWJ A;  4RK9 A;  2RCB A;  1Z7N E;  1ZKB A;  1SW1 A;  4YB6 A;  4AS5 A;  4JSO A;  2I4C A;  3MJN A;  3PV0 E;  3M3K A;  2QS4 A;  1B4H A;  1B1X A;  4ZDM A;  1GR2 A;  1MY1 A;  1MM7 A;  4PF6 A;  3MPK A;  3KEI A;  4LP2 B;  2XXR A;  3QSL A;  4YKP A;  1T0K A;  5TP9 A;  5DEX A;  2QVU A;  3RY3 A;  2UXA A;  4H0W A;  1D9Y A;  4OEU A;  2IEE A;  1H43 A;  2UVI A;  1B0L A;  3CSG A;  5ET6 A;  2GQ1 A;  3C31 A;  2DVZ A;  1LBY A;  1VE4 A;  5DT6 A;  4XTC Q;  4IB2 A;  5DYH A;  2AIX A;  3RYD A;  5A5X A;  3PPR A;  4NQ8 A;  3SDF A;  3RTF B;  3K1N A;  4PAI A;  5CC2 A;  1FQE A;  3DM0 A;  5LDZ A;  1LBV A;  3MZ1 A;  4FBP A;  2P0S A;  5EQ7 A;  3PUX E;  3KGC A;  1LBZ A;  1KA0 A;  1FPE A;  3MVW A;  5CI5 A;  1LFG A;  3O9P A;  1ZMG A;  4PBH A;  3IK6 B;  4C0R A;  3MPL A;  4N07 A;  3HFU A;  1YZ0 A;  2QS2 A;  4NF5 A;  2GHB A;  4LZ7 A;  4G8M A;  3OEM A;  1SI0 A;  1O64 A;  4IR8 A;  4MIJ A;  1MXX A;  3OXN A;  2XXX A;  4R73 A;  2XXH A;  2F3D A;  3PMW A;  5I59 A;  5ISU A;  2B65 A;  1O7T A;  4JBZ A;  3EHU A;  1NI9 A;  5L9O A;  3N26 A;  2M8C A;  2ZNS A;  1FPL A;  3R6U A;  3FBP A;  4P1L A;  3C35 A;  1XS5 A;  2ZYO A;  4GXA A;  5FTI A;  2E1S A;  1LST A;  1FTO A;  3SEV A;  4DCX A;  4R9G A;  3T9U A;  4I62 A;  1IMC A;  4LN5 A;  1QUK A;  4RNS A;  1EU8 A;  3OO9 A;  4QXD A;  1RDX A;  4G68 A;  1ZBM A;  3C4M A;  2UVJ A;  1DTG A;  3Q27 A;  4F3S A;  2OBG A;  1FCK A;  4QFO A;  5AA2 A;  3G3H A;  1MDP 1;  5L8D A;  2G29 A;  1WOD A;  2OK2 A;  4PAK A;  1IUD A;  4P1E A;  2CZL A;  1US4 A;  1MM6 A;  4PFI A;  3FUZ A;  4PDD A;  1N7X A;  4XXU A; 
#chains in the Genus database with same CATH homology
 1XOC A;  5KCJ B;  1H76 A;  4BDL A;  2OZZ A;  2Q88 A;  5EHS A;  2RKM A;  3M3F A;  3T93 B;  1S9T A;  2D5W A;  5AA2 B;  3CFX A;  4O3A A;  3O6I A;  3U92 A;  1UTH B;  4JWO A;  3TYH A;  4OFJ A;  4ZZA A;  5I2N A;  4OFO A;  1CB6 A;  4OEV A;  2Y7P A;  4M1V A;  2H9B A;  1HSE A;  1P1W A;  1S7Y A;  3OO8 A;  4ZEB A;  4QFL A;  1P99 A;  1SD3 A;  4IO5 A;  1Y3P A;  4ZEC A;  3PGF A;  1TFA A;  4BDO A;  3LSL A;  4F2Q A;  2FA7 A;  3BFU A;  3C34 A;  4ELP A;  5I57 B;  5I2N B;  1GTK A;  1N3W A;  1Y4T A;  3HV1 A;  3KFM A;  2UYF A;  3U1O A;  1FQA A;  4GL8 A;  4NF6 A;  3D4C A;  3H6V A;  3MQ9 A;  3MAM A;  1A55 A;  5J1D A;  4U2R A;  4PFW A;  1L5T A;  2VHA A;  5JTY B;  3TFL A;  3QAX A;  2XXY A;  3FV2 A;  4N6P A;  1SVX B;  4XKQ A;  2QS1 A;  3WAF A;  4P11 A;  1FTJ A;  1B9J A;  3QYT A;  3GZG A;  3E3K A;  4EF2 A;  3C36 A;  4U21 A;  1UTB A;  3IJX B;  2HCA A;  3CRB A;  1IEJ A;  3EHS A;  4XIG Q;  3VLW A;  1DMB A;  1B3L A;  1NNP A;  3PD9 A;  5ITP A;  1DPE A;  2NXO A;  1PC3 A;  4K3F A;  4EUO A;  2DWI A;  4IO6 A;  3LSW A;  4Q5T A;  1ANF A;  4U22 A;  2ABH A;  1FTL A;  3OEN A;  3S9M C;  3MWB A;  5L9S A;  1EZ9 A;  1N7W A;  4KYS A;  3EF7 A;  2PMS A;  4THI A;  1PEB A;  4NF8 B;  2NVU B;  1WDN A;  3TCH A;  3OMB A;  1EZO A;  3B6W A;  1USY H;  2THI A;  4DXC A;  1MH3 A;  2I48 A;  2PYY A;  3UN6 A;  2V3Q A;  3OD7 A;  1I6B A;  1SI1 A;  1MXW A;  4QRZ A;  4U1Z A;  2GHA A;  2FNC A;  3IOV A;  4RA1 A;  4GIZ A;  3TPA A;  5CMM A;  3TTM A;  3LC8 A;  5FHO A;  4X48 A;  3HHG A;  1ZJL A;  3PUY E;  3G3J A;  4H6D A;  5I2K B;  3TEL A;  3N94 A;  4DIG A;  3ODB A;  3GBB A;  2G93 A;  3EPE A;  3O66 A;  3VFJ A;  4OEN A;  1UQW A;  1MG1 A;  4PP0 A;  5BUU A;  4H8J A;  3G3I A;  1R9L A;  1LAF E;  4IY5 A;  2DXR A;  4U23 A;  3HPI A;  1ZTY A;  3CG1 A;  3RTW B;  5H8Q A;  4TLM B;  1NL5 A;  5I84 A;  4MH5 A;  2OWS A;  2PT1 A;  2YJP A;  1ZU0 A;  5H8F A;  1F9B A;  3FJ7 A;  1N0T A;  1OIB A;  2UVG A;  3OSR A;  1N04 A;  4EQ7 A;  2RC8 A;  4H67 A;  4R6H A;  3KBR A;  1MXU A;  4KCC A;  3R7X A;  2Z8D A;  4NF4 A;  5K2X A;  1Y9U A;  3PUZ E;  2HZK A;  2XXP A;  4ESX A;  2A5T B;  3SER A;  3TDJ A;  2RC9 A;  4HCW A;  4MLV A;  3FGS A;  1P1N A;  3HN0 A;  2D21 A;  5DTB A;  1FQB A;  1SBP A;  2V3T A;  3UP9 A;  1FQF A;  4WED A;  1AIV A;  2DQV A;  4TQU Q;  2I49 A;  5HM4 B;  1OQG A;  3QK6 A;  4C1T A;  3VVD A;  5I56 B;  3IOT A;  3ZKL A;  2BJJ X;  5H8H A;  1A7L A;  3QUF A;  4GWO A;  3E9X A;  1H44 A;  2IA4 A;  4F2O A;  1RYX A;  2Z22 A;  5CBS A;  1JEU A;  5TPA B;  2PBW A;  4ZEK A;  1ELJ A;  4F18 A;  3T96 B;  3O97 A;  3U8Q A;  3V89 B;  3FJG A;  3MC2 A;  3G3F A;  5KZT A;  1N76 A;  1B3G A;  4GXS B;  2DXY A;  1GGG A;  4I8C A;  3ONM A;  3H6W A;  4IO3 A;  4C1U A;  1HSJ A;  1B5I A;  1B7Z A;  4EXK A;  1PDA A;  4MBP A;  1P1U A;  4WXJ A;  1B2H A;  2XHD A;  4F1V A;  3U72 A;  1SYH A;  4X1D A;  1IXH A;  4LZ8 A;  4PE5 B;  2V93 A;  4JDF A;  1SQY A;  4PFT A;  1NKX A;  1POY 1;  2VD2 A;  1B1H A;  4KYD A;  3DLN A;  1OVT A;  2F6P A;  3IOU A;  3FVO A;  2O84 X;  1JW1 A;  1EZP A;  2X7P A;  1IQ7 A;  2I3V A;  4KPT A;  2Q2A A;  1PB7 A;  4NTL A;  1B5H A;  1BLF A;  4RXL A;  4XKR A;  1AL3 A;  3PUW E;  4Q0C A;  4X9T A;  4R72 A;  3TQL A;  2WKY A;  3SEY A;  2O69 A;  4ZE9 A;  3OEK A;  4R2F A;  1B3H A;  3ZS6 A;  3RGY A;  3CFL A;  4TOZ A;  3B6Q A;  4P0G A;  5ELV A;  2F36 A;  2GFE A;  4ONY A;  2F8D A;  3BFT A;  1LFI A;  1QKB A;  5TP9 B;  2HXW A;  5DEX B;  5CMK A;  2XX8 A;  2O7U A;  4R9F A;  3P7I A;  5I58 A;  1AMF A;  3V83 A;  4F31 B;  3KOS A;  3M8U A;  3QIM A;  2H25 A;  4KD5 A;  3MVY A;  4IGT A;  3KN3 A;  2ANJ A;  1R1N A;  5A5X B;  2RCA A;  1A8E A;  4GOT A;  1MQG A;  5ICT A;  3AXF A;  1BIY A;  4BDM A;  5AA1 A;  4KFQ A;  3TTR A;  3KZG A;  4GL0 A;  1DOT A;  2ZMB A;  3C9H A;  3K01 A;  3H03 A;  1POT A;  2DP8 A;  1UIV A;  1S50 A;  1B0H A;  4H65 A;  4BLA A;  3FAT A;  3CVG A;  4FED A;  4PET A;  1MY2 A;  4NF5 B;  5K2Y A;  1B7U A;  5FTH A;  3TTK A;  1Q1K A;  4OWD A;  1USY E;  4F3G A;  2REG A;  3MBP A;  2FYI A;  4U1O A;  1O63 A;  5CBR A;  2QMX A;  3ZSF A;  5I59 B;  2DWA A;  3UOR A;  2B3F A;  1LB9 A;  1OLC A;  2HAU A;  4NED A;  4JWY A;  1I6A A;  3JZJ A;  2R6G E;  4AB5 A;  4KI0 E;  4YB7 A;  4DLD A;  3CFZ A;  4ISU A;  3L6H A;  4H5G A;  4EQB A;  2OCU A;  2QSX A;  5KDT A;  4G68 B;  3HST A;  1LFH A;  1R6Z A;  2VP1 A;  1SDX A;  2XX7 A;  3TCG A;  1QUL A;  3FXQ A;  2XXI A;  4G2Z A;  2QJE A;  2DWH A;  4YIC A;  3S9E A;  3B7D A;  2ONR A;  4H8I A;  1MY3 A;  3W15 C;  2QRY A;  2XXV A;  1MXV A;  4NWD A;  1DPP A;  3FZV A;  2I3W A;  5AA4 A;  1VFE A;  2NWJ A;  4GF8 A;  3MP6 A;  3TZA A;  3TKD A;  3GBA A;  3C33 A;  3O6G A;  1P1O A;  5ICQ A;  3IB1 A;  1D4N A;  3TMG A;  4QFP A;  1QUJ A;  2HFB A;  2HZL A;  3RN8 A;  1YAE A;  4GVO A;  5AA4 B;  3PU5 A;  3SKP A;  4OHN A;  4QSE A;  3KN7 A;  4LQ2 A;  4G68 C;  1KWH A;  3A3C A;  3OOA A;  4NF6 B;  4LVQ A;  1OQH A;  4F1Y A;  4OES A;  1A40 A;  4FE8 A;  3TUS A;  3T9V A;  2F5X A;  1JEV A;  3EHT A;  2NOO A;  4PQJ A;  2V25 A;  5FHM A;  1JET A;  1EH3 A;  2DE3 A;  3V5A A;  2XXW A;  3O2A A;  3PPQ A;  3ILU B;  3D4G A;  2ZNT A;  3DP8 A;  1B6H A;  3TOD A;  3G3K A;  4JSD A;  3PPP A;  2PX1 A;  1UTB B;  1Z7M E;  3N6U A;  3ECR A;  4MFI A;  1DTZ A;  3A09 A;  4GFR A;  2UYE A;  5DVI A;  4IO7 A;  4FEC A;  4JWX A;  4DZ1 A;  4OMB A;  3RNN A;  3IO4 A;  1SYI A;  4LZ5 A;  4YU0 A;  3FAS A;  3IR1 A;  4X1B A;  2GRV A;  3CIJ A;  3MW0 A;  2F78 A;  3LSX A;  5AA3 A;  3H7M A;  4AQ4 A;  1OLA A;  4JXI A;  4ND9 A;  4AB6 A;  2HAV A;  3GXA A;  4ELO A;  3CR9 A;  4KHZ E;  3Q29 A;  4BDR A;  1SW5 A;  3S4U A;  2V3U A;  2Z8F A;  3VXC A;  3FVK A;  3KOT A;  2X26 A;  3RPW A;  4FOR A;  2Y7I A;  1MY4 A;  3K00 A;  1H45 A;  4ELQ A;  3KJ7 A;  2VOZ A;  1MQI A;  1MQD A;  5AE4 A;  3MVX A;  4R6K A;  1XC1 A;  2REJ A;  4OET A;  2R9J A;  3VLU A;  4N13 A;  1QUI A;  4QSD A;  4F3P A;  1MXZ A;  4POW A;  4OER A;  2F7C A;  3O29 A;  3OO6 A;  4NWC A;  1QJM A;  3T66 A;  1PB8 A;  3U93 A;  1YTV A;  1FTK A;  1NH7 A;  5H8Q B;  2Z23 A;  2UVH A;  4OVJ A;  2HEU A;  3LUY A;  3Q28 A;  1B7H A;  1Y1M A;  5H8F B;  1URD A;  3I6V A;  1MQH A;  3VVE A;  3KJT A;  4G4P A;  2PT2 A;  1HSL A;  2F35 A;  4UAC A;  4HW8 A;  4G77 A;  3K02 A;  1GVC A;  1B58 A;  2RIN A;  3FVG A;  4HCY A;  3TTL A;  2I0C A;  3VXB A;  3W9W A;  4OXV A;  2Q89 A;  4NF4 B;  4ZED A;  4RPO A;  3CI8 A;  3KSJ A;  4GLI A;  4YAH X;  1A8F A;  3R26 A;  2ZXT A;  3G3G A;  5DVF A;  1B40 A;  3USD A;  5L9M A;  1MXY A;  2DE2 A;  4G8H A;  3IOW A;  1B51 A;  1RKM A;  1MRP A;  1JQF A;  3UGW A;  1ATG A;  1LB8 A;  3HO7 A;  4OZ9 A;  1IXC A;  1XT8 A;  1IXI A;  3VE1 B;  3QXM A;  1Y4C A;  1US5 A;  5JEI A;  1LCF A;  3FJM A;  1Q35 A;  2Y7K A;  5H8H B;  4F19 A;  2H98 A;  2CMO A;  1TXF A;  4I1D A;  2XXQ A;  4FIM A;  2P2A A;  1IIT A;  4DXU A;  2YLN A;  1UIU A;  4RPN A;  1QKA A;  1MH4 A;  3ZKK A;  3H4Z A;  3V8X B;  2QMW A;  1Y20 A;  1LBC A;  3LR1 A;  1B5J A;  3Q26 A;  4F3B A;  4BDQ A;  3B6T A;  1AOV A;  5LOM A;  2XXT A;  1LLS A;  3TCF A;  2QPQ A;  1TFD A;  1M5B A;  1CE2 A;  4LA9 A;  4R6Y A;  4DDD A;  2DE4 A;  4YKK A;  3RT6 B;  3S9L C;  2O51 A;  1FQD A;  4Z0I A;  3CSB A;  4IY6 A;  3S2V A;  4FAT A;  1OVB A;  1BP5 A;  3IJO B;  3OO7 A;  4YKI A;  3K4U A;  3Q25 A;  1LAG E;  2YPN A;  3BBR A;  2LAO A;  4OYV A;  1R9Q A;  4BDN A;  4HTG A;  5DVJ A;  4IGR A;  4E0W A;  5H8N A;  2RF1 A;  3T9H B;  5HPQ A;  1D3K A;  2I0B A;  5CM6 A;  4IO4 A;  1B3F A;  2GH9 A;  5HBC A;  3MUQ A;  2QL3 A;  1Y3Q A;  3UIF A;  2D3I A;  2ALU A;  4JB7 A;  2OWT A;  3FIR A;  1RYO A;  5H8N B;  2W7Y A;  5I58 B;  2F6G A;  2F7A A;  3SET A;  2I4B A;  2ONK E;  3K1P A;  4NE4 A;  4Q30 B;  3FD3 A;  3BKI B;  1XVX A;  3EQ1 A;  2B3B A;  1VSO A;  5EYF A;  1BTJ A;  3G7W A;  1NNF A;  5IAI A;  4HS7 A;  3M3L A;  1IZ1 A;  1II5 A;  1J1N A;  1B4Z A;  3VV5 A;  3IAZ A;  4F39 A;  3K6X A;  4PFU A;  1FQC A;  3PMX A;  4EQ9 A;  1Y3N A;  1P1Q A;  1JNF A;  1URS A;  3E13 X;  1N84 A;  3W9V A;  1NMU A;  1MQJ A;  3H6T A;  4H1X A;  5M2V A;  4Z7E A;  1I69 A;  5KCJ A;  4EXL A;  2O68 A;  1LAX A;  1NH8 A;  1MS7 A;  2Y84 A;  4E0X A;  2OJT A;  3N6T A;  4OQO A;  3VVF A;  4M4G A;  4I9D A;  3FXR A;  3TAJ A;  2KLF A;  2P1S A;  2O7I A;  1UTH A;  3VDF A;  3F11 A;  1BKA A;  3SES A;  2ZYM A;  4PFY A;  3T9X B;  5B70 A;  5JK4 A;  4F22 A;  1PBQ A;  3E4R A;  5EHM A;  1AH5 A;  1XHY A;  3MP8 A;  3ILT B;  3O28 A;  3TTN A;  2VD3 A;  3MP1 A;  2V84 A;  2X7Q A;  5KDT B;  1MPB A;  4F1U A;  4H5F A;  2DSF A;  4YMB A;  3K2D A;  3MZB A;  4XKN A;  5I57 A;  4ZZE A;  4L17 A;  3MZ9 A;  4G8N A;  2ONS A;  1MPC A;  3K6U A;  2R71 A;  4QFK A;  1URG A;  1XVY A;  1LBB A;  2Y7W A;  2O1L A;  3JYR A;  2AL4 A;  2I6E A;  1LCT A;  4DCY A;  1FTM A;  1M5D A;  5JTY A;  3MVZ A;  1B32 A;  1PBP A;  4Q8R A;  1NNT A;  2O1M A;  2DS9 A;  5H8S A;  2AYS A;  3N5L A;  1SW4 A;  3FV1 A;  2ZNU A;  3O6H A;  3KSX A;  4ECF A;  1FW0 A;  1IXG A;  1JW4 A;  3GLB A;  3KG2 A;  4RK2 A;  4NMY A;  4WKM A;  2QS3 A;  3LSF B;  3H06 B;  5CMC A;  4U4X A;  4R74 A;  2VGQ A;  2DVC A;  4LAT A;  4YZZ A;  1SW2 A;  3I5O A;  3RUM A;  3DP6 A;  1B05 A;  4P0I A;  2Q2C A;  4FEB A;  1NFT A;  4QSC A;  5AA2 D;  4QHQ A;  2H4I A;  3FXU A;  4NF8 A;  4KR5 A;  2ZYN A;  3PPO A;  3PUV E;  5TU0 A;  4GD5 A;  3TQW A;  3H3G A;  2F34 A;  4LON B;  1D9V A;  4KYE A;  1B46 A;  1QVS A;  3IX1 A;  3SEX A;  3K6V A;  4FJP A;  1ZLQ A;  4MLQ A;  3K6W A;  3T22 A;  3DP4 A;  3WAE A;  4LUB A;  5F1Q A;  3RLF E;  1ZIU A;  3HCQ A;  5I2K A;  1M5E A;  1MY0 A;  4EDP A;  2O6A A;  3QUJ A;  3VLV A;  1YPN A;  3PD8 A;  1TWY A;  3K0V A;  1A99 A;  1I6Q A;  3SEU A;  5IKB A;  1TT1 A;  4EF1 A;  1NNK A;  1QW0 A;  1B3E A;  1M5F A;  1GV8 A;  4OFL A;  1LGB C;  3LBS A;  4DXB A;  5FHN A;  4ZE8 A;  5CMB A;  1VR5 A;  2PVU A;  3RT8 A;  3TEP A;  3IO6 A;  3KN8 A;  4XKP A;  3PMV A;  3S9N C;  2H5Y A;  4ELR A;  2XD3 A;  4ZEI A;  3FVN A;  4ZEF A;  2I58 A;  1DSN A;  1A54 A;  3IOR A;  2A5T A;  2DWJ A;  3JV9 A;  1LAH E;  5F7V A;  2OLB A;  4ESW A;  2E0S A;  2Y7R A;  4R2B A;  2A5S A;  3I3V A;  3A3U A;  2ESN A;  2XXU A;  4MF3 A;  4RYA A;  4LQ5 A;  5CRY A;  5B7D A;  1MDQ A;  3SEW A;  5ITO A;  3K1M A;  1JW5 A;  2F97 A;  3OSQ A;  5I56 A;  1JVY A;  4ZS9 A;  4KQP A;  2AL5 A;  2H99 A;  3IB0 A;  4U4S A;  3IB2 A;  2XX9 A;  4WEP A;  3UA8 A;  4YB5 A;  5TPA A;  4IO2 A;  1B52 A;  1H3D A;  4O3B A;  3U94 A;  4UA8 A;  1YCJ A;  2NUV A;  4OTE A;  4YKJ A;  4GQO A;  3THI A;  4GRK A;  4F29 A;  4FAJ A;  1M5C A;  3OEL A;  3UK4 A;  4KCD A;  1JVX A;  2HQ0 A;  3EN3 A;  3IL1 B;  3L6G A;  4TLL B;  3CG3 A;  3HHF A;  2Q8J A;  3PPN A;  3C32 A;  4RY1 A;  1VFD A;  4QF9 A;  1PB9 A;  4RJZ A;  1OMP A;  2F7B A;  1N3X A;  3DEL B;  3H6U A;  3RQT A;  2ZYK A;  2Q9T A;  2DOJ A;  1IIW A;  4QFN A;  4R75 A;  4POX A;  1MPD A;  4O3C A;  2RC7 A;  1WVJ A;  1Y1Z A;  2DYX A;  2XD2 A;  4DE8 A;  4YMA A;  2Z8E A;  5BWJ A;  4RK9 A;  2RCB A;  1Z7N E;  1ZKB A;  1SW1 A;  4YB6 A;  4JSO A;  2I4C A;  3MJN A;  3PV0 E;  3M3K A;  2QS4 A;  1B4H A;  1B1X A;  4ZDM A;  1GR2 A;  1MY1 A;  1MM7 A;  3MPK A;  3KEI A;  4LP2 B;  2XXR A;  3QSL A;  4YKP A;  1T0K A;  5TP9 A;  5DEX A;  3RY3 A;  2UXA A;  4H0W A;  1D9Y A;  4OEU A;  2IEE A;  1H43 A;  2UVI A;  1B0L A;  3CSG A;  3C31 A;  2DVZ A;  1VE4 A;  5DT6 A;  4XTC Q;  4IB2 A;  5DYH A;  2AIX A;  5A5X A;  3PPR A;  3SDF A;  3RTF B;  3K1N A;  5CC2 A;  1FQE A;  3DM0 A;  3MZ1 A;  2P0S A;  3PUX E;  3KGC A;  3MVW A;  5CI5 A;  1LFG A;  3O9P A;  1ZMG A;  3IK6 B;  4C0R A;  3MPL A;  4N07 A;  2QS2 A;  4NF5 A;  2GHB A;  4LZ7 A;  4G8M A;  3OEM A;  1SI0 A;  1O64 A;  1MXX A;  3OXN A;  2XXX A;  4R73 A;  2XXH A;  5I59 A;  3PMW A;  5ISU A;  2B65 A;  1O7T A;  4JBZ A;  3EHU A;  5L9O A;  3N26 A;  2M8C A;  2ZNS A;  3R6U A;  3C35 A;  1XS5 A;  2ZYO A;  4GXA A;  5FTI A;  2E1S A;  1LST A;  1FTO A;  3SEV A;  4DCX A;  4R9G A;  3T9U A;  4I62 A;  1QUK A;  4RNS A;  1EU8 A;  3OO9 A;  4G68 A;  1ZBM A;  3C4M A;  2UVJ A;  1DTG A;  3Q27 A;  4F3S A;  2OBG A;  1FCK A;  4QFO A;  5AA2 A;  3G3H A;  1MDP 1;  5L8D A;  2G29 A;  1WOD A;  2OK2 A;  1IUD A;  2CZL A;  1US4 A;  1MM6 A;  3FUZ A;  1N7X A;  4XXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...