5H8FB

Structure of the apo human glun1/glun2a lbd
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
286
structure length
283
Chain Sequence
RLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Positive Allosteric Modulators of GluN2A-Containing NMDARs with Distinct Modes of Action and Impacts on Circuit Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Glutamate receptor ionotropic, NMDA 2A
total genus 81
structure length 283
sequence length 286
ec nomenclature
pdb deposition date 2015-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8fB01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8fB02
1GTKA 3W9VA 2XD2A 4QF9A 1BIYA 2I48A 1WODA 3Q29A 1ATGA 3CG1A 2F7CA 3MZ9A 3PD9A 1B3EA 4FJPA 4G8NA 3VVFA 1AIVA 1OVBA 1TFAA 3OEKA 1MPBA 2AIXA 3FV2A 3FGSA 3TTRA 1FQBA 1FTMA 1ZTYA 2UYFA 3EQ1A 4U1OA 1FTKA 2O51A 3USDA 2FA7A 3FJMA 3N94A 4Q8RA 2DVZA 1QUIA 2Y7IA 1M5BA 4GRKA 3SDFA 5I2NA 2HAVA 5KDTA 4PP0A 4H5GA 4OZ9A 3U1OA 1CE2A 4F18A 5KDTB 2ALUA 3KBRA 4R6HA 4TLMB 3FVOA 2HZLA 2F7BA 1MXWA 1Y4CA 3MPLA 1VSOA 3W15C 5ISUA 2M8CA 3G3FA 1XHYA 2Z23A 3KJTA 3KN7A 3PUWE 3R26A 5H8HA 2O7IA 1MDP1 3HHGA 4NF8A 3IX1A 2G93A 4YAHX 1B3GA 2QPQA 4G77A 3TTLA 3D4GA 4IY6A 4AQ4A 3H3GA 1EU8A 3N6TA 2DSFA 2GHAA 2B65A 4X48A 2H25A 4LVQA 4GVOA 3RT8A 2XX9A 3ZKLA 3LR1A 4IO4A 5B7DA 2QRYA 1NNPA 3EHTA 1Y3PA 3W9WA 1HSLA 3O97A 3Q27A 1SYHA 1I69A 1MY2A 1YCJA 3DM0A 2D3IA 4G68A 4JWYA 4U4XA 1D4NA 4BDLA 4OENA 3PPPA 4NMYA 4JDFA 2RC7A 3TPAA 5AA4A 2Z8FA 1IIWA 3MVYA 5DT6A 2AYSA 4ZS9A 3KOSA 3RTWB 5ICTA 3SKPA 3DP6A 4XXUA 4OXVA 1LAXA 2HQ0A 4H6DA 1URDA 2RC8A 3R6UA 1A99A 1DTGA 1LFHA 2Y7WA 1ELJA 4AB5A 1MY3A 2R71A 4DLDA 2QJEA 1MQIA 3IAZA 2XX8A 2RF1A 3MVWA 1B1HA 1B52A 1EH3A 3DP4A 3TUSA 2DE4A 4YZZA 3SEUA 4NF4A 3PMXA 1SW2A 3VE1B 1USYE 3QYTA 3VXCA 4EDPA 3K6VA 4OFLA 1B7HA 2Z8DA 1OVTA 3ILTB 3IJOB 2ZNTA 1DPPA 1UTBB 1PB9A 1B4ZA 4RJZA 4YU0A 1IXCA 3EN3A 3VLVA 4PFYA 4DZ1A 3S2VA 3M8UA 2DYXA 4F2QA 3WAEA 4FAJA 2Q2CA 2VHAA 2ZYKA 3O9PA 4POWA 1JEUA 1ZBMA 3S9NC 1WDNA 1WVJA 3EPEA 1IZ1A 2XXUA 4XKPA 1LFGA 1QUKA 4LZ7A 3E3KA 4OFOA 5I58A 3RTFB 2O69A 2ZYNA 1AH5A 5A5XA 4YB5A 5L9SA 1SW4A 2Y7KA 3CIJA 1JVXA 1Y3NA 3IL1B 1A55A 2I0CA 3IO4A 1R9LA 2E0SA 2VP1A 1JW5A 3IB2A 2RCBA 3BKIB 1R9QA 2H5YA 3LUYA 3M3KA 1M5FA 4G68B 4NF6A 3G3GA 2NWJA 3TTMA 4BDRA 1JNFA 3FVGA 3G3JA 3IOVA 2ABHA 4L17A 4NE4A 4BDMA 1SI0A 4GXAA 4RA1A 1XVXA 1P1OA 1LCFA 1P1UA 5H8QA 1B0HA 4U22A 1EZ9A 3PMWA 5CBRA 4N6PA 3RY3A 1POY1 3PUVE 2RCAA 2DS9A 2X7PA 1MRPA 2CMOA 4NTLA 1AOVA 1LFIA 4DXBA 1MS7A 5AE4A 5H8NB 4JB7A 1IXGA 3TQWA 2VGQA 4E0XA 2DOJA 3I3VA 3TTKA 1B0LA 1B2HA 2DWIA 5H8FA 5CBSA 1EZOA 3FUZA 1MM7A 2HZKA 4F3PA 2D21A 2ZYMA 1VR5A 3KGCA 2NUVA 3HPIA 4ZDMA 4R72A 3SEXA 3K4UA 1MQHA 4NF6B 5AA1A 4F31B 1B5HA 2F8DA 4QFLA 4PQJA 1DMBA 3VVDA 2XXRA 1FW0A 3E4RA 1PC3A 4BDQA 4LA9A 5TP9B 3Q28A 3T96B 3LSFB 4O3AA 2ZNSA 2PMSA 5LOMA 4LATA 1B3LA 1YPNA 5H8QB 1SBPA 2PX1A 3HV1A 4C1UA 2XXVA 2O6AA 2VD2A 2ANJA 3IORA 4IO5A 1AMFA 5DVIA 5ITOA 4ECFA 4YMBA 5HPQA 4RK9A 1XC1A 1LAGE 3UIFA 2P0SA 3ECRA 4QRZA 4DCXA 1B46A 2HAUA 3L6GA 4WKMA 4GL0A 1SW1A 2DE2A 2GRVA 5DEXB 5H8NA 1XVYA 3MW0A 2NVUB 1T0KA 4ZZEA 3SERA 4F29A 1A54A 3LSXA 3SEWA 3UN6A 1ANFA 3B6QA 3M3FA 1UTHA 1QKAA 4MFIA 3PMVA 4XKRA 3VLWA 1IQ7A 1ZJLA 2F6PA 5CC2A 3K6WA 3OO9A 5K2XA 5TPAB 4X1BA 2DE3A 2H9BA 1FQDA 1DSNA 1GR2A 3AXFA 3H6VA 1N76A 1UIVA 2V84A 3MPKA 3G3HA 4R6KA 3SEYA 4C0RA 4GFRA 4FATA 4E0WA 2OZZA 2I0BA 2OK2A 1Q35A 5TP9A 1FCKA 3OSRA 4ZECA 5AA3A 3S9EA 1XS5A 4YB6A 3IOUA 3D4CA 3V83A 5H8FB 1LLSA 2DXYA 4YKPA 3TYHA 2KLFA 5I2KB 5AA4B 3S9MC 1US4A 5JK4A 1RKMA 1MM6A 4LUBA 4OEVA 2I58A 1DPEA 4O3BA 4R2BA 4ONYA 3QAXA 4LONB 3IOWA 4QFKA 4QFOA 5TU0A 3OOAA 5B70A 5JTYA 1EZPA 1QKBA 4ZEFA 4X1DA 2IA4A 4H8JA 3T9VA 3K1PA 3U93A 1QULA 4IGTA 5H8HB 2O7UA 2P1SA 2Q2AA 1LBBA 3KJ7A 2X26A 4GLIA 2O1MA 1JETA 4NF5A 4RK2A 4F19A 4QFNA 1FTOA 2X7QA 3FVNA 2ZMBA 3HO7A 3VDFA 3GBBA 4OETA 3HHFA 4PETA 3T9UA 1B58A 3QUFA 2Q8JA 2ONSA 2A5TB 4R9FA 4KYDA 4FE8A 2UVIA 2HFBA 3O29A 4G8MA 4Q30B 5L8DA 2R9JA 3O6HA 4KYEA 4LZ8A 4GWOA 1QVSA 2Z8EA 4KCCA 3RT6B 2AL4A 4N07A 3U92A 2F7AA 3CFLA 2DP8A 1XT8A 3C33A 3MBPA 4H8IA 3E9XA 1M5CA 3I6VA 3MVXA 1OQHA 4NWDA 2VD3A 1POTA 4GXSB 1ZMGA 4OWDA 3H06B 5TPAA 2F5XA 4BDOA 4F1UA 4O3CA 1MXYA 2UYEA 3I5OA 1JEVA 1JVYA 1LB9A 4MH5A 3E13X 1GV8A 4TOZA 1Z7ME 1NMUA 3UGWA 4ZEIA 1TFDA 2YJPA 1PDAA 1N0TA 3KEIA 1MXXA 4Z0IA 3KFMA 3T22A 3V89B 5KZTA 1MPDA 1URGA 2FYIA 3BBRA 3OO6A 5K2YA 1L5TA 3TQLA 3CR9A 3F11A 2V93A 4OVJA 2R6GE 2Y84A 2OWSA 3QSLA 4GF8A 1SD3A 5DYHA 4R6YA 3MP8A 2THIA 5M2VA 4EXLA 3RN8A 2V25A 4G68C 3K1MA 4IO2A 1LB8A 3T9HB 4P0GA 3HN0A 4M1VA 4ZEBA 2H4IA 4GOTA 4TLLB 4G4PA 1H44A 1MH4A 1M5EA 3V5AA 5L9MA 2QSXA 3HSTA 2XXWA 3N5LA 5HM4B 3MZ1A 4WEPA 3L6HA 4R9GA 2XXXA 2F6GA 4F22A 4OQOA 4RPNA 1FQFA 1B4HA 3KSJA 1MPCA 1N04A 4H67A 3VVEA 3N26A 3K1NA 2XX7A 4EQ7A 4N13A 1Y9UA 1SI1A 3ODBA 2G29A 4F3GA 1VFEA 1NNTA 2ONRA 1MQDA 4QHQA 5AA2B 3PUXE 1JW4A 2I4BA 1H45A 4KQPA 1BKAA 3P7IA 4XIGQ 1FTLA 3TTNA 3RQTA 2H99A 2O1LA 3M3LA 5IAIA 5JEIA 1M5DA 3JYRA 1S7YA 3PUZE 1CB6A 4PFWA 4XTCQ 3TKDA 2ZXTA 4EUOA 4F39A 2Y7RA 2OJTA 4ZE9A 5ITPA 1USYH 1P1QA 4F2OA 2BJJX 1P1WA 3FIRA 5FTIA 3IJXB 5FHOA 3MVZA 2PT1A 2XXPA 3PD8A 5KCJA 1OMPA 5H8SA 2VOZA 3FV1A 3CFXA 2QMWA 1MQJA 2PVUA 5L9OA 4NEDA 4U4SA 1DOTA 3B6WA 2GH9A 1O63A 4IY5A 3FXRA 2XXYA 1D9YA 3CRBA 4THIA 4RY1A 3IB1A 3ZSFA 1A8EA 3O2AA 5AA2A 3RLFE 2E1SA 2XD3A 2YLNA 1IXIA 1JW1A 4QSDA 4QSCA 1MXVA 4R2FA 4R74A 2DWAA 3T93B 3FVKA 1BP5A 1KWHA 1RYXA 1US5A 3TMGA 3MAMA 2Z22A 4ELRA 4PFUA 3CSBA 1LAHE 1FQCA 4ESXA 4ELPA 4PE5B 4U2RA 4I1DA 1N3XA 1URSA 3U72A 2DXRA 4EQ9A 1Y3QA 4M4GA 3CVGA 3LSWA 4OYVA 1B1XA 4Z7EA 2PT2A 3TEPA 1XOCA 2REJA 4FECA 5I56A 1ZLQA 2NXOA 2UVHA 4JSOA 2XXIA 3ONMA 3TAJA 1B40A 4XKNA 4F1YA 1SQYA 3OXNA 1A8FA 1S9TA 1UIUA 1QW0A 4ISUA 4AB6A 2RC9A 1B7UA 4QFPA 3UORA 3MUQA 3SETA 5I59B 3OMBA 3FZVA 3PV0E 5DEXA 3PPNA 2DQVA 5CI5A 1A40A 1H43A 3C32A 4Q0CA 4EF2A 4G2ZA 4WXJA 2F97A 1FQEA 3Q25A 1AL3A 1NNKA 4MF3A 2XXQA 4OERA 3T9XB 3KZGA 5EYFA 3PU5A 1J1NA 2GFEA 3B6TA 1I6QA 1P1NA 2UVJA 1SDXA 5FHMA 4DIGA 3B7DA 1B7ZA 2HXWA 1MY1A 3C36A 5J1DA 4K3FA 3LSLA 5FHNA 3UK4A 1Y20A 1B05A 2H98A 4ESWA 2DVCA 3TCHA 5CMBA 1VE4A 2OBGA 4YB7A 5I84A 1D9VA 2ZNUA 4KHZE 3SESA 4KPTA 4LP2B 3OENA 3PGFA 4DDDA 4YICA 3GZGA 3KN3A 1B51A 3GXAA 2QS2A 1ZU0A 1MY4A 1S50A 3HCQA 1B3HA 3KN8A 5F7VA 3VXBA 4I9DA 3TELA 1TT1A 1Y1MA 3TODA 4EF1A 3OD7A 3TCFA 1Y4TA 4OEUA 1FQAA 1I6BA 2OLBA 1OIBA 3ILUB 3IR1A 4KD5A 4MLVA 3C31A 2GHBA 4I62A 4NWCA 5F1QA 2NOOA 3TDJA 5I57B 3MWBA 4G8HA 2QS3A 3IOTA 3IO6A 1Y1ZA 4IB2A 3K02A 4NF8B 4BDNA 1UQWA 1N3WA 3KSXA 3RNNA 3TCGA 4DE8A 4UACA 2LAOA 3CI8A 4WEDA 4JSDA 3O6IA 3PUYE 4OMBA 4ZEKA 1MH3A 3K2DA 4FEDA 4H5FA 3T66A 3FASA 1Z7NE 2F35A 5HBCA 3FD3A 3EHSA 1H3DA 1LSTA 5BWJA 3OO7A 4YKIA 3VLUA 2OWTA 3RPWA 2DWJA 2RINA 3LC8A 3VV5A 3MP6A 2QMXA 1SW5A 4JBZA 3ZS6A 4KR5A 3PPQA 4R75A 3BFUA 1OLAA 1H76A 5BUUA 4DCYA 2CZLA 3DLNA 4OESA 4POXA 4HTGA 1LCTA 1B32A 2Q88A 5CMCA 4Q5TA 5I2NB 3S9LC 3H03A 4KYSA 1MXZA 1R6ZA 3MP1A 1IITA 2Q89A 3OO8A 2B3FA 4RPOA 2QS1A 2PYYA 4P11A 4U1ZA 1VFDA 3K0VA 4F3BA 3GBAA 2O84X 5I57A 1NKXA 3OELA 5I2KA 2PBWA 4IGRA 1PBQA 2P2AA 3C34A 3FXUA 3K00A 3N6UA 3QK6A 4FEBA 3OEMA 2HEUA 4X9TA 2I3VA 4NF4B 1OLCA 2F34A 3C35A 3PPOA 2UVGA 1YAEA 4YKJA 5DVJA 2QL3A 4ZE8A 2WKYA 4F1VA 1JQFA 2I49A 3RUMA 1MY0A 2Y7PA 3C9HA 2D5WA 2ESNA 4H0WA 2HCAA 4ELOA 4EQBA 2DWHA 4KCDA 3H6WA 2YPNA 4MBPA 4BLAA 5AA2D 2XXHA 1B5IA 3K6UA 1NH8A 1PB7A 3KG2A 3MC2A 4XKQA 3U8QA 3TFLA 1UTHB 4GQOA 3DP8A 4PFTA 3TZAA 2I4CA 4IO7A 4RNSA 2XXTA 4MLQA 2F78A 1QUJA 3MQ9A 5CMMA 2V3QA 3UA8A 2IEEA 2OCUA 4EXKA 1IEJA 3QIMA 4JWOA 5CRYA 4FIMA 5CM6A 2ZYOA 3O66A 4HCYA 1TWYA 4JWXA 4JXIA 1IXHA 1PBPA 4ND9A 4ZZAA 2A5SA 3GLBA 1IUDA 1B3FA 2QS4A 2Q9TA 3C4MA 3KOTA 4H65A 3VFJA 1TXFA 1DTZA 1NFTA 2V3TA 3EF7A 3JV9A 2RKMA 3FXQA 4KI0E 1FTJA 4LZ5A 5DVFA 3K6XA 4HW8A 1N7WA 5I58B 3CFZA 3CG3A 1MDQA 3H6UA 4TQUQ 4HS7A 5EHSA 1PEBA 2UXAA 4YMAA 5IKBA 1R1NA 5KCJB 1I6AA 1II5A 1A7LA 1LBCA 2A5TA 2REGA 3IB0A 1BLFA 2W7YA 4I8CA 5DTBA 3R7XA 3U94A 1SYIA 4YKKA 3MZBA 1GVCA 3S4UA 1UTBA 4U23A 1NNFA 4RXLA 3FJ7A 5ELVA 4U21A 5I56B 3G7WA 1HSEA 1P99A 3Q26A 2I3WA 5EHMA 4FORA 3RGYA 4NF5B 1HSJA 1B9JA 1MQGA 1F9BA 1N84A 1PB8A 4H1XA 2FNCA 3PPRA 3QXMA 4GD5A 1B6HA 4RYAA 5ICQA 4IO3A 1B5JA 4LQ5A 1ZIUA 1YTVA 4GL8A 5FTHA 3LBSA 4DXUA 1QJMA 2B3BA 1OQGA 4OTEA 5A5XB 5JTYB 3A3CA 3ZKKA 1NL5A 3K01A 3EHUA 4C1TA 4DXCA 3H6TA 4LQ2A 3DELB 2XHDA 2F36A 1BTJA 3A09A 2O68A 3H4ZA 3O28A 1LGBC 4OFJA 2AL5A 5CMKA 3A3UA 3G3KA 3BFTA 3O6GA 1D3KA 3UP9A 3WAFA 4UA8A 1GGGA 2I6EA 1N7XA 1MXUA 4GIZA 3IK6B 4R73A 1MG1A 1SVXB 1Q1KA 2V3UA 3FATA 2ONKE 4F3SA 5I59A 3JZJA 3MJNA 3QUJA 4OHNA 1RYOA 3G3IA 4IO6A 1O64A 3CSGA 4HCWA 4ZEDA 4P0IA 1ZKBA 3THIA 3H7MA 4QSEA 4KFQA 1LAFE 1NH7A 1O7TA 3FJGA 3SEVA 4ELQA 3V8XB 3OSQA
chains in the Genus database with same CATH superfamily
1GTKA 3E78A 1WODA 2CZKA 2F7CA 1B3EA 3VVFA 1OVBA 1TFAA 1D9QA 4N8GA 3FJMA 4Q8RA 2DVZA 4MMPA 1M5BA 1NI9A 1VSOA 5ISUA 2M8CA 3PUWE 1KA1A 3R26A 3HHGA 3IX1A 1B3GA 1SPIA 2DSFA 4LVQA 3RT8A 4GVOA 3ZKLA 4MNIA 1NNPA 3EHTA 1SYHA 4G68A 4U4XA 5IZZA 1AWBA 4NMYA 3TPAA 1LBVA 5AA4A 1IIWA 4ZS9A 2B4MA 2HQ0A 4H6DA 2RC8A 1LFHA 1ELJA 1MY3A 2R71A 1MQIA 3IAZA 2XX8A 2RF1A 3VE1B 3PMXA 1EYIA 3VXCA 4P56A 4QBAA 4RJZA 3MSTA 3EN3A 1EYJA 4PFYA 3M8UA 3WAEA 4FAJA 2VHAA 1JEUA 1ZBMA 5I58A 1LFGA 3E3KA 3RTFB 1AH5A 1A55A 3M3KA 3BKIB 4NF6A 3TTMA 5IAIA 4YMBA 3FVGA 1EZ9A 5CBRA 4JVDA 3RY3A 2DS9A 1MRPA 2F3DA 5AE4A 5H8NB 1IXGA 3I3VA 2XWKA 1B0LA 3FUZA 2D21A 2NUVA 3SEXA 3K4UA 4OANA 1B5HA 3ROJA 4MJOA 1FW0A 4BDQA 3T96B 5LOMA 3HV1A 3ECRA 2GRVA 5DEXB 2NVUB 1A54A 3SEWA 3PMVA 4XKRA 5I7IA 2F6PA 2DDKA 5TPAB 4X1BA 4O7MA 1RDXA 1FQDA 3MPKA 1GR2A 3AXFA 3H6VA 4R6KA 2I0BA 2OK2A 5EQ9A 4X8RA 5H8FB 1LLSA 2CZHA 4PFBA 5AA4B 4N8YA 4MHFA 4OEVA 1DPEA 4X1DA 4NF5A 2ZMBA 3HO7A 3T9UA 3HHFA 2HFBA 5L8DA 4GWOA 4KCCA 2Z8EA 2AL4A 4XEQA 4N07A 2F7AA 1OQHA 1POTA 3H06B 1JEVA 4MH5A 3E13X 4ZEIA 4E0WA 1N0TA 3KFMA 3V89B 3BBRA 1URGA 5A5LA 3F11A 2V93A 4GF8A 3U65A 4R6YA 2H4IA 4GOTA 4TLLB 4G4PA 1H44A 1MH4A 1M5EA 2V4CA 2QSXA 3HSTA 5HM4B 4R9GA 2F6GA 4OQOA 4H67A 1MPCA 1N04A 4EXKA 2XX7A 2VPOA 1NNTA 2ONRA 4QHQA 1FTLA 5JEIA 2XWOA 3PUZE 4PFWA 4XTCQ 2Y7RA 2OJTA 1P1WA 3FIRA 2XXPA 3PD8A 5KCJA 5H8SA 3CFXA 2PVUA 5L9OA 1DOTA 2XXYA 1D9YA 3CRBA 2CEXA 2HHMA 3IB1A 4NG7A 4QSDA 4R2FA 3T93B 1DK4A 2DWAA 3TMGA 4PFUA 4O8MA 4ELPA 4U2RA 4I1DA 1FBEA 3LSWA 2NXOA 4JSOA 4F1YA 3ONMA 4ISUA 2QFLA 1B7UA 4QFPA 5I59B 3OMBA 3FZVA 1A40A 4GWSA 2FBPA 4G2ZA 1FQEA 3Q25A 4DI4B 4GX6A 4N6DA 2GFEA 1I6QA 1MY1A 4PAFA 4ESWA 2DVCA 2ZNUA 3EKIA 3OENA 3GXAA 3HCQA 1S50A 4JVCA 1Y1MA 4EF1A 4OEUA 3IR1A 4KD5A 4NWCA 2NOOA 3MWBA 4G8HA 4NF8B 4NQ8A 4WEDA 4OMBA 4ZEKA 4H5FA 4P47A 4N81A 1Z7NE 2F35A 3VLUA 3RPWA 2RINA 2QMXA 2MKZA 3PPQA 4POXA 4HTGA 1LCTA 1B32A 5CMCA 4Q5TA 4KYSA 2Q89A 3OO8A 2B3FA 1VFDA 3OELA 5I2KA 4IGRA 3C34A 3FXUA 2HEUA 2I3VA 4F1VA 2UVGA 1JQFA 1NV3A 2D5WA 4EQBA 2HCAA 2DWHA 3H6WA 2YPNA 2XXHA 3MC2A 2PFZA 2ZZXA 3TFLA 1UTHB 4GQOA 3TZAA 5DW8A 2I4CA 4IO7A 3UA8A 2IEEA 4FBPA 3O66A 4ZZAA 3KOTA 1B3FA 3C4MA 1JP4A 4AS5A 1TXFA 3EF7A 4HW8A 1FTJA 5DVFA 1N7WA 5I58B 3CG3A 5IKBA 2A5TA 4U21A 3Q26A 4FORA 4NF5B 1HSJA 1B9JA 1MQGA 1PB8A 4H1XA 4H46A 4IO3A 1OQGA 3ZKKA 1NV1A 3EHUA 4DXCA 3H6TA 2XA5A 3DELB 4GBWA 4OFJA 1MG1A 1SVXB 3FATA 5I59A 4F3SA 3JZJA 3MJNA 4OHNA 3G3IA 4HCWA 4NAPA 1O7TA 3V8XB 3OSQA 4QF9A 1BIYA 1ATGA 3PD9A 4FJPA 2AIXA 4N15A 2UYFA 4U1OA 2FVZA 2O51A 2FA7A 3N94A 3SDFA 2Y7IA 4GRKA 3BIGA 4PP0A 3U1OA 4OZ9A 4F18A 4HE0A 2R8TA 2ALUA 3KBRA 1IMBA 3FVOA 1MXWA 3MPLA 4P3LA 3G3FA 2Z23A 1FJ6A 5H8HA 2O7IA 1MDP1 3CHGA 4NF8A 3TTLA 4IY6A 1EU8A 3N6TA 2B65A 2QRYA 1YCJA 4JWYA 1D4NA 4OENA 4OVTA 2Q8MA 1BK4A 1K9ZA 2Z8FA 3RTWB 3KOSA 4PCDA 4OXVA 1LAXA 1URDA 3R6UA 1A99A 1NUXA 1B52A 2DE4A 1USYE 2ZNTA 4GWZA 3VLVA 4F2QA 4GWXA 3O9PA 1WVJA 1IZ1A 4OFOA 5A5XA 4YB5A 1JVXA 1Y3NA 3IL1B 4QFNA 2E0SA 4N91A 2H5YA 3LUYA 2NWJA 4BDRA 1JNFA 4NE4A 1P1OA 4OVRA 1B0HA 4U22A 1IMFA 1NV6A 3PMWA 4N6PA 3PUVE 2CMOA 1FBFA 5LTCA 1AOVA 4E0XA 3TTKA 2WX9A 3ISPA 4MNPA 5H8FA 5CBSA 1EZOA 2HZKA 2ZYMA 3KGCA 3HPIA 4XF5A 4QXDA 1MQHA 5AA1A 2F8DA 1INPA 4PQJA 1DMBA 2XXRA 3E4RA 1PC3A 4LA9A 3LSFB 1YPNA 5H8QB 1SBPA 2PX1A 4P1EA 2XXVA 3IORA 2VD2A 4IO5A 5HPQA 1LAGE 2P0SA 2HAUA 4GL0A 1SW1A 1XVYA 1T0KA 3SERA 3LSXA 3VLWA 3M3FA 1IQ7A 3FXBA 5K2XA 2DE3A 4RA1A 1DSNA 1FPJA 1QGXA 1N76A 4C0RA 4GFRA 4MIJA 1DCUA 1Q35A 4YB6A 4YKPA 3S9MC 1MM6A 4O3BA 4QFOA 5TU0A 2F3BA 3U93A 4IGTA 2O7UA 2Q2AA 4RK2A 2X26A 4F19A 2O1MA 2X7QA 3FVNA 4OETA 4PETA 5IM2A 4G8MA 3O29A 3O6HA 3RT6B 3CFLA 1XT8A 3I6VA 4MAGA 4GXSB 1ZMGA 4BDOA 4O3CA 1MXYA 3I5OA 1GV8A 4TOZA 4Z0IA 1PDAA 3OO6A 3TQLA 3CR9A 4GWUA 2QVRA 4OVJA 2Y84A 2OWSA 1SD3A 5T3JA 3MP8A 5M2VA 4G68C 4PF6A 3K1MA 1LB8A 4P0GA 4M1VA 5L9MA 4RPNA 1FQFA 3N26A 3K1NA 1SI1A 5AA2B 2G29A 1MQDA 3TTNA 3RQTA 2H99A 1S7YA 3TKDA 3D1RA 1P1QA 1EYKA 1FPGA 4NEDA 3B6WA 2GH9A 1A8EA 5AA2A 3RLFE 2YLNA 4R74A 1BP5A 1KWHA 1RYXA 3SZPA 3MAMA 3CSBA 1LAHE 3U72A 4EQ9A 1Y3QA 3CVGA 3TEPA 5I56A 1B40A 3OXNA 2RC9A 3UORA 2DQVA 5CI5A 3C32A 1FBGA 2F97A 5EYFA 4GBVA 4I3YA 3PU5A 1J1NA 3B6TA 1IMCA 4DIGA 4OVQA 4K3FA 3LSLA 5FHNA 3UK4A 1VE4A 2OBGA 1D9VA 2HXRA 4LP2B 4DDDA 4YICA 3KN3A 1B51A 5I5PA 4AS4A 3TODA 3OD7A 3TCFA 2B4LA 1I6BA 5I57B 4IB2A 3IOTA 5I84A 1N3WA 3RNNA 4OVPA 3EHSA 4N4UA 4N17A 3VV5A 4O94A 4JBZA 3ZS6A 4KR5A 1OLAA 2Q88A 2P3VA 1RDZA 1FBHA 1MXZA 1FSAA 4RPOA 2QS1A 1FBCA 3GBAA 5I57A 1NKXA 1PBQA 2P2AA 4FEBA 4X9TA 4LN5A 1LBXA 3C35A 3PPOA 3QMFA 2I49A 4KCDA 5AA2D 1NH8A 2F78A 3MQ9A 5CMMA 4NN3A 1IEJA 4JWOA 5CM6A 4ND9A 1IXHA 2XXKA 5BUUA 2L5VA 3IFAA 3E79A 2V3TA 2RKMA 3H6UA 2VT5A 4YMAA 1II5A 1A7LA 3U94A 2W7YA 3R7XA 4YKKA 4RXLA 3A29A 3RGYA 1F9BA 1N84A 3PPRA 5IGAA 4GL8A 5FTHA 4OTEA 2B3BA 4P8BA 5JTYB 3A3CA 1NL5A 3K01A 3A09A 2O68A 3H4ZA 3WAFA 1GGGA 4R73A 3IK6B 3LUZA 4IO6A 1O64A 3CSGA 4P0IA 3THIA 4ELQA 3Q29A 3MZ9A 2WBDA 1AIVA 3OEKA 3FV2A 3TTRA 3EQ1A 1ZTYA 3RPLB 1FTKA 4NGUA 3USDA 1QUIA 2HAVA 2F7BA 3W15C 3KJTA 4YAHX 2G93A 4G77A 3D4GA 4AQ4A 3LR1A 4IO4A 5B7DA 3W9WA 1HSLA 3O97A 1I69A 4BDLA 2RC7A 3MVYA 2AYSA 3SKPA 3DP6A 4XXUA 2Y7WA 4AB5A 4NX1A 4DLDA 2QJEA 3TUSA 1B1HA 4EDPA 3K6VA 1FPBA 2Z8DA 1OVTA 3IJOB 1B4ZA 1IXCA 4DZ1A 3GYYA 5EYGA 2Q2CA 1WDNA 3EPEA 2HPGA 2XXUA 1QUKA 4HE1A 1YYZA 1IMAA 2O69A 2ZYNA 5J16A 1SW4A 1JW5A 4THIA 2RCBA 1R9QA 3RYDA 4BDMA 3G3JA 4L17A 1XVXA 4NHBA 1P1UA 1FPLA 5IZ1A 2RCAA 2X7PA 1LFIA 2VGQA 2DOJA 4O7IA 4F3PA 1VR5A 1Q9DA 4NF6B 2FIEA 4QFLA 2ZNSA 2PMSA 3BIHA 4LATA 1B3LA 1NV5A 4C1UA 2O6AA 4ECFA 2ANJA 4RK9A 1XC1A 1NV7A 4DCXA 4QRZA 4WKMA 5H8NA 2DE2A 4PAKA 1NV0A 4ZZEA 4F29A 4MFIA 4PFIA 1UTHA 5CC2A 3K6WA 3OO9A 3T1BA 1FPFA 1UIVA 2V84A 3SEYA 4FATA 2OZZA 5AA3A 2XWVA 1FCKA 1XS5A 5I2KB 1US4A 1RKMA 4LUBA 4H45A 1FBDA 1K9YA 5IZ3B 5JTYA 1EZPA 4ZEFA 2IA4A 3T9VA 3K1PA 1QULA 1G0HA 2P1SA 4GLIA 1LBBA 1JETA 2WYKA 4PC9A 3NOHA 2XWIA 2FIXA 4FE8A 2R9JA 4KYEA 4LZ8A 1QVSA 3MBPA 3C33A 4H8IA 1M5CA 4NWDA 2VD3A 4OWDA 5TPAA 4F1UA 2F5XA 2UYEA 1NMUA 1TFDA 2YJPA 3T22A 1MXXA 2FYIA 1FPEA 4PBHA 4EXLA 2THIA 3T9HB 3KBZA 4ZEBA 3N5LA 3MZ1A 4WEPA 4F22A 1B4HA 4P9KA 4EQ7A 4N13A 1Y9UA 4PF8A 1VFEA 2I4BA 4KQPA 3P7IA 4XIGQ 3M3LA 1M5DA 3JYRA 1CB6A 4F39A 5ITPA 3IJXB 5FHOA 2PT1A 2WEFA 1OMPA 3FV1A 4PE3A 1MQJA 4U4SA 4MCOA 4IY5A 4RY1A 3O2AA 2E1SA 1IXIA 1JW1A 4QSCA 3FVKA 2Z22A 4PE5B 1URSA 2DXRA 4Z7EA 4OYVA 2PT2A 5EYHA 4FECA 2REJA 1ZLQA 2XXIA 1SQYA 1UIUA 1QW0A 4AB6A 3MUQA 3SETA 5DEXA 3PPNA 1H43A 4EF2A 4WXJA 1IMEA 4MF3A 4OERA 3T9XB 1NV2A 1P1NA 2UVJA 5FHMA 1B7ZA 2HXWA 5J1DA 1Y20A 2H98A 5CMBA 4YB7A 4KHZE 3SESA 3GZGA 1ZU0A 1B3HA 1Y4TA 1FQAA 2OLBA 4MLVA 3C31A 2GHBA 4I62A 5F1QA 3TDJA 4BDNA 5LDZA 4DE8A 3KSXA 4PGPA 3CI8A 3O6IA 3K2DA 4FEDA 1LEVA 3FASA 5HBCA 1H3DA 2KR0A 3OO7A 2DWJA 1SW5A 4OA4A 3HFUA 2FHYA 1H76A 4GX4A 4DCYA 2CZLA 4OESA 5I2NB 3S9LC 3H03A 1R6ZA 3MP1A 2PYYA 4P11A 4U1ZA 3K0VA 4OVSA 3K00A 4NF4B 1NUWA 1OLCA 2F34A 5DVJA 1LBWA 2QL3A 2WKYA 3RUMA 4XFEA 1FPKA 2WBBA 2ESNA 3C9HA 4H0WA 4I40A 4ELOA 2QVVA 4BLAA 3B8BA 1B5IA 3KG2A 4XKQA 3DP8A 4PFTA 1CNQA 4GWYA 4MLQA 2V3QA 3QIMA 4FIMA 2ZYOA 1VDWA 2A5SA 3GLBA 1IUDA 3IFCA 1NFTA 4PDHA 4KI0E 3K6XA 2QVUA 3CFZA 5FBPA 5IZ3A 5ET7A 1R1NA 5KCJB 1I6AA 5DTBA 3ZSFA 1BLFA 2CZIA 1SYIA 4GWWA 3S4UA 1UTBA 5I56B 3G7WA 1HSEA 1P99A 2I3WA 2GQ1A 2FNCA 5ICQA 1B5JA 1YTVA 4DXUA 5A5XB 1QJMA 4PBQA 1LBYA 4C1TA 4LQ2A 1BTJA 5EQAA 2F36A 3O28A 5CMKA 2AL5A 3BFTA 3UP9A 4UA8A 1N7XA 4GIZA 1RDYA 2V3UA 4MEVA 3QUJA 4ZEDA 1ZKBA 4KFQA 1LAFE 1NH7A 3FJGA 3B50A 3SEVA 2P3NA 3W9VA 3MYUA 2XD2A 2I48A 4X04A 5I3SA 3CG1A 4G8NA 2VPNA 1MPBA 3FGSA 1FQBA 1FTMA 5I2NA 5KDTA 4H5GA 1CE2A 4R6HA 4TLMB 2HZLA 1Y4CA 3T0JA 1XHYA 3KN7A 2QPQA 3H3GA 2GHAA 4X48A 2H25A 2XX9A 1Y3PA 3Q27A 1MY2A 1YZ0A 3DM0A 2D3IA 3PPPA 4JDFA 5ICTA 1DTGA 1NUZA 1XI6A 3MVWA 3DP4A 1EH3A 4YZZA 3SEUA 4NF4A 3LV0A 1SW2A 3QYTA 4OFLA 1IMDA 1B7HA 3ILTB 1DPPA 1UTBB 1PB9A 4YU0A 4HE2A 3S2VA 2DYXA 2ZYKA 4POWA 1KZ8A 3S9NC 4XKPA 4LZ7A 5L9SA 2Y7KA 3CIJA 3IO4A 4GXAA 4JVIA 2I0CA 1R9LA 2VP1A 3IB2A 5DT6A 4G68B 1M5FA 3G3GA 5F24A 3IOVA 2ABHA 1SI0A 1LCFA 5H8QA 1POY1 4NTLA 1YXIA 4N6KA 1MS7A 4DXBA 4JB7A 3TQWA 2CEYA 2PCRA 1B2HA 2DWIA 1MM7A 4ZDMA 4R72A 4PAIA 3VVDA 5TP9B 3Q28A 5ET6A 4O3AA 1FPDA 4I3EA 5ITOA 1AMFA 5DVIA 5ET8A 3UIFA 1B46A 3L6GA 3MW0A 3UN6A 1ANFA 3B6QA 1QKAA 1ZJLA 2Q74A 2H9BA 3G3HA 2BJIA 4G61A 4ZECA 5TP9A 3S9EA 3OSRA 4MNCA 3IOUA 3D4CA 3V83A 2DXYA 3TYHA 2KLFA 5JK4A 2I58A 4R2BA 4ONYA 3QAXA 4LONB 3IOWA 2WYPA 4QFKA 3OOAA 4IR8A 5B70A 1QKBA 4H8JA 2Y5KA 5H8HB 4PDDA 3KJ7A 1FTOA 3VDFA 3GBBA 1B58A 3QUFA 2Q8JA 2ONSA 2A5TB 4R9FA 4KYDA 2UVIA 4Q30B 2ZZWA 2Y5LA 3U92A 2DP8A 2OWZA 3E9XA 3MVXA 4KXPA 4UABA 1JVYA 1LB9A 1Z7ME 3UGWA 1FPIA 3KEIA 5KZTA 4PFRA 1FJ9A 1MPDA 1L5TA 5K2YA 2R6GE 3QSLA 5DYHA 3RN8A 2V25A 4IO2A 3HN0A 1FRPA 3V5AA 2XXWA 3L6HA 2XXXA 1G0IA 4DI3D 3KSJA 3VVEA 4F3GA 3ODBA 3PUXE 1JW4A 1H45A 1BKAA 2O1LA 4EUOA 2JJKA 4ZE9A 2ZXTA 1USYH 4F2OA 2BJJX 5FTIA 3MVZA 2VOZA 2QMWA 4F31B 1O63A 3FXRA 1KA0A 3RPLA 2XD3A 1MXVA 4ELRA 1US5A 1FQCA 4ESXA 1N3XA 4M4GA 5ESYA 1B1XA 1XOCA 2PFYA 2OX3A 3TAJA 2UVHA 4XKNA 1A8FA 1S9TA 3KC0A 4PGNA 4GX3A 2ZZVA 3PV0E 4Q0CA 1AL3A 1NNKA 2XXQA 3KZGA 3PTYA 1SDXA 3B7DA 3C36A 1LBZA 1NV4A 1B05A 3TCHA 4KPTA 3PGFA 2QS2A 1MY4A 3KN8A 5F7VA 3VXBA 4I9DA 3TELA 1TT1A 3FBPA 1OIBA 3ILUB 5EQ8A 2QS3A 3IO6A 1Y1ZA 3K02A 1UQWA 3TCGA 4UACA 2LAOA 4JSDA 3PUYE 1MH3A 3T66A 3FD3A 5BWJA 1LSTA 4YKIA 2OWTA 3LC8A 3MP6A 4R75A 3BFUA 3DLNA 1IITA 4F3BA 2O84X 2PBWA 3N6UA 3QK6A 3OEMA 4YKJA 4ZE8A 1YAEA 1MY0A 1FTAA 2Y7PA 4MBPA 1DBZA 3K6UA 1PB7A 3U8QA 4RNSA 2XXTA 1QUJA 2OCUA 5CRYA 4HCYA 4JWXA 1TWYA 4JXIA 1PBPA 4H65A 2QS4A 2Q9TA 3VFJA 1DTZA 3JV9A 4LZ5A 3FXQA 1MDQA 4TQUQ 4HS7A 5EHSA 1PEBA 2UXAA 4PTKA 1LBCA 2REGA 3IB0A 4I8CA 3MZBA 1GVCA 4U23A 4HXVA 1NNFA 3FJ7A 5ELVA 5EQ7A 5EHMA 4MX6A 4RYAA 3QXMA 4GD5A 1B6HA 4LQ5A 1ZIUA 5KDTB 3LBSA 4P1LA 3KC1A 1FBPA 2XHDA 1LGBC 4NF0A 3A3UA 3G3KA 3O6GA 1D3KA 2I6EA 1MXUA 1NUYA 1Q1KA 2ONKE 5ET5A 1RYOA 2KQZA 3H7MA 4QSEA
chains in the Genus database with same CATH topology
1GTKA 3W9VA 2XD2A 4QF9A 1BIYA 2I48A 1WODA 3Q29A 1ATGA 3CG1A 2F7CA 3MZ9A 3PD9A 1B3EA 4FJPA 4G8NA 3VVFA 1AIVA 1OVBA 1TFAA 3OEKA 1MPBA 2AIXA 3FV2A 3FGSA 3TTRA 1FQBA 1FTMA 1ZTYA 2UYFA 3EQ1A 4U1OA 1FTKA 2O51A 3USDA 2FA7A 3FJMA 3N94A 4Q8RA 2DVZA 1QUIA 2Y7IA 1M5BA 4GRKA 3SDFA 5I2NA 2HAVA 5KDTA 4PP0A 4H5GA 4OZ9A 3U1OA 1CE2A 4F18A 5KDTB 2ALUA 3KBRA 4R6HA 4TLMB 3FVOA 2HZLA 2F7BA 1MXWA 1Y4CA 3MPLA 1VSOA 3W15C 5ISUA 2M8CA 3G3FA 1XHYA 2Z23A 3KJTA 3KN7A 3PUWE 3R26A 5H8HA 2O7IA 1MDP1 3HHGA 4NF8A 3IX1A 2G93A 4YAHX 1B3GA 2QPQA 4G77A 3TTLA 3D4GA 4IY6A 4AQ4A 3H3GA 1EU8A 3N6TA 2DSFA 2GHAA 2B65A 4X48A 2H25A 4LVQA 4GVOA 3RT8A 2XX9A 3ZKLA 3LR1A 4IO4A 5B7DA 2QRYA 1NNPA 3EHTA 1Y3PA 3W9WA 1HSLA 3O97A 3Q27A 1SYHA 1I69A 1MY2A 1YCJA 3DM0A 2D3IA 4G68A 4JWYA 4U4XA 1D4NA 4BDLA 4OENA 3PPPA 4NMYA 4JDFA 2RC7A 3TPAA 5AA4A 2Z8FA 1IIWA 3MVYA 5DT6A 2AYSA 4ZS9A 3KOSA 3RTWB 5ICTA 3SKPA 3DP6A 4XXUA 4OXVA 1LAXA 2HQ0A 4H6DA 1URDA 2RC8A 3R6UA 1A99A 1DTGA 1LFHA 2Y7WA 1ELJA 4AB5A 1MY3A 2R71A 4DLDA 2QJEA 1MQIA 3IAZA 2XX8A 2RF1A 3MVWA 1B1HA 1B52A 1EH3A 3DP4A 3TUSA 2DE4A 4YZZA 3SEUA 4NF4A 3PMXA 1SW2A 3VE1B 1USYE 3QYTA 3VXCA 4EDPA 3K6VA 4OFLA 1B7HA 2Z8DA 1OVTA 3ILTB 3IJOB 2ZNTA 1DPPA 1UTBB 1PB9A 1B4ZA 4RJZA 4YU0A 1IXCA 3EN3A 3VLVA 4PFYA 4DZ1A 3S2VA 3M8UA 2DYXA 4F2QA 3WAEA 4FAJA 2Q2CA 2VHAA 2ZYKA 3O9PA 4POWA 1JEUA 1ZBMA 3S9NC 1WDNA 1WVJA 3EPEA 1IZ1A 2XXUA 4XKPA 1LFGA 1QUKA 4LZ7A 3E3KA 4OFOA 5I58A 3RTFB 2O69A 2ZYNA 1AH5A 5A5XA 4YB5A 5L9SA 1SW4A 2Y7KA 3CIJA 1JVXA 1Y3NA 3IL1B 1A55A 2I0CA 3IO4A 1R9LA 2E0SA 2VP1A 1JW5A 3IB2A 2RCBA 3BKIB 1R9QA 2H5YA 3LUYA 3M3KA 1M5FA 4G68B 4NF6A 3G3GA 2NWJA 3TTMA 4BDRA 1JNFA 3FVGA 3G3JA 3IOVA 2ABHA 4L17A 4NE4A 4BDMA 1SI0A 4GXAA 4RA1A 1XVXA 1P1OA 1LCFA 1P1UA 5H8QA 1B0HA 4U22A 1EZ9A 3PMWA 5CBRA 4N6PA 3RY3A 1POY1 3PUVE 2RCAA 2DS9A 2X7PA 1MRPA 2CMOA 4NTLA 1AOVA 1LFIA 4DXBA 1MS7A 5AE4A 5H8NB 4JB7A 1IXGA 3TQWA 2VGQA 4E0XA 2DOJA 3I3VA 3TTKA 1B0LA 1B2HA 2DWIA 5H8FA 5CBSA 1EZOA 3FUZA 1MM7A 2HZKA 4F3PA 2D21A 2ZYMA 1VR5A 3KGCA 2NUVA 3HPIA 4ZDMA 4R72A 3SEXA 3K4UA 1MQHA 4NF6B 5AA1A 4F31B 1B5HA 2F8DA 4QFLA 4PQJA 1DMBA 3VVDA 2XXRA 1FW0A 3E4RA 1PC3A 4BDQA 4LA9A 5TP9B 3Q28A 3T96B 3LSFB 4O3AA 2ZNSA 2PMSA 5LOMA 4LATA 1B3LA 1YPNA 5H8QB 1SBPA 2PX1A 3HV1A 4C1UA 2XXVA 2O6AA 2VD2A 2ANJA 3IORA 4IO5A 1AMFA 5DVIA 5ITOA 4ECFA 4YMBA 5HPQA 4RK9A 1XC1A 1LAGE 3UIFA 2P0SA 3ECRA 4QRZA 4DCXA 1B46A 2HAUA 3L6GA 4WKMA 4GL0A 1SW1A 2DE2A 2GRVA 5DEXB 5H8NA 1XVYA 3MW0A 2NVUB 1T0KA 4ZZEA 3SERA 4F29A 1A54A 3LSXA 3SEWA 3UN6A 1ANFA 3B6QA 3M3FA 1UTHA 1QKAA 4MFIA 3PMVA 4XKRA 3VLWA 1IQ7A 1ZJLA 2F6PA 5CC2A 3K6WA 3OO9A 5K2XA 5TPAB 4X1BA 2DE3A 2H9BA 1FQDA 1DSNA 1GR2A 3AXFA 3H6VA 1N76A 1UIVA 2V84A 3MPKA 3G3HA 4R6KA 3SEYA 4C0RA 4GFRA 4FATA 4E0WA 2OZZA 2I0BA 2OK2A 1Q35A 5TP9A 1FCKA 3OSRA 4ZECA 5AA3A 3S9EA 1XS5A 4YB6A 3IOUA 3D4CA 3V83A 5H8FB 1LLSA 2DXYA 4YKPA 3TYHA 2KLFA 5I2KB 5AA4B 3S9MC 1US4A 5JK4A 1RKMA 1MM6A 4LUBA 4OEVA 2I58A 1DPEA 4O3BA 4R2BA 4ONYA 3QAXA 4LONB 3IOWA 4QFKA 4QFOA 5TU0A 3OOAA 5B70A 5JTYA 1EZPA 1QKBA 4ZEFA 4X1DA 2IA4A 4H8JA 3T9VA 3K1PA 3U93A 1QULA 4IGTA 5H8HB 2O7UA 2P1SA 2Q2AA 1LBBA 3KJ7A 2X26A 4GLIA 2O1MA 1JETA 4NF5A 4RK2A 4F19A 4QFNA 1FTOA 2X7QA 3FVNA 2ZMBA 3HO7A 3VDFA 3GBBA 4OETA 3HHFA 4PETA 3T9UA 1B58A 3QUFA 2Q8JA 2ONSA 2A5TB 4R9FA 4KYDA 4FE8A 2UVIA 2HFBA 3O29A 4G8MA 4Q30B 5L8DA 2R9JA 3O6HA 4KYEA 4LZ8A 4GWOA 1QVSA 2Z8EA 4KCCA 3RT6B 2AL4A 4N07A 3U92A 2F7AA 3CFLA 2DP8A 1XT8A 3C33A 3MBPA 4H8IA 3E9XA 1M5CA 3I6VA 3MVXA 1OQHA 4NWDA 2VD3A 1POTA 4GXSB 1ZMGA 4OWDA 3H06B 5TPAA 2F5XA 4BDOA 4F1UA 4O3CA 1MXYA 2UYEA 3I5OA 1JEVA 1JVYA 1LB9A 4MH5A 3E13X 1GV8A 4TOZA 1Z7ME 1NMUA 3UGWA 4ZEIA 1TFDA 2YJPA 1PDAA 1N0TA 3KEIA 1MXXA 4Z0IA 3KFMA 3T22A 3V89B 5KZTA 1MPDA 1URGA 2FYIA 3BBRA 3OO6A 5K2YA 1L5TA 3TQLA 3CR9A 3F11A 2V93A 4OVJA 2R6GE 2Y84A 2OWSA 3QSLA 4GF8A 1SD3A 5DYHA 4R6YA 3MP8A 2THIA 5M2VA 4EXLA 3RN8A 2V25A 4G68C 3K1MA 4IO2A 1LB8A 3T9HB 4P0GA 3HN0A 4M1VA 4ZEBA 2H4IA 4GOTA 4TLLB 4G4PA 1H44A 1MH4A 1M5EA 3V5AA 5L9MA 2QSXA 3HSTA 2XXWA 3N5LA 5HM4B 3MZ1A 4WEPA 3L6HA 4R9GA 2XXXA 2F6GA 4F22A 4OQOA 4RPNA 1FQFA 1B4HA 3KSJA 1MPCA 1N04A 4H67A 3VVEA 3N26A 3K1NA 2XX7A 4EQ7A 4N13A 1Y9UA 1SI1A 3ODBA 2G29A 4F3GA 1VFEA 1NNTA 2ONRA 1MQDA 4QHQA 5AA2B 3PUXE 1JW4A 2I4BA 1H45A 4KQPA 1BKAA 3P7IA 4XIGQ 1FTLA 3TTNA 3RQTA 2H99A 2O1LA 3M3LA 5IAIA 5JEIA 1M5DA 3JYRA 1S7YA 3PUZE 1CB6A 4PFWA 4XTCQ 3TKDA 2ZXTA 4EUOA 4F39A 2Y7RA 2OJTA 4ZE9A 5ITPA 1USYH 1P1QA 4F2OA 2BJJX 1P1WA 3FIRA 5FTIA 3IJXB 5FHOA 3MVZA 2PT1A 2XXPA 3PD8A 5KCJA 1OMPA 5H8SA 2VOZA 3FV1A 3CFXA 2QMWA 1MQJA 2PVUA 5L9OA 4NEDA 4U4SA 1DOTA 3B6WA 2GH9A 1O63A 4IY5A 3FXRA 2XXYA 1D9YA 3CRBA 4THIA 4RY1A 3IB1A 3ZSFA 1A8EA 3O2AA 5AA2A 3RLFE 2E1SA 2XD3A 2YLNA 1IXIA 1JW1A 4QSDA 4QSCA 1MXVA 4R2FA 4R74A 2DWAA 3T93B 3FVKA 1BP5A 1KWHA 1RYXA 1US5A 3TMGA 3MAMA 2Z22A 4ELRA 4PFUA 3CSBA 1LAHE 1FQCA 4ESXA 4ELPA 4PE5B 4U2RA 4I1DA 1N3XA 1URSA 3U72A 2DXRA 4EQ9A 1Y3QA 4M4GA 3CVGA 3LSWA 4OYVA 1B1XA 4Z7EA 2PT2A 3TEPA 1XOCA 2REJA 4FECA 5I56A 1ZLQA 2NXOA 2UVHA 4JSOA 2XXIA 3ONMA 3TAJA 1B40A 4XKNA 4F1YA 1SQYA 3OXNA 1A8FA 1S9TA 1UIUA 1QW0A 4ISUA 4AB6A 2RC9A 1B7UA 4QFPA 3UORA 3MUQA 3SETA 5I59B 3OMBA 3FZVA 3PV0E 5DEXA 3PPNA 2DQVA 5CI5A 1A40A 1H43A 3C32A 4Q0CA 4EF2A 4G2ZA 4WXJA 2F97A 1FQEA 3Q25A 1AL3A 1NNKA 4MF3A 2XXQA 4OERA 3T9XB 3KZGA 5EYFA 3PU5A 1J1NA 2GFEA 3B6TA 1I6QA 1P1NA 2UVJA 1SDXA 5FHMA 4DIGA 3B7DA 1B7ZA 2HXWA 1MY1A 3C36A 5J1DA 4K3FA 3LSLA 5FHNA 3UK4A 1Y20A 1B05A 2H98A 4ESWA 2DVCA 3TCHA 5CMBA 1VE4A 2OBGA 4YB7A 5I84A 1D9VA 2ZNUA 4KHZE 3SESA 4KPTA 4LP2B 3OENA 3PGFA 4DDDA 4YICA 3GZGA 3KN3A 1B51A 3GXAA 2QS2A 1ZU0A 1MY4A 1S50A 3HCQA 1B3HA 3KN8A 5F7VA 3VXBA 4I9DA 3TELA 1TT1A 1Y1MA 3TODA 4EF1A 3OD7A 3TCFA 1Y4TA 4OEUA 1FQAA 1I6BA 2OLBA 1OIBA 3ILUB 3IR1A 4KD5A 4MLVA 3C31A 2GHBA 4I62A 4NWCA 5F1QA 2NOOA 3TDJA 5I57B 3MWBA 4G8HA 2QS3A 3IOTA 3IO6A 1Y1ZA 4IB2A 3K02A 4NF8B 4BDNA 1UQWA 1N3WA 3KSXA 3RNNA 3TCGA 4DE8A 4UACA 2LAOA 3CI8A 4WEDA 4JSDA 3O6IA 3PUYE 4OMBA 4ZEKA 1MH3A 3K2DA 4FEDA 4H5FA 3T66A 3FASA 1Z7NE 2F35A 5HBCA 3FD3A 3EHSA 1H3DA 1LSTA 5BWJA 3OO7A 4YKIA 3VLUA 2OWTA 3RPWA 2DWJA 2RINA 3LC8A 3VV5A 3MP6A 2QMXA 1SW5A 4JBZA 3ZS6A 4KR5A 3PPQA 4R75A 3BFUA 1OLAA 1H76A 5BUUA 4DCYA 2CZLA 3DLNA 4OESA 4POXA 4HTGA 1LCTA 1B32A 2Q88A 5CMCA 4Q5TA 5I2NB 3S9LC 3H03A 4KYSA 1MXZA 1R6ZA 3MP1A 1IITA 2Q89A 3OO8A 2B3FA 4RPOA 2QS1A 2PYYA 4P11A 4U1ZA 1VFDA 3K0VA 4F3BA 3GBAA 2O84X 5I57A 1NKXA 3OELA 5I2KA 2PBWA 4IGRA 1PBQA 2P2AA 3C34A 3FXUA 3K00A 3N6UA 3QK6A 4FEBA 3OEMA 2HEUA 4X9TA 2I3VA 4NF4B 1OLCA 2F34A 3C35A 3PPOA 2UVGA 1YAEA 4YKJA 5DVJA 2QL3A 4ZE8A 2WKYA 4F1VA 1JQFA 2I49A 3RUMA 1MY0A 2Y7PA 3C9HA 2D5WA 2ESNA 4H0WA 2HCAA 4ELOA 4EQBA 2DWHA 4KCDA 3H6WA 2YPNA 4MBPA 4BLAA 5AA2D 2XXHA 1B5IA 3K6UA 1NH8A 1PB7A 3KG2A 3MC2A 4XKQA 3U8QA 3TFLA 1UTHB 4GQOA 3DP8A 4PFTA 3TZAA 2I4CA 4IO7A 4RNSA 2XXTA 4MLQA 2F78A 1QUJA 3MQ9A 5CMMA 2V3QA 3UA8A 2IEEA 2OCUA 4EXKA 1IEJA 3QIMA 4JWOA 5CRYA 4FIMA 5CM6A 2ZYOA 3O66A 4HCYA 1TWYA 4JWXA 4JXIA 1IXHA 1PBPA 4ND9A 4ZZAA 2A5SA 3GLBA 1IUDA 1B3FA 2QS4A 2Q9TA 3C4MA 3KOTA 4H65A 3VFJA 1TXFA 1DTZA 1NFTA 2V3TA 3EF7A 3JV9A 2RKMA 3FXQA 4KI0E 1FTJA 4LZ5A 5DVFA 3K6XA 4HW8A 1N7WA 5I58B 3CFZA 3CG3A 1MDQA 3H6UA 4TQUQ 4HS7A 5EHSA 1PEBA 2UXAA 4YMAA 5IKBA 1R1NA 5KCJB 1I6AA 1II5A 1A7LA 1LBCA 2A5TA 2REGA 3IB0A 1BLFA 2W7YA 4I8CA 5DTBA 3R7XA 3U94A 1SYIA 4YKKA 3MZBA 1GVCA 3S4UA 1UTBA 4U23A 1NNFA 4RXLA 3FJ7A 5ELVA 4U21A 5I56B 3G7WA 1HSEA 1P99A 3Q26A 2I3WA 5EHMA 4FORA 3RGYA 4NF5B 1HSJA 1B9JA 1MQGA 1F9BA 1N84A 1PB8A 4H1XA 2FNCA 3PPRA 3QXMA 4GD5A 1B6HA 4RYAA 5ICQA 4IO3A 1B5JA 4LQ5A 1ZIUA 1YTVA 4GL8A 5FTHA 3LBSA 4DXUA 1QJMA 2B3BA 1OQGA 4OTEA 5A5XB 5JTYB 3A3CA 3ZKKA 1NL5A 3K01A 3EHUA 4C1TA 4DXCA 3H6TA 4LQ2A 3DELB 2XHDA 2F36A 1BTJA 3A09A 2O68A 3H4ZA 3O28A 1LGBC 4OFJA 2AL5A 5CMKA 3A3UA 3G3KA 3BFTA 3O6GA 1D3KA 3UP9A 3WAFA 4UA8A 1GGGA 2I6EA 1N7XA 1MXUA 4GIZA 3IK6B 4R73A 1MG1A 1SVXB 1Q1KA 2V3UA 3FATA 2ONKE 4F3SA 5I59A 3JZJA 3MJNA 3QUJA 4OHNA 1RYOA 3G3IA 4IO6A 1O64A 3CSGA 4HCWA 4ZEDA 4P0IA 1ZKBA 3THIA 3H7MA 4QSEA 4KFQA 1LAFE 1NH7A 1O7TA 3FJGA 3SEVA 4ELQA 3V8XB 3OSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTK A;  3W9V A;  2XD2 A;  4QF9 A;  1BIY A;  2I48 A;  1WOD A;  3Q29 A;  1ATG A;  3CG1 A;  2F7C A;  3MZ9 A;  3PD9 A;  1B3E A;  4FJP A;  4G8N A;  3VVF A;  1AIV A;  1OVB A;  1TFA A;  3OEK A;  1MPB A;  2AIX A;  3FV2 A;  3FGS A;  3TTR A;  1FQB A;  1FTM A;  1ZTY A;  2UYF A;  3EQ1 A;  4U1O A;  1FTK A;  2O51 A;  3USD A;  2FA7 A;  3FJM A;  3N94 A;  4Q8R A;  2DVZ A;  1QUI A;  2Y7I A;  1M5B A;  4GRK A;  3SDF A;  5I2N A;  2HAV A;  5KDT A;  4PP0 A;  4H5G A;  4OZ9 A;  3U1O A;  1CE2 A;  4F18 A;  5KDT B;  2ALU A;  3KBR A;  4R6H A;  4TLM B;  3FVO A;  2HZL A;  2F7B A;  1MXW A;  1Y4C A;  3MPL A;  1VSO A;  3W15 C;  5ISU A;  2M8C A;  3G3F A;  1XHY A;  2Z23 A;  3KJT A;  3KN7 A;  3PUW E;  3R26 A;  5H8H A;  2O7I A;  1MDP 1;  3HHG A;  4NF8 A;  3IX1 A;  2G93 A;  4YAH X;  1B3G A;  2QPQ A;  4G77 A;  3TTL A;  3D4G A;  4IY6 A;  4AQ4 A;  3H3G A;  1EU8 A;  3N6T A;  2DSF A;  2GHA A;  2B65 A;  4X48 A;  2H25 A;  4LVQ A;  4GVO A;  3RT8 A;  2XX9 A;  3ZKL A;  3LR1 A;  4IO4 A;  5B7D A;  2QRY A;  1NNP A;  3EHT A;  1Y3P A;  3W9W A;  1HSL A;  3O97 A;  3Q27 A;  1SYH A;  1I69 A;  1MY2 A;  1YCJ A;  3DM0 A;  2D3I A;  4G68 A;  4JWY A;  4U4X A;  1D4N A;  4BDL A;  4OEN A;  3PPP A;  4NMY A;  4JDF A;  2RC7 A;  3TPA A;  5AA4 A;  2Z8F A;  1IIW A;  3MVY A;  5DT6 A;  2AYS A;  4ZS9 A;  3KOS A;  3RTW B;  5ICT A;  3SKP A;  3DP6 A;  4XXU A;  4OXV A;  1LAX A;  2HQ0 A;  4H6D A;  1URD A;  2RC8 A;  3R6U A;  1A99 A;  1DTG A;  1LFH A;  2Y7W A;  1ELJ A;  4AB5 A;  1MY3 A;  2R71 A;  4DLD A;  2QJE A;  1MQI A;  3IAZ A;  2XX8 A;  2RF1 A;  3MVW A;  1B1H A;  1B52 A;  1EH3 A;  3DP4 A;  3TUS A;  2DE4 A;  4YZZ A;  3SEU A;  4NF4 A;  3PMX A;  1SW2 A;  3VE1 B;  1USY E;  3QYT A;  3VXC A;  4EDP A;  3K6V A;  4OFL A;  1B7H A;  2Z8D A;  1OVT A;  3ILT B;  3IJO B;  2ZNT A;  1DPP A;  1UTB B;  1PB9 A;  1B4Z A;  4RJZ A;  4YU0 A;  1IXC A;  3EN3 A;  3VLV A;  4PFY A;  4DZ1 A;  3S2V A;  3M8U A;  2DYX A;  4F2Q A;  3WAE A;  4FAJ A;  2Q2C A;  2VHA A;  2ZYK A;  3O9P A;  4POW A;  1JEU A;  1ZBM A;  3S9N C;  1WDN A;  1WVJ A;  3EPE A;  1IZ1 A;  2XXU A;  4XKP A;  1LFG A;  1QUK A;  4LZ7 A;  3E3K A;  4OFO A;  5I58 A;  3RTF B;  2O69 A;  2ZYN A;  1AH5 A;  5A5X A;  4YB5 A;  5L9S A;  1SW4 A;  2Y7K A;  3CIJ A;  1JVX A;  1Y3N A;  3IL1 B;  1A55 A;  2I0C A;  3IO4 A;  1R9L A;  2E0S A;  2VP1 A;  1JW5 A;  3IB2 A;  2RCB A;  3BKI B;  1R9Q A;  2H5Y A;  3LUY A;  3M3K A;  1M5F A;  4G68 B;  4NF6 A;  3G3G A;  2NWJ A;  3TTM A;  4BDR A;  1JNF A;  3FVG A;  3G3J A;  3IOV A;  2ABH A;  4L17 A;  4NE4 A;  4BDM A;  1SI0 A;  4GXA A;  4RA1 A;  1XVX A;  1P1O A;  1LCF A;  1P1U A;  5H8Q A;  1B0H A;  4U22 A;  1EZ9 A;  3PMW A;  5CBR A;  4N6P A;  3RY3 A;  1POY 1;  3PUV E;  2RCA A;  2DS9 A;  2X7P A;  1MRP A;  2CMO A;  4NTL A;  1AOV A;  1LFI A;  4DXB A;  1MS7 A;  5AE4 A;  5H8N B;  4JB7 A;  1IXG A;  3TQW A;  2VGQ A;  4E0X A;  2DOJ A;  3I3V A;  3TTK A;  1B0L A;  1B2H A;  2DWI A;  5H8F A;  5CBS A;  1EZO A;  3FUZ A;  1MM7 A;  2HZK A;  4F3P A;  2D21 A;  2ZYM A;  1VR5 A;  3KGC A;  2NUV A;  3HPI A;  4ZDM A;  4R72 A;  3SEX A;  3K4U A;  1MQH A;  4NF6 B;  5AA1 A;  4F31 B;  1B5H A;  2F8D A;  4QFL A;  4PQJ A;  1DMB A;  3VVD A;  2XXR A;  1FW0 A;  3E4R A;  1PC3 A;  4BDQ A;  4LA9 A;  5TP9 B;  3Q28 A;  3T96 B;  3LSF B;  4O3A A;  2ZNS A;  2PMS A;  5LOM A;  4LAT A;  1B3L A;  1YPN A;  5H8Q B;  1SBP A;  2PX1 A;  3HV1 A;  4C1U A;  2XXV A;  2O6A A;  2VD2 A;  2ANJ A;  3IOR A;  4IO5 A;  1AMF A;  5DVI A;  5ITO A;  4ECF A;  4YMB A;  5HPQ A;  4RK9 A;  1XC1 A;  1LAG E;  3UIF A;  2P0S A;  3ECR A;  4QRZ A;  4DCX A;  1B46 A;  2HAU A;  3L6G A;  4WKM A;  4GL0 A;  1SW1 A;  2DE2 A;  2GRV A;  5DEX B;  5H8N A;  1XVY A;  3MW0 A;  2NVU B;  1T0K A;  4ZZE A;  3SER A;  4F29 A;  1A54 A;  3LSX A;  3SEW A;  3UN6 A;  1ANF A;  3B6Q A;  3M3F A;  1UTH A;  1QKA A;  4MFI A;  3PMV A;  4XKR A;  3VLW A;  1IQ7 A;  1ZJL A;  2F6P A;  5CC2 A;  3K6W A;  3OO9 A;  5K2X A;  5TPA B;  4X1B A;  2DE3 A;  2H9B A;  1FQD A;  1DSN A;  1GR2 A;  3AXF A;  3H6V A;  1N76 A;  1UIV A;  2V84 A;  3MPK A;  3G3H A;  4R6K A;  3SEY A;  4C0R A;  4GFR A;  4FAT A;  4E0W A;  2OZZ A;  2I0B A;  2OK2 A;  1Q35 A;  5TP9 A;  1FCK A;  3OSR A;  4ZEC A;  5AA3 A;  3S9E A;  1XS5 A;  4YB6 A;  3IOU A;  3D4C A;  3V83 A;  5H8F B;  1LLS A;  2DXY A;  4YKP A;  3TYH A;  2KLF A;  5I2K B;  5AA4 B;  3S9M C;  1US4 A;  5JK4 A;  1RKM A;  1MM6 A;  4LUB A;  4OEV A;  2I58 A;  1DPE A;  4O3B A;  4R2B A;  4ONY A;  3QAX A;  4LON B;  3IOW A;  4QFK A;  4QFO A;  5TU0 A;  3OOA A;  5B70 A;  5JTY A;  1EZP A;  1QKB A;  4ZEF A;  4X1D A;  2IA4 A;  4H8J A;  3T9V A;  3K1P A;  3U93 A;  1QUL A;  4IGT A;  5H8H B;  2O7U A;  2P1S A;  2Q2A A;  1LBB A;  3KJ7 A;  2X26 A;  4GLI A;  2O1M A;  1JET A;  4NF5 A;  4RK2 A;  4F19 A;  4QFN A;  1FTO A;  2X7Q A;  3FVN A;  2ZMB A;  3HO7 A;  3VDF A;  3GBB A;  4OET A;  3HHF A;  4PET A;  3T9U A;  1B58 A;  3QUF A;  2Q8J A;  2ONS A;  2A5T B;  4R9F A;  4KYD A;  4FE8 A;  2UVI A;  2HFB A;  3O29 A;  4G8M A;  4Q30 B;  5L8D A;  2R9J A;  3O6H A;  4KYE A;  4LZ8 A;  4GWO A;  1QVS A;  2Z8E A;  4KCC A;  3RT6 B;  2AL4 A;  4N07 A;  3U92 A;  2F7A A;  3CFL A;  2DP8 A;  1XT8 A;  3C33 A;  3MBP A;  4H8I A;  3E9X A;  1M5C A;  3I6V A;  3MVX A;  1OQH A;  4NWD A;  2VD3 A;  1POT A;  4GXS B;  1ZMG A;  4OWD A;  3H06 B;  5TPA A;  2F5X A;  4BDO A;  4F1U A;  4O3C A;  1MXY A;  2UYE A;  3I5O A;  1JEV A;  1JVY A;  1LB9 A;  4MH5 A;  3E13 X;  1GV8 A;  4TOZ A;  1Z7M E;  1NMU A;  3UGW A;  4ZEI A;  1TFD A;  2YJP A;  1PDA A;  1N0T A;  3KEI A;  1MXX A;  4Z0I A;  3KFM A;  3T22 A;  3V89 B;  5KZT A;  1MPD A;  1URG A;  2FYI A;  3BBR A;  3OO6 A;  5K2Y A;  1L5T A;  3TQL A;  3CR9 A;  3F11 A;  2V93 A;  4OVJ A;  2R6G E;  2Y84 A;  2OWS A;  3QSL A;  4GF8 A;  1SD3 A;  5DYH A;  4R6Y A;  3MP8 A;  2THI A;  5M2V A;  4EXL A;  3RN8 A;  2V25 A;  4G68 C;  3K1M A;  4IO2 A;  1LB8 A;  3T9H B;  4P0G A;  3HN0 A;  4M1V A;  4ZEB A;  2H4I A;  4GOT A;  4TLL B;  4G4P A;  1H44 A;  1MH4 A;  1M5E A;  3V5A A;  5L9M A;  2QSX A;  3HST A;  2XXW A;  3N5L A;  5HM4 B;  3MZ1 A;  4WEP A;  3L6H A;  4R9G A;  2XXX A;  2F6G A;  4F22 A;  4OQO A;  4RPN A;  1FQF A;  1B4H A;  3KSJ A;  1MPC A;  1N04 A;  4H67 A;  3VVE A;  3N26 A;  3K1N A;  2XX7 A;  4EQ7 A;  4N13 A;  1Y9U A;  1SI1 A;  3ODB A;  2G29 A;  4F3G A;  1VFE A;  1NNT A;  2ONR A;  1MQD A;  4QHQ A;  5AA2 B;  3PUX E;  1JW4 A;  2I4B A;  1H45 A;  4KQP A;  1BKA A;  3P7I A;  4XIG Q;  1FTL A;  3TTN A;  3RQT A;  2H99 A;  2O1L A;  3M3L A;  5IAI A;  5JEI A;  1M5D A;  3JYR A;  1S7Y A;  3PUZ E;  1CB6 A;  4PFW A;  4XTC Q;  3TKD A;  2ZXT A;  4EUO A;  4F39 A;  2Y7R A;  2OJT A;  4ZE9 A;  5ITP A;  1USY H;  1P1Q A;  4F2O A;  2BJJ X;  1P1W A;  3FIR A;  5FTI A;  3IJX B;  5FHO A;  3MVZ A;  2PT1 A;  2XXP A;  3PD8 A;  5KCJ A;  1OMP A;  5H8S A;  2VOZ A;  3FV1 A;  3CFX A;  2QMW A;  1MQJ A;  2PVU A;  5L9O A;  4NED A;  4U4S A;  1DOT A;  3B6W A;  2GH9 A;  1O63 A;  4IY5 A;  3FXR A;  2XXY A;  1D9Y A;  3CRB A;  4THI A;  4RY1 A;  3IB1 A;  3ZSF A;  1A8E A;  3O2A A;  5AA2 A;  3RLF E;  2E1S A;  2XD3 A;  2YLN A;  1IXI A;  1JW1 A;  4QSD A;  4QSC A;  1MXV A;  4R2F A;  4R74 A;  2DWA A;  3T93 B;  3FVK A;  1BP5 A;  1KWH A;  1RYX A;  1US5 A;  3TMG A;  3MAM A;  2Z22 A;  4ELR A;  4PFU A;  3CSB A;  1LAH E;  1FQC A;  4ESX A;  4ELP A;  4PE5 B;  4U2R A;  4I1D A;  1N3X A;  1URS A;  3U72 A;  2DXR A;  4EQ9 A;  1Y3Q A;  4M4G A;  3CVG A;  3LSW A;  4OYV A;  1B1X A;  4Z7E A;  2PT2 A;  3TEP A;  1XOC A;  2REJ A;  4FEC A;  5I56 A;  1ZLQ A;  2NXO A;  2UVH A;  4JSO A;  2XXI A;  3ONM A;  3TAJ A;  1B40 A;  4XKN A;  4F1Y A;  1SQY A;  3OXN A;  1A8F A;  1S9T A;  1UIU A;  1QW0 A;  4ISU A;  4AB6 A;  2RC9 A;  1B7U A;  4QFP A;  3UOR A;  3MUQ A;  3SET A;  5I59 B;  3OMB A;  3FZV A;  3PV0 E;  5DEX A;  3PPN A;  2DQV A;  5CI5 A;  1A40 A;  1H43 A;  3C32 A;  4Q0C A;  4EF2 A;  4G2Z A;  4WXJ A;  2F97 A;  1FQE A;  3Q25 A;  1AL3 A;  1NNK A;  4MF3 A;  2XXQ A;  4OER A;  3T9X B;  3KZG A;  5EYF A;  3PU5 A;  1J1N A;  2GFE A;  3B6T A;  1I6Q A;  1P1N A;  2UVJ A;  1SDX A;  5FHM A;  4DIG A;  3B7D A;  1B7Z A;  2HXW A;  1MY1 A;  3C36 A;  5J1D A;  4K3F A;  3LSL A;  5FHN A;  3UK4 A;  1Y20 A;  1B05 A;  2H98 A;  4ESW A;  2DVC A;  3TCH A;  5CMB A;  1VE4 A;  2OBG A;  4YB7 A;  5I84 A;  1D9V A;  2ZNU A;  4KHZ E;  3SES A;  4KPT A;  4LP2 B;  3OEN A;  3PGF A;  4DDD A;  4YIC A;  3GZG A;  3KN3 A;  1B51 A;  3GXA A;  2QS2 A;  1ZU0 A;  1MY4 A;  1S50 A;  3HCQ A;  1B3H A;  3KN8 A;  5F7V A;  3VXB A;  4I9D A;  3TEL A;  1TT1 A;  1Y1M A;  3TOD A;  4EF1 A;  3OD7 A;  3TCF A;  1Y4T A;  4OEU A;  1FQA A;  1I6B A;  2OLB A;  1OIB A;  3ILU B;  3IR1 A;  4KD5 A;  4MLV A;  3C31 A;  2GHB A;  4I62 A;  4NWC A;  5F1Q A;  2NOO A;  3TDJ A;  5I57 B;  3MWB A;  4G8H A;  2QS3 A;  3IOT A;  3IO6 A;  1Y1Z A;  4IB2 A;  3K02 A;  4NF8 B;  4BDN A;  1UQW A;  1N3W A;  3KSX A;  3RNN A;  3TCG A;  4DE8 A;  4UAC A;  2LAO A;  3CI8 A;  4WED A;  4JSD A;  3O6I A;  3PUY E;  4OMB A;  4ZEK A;  1MH3 A;  3K2D A;  4FED A;  4H5F A;  3T66 A;  3FAS A;  1Z7N E;  2F35 A;  5HBC A;  3FD3 A;  3EHS A;  1H3D A;  1LST A;  5BWJ A;  3OO7 A;  4YKI A;  3VLU A;  2OWT A;  3RPW A;  2DWJ A;  2RIN A;  3LC8 A;  3VV5 A;  3MP6 A;  2QMX A;  1SW5 A;  4JBZ A;  3ZS6 A;  4KR5 A;  3PPQ A;  4R75 A;  3BFU A;  1OLA A;  1H76 A;  5BUU A;  4DCY A;  2CZL A;  3DLN A;  4OES A;  4POX A;  4HTG A;  1LCT A;  1B32 A;  2Q88 A;  5CMC A;  4Q5T A;  5I2N B;  3S9L C;  3H03 A;  4KYS A;  1MXZ A;  1R6Z A;  3MP1 A;  1IIT A;  2Q89 A;  3OO8 A;  2B3F A;  4RPO A;  2QS1 A;  2PYY A;  4P11 A;  4U1Z A;  1VFD A;  3K0V A;  4F3B A;  3GBA A;  2O84 X;  5I57 A;  1NKX A;  3OEL A;  5I2K A;  2PBW A;  4IGR A;  1PBQ A;  2P2A A;  3C34 A;  3FXU A;  3K00 A;  3N6U A;  3QK6 A;  4FEB A;  3OEM A;  2HEU A;  4X9T A;  2I3V A;  4NF4 B;  1OLC A;  2F34 A;  3C35 A;  3PPO A;  2UVG A;  1YAE A;  4YKJ A;  5DVJ A;  2QL3 A;  4ZE8 A;  2WKY A;  4F1V A;  1JQF A;  2I49 A;  3RUM A;  1MY0 A;  2Y7P A;  3C9H A;  2D5W A;  2ESN A;  4H0W A;  2HCA A;  4ELO A;  4EQB A;  2DWH A;  4KCD A;  3H6W A;  2YPN A;  4MBP A;  4BLA A;  5AA2 D;  2XXH A;  1B5I A;  3K6U A;  1NH8 A;  1PB7 A;  3KG2 A;  3MC2 A;  4XKQ A;  3U8Q A;  3TFL A;  1UTH B;  4GQO A;  3DP8 A;  4PFT A;  3TZA A;  2I4C A;  4IO7 A;  4RNS A;  2XXT A;  4MLQ A;  2F78 A;  1QUJ A;  3MQ9 A;  5CMM A;  2V3Q A;  3UA8 A;  2IEE A;  2OCU A;  4EXK A;  1IEJ A;  3QIM A;  4JWO A;  5CRY A;  4FIM A;  5CM6 A;  2ZYO A;  3O66 A;  4HCY A;  1TWY A;  4JWX A;  4JXI A;  1IXH A;  1PBP A;  4ND9 A;  4ZZA A;  2A5S A;  3GLB A;  1IUD A;  1B3F A;  2QS4 A;  2Q9T A;  3C4M A;  3KOT A;  4H65 A;  3VFJ A;  1TXF A;  1DTZ A;  1NFT A;  2V3T A;  3EF7 A;  3JV9 A;  2RKM A;  3FXQ A;  4KI0 E;  1FTJ A;  4LZ5 A;  5DVF A;  3K6X A;  4HW8 A;  1N7W A;  5I58 B;  3CFZ A;  3CG3 A;  1MDQ A;  3H6U A;  4TQU Q;  4HS7 A;  5EHS A;  1PEB A;  2UXA A;  4YMA A;  5IKB A;  1R1N A;  5KCJ B;  1I6A A;  1II5 A;  1A7L A;  1LBC A;  2A5T A;  2REG A;  3IB0 A;  1BLF A;  2W7Y A;  4I8C A;  5DTB A;  3R7X A;  3U94 A;  1SYI A;  4YKK A;  3MZB A;  1GVC A;  3S4U A;  1UTB A;  4U23 A;  1NNF A;  4RXL A;  3FJ7 A;  5ELV A;  4U21 A;  5I56 B;  3G7W A;  1HSE A;  1P99 A;  3Q26 A;  2I3W A;  5EHM A;  4FOR A;  3RGY A;  4NF5 B;  1HSJ A;  1B9J A;  1MQG A;  1F9B A;  1N84 A;  1PB8 A;  4H1X A;  2FNC A;  3PPR A;  3QXM A;  4GD5 A;  1B6H A;  4RYA A;  5ICQ A;  4IO3 A;  1B5J A;  4LQ5 A;  1ZIU A;  1YTV A;  4GL8 A;  5FTH A;  3LBS A;  4DXU A;  1QJM A;  2B3B A;  1OQG A;  4OTE A;  5A5X B;  5JTY B;  3A3C A;  3ZKK A;  1NL5 A;  3K01 A;  3EHU A;  4C1T A;  4DXC A;  3H6T A;  4LQ2 A;  3DEL B;  2XHD A;  2F36 A;  1BTJ A;  3A09 A;  2O68 A;  3H4Z A;  3O28 A;  1LGB C;  4OFJ A;  2AL5 A;  5CMK A;  3A3U A;  3G3K A;  3BFT A;  3O6G A;  1D3K A;  3UP9 A;  3WAF A;  4UA8 A;  1GGG A;  2I6E A;  1N7X A;  1MXU A;  4GIZ A;  3IK6 B;  4R73 A;  1MG1 A;  1SVX B;  1Q1K A;  2V3U A;  3FAT A;  2ONK E;  4F3S A;  5I59 A;  3JZJ A;  3MJN A;  3QUJ A;  4OHN A;  1RYO A;  3G3I A;  4IO6 A;  1O64 A;  3CSG A;  4HCW A;  4ZED A;  4P0I A;  1ZKB A;  3THI A;  3H7M A;  4QSE A;  4KFQ A;  1LAF E;  1NH7 A;  1O7T A;  3FJG A;  3SEV A;  4ELQ A;  3V8X B;  3OSQ A; 
#chains in the Genus database with same CATH topology
 1GTK A;  3E78 A;  1WOD A;  2CZK A;  2F7C A;  1B3E A;  3VVF A;  1OVB A;  1TFA A;  1D9Q A;  4N8G A;  3FJM A;  4Q8R A;  2DVZ A;  4MMP A;  1M5B A;  1NI9 A;  1VSO A;  5ISU A;  2M8C A;  3PUW E;  1KA1 A;  3R26 A;  3HHG A;  3IX1 A;  1B3G A;  1SPI A;  2DSF A;  4LVQ A;  3RT8 A;  4GVO A;  3ZKL A;  4MNI A;  1NNP A;  3EHT A;  1SYH A;  4G68 A;  4U4X A;  5IZZ A;  1AWB A;  4NMY A;  3TPA A;  1LBV A;  5AA4 A;  1IIW A;  4ZS9 A;  2B4M A;  2HQ0 A;  4H6D A;  2RC8 A;  1LFH A;  1ELJ A;  1MY3 A;  2R71 A;  1MQI A;  3IAZ A;  2XX8 A;  2RF1 A;  3VE1 B;  3PMX A;  1EYI A;  3VXC A;  4P56 A;  4QBA A;  4RJZ A;  3MST A;  3EN3 A;  1EYJ A;  4PFY A;  3M8U A;  3WAE A;  4FAJ A;  2VHA A;  1JEU A;  1ZBM A;  5I58 A;  1LFG A;  3E3K A;  3RTF B;  1AH5 A;  1A55 A;  3M3K A;  3BKI B;  4NF6 A;  3TTM A;  5IAI A;  4YMB A;  3FVG A;  1EZ9 A;  5CBR A;  4JVD A;  3RY3 A;  2DS9 A;  1MRP A;  2F3D A;  5AE4 A;  5H8N B;  1IXG A;  3I3V A;  2XWK A;  1B0L A;  3FUZ A;  2D21 A;  2NUV A;  3SEX A;  3K4U A;  4OAN A;  1B5H A;  3ROJ A;  4MJO A;  1FW0 A;  4BDQ A;  3T96 B;  5LOM A;  3HV1 A;  3ECR A;  2GRV A;  5DEX B;  2NVU B;  1A54 A;  3SEW A;  3PMV A;  4XKR A;  5I7I A;  2F6P A;  2DDK A;  5TPA B;  4X1B A;  4O7M A;  1RDX A;  1FQD A;  3MPK A;  1GR2 A;  3AXF A;  3H6V A;  4R6K A;  2I0B A;  2OK2 A;  5EQ9 A;  4X8R A;  5H8F B;  1LLS A;  2CZH A;  4PFB A;  5AA4 B;  4N8Y A;  4MHF A;  4OEV A;  1DPE A;  4X1D A;  4NF5 A;  2ZMB A;  3HO7 A;  3T9U A;  3HHF A;  2HFB A;  5L8D A;  4GWO A;  4KCC A;  2Z8E A;  2AL4 A;  4XEQ A;  4N07 A;  2F7A A;  1OQH A;  1POT A;  3H06 B;  1JEV A;  4MH5 A;  3E13 X;  4ZEI A;  4E0W A;  1N0T A;  3KFM A;  3V89 B;  3BBR A;  1URG A;  5A5L A;  3F11 A;  2V93 A;  4GF8 A;  3U65 A;  4R6Y A;  2H4I A;  4GOT A;  4TLL B;  4G4P A;  1H44 A;  1MH4 A;  1M5E A;  2V4C A;  2QSX A;  3HST A;  5HM4 B;  4R9G A;  2F6G A;  4OQO A;  4H67 A;  1MPC A;  1N04 A;  4EXK A;  2XX7 A;  2VPO A;  1NNT A;  2ONR A;  4QHQ A;  1FTL A;  5JEI A;  2XWO A;  3PUZ E;  4PFW A;  4XTC Q;  2Y7R A;  2OJT A;  1P1W A;  3FIR A;  2XXP A;  3PD8 A;  5KCJ A;  5H8S A;  3CFX A;  2PVU A;  5L9O A;  1DOT A;  2XXY A;  1D9Y A;  3CRB A;  2CEX A;  2HHM A;  3IB1 A;  4NG7 A;  4QSD A;  4R2F A;  3T93 B;  1DK4 A;  2DWA A;  3TMG A;  4PFU A;  4O8M A;  4ELP A;  4U2R A;  4I1D A;  1FBE A;  3LSW A;  2NXO A;  4JSO A;  4F1Y A;  3ONM A;  4ISU A;  2QFL A;  1B7U A;  4QFP A;  5I59 B;  3OMB A;  3FZV A;  1A40 A;  4GWS A;  2FBP A;  4G2Z A;  1FQE A;  3Q25 A;  4DI4 B;  4GX6 A;  4N6D A;  2GFE A;  1I6Q A;  1MY1 A;  4PAF A;  4ESW A;  2DVC A;  2ZNU A;  3EKI A;  3OEN A;  3GXA A;  3HCQ A;  1S50 A;  4JVC A;  1Y1M A;  4EF1 A;  4OEU A;  3IR1 A;  4KD5 A;  4NWC A;  2NOO A;  3MWB A;  4G8H A;  4NF8 B;  4NQ8 A;  4WED A;  4OMB A;  4ZEK A;  4H5F A;  4P47 A;  4N81 A;  1Z7N E;  2F35 A;  3VLU A;  3RPW A;  2RIN A;  2QMX A;  2MKZ A;  3PPQ A;  4POX A;  4HTG A;  1LCT A;  1B32 A;  5CMC A;  4Q5T A;  4KYS A;  2Q89 A;  3OO8 A;  2B3F A;  1VFD A;  3OEL A;  5I2K A;  4IGR A;  3C34 A;  3FXU A;  2HEU A;  2I3V A;  4F1V A;  2UVG A;  1JQF A;  1NV3 A;  2D5W A;  4EQB A;  2HCA A;  2DWH A;  3H6W A;  2YPN A;  2XXH A;  3MC2 A;  2PFZ A;  2ZZX A;  3TFL A;  1UTH B;  4GQO A;  3TZA A;  5DW8 A;  2I4C A;  4IO7 A;  3UA8 A;  2IEE A;  4FBP A;  3O66 A;  4ZZA A;  3KOT A;  1B3F A;  3C4M A;  1JP4 A;  4AS5 A;  1TXF A;  3EF7 A;  4HW8 A;  1FTJ A;  5DVF A;  1N7W A;  5I58 B;  3CG3 A;  5IKB A;  2A5T A;  4U21 A;  3Q26 A;  4FOR A;  4NF5 B;  1HSJ A;  1B9J A;  1MQG A;  1PB8 A;  4H1X A;  4H46 A;  4IO3 A;  1OQG A;  3ZKK A;  1NV1 A;  3EHU A;  4DXC A;  3H6T A;  2XA5 A;  3DEL B;  4GBW A;  4OFJ A;  1MG1 A;  1SVX B;  3FAT A;  5I59 A;  4F3S A;  3JZJ A;  3MJN A;  4OHN A;  3G3I A;  4HCW A;  4NAP A;  1O7T A;  3V8X B;  3OSQ A;  4QF9 A;  1BIY A;  1ATG A;  3PD9 A;  4FJP A;  2AIX A;  4N15 A;  2UYF A;  4U1O A;  2FVZ A;  2O51 A;  2FA7 A;  3N94 A;  3SDF A;  2Y7I A;  4GRK A;  3BIG A;  4PP0 A;  3U1O A;  4OZ9 A;  4F18 A;  4HE0 A;  2R8T A;  2ALU A;  3KBR A;  1IMB A;  3FVO A;  1MXW A;  3MPL A;  4P3L A;  3G3F A;  2Z23 A;  1FJ6 A;  5H8H A;  2O7I A;  1MDP 1;  3CHG A;  4NF8 A;  3TTL A;  4IY6 A;  1EU8 A;  3N6T A;  2B65 A;  2QRY A;  1YCJ A;  4JWY A;  1D4N A;  4OEN A;  4OVT A;  2Q8M A;  1BK4 A;  1K9Z A;  2Z8F A;  3RTW B;  3KOS A;  4PCD A;  4OXV A;  1LAX A;  1URD A;  3R6U A;  1A99 A;  1NUX A;  1B52 A;  2DE4 A;  1USY E;  2ZNT A;  4GWZ A;  3VLV A;  4F2Q A;  4GWX A;  3O9P A;  1WVJ A;  1IZ1 A;  4OFO A;  5A5X A;  4YB5 A;  1JVX A;  1Y3N A;  3IL1 B;  4QFN A;  2E0S A;  4N91 A;  2H5Y A;  3LUY A;  2NWJ A;  4BDR A;  1JNF A;  4NE4 A;  1P1O A;  4OVR A;  1B0H A;  4U22 A;  1IMF A;  1NV6 A;  3PMW A;  4N6P A;  3PUV E;  2CMO A;  1FBF A;  5LTC A;  1AOV A;  4E0X A;  3TTK A;  2WX9 A;  3ISP A;  4MNP A;  5H8F A;  5CBS A;  1EZO A;  2HZK A;  2ZYM A;  3KGC A;  3HPI A;  4XF5 A;  4QXD A;  1MQH A;  5AA1 A;  2F8D A;  1INP A;  4PQJ A;  1DMB A;  2XXR A;  3E4R A;  1PC3 A;  4LA9 A;  3LSF B;  1YPN A;  5H8Q B;  1SBP A;  2PX1 A;  4P1E A;  2XXV A;  3IOR A;  2VD2 A;  4IO5 A;  5HPQ A;  1LAG E;  2P0S A;  2HAU A;  4GL0 A;  1SW1 A;  1XVY A;  1T0K A;  3SER A;  3LSX A;  3VLW A;  3M3F A;  1IQ7 A;  3FXB A;  5K2X A;  2DE3 A;  4RA1 A;  1DSN A;  1FPJ A;  1QGX A;  1N76 A;  4C0R A;  4GFR A;  4MIJ A;  1DCU A;  1Q35 A;  4YB6 A;  4YKP A;  3S9M C;  1MM6 A;  4O3B A;  4QFO A;  5TU0 A;  2F3B A;  3U93 A;  4IGT A;  2O7U A;  2Q2A A;  4RK2 A;  2X26 A;  4F19 A;  2O1M A;  2X7Q A;  3FVN A;  4OET A;  4PET A;  5IM2 A;  4G8M A;  3O29 A;  3O6H A;  3RT6 B;  3CFL A;  1XT8 A;  3I6V A;  4MAG A;  4GXS B;  1ZMG A;  4BDO A;  4O3C A;  1MXY A;  3I5O A;  1GV8 A;  4TOZ A;  4Z0I A;  1PDA A;  3OO6 A;  3TQL A;  3CR9 A;  4GWU A;  2QVR A;  4OVJ A;  2Y84 A;  2OWS A;  1SD3 A;  5T3J A;  3MP8 A;  5M2V A;  4G68 C;  4PF6 A;  3K1M A;  1LB8 A;  4P0G A;  4M1V A;  5L9M A;  4RPN A;  1FQF A;  3N26 A;  3K1N A;  1SI1 A;  5AA2 B;  2G29 A;  1MQD A;  3TTN A;  3RQT A;  2H99 A;  1S7Y A;  3TKD A;  3D1R A;  1P1Q A;  1EYK A;  1FPG A;  4NED A;  3B6W A;  2GH9 A;  1A8E A;  5AA2 A;  3RLF E;  2YLN A;  4R74 A;  1BP5 A;  1KWH A;  1RYX A;  3SZP A;  3MAM A;  3CSB A;  1LAH E;  3U72 A;  4EQ9 A;  1Y3Q A;  3CVG A;  3TEP A;  5I56 A;  1B40 A;  3OXN A;  2RC9 A;  3UOR A;  2DQV A;  5CI5 A;  3C32 A;  1FBG A;  2F97 A;  5EYF A;  4GBV A;  4I3Y A;  3PU5 A;  1J1N A;  3B6T A;  1IMC A;  4DIG A;  4OVQ A;  4K3F A;  3LSL A;  5FHN A;  3UK4 A;  1VE4 A;  2OBG A;  1D9V A;  2HXR A;  4LP2 B;  4DDD A;  4YIC A;  3KN3 A;  1B51 A;  5I5P A;  4AS4 A;  3TOD A;  3OD7 A;  3TCF A;  2B4L A;  1I6B A;  5I57 B;  4IB2 A;  3IOT A;  5I84 A;  1N3W A;  3RNN A;  4OVP A;  3EHS A;  4N4U A;  4N17 A;  3VV5 A;  4O94 A;  4JBZ A;  3ZS6 A;  4KR5 A;  1OLA A;  2Q88 A;  2P3V A;  1RDZ A;  1FBH A;  1MXZ A;  1FSA A;  4RPO A;  2QS1 A;  1FBC A;  3GBA A;  5I57 A;  1NKX A;  1PBQ A;  2P2A A;  4FEB A;  4X9T A;  4LN5 A;  1LBX A;  3C35 A;  3PPO A;  3QMF A;  2I49 A;  4KCD A;  5AA2 D;  1NH8 A;  2F78 A;  3MQ9 A;  5CMM A;  4NN3 A;  1IEJ A;  4JWO A;  5CM6 A;  4ND9 A;  1IXH A;  2XXK A;  5BUU A;  2L5V A;  3IFA A;  3E79 A;  2V3T A;  2RKM A;  3H6U A;  2VT5 A;  4YMA A;  1II5 A;  1A7L A;  3U94 A;  2W7Y A;  3R7X A;  4YKK A;  4RXL A;  3A29 A;  3RGY A;  1F9B A;  1N84 A;  3PPR A;  5IGA A;  4GL8 A;  5FTH A;  4OTE A;  2B3B A;  4P8B A;  5JTY B;  3A3C A;  1NL5 A;  3K01 A;  3A09 A;  2O68 A;  3H4Z A;  3WAF A;  1GGG A;  4R73 A;  3IK6 B;  3LUZ A;  4IO6 A;  1O64 A;  3CSG A;  4P0I A;  3THI A;  4ELQ A;  3Q29 A;  3MZ9 A;  2WBD A;  1AIV A;  3OEK A;  3FV2 A;  3TTR A;  3EQ1 A;  1ZTY A;  3RPL B;  1FTK A;  4NGU A;  3USD A;  1QUI A;  2HAV A;  2F7B A;  3W15 C;  3KJT A;  4YAH X;  2G93 A;  4G77 A;  3D4G A;  4AQ4 A;  3LR1 A;  4IO4 A;  5B7D A;  3W9W A;  1HSL A;  3O97 A;  1I69 A;  4BDL A;  2RC7 A;  3MVY A;  2AYS A;  3SKP A;  3DP6 A;  4XXU A;  2Y7W A;  4AB5 A;  4NX1 A;  4DLD A;  2QJE A;  3TUS A;  1B1H A;  4EDP A;  3K6V A;  1FPB A;  2Z8D A;  1OVT A;  3IJO B;  1B4Z A;  1IXC A;  4DZ1 A;  3GYY A;  5EYG A;  2Q2C A;  1WDN A;  3EPE A;  2HPG A;  2XXU A;  1QUK A;  4HE1 A;  1YYZ A;  1IMA A;  2O69 A;  2ZYN A;  5J16 A;  1SW4 A;  1JW5 A;  4THI A;  2RCB A;  1R9Q A;  3RYD A;  4BDM A;  3G3J A;  4L17 A;  1XVX A;  4NHB A;  1P1U A;  1FPL A;  5IZ1 A;  2RCA A;  2X7P A;  1LFI A;  2VGQ A;  2DOJ A;  4O7I A;  4F3P A;  1VR5 A;  1Q9D A;  4NF6 B;  2FIE A;  4QFL A;  2ZNS A;  2PMS A;  3BIH A;  4LAT A;  1B3L A;  1NV5 A;  4C1U A;  2O6A A;  4ECF A;  2ANJ A;  4RK9 A;  1XC1 A;  1NV7 A;  4DCX A;  4QRZ A;  4WKM A;  5H8N A;  2DE2 A;  4PAK A;  1NV0 A;  4ZZE A;  4F29 A;  4MFI A;  4PFI A;  1UTH A;  5CC2 A;  3K6W A;  3OO9 A;  3T1B A;  1FPF A;  1UIV A;  2V84 A;  3SEY A;  4FAT A;  2OZZ A;  5AA3 A;  2XWV A;  1FCK A;  1XS5 A;  5I2K B;  1US4 A;  1RKM A;  4LUB A;  4H45 A;  1FBD A;  1K9Y A;  5IZ3 B;  5JTY A;  1EZP A;  4ZEF A;  2IA4 A;  3T9V A;  3K1P A;  1QUL A;  1G0H A;  2P1S A;  4GLI A;  1LBB A;  1JET A;  2WYK A;  4PC9 A;  3NOH A;  2XWI A;  2FIX A;  4FE8 A;  2R9J A;  4KYE A;  4LZ8 A;  1QVS A;  3MBP A;  3C33 A;  4H8I A;  1M5C A;  4NWD A;  2VD3 A;  4OWD A;  5TPA A;  4F1U A;  2F5X A;  2UYE A;  1NMU A;  1TFD A;  2YJP A;  3T22 A;  1MXX A;  2FYI A;  1FPE A;  4PBH A;  4EXL A;  2THI A;  3T9H B;  3KBZ A;  4ZEB A;  3N5L A;  3MZ1 A;  4WEP A;  4F22 A;  1B4H A;  4P9K A;  4EQ7 A;  4N13 A;  1Y9U A;  4PF8 A;  1VFE A;  2I4B A;  4KQP A;  3P7I A;  4XIG Q;  3M3L A;  1M5D A;  3JYR A;  1CB6 A;  4F39 A;  5ITP A;  3IJX B;  5FHO A;  2PT1 A;  2WEF A;  1OMP A;  3FV1 A;  4PE3 A;  1MQJ A;  4U4S A;  4MCO A;  4IY5 A;  4RY1 A;  3O2A A;  2E1S A;  1IXI A;  1JW1 A;  4QSC A;  3FVK A;  2Z22 A;  4PE5 B;  1URS A;  2DXR A;  4Z7E A;  4OYV A;  2PT2 A;  5EYH A;  4FEC A;  2REJ A;  1ZLQ A;  2XXI A;  1SQY A;  1UIU A;  1QW0 A;  4AB6 A;  3MUQ A;  3SET A;  5DEX A;  3PPN A;  1H43 A;  4EF2 A;  4WXJ A;  1IME A;  4MF3 A;  4OER A;  3T9X B;  1NV2 A;  1P1N A;  2UVJ A;  5FHM A;  1B7Z A;  2HXW A;  5J1D A;  1Y20 A;  2H98 A;  5CMB A;  4YB7 A;  4KHZ E;  3SES A;  3GZG A;  1ZU0 A;  1B3H A;  1Y4T A;  1FQA A;  2OLB A;  4MLV A;  3C31 A;  2GHB A;  4I62 A;  5F1Q A;  3TDJ A;  4BDN A;  5LDZ A;  4DE8 A;  3KSX A;  4PGP A;  3CI8 A;  3O6I A;  3K2D A;  4FED A;  1LEV A;  3FAS A;  5HBC A;  1H3D A;  2KR0 A;  3OO7 A;  2DWJ A;  1SW5 A;  4OA4 A;  3HFU A;  2FHY A;  1H76 A;  4GX4 A;  4DCY A;  2CZL A;  4OES A;  5I2N B;  3S9L C;  3H03 A;  1R6Z A;  3MP1 A;  2PYY A;  4P11 A;  4U1Z A;  3K0V A;  4OVS A;  3K00 A;  4NF4 B;  1NUW A;  1OLC A;  2F34 A;  5DVJ A;  1LBW A;  2QL3 A;  2WKY A;  3RUM A;  4XFE A;  1FPK A;  2WBB A;  2ESN A;  3C9H A;  4H0W A;  4I40 A;  4ELO A;  2QVV A;  4BLA A;  3B8B A;  1B5I A;  3KG2 A;  4XKQ A;  3DP8 A;  4PFT A;  1CNQ A;  4GWY A;  4MLQ A;  2V3Q A;  3QIM A;  4FIM A;  2ZYO A;  1VDW A;  2A5S A;  3GLB A;  1IUD A;  3IFC A;  1NFT A;  4PDH A;  4KI0 E;  3K6X A;  2QVU A;  3CFZ A;  5FBP A;  5IZ3 A;  5ET7 A;  1R1N A;  5KCJ B;  1I6A A;  5DTB A;  3ZSF A;  1BLF A;  2CZI A;  1SYI A;  4GWW A;  3S4U A;  1UTB A;  5I56 B;  3G7W A;  1HSE A;  1P99 A;  2I3W A;  2GQ1 A;  2FNC A;  5ICQ A;  1B5J A;  1YTV A;  4DXU A;  5A5X B;  1QJM A;  4PBQ A;  1LBY A;  4C1T A;  4LQ2 A;  1BTJ A;  5EQA A;  2F36 A;  3O28 A;  5CMK A;  2AL5 A;  3BFT A;  3UP9 A;  4UA8 A;  1N7X A;  4GIZ A;  1RDY A;  2V3U A;  4MEV A;  3QUJ A;  4ZED A;  1ZKB A;  4KFQ A;  1LAF E;  1NH7 A;  3FJG A;  3B50 A;  3SEV A;  2P3N A;  3W9V A;  3MYU A;  2XD2 A;  2I48 A;  4X04 A;  5I3S A;  3CG1 A;  4G8N A;  2VPN A;  1MPB A;  3FGS A;  1FQB A;  1FTM A;  5I2N A;  5KDT A;  4H5G A;  1CE2 A;  4R6H A;  4TLM B;  2HZL A;  1Y4C A;  3T0J A;  1XHY A;  3KN7 A;  2QPQ A;  3H3G A;  2GHA A;  4X48 A;  2H25 A;  2XX9 A;  1Y3P A;  3Q27 A;  1MY2 A;  1YZ0 A;  3DM0 A;  2D3I A;  3PPP A;  4JDF A;  5ICT A;  1DTG A;  1NUZ A;  1XI6 A;  3MVW A;  3DP4 A;  1EH3 A;  4YZZ A;  3SEU A;  4NF4 A;  3LV0 A;  1SW2 A;  3QYT A;  4OFL A;  1IMD A;  1B7H A;  3ILT B;  1DPP A;  1UTB B;  1PB9 A;  4YU0 A;  4HE2 A;  3S2V A;  2DYX A;  2ZYK A;  4POW A;  1KZ8 A;  3S9N C;  4XKP A;  4LZ7 A;  5L9S A;  2Y7K A;  3CIJ A;  3IO4 A;  4GXA A;  4JVI A;  2I0C A;  1R9L A;  2VP1 A;  3IB2 A;  5DT6 A;  4G68 B;  1M5F A;  3G3G A;  5F24 A;  3IOV A;  2ABH A;  1SI0 A;  1LCF A;  5H8Q A;  1POY 1;  4NTL A;  1YXI A;  4N6K A;  1MS7 A;  4DXB A;  4JB7 A;  3TQW A;  2CEY A;  2PCR A;  1B2H A;  2DWI A;  1MM7 A;  4ZDM A;  4R72 A;  4PAI A;  3VVD A;  5TP9 B;  3Q28 A;  5ET6 A;  4O3A A;  1FPD A;  4I3E A;  5ITO A;  1AMF A;  5DVI A;  5ET8 A;  3UIF A;  1B46 A;  3L6G A;  3MW0 A;  3UN6 A;  1ANF A;  3B6Q A;  1QKA A;  1ZJL A;  2Q74 A;  2H9B A;  3G3H A;  2BJI A;  4G61 A;  4ZEC A;  5TP9 A;  3S9E A;  3OSR A;  4MNC A;  3IOU A;  3D4C A;  3V83 A;  2DXY A;  3TYH A;  2KLF A;  5JK4 A;  2I58 A;  4R2B A;  4ONY A;  3QAX A;  4LON B;  3IOW A;  2WYP A;  4QFK A;  3OOA A;  4IR8 A;  5B70 A;  1QKB A;  4H8J A;  2Y5K A;  5H8H B;  4PDD A;  3KJ7 A;  1FTO A;  3VDF A;  3GBB A;  1B58 A;  3QUF A;  2Q8J A;  2ONS A;  2A5T B;  4R9F A;  4KYD A;  2UVI A;  4Q30 B;  2ZZW A;  2Y5L A;  3U92 A;  2DP8 A;  2OWZ A;  3E9X A;  3MVX A;  4KXP A;  4UAB A;  1JVY A;  1LB9 A;  1Z7M E;  3UGW A;  1FPI A;  3KEI A;  5KZT A;  4PFR A;  1FJ9 A;  1MPD A;  1L5T A;  5K2Y A;  2R6G E;  3QSL A;  5DYH A;  3RN8 A;  2V25 A;  4IO2 A;  3HN0 A;  1FRP A;  3V5A A;  2XXW A;  3L6H A;  2XXX A;  1G0I A;  4DI3 D;  3KSJ A;  3VVE A;  4F3G A;  3ODB A;  3PUX E;  1JW4 A;  1H45 A;  1BKA A;  2O1L A;  4EUO A;  2JJK A;  4ZE9 A;  2ZXT A;  1USY H;  4F2O A;  2BJJ X;  5FTI A;  3MVZ A;  2VOZ A;  2QMW A;  4F31 B;  1O63 A;  3FXR A;  1KA0 A;  3RPL A;  2XD3 A;  1MXV A;  4ELR A;  1US5 A;  1FQC A;  4ESX A;  1N3X A;  4M4G A;  5ESY A;  1B1X A;  1XOC A;  2PFY A;  2OX3 A;  3TAJ A;  2UVH A;  4XKN A;  1A8F A;  1S9T A;  3KC0 A;  4PGN A;  4GX3 A;  2ZZV A;  3PV0 E;  4Q0C A;  1AL3 A;  1NNK A;  2XXQ A;  3KZG A;  3PTY A;  1SDX A;  3B7D A;  3C36 A;  1LBZ A;  1NV4 A;  1B05 A;  3TCH A;  4KPT A;  3PGF A;  2QS2 A;  1MY4 A;  3KN8 A;  5F7V A;  3VXB A;  4I9D A;  3TEL A;  1TT1 A;  3FBP A;  1OIB A;  3ILU B;  5EQ8 A;  2QS3 A;  3IO6 A;  1Y1Z A;  3K02 A;  1UQW A;  3TCG A;  4UAC A;  2LAO A;  4JSD A;  3PUY E;  1MH3 A;  3T66 A;  3FD3 A;  5BWJ A;  1LST A;  4YKI A;  2OWT A;  3LC8 A;  3MP6 A;  4R75 A;  3BFU A;  3DLN A;  1IIT A;  4F3B A;  2O84 X;  2PBW A;  3N6U A;  3QK6 A;  3OEM A;  4YKJ A;  4ZE8 A;  1YAE A;  1MY0 A;  1FTA A;  2Y7P A;  4MBP A;  1DBZ A;  3K6U A;  1PB7 A;  3U8Q A;  4RNS A;  2XXT A;  1QUJ A;  2OCU A;  5CRY A;  4HCY A;  4JWX A;  1TWY A;  4JXI A;  1PBP A;  4H65 A;  2QS4 A;  2Q9T A;  3VFJ A;  1DTZ A;  3JV9 A;  4LZ5 A;  3FXQ A;  1MDQ A;  4TQU Q;  4HS7 A;  5EHS A;  1PEB A;  2UXA A;  4PTK A;  1LBC A;  2REG A;  3IB0 A;  4I8C A;  3MZB A;  1GVC A;  4U23 A;  4HXV A;  1NNF A;  3FJ7 A;  5ELV A;  5EQ7 A;  5EHM A;  4MX6 A;  4RYA A;  3QXM A;  4GD5 A;  1B6H A;  4LQ5 A;  1ZIU A;  5KDT B;  3LBS A;  4P1L A;  3KC1 A;  1FBP A;  2XHD A;  1LGB C;  4NF0 A;  3A3U A;  3G3K A;  3O6G A;  1D3K A;  2I6E A;  1MXU A;  1NUY A;  1Q1K A;  2ONK E;  5ET5 A;  1RYO A;  2KQZ A;  3H7M A;  4QSE A; 
#chains in the Genus database with same CATH homology
 1GTK A;  3W9V A;  2XD2 A;  4QF9 A;  1BIY A;  2I48 A;  1WOD A;  3Q29 A;  1ATG A;  3CG1 A;  2F7C A;  3MZ9 A;  3PD9 A;  1B3E A;  4FJP A;  4G8N A;  3VVF A;  1AIV A;  1OVB A;  1TFA A;  3OEK A;  1MPB A;  2AIX A;  3FV2 A;  3FGS A;  3TTR A;  1FQB A;  1FTM A;  1ZTY A;  2UYF A;  3EQ1 A;  4U1O A;  1FTK A;  2O51 A;  3USD A;  2FA7 A;  3FJM A;  3N94 A;  4Q8R A;  2DVZ A;  1QUI A;  2Y7I A;  1M5B A;  4GRK A;  3SDF A;  5I2N A;  2HAV A;  5KDT A;  4PP0 A;  4H5G A;  4OZ9 A;  3U1O A;  1CE2 A;  4F18 A;  5KDT B;  2ALU A;  3KBR A;  4R6H A;  4TLM B;  3FVO A;  2HZL A;  2F7B A;  1MXW A;  1Y4C A;  3MPL A;  1VSO A;  3W15 C;  5ISU A;  2M8C A;  3G3F A;  1XHY A;  2Z23 A;  3KJT A;  3KN7 A;  3PUW E;  3R26 A;  5H8H A;  2O7I A;  1MDP 1;  3HHG A;  4NF8 A;  3IX1 A;  2G93 A;  4YAH X;  1B3G A;  2QPQ A;  4G77 A;  3TTL A;  3D4G A;  4IY6 A;  4AQ4 A;  3H3G A;  1EU8 A;  3N6T A;  2DSF A;  2GHA A;  2B65 A;  4X48 A;  2H25 A;  4LVQ A;  4GVO A;  3RT8 A;  2XX9 A;  3ZKL A;  3LR1 A;  4IO4 A;  5B7D A;  2QRY A;  1NNP A;  3EHT A;  1Y3P A;  3W9W A;  1HSL A;  3O97 A;  3Q27 A;  1SYH A;  1I69 A;  1MY2 A;  1YCJ A;  3DM0 A;  2D3I A;  4G68 A;  4JWY A;  4U4X A;  1D4N A;  4BDL A;  4OEN A;  3PPP A;  4NMY A;  4JDF A;  2RC7 A;  3TPA A;  5AA4 A;  2Z8F A;  1IIW A;  3MVY A;  5DT6 A;  2AYS A;  4ZS9 A;  3KOS A;  3RTW B;  5ICT A;  3SKP A;  3DP6 A;  4XXU A;  4OXV A;  1LAX A;  2HQ0 A;  4H6D A;  1URD A;  2RC8 A;  3R6U A;  1A99 A;  1DTG A;  1LFH A;  2Y7W A;  1ELJ A;  4AB5 A;  1MY3 A;  2R71 A;  4DLD A;  2QJE A;  1MQI A;  3IAZ A;  2XX8 A;  2RF1 A;  3MVW A;  1B1H A;  1B52 A;  1EH3 A;  3DP4 A;  3TUS A;  2DE4 A;  4YZZ A;  3SEU A;  4NF4 A;  3PMX A;  1SW2 A;  3VE1 B;  1USY E;  3QYT A;  3VXC A;  4EDP A;  3K6V A;  4OFL A;  1B7H A;  2Z8D A;  1OVT A;  3ILT B;  3IJO B;  2ZNT A;  1DPP A;  1UTB B;  1PB9 A;  1B4Z A;  4RJZ A;  4YU0 A;  1IXC A;  3EN3 A;  3VLV A;  4PFY A;  4DZ1 A;  3S2V A;  3M8U A;  2DYX A;  4F2Q A;  3WAE A;  4FAJ A;  2Q2C A;  2VHA A;  2ZYK A;  3O9P A;  4POW A;  1JEU A;  1ZBM A;  3S9N C;  1WDN A;  1WVJ A;  3EPE A;  1IZ1 A;  2XXU A;  4XKP A;  1LFG A;  1QUK A;  4LZ7 A;  3E3K A;  4OFO A;  5I58 A;  3RTF B;  2O69 A;  2ZYN A;  1AH5 A;  5A5X A;  4YB5 A;  5L9S A;  1SW4 A;  2Y7K A;  3CIJ A;  1JVX A;  1Y3N A;  3IL1 B;  1A55 A;  2I0C A;  3IO4 A;  1R9L A;  2E0S A;  2VP1 A;  1JW5 A;  3IB2 A;  2RCB A;  3BKI B;  1R9Q A;  2H5Y A;  3LUY A;  3M3K A;  1M5F A;  4G68 B;  4NF6 A;  3G3G A;  2NWJ A;  3TTM A;  4BDR A;  1JNF A;  3FVG A;  3G3J A;  3IOV A;  2ABH A;  4L17 A;  4NE4 A;  4BDM A;  1SI0 A;  4GXA A;  4RA1 A;  1XVX A;  1P1O A;  1LCF A;  1P1U A;  5H8Q A;  1B0H A;  4U22 A;  1EZ9 A;  3PMW A;  5CBR A;  4N6P A;  3RY3 A;  1POY 1;  3PUV E;  2RCA A;  2DS9 A;  2X7P A;  1MRP A;  2CMO A;  4NTL A;  1AOV A;  1LFI A;  4DXB A;  1MS7 A;  5AE4 A;  5H8N B;  4JB7 A;  1IXG A;  3TQW A;  2VGQ A;  4E0X A;  2DOJ A;  3I3V A;  3TTK A;  1B0L A;  1B2H A;  2DWI A;  5H8F A;  5CBS A;  1EZO A;  3FUZ A;  1MM7 A;  2HZK A;  4F3P A;  2D21 A;  2ZYM A;  1VR5 A;  3KGC A;  2NUV A;  3HPI A;  4ZDM A;  4R72 A;  3SEX A;  3K4U A;  1MQH A;  4NF6 B;  5AA1 A;  4F31 B;  1B5H A;  2F8D A;  4QFL A;  4PQJ A;  1DMB A;  3VVD A;  2XXR A;  1FW0 A;  3E4R A;  1PC3 A;  4BDQ A;  4LA9 A;  5TP9 B;  3Q28 A;  3T96 B;  3LSF B;  4O3A A;  2ZNS A;  2PMS A;  5LOM A;  4LAT A;  1B3L A;  1YPN A;  5H8Q B;  1SBP A;  2PX1 A;  3HV1 A;  4C1U A;  2XXV A;  2O6A A;  2VD2 A;  2ANJ A;  3IOR A;  4IO5 A;  1AMF A;  5DVI A;  5ITO A;  4ECF A;  4YMB A;  5HPQ A;  4RK9 A;  1XC1 A;  1LAG E;  3UIF A;  2P0S A;  3ECR A;  4QRZ A;  4DCX A;  1B46 A;  2HAU A;  3L6G A;  4WKM A;  4GL0 A;  1SW1 A;  2DE2 A;  2GRV A;  5DEX B;  5H8N A;  1XVY A;  3MW0 A;  2NVU B;  1T0K A;  4ZZE A;  3SER A;  4F29 A;  1A54 A;  3LSX A;  3SEW A;  3UN6 A;  1ANF A;  3B6Q A;  3M3F A;  1UTH A;  1QKA A;  4MFI A;  3PMV A;  4XKR A;  3VLW A;  1IQ7 A;  1ZJL A;  2F6P A;  5CC2 A;  3K6W A;  3OO9 A;  5K2X A;  5TPA B;  4X1B A;  2DE3 A;  2H9B A;  1FQD A;  1DSN A;  1GR2 A;  3AXF A;  3H6V A;  1N76 A;  1UIV A;  2V84 A;  3MPK A;  3G3H A;  4R6K A;  3SEY A;  4C0R A;  4GFR A;  4FAT A;  4E0W A;  2OZZ A;  2I0B A;  2OK2 A;  1Q35 A;  5TP9 A;  1FCK A;  3OSR A;  4ZEC A;  5AA3 A;  3S9E A;  1XS5 A;  4YB6 A;  3IOU A;  3D4C A;  3V83 A;  5H8F B;  1LLS A;  2DXY A;  4YKP A;  3TYH A;  2KLF A;  5I2K B;  5AA4 B;  3S9M C;  1US4 A;  5JK4 A;  1RKM A;  1MM6 A;  4LUB A;  4OEV A;  2I58 A;  1DPE A;  4O3B A;  4R2B A;  4ONY A;  3QAX A;  4LON B;  3IOW A;  4QFK A;  4QFO A;  5TU0 A;  3OOA A;  5B70 A;  5JTY A;  1EZP A;  1QKB A;  4ZEF A;  4X1D A;  2IA4 A;  4H8J A;  3T9V A;  3K1P A;  3U93 A;  1QUL A;  4IGT A;  5H8H B;  2O7U A;  2P1S A;  2Q2A A;  1LBB A;  3KJ7 A;  2X26 A;  4GLI A;  2O1M A;  1JET A;  4NF5 A;  4RK2 A;  4F19 A;  4QFN A;  1FTO A;  2X7Q A;  3FVN A;  2ZMB A;  3HO7 A;  3VDF A;  3GBB A;  4OET A;  3HHF A;  4PET A;  3T9U A;  1B58 A;  3QUF A;  2Q8J A;  2ONS A;  2A5T B;  4R9F A;  4KYD A;  4FE8 A;  2UVI A;  2HFB A;  3O29 A;  4G8M A;  4Q30 B;  5L8D A;  2R9J A;  3O6H A;  4KYE A;  4LZ8 A;  4GWO A;  1QVS A;  2Z8E A;  4KCC A;  3RT6 B;  2AL4 A;  4N07 A;  3U92 A;  2F7A A;  3CFL A;  2DP8 A;  1XT8 A;  3C33 A;  3MBP A;  4H8I A;  3E9X A;  1M5C A;  3I6V A;  3MVX A;  1OQH A;  4NWD A;  2VD3 A;  1POT A;  4GXS B;  1ZMG A;  4OWD A;  3H06 B;  5TPA A;  2F5X A;  4BDO A;  4F1U A;  4O3C A;  1MXY A;  2UYE A;  3I5O A;  1JEV A;  1JVY A;  1LB9 A;  4MH5 A;  3E13 X;  1GV8 A;  4TOZ A;  1Z7M E;  1NMU A;  3UGW A;  4ZEI A;  1TFD A;  2YJP A;  1PDA A;  1N0T A;  3KEI A;  1MXX A;  4Z0I A;  3KFM A;  3T22 A;  3V89 B;  5KZT A;  1MPD A;  1URG A;  2FYI A;  3BBR A;  3OO6 A;  5K2Y A;  1L5T A;  3TQL A;  3CR9 A;  3F11 A;  2V93 A;  4OVJ A;  2R6G E;  2Y84 A;  2OWS A;  3QSL A;  4GF8 A;  1SD3 A;  5DYH A;  4R6Y A;  3MP8 A;  2THI A;  5M2V A;  4EXL A;  3RN8 A;  2V25 A;  4G68 C;  3K1M A;  4IO2 A;  1LB8 A;  3T9H B;  4P0G A;  3HN0 A;  4M1V A;  4ZEB A;  2H4I A;  4GOT A;  4TLL B;  4G4P A;  1H44 A;  1MH4 A;  1M5E A;  3V5A A;  5L9M A;  2QSX A;  3HST A;  2XXW A;  3N5L A;  5HM4 B;  3MZ1 A;  4WEP A;  3L6H A;  4R9G A;  2XXX A;  2F6G A;  4F22 A;  4OQO A;  4RPN A;  1FQF A;  1B4H A;  3KSJ A;  1MPC A;  1N04 A;  4H67 A;  3VVE A;  3N26 A;  3K1N A;  2XX7 A;  4EQ7 A;  4N13 A;  1Y9U A;  1SI1 A;  3ODB A;  2G29 A;  4F3G A;  1VFE A;  1NNT A;  2ONR A;  1MQD A;  4QHQ A;  5AA2 B;  3PUX E;  1JW4 A;  2I4B A;  1H45 A;  4KQP A;  1BKA A;  3P7I A;  4XIG Q;  1FTL A;  3TTN A;  3RQT A;  2H99 A;  2O1L A;  3M3L A;  5IAI A;  5JEI A;  1M5D A;  3JYR A;  1S7Y A;  3PUZ E;  1CB6 A;  4PFW A;  4XTC Q;  3TKD A;  2ZXT A;  4EUO A;  4F39 A;  2Y7R A;  2OJT A;  4ZE9 A;  5ITP A;  1USY H;  1P1Q A;  4F2O A;  2BJJ X;  1P1W A;  3FIR A;  5FTI A;  3IJX B;  5FHO A;  3MVZ A;  2PT1 A;  2XXP A;  3PD8 A;  5KCJ A;  1OMP A;  5H8S A;  2VOZ A;  3FV1 A;  3CFX A;  2QMW A;  1MQJ A;  2PVU A;  5L9O A;  4NED A;  4U4S A;  1DOT A;  3B6W A;  2GH9 A;  1O63 A;  4IY5 A;  3FXR A;  2XXY A;  1D9Y A;  3CRB A;  4THI A;  4RY1 A;  3IB1 A;  3ZSF A;  1A8E A;  3O2A A;  5AA2 A;  3RLF E;  2E1S A;  2XD3 A;  2YLN A;  1IXI A;  1JW1 A;  4QSD A;  4QSC A;  1MXV A;  4R2F A;  4R74 A;  2DWA A;  3T93 B;  3FVK A;  1BP5 A;  1KWH A;  1RYX A;  1US5 A;  3TMG A;  3MAM A;  2Z22 A;  4ELR A;  4PFU A;  3CSB A;  1LAH E;  1FQC A;  4ESX A;  4ELP A;  4PE5 B;  4U2R A;  4I1D A;  1N3X A;  1URS A;  3U72 A;  2DXR A;  4EQ9 A;  1Y3Q A;  4M4G A;  3CVG A;  3LSW A;  4OYV A;  1B1X A;  4Z7E A;  2PT2 A;  3TEP A;  1XOC A;  2REJ A;  4FEC A;  5I56 A;  1ZLQ A;  2NXO A;  2UVH A;  4JSO A;  2XXI A;  3ONM A;  3TAJ A;  1B40 A;  4XKN A;  4F1Y A;  1SQY A;  3OXN A;  1A8F A;  1S9T A;  1UIU A;  1QW0 A;  4ISU A;  4AB6 A;  2RC9 A;  1B7U A;  4QFP A;  3UOR A;  3MUQ A;  3SET A;  5I59 B;  3OMB A;  3FZV A;  3PV0 E;  5DEX A;  3PPN A;  2DQV A;  5CI5 A;  1A40 A;  1H43 A;  3C32 A;  4Q0C A;  4EF2 A;  4G2Z A;  4WXJ A;  2F97 A;  1FQE A;  3Q25 A;  1AL3 A;  1NNK A;  4MF3 A;  2XXQ A;  4OER A;  3T9X B;  3KZG A;  5EYF A;  3PU5 A;  1J1N A;  2GFE A;  3B6T A;  1I6Q A;  1P1N A;  2UVJ A;  1SDX A;  5FHM A;  4DIG A;  3B7D A;  1B7Z A;  2HXW A;  1MY1 A;  3C36 A;  5J1D A;  4K3F A;  3LSL A;  5FHN A;  3UK4 A;  1Y20 A;  1B05 A;  2H98 A;  4ESW A;  2DVC A;  3TCH A;  5CMB A;  1VE4 A;  2OBG A;  4YB7 A;  5I84 A;  1D9V A;  2ZNU A;  4KHZ E;  3SES A;  4KPT A;  4LP2 B;  3OEN A;  3PGF A;  4DDD A;  4YIC A;  3GZG A;  3KN3 A;  1B51 A;  3GXA A;  2QS2 A;  1ZU0 A;  1MY4 A;  1S50 A;  3HCQ A;  1B3H A;  3KN8 A;  5F7V A;  3VXB A;  4I9D A;  3TEL A;  1TT1 A;  1Y1M A;  3TOD A;  4EF1 A;  3OD7 A;  3TCF A;  1Y4T A;  4OEU A;  1FQA A;  1I6B A;  2OLB A;  1OIB A;  3ILU B;  3IR1 A;  4KD5 A;  4MLV A;  3C31 A;  2GHB A;  4I62 A;  4NWC A;  5F1Q A;  2NOO A;  3TDJ A;  5I57 B;  3MWB A;  4G8H A;  2QS3 A;  3IOT A;  3IO6 A;  1Y1Z A;  4IB2 A;  3K02 A;  4NF8 B;  4BDN A;  1UQW A;  1N3W A;  3KSX A;  3RNN A;  3TCG A;  4DE8 A;  4UAC A;  2LAO A;  3CI8 A;  4WED A;  4JSD A;  3O6I A;  3PUY E;  4OMB A;  4ZEK A;  1MH3 A;  3K2D A;  4FED A;  4H5F A;  3T66 A;  3FAS A;  1Z7N E;  2F35 A;  5HBC A;  3FD3 A;  3EHS A;  1H3D A;  1LST A;  5BWJ A;  3OO7 A;  4YKI A;  3VLU A;  2OWT A;  3RPW A;  2DWJ A;  2RIN A;  3LC8 A;  3VV5 A;  3MP6 A;  2QMX A;  1SW5 A;  4JBZ A;  3ZS6 A;  4KR5 A;  3PPQ A;  4R75 A;  3BFU A;  1OLA A;  1H76 A;  5BUU A;  4DCY A;  2CZL A;  3DLN A;  4OES A;  4POX A;  4HTG A;  1LCT A;  1B32 A;  2Q88 A;  5CMC A;  4Q5T A;  5I2N B;  3S9L C;  3H03 A;  4KYS A;  1MXZ A;  1R6Z A;  3MP1 A;  1IIT A;  2Q89 A;  3OO8 A;  2B3F A;  4RPO A;  2QS1 A;  2PYY A;  4P11 A;  4U1Z A;  1VFD A;  3K0V A;  4F3B A;  3GBA A;  2O84 X;  5I57 A;  1NKX A;  3OEL A;  5I2K A;  2PBW A;  4IGR A;  1PBQ A;  2P2A A;  3C34 A;  3FXU A;  3K00 A;  3N6U A;  3QK6 A;  4FEB A;  3OEM A;  2HEU A;  4X9T A;  2I3V A;  4NF4 B;  1OLC A;  2F34 A;  3C35 A;  3PPO A;  2UVG A;  1YAE A;  4YKJ A;  5DVJ A;  2QL3 A;  4ZE8 A;  2WKY A;  4F1V A;  1JQF A;  2I49 A;  3RUM A;  1MY0 A;  2Y7P A;  3C9H A;  2D5W A;  2ESN A;  4H0W A;  2HCA A;  4ELO A;  4EQB A;  2DWH A;  4KCD A;  3H6W A;  2YPN A;  4MBP A;  4BLA A;  5AA2 D;  2XXH A;  1B5I A;  3K6U A;  1NH8 A;  1PB7 A;  3KG2 A;  3MC2 A;  4XKQ A;  3U8Q A;  3TFL A;  1UTH B;  4GQO A;  3DP8 A;  4PFT A;  3TZA A;  2I4C A;  4IO7 A;  4RNS A;  2XXT A;  4MLQ A;  2F78 A;  1QUJ A;  3MQ9 A;  5CMM A;  2V3Q A;  3UA8 A;  2IEE A;  2OCU A;  4EXK A;  1IEJ A;  3QIM A;  4JWO A;  5CRY A;  4FIM A;  5CM6 A;  2ZYO A;  3O66 A;  4HCY A;  1TWY A;  4JWX A;  4JXI A;  1IXH A;  1PBP A;  4ND9 A;  4ZZA A;  2A5S A;  3GLB A;  1IUD A;  1B3F A;  2QS4 A;  2Q9T A;  3C4M A;  3KOT A;  4H65 A;  3VFJ A;  1TXF A;  1DTZ A;  1NFT A;  2V3T A;  3EF7 A;  3JV9 A;  2RKM A;  3FXQ A;  4KI0 E;  1FTJ A;  4LZ5 A;  5DVF A;  3K6X A;  4HW8 A;  1N7W A;  5I58 B;  3CFZ A;  3CG3 A;  1MDQ A;  3H6U A;  4TQU Q;  4HS7 A;  5EHS A;  1PEB A;  2UXA A;  4YMA A;  5IKB A;  1R1N A;  5KCJ B;  1I6A A;  1II5 A;  1A7L A;  1LBC A;  2A5T A;  2REG A;  3IB0 A;  1BLF A;  2W7Y A;  4I8C A;  5DTB A;  3R7X A;  3U94 A;  1SYI A;  4YKK A;  3MZB A;  1GVC A;  3S4U A;  1UTB A;  4U23 A;  1NNF A;  4RXL A;  3FJ7 A;  5ELV A;  4U21 A;  5I56 B;  3G7W A;  1HSE A;  1P99 A;  3Q26 A;  2I3W A;  5EHM A;  4FOR A;  3RGY A;  4NF5 B;  1HSJ A;  1B9J A;  1MQG A;  1F9B A;  1N84 A;  1PB8 A;  4H1X A;  2FNC A;  3PPR A;  3QXM A;  4GD5 A;  1B6H A;  4RYA A;  5ICQ A;  4IO3 A;  1B5J A;  4LQ5 A;  1ZIU A;  1YTV A;  4GL8 A;  5FTH A;  3LBS A;  4DXU A;  1QJM A;  2B3B A;  1OQG A;  4OTE A;  5A5X B;  5JTY B;  3A3C A;  3ZKK A;  1NL5 A;  3K01 A;  3EHU A;  4C1T A;  4DXC A;  3H6T A;  4LQ2 A;  3DEL B;  2XHD A;  2F36 A;  1BTJ A;  3A09 A;  2O68 A;  3H4Z A;  3O28 A;  1LGB C;  4OFJ A;  2AL5 A;  5CMK A;  3A3U A;  3G3K A;  3BFT A;  3O6G A;  1D3K A;  3UP9 A;  3WAF A;  4UA8 A;  1GGG A;  2I6E A;  1N7X A;  1MXU A;  4GIZ A;  3IK6 B;  4R73 A;  1MG1 A;  1SVX B;  1Q1K A;  2V3U A;  3FAT A;  2ONK E;  4F3S A;  5I59 A;  3JZJ A;  3MJN A;  3QUJ A;  4OHN A;  1RYO A;  3G3I A;  4IO6 A;  1O64 A;  3CSG A;  4HCW A;  4ZED A;  4P0I A;  1ZKB A;  3THI A;  3H7M A;  4QSE A;  4KFQ A;  1LAF E;  1NH7 A;  1O7T A;  3FJG A;  3SEV A;  4ELQ A;  3V8X B;  3OSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...