5H8FB

Structure of the apo human glun1/glun2a lbd
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
286
structure length
283
Chain Sequence
RLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glutamate receptor ionotropic, NMDA 2A
publication title Positive Allosteric Modulators of GluN2A-Containing NMDARs with Distinct Modes of Action and Impacts on Circuit Function.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 283
sequence length 286
ec nomenclature
pdb deposition date 2015-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8fB01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8fB02
4BDOA 4R6KA 2DS9A 4KPTA 3CG3A 3JZJA 4MLVA 3IOVA 4YB6A 3QYTA 1JEUA 4GL0A 4WXJA 1NNKA 3LUYA 4DDDA 2RC8A 2X7QA 1IITA 4ZZAA 1MY3A 3SEUA 2XXVA 2RF1A 1N7XA 4R75A 1FQFA 1B3HA 5EYFA 4FEDA 2F7CA 4M1VA 1MPDA 3MWBA 3Q29A 1Y3QA 2A5TB 4EQ7A 3M8UA 3TTMA 3FGSA 1LB8A 1ZKBA 5H8NA 4F22A 2GHBA 3QUJA 4RY1A 4G8HA 1PB7A 1B0LA 1FCKA 1UTHA 3CRBA 3U8QA 3C34A 2XXTA 4R6HA 1UIVA 4G4PA 2V93A 1DTZA 3QK6A 1QW0A 1LFHA 4KQPA 1P1UA 4EQBA 5H8FB 3IB1A 1JVYA 3H03A 4UA8A 1MXZA 1JNFA 2XD3A 3IOTA 1WVJA 1LCFA 3O28A 2F6PA 2I4CA 2UYEA 3TQLA 1XC1A 3TMGA 4OEVA 3EPEA 3THIA 4PP0A 3L6HA 5DVFA 5H8QA 1US4A 2F7BA 4M4GA 1B52A 4R2FA 1GGGA 3ILUB 4ONYA 1P1NA 5I56A 4DCYA 5KCJB 4ZS9A 3OOAA 2ZYMA 3OSRA 5I2NB 4U22A 5ISUA 4GL8A 5DT6A 4KYEA 4RA1A 3OMBA 2LAOA 3IJOB 3FIRA 3PUYE 4OESA 4KI0E 1OLCA 3MP1A 2IEEA 4YU0A 1A40A 3FXUA 1O64A 4ZEKA 2RINA 4C1TA 4BLAA 1B5IA 5EHMA 1M5CA 3OELA 1B0HA 2F8DA 5BUUA 1DSNA 1MG1A 1B7UA 3FV2A 2W7YA 5EHSA 3QAXA 1PEBA 4Q8RA 3QUFA 3H6VA 3C31A 1MQGA 3KFMA 1Y1ZA 2G29A 2IA4A 2ZYKA 3IR1A 4KD5A 5I2KA 2V25A 3K4UA 3GXAA 2I0CA 4HTGA 3VFJA 4DXBA 1UTBB 4PETA 5K2XA 1HSJA 3MBPA 2XXQA 4H67A 4O3BA 3VVDA 4H8JA 2OZZA 3PU5A 2CMOA 3OXNA 4E0XA 1B40A 3KEIA 5AA1A 4HCYA 4QFOA 3LSXA 1EZPA 1N84A 2ZNTA 2ZYNA 4NF6B 3H6UA 4RPOA 2PYYA 3IO4A 3IL1B 5DYHA 2VD2A 3E13X 2UVJA 4NTLA 4LA9A 3RPWA 4ZEDA 1MRPA 2ABHA 4OFJA 3MVWA 1QUJA 2QJEA 1IIWA 4LZ5A 2I3WA 4THIA 5JTYB 1MH4A 1FQEA 2DYXA 1WDNA 2HQ0A 3FJ7A 4X9TA 3TAJA 5JTYA 1VE4A 1B05A 3FJMA 4JSOA 1TXFA 5ICTA 1DOTA 1M5EA 3HN0A 2AIXA 4X1BA 3PD8A 1ANFA 1DPPA 5ITPA 4LZ8A 5K2YA 3T96B 3VDFA 1NL5A 1OQHA 5BWJA 3PV0E 3SDFA 2WKYA 3U94A 4F1UA 2YLNA 2M8CA 3K6VA 4GF8A 1XS5A 2QL3A 3O6GA 1A8EA 5H8HA 3BBRA 3TEPA 4LONB 4ELQA 2UVGA 1A7LA 5HBCA 3E4RA 1LSTA 1MQJA 4POXA 3B6WA 4R6YA 3TTRA 4LVQA 3SERA 4IB2A 4MBPA 2F5XA 5CBRA 4U4SA 1BKAA 3K01A 1AOVA 4X48A 4NF8B 3KSJA 5AA4A 2OK2A 3MZ9A 3H4ZA 1VSOA 3USDA 1O7TA 1OIBA 2AL4A 1GV8A 3D4GA 4IGRA 2DSFA 1XVXA 5AA2D 1Y20A 3IK6B 1FW0A 5HM4B 4F3BA 3MJNA 4OENA 1B7HA 5FHNA 4KR5A 2DXYA 4GRKA 2D21A 2ANJA 3OO6A 1FTKA 1POY1 3O6IA 1FTLA 2I49A 2YJPA 1I69A 4UACA 4F39A 2O6AA 4IO7A 4P11A 2THIA 5A5XA 4JWYA 1MPCA 3P7IA 2GRVA 3Q27A 1JW5A 3K00A 4ESXA 5CMCA 3TCHA 4XXUA 2QSXA 3T9VA 4FORA 4AB6A 4Z0IA 1MY4A 3UIFA 4RJZA 1MDP1 5CMKA 3MP6A 4WKMA 2NXOA 2XXYA 1BLFA 5KDTB 1ZU0A 4PQJA 4I8CA 2OJTA 1LLSA 5FTIA 3D4CA 4JB7A 4TQUQ 1IEJA 2AL5A 1SD3A 1D4NA 3H6WA 3LC8A 2XHDA 4LZ7A 1FQAA 3IJXB 3TUSA 2R71A 4I9DA 1LGBC 4I1DA 5I57B 3DP8A 2ZXTA 4QFKA 5CC2A 5I57A 5I58A 1GR2A 5L9OA 2OBGA 1MXUA 3VVFA 1A54A 4JSDA 3B7DA 3W15C 2P1SA 1SVXB 1QKAA 1SQYA 2GH9A 4EF1A 1S50A 5TP9B 2G93A 4PFUA 3QXMA 1SW4A 4N13A 5TP9A 4WEPA 4YAHX 3VXCA 2P2AA 1HSLA 1OVTA 4PFWA 2RC9A 1PB8A 4ZZEA 1FTOA 3VV5A 2QS3A 1HSEA 5CMBA 1ZTYA 3PUZE 4F3GA 3U93A 1MXVA 3IX1A 1I6BA 2QMWA 1B3LA 4FECA 1LAFE 3C4MA 1KWHA 1ATGA 1N3WA 2I0BA 4Q0CA 1H3DA 2HXWA 2ONKE 3OEMA 3OEKA 3S4UA 5IAIA 1BTJA 2OWTA 3S9MC 2A5TA 3PGFA 4LATA 1JVXA 1EH3A 2H4IA 4Q5TA 2Z8DA 4RYAA 2HZKA 3RNNA 2Q88A 3AXFA 2GHAA 1P99A 3S9EA 1MY0A 3GBAA 5CMMA 1Q1KA 2Q8JA 2O7IA 4G68B 4ZEFA 2RC7A 3TDJA 3T9XB 4G8NA 3SEVA 3DP4A 1EU8A 5H8FA 2QS2A 1S9TA 4DZ1A 1B46A 5JK4A 5DEXB 2DOJA 5CRYA 4R9FA 3RY3A 1B1HA 1OMPA 1R6ZA 1Y4CA 1A55A 3EHTA 1URDA 3HHFA 5I59B 5DVIA 1RYOA 1II5A 1QKBA 3VLUA 4U4XA 2HEUA 3PUWE 2Y7RA 5AE4A 3Q28A 3FXQA 5AA2B 3G3KA 2ZYOA 5FTHA 4NWCA 5KCJA 4HS7A 2X26A 3A3CA 4YB5A 4ZDMA 4QHQA 5I2NA 4KCDA 3ONMA 3UA8A 1OQGA 3HO7A 2Q89A 3DLNA 4JXIA 5HPQA 3DELB 3CI8A 1US5A 2H98A 2Y7KA 3DP6A 3N5LA 4NWDA 4EQ9A 4R9GA 3TODA 4NF5B 1OVBA 4JBZA 3G7WA 1B6HA 4NF5A 3A09A 4IO5A 3TELA 1A8FA 1M5DA 4H6DA 4OFOA 1N04A 2E0SA 3S9LC 3PPNA 4QF9A 4H5GA 1SW5A 1B3EA 4EF2A 3T66A 1O63A 4F3PA 2R6GE 2DWJA 3MZ1A 4F31B 2I3VA 3M3FA 1TFAA 2YPNA 3UK4A 4F2QA 3OO7A 3PMWA 4YKPA 3I5OA 2XXIA 2Y7IA 1ZIUA 1ZLQA 1H43A 3WAEA 1M5BA 3TZAA 1DPEA 4OEUA 4X1DA 1N7WA 2HFBA 1PB9A 3IB2A 3M3LA 3KG2A 5TPAB 2Q9TA 1UTBA 1AL3A 3CIJA 1R9QA 1SBPA 4DXUA 4OTEA 2Z8FA 2O7UA 2VOZA 3PD9A 2E1SA 4MH5A 1L5TA 1FQCA 1MY2A 1B32A 1VFDA 5M2VA 1PDAA 3C36A 4IO4A 5F1QA 2P0SA 3SKPA 2R9JA 4XIGQ 4C0RA 4NF6A 4H1XA 3MQ9A 2HZLA 2H5YA 1Y3PA 4LUBA 3EHUA 2RKMA 1TWYA 1JQFA 1DMBA 2O69A 3U92A 2H25A 2ONSA 3FUZA 3LSFB 3O6HA 5L9SA 1M5FA 3JYRA 4ZE9A 3FJGA 4EXLA 2DQVA 1Z7ME 2Y7WA 2REGA 4U23A 1NFTA 3MZBA 1B5HA 4KYSA 1MQHA 1BP5A 4LQ5A 2ALUA 1MXYA 3RLFE 2HAVA 1EZ9A 3R7XA 1R1NA 3CVGA 3HPIA 1MS7A 1USYE 1CE2A 1QUIA 2NUVA 2CZLA 3OENA 3TCFA 3MC2A 2V3UA 3ODBA 3IORA 3KN7A 3VLWA 3RT8A 4BDRA 1AH5A 4IY6A 1T0KA 4F19A 1A99A 2GFEA 4FIMA 2QS1A 3E9XA 4FATA 5LOMA 1SI0A 2XX7A 3EHSA 1D9YA 1OLAA 2DWHA 4YICA 4PFTA 3V8XB 3TFLA 1LFIA 2O68A 2QRYA 1YCJA 3K6UA 2F35A 3O2AA 4I62A 3JV9A 1LBCA 4R72A 4OFLA 1N3XA 1R9LA 1FQDA 1B3FA 4JWOA 1ZJLA 3RUMA 1QULA 3MP8A 2H99A 4H0WA 4NF8A 2HAUA 1H76A 4KCCA 2ESNA 4U1ZA 4U2RA 3GBBA 5B7DA 2H9BA 3RTWB 2QMXA 5CI5A 4H8IA 3TTKA 2RCBA 2D3IA 4F29A 4OWDA 1RKMA 5JEIA 1P1OA 2F97A 3CR9A 3KN8A 3MVXA 1MQDA 1Y4TA 1GTKA 1ZBMA 4KYDA 2B3FA 3S9NC 1LB9A 1NH7A 1QVSA 4AQ4A 3ECRA 4ZECA 4ND9A 1FTMA 1FTJA 3CFLA 4WEDA 3V83A 2RCAA 5TU0A 3C33A 3RQTA 5CBSA 1B7ZA 4YB7A 4RNSA 4K3FA 4HCWA 1MPBA 4MF3A 4NEDA 2F6GA 3PPPA 4TOZA 4MLQA 1MQIA 3FZVA 2XXPA 4IGTA 4L17A 4EDPA 4NF4B 4MFIA 4QFPA 5KDTA 1B1XA 2OLBA 2ZNSA 4GFRA 3K1PA 3IB0A 4LQ2A 4PFYA 4DXCA 1LAGE 3KOSA 3KSXA 5IKBA 3UP9A 4EXKA 3ZKKA 3KGCA 3T22A 3DM0A 3EF7A 3PUVE 2F36A 4DE8A 1BIYA 1RYXA 2DE3A 2OWSA 1MM7A 2PMSA 3I3VA 3HV1A 1YPNA 4OQOA 4F18A 5DTBA 3T93B 1JEVA 2ZMBA 3K1NA 4GXAA 1AMFA 3OSQA 3UGWA 1MM6A 3LR1A 3O9PA 2Z23A 5ICQA 2V3QA 2O1MA 4FEBA 1JW1A 2ZNUA 1LAXA 3TPAA 3PPQA 3A3UA 3N6UA 1PC3A 3MVYA 1P1QA 4OMBA 1YAEA 4XKPA 1QJMA 3LBSA 4G68C 3WAFA 1MXXA 1D3KA 4ELOA 3TQWA 4QSCA 5L8DA 1JETA 3K2DA 1IUDA 1MDQA 4ZEIA 1IXGA 4GXSB 1B3GA 1I6QA 3SEXA 3KJ7A 3OD7A 3T9UA 1IXHA 2O84X 1DTGA 3VE1B 2DE4A 2Q2CA 3FVNA 4IY5A 1Y1MA 2PX1A 3G3GA 1SI1A 1GVCA 2UYFA 4ECFA 3CG1A 5H8NB 2DP8A 1WODA 3FXRA 1UTHB 4POWA 4RK2A 1NNPA 4XKRA 4R73A 1Z7NE 4G68A 3FVOA 2OCUA 2XD2A 2I4BA 3SEWA 3RN8A 4RK9A 3W9WA 5CM6A 2F7AA 3U72A 5DEXA 3Q25A 4GIZA 3IAZA 4C1UA 1ZMGA 4G8MA 5I59A 1USYH 4QSDA 3BKIB 3N6TA 3ZKLA 2PBWA 2XXUA 2F78A 3HHGA 2B65A 1B4HA 1QUKA 1I6AA 5H8QB 1B2HA 4BDLA 2DWAA 1UIUA 3O97A 5AA2A 3CFXA 3N94A 5L9MA 1B5JA 3V89B 4YMAA 3S2VA 5I56B 2O1LA 4U21A 1B9JA 2VD3A 2XXHA 3SESA 1IZ1A 4YKIA 5ITOA 4QRZA 3HSTA 4P0IA 3KN3A 4H65A 4F2OA 5F7VA 3PPRA 2FYIA 3QSLA 3FASA 3K6XA 1XOCA 2DVCA 4YKJA 3KZGA 2DXRA 4R74A 4YKKA 4OETA 3V5AA 1D9VA 1JW4A 1NNTA 4QSEA 4YZZA 3M3KA 3OO9A 1FQBA 2VGQA 4OYVA 2PT2A 3C32A 2HCAA 5FHMA 5KZTA 2XXXA 3MW0A 3K1MA 3R26A 5FHOA 4IO6A 1H45A 3MVZA 3MPLA 1N0TA 1F9BA 3EN3A 3FV1A 2B3BA 1SW1A 3MUQA 4OZ9A 3N26A 4ESWA 2V3TA 3MAMA 3O66A 1B58A 5I2KB 2VHAA 4O3AA 4N07A 1Y3NA 1URSA 5TPAA 3OO8A 4EUOA 1EZOA 3E3KA 1NH8A 1SDXA 2UXAA 2XX9A 4GQOA 3ZS6A 4R2BA 1Y9UA 4F1VA 4OXVA 2REJA 1S7YA 1B51A 4HW8A 1PBPA 3LSWA 4TLLB 4IO3A 4ZE8A 2Z22A 2XXWA 2FNCA 1IXCA 2NVUB 5I84A 2AYSA 3QIMA 2I58A 4ZEBA 3FVGA 4XKNA 5ELVA 2Y84A 2Z8EA 2XXRA 2Y7PA 3TTNA 2XX8A 3GLBA 3VLVA 4FJPA 2ONRA 4G77A 2UVHA 3C9HA 3KOTA 1NMUA 3W9VA 4NE4A 1ELJA 3G3HA 1YTVA 1SW2A 3G3IA 2QS4A 4FE8A 2O51A 2NWJA 3TTLA 4NMYA 4ELPA 3FATA 3BFUA 4GD5A 4OHNA 1VFEA 4RPNA 5AA3A 1TFDA 4E0WA 4XKQA 3B6QA 3T9HB 3U1OA 4OERA 4Z7EA 3FD3A 3B6TA 3H06B 1MY1A 3I6VA 5H8HB 2KLFA 3Q26A 2Q2AA 4Q30B 3PUXE 3ZSFA 1PBQA 3O29A 4QFLA 3PMXA 1B4ZA 4OVJA 3SETA 1IQ7A 4G2ZA 3VXBA 4JWXA 4KHZE 1LBBA 5B70A 3TKDA 3FVKA 1NNFA 3G3FA 1MXWA 3F11A 3ILTB 4AB5A 1POTA 3G3JA 2DE2A 3EQ1A 4BDNA 5AA4B 1LCTA 3SEYA 4O3CA 3RGYA 2A5SA 2QPQA 5DVJA 1LFGA 4H5FA 4GVOA 4RXLA 3R6UA 1H44A 4F1YA 4GWOA 3HCQA 4YMBA 1UQWA 1SYHA 2X7PA 2DWIA 4P0GA 2PVUA 3TYHA 3GZGA 3RTFB 1SYIA 3K6WA 1LAHE 1P1WA 4QFNA 4DCXA 1NKXA 4F3SA 1CB6A 2PT1A 3CSBA 1N76A 4N6PA 1Q35A 4XTCQ 3IOUA 1URGA 5A5XB 4DLDA 2DVZA 2D5WA 3H7MA 3CSGA 1TT1A 4GOTA 3K02A 2F34A 1AIVA 4BDMA 2I48A 3L6GA 3PPOA 3H3GA 3H6TA 3IOWA 2FA7A 3MPKA 4NF4A 3RT6B 1XVYA 3KJTA 3K0VA 1J1NA 3BFTA 4PE5B 4DIGA 2BJJX 3UORA 4TLMB 4U1OA 3KBRA 4LP2B 2UVIA 3TCGA 2I6EA 1MH3A 3PMVA 3C35A 4BDQA 4JDFA 5I58B 2VP1A 3VVEA 4GLIA 1XT8A 3LSLA 5J1DA 4IO2A 1IXIA 4KFQA 4ISUA 3UN6A 2NOOA 3CFZA 5H8SA 4FAJA 1XHYA 4ELRA 2V84A 1VR5A 3IO6A
chains in the Genus database with same CATH superfamily
4I3EA 4BDOA 4R6KA 2DS9A 1FBFA 4KPTA 2B4LA 3CG3A 3JZJA 4MLVA 1NV7A 1IMBA 3IOVA 4YB6A 3QYTA 1JEUA 4GL0A 4WXJA 2Q8MA 4N17A 1NNKA 3LUYA 4DDDA 2RC8A 2X7QA 1IITA 4ZZAA 1MY3A 3SEUA 2XXVA 2RF1A 1N7XA 4R75A 1FQFA 1B3HA 5EYFA 4FEDA 2F7CA 4M1VA 1MPDA 3MWBA 1NV6A 3Q29A 1Y3QA 2A5TB 4EQ7A 3M8UA 3TTMA 3FGSA 1LB8A 1ZKBA 5H8NA 4F22A 2GHBA 3QUJA 4RY1A 4G8HA 1PB7A 1B0LA 1FCKA 1UTHA 3CRBA 3U8QA 1NUXA 3C34A 4NAPA 2XXTA 4R6HA 1UIVA 4G4PA 2V93A 1DTZA 3QK6A 1QW0A 1LFHA 4O7IA 4KQPA 1P1UA 4EQBA 5H8FB 4PBQA 3IB1A 1JVYA 2CEXA 3H03A 4UA8A 4GWUA 4MIJA 1MXZA 1JNFA 2XD3A 3IOTA 1WVJA 1LCFA 3O28A 2F6PA 2VPOA 4QXDA 1VDWA 4NG7A 2I4CA 2UYEA 3TQLA 1FTAA 1XC1A 4MCOA 3TMGA 4OEVA 3EPEA 3THIA 4PP0A 3L6HA 5DVFA 5H8QA 1US4A 2F7BA 4M4GA 1B52A 4R2FA 1GGGA 3ILUB 4ONYA 1P1NA 1LEVA 1LBWA 5I56A 4DCYA 5KCJB 4ZS9A 3OOAA 2ZYMA 1FJ9A 3FXBA 3OSRA 5I2NB 4U22A 3KC0A 2PFZA 5ISUA 4GL8A 5DT6A 4KYEA 4RA1A 4XFEA 3OMBA 2LAOA 4P9KA 3IJOB 3FIRA 3PUYE 4OESA 4KI0E 4QBAA 4UABA 1OLCA 3MP1A 2IEEA 2WYPA 4YU0A 1A40A 4JVCA 3FXUA 4O94A 1O64A 4ZEKA 2RINA 4C1TA 4BLAA 4N8GA 1B5IA 1NUYA 5EHMA 1LBYA 1M5CA 3OELA 1B0HA 2F8DA 5BUUA 3RPLB 1YXIA 5IM2A 1DSNA 1MG1A 1B7UA 4PAKA 3B50A 3FV2A 2W7YA 5EHSA 3QAXA 1PEBA 4Q8RA 3QUFA 3H6VA 3C31A 1MQGA 3KFMA 1Y1ZA 2G29A 2IA4A 2ZYKA 3IR1A 4KD5A 5I2KA 2V25A 3K4UA 3GXAA 1FPFA 1NI9A 2I0CA 4HTGA 3VFJA 1UTBB 4DXBA 4PF8A 4PETA 5EQ7A 5K2XA 1INPA 1HSJA 3MBPA 2XXQA 4H67A 1KA0A 4O3BA 3VVDA 1D9QA 2KR0A 4H8JA 4JVIA 2OZZA 3PU5A 2CMOA 3OXNA 5ET5A 2Y5KA 4E0XA 2Q74A 1B40A 3KEIA 5AA1A 4HCYA 4QFOA 3LSXA 1EZPA 1FPIA 1N84A 2ZNTA 2ZYNA 4NF6B 3H6UA 4NN3A 1DK4A 2QVVA 4RPOA 2PYYA 3IO4A 3IL1B 5DYHA 2VD2A 3E13X 3LV0A 2UVJA 4NTLA 4LA9A 3RPWA 4ZEDA 1MRPA 2ABHA 4OFJA 3MVWA 2ZZVA 1QUJA 2QJEA 1IIWA 4LZ5A 1FBGA 2I3WA 2XA5A 4THIA 5IGAA 5JTYB 1IMEA 1MH4A 1FQEA 2DYXA 1WDNA 2WYKA 3U65A 2HQ0A 3FJ7A 4X9TA 3TAJA 5JTYA 1Q9DA 1VE4A 1B05A 3FJMA 4MHFA 4NQ8A 4JSOA 3LUZA 1NV0A 1TXFA 1DOTA 5ICTA 1M5EA 3HN0A 2AIXA 1KA1A 4X1BA 3PD8A 1ANFA 1DPPA 5ITPA 2XXKA 4LZ8A 5K2YA 3T96B 3VDFA 1NL5A 1OQHA 2QVRA 1FPGA 1SPIA 5BWJA 2PFYA 3PV0E 3SDFA 2WKYA 3U94A 4F1UA 2YLNA 2M8CA 3K6VA 4GF8A 1XS5A 2QL3A 2VPNA 3O6GA 1A8EA 5H8HA 3BBRA 3TEPA 4LONB 4ELQA 2UVGA 1A7LA 5HBCA 2CZKA 3E4RA 1LSTA 1MQJA 4POXA 3B6WA 4R6YA 3TTRA 4LVQA 3SERA 4IB2A 4MBPA 2F5XA 5CBRA 4U4SA 1BKAA 1EYIA 3K01A 1AOVA 4XF5A 4X48A 4NF8B 3KSJA 5AA4A 2OK2A 3MZ9A 3H4ZA 1VSOA 3USDA 1O7TA 2P3NA 1OIBA 4I40A 2AL4A 1GV8A 3D4GA 4IGRA 2DSFA 1XVXA 5AA2D 1Y20A 3IK6B 4NF0A 1FW0A 5HM4B 4F3BA 3MJNA 1NUZA 4OENA 1B7HA 5FHNA 1DCUA 4KR5A 4O8MA 2DXYA 4GRKA 3E78A 2D21A 2ANJA 3OO6A 1FTKA 1POY1 3O6IA 3ISPA 1FTLA 2I49A 2YJPA 1I69A 4UACA 4F39A 2O6AA 4IO7A 4P11A 2THIA 5A5XA 4JWYA 4H45A 1RDZA 1MPCA 3P7IA 2GRVA 3Q27A 1JW5A 3K00A 2FIEA 2B4MA 4ESXA 5CMCA 3TCHA 5A5LA 1YZ0A 4XXUA 1FPLA 2QSXA 3T9VA 4FORA 4AB6A 4Z0IA 1MY4A 3UIFA 4RJZA 1MDP1 4PFRA 5CMKA 3MP6A 4WKMA 2NXOA 2XXYA 1BLFA 5KDTB 1ZU0A 4PQJA 4I8CA 2OJTA 1LLSA 5FTIA 4P1EA 4XEQA 3D4CA 1NV3A 4JB7A 1FPBA 4TQUQ 1IEJA 2L5VA 1SD3A 2AL5A 1D4NA 3H6WA 3LC8A 2XHDA 4LZ7A 1FQAA 3IJXB 3TUSA 2R71A 4I9DA 1LGBC 4I1DA 5I57B 3DP8A 2ZXTA 4N81A 4QFKA 4PGNA 5CC2A 5I57A 3A29A 4H46A 5I58A 1GR2A 5L9OA 2OBGA 1MXUA 2GQ1A 3VVFA 1A54A 4JSDA 3B7DA 3W15C 2P1SA 1SVXB 4IR8A 1QKAA 1SQYA 1FBDA 2GH9A 4EF1A 1S50A 5TP9B 2G93A 4PFUA 3QXMA 1SW4A 1KZ8A 4N13A 5TP9A 4WEPA 4YAHX 3VXCA 2P2AA 1HSLA 1OVTA 4PFWA 2RC9A 1PB8A 4ZZEA 1FTOA 3EKIA 3VV5A 2Y5LA 2QS3A 1HSEA 5CMBA 1ZTYA 3PUZE 4F3GA 2V4CA 3T0JA 3U93A 1MXVA 3IX1A 2HHMA 1I6BA 2QMWA 1B3LA 4FECA 1LAFE 5T3JA 3C4MA 1KWHA 2F3DA 1ATGA 1N3WA 2I0BA 4Q0CA 5LTCA 1H3DA 2HXWA 2ONKE 3OEMA 3OEKA 3S4UA 5IAIA 1BTJA 4PC9A 2HXRA 2OWTA 4GWYA 4FBPA 3S9MC 2A5TA 3PGFA 4LATA 1JVXA 1EH3A 2H4IA 2FIXA 1K9YA 4Q5TA 2Z8DA 5EYGA 4RYAA 4OVTA 3D1RA 2HZKA 2PCRA 5ET7A 3RNNA 2Q88A 3AXFA 4MX6A 2GHAA 1P99A 3S9EA 1MY0A 3GBAA 5CMMA 1Q1KA 2Q8JA 2O7IA 4G68B 1LBVA 2OX3A 4ZEFA 2RC7A 1IMFA 3TDJA 3T9XB 4G8NA 4G61A 4AS5A 3SEVA 3DP4A 1EU8A 5H8FA 2QS2A 1S9TA 2VT5A 4DZ1A 1B46A 5JK4A 5DEXB 2DOJA 5CRYA 4R9FA 3FBPA 3RY3A 1B1HA 1OMPA 1R6ZA 1Y4CA 1A55A 3EHTA 1URDA 3HHFA 5I59B 5DVIA 1RYOA 1II5A 1QKBA 3VLUA 4U4XA 2HEUA 3PUWE 2Y7RA 5AE4A 1LBZA 4OANA 3Q28A 3FXQA 1RDXA 5AA2B 4MMPA 3G3KA 3QMFA 2ZYOA 5FTHA 4NWCA 5KCJA 4HS7A 2X26A 3A3CA 4YB5A 4ZDMA 4QHQA 3SZPA 5I2NA 4KCDA 3ONMA 3UA8A 4P56A 1OQGA 3HO7A 2Q89A 3DLNA 4JXIA 1EYKA 5HPQA 4MNPA 3DELB 3CI8A 1US5A 2H98A 2Y7KA 3DP6A 3N5LA 4NWDA 4EQ9A 4R9GA 3TODA 4NF5B 1OVBA 4N6KA 4JBZA 2XWOA 3G7WA 1B6HA 4NF5A 3A09A 4IO5A 3TELA 1A8FA 1M5DA 4H6DA 4OFOA 1N04A 2E0SA 3MSTA 3S9LC 3PPNA 4QF9A 4H5GA 3RYDA 1SW5A 3RPLA 1B3EA 4EF2A 3T66A 1O63A 4F3PA 2R6GE 2DWJA 3MZ1A 5EQ8A 4F31B 2I3VA 4MEVA 3M3FA 1TFAA 2YPNA 3UK4A 1DBZA 4F2QA 4P3LA 3OO7A 3PMWA 4LN5A 3I5OA 4YKPA 2XXIA 2Y7IA 1ZIUA 1ZLQA 1H43A 3WAEA 1M5BA 3TZAA 1DPEA 4OEUA 4X1DA 1N7WA 2HFBA 1PB9A 2P3VA 5I5PA 3IB2A 3M3LA 3NOHA 3KG2A 5TPAB 2Q9TA 1UTBA 1AL3A 4HXVA 3CIJA 1R9QA 1SBPA 4DXUA 4OTEA 2Z8FA 2O7UA 2VOZA 3PD9A 2E1SA 4MH5A 1L5TA 1FQCA 1MY2A 1B32A 4PAIA 1VFDA 5M2VA 3IFCA 1PDAA 3C36A 4IO4A 5F1QA 2P0SA 3SKPA 2R9JA 4N15A 4XIGQ 4C0RA 4NF6A 4H1XA 3MQ9A 2HZLA 2H5YA 1Y3PA 4LUBA 3EHUA 2RKMA 1TWYA 1JQFA 1DMBA 2O69A 3LSFB 2H25A 2ONSA 3FUZA 3O6HA 3U92A 5L9SA 1M5FA 3JYRA 4ZE9A 3FJGA 4EXLA 2FVZA 2DQVA 1Z7ME 2Y7WA 2REGA 4N91A 4U23A 1NFTA 3MZBA 1B5HA 4P8BA 4KYSA 1MQHA 4AS4A 1BP5A 4OVRA 4LQ5A 2ALUA 1MXYA 3RLFE 2HAVA 1EZ9A 3R7XA 2QFLA 1R1NA 3CVGA 3HPIA 2XWVA 1MS7A 1USYE 4X04A 1CE2A 1QUIA 4NX1A 2NUVA 2CZLA 3OENA 3TCFA 3MC2A 2V3UA 3ODBA 3IORA 3KN7A 3VLWA 4PFBA 1FPEA 4DI3D 3RT8A 4BDRA 1AH5A 4IY6A 1T0KA 4F19A 1A99A 2GFEA 4FIMA 2QS1A 3E9XA 4FATA 5LOMA 1SI0A 2XX7A 3EHSA 1D9YA 1OLAA 2DWHA 4YICA 4PFTA 5FBPA 3V8XB 4PBHA 3TFLA 1LFIA 2O68A 2QRYA 1YCJA 3K6UA 2F35A 3O2AA 4I62A 3JV9A 1LBCA 4R72A 4OFLA 1N3XA 1R9LA 1FQDA 1B3FA 4JWOA 1ZJLA 3RUMA 1QULA 3MP8A 2H99A 4H0WA 1G0HA 1IMAA 3HFUA 4NF8A 2HAUA 1H76A 4KCCA 2ESNA 2HPGA 4U1ZA 4U2RA 3GBBA 5B7DA 2H9BA 5ET8A 3RTWB 2QMXA 5CI5A 2BJIA 4H8IA 3TTKA 2RCBA 2D3IA 4F29A 3CHGA 5EQ9A 1IMDA 4OWDA 1RKMA 5JEIA 1P1OA 5EYHA 2F97A 3CR9A 3KN8A 3MVXA 1MQDA 1Y4TA 4GWXA 1GTKA 1ZBMA 4KYDA 1YYZA 2B3FA 3S9NC 5IZ3B 1NV4A 3BIHA 1LB9A 1NH7A 1QVSA 4AQ4A 2QVUA 3ECRA 4ZECA 4ND9A 1FTMA 1FTJA 3CFLA 4WEDA 1FBHA 3V83A 2RCAA 5TU0A 3C33A 3RQTA 5CBSA 1B7ZA 4YB7A 4RNSA 4K3FA 4HCWA 1MPBA 4MF3A 4NEDA 2F6GA 1FBPA 3PPPA 4TOZA 4MLQA 1MQIA 3FZVA 2XXPA 4IGTA 4KXPA 4L17A 4EDPA 4NF4B 4MFIA 4PFIA 4QFPA 5KDTA 1B1XA 2OLBA 2ZNSA 4GFRA 3K1PA 3IB0A 4LQ2A 4PTKA 4PFYA 4DXCA 1LAGE 3KOSA 3KSXA 2ZZXA 5IKBA 3UP9A 4OA4A 4N4UA 4MNIA 3GYYA 4EXKA 4N8YA 1K9ZA 3ZKKA 3KGCA 3T22A 3DM0A 3EF7A 3PUVE 2F36A 3KC1A 4DE8A 1BIYA 1RYXA 2DE3A 4HE1A 2OWSA 1MM7A 2PMSA 3I3VA 3HV1A 1YPNA 4OQOA 4F18A 5DTBA 3T93B 1JEVA 2ZMBA 3K1NA 4GXAA 1AMFA 3OSQA 3UGWA 1MM6A 3LR1A 5F24A 3O9PA 2Z23A 5ICQA 2V3QA 2O1MA 4FEBA 1JW1A 2ZNUA 1LAXA 3TPAA 3B8BA 3PPQA 3A3UA 3N6UA 2WX9A 1PC3A 3MVYA 1P1QA 4OMBA 1YAEA 4XKPA 1QJMA 3LBSA 4G68C 3WAFA 1MXXA 1D3KA 4ELOA 3TQWA 4QSCA 5L8DA 4PCDA 1JETA 3K2DA 1IUDA 1MDQA 4MJOA 4ZEIA 2MKZA 1IXGA 4GXSB 1B3GA 1I6QA 3SEXA 3KJ7A 3OD7A 3T9UA 4PE3A 1IXHA 2O84X 1DTGA 3VE1B 2DE4A 2Q2CA 3FVNA 4IY5A 1Y1MA 2PX1A 3G3GA 1SI1A 1GVCA 2UYFA 4ECFA 3CG1A 5H8NB 1QGXA 2DP8A 1NV2A 1WODA 3FXRA 1UTHB 4POWA 1FBCA 5IZ1A 4RK2A 1RDYA 1NNPA 4OVPA 4XKRA 4R73A 4HE2A 1Z7NE 4G68A 3FVOA 2OCUA 2XD2A 2I4BA 3SEWA 3RN8A 1EYJA 4RK9A 3W9WA 1IMCA 5CM6A 2F7AA 5DEXA 3U72A 3Q25A 4GIZA 5IZZA 4GX6A 3IAZA 4C1UA 3PTYA 1ZMGA 4GBVA 4G8MA 5I59A 1USYH 4GX3A 4QSDA 3BKIB 3N6TA 3ZKLA 2PBWA 2XXUA 2F78A 3HHGA 2B65A 1B4HA 1QUKA 1I6AA 5H8QB 1B2HA 4BDLA 2DWAA 1UIUA 3O97A 2R8TA 5AA2A 3CFXA 3N94A 5L9MA 1B5JA 3V89B 4YMAA 3S2VA 5I56B 2O1LA 4U21A 1B9JA 2VD3A 2XXHA 3SESA 5LDZA 1IZ1A 4YKIA 5ITOA 4QRZA 3ROJA 3HSTA 4P0IA 4HE0A 3KN3A 4H65A 4PAFA 4F2OA 2XWKA 5F7VA 3PPRA 2FYIA 3QSLA 3FASA 3K6XA 1XOCA 4MNCA 2DVCA 4YKJA 3KZGA 2DXRA 4R74A 4YKKA 4OETA 3V5AA 1D9VA 1JW4A 1NNTA 4QSEA 4YZZA 3M3KA 3OO9A 1FQBA 2VGQA 4OYVA 1LBXA 2PT2A 3C32A 2HCAA 1FPJA 5FHMA 5KZTA 2XXXA 3MW0A 3K1MA 3R26A 4I3YA 4IO6A 5FHOA 1H45A 3MVZA 1FRPA 4NGUA 3E79A 1JP4A 3MPLA 1N0TA 1F9BA 3EN3A 3FV1A 2B3BA 5I3SA 1SW1A 3MUQA 1AWBA 4OZ9A 3N26A 4ESWA 2V3TA 3MAMA 3O66A 1B58A 2F3BA 5I2KB 2VHAA 4GBWA 4O3AA 3BIGA 4N07A 1Y3NA 4GWWA 1URSA 5TPAA 3OO8A 3KBZA 2FBPA 4EUOA 1EZOA 3E3KA 1NH8A 1SDXA 3IFAA 5ESYA 2UXAA 2XX9A 4GQOA 3ZS6A 4R2BA 1Y9UA 4F1VA 4OXVA 2REJA 1S7YA 1B51A 4HW8A 1PBPA 3LSWA 4PF6A 4IO3A 4TLLB 4ZE8A 2Z22A 2WEFA 2XXWA 2FNCA 2XWIA 1IXCA 1FBEA 4PDHA 2NVUB 5I84A 2AYSA 3QIMA 2I58A 4ZEBA 3FVGA 4XKNA 4OVQA 1FPDA 5ELVA 2Y84A 2Z8EA 2XXRA 2Y7PA 3TTNA 1XI6A 2XX8A 3GLBA 3VLVA 4FJPA 2ONRA 4G77A 2UVHA 3C9HA 3KOTA 1NMUA 3W9VA 4NE4A 2WBDA 1ELJA 4GX4A 3G3HA 1YTVA 1SW2A 4MAGA 3G3IA 2QS4A 4FE8A 2O51A 2NWJA 3TTLA 4JVDA 4NMYA 4ELPA 2DDKA 3FATA 3BFUA 4GD5A 4OHNA 1VFEA 4RPNA 5AA3A 4X8RA 1TFDA 4E0WA 4XKQA 3B6QA 3T9HB 3U1OA 4OERA 2OWZA 4Z7EA 3FD3A 3B6TA 3H06B 1MY1A 4NHBA 3I6VA 5H8HB 2KLFA 3Q26A 2Q2AA 4Q30B 3PUXE 3ZSFA 1PBQA 3O29A 4GWSA 4QFLA 2KQZA 3PMXA 1B4ZA 4OVJA 3SETA 1IQ7A 4PGPA 4G2ZA 3VXBA 4JWXA 4KHZE 1LBBA 5B70A 3TKDA 5DW8A 3FVKA 1NNFA 2WBBA 3G3FA 1MXWA 2FHYA 1CNQA 1FPKA 3F11A 3ILTB 4AB5A 1POTA 3G3JA 2DE2A 3EQ1A 4BDNA 5AA4B 2CZHA 1NV5A 1LCTA 3SEYA 4O3CA 3RGYA 2A5SA 2QPQA 5DVJA 1LFGA 1NUWA 2CZIA 4H5FA 4GVOA 5I7IA 4RXLA 3R6UA 1H44A 2CEYA 4P47A 4F1YA 4P1LA 4GWOA 3HCQA 1NV1A 4YMBA 1UQWA 1SYHA 2X7PA 2DWIA 4P0GA 2PVUA 3TYHA 3GZGA 3RTFB 1SYIA 3K6WA 1LAHE 5IZ3A 1P1WA 4QFNA 4DCXA 1NKXA 4F3SA 1CB6A 2PT1A 3CSBA 1N76A 4N6PA 1Q35A 4XTCQ 4N6DA 5EQAA 3IOUA 1URGA 5A5XB 4DI4B 4DLDA 2DVZA 2D5WA 3H7MA 3CSGA 1TT1A 3MYUA 2JJKA 4GOTA 2ZZWA 3K02A 2F34A 1AIVA 4BDMA 5ET6A 2I48A 3L6GA 3PPOA 3H3GA 3H6TA 3IOWA 2FA7A 3MPKA 1G0IA 4NF4A 3RT6B 1XVYA 3KJTA 3K0VA 1J1NA 4OVSA 3BFTA 4PE5B 4DIGA 4O7MA 2BJJX 3UORA 1FJ6A 4TLMB 4U1OA 3KBRA 4LP2B 2UVIA 3TCGA 2I6EA 4PDDA 3T1BA 1MH3A 3PMVA 3C35A 4BDQA 4JDFA 5I58B 2VP1A 3VVEA 4GLIA 1XT8A 3LSLA 5J1DA 4IO2A 1IXIA 4KFQA 4ISUA 3UN6A 2NOOA 3CFZA 5J16A 5H8SA 4FAJA 1XHYA 4ELRA 2V84A 1VR5A 1BK4A 4GWZA 1FSAA 3IO6A
chains in the Genus database with same CATH topology
4BDOA 4R6KA 2DS9A 4KPTA 3CG3A 3JZJA 4MLVA 3IOVA 4YB6A 3QYTA 1JEUA 4GL0A 4WXJA 1NNKA 3LUYA 4DDDA 2RC8A 2X7QA 1IITA 4ZZAA 1MY3A 3SEUA 2XXVA 2RF1A 1N7XA 4R75A 1FQFA 1B3HA 5EYFA 4FEDA 2F7CA 4M1VA 1MPDA 3MWBA 3Q29A 1Y3QA 2A5TB 4EQ7A 3M8UA 3TTMA 3FGSA 1LB8A 1ZKBA 5H8NA 4F22A 2GHBA 3QUJA 4RY1A 4G8HA 1PB7A 1B0LA 1FCKA 1UTHA 3CRBA 3U8QA 3C34A 2XXTA 4R6HA 1UIVA 4G4PA 2V93A 1DTZA 3QK6A 1QW0A 1LFHA 4KQPA 1P1UA 4EQBA 5H8FB 3IB1A 1JVYA 3H03A 4UA8A 1MXZA 1JNFA 2XD3A 3IOTA 1WVJA 1LCFA 3O28A 2F6PA 2I4CA 2UYEA 3TQLA 1XC1A 3TMGA 4OEVA 3EPEA 3THIA 4PP0A 3L6HA 5DVFA 5H8QA 1US4A 2F7BA 4M4GA 1B52A 4R2FA 1GGGA 3ILUB 4ONYA 1P1NA 5I56A 4DCYA 5KCJB 4ZS9A 3OOAA 2ZYMA 3OSRA 5I2NB 4U22A 5ISUA 4GL8A 5DT6A 4KYEA 4RA1A 3OMBA 2LAOA 3IJOB 3FIRA 3PUYE 4OESA 4KI0E 1OLCA 3MP1A 2IEEA 4YU0A 1A40A 3FXUA 1O64A 4ZEKA 2RINA 4C1TA 4BLAA 1B5IA 5EHMA 1M5CA 3OELA 1B0HA 2F8DA 5BUUA 1DSNA 1MG1A 1B7UA 3FV2A 2W7YA 5EHSA 3QAXA 1PEBA 4Q8RA 3QUFA 3H6VA 3C31A 1MQGA 3KFMA 1Y1ZA 2G29A 2IA4A 2ZYKA 3IR1A 4KD5A 5I2KA 2V25A 3K4UA 3GXAA 2I0CA 4HTGA 3VFJA 4DXBA 1UTBB 4PETA 5K2XA 1HSJA 3MBPA 2XXQA 4H67A 4O3BA 3VVDA 4H8JA 2OZZA 3PU5A 2CMOA 3OXNA 4E0XA 1B40A 3KEIA 5AA1A 4HCYA 4QFOA 3LSXA 1EZPA 1N84A 2ZNTA 2ZYNA 4NF6B 3H6UA 4RPOA 2PYYA 3IO4A 3IL1B 5DYHA 2VD2A 3E13X 2UVJA 4NTLA 4LA9A 3RPWA 4ZEDA 1MRPA 2ABHA 4OFJA 3MVWA 1QUJA 2QJEA 1IIWA 4LZ5A 2I3WA 4THIA 5JTYB 1MH4A 1FQEA 2DYXA 1WDNA 2HQ0A 3FJ7A 4X9TA 3TAJA 5JTYA 1VE4A 1B05A 3FJMA 4JSOA 1TXFA 5ICTA 1DOTA 1M5EA 3HN0A 2AIXA 4X1BA 3PD8A 1ANFA 1DPPA 5ITPA 4LZ8A 5K2YA 3T96B 3VDFA 1NL5A 1OQHA 5BWJA 3PV0E 3SDFA 2WKYA 3U94A 4F1UA 2YLNA 2M8CA 3K6VA 4GF8A 1XS5A 2QL3A 3O6GA 1A8EA 5H8HA 3BBRA 3TEPA 4LONB 4ELQA 2UVGA 1A7LA 5HBCA 3E4RA 1LSTA 1MQJA 4POXA 3B6WA 4R6YA 3TTRA 4LVQA 3SERA 4IB2A 4MBPA 2F5XA 5CBRA 4U4SA 1BKAA 3K01A 1AOVA 4X48A 4NF8B 3KSJA 5AA4A 2OK2A 3MZ9A 3H4ZA 1VSOA 3USDA 1O7TA 1OIBA 2AL4A 1GV8A 3D4GA 4IGRA 2DSFA 1XVXA 5AA2D 1Y20A 3IK6B 1FW0A 5HM4B 4F3BA 3MJNA 4OENA 1B7HA 5FHNA 4KR5A 2DXYA 4GRKA 2D21A 2ANJA 3OO6A 1FTKA 1POY1 3O6IA 1FTLA 2I49A 2YJPA 1I69A 4UACA 4F39A 2O6AA 4IO7A 4P11A 2THIA 5A5XA 4JWYA 1MPCA 3P7IA 2GRVA 3Q27A 1JW5A 3K00A 4ESXA 5CMCA 3TCHA 4XXUA 2QSXA 3T9VA 4FORA 4AB6A 4Z0IA 1MY4A 3UIFA 4RJZA 1MDP1 5CMKA 3MP6A 4WKMA 2NXOA 2XXYA 1BLFA 5KDTB 1ZU0A 4PQJA 4I8CA 2OJTA 1LLSA 5FTIA 3D4CA 4JB7A 4TQUQ 1IEJA 2AL5A 1SD3A 1D4NA 3H6WA 3LC8A 2XHDA 4LZ7A 1FQAA 3IJXB 3TUSA 2R71A 4I9DA 1LGBC 4I1DA 5I57B 3DP8A 2ZXTA 4QFKA 5CC2A 5I57A 5I58A 1GR2A 5L9OA 2OBGA 1MXUA 3VVFA 1A54A 4JSDA 3B7DA 3W15C 2P1SA 1SVXB 1QKAA 1SQYA 2GH9A 4EF1A 1S50A 5TP9B 2G93A 4PFUA 3QXMA 1SW4A 4N13A 5TP9A 4WEPA 4YAHX 3VXCA 2P2AA 1HSLA 1OVTA 4PFWA 2RC9A 1PB8A 4ZZEA 1FTOA 3VV5A 2QS3A 1HSEA 5CMBA 1ZTYA 3PUZE 4F3GA 3U93A 1MXVA 3IX1A 1I6BA 2QMWA 1B3LA 4FECA 1LAFE 3C4MA 1KWHA 1ATGA 1N3WA 2I0BA 4Q0CA 1H3DA 2HXWA 2ONKE 3OEMA 3OEKA 3S4UA 5IAIA 1BTJA 2OWTA 3S9MC 2A5TA 3PGFA 4LATA 1JVXA 1EH3A 2H4IA 4Q5TA 2Z8DA 4RYAA 2HZKA 3RNNA 2Q88A 3AXFA 2GHAA 1P99A 3S9EA 1MY0A 3GBAA 5CMMA 1Q1KA 2Q8JA 2O7IA 4G68B 4ZEFA 2RC7A 3TDJA 3T9XB 4G8NA 3SEVA 3DP4A 1EU8A 5H8FA 2QS2A 1S9TA 4DZ1A 1B46A 5JK4A 5DEXB 2DOJA 5CRYA 4R9FA 3RY3A 1B1HA 1OMPA 1R6ZA 1Y4CA 1A55A 3EHTA 1URDA 3HHFA 5I59B 5DVIA 1RYOA 1II5A 1QKBA 3VLUA 4U4XA 2HEUA 3PUWE 2Y7RA 5AE4A 3Q28A 3FXQA 5AA2B 3G3KA 2ZYOA 5FTHA 4NWCA 5KCJA 4HS7A 2X26A 3A3CA 4YB5A 4ZDMA 4QHQA 5I2NA 4KCDA 3ONMA 3UA8A 1OQGA 3HO7A 2Q89A 3DLNA 4JXIA 5HPQA 3DELB 3CI8A 1US5A 2H98A 2Y7KA 3DP6A 3N5LA 4NWDA 4EQ9A 4R9GA 3TODA 4NF5B 1OVBA 4JBZA 3G7WA 1B6HA 4NF5A 3A09A 4IO5A 3TELA 1A8FA 1M5DA 4H6DA 4OFOA 1N04A 2E0SA 3S9LC 3PPNA 4QF9A 4H5GA 1SW5A 1B3EA 4EF2A 3T66A 1O63A 4F3PA 2R6GE 2DWJA 3MZ1A 4F31B 2I3VA 3M3FA 1TFAA 2YPNA 3UK4A 4F2QA 3OO7A 3PMWA 4YKPA 3I5OA 2XXIA 2Y7IA 1ZIUA 1ZLQA 1H43A 3WAEA 1M5BA 3TZAA 1DPEA 4OEUA 4X1DA 1N7WA 2HFBA 1PB9A 3IB2A 3M3LA 3KG2A 5TPAB 2Q9TA 1UTBA 1AL3A 3CIJA 1R9QA 1SBPA 4DXUA 4OTEA 2Z8FA 2O7UA 2VOZA 3PD9A 2E1SA 4MH5A 1L5TA 1FQCA 1MY2A 1B32A 1VFDA 5M2VA 1PDAA 3C36A 4IO4A 5F1QA 2P0SA 3SKPA 2R9JA 4XIGQ 4C0RA 4NF6A 4H1XA 3MQ9A 2HZLA 2H5YA 1Y3PA 4LUBA 3EHUA 2RKMA 1TWYA 1JQFA 1DMBA 2O69A 3U92A 2H25A 2ONSA 3FUZA 3LSFB 3O6HA 5L9SA 1M5FA 3JYRA 4ZE9A 3FJGA 4EXLA 2DQVA 1Z7ME 2Y7WA 2REGA 4U23A 1NFTA 3MZBA 1B5HA 4KYSA 1MQHA 1BP5A 4LQ5A 2ALUA 1MXYA 3RLFE 2HAVA 1EZ9A 3R7XA 1R1NA 3CVGA 3HPIA 1MS7A 1USYE 1CE2A 1QUIA 2NUVA 2CZLA 3OENA 3TCFA 3MC2A 2V3UA 3ODBA 3IORA 3KN7A 3VLWA 3RT8A 4BDRA 1AH5A 4IY6A 1T0KA 4F19A 1A99A 2GFEA 4FIMA 2QS1A 3E9XA 4FATA 5LOMA 1SI0A 2XX7A 3EHSA 1D9YA 1OLAA 2DWHA 4YICA 4PFTA 3V8XB 3TFLA 1LFIA 2O68A 2QRYA 1YCJA 3K6UA 2F35A 3O2AA 4I62A 3JV9A 1LBCA 4R72A 4OFLA 1N3XA 1R9LA 1FQDA 1B3FA 4JWOA 1ZJLA 3RUMA 1QULA 3MP8A 2H99A 4H0WA 4NF8A 2HAUA 1H76A 4KCCA 2ESNA 4U1ZA 4U2RA 3GBBA 5B7DA 2H9BA 3RTWB 2QMXA 5CI5A 4H8IA 3TTKA 2RCBA 2D3IA 4F29A 4OWDA 1RKMA 5JEIA 1P1OA 2F97A 3CR9A 3KN8A 3MVXA 1MQDA 1Y4TA 1GTKA 1ZBMA 4KYDA 2B3FA 3S9NC 1LB9A 1NH7A 1QVSA 4AQ4A 3ECRA 4ZECA 4ND9A 1FTMA 1FTJA 3CFLA 4WEDA 3V83A 2RCAA 5TU0A 3C33A 3RQTA 5CBSA 1B7ZA 4YB7A 4RNSA 4K3FA 4HCWA 1MPBA 4MF3A 4NEDA 2F6GA 3PPPA 4TOZA 4MLQA 1MQIA 3FZVA 2XXPA 4IGTA 4L17A 4EDPA 4NF4B 4MFIA 4QFPA 5KDTA 1B1XA 2OLBA 2ZNSA 4GFRA 3K1PA 3IB0A 4LQ2A 4PFYA 4DXCA 1LAGE 3KOSA 3KSXA 5IKBA 3UP9A 4EXKA 3ZKKA 3KGCA 3T22A 3DM0A 3EF7A 3PUVE 2F36A 4DE8A 1BIYA 1RYXA 2DE3A 2OWSA 1MM7A 2PMSA 3I3VA 3HV1A 1YPNA 4OQOA 4F18A 5DTBA 3T93B 1JEVA 2ZMBA 3K1NA 4GXAA 1AMFA 3OSQA 3UGWA 1MM6A 3LR1A 3O9PA 2Z23A 5ICQA 2V3QA 2O1MA 4FEBA 1JW1A 2ZNUA 1LAXA 3TPAA 3PPQA 3A3UA 3N6UA 1PC3A 3MVYA 1P1QA 4OMBA 1YAEA 4XKPA 1QJMA 3LBSA 4G68C 3WAFA 1MXXA 1D3KA 4ELOA 3TQWA 4QSCA 5L8DA 1JETA 3K2DA 1IUDA 1MDQA 4ZEIA 1IXGA 4GXSB 1B3GA 1I6QA 3SEXA 3KJ7A 3OD7A 3T9UA 1IXHA 2O84X 1DTGA 3VE1B 2DE4A 2Q2CA 3FVNA 4IY5A 1Y1MA 2PX1A 3G3GA 1SI1A 1GVCA 2UYFA 4ECFA 3CG1A 5H8NB 2DP8A 1WODA 3FXRA 1UTHB 4POWA 4RK2A 1NNPA 4XKRA 4R73A 1Z7NE 4G68A 3FVOA 2OCUA 2XD2A 2I4BA 3SEWA 3RN8A 4RK9A 3W9WA 5CM6A 2F7AA 3U72A 5DEXA 3Q25A 4GIZA 3IAZA 4C1UA 1ZMGA 4G8MA 5I59A 1USYH 4QSDA 3BKIB 3N6TA 3ZKLA 2PBWA 2XXUA 2F78A 3HHGA 2B65A 1B4HA 1QUKA 1I6AA 5H8QB 1B2HA 4BDLA 2DWAA 1UIUA 3O97A 5AA2A 3CFXA 3N94A 5L9MA 1B5JA 3V89B 4YMAA 3S2VA 5I56B 2O1LA 4U21A 1B9JA 2VD3A 2XXHA 3SESA 1IZ1A 4YKIA 5ITOA 4QRZA 3HSTA 4P0IA 3KN3A 4H65A 4F2OA 5F7VA 3PPRA 2FYIA 3QSLA 3FASA 3K6XA 1XOCA 2DVCA 4YKJA 3KZGA 2DXRA 4R74A 4YKKA 4OETA 3V5AA 1D9VA 1JW4A 1NNTA 4QSEA 4YZZA 3M3KA 3OO9A 1FQBA 2VGQA 4OYVA 2PT2A 3C32A 2HCAA 5FHMA 5KZTA 2XXXA 3MW0A 3K1MA 3R26A 5FHOA 4IO6A 1H45A 3MVZA 3MPLA 1N0TA 1F9BA 3EN3A 3FV1A 2B3BA 1SW1A 3MUQA 4OZ9A 3N26A 4ESWA 2V3TA 3MAMA 3O66A 1B58A 5I2KB 2VHAA 4O3AA 4N07A 1Y3NA 1URSA 5TPAA 3OO8A 4EUOA 1EZOA 3E3KA 1NH8A 1SDXA 2UXAA 2XX9A 4GQOA 3ZS6A 4R2BA 1Y9UA 4F1VA 4OXVA 2REJA 1S7YA 1B51A 4HW8A 1PBPA 3LSWA 4TLLB 4IO3A 4ZE8A 2Z22A 2XXWA 2FNCA 1IXCA 2NVUB 5I84A 2AYSA 3QIMA 2I58A 4ZEBA 3FVGA 4XKNA 5ELVA 2Y84A 2Z8EA 2XXRA 2Y7PA 3TTNA 2XX8A 3GLBA 3VLVA 4FJPA 2ONRA 4G77A 2UVHA 3C9HA 3KOTA 1NMUA 3W9VA 4NE4A 1ELJA 3G3HA 1YTVA 1SW2A 3G3IA 2QS4A 4FE8A 2O51A 2NWJA 3TTLA 4NMYA 4ELPA 3FATA 3BFUA 4GD5A 4OHNA 1VFEA 4RPNA 5AA3A 1TFDA 4E0WA 4XKQA 3B6QA 3T9HB 3U1OA 4OERA 4Z7EA 3FD3A 3B6TA 3H06B 1MY1A 3I6VA 5H8HB 2KLFA 3Q26A 2Q2AA 4Q30B 3PUXE 3ZSFA 1PBQA 3O29A 4QFLA 3PMXA 1B4ZA 4OVJA 3SETA 1IQ7A 4G2ZA 3VXBA 4JWXA 4KHZE 1LBBA 5B70A 3TKDA 3FVKA 1NNFA 3G3FA 1MXWA 3F11A 3ILTB 4AB5A 1POTA 3G3JA 2DE2A 3EQ1A 4BDNA 5AA4B 1LCTA 3SEYA 4O3CA 3RGYA 2A5SA 2QPQA 5DVJA 1LFGA 4H5FA 4GVOA 4RXLA 3R6UA 1H44A 4F1YA 4GWOA 3HCQA 4YMBA 1UQWA 1SYHA 2X7PA 2DWIA 4P0GA 2PVUA 3TYHA 3GZGA 3RTFB 1SYIA 3K6WA 1LAHE 1P1WA 4QFNA 4DCXA 1NKXA 4F3SA 1CB6A 2PT1A 3CSBA 1N76A 4N6PA 1Q35A 4XTCQ 3IOUA 1URGA 5A5XB 4DLDA 2DVZA 2D5WA 3H7MA 3CSGA 1TT1A 4GOTA 3K02A 2F34A 1AIVA 4BDMA 2I48A 3L6GA 3PPOA 3H3GA 3H6TA 3IOWA 2FA7A 3MPKA 4NF4A 3RT6B 1XVYA 3KJTA 3K0VA 1J1NA 3BFTA 4PE5B 4DIGA 2BJJX 3UORA 4TLMB 4U1OA 3KBRA 4LP2B 2UVIA 3TCGA 2I6EA 1MH3A 3PMVA 3C35A 4BDQA 4JDFA 5I58B 2VP1A 3VVEA 4GLIA 1XT8A 3LSLA 5J1DA 4IO2A 1IXIA 4KFQA 4ISUA 3UN6A 2NOOA 3CFZA 5H8SA 4FAJA 1XHYA 4ELRA 2V84A 1VR5A 3IO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDO A;  4R6K A;  2DS9 A;  4KPT A;  3CG3 A;  3JZJ A;  4MLV A;  3IOV A;  4YB6 A;  3QYT A;  1JEU A;  4GL0 A;  4WXJ A;  1NNK A;  3LUY A;  4DDD A;  2RC8 A;  2X7Q A;  1IIT A;  4ZZA A;  1MY3 A;  3SEU A;  2XXV A;  2RF1 A;  1N7X A;  4R75 A;  1FQF A;  1B3H A;  5EYF A;  4FED A;  2F7C A;  4M1V A;  1MPD A;  3MWB A;  3Q29 A;  1Y3Q A;  2A5T B;  4EQ7 A;  3M8U A;  3TTM A;  3FGS A;  1LB8 A;  1ZKB A;  5H8N A;  4F22 A;  2GHB A;  3QUJ A;  4RY1 A;  4G8H A;  1PB7 A;  1B0L A;  1FCK A;  1UTH A;  3CRB A;  3U8Q A;  3C34 A;  2XXT A;  4R6H A;  1UIV A;  4G4P A;  2V93 A;  1DTZ A;  3QK6 A;  1QW0 A;  1LFH A;  4KQP A;  1P1U A;  4EQB A;  5H8F B;  3IB1 A;  1JVY A;  3H03 A;  4UA8 A;  1MXZ A;  1JNF A;  2XD3 A;  3IOT A;  1WVJ A;  1LCF A;  3O28 A;  2F6P A;  2I4C A;  2UYE A;  3TQL A;  1XC1 A;  3TMG A;  4OEV A;  3EPE A;  3THI A;  4PP0 A;  3L6H A;  5DVF A;  5H8Q A;  1US4 A;  2F7B A;  4M4G A;  1B52 A;  4R2F A;  1GGG A;  3ILU B;  4ONY A;  1P1N A;  5I56 A;  4DCY A;  5KCJ B;  4ZS9 A;  3OOA A;  2ZYM A;  3OSR A;  5I2N B;  4U22 A;  5ISU A;  4GL8 A;  5DT6 A;  4KYE A;  4RA1 A;  3OMB A;  2LAO A;  3IJO B;  3FIR A;  3PUY E;  4OES A;  4KI0 E;  1OLC A;  3MP1 A;  2IEE A;  4YU0 A;  1A40 A;  3FXU A;  1O64 A;  4ZEK A;  2RIN A;  4C1T A;  4BLA A;  1B5I A;  5EHM A;  1M5C A;  3OEL A;  1B0H A;  2F8D A;  5BUU A;  1DSN A;  1MG1 A;  1B7U A;  3FV2 A;  2W7Y A;  5EHS A;  3QAX A;  1PEB A;  4Q8R A;  3QUF A;  3H6V A;  3C31 A;  1MQG A;  3KFM A;  1Y1Z A;  2G29 A;  2IA4 A;  2ZYK A;  3IR1 A;  4KD5 A;  5I2K A;  2V25 A;  3K4U A;  3GXA A;  2I0C A;  4HTG A;  3VFJ A;  4DXB A;  1UTB B;  4PET A;  5K2X A;  1HSJ A;  3MBP A;  2XXQ A;  4H67 A;  4O3B A;  3VVD A;  4H8J A;  2OZZ A;  3PU5 A;  2CMO A;  3OXN A;  4E0X A;  1B40 A;  3KEI A;  5AA1 A;  4HCY A;  4QFO A;  3LSX A;  1EZP A;  1N84 A;  2ZNT A;  2ZYN A;  4NF6 B;  3H6U A;  4RPO A;  2PYY A;  3IO4 A;  3IL1 B;  5DYH A;  2VD2 A;  3E13 X;  2UVJ A;  4NTL A;  4LA9 A;  3RPW A;  4ZED A;  1MRP A;  2ABH A;  4OFJ A;  3MVW A;  1QUJ A;  2QJE A;  1IIW A;  4LZ5 A;  2I3W A;  4THI A;  5JTY B;  1MH4 A;  1FQE A;  2DYX A;  1WDN A;  2HQ0 A;  3FJ7 A;  4X9T A;  3TAJ A;  5JTY A;  1VE4 A;  1B05 A;  3FJM A;  4JSO A;  1TXF A;  5ICT A;  1DOT A;  1M5E A;  3HN0 A;  2AIX A;  4X1B A;  3PD8 A;  1ANF A;  1DPP A;  5ITP A;  4LZ8 A;  5K2Y A;  3T96 B;  3VDF A;  1NL5 A;  1OQH A;  5BWJ A;  3PV0 E;  3SDF A;  2WKY A;  3U94 A;  4F1U A;  2YLN A;  2M8C A;  3K6V A;  4GF8 A;  1XS5 A;  2QL3 A;  3O6G A;  1A8E A;  5H8H A;  3BBR A;  3TEP A;  4LON B;  4ELQ A;  2UVG A;  1A7L A;  5HBC A;  3E4R A;  1LST A;  1MQJ A;  4POX A;  3B6W A;  4R6Y A;  3TTR A;  4LVQ A;  3SER A;  4IB2 A;  4MBP A;  2F5X A;  5CBR A;  4U4S A;  1BKA A;  3K01 A;  1AOV A;  4X48 A;  4NF8 B;  3KSJ A;  5AA4 A;  2OK2 A;  3MZ9 A;  3H4Z A;  1VSO A;  3USD A;  1O7T A;  1OIB A;  2AL4 A;  1GV8 A;  3D4G A;  4IGR A;  2DSF A;  1XVX A;  5AA2 D;  1Y20 A;  3IK6 B;  1FW0 A;  5HM4 B;  4F3B A;  3MJN A;  4OEN A;  1B7H A;  5FHN A;  4KR5 A;  2DXY A;  4GRK A;  2D21 A;  2ANJ A;  3OO6 A;  1FTK A;  1POY 1;  3O6I A;  1FTL A;  2I49 A;  2YJP A;  1I69 A;  4UAC A;  4F39 A;  2O6A A;  4IO7 A;  4P11 A;  2THI A;  5A5X A;  4JWY A;  1MPC A;  3P7I A;  2GRV A;  3Q27 A;  1JW5 A;  3K00 A;  4ESX A;  5CMC A;  3TCH A;  4XXU A;  2QSX A;  3T9V A;  4FOR A;  4AB6 A;  4Z0I A;  1MY4 A;  3UIF A;  4RJZ A;  1MDP 1;  5CMK A;  3MP6 A;  4WKM A;  2NXO A;  2XXY A;  1BLF A;  5KDT B;  1ZU0 A;  4PQJ A;  4I8C A;  2OJT A;  1LLS A;  5FTI A;  3D4C A;  4JB7 A;  4TQU Q;  1IEJ A;  2AL5 A;  1SD3 A;  1D4N A;  3H6W A;  3LC8 A;  2XHD A;  4LZ7 A;  1FQA A;  3IJX B;  3TUS A;  2R71 A;  4I9D A;  1LGB C;  4I1D A;  5I57 B;  3DP8 A;  2ZXT A;  4QFK A;  5CC2 A;  5I57 A;  5I58 A;  1GR2 A;  5L9O A;  2OBG A;  1MXU A;  3VVF A;  1A54 A;  4JSD A;  3B7D A;  3W15 C;  2P1S A;  1SVX B;  1QKA A;  1SQY A;  2GH9 A;  4EF1 A;  1S50 A;  5TP9 B;  2G93 A;  4PFU A;  3QXM A;  1SW4 A;  4N13 A;  5TP9 A;  4WEP A;  4YAH X;  3VXC A;  2P2A A;  1HSL A;  1OVT A;  4PFW A;  2RC9 A;  1PB8 A;  4ZZE A;  1FTO A;  3VV5 A;  2QS3 A;  1HSE A;  5CMB A;  1ZTY A;  3PUZ E;  4F3G A;  3U93 A;  1MXV A;  3IX1 A;  1I6B A;  2QMW A;  1B3L A;  4FEC A;  1LAF E;  3C4M A;  1KWH A;  1ATG A;  1N3W A;  2I0B A;  4Q0C A;  1H3D A;  2HXW A;  2ONK E;  3OEM A;  3OEK A;  3S4U A;  5IAI A;  1BTJ A;  2OWT A;  3S9M C;  2A5T A;  3PGF A;  4LAT A;  1JVX A;  1EH3 A;  2H4I A;  4Q5T A;  2Z8D A;  4RYA A;  2HZK A;  3RNN A;  2Q88 A;  3AXF A;  2GHA A;  1P99 A;  3S9E A;  1MY0 A;  3GBA A;  5CMM A;  1Q1K A;  2Q8J A;  2O7I A;  4G68 B;  4ZEF A;  2RC7 A;  3TDJ A;  3T9X B;  4G8N A;  3SEV A;  3DP4 A;  1EU8 A;  5H8F A;  2QS2 A;  1S9T A;  4DZ1 A;  1B46 A;  5JK4 A;  5DEX B;  2DOJ A;  5CRY A;  4R9F A;  3RY3 A;  1B1H A;  1OMP A;  1R6Z A;  1Y4C A;  1A55 A;  3EHT A;  1URD A;  3HHF A;  5I59 B;  5DVI A;  1RYO A;  1II5 A;  1QKB A;  3VLU A;  4U4X A;  2HEU A;  3PUW E;  2Y7R A;  5AE4 A;  3Q28 A;  3FXQ A;  5AA2 B;  3G3K A;  2ZYO A;  5FTH A;  4NWC A;  5KCJ A;  4HS7 A;  2X26 A;  3A3C A;  4YB5 A;  4ZDM A;  4QHQ A;  5I2N A;  4KCD A;  3ONM A;  3UA8 A;  1OQG A;  3HO7 A;  2Q89 A;  3DLN A;  4JXI A;  5HPQ A;  3DEL B;  3CI8 A;  1US5 A;  2H98 A;  2Y7K A;  3DP6 A;  3N5L A;  4NWD A;  4EQ9 A;  4R9G A;  3TOD A;  4NF5 B;  1OVB A;  4JBZ A;  3G7W A;  1B6H A;  4NF5 A;  3A09 A;  4IO5 A;  3TEL A;  1A8F A;  1M5D A;  4H6D A;  4OFO A;  1N04 A;  2E0S A;  3S9L C;  3PPN A;  4QF9 A;  4H5G A;  1SW5 A;  1B3E A;  4EF2 A;  3T66 A;  1O63 A;  4F3P A;  2R6G E;  2DWJ A;  3MZ1 A;  4F31 B;  2I3V A;  3M3F A;  1TFA A;  2YPN A;  3UK4 A;  4F2Q A;  3OO7 A;  3PMW A;  4YKP A;  3I5O A;  2XXI A;  2Y7I A;  1ZIU A;  1ZLQ A;  1H43 A;  3WAE A;  1M5B A;  3TZA A;  1DPE A;  4OEU A;  4X1D A;  1N7W A;  2HFB A;  1PB9 A;  3IB2 A;  3M3L A;  3KG2 A;  5TPA B;  2Q9T A;  1UTB A;  1AL3 A;  3CIJ A;  1R9Q A;  1SBP A;  4DXU A;  4OTE A;  2Z8F A;  2O7U A;  2VOZ A;  3PD9 A;  2E1S A;  4MH5 A;  1L5T A;  1FQC A;  1MY2 A;  1B32 A;  1VFD A;  5M2V A;  1PDA A;  3C36 A;  4IO4 A;  5F1Q A;  2P0S A;  3SKP A;  2R9J A;  4XIG Q;  4C0R A;  4NF6 A;  4H1X A;  3MQ9 A;  2HZL A;  2H5Y A;  1Y3P A;  4LUB A;  3EHU A;  2RKM A;  1TWY A;  1JQF A;  1DMB A;  2O69 A;  3U92 A;  2H25 A;  2ONS A;  3FUZ A;  3LSF B;  3O6H A;  5L9S A;  1M5F A;  3JYR A;  4ZE9 A;  3FJG A;  4EXL A;  2DQV A;  1Z7M E;  2Y7W A;  2REG A;  4U23 A;  1NFT A;  3MZB A;  1B5H A;  4KYS A;  1MQH A;  1BP5 A;  4LQ5 A;  2ALU A;  1MXY A;  3RLF E;  2HAV A;  1EZ9 A;  3R7X A;  1R1N A;  3CVG A;  3HPI A;  1MS7 A;  1USY E;  1CE2 A;  1QUI A;  2NUV A;  2CZL A;  3OEN A;  3TCF A;  3MC2 A;  2V3U A;  3ODB A;  3IOR A;  3KN7 A;  3VLW A;  3RT8 A;  4BDR A;  1AH5 A;  4IY6 A;  1T0K A;  4F19 A;  1A99 A;  2GFE A;  4FIM A;  2QS1 A;  3E9X A;  4FAT A;  5LOM A;  1SI0 A;  2XX7 A;  3EHS A;  1D9Y A;  1OLA A;  2DWH A;  4YIC A;  4PFT A;  3V8X B;  3TFL A;  1LFI A;  2O68 A;  2QRY A;  1YCJ A;  3K6U A;  2F35 A;  3O2A A;  4I62 A;  3JV9 A;  1LBC A;  4R72 A;  4OFL A;  1N3X A;  1R9L A;  1FQD A;  1B3F A;  4JWO A;  1ZJL A;  3RUM A;  1QUL A;  3MP8 A;  2H99 A;  4H0W A;  4NF8 A;  2HAU A;  1H76 A;  4KCC A;  2ESN A;  4U1Z A;  4U2R A;  3GBB A;  5B7D A;  2H9B A;  3RTW B;  2QMX A;  5CI5 A;  4H8I A;  3TTK A;  2RCB A;  2D3I A;  4F29 A;  4OWD A;  1RKM A;  5JEI A;  1P1O A;  2F97 A;  3CR9 A;  3KN8 A;  3MVX A;  1MQD A;  1Y4T A;  1GTK A;  1ZBM A;  4KYD A;  2B3F A;  3S9N C;  1LB9 A;  1NH7 A;  1QVS A;  4AQ4 A;  3ECR A;  4ZEC A;  4ND9 A;  1FTM A;  1FTJ A;  3CFL A;  4WED A;  3V83 A;  2RCA A;  5TU0 A;  3C33 A;  3RQT A;  5CBS A;  1B7Z A;  4YB7 A;  4RNS A;  4K3F A;  4HCW A;  1MPB A;  4MF3 A;  4NED A;  2F6G A;  3PPP A;  4TOZ A;  4MLQ A;  1MQI A;  3FZV A;  2XXP A;  4IGT A;  4L17 A;  4EDP A;  4NF4 B;  4MFI A;  4QFP A;  5KDT A;  1B1X A;  2OLB A;  2ZNS A;  4GFR A;  3K1P A;  3IB0 A;  4LQ2 A;  4PFY A;  4DXC A;  1LAG E;  3KOS A;  3KSX A;  5IKB A;  3UP9 A;  4EXK A;  3ZKK A;  3KGC A;  3T22 A;  3DM0 A;  3EF7 A;  3PUV E;  2F36 A;  4DE8 A;  1BIY A;  1RYX A;  2DE3 A;  2OWS A;  1MM7 A;  2PMS A;  3I3V A;  3HV1 A;  1YPN A;  4OQO A;  4F18 A;  5DTB A;  3T93 B;  1JEV A;  2ZMB A;  3K1N A;  4GXA A;  1AMF A;  3OSQ A;  3UGW A;  1MM6 A;  3LR1 A;  3O9P A;  2Z23 A;  5ICQ A;  2V3Q A;  2O1M A;  4FEB A;  1JW1 A;  2ZNU A;  1LAX A;  3TPA A;  3PPQ A;  3A3U A;  3N6U A;  1PC3 A;  3MVY A;  1P1Q A;  4OMB A;  1YAE A;  4XKP A;  1QJM A;  3LBS A;  4G68 C;  3WAF A;  1MXX A;  1D3K A;  4ELO A;  3TQW A;  4QSC A;  5L8D A;  1JET A;  3K2D A;  1IUD A;  1MDQ A;  4ZEI A;  1IXG A;  4GXS B;  1B3G A;  1I6Q A;  3SEX A;  3KJ7 A;  3OD7 A;  3T9U A;  1IXH A;  2O84 X;  1DTG A;  3VE1 B;  2DE4 A;  2Q2C A;  3FVN A;  4IY5 A;  1Y1M A;  2PX1 A;  3G3G A;  1SI1 A;  1GVC A;  2UYF A;  4ECF A;  3CG1 A;  5H8N B;  2DP8 A;  1WOD A;  3FXR A;  1UTH B;  4POW A;  4RK2 A;  1NNP A;  4XKR A;  4R73 A;  1Z7N E;  4G68 A;  3FVO A;  2OCU A;  2XD2 A;  2I4B A;  3SEW A;  3RN8 A;  4RK9 A;  3W9W A;  5CM6 A;  2F7A A;  3U72 A;  5DEX A;  3Q25 A;  4GIZ A;  3IAZ A;  4C1U A;  1ZMG A;  4G8M A;  5I59 A;  1USY H;  4QSD A;  3BKI B;  3N6T A;  3ZKL A;  2PBW A;  2XXU A;  2F78 A;  3HHG A;  2B65 A;  1B4H A;  1QUK A;  1I6A A;  5H8Q B;  1B2H A;  4BDL A;  2DWA A;  1UIU A;  3O97 A;  5AA2 A;  3CFX A;  3N94 A;  5L9M A;  1B5J A;  3V89 B;  4YMA A;  3S2V A;  5I56 B;  2O1L A;  4U21 A;  1B9J A;  2VD3 A;  2XXH A;  3SES A;  1IZ1 A;  4YKI A;  5ITO A;  4QRZ A;  3HST A;  4P0I A;  3KN3 A;  4H65 A;  4F2O A;  5F7V A;  3PPR A;  2FYI A;  3QSL A;  3FAS A;  3K6X A;  1XOC A;  2DVC A;  4YKJ A;  3KZG A;  2DXR A;  4R74 A;  4YKK A;  4OET A;  3V5A A;  1D9V A;  1JW4 A;  1NNT A;  4QSE A;  4YZZ A;  3M3K A;  3OO9 A;  1FQB A;  2VGQ A;  4OYV A;  2PT2 A;  3C32 A;  2HCA A;  5FHM A;  5KZT A;  2XXX A;  3MW0 A;  3K1M A;  3R26 A;  5FHO A;  4IO6 A;  1H45 A;  3MVZ A;  3MPL A;  1N0T A;  1F9B A;  3EN3 A;  3FV1 A;  2B3B A;  1SW1 A;  3MUQ A;  4OZ9 A;  3N26 A;  4ESW A;  2V3T A;  3MAM A;  3O66 A;  1B58 A;  5I2K B;  2VHA A;  4O3A A;  4N07 A;  1Y3N A;  1URS A;  5TPA A;  3OO8 A;  4EUO A;  1EZO A;  3E3K A;  1NH8 A;  1SDX A;  2UXA A;  2XX9 A;  4GQO A;  3ZS6 A;  4R2B A;  1Y9U A;  4F1V A;  4OXV A;  2REJ A;  1S7Y A;  1B51 A;  4HW8 A;  1PBP A;  3LSW A;  4TLL B;  4IO3 A;  4ZE8 A;  2Z22 A;  2XXW A;  2FNC A;  1IXC A;  2NVU B;  5I84 A;  2AYS A;  3QIM A;  2I58 A;  4ZEB A;  3FVG A;  4XKN A;  5ELV A;  2Y84 A;  2Z8E A;  2XXR A;  2Y7P A;  3TTN A;  2XX8 A;  3GLB A;  3VLV A;  4FJP A;  2ONR A;  4G77 A;  2UVH A;  3C9H A;  3KOT A;  1NMU A;  3W9V A;  4NE4 A;  1ELJ A;  3G3H A;  1YTV A;  1SW2 A;  3G3I A;  2QS4 A;  4FE8 A;  2O51 A;  2NWJ A;  3TTL A;  4NMY A;  4ELP A;  3FAT A;  3BFU A;  4GD5 A;  4OHN A;  1VFE A;  4RPN A;  5AA3 A;  1TFD A;  4E0W A;  4XKQ A;  3B6Q A;  3T9H B;  3U1O A;  4OER A;  4Z7E A;  3FD3 A;  3B6T A;  3H06 B;  1MY1 A;  3I6V A;  5H8H B;  2KLF A;  3Q26 A;  2Q2A A;  4Q30 B;  3PUX E;  3ZSF A;  1PBQ A;  3O29 A;  4QFL A;  3PMX A;  1B4Z A;  4OVJ A;  3SET A;  1IQ7 A;  4G2Z A;  3VXB A;  4JWX A;  4KHZ E;  1LBB A;  5B70 A;  3TKD A;  3FVK A;  1NNF A;  3G3F A;  1MXW A;  3F11 A;  3ILT B;  4AB5 A;  1POT A;  3G3J A;  2DE2 A;  3EQ1 A;  4BDN A;  5AA4 B;  1LCT A;  3SEY A;  4O3C A;  3RGY A;  2A5S A;  2QPQ A;  5DVJ A;  1LFG A;  4H5F A;  4GVO A;  4RXL A;  3R6U A;  1H44 A;  4F1Y A;  4GWO A;  3HCQ A;  4YMB A;  1UQW A;  1SYH A;  2X7P A;  2DWI A;  4P0G A;  2PVU A;  3TYH A;  3GZG A;  3RTF B;  1SYI A;  3K6W A;  1LAH E;  1P1W A;  4QFN A;  4DCX A;  1NKX A;  4F3S A;  1CB6 A;  2PT1 A;  3CSB A;  1N76 A;  4N6P A;  1Q35 A;  4XTC Q;  3IOU A;  1URG A;  5A5X B;  4DLD A;  2DVZ A;  2D5W A;  3H7M A;  3CSG A;  1TT1 A;  4GOT A;  3K02 A;  2F34 A;  1AIV A;  4BDM A;  2I48 A;  3L6G A;  3PPO A;  3H3G A;  3H6T A;  3IOW A;  2FA7 A;  3MPK A;  4NF4 A;  3RT6 B;  1XVY A;  3KJT A;  3K0V A;  1J1N A;  3BFT A;  4PE5 B;  4DIG A;  2BJJ X;  3UOR A;  4TLM B;  4U1O A;  3KBR A;  4LP2 B;  2UVI A;  3TCG A;  2I6E A;  1MH3 A;  3PMV A;  3C35 A;  4BDQ A;  4JDF A;  5I58 B;  2VP1 A;  3VVE A;  4GLI A;  1XT8 A;  3LSL A;  5J1D A;  4IO2 A;  1IXI A;  4KFQ A;  4ISU A;  3UN6 A;  2NOO A;  3CFZ A;  5H8S A;  4FAJ A;  1XHY A;  4ELR A;  2V84 A;  1VR5 A;  3IO6 A; 
#chains in the Genus database with same CATH topology
 4I3E A;  4BDO A;  4R6K A;  2DS9 A;  1FBF A;  4KPT A;  2B4L A;  3CG3 A;  3JZJ A;  4MLV A;  1NV7 A;  1IMB A;  3IOV A;  4YB6 A;  3QYT A;  1JEU A;  4GL0 A;  4WXJ A;  2Q8M A;  4N17 A;  1NNK A;  3LUY A;  4DDD A;  2RC8 A;  2X7Q A;  1IIT A;  4ZZA A;  1MY3 A;  3SEU A;  2XXV A;  2RF1 A;  1N7X A;  4R75 A;  1FQF A;  1B3H A;  5EYF A;  4FED A;  2F7C A;  4M1V A;  1MPD A;  3MWB A;  1NV6 A;  3Q29 A;  1Y3Q A;  2A5T B;  4EQ7 A;  3M8U A;  3TTM A;  3FGS A;  1LB8 A;  1ZKB A;  5H8N A;  4F22 A;  2GHB A;  3QUJ A;  4RY1 A;  4G8H A;  1PB7 A;  1B0L A;  1FCK A;  1UTH A;  3CRB A;  3U8Q A;  1NUX A;  3C34 A;  4NAP A;  2XXT A;  4R6H A;  1UIV A;  4G4P A;  2V93 A;  1DTZ A;  3QK6 A;  1QW0 A;  1LFH A;  4O7I A;  4KQP A;  1P1U A;  4EQB A;  5H8F B;  4PBQ A;  3IB1 A;  1JVY A;  2CEX A;  3H03 A;  4UA8 A;  4GWU A;  4MIJ A;  1MXZ A;  1JNF A;  2XD3 A;  3IOT A;  1WVJ A;  1LCF A;  3O28 A;  2F6P A;  2VPO A;  4QXD A;  1VDW A;  4NG7 A;  2I4C A;  2UYE A;  3TQL A;  1FTA A;  1XC1 A;  4MCO A;  3TMG A;  4OEV A;  3EPE A;  3THI A;  4PP0 A;  3L6H A;  5DVF A;  5H8Q A;  1US4 A;  2F7B A;  4M4G A;  1B52 A;  4R2F A;  1GGG A;  3ILU B;  4ONY A;  1P1N A;  1LEV A;  1LBW A;  5I56 A;  4DCY A;  5KCJ B;  4ZS9 A;  3OOA A;  2ZYM A;  1FJ9 A;  3FXB A;  3OSR A;  5I2N B;  4U22 A;  3KC0 A;  2PFZ A;  5ISU A;  4GL8 A;  5DT6 A;  4KYE A;  4RA1 A;  4XFE A;  3OMB A;  2LAO A;  4P9K A;  3IJO B;  3FIR A;  3PUY E;  4OES A;  4KI0 E;  4QBA A;  4UAB A;  1OLC A;  3MP1 A;  2IEE A;  2WYP A;  4YU0 A;  1A40 A;  4JVC A;  3FXU A;  4O94 A;  1O64 A;  4ZEK A;  2RIN A;  4C1T A;  4BLA A;  4N8G A;  1B5I A;  1NUY A;  5EHM A;  1LBY A;  1M5C A;  3OEL A;  1B0H A;  2F8D A;  5BUU A;  3RPL B;  1YXI A;  5IM2 A;  1DSN A;  1MG1 A;  1B7U A;  4PAK A;  3B50 A;  3FV2 A;  2W7Y A;  5EHS A;  3QAX A;  1PEB A;  4Q8R A;  3QUF A;  3H6V A;  3C31 A;  1MQG A;  3KFM A;  1Y1Z A;  2G29 A;  2IA4 A;  2ZYK A;  3IR1 A;  4KD5 A;  5I2K A;  2V25 A;  3K4U A;  3GXA A;  1FPF A;  1NI9 A;  2I0C A;  4HTG A;  3VFJ A;  1UTB B;  4DXB A;  4PF8 A;  4PET A;  5EQ7 A;  5K2X A;  1INP A;  1HSJ A;  3MBP A;  2XXQ A;  4H67 A;  1KA0 A;  4O3B A;  3VVD A;  1D9Q A;  2KR0 A;  4H8J A;  4JVI A;  2OZZ A;  3PU5 A;  2CMO A;  3OXN A;  5ET5 A;  2Y5K A;  4E0X A;  2Q74 A;  1B40 A;  3KEI A;  5AA1 A;  4HCY A;  4QFO A;  3LSX A;  1EZP A;  1FPI A;  1N84 A;  2ZNT A;  2ZYN A;  4NF6 B;  3H6U A;  4NN3 A;  1DK4 A;  2QVV A;  4RPO A;  2PYY A;  3IO4 A;  3IL1 B;  5DYH A;  2VD2 A;  3E13 X;  3LV0 A;  2UVJ A;  4NTL A;  4LA9 A;  3RPW A;  4ZED A;  1MRP A;  2ABH A;  4OFJ A;  3MVW A;  2ZZV A;  1QUJ A;  2QJE A;  1IIW A;  4LZ5 A;  1FBG A;  2I3W A;  2XA5 A;  4THI A;  5IGA A;  5JTY B;  1IME A;  1MH4 A;  1FQE A;  2DYX A;  1WDN A;  2WYK A;  3U65 A;  2HQ0 A;  3FJ7 A;  4X9T A;  3TAJ A;  5JTY A;  1Q9D A;  1VE4 A;  1B05 A;  3FJM A;  4MHF A;  4NQ8 A;  4JSO A;  3LUZ A;  1NV0 A;  1TXF A;  1DOT A;  5ICT A;  1M5E A;  3HN0 A;  2AIX A;  1KA1 A;  4X1B A;  3PD8 A;  1ANF A;  1DPP A;  5ITP A;  2XXK A;  4LZ8 A;  5K2Y A;  3T96 B;  3VDF A;  1NL5 A;  1OQH A;  2QVR A;  1FPG A;  1SPI A;  5BWJ A;  2PFY A;  3PV0 E;  3SDF A;  2WKY A;  3U94 A;  4F1U A;  2YLN A;  2M8C A;  3K6V A;  4GF8 A;  1XS5 A;  2QL3 A;  2VPN A;  3O6G A;  1A8E A;  5H8H A;  3BBR A;  3TEP A;  4LON B;  4ELQ A;  2UVG A;  1A7L A;  5HBC A;  2CZK A;  3E4R A;  1LST A;  1MQJ A;  4POX A;  3B6W A;  4R6Y A;  3TTR A;  4LVQ A;  3SER A;  4IB2 A;  4MBP A;  2F5X A;  5CBR A;  4U4S A;  1BKA A;  1EYI A;  3K01 A;  1AOV A;  4XF5 A;  4X48 A;  4NF8 B;  3KSJ A;  5AA4 A;  2OK2 A;  3MZ9 A;  3H4Z A;  1VSO A;  3USD A;  1O7T A;  2P3N A;  1OIB A;  4I40 A;  2AL4 A;  1GV8 A;  3D4G A;  4IGR A;  2DSF A;  1XVX A;  5AA2 D;  1Y20 A;  3IK6 B;  4NF0 A;  1FW0 A;  5HM4 B;  4F3B A;  3MJN A;  1NUZ A;  4OEN A;  1B7H A;  5FHN A;  1DCU A;  4KR5 A;  4O8M A;  2DXY A;  4GRK A;  3E78 A;  2D21 A;  2ANJ A;  3OO6 A;  1FTK A;  1POY 1;  3O6I A;  3ISP A;  1FTL A;  2I49 A;  2YJP A;  1I69 A;  4UAC A;  4F39 A;  2O6A A;  4IO7 A;  4P11 A;  2THI A;  5A5X A;  4JWY A;  4H45 A;  1RDZ A;  1MPC A;  3P7I A;  2GRV A;  3Q27 A;  1JW5 A;  3K00 A;  2FIE A;  2B4M A;  4ESX A;  5CMC A;  3TCH A;  5A5L A;  1YZ0 A;  4XXU A;  1FPL A;  2QSX A;  3T9V A;  4FOR A;  4AB6 A;  4Z0I A;  1MY4 A;  3UIF A;  4RJZ A;  1MDP 1;  4PFR A;  5CMK A;  3MP6 A;  4WKM A;  2NXO A;  2XXY A;  1BLF A;  5KDT B;  1ZU0 A;  4PQJ A;  4I8C A;  2OJT A;  1LLS A;  5FTI A;  4P1E A;  4XEQ A;  3D4C A;  1NV3 A;  4JB7 A;  1FPB A;  4TQU Q;  1IEJ A;  2L5V A;  1SD3 A;  2AL5 A;  1D4N A;  3H6W A;  3LC8 A;  2XHD A;  4LZ7 A;  1FQA A;  3IJX B;  3TUS A;  2R71 A;  4I9D A;  1LGB C;  4I1D A;  5I57 B;  3DP8 A;  2ZXT A;  4N81 A;  4QFK A;  4PGN A;  5CC2 A;  5I57 A;  3A29 A;  4H46 A;  5I58 A;  1GR2 A;  5L9O A;  2OBG A;  1MXU A;  2GQ1 A;  3VVF A;  1A54 A;  4JSD A;  3B7D A;  3W15 C;  2P1S A;  1SVX B;  4IR8 A;  1QKA A;  1SQY A;  1FBD A;  2GH9 A;  4EF1 A;  1S50 A;  5TP9 B;  2G93 A;  4PFU A;  3QXM A;  1SW4 A;  1KZ8 A;  4N13 A;  5TP9 A;  4WEP A;  4YAH X;  3VXC A;  2P2A A;  1HSL A;  1OVT A;  4PFW A;  2RC9 A;  1PB8 A;  4ZZE A;  1FTO A;  3EKI A;  3VV5 A;  2Y5L A;  2QS3 A;  1HSE A;  5CMB A;  1ZTY A;  3PUZ E;  4F3G A;  2V4C A;  3T0J A;  3U93 A;  1MXV A;  3IX1 A;  2HHM A;  1I6B A;  2QMW A;  1B3L A;  4FEC A;  1LAF E;  5T3J A;  3C4M A;  1KWH A;  2F3D A;  1ATG A;  1N3W A;  2I0B A;  4Q0C A;  5LTC A;  1H3D A;  2HXW A;  2ONK E;  3OEM A;  3OEK A;  3S4U A;  5IAI A;  1BTJ A;  4PC9 A;  2HXR A;  2OWT A;  4GWY A;  4FBP A;  3S9M C;  2A5T A;  3PGF A;  4LAT A;  1JVX A;  1EH3 A;  2H4I A;  2FIX A;  1K9Y A;  4Q5T A;  2Z8D A;  5EYG A;  4RYA A;  4OVT A;  3D1R A;  2HZK A;  2PCR A;  5ET7 A;  3RNN A;  2Q88 A;  3AXF A;  4MX6 A;  2GHA A;  1P99 A;  3S9E A;  1MY0 A;  3GBA A;  5CMM A;  1Q1K A;  2Q8J A;  2O7I A;  4G68 B;  1LBV A;  2OX3 A;  4ZEF A;  2RC7 A;  1IMF A;  3TDJ A;  3T9X B;  4G8N A;  4G61 A;  4AS5 A;  3SEV A;  3DP4 A;  1EU8 A;  5H8F A;  2QS2 A;  1S9T A;  2VT5 A;  4DZ1 A;  1B46 A;  5JK4 A;  5DEX B;  2DOJ A;  5CRY A;  4R9F A;  3FBP A;  3RY3 A;  1B1H A;  1OMP A;  1R6Z A;  1Y4C A;  1A55 A;  3EHT A;  1URD A;  3HHF A;  5I59 B;  5DVI A;  1RYO A;  1II5 A;  1QKB A;  3VLU A;  4U4X A;  2HEU A;  3PUW E;  2Y7R A;  5AE4 A;  1LBZ A;  4OAN A;  3Q28 A;  3FXQ A;  1RDX A;  5AA2 B;  4MMP A;  3G3K A;  3QMF A;  2ZYO A;  5FTH A;  4NWC A;  5KCJ A;  4HS7 A;  2X26 A;  3A3C A;  4YB5 A;  4ZDM A;  4QHQ A;  3SZP A;  5I2N A;  4KCD A;  3ONM A;  3UA8 A;  4P56 A;  1OQG A;  3HO7 A;  2Q89 A;  3DLN A;  4JXI A;  1EYK A;  5HPQ A;  4MNP A;  3DEL B;  3CI8 A;  1US5 A;  2H98 A;  2Y7K A;  3DP6 A;  3N5L A;  4NWD A;  4EQ9 A;  4R9G A;  3TOD A;  4NF5 B;  1OVB A;  4N6K A;  4JBZ A;  2XWO A;  3G7W A;  1B6H A;  4NF5 A;  3A09 A;  4IO5 A;  3TEL A;  1A8F A;  1M5D A;  4H6D A;  4OFO A;  1N04 A;  2E0S A;  3MST A;  3S9L C;  3PPN A;  4QF9 A;  4H5G A;  3RYD A;  1SW5 A;  3RPL A;  1B3E A;  4EF2 A;  3T66 A;  1O63 A;  4F3P A;  2R6G E;  2DWJ A;  3MZ1 A;  5EQ8 A;  4F31 B;  2I3V A;  4MEV A;  3M3F A;  1TFA A;  2YPN A;  3UK4 A;  1DBZ A;  4F2Q A;  4P3L A;  3OO7 A;  3PMW A;  4LN5 A;  3I5O A;  4YKP A;  2XXI A;  2Y7I A;  1ZIU A;  1ZLQ A;  1H43 A;  3WAE A;  1M5B A;  3TZA A;  1DPE A;  4OEU A;  4X1D A;  1N7W A;  2HFB A;  1PB9 A;  2P3V A;  5I5P A;  3IB2 A;  3M3L A;  3NOH A;  3KG2 A;  5TPA B;  2Q9T A;  1UTB A;  1AL3 A;  4HXV A;  3CIJ A;  1R9Q A;  1SBP A;  4DXU A;  4OTE A;  2Z8F A;  2O7U A;  2VOZ A;  3PD9 A;  2E1S A;  4MH5 A;  1L5T A;  1FQC A;  1MY2 A;  1B32 A;  4PAI A;  1VFD A;  5M2V A;  3IFC A;  1PDA A;  3C36 A;  4IO4 A;  5F1Q A;  2P0S A;  3SKP A;  2R9J A;  4N15 A;  4XIG Q;  4C0R A;  4NF6 A;  4H1X A;  3MQ9 A;  2HZL A;  2H5Y A;  1Y3P A;  4LUB A;  3EHU A;  2RKM A;  1TWY A;  1JQF A;  1DMB A;  2O69 A;  3LSF B;  2H25 A;  2ONS A;  3FUZ A;  3O6H A;  3U92 A;  5L9S A;  1M5F A;  3JYR A;  4ZE9 A;  3FJG A;  4EXL A;  2FVZ A;  2DQV A;  1Z7M E;  2Y7W A;  2REG A;  4N91 A;  4U23 A;  1NFT A;  3MZB A;  1B5H A;  4P8B A;  4KYS A;  1MQH A;  4AS4 A;  1BP5 A;  4OVR A;  4LQ5 A;  2ALU A;  1MXY A;  3RLF E;  2HAV A;  1EZ9 A;  3R7X A;  2QFL A;  1R1N A;  3CVG A;  3HPI A;  2XWV A;  1MS7 A;  1USY E;  4X04 A;  1CE2 A;  1QUI A;  4NX1 A;  2NUV A;  2CZL A;  3OEN A;  3TCF A;  3MC2 A;  2V3U A;  3ODB A;  3IOR A;  3KN7 A;  3VLW A;  4PFB A;  1FPE A;  4DI3 D;  3RT8 A;  4BDR A;  1AH5 A;  4IY6 A;  1T0K A;  4F19 A;  1A99 A;  2GFE A;  4FIM A;  2QS1 A;  3E9X A;  4FAT A;  5LOM A;  1SI0 A;  2XX7 A;  3EHS A;  1D9Y A;  1OLA A;  2DWH A;  4YIC A;  4PFT A;  5FBP A;  3V8X B;  4PBH A;  3TFL A;  1LFI A;  2O68 A;  2QRY A;  1YCJ A;  3K6U A;  2F35 A;  3O2A A;  4I62 A;  3JV9 A;  1LBC A;  4R72 A;  4OFL A;  1N3X A;  1R9L A;  1FQD A;  1B3F A;  4JWO A;  1ZJL A;  3RUM A;  1QUL A;  3MP8 A;  2H99 A;  4H0W A;  1G0H A;  1IMA A;  3HFU A;  4NF8 A;  2HAU A;  1H76 A;  4KCC A;  2ESN A;  2HPG A;  4U1Z A;  4U2R A;  3GBB A;  5B7D A;  2H9B A;  5ET8 A;  3RTW B;  2QMX A;  5CI5 A;  2BJI A;  4H8I A;  3TTK A;  2RCB A;  2D3I A;  4F29 A;  3CHG A;  5EQ9 A;  1IMD A;  4OWD A;  1RKM A;  5JEI A;  1P1O A;  5EYH A;  2F97 A;  3CR9 A;  3KN8 A;  3MVX A;  1MQD A;  1Y4T A;  4GWX A;  1GTK A;  1ZBM A;  4KYD A;  1YYZ A;  2B3F A;  3S9N C;  5IZ3 B;  1NV4 A;  3BIH A;  1LB9 A;  1NH7 A;  1QVS A;  4AQ4 A;  2QVU A;  3ECR A;  4ZEC A;  4ND9 A;  1FTM A;  1FTJ A;  3CFL A;  4WED A;  1FBH A;  3V83 A;  2RCA A;  5TU0 A;  3C33 A;  3RQT A;  5CBS A;  1B7Z A;  4YB7 A;  4RNS A;  4K3F A;  4HCW A;  1MPB A;  4MF3 A;  4NED A;  2F6G A;  1FBP A;  3PPP A;  4TOZ A;  4MLQ A;  1MQI A;  3FZV A;  2XXP A;  4IGT A;  4KXP A;  4L17 A;  4EDP A;  4NF4 B;  4MFI A;  4PFI A;  4QFP A;  5KDT A;  1B1X A;  2OLB A;  2ZNS A;  4GFR A;  3K1P A;  3IB0 A;  4LQ2 A;  4PTK A;  4PFY A;  4DXC A;  1LAG E;  3KOS A;  3KSX A;  2ZZX A;  5IKB A;  3UP9 A;  4OA4 A;  4N4U A;  4MNI A;  3GYY A;  4EXK A;  4N8Y A;  1K9Z A;  3ZKK A;  3KGC A;  3T22 A;  3DM0 A;  3EF7 A;  3PUV E;  2F36 A;  3KC1 A;  4DE8 A;  1BIY A;  1RYX A;  2DE3 A;  4HE1 A;  2OWS A;  1MM7 A;  2PMS A;  3I3V A;  3HV1 A;  1YPN A;  4OQO A;  4F18 A;  5DTB A;  3T93 B;  1JEV A;  2ZMB A;  3K1N A;  4GXA A;  1AMF A;  3OSQ A;  3UGW A;  1MM6 A;  3LR1 A;  5F24 A;  3O9P A;  2Z23 A;  5ICQ A;  2V3Q A;  2O1M A;  4FEB A;  1JW1 A;  2ZNU A;  1LAX A;  3TPA A;  3B8B A;  3PPQ A;  3A3U A;  3N6U A;  2WX9 A;  1PC3 A;  3MVY A;  1P1Q A;  4OMB A;  1YAE A;  4XKP A;  1QJM A;  3LBS A;  4G68 C;  3WAF A;  1MXX A;  1D3K A;  4ELO A;  3TQW A;  4QSC A;  5L8D A;  4PCD A;  1JET A;  3K2D A;  1IUD A;  1MDQ A;  4MJO A;  4ZEI A;  2MKZ A;  1IXG A;  4GXS B;  1B3G A;  1I6Q A;  3SEX A;  3KJ7 A;  3OD7 A;  3T9U A;  4PE3 A;  1IXH A;  2O84 X;  1DTG A;  3VE1 B;  2DE4 A;  2Q2C A;  3FVN A;  4IY5 A;  1Y1M A;  2PX1 A;  3G3G A;  1SI1 A;  1GVC A;  2UYF A;  4ECF A;  3CG1 A;  5H8N B;  1QGX A;  2DP8 A;  1NV2 A;  1WOD A;  3FXR A;  1UTH B;  4POW A;  1FBC A;  5IZ1 A;  4RK2 A;  1RDY A;  1NNP A;  4OVP A;  4XKR A;  4R73 A;  4HE2 A;  1Z7N E;  4G68 A;  3FVO A;  2OCU A;  2XD2 A;  2I4B A;  3SEW A;  3RN8 A;  1EYJ A;  4RK9 A;  3W9W A;  1IMC A;  5CM6 A;  2F7A A;  5DEX A;  3U72 A;  3Q25 A;  4GIZ A;  5IZZ A;  4GX6 A;  3IAZ A;  4C1U A;  3PTY A;  1ZMG A;  4GBV A;  4G8M A;  5I59 A;  1USY H;  4GX3 A;  4QSD A;  3BKI B;  3N6T A;  3ZKL A;  2PBW A;  2XXU A;  2F78 A;  3HHG A;  2B65 A;  1B4H A;  1QUK A;  1I6A A;  5H8Q B;  1B2H A;  4BDL A;  2DWA A;  1UIU A;  3O97 A;  2R8T A;  5AA2 A;  3CFX A;  3N94 A;  5L9M A;  1B5J A;  3V89 B;  4YMA A;  3S2V A;  5I56 B;  2O1L A;  4U21 A;  1B9J A;  2VD3 A;  2XXH A;  3SES A;  5LDZ A;  1IZ1 A;  4YKI A;  5ITO A;  4QRZ A;  3ROJ A;  3HST A;  4P0I A;  4HE0 A;  3KN3 A;  4H65 A;  4PAF A;  4F2O A;  2XWK A;  5F7V A;  3PPR A;  2FYI A;  3QSL A;  3FAS A;  3K6X A;  1XOC A;  4MNC A;  2DVC A;  4YKJ A;  3KZG A;  2DXR A;  4R74 A;  4YKK A;  4OET A;  3V5A A;  1D9V A;  1JW4 A;  1NNT A;  4QSE A;  4YZZ A;  3M3K A;  3OO9 A;  1FQB A;  2VGQ A;  4OYV A;  1LBX A;  2PT2 A;  3C32 A;  2HCA A;  1FPJ A;  5FHM A;  5KZT A;  2XXX A;  3MW0 A;  3K1M A;  3R26 A;  4I3Y A;  4IO6 A;  5FHO A;  1H45 A;  3MVZ A;  1FRP A;  4NGU A;  3E79 A;  1JP4 A;  3MPL A;  1N0T A;  1F9B A;  3EN3 A;  3FV1 A;  2B3B A;  5I3S A;  1SW1 A;  3MUQ A;  1AWB A;  4OZ9 A;  3N26 A;  4ESW A;  2V3T A;  3MAM A;  3O66 A;  1B58 A;  2F3B A;  5I2K B;  2VHA A;  4GBW A;  4O3A A;  3BIG A;  4N07 A;  1Y3N A;  4GWW A;  1URS A;  5TPA A;  3OO8 A;  3KBZ A;  2FBP A;  4EUO A;  1EZO A;  3E3K A;  1NH8 A;  1SDX A;  3IFA A;  5ESY A;  2UXA A;  2XX9 A;  4GQO A;  3ZS6 A;  4R2B A;  1Y9U A;  4F1V A;  4OXV A;  2REJ A;  1S7Y A;  1B51 A;  4HW8 A;  1PBP A;  3LSW A;  4PF6 A;  4IO3 A;  4TLL B;  4ZE8 A;  2Z22 A;  2WEF A;  2XXW A;  2FNC A;  2XWI A;  1IXC A;  1FBE A;  4PDH A;  2NVU B;  5I84 A;  2AYS A;  3QIM A;  2I58 A;  4ZEB A;  3FVG A;  4XKN A;  4OVQ A;  1FPD A;  5ELV A;  2Y84 A;  2Z8E A;  2XXR A;  2Y7P A;  3TTN A;  1XI6 A;  2XX8 A;  3GLB A;  3VLV A;  4FJP A;  2ONR A;  4G77 A;  2UVH A;  3C9H A;  3KOT A;  1NMU A;  3W9V A;  4NE4 A;  2WBD A;  1ELJ A;  4GX4 A;  3G3H A;  1YTV A;  1SW2 A;  4MAG A;  3G3I A;  2QS4 A;  4FE8 A;  2O51 A;  2NWJ A;  3TTL A;  4JVD A;  4NMY A;  4ELP A;  2DDK A;  3FAT A;  3BFU A;  4GD5 A;  4OHN A;  1VFE A;  4RPN A;  5AA3 A;  4X8R A;  1TFD A;  4E0W A;  4XKQ A;  3B6Q A;  3T9H B;  3U1O A;  4OER A;  2OWZ A;  4Z7E A;  3FD3 A;  3B6T A;  3H06 B;  1MY1 A;  4NHB A;  3I6V A;  5H8H B;  2KLF A;  3Q26 A;  2Q2A A;  4Q30 B;  3PUX E;  3ZSF A;  1PBQ A;  3O29 A;  4GWS A;  4QFL A;  2KQZ A;  3PMX A;  1B4Z A;  4OVJ A;  3SET A;  1IQ7 A;  4PGP A;  4G2Z A;  3VXB A;  4JWX A;  4KHZ E;  1LBB A;  5B70 A;  3TKD A;  5DW8 A;  3FVK A;  1NNF A;  2WBB A;  3G3F A;  1MXW A;  2FHY A;  1CNQ A;  1FPK A;  3F11 A;  3ILT B;  4AB5 A;  1POT A;  3G3J A;  2DE2 A;  3EQ1 A;  4BDN A;  5AA4 B;  2CZH A;  1NV5 A;  1LCT A;  3SEY A;  4O3C A;  3RGY A;  2A5S A;  2QPQ A;  5DVJ A;  1LFG A;  1NUW A;  2CZI A;  4H5F A;  4GVO A;  5I7I A;  4RXL A;  3R6U A;  1H44 A;  2CEY A;  4P47 A;  4F1Y A;  4P1L A;  4GWO A;  3HCQ A;  1NV1 A;  4YMB A;  1UQW A;  1SYH A;  2X7P A;  2DWI A;  4P0G A;  2PVU A;  3TYH A;  3GZG A;  3RTF B;  1SYI A;  3K6W A;  1LAH E;  5IZ3 A;  1P1W A;  4QFN A;  4DCX A;  1NKX A;  4F3S A;  1CB6 A;  2PT1 A;  3CSB A;  1N76 A;  4N6P A;  1Q35 A;  4XTC Q;  4N6D A;  5EQA A;  3IOU A;  1URG A;  5A5X B;  4DI4 B;  4DLD A;  2DVZ A;  2D5W A;  3H7M A;  3CSG A;  1TT1 A;  3MYU A;  2JJK A;  4GOT A;  2ZZW A;  3K02 A;  2F34 A;  1AIV A;  4BDM A;  5ET6 A;  2I48 A;  3L6G A;  3PPO A;  3H3G A;  3H6T A;  3IOW A;  2FA7 A;  3MPK A;  1G0I A;  4NF4 A;  3RT6 B;  1XVY A;  3KJT A;  3K0V A;  1J1N A;  4OVS A;  3BFT A;  4PE5 B;  4DIG A;  4O7M A;  2BJJ X;  3UOR A;  1FJ6 A;  4TLM B;  4U1O A;  3KBR A;  4LP2 B;  2UVI A;  3TCG A;  2I6E A;  4PDD A;  3T1B A;  1MH3 A;  3PMV A;  3C35 A;  4BDQ A;  4JDF A;  5I58 B;  2VP1 A;  3VVE A;  4GLI A;  1XT8 A;  3LSL A;  5J1D A;  4IO2 A;  1IXI A;  4KFQ A;  4ISU A;  3UN6 A;  2NOO A;  3CFZ A;  5J16 A;  5H8S A;  4FAJ A;  1XHY A;  4ELR A;  2V84 A;  1VR5 A;  1BK4 A;  4GWZ A;  1FSA A;  3IO6 A; 
#chains in the Genus database with same CATH homology
 4BDO A;  4R6K A;  2DS9 A;  4KPT A;  3CG3 A;  3JZJ A;  4MLV A;  3IOV A;  4YB6 A;  3QYT A;  1JEU A;  4GL0 A;  4WXJ A;  1NNK A;  3LUY A;  4DDD A;  2RC8 A;  2X7Q A;  1IIT A;  4ZZA A;  1MY3 A;  3SEU A;  2XXV A;  2RF1 A;  1N7X A;  4R75 A;  1FQF A;  1B3H A;  5EYF A;  4FED A;  2F7C A;  4M1V A;  1MPD A;  3MWB A;  3Q29 A;  1Y3Q A;  2A5T B;  4EQ7 A;  3M8U A;  3TTM A;  3FGS A;  1LB8 A;  1ZKB A;  5H8N A;  4F22 A;  2GHB A;  3QUJ A;  4RY1 A;  4G8H A;  1PB7 A;  1B0L A;  1FCK A;  1UTH A;  3CRB A;  3U8Q A;  3C34 A;  2XXT A;  4R6H A;  1UIV A;  4G4P A;  2V93 A;  1DTZ A;  3QK6 A;  1QW0 A;  1LFH A;  4KQP A;  1P1U A;  4EQB A;  5H8F B;  3IB1 A;  1JVY A;  3H03 A;  4UA8 A;  1MXZ A;  1JNF A;  2XD3 A;  3IOT A;  1WVJ A;  1LCF A;  3O28 A;  2F6P A;  2I4C A;  2UYE A;  3TQL A;  1XC1 A;  3TMG A;  4OEV A;  3EPE A;  3THI A;  4PP0 A;  3L6H A;  5DVF A;  5H8Q A;  1US4 A;  2F7B A;  4M4G A;  1B52 A;  4R2F A;  1GGG A;  3ILU B;  4ONY A;  1P1N A;  5I56 A;  4DCY A;  5KCJ B;  4ZS9 A;  3OOA A;  2ZYM A;  3OSR A;  5I2N B;  4U22 A;  5ISU A;  4GL8 A;  5DT6 A;  4KYE A;  4RA1 A;  3OMB A;  2LAO A;  3IJO B;  3FIR A;  3PUY E;  4OES A;  4KI0 E;  1OLC A;  3MP1 A;  2IEE A;  4YU0 A;  1A40 A;  3FXU A;  1O64 A;  4ZEK A;  2RIN A;  4C1T A;  4BLA A;  1B5I A;  5EHM A;  1M5C A;  3OEL A;  1B0H A;  2F8D A;  5BUU A;  1DSN A;  1MG1 A;  1B7U A;  3FV2 A;  2W7Y A;  5EHS A;  3QAX A;  1PEB A;  4Q8R A;  3QUF A;  3H6V A;  3C31 A;  1MQG A;  3KFM A;  1Y1Z A;  2G29 A;  2IA4 A;  2ZYK A;  3IR1 A;  4KD5 A;  5I2K A;  2V25 A;  3K4U A;  3GXA A;  2I0C A;  4HTG A;  3VFJ A;  4DXB A;  1UTB B;  4PET A;  5K2X A;  1HSJ A;  3MBP A;  2XXQ A;  4H67 A;  4O3B A;  3VVD A;  4H8J A;  2OZZ A;  3PU5 A;  2CMO A;  3OXN A;  4E0X A;  1B40 A;  3KEI A;  5AA1 A;  4HCY A;  4QFO A;  3LSX A;  1EZP A;  1N84 A;  2ZNT A;  2ZYN A;  4NF6 B;  3H6U A;  4RPO A;  2PYY A;  3IO4 A;  3IL1 B;  5DYH A;  2VD2 A;  3E13 X;  2UVJ A;  4NTL A;  4LA9 A;  3RPW A;  4ZED A;  1MRP A;  2ABH A;  4OFJ A;  3MVW A;  1QUJ A;  2QJE A;  1IIW A;  4LZ5 A;  2I3W A;  4THI A;  5JTY B;  1MH4 A;  1FQE A;  2DYX A;  1WDN A;  2HQ0 A;  3FJ7 A;  4X9T A;  3TAJ A;  5JTY A;  1VE4 A;  1B05 A;  3FJM A;  4JSO A;  1TXF A;  5ICT A;  1DOT A;  1M5E A;  3HN0 A;  2AIX A;  4X1B A;  3PD8 A;  1ANF A;  1DPP A;  5ITP A;  4LZ8 A;  5K2Y A;  3T96 B;  3VDF A;  1NL5 A;  1OQH A;  5BWJ A;  3PV0 E;  3SDF A;  2WKY A;  3U94 A;  4F1U A;  2YLN A;  2M8C A;  3K6V A;  4GF8 A;  1XS5 A;  2QL3 A;  3O6G A;  1A8E A;  5H8H A;  3BBR A;  3TEP A;  4LON B;  4ELQ A;  2UVG A;  1A7L A;  5HBC A;  3E4R A;  1LST A;  1MQJ A;  4POX A;  3B6W A;  4R6Y A;  3TTR A;  4LVQ A;  3SER A;  4IB2 A;  4MBP A;  2F5X A;  5CBR A;  4U4S A;  1BKA A;  3K01 A;  1AOV A;  4X48 A;  4NF8 B;  3KSJ A;  5AA4 A;  2OK2 A;  3MZ9 A;  3H4Z A;  1VSO A;  3USD A;  1O7T A;  1OIB A;  2AL4 A;  1GV8 A;  3D4G A;  4IGR A;  2DSF A;  1XVX A;  5AA2 D;  1Y20 A;  3IK6 B;  1FW0 A;  5HM4 B;  4F3B A;  3MJN A;  4OEN A;  1B7H A;  5FHN A;  4KR5 A;  2DXY A;  4GRK A;  2D21 A;  2ANJ A;  3OO6 A;  1FTK A;  1POY 1;  3O6I A;  1FTL A;  2I49 A;  2YJP A;  1I69 A;  4UAC A;  4F39 A;  2O6A A;  4IO7 A;  4P11 A;  2THI A;  5A5X A;  4JWY A;  1MPC A;  3P7I A;  2GRV A;  3Q27 A;  1JW5 A;  3K00 A;  4ESX A;  5CMC A;  3TCH A;  4XXU A;  2QSX A;  3T9V A;  4FOR A;  4AB6 A;  4Z0I A;  1MY4 A;  3UIF A;  4RJZ A;  1MDP 1;  5CMK A;  3MP6 A;  4WKM A;  2NXO A;  2XXY A;  1BLF A;  5KDT B;  1ZU0 A;  4PQJ A;  4I8C A;  2OJT A;  1LLS A;  5FTI A;  3D4C A;  4JB7 A;  4TQU Q;  1IEJ A;  2AL5 A;  1SD3 A;  1D4N A;  3H6W A;  3LC8 A;  2XHD A;  4LZ7 A;  1FQA A;  3IJX B;  3TUS A;  2R71 A;  4I9D A;  1LGB C;  4I1D A;  5I57 B;  3DP8 A;  2ZXT A;  4QFK A;  5CC2 A;  5I57 A;  5I58 A;  1GR2 A;  5L9O A;  2OBG A;  1MXU A;  3VVF A;  1A54 A;  4JSD A;  3B7D A;  3W15 C;  2P1S A;  1SVX B;  1QKA A;  1SQY A;  2GH9 A;  4EF1 A;  1S50 A;  5TP9 B;  2G93 A;  4PFU A;  3QXM A;  1SW4 A;  4N13 A;  5TP9 A;  4WEP A;  4YAH X;  3VXC A;  2P2A A;  1HSL A;  1OVT A;  4PFW A;  2RC9 A;  1PB8 A;  4ZZE A;  1FTO A;  3VV5 A;  2QS3 A;  1HSE A;  5CMB A;  1ZTY A;  3PUZ E;  4F3G A;  3U93 A;  1MXV A;  3IX1 A;  1I6B A;  2QMW A;  1B3L A;  4FEC A;  1LAF E;  3C4M A;  1KWH A;  1ATG A;  1N3W A;  2I0B A;  4Q0C A;  1H3D A;  2HXW A;  2ONK E;  3OEM A;  3OEK A;  3S4U A;  5IAI A;  1BTJ A;  2OWT A;  3S9M C;  2A5T A;  3PGF A;  4LAT A;  1JVX A;  1EH3 A;  2H4I A;  4Q5T A;  2Z8D A;  4RYA A;  2HZK A;  3RNN A;  2Q88 A;  3AXF A;  2GHA A;  1P99 A;  3S9E A;  1MY0 A;  3GBA A;  5CMM A;  1Q1K A;  2Q8J A;  2O7I A;  4G68 B;  4ZEF A;  2RC7 A;  3TDJ A;  3T9X B;  4G8N A;  3SEV A;  3DP4 A;  1EU8 A;  5H8F A;  2QS2 A;  1S9T A;  4DZ1 A;  1B46 A;  5JK4 A;  5DEX B;  2DOJ A;  5CRY A;  4R9F A;  3RY3 A;  1B1H A;  1OMP A;  1R6Z A;  1Y4C A;  1A55 A;  3EHT A;  1URD A;  3HHF A;  5I59 B;  5DVI A;  1RYO A;  1II5 A;  1QKB A;  3VLU A;  4U4X A;  2HEU A;  3PUW E;  2Y7R A;  5AE4 A;  3Q28 A;  3FXQ A;  5AA2 B;  3G3K A;  2ZYO A;  5FTH A;  4NWC A;  5KCJ A;  4HS7 A;  2X26 A;  3A3C A;  4YB5 A;  4ZDM A;  4QHQ A;  5I2N A;  4KCD A;  3ONM A;  3UA8 A;  1OQG A;  3HO7 A;  2Q89 A;  3DLN A;  4JXI A;  5HPQ A;  3DEL B;  3CI8 A;  1US5 A;  2H98 A;  2Y7K A;  3DP6 A;  3N5L A;  4NWD A;  4EQ9 A;  4R9G A;  3TOD A;  4NF5 B;  1OVB A;  4JBZ A;  3G7W A;  1B6H A;  4NF5 A;  3A09 A;  4IO5 A;  3TEL A;  1A8F A;  1M5D A;  4H6D A;  4OFO A;  1N04 A;  2E0S A;  3S9L C;  3PPN A;  4QF9 A;  4H5G A;  1SW5 A;  1B3E A;  4EF2 A;  3T66 A;  1O63 A;  4F3P A;  2R6G E;  2DWJ A;  3MZ1 A;  4F31 B;  2I3V A;  3M3F A;  1TFA A;  2YPN A;  3UK4 A;  4F2Q A;  3OO7 A;  3PMW A;  4YKP A;  3I5O A;  2XXI A;  2Y7I A;  1ZIU A;  1ZLQ A;  1H43 A;  3WAE A;  1M5B A;  3TZA A;  1DPE A;  4OEU A;  4X1D A;  1N7W A;  2HFB A;  1PB9 A;  3IB2 A;  3M3L A;  3KG2 A;  5TPA B;  2Q9T A;  1UTB A;  1AL3 A;  3CIJ A;  1R9Q A;  1SBP A;  4DXU A;  4OTE A;  2Z8F A;  2O7U A;  2VOZ A;  3PD9 A;  2E1S A;  4MH5 A;  1L5T A;  1FQC A;  1MY2 A;  1B32 A;  1VFD A;  5M2V A;  1PDA A;  3C36 A;  4IO4 A;  5F1Q A;  2P0S A;  3SKP A;  2R9J A;  4XIG Q;  4C0R A;  4NF6 A;  4H1X A;  3MQ9 A;  2HZL A;  2H5Y A;  1Y3P A;  4LUB A;  3EHU A;  2RKM A;  1TWY A;  1JQF A;  1DMB A;  2O69 A;  3U92 A;  2H25 A;  2ONS A;  3FUZ A;  3LSF B;  3O6H A;  5L9S A;  1M5F A;  3JYR A;  4ZE9 A;  3FJG A;  4EXL A;  2DQV A;  1Z7M E;  2Y7W A;  2REG A;  4U23 A;  1NFT A;  3MZB A;  1B5H A;  4KYS A;  1MQH A;  1BP5 A;  4LQ5 A;  2ALU A;  1MXY A;  3RLF E;  2HAV A;  1EZ9 A;  3R7X A;  1R1N A;  3CVG A;  3HPI A;  1MS7 A;  1USY E;  1CE2 A;  1QUI A;  2NUV A;  2CZL A;  3OEN A;  3TCF A;  3MC2 A;  2V3U A;  3ODB A;  3IOR A;  3KN7 A;  3VLW A;  3RT8 A;  4BDR A;  1AH5 A;  4IY6 A;  1T0K A;  4F19 A;  1A99 A;  2GFE A;  4FIM A;  2QS1 A;  3E9X A;  4FAT A;  5LOM A;  1SI0 A;  2XX7 A;  3EHS A;  1D9Y A;  1OLA A;  2DWH A;  4YIC A;  4PFT A;  3V8X B;  3TFL A;  1LFI A;  2O68 A;  2QRY A;  1YCJ A;  3K6U A;  2F35 A;  3O2A A;  4I62 A;  3JV9 A;  1LBC A;  4R72 A;  4OFL A;  1N3X A;  1R9L A;  1FQD A;  1B3F A;  4JWO A;  1ZJL A;  3RUM A;  1QUL A;  3MP8 A;  2H99 A;  4H0W A;  4NF8 A;  2HAU A;  1H76 A;  4KCC A;  2ESN A;  4U1Z A;  4U2R A;  3GBB A;  5B7D A;  2H9B A;  3RTW B;  2QMX A;  5CI5 A;  4H8I A;  3TTK A;  2RCB A;  2D3I A;  4F29 A;  4OWD A;  1RKM A;  5JEI A;  1P1O A;  2F97 A;  3CR9 A;  3KN8 A;  3MVX A;  1MQD A;  1Y4T A;  1GTK A;  1ZBM A;  4KYD A;  2B3F A;  3S9N C;  1LB9 A;  1NH7 A;  1QVS A;  4AQ4 A;  3ECR A;  4ZEC A;  4ND9 A;  1FTM A;  1FTJ A;  3CFL A;  4WED A;  3V83 A;  2RCA A;  5TU0 A;  3C33 A;  3RQT A;  5CBS A;  1B7Z A;  4YB7 A;  4RNS A;  4K3F A;  4HCW A;  1MPB A;  4MF3 A;  4NED A;  2F6G A;  3PPP A;  4TOZ A;  4MLQ A;  1MQI A;  3FZV A;  2XXP A;  4IGT A;  4L17 A;  4EDP A;  4NF4 B;  4MFI A;  4QFP A;  5KDT A;  1B1X A;  2OLB A;  2ZNS A;  4GFR A;  3K1P A;  3IB0 A;  4LQ2 A;  4PFY A;  4DXC A;  1LAG E;  3KOS A;  3KSX A;  5IKB A;  3UP9 A;  4EXK A;  3ZKK A;  3KGC A;  3T22 A;  3DM0 A;  3EF7 A;  3PUV E;  2F36 A;  4DE8 A;  1BIY A;  1RYX A;  2DE3 A;  2OWS A;  1MM7 A;  2PMS A;  3I3V A;  3HV1 A;  1YPN A;  4OQO A;  4F18 A;  5DTB A;  3T93 B;  1JEV A;  2ZMB A;  3K1N A;  4GXA A;  1AMF A;  3OSQ A;  3UGW A;  1MM6 A;  3LR1 A;  3O9P A;  2Z23 A;  5ICQ A;  2V3Q A;  2O1M A;  4FEB A;  1JW1 A;  2ZNU A;  1LAX A;  3TPA A;  3PPQ A;  3A3U A;  3N6U A;  1PC3 A;  3MVY A;  1P1Q A;  4OMB A;  1YAE A;  4XKP A;  1QJM A;  3LBS A;  4G68 C;  3WAF A;  1MXX A;  1D3K A;  4ELO A;  3TQW A;  4QSC A;  5L8D A;  1JET A;  3K2D A;  1IUD A;  1MDQ A;  4ZEI A;  1IXG A;  4GXS B;  1B3G A;  1I6Q A;  3SEX A;  3KJ7 A;  3OD7 A;  3T9U A;  1IXH A;  2O84 X;  1DTG A;  3VE1 B;  2DE4 A;  2Q2C A;  3FVN A;  4IY5 A;  1Y1M A;  2PX1 A;  3G3G A;  1SI1 A;  1GVC A;  2UYF A;  4ECF A;  3CG1 A;  5H8N B;  2DP8 A;  1WOD A;  3FXR A;  1UTH B;  4POW A;  4RK2 A;  1NNP A;  4XKR A;  4R73 A;  1Z7N E;  4G68 A;  3FVO A;  2OCU A;  2XD2 A;  2I4B A;  3SEW A;  3RN8 A;  4RK9 A;  3W9W A;  5CM6 A;  2F7A A;  3U72 A;  5DEX A;  3Q25 A;  4GIZ A;  3IAZ A;  4C1U A;  1ZMG A;  4G8M A;  5I59 A;  1USY H;  4QSD A;  3BKI B;  3N6T A;  3ZKL A;  2PBW A;  2XXU A;  2F78 A;  3HHG A;  2B65 A;  1B4H A;  1QUK A;  1I6A A;  5H8Q B;  1B2H A;  4BDL A;  2DWA A;  1UIU A;  3O97 A;  5AA2 A;  3CFX A;  3N94 A;  5L9M A;  1B5J A;  3V89 B;  4YMA A;  3S2V A;  5I56 B;  2O1L A;  4U21 A;  1B9J A;  2VD3 A;  2XXH A;  3SES A;  1IZ1 A;  4YKI A;  5ITO A;  4QRZ A;  3HST A;  4P0I A;  3KN3 A;  4H65 A;  4F2O A;  5F7V A;  3PPR A;  2FYI A;  3QSL A;  3FAS A;  3K6X A;  1XOC A;  2DVC A;  4YKJ A;  3KZG A;  2DXR A;  4R74 A;  4YKK A;  4OET A;  3V5A A;  1D9V A;  1JW4 A;  1NNT A;  4QSE A;  4YZZ A;  3M3K A;  3OO9 A;  1FQB A;  2VGQ A;  4OYV A;  2PT2 A;  3C32 A;  2HCA A;  5FHM A;  5KZT A;  2XXX A;  3MW0 A;  3K1M A;  3R26 A;  5FHO A;  4IO6 A;  1H45 A;  3MVZ A;  3MPL A;  1N0T A;  1F9B A;  3EN3 A;  3FV1 A;  2B3B A;  1SW1 A;  3MUQ A;  4OZ9 A;  3N26 A;  4ESW A;  2V3T A;  3MAM A;  3O66 A;  1B58 A;  5I2K B;  2VHA A;  4O3A A;  4N07 A;  1Y3N A;  1URS A;  5TPA A;  3OO8 A;  4EUO A;  1EZO A;  3E3K A;  1NH8 A;  1SDX A;  2UXA A;  2XX9 A;  4GQO A;  3ZS6 A;  4R2B A;  1Y9U A;  4F1V A;  4OXV A;  2REJ A;  1S7Y A;  1B51 A;  4HW8 A;  1PBP A;  3LSW A;  4TLL B;  4IO3 A;  4ZE8 A;  2Z22 A;  2XXW A;  2FNC A;  1IXC A;  2NVU B;  5I84 A;  2AYS A;  3QIM A;  2I58 A;  4ZEB A;  3FVG A;  4XKN A;  5ELV A;  2Y84 A;  2Z8E A;  2XXR A;  2Y7P A;  3TTN A;  2XX8 A;  3GLB A;  3VLV A;  4FJP A;  2ONR A;  4G77 A;  2UVH A;  3C9H A;  3KOT A;  1NMU A;  3W9V A;  4NE4 A;  1ELJ A;  3G3H A;  1YTV A;  1SW2 A;  3G3I A;  2QS4 A;  4FE8 A;  2O51 A;  2NWJ A;  3TTL A;  4NMY A;  4ELP A;  3FAT A;  3BFU A;  4GD5 A;  4OHN A;  1VFE A;  4RPN A;  5AA3 A;  1TFD A;  4E0W A;  4XKQ A;  3B6Q A;  3T9H B;  3U1O A;  4OER A;  4Z7E A;  3FD3 A;  3B6T A;  3H06 B;  1MY1 A;  3I6V A;  5H8H B;  2KLF A;  3Q26 A;  2Q2A A;  4Q30 B;  3PUX E;  3ZSF A;  1PBQ A;  3O29 A;  4QFL A;  3PMX A;  1B4Z A;  4OVJ A;  3SET A;  1IQ7 A;  4G2Z A;  3VXB A;  4JWX A;  4KHZ E;  1LBB A;  5B70 A;  3TKD A;  3FVK A;  1NNF A;  3G3F A;  1MXW A;  3F11 A;  3ILT B;  4AB5 A;  1POT A;  3G3J A;  2DE2 A;  3EQ1 A;  4BDN A;  5AA4 B;  1LCT A;  3SEY A;  4O3C A;  3RGY A;  2A5S A;  2QPQ A;  5DVJ A;  1LFG A;  4H5F A;  4GVO A;  4RXL A;  3R6U A;  1H44 A;  4F1Y A;  4GWO A;  3HCQ A;  4YMB A;  1UQW A;  1SYH A;  2X7P A;  2DWI A;  4P0G A;  2PVU A;  3TYH A;  3GZG A;  3RTF B;  1SYI A;  3K6W A;  1LAH E;  1P1W A;  4QFN A;  4DCX A;  1NKX A;  4F3S A;  1CB6 A;  2PT1 A;  3CSB A;  1N76 A;  4N6P A;  1Q35 A;  4XTC Q;  3IOU A;  1URG A;  5A5X B;  4DLD A;  2DVZ A;  2D5W A;  3H7M A;  3CSG A;  1TT1 A;  4GOT A;  3K02 A;  2F34 A;  1AIV A;  4BDM A;  2I48 A;  3L6G A;  3PPO A;  3H3G A;  3H6T A;  3IOW A;  2FA7 A;  3MPK A;  4NF4 A;  3RT6 B;  1XVY A;  3KJT A;  3K0V A;  1J1N A;  3BFT A;  4PE5 B;  4DIG A;  2BJJ X;  3UOR A;  4TLM B;  4U1O A;  3KBR A;  4LP2 B;  2UVI A;  3TCG A;  2I6E A;  1MH3 A;  3PMV A;  3C35 A;  4BDQ A;  4JDF A;  5I58 B;  2VP1 A;  3VVE A;  4GLI A;  1XT8 A;  3LSL A;  5J1D A;  4IO2 A;  1IXI A;  4KFQ A;  4ISU A;  3UN6 A;  2NOO A;  3CFZ A;  5H8S A;  4FAJ A;  1XHY A;  4ELR A;  2V84 A;  1VR5 A;  3IO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...