3CVGA

Crystal structure of a periplasmic putative metal binding protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
270
Chain Sequence
EDVYDGPVQLRIGNGGAGQSGLVKELADAFIKSKVDSGFKVAWYKSDTTVTINYLKDGIVDVGITYSPVAERISIKHGISESPSYYAFRDHFMLIGPPSNPAKLSGDSDIADMFSKMHDAAEAGNTKPPVRFLSRYDKSATNIKEAELWLSIGQVPWATAYSTWYHQYITFPIQALTAAILLREYTITDYGTYLSIPRGLRDQMVIYKKGTNDADDPLLNPAHLLVGARAKNAEMAKEFAKWLVSKEGGQKVIEGFKKDGQQLYSPAPYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal binding protein
publication title Crystal structure of a periplasmic putative metal binding protein.
rcsb
source organism Coccidioides immitis
molecule tags Metal binding protein
total genus 80
structure length 270
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cvgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cvgA02
4TOZA 3SEWA 2DE3A 1QKAA 4AB5A 3RTFB 5EHMA 4R2FA 1HSLA 2NVUB 2Y84A 3IO6A 2I58A 5A5XB 4U1ZA 4M1VA 3S9EA 2DOJA 1NNPA 3UIFA 2QS2A 1MY0A 1SYIA 1B40A 3FGSA 4NF5A 1NH8A 3FXQA 2UVIA 4RPOA 3H6WA 1FTKA 4ZDMA 1SD3A 2I4BA 2RCAA 2Z8DA 1MDQA 2XXVA 3QK6A 5TU0A 3E9XA 3N5LA 3T93B 3LUYA 2H25A 5KZTA 3IOTA 4MLVA 4JDFA 2PMSA 1LBBA 2Q88A 1LFIA 3IR1A 3HHFA 1B0LA 1IQ7A 4HTGA 1NMUA 3ECRA 1TT1A 4JXIA 4GL8A 4IO2A 4ZEBA 4GL0A 5I59A 4Z0IA 1PBPA 1S9TA 5FHNA 3W15C 3MVZA 3L6HA 1BTJA 3A3UA 1EZPA 4ZEKA 4HW8A 1TFDA 5BUUA 4F2QA 1VFDA 3RT6B 3SKPA 2DWHA 4FEBA 1MH3A 1LLSA 3TTRA 1Y3QA 3QIMA 1HSJA 3G3KA 2QS1A 2VHAA 4BDLA 2GHAA 2HQ0A 1ZMGA 4N07A 1B3HA 5I57B 1O7TA 4KD5A 1B2HA 4HCYA 3DP6A 5FHOA 4QFOA 4O3BA 1A8FA 3T66A 1US4A 1MPBA 1URGA 1MY3A 2X7PA 1M5BA 3VV5A 1P99A 1VFEA 4LQ2A 1ZBMA 4XKQA 2AIXA 2V3UA 4L17A 3UN6A 5AE4A 3O66A 4N6PA 5DT6A 1I6BA 4AB6A 3H06B 2XX9A 2OWSA 2VP1A 1MQJA 3CFXA 3D4CA 3M3FA 1R9QA 1EZOA 2O68A 4F39A 3K2DA 3IO4A 2P0SA 3MUQA 3T9XB 1JNFA 2O1LA 2IA4A 4ZZEA 5B70A 3K4UA 3RPWA 3FV1A 2Q2AA 4H1XA 2I3VA 1LBCA 1IXCA 1MG1A 5HBCA 2A5TB 4LUBA 2KLFA 1MM6A 3Q27A 2NUVA 3Q26A 4JBZA 4LP2B 1B7UA 4ONYA 4NF4B 3C36A 1TXFA 1M5EA 1AMFA 5DVFA 3RTWB 3E3KA 4EXLA 3TTNA 3FJGA 3KEIA 3KBRA 3OELA 3QUFA 4IY5A 1P1QA 3FXUA 4F1UA 1BKAA 3IB0A 2XXYA 4PFUA 3ZKKA 2V84A 2UVJA 2Q9TA 1SBPA 3AXFA 4ZEFA 3TTMA 1OVBA 2HZLA 4YKIA 1S7YA 2H5YA 1B7ZA 1P1UA 4R6KA 1FTJA 4XIGQ 3MC2A 3TCFA 4GOTA 4P0GA 4R75A 1FCKA 4QFLA 4NF5B 3K0VA 2ZMBA 3JZJA 2FYIA 4WEDA 2DXYA 1LAGE 4JWXA 2X7QA 1B51A 4BDQA 4H0WA 2OJTA 1SVXB 2V3TA 3IB1A 3OMBA 2PVUA 4OVJA 2HXWA 5CBSA 1EH3A 5A5XA 1POTA 1AOVA 2E1SA 5ISUA 1OIBA 1NH7A 3U93A 4I1DA 3FIRA 2DS9A 1MY2A 5I59B 4EQBA 4KYDA 3THIA 2Y7IA 4NF8A 5CMCA 1M5CA 3PUWE 4GF8A 1D9VA 5I2NA 3C9HA 1QW0A 3V8XB 3SERA 3IJOB 2VOZA 4YICA 1IZ1A 1DPEA 2ZYOA 4EUOA 4ZZAA 3T9VA 1IITA 4F31B 4THIA 4ELPA 2F35A 3JV9A 4U4SA 4R9FA 1OLCA 3K00A 1Y9UA 2B3FA 2RC9A 1B58A 1J1NA 5H8QA 3OO6A 2F7CA 4RYAA 4GIZA 4U1OA 3SEVA 3TCGA 2QS3A 1SW2A 4QF9A 4FE8A 2M8CA 5I2KA 3V89B 3TCHA 1SW4A 3N6TA 2XX8A 4X48A 2ONRA 1O64A 3RY3A 1Y1ZA 4TQUQ 3EHSA 2A5SA 3RGYA 1LAFE 4YKPA 4M4GA 5DEXA 3HHGA 3KGCA 3MWBA 2F34A 5ITOA 2IEEA 4EXKA 3FJMA 1GVCA 4MFIA 1B5JA 3DP4A 1UIUA 1URDA 4G8NA 3C32A 1TFAA 2I6EA 2GHBA 4PFYA 2THIA 3K1PA 1JW1A 1XS5A 3P7IA 1FW0A 3HO7A 3FD3A 4GWOA 3FXRA 3TTKA 4OEVA 3K6VA 4ZEIA 3U92A 3H6UA 5CMKA 1KWHA 1SQYA 2O1MA 1FTLA 1DTGA 1FQDA 1N3WA 3TKDA 3RLFE 2W7YA 4OQOA 3VXBA 1QVSA 4QHQA 1Q1KA 3VVEA 1T0KA 2QMWA 4PFTA 4FEDA 3O6IA 1USYH 4F3PA 2ZYKA 2PBWA 3EN3A 1BLFA 1Y1MA 1SDXA 3FVNA 2ZNSA 4ESXA 4F18A 3OXNA 4JWYA 4G8MA 1SI0A 3OO9A 3W9VA 2Y7PA 5KCJA 4LONB 3MVXA 4EQ7A 3BBRA 4OERA 3FATA 1TWYA 4DZ1A 1JW5A 2F8DA 3KOSA 2QJEA 1JEUA 1LB8A 3OOAA 4NWDA 2V25A 1LFHA 3CFLA 3DM0A 2PT1A 2VD3A 1H76A 2UXAA 1PB9A 3MQ9A 4DXUA 3K6WA 3I3VA 4FIMA 1F9BA 3M8UA 5AA2D 3KN8A 1MXXA 3DP8A 4P11A 1H44A 1D4NA 4IB2A 1WVJA 3OO7A 3T9UA 5L9MA 4IGTA 1RYOA 3MZBA 2O7UA 3PV0E 2DVCA 1XOCA 3K6UA 1NNFA 2CMOA 4POWA 4KI0E 4Q8RA 4ND9A 3Q25A 1PBQA 4I9DA 5IKBA 4NF8B 1B3EA 1MPDA 1SW1A 4O3CA 4QSDA 2AYSA 3N94A 3K1NA 5I2NB 1Z7NE 2X26A 1NL5A 5EHSA 3PUZE 4OEUA 5LOMA 5CMBA 1N76A 1ZKBA 1IUDA 1SYHA 1Q35A 1OVTA 4C0RA 1B3FA 4YB6A 3TQWA 4OETA 2F6GA 5H8QB 3VXCA 5AA3A 4NE4A 4EF1A 4DE8A 3GBBA 1VE4A 3LC8A 1PB7A 3MP6A 5AA1A 5I2KB 3SDFA 3EPEA 1URSA 4UACA 4BLAA 4X9TA 4ZEDA 4YZZA 4YKKA 3TMGA 3CFZA 4DIGA 3L6GA 4R6YA 2XXRA 2OCUA 3RUMA 5DEXB 4OHNA 2O7IA 1B4ZA 1B46A 3ZSFA 4F3BA 3VLWA 4Q0CA 2DXRA 3RQTA 2OK2A 3G3HA 2R71A 5FHMA 3H7MA 3PUVE 3I6VA 2F97A 1MQGA 3O6GA 3OD7A 1RKMA 4OMBA 2I48A 3PPRA 1JQFA 1A8EA 4GD5A 1LB9A 1FTMA 4PETA 4LZ8A 1B9JA 4G8HA 4Z7EA 1WODA 1ZTYA 2H98A 3T96B 2HFBA 1AIVA 4QSCA 2QPQA 3O29A 1R1NA 2Z8FA 5F1QA 5TPAA 3FZVA 2NWJA 3ILUB 1A54A 3EHTA 3F11A 4LZ7A 5HPQA 1PEBA 5DVIA 5DYHA 4FATA 4HS7A 1JVYA 1FQAA 5KCJB 3SEXA 4GFRA 3ZKLA 3HN0A 3MPKA 3MP8A 3UK4A 4OYVA 4G2ZA 4WEPA 3TZAA 3R7XA 1YCJA 2G29A 4XTCQ 2Y7RA 4H8IA 1M5FA 4DLDA 4DXCA 3OSRA 2DVZA 1UTBA 2RINA 3G3IA 5JK4A 1MXUA 2R6GE 1H45A 1MS7A 1QULA 3DLNA 4TLLB 1MXVA 1Y3PA 3ILTB 1P1OA 2ABHA 1YTVA 5DTBA 4RA1A 2LAOA 1DMBA 5AA4A 1LCTA 4NTLA 1MXYA 1PB8A 5K2YA 1QUKA 3MPLA 2ONKE 4KHZE 4GXAA 4ELRA 1FTOA 1B3GA 1DTZA 5CBRA 2OBGA 3DELB 3MW0A 3FVOA 4F1YA 2D5WA 2ONSA 3IB2A 4U21A 3CIJA 2B3BA 2OZZA 3N6UA 4P0IA 2XXIA 2H4IA 4YKJA 3TUSA 2XXTA 1LFGA 4TLMB 1OQHA 3A3CA 3CG3A 2DQVA 1B05A 1XT8A 4MBPA 1GR2A 1ZU0A 2UVHA 3KSXA 1N3XA 3UP9A 3MZ1A 4G77A 1B4HA 1WDNA 4KYSA 4NMYA 3HSTA 1GGGA 4ZS9A 4LATA 3O97A 5J1DA 4XKRA 3PD8A 1MRPA 3C35A 3UORA 1D9YA 4KR5A 3OO8A 3IK6B 5K2XA 4O3AA 4RJZA 3PUXE 3QSLA 3QAXA 2RKMA 4OWDA 1MDP1 4WKMA 2F7AA 5ITPA 4H5GA 4IO6A 1N0TA 3C34A 3KOTA 1EZ9A 5HM4B 3TPAA 4F2OA 1LAHE 1I6AA 4E0WA 2F7BA 1RYXA 3IOWA 1R9LA 3W9WA 3PMWA 4RK2A 1FQFA 2Y7KA 5H8NA 4JSDA 4DDDA 3HPIA 1B1HA 5TPAB 1EU8A 3FVGA 2P2AA 2BJJX 4OFOA 2VD2A 4BDMA 3LSXA 2GFEA 3PD9A 3KFMA 4JSOA 3OEMA 3BKIB 3RNNA 3M3KA 3M3LA 4RK9A 3ZS6A 2QRYA 3KN7A 1YPNA 4FORA 3QUJA 1P1NA 4YMBA 3KN3A 1GV8A 3H03A 5KDTB 4H67A 1CB6A 2XD3A 3GXAA 4IGRA 1ELJA 1FQBA 4GQOA 1MQHA 1Y4CA 4XKPA 3LSWA 2F78A 1MH4A 3KJ7A 1D3KA 3KJTA 1FQEA 3FASA 4YB5A 4N13A 3B6TA 1UTBB 4LZ5A 2PX1A 5L8DA 5I58B 2D3IA 3TAJA 4UA8A 3FV2A 3RN8A 1LSTA 3TELA 3IAZA 2ZNUA 4DXBA 4OFJA 4NF6B 4R9GA 1LAXA 5AA4B 4GRKA 4I62A 4U23A 4Q5TA 2DWIA 3U8QA 4BDRA 2HAUA 3N26A 2ANJA 4ISUA 4X1BA 4IO7A 1Z7ME 4QFPA 1DSNA 3O9PA 3GLBA 2ALUA 2OLBA 4JB7A 3USDA 3LSLA 2DE2A 4PQJA 1H43A 2HCAA 2F5XA 3H6TA 2ZNTA 3FJ7A 3PPQA 2V3QA 2F36A 2OWTA 1A99A 1ATGA 2ZXTA 4EF2A 3VVFA 3VVDA 3HCQA 3BFTA 3MVYA 4K3FA 5JEIA 4HCWA 2XD2A 1Y3NA 2QL3A 5I56A 1NFTA 1BIYA 3JYRA 2Z22A 3O28A 3TTLA 3WAEA 5ICTA 3GBAA 3PPNA 1MPCA 1XC1A 3TFLA 2Q8JA 3FVKA 2DWJA 1IXIA 1P1WA 4EDPA 2WKYA 1MQDA 1GTKA 2P1SA 4QRZA 2QSXA 3CR9A 3O2AA 5L9SA 3OENA 3LR1A 3TODA 4Q30B 3EQ1A 2XXPA 4R2BA 1IXGA 1PDAA 5ELVA 3CI8A 2O69A 2O6AA 4BDNA 2RC8A 3U1OA 3VFJA 1I6QA 4YMAA 2RF1A 4R72A 2I3WA 5CI5A 5H8HA 2I4CA 5M2VA 3D4GA 4ESWA 1XVYA 2XXHA 5CC2A 3U94A 3ONMA 2G93A 4KCDA 3BFUA 3IJXB 1B5IA 3B6QA 1JEVA 1QKBA 1HSEA 5CMMA 5H8NB 1B32A 5H8FA 3PU5A 1SI1A 4RNSA 3EHUA 4IY6A 5L9OA 3S9LC 2Z8EA 2REJA 2O51A 4LQ5A 4JWOA 2REGA 1BP5A 3EF7A 1UTHB 1XVXA 1USYE 4QFKA 1UIVA 2GRVA 4PP0A 4WXJA 5I84A 3PGFA 3RT8A 5TP9A 4YAHX 4ELOA 3G3GA 3CVGA 4QFNA 3T22A 1CE2A 1M5DA 5EYFA 2I0BA 1NNTA 1OQGA 4U4XA 2DWAA 1A55A 4OFLA 3U72A 2VGQA 2RC7A 1LCFA 2FNCA 2QMXA 1ZIUA 1YAEA 3LSFB 4U2RA 2UYEA 1SW5A 2O84X 1H3DA 2XX7A 4KQPA 4LVQA 3H4ZA 4LA9A 3H3GA 4DCYA 3GZGA 2QS4A 3IL1B 1B5HA 1N84A 4G4PA 4GLIA 1OMPA 3MP1A 1JVXA 2XXWA 5KDTA 5AA2A 3G3FA 1N7WA 3SEUA 1ANFA 3I5OA 2XXXA 4RXLA 2R9JA 5IAIA 4PE5B 3UA8A 4G68A 5ICQA 4F22A 1JETA 5I58A 4F1VA 3C4MA 3FUZA 4IO3A 1QUJA 1N04A 2YPNA 3V5AA 3G7WA 2AL4A 4KFQA 4NF6A 3E13X 3QXMA 2I0CA 4F3SA 2CZLA 5JTYA 4H5FA 4ZE8A 2D21A 4MF3A 3VLUA 4F19A 1JW4A 3Q29A 2ZYMA 5I56B 5B7DA 2HZKA 3S4UA 1US5A 1VSOA 4YB7A 5CRYA 4H8JA 4C1TA 2DSFA 4RY1A 2NXOA 3R26A 3OSQA 2YJPA 1LGBC 2DE4A 3UGWA 4DCXA 4GXSB 4F29A 5DVJA 4X1DA 1MQIA 3CSBA 2H99A 2Z23A 2H9BA 2YLNA 4PFWA 2PYYA 4U22A 2I49A 3C33A 4EQ9A 3IORA 4FECA 3S9MC 2GH9A 5H8HB 2HAVA 3R6UA 3B6WA 1B7HA 3TYHA 3HV1A 3C31A 1N7XA 4H6DA 4G68C 1NNKA 2E0SA 1B1XA 2XXUA 3TDJA 2F6PA 5FTIA 1B0HA 1MY1A 4KPTA 3VLVA 4OXVA 5F7VA 2XXQA 2NOOA 2DYXA 1IEJA 5H8FB 4ELQA 4MH5A 3PPPA 4IO5A 1B52A 4QSEA 1A7LA 2V93A 4R73A 2FA7A 1S50A 2DP8A 3OEKA 2Q2CA 1I69A 2B65A 5H8SA 3KZGA 3QYTA 3VDFA 5TP9B 1B6HA 3PMVA 3TEPA 1IXHA 1PC3A 3IOUA 3SESA 3G3JA 4ZECA 1MY4A 1R6ZA 3LBSA 1DPPA 2HEUA 4F3GA 4ZE9A 3PMXA 5FTHA 4FJPA 3S9NC 4E0XA 2Y7WA 4H65A 1L5TA 4OENA 4I8CA 3MVWA 4IO4A 1QJMA 1UTHA 4NWCA 1MM7A 2ESNA 4OZ9A 1II5A 3O6HA 2ZYNA 4R6HA 4POXA 4KYEA 3MAMA 4XKNA 1ZJLA 1O63A 4YU0A 3V83A 1VR5A 4C1UA 5I57A 4BDOA 4RPNA 3H6VA 3S2VA 2XHDA 3K1MA 3ODBA 1QUIA 5AA2B 1Y4TA 1A40A 2Q89A 1NKXA 3WAFA 1Y20A 3SEYA 1MXZA 1DOTA 1IIWA 5CM6A 3K6XA 3VE1B 1FQCA 1ZLQA 1MXWA 4G68B 3SETA 2AL5A 3E4RA 3K02A 1UQWA 3K01A 4FAJA 4KCCA 3MJNA 3CG1A 1XHYA 2UYFA 2RCBA 5JTYB 4MLQA 4ECFA 4OESA 3MBPA 4NEDA 3IX1A 3IOVA 3PUYE 3KG2A 4OTEA 1POY1 3KSJA 3TQLA 4R74A 3A09A 1AL3A 3CRBA 2A5TA 4AQ4A 1B3LA 3Q28A 2PT2A 2UVGA 1AH5A 3PPOA 4GVOA 3MZ9A 4NF4A 3CSGA 4XXUA 1OLAA 3B7DA 3T9HB 5BWJA
chains in the Genus database with same CATH superfamily
4P9KA 4TOZA 3SEWA 2XWVA 2DE3A 1QKAA 1FBCA 4AB5A 3RTFB 5EHMA 4R2FA 1HSLA 2NVUB 2Y84A 4O8MA 3IFAA 2I58A 3IO6A 5A5XB 4U1ZA 4M1VA 3S9EA 5T3JA 2DOJA 1NNPA 3UIFA 2QS2A 1MY0A 1SYIA 1B40A 3FGSA 4NF5A 1NH8A 3FXQA 2UVIA 4RPOA 3HFUA 1FPBA 3H6WA 1FTKA 4HXVA 4ZDMA 1SD3A 2I4BA 2RCAA 1K9ZA 2Z8DA 1MDQA 2XXVA 3QK6A 5TU0A 3E9XA 3N5LA 3T93B 3LUYA 2H25A 5KZTA 3IOTA 4MLVA 4JDFA 2PMSA 1LBBA 2Q88A 1LFIA 2L5VA 3IR1A 3HHFA 1QGXA 1NV3A 1XI6A 1B0LA 1IQ7A 4HTGA 1NMUA 3ECRA 3QMFA 1TT1A 4JXIA 5ESYA 4GL8A 4GX6A 4IO2A 4ZEBA 4GL0A 5I59A 4Z0IA 1PBPA 1S9TA 5FHNA 1FBDA 3W15C 3MVZA 3L6HA 1BTJA 3A3UA 3A29A 1EZPA 4ZEKA 4IR8A 4HW8A 1TFDA 5BUUA 4F2QA 2OWZA 1VFDA 3RT6B 3SKPA 2DWHA 4FEBA 1MH3A 1LLSA 3TTRA 1FRPA 1Y3QA 3QIMA 1HSJA 3G3KA 1YYZA 2QS1A 2VHAA 4BDLA 4GWUA 2GHAA 2HQ0A 4JVDA 1ZMGA 4N07A 1B3HA 5I57B 1O7TA 2CEYA 4KD5A 2WYPA 1B2HA 4HCYA 3DP6A 2Y5LA 5FHOA 4QFOA 5IM2A 4O3BA 1A8FA 3T66A 1US4A 1MPBA 4QXDA 1URGA 1MY3A 2X7PA 1M5BA 3VV5A 2FVZA 4GWZA 1P99A 1VFEA 4LQ2A 5J16A 1ZBMA 4XKQA 4MEVA 2AIXA 2V3UA 4L17A 3UN6A 5AE4A 3O66A 4N6PA 5DT6A 1I6BA 4AB6A 3H06B 2XX9A 2WBDA 2OWSA 2VP1A 1MQJA 3CFXA 3D4CA 3M3FA 1R9QA 1EZOA 2O68A 4F39A 3K2DA 3IO4A 2P0SA 3MUQA 3T9XB 1JNFA 2O1LA 2IA4A 4ZZEA 1RDZA 5B70A 3K4UA 3RPWA 3FV1A 2Q2AA 4H1XA 2I3VA 1LBCA 1IXCA 1FBPA 1FPKA 1MG1A 1G0IA 5HBCA 2A5TB 4LUBA 2KLFA 1MM6A 3Q27A 2NUVA 3Q26A 4JBZA 4LP2B 1B7UA 4ONYA 4NF4B 3C36A 1TXFA 4G61A 1M5EA 1AMFA 5DVFA 3RTWB 3E3KA 4EXLA 3TTNA 3FJGA 3KEIA 3KBRA 3OELA 3QUFA 4IY5A 1P1QA 1RDXA 3FXUA 1LBVA 4F1UA 1BKAA 3IB0A 2XXYA 4PFUA 3ZKKA 2V84A 2UVJA 2Q9TA 1SBPA 3AXFA 4ZEFA 4O7IA 3TTMA 1OVBA 2HZLA 4YKIA 1S7YA 2H5YA 1B7ZA 1P1UA 4R6KA 1FTJA 2B4LA 4XIGQ 3MC2A 3TCFA 4GOTA 5F24A 4P0GA 4R75A 5I7IA 1FCKA 4QFLA 4NF5B 1LEVA 3K0VA 2ZMBA 3JZJA 2FIEA 2FYIA 4WEDA 3B50A 2DXYA 1LAGE 4OVQA 4JWXA 2X7QA 1B51A 4BDQA 4H0WA 2OJTA 1SVXB 2V3TA 3IB1A 3OMBA 2PVUA 4OVJA 2HXWA 5CBSA 1FBEA 1EH3A 5A5XA 1POTA 2P3VA 4OVTA 1AOVA 2E1SA 5ISUA 1OIBA 1NH7A 3U93A 1FPGA 4GBVA 4I1DA 3FIRA 2DS9A 4GX4A 1MY2A 5I59B 4EQBA 4KYDA 3THIA 2Y7IA 4NF8A 5CMCA 1M5CA 3PUWE 4GF8A 1D9VA 5I2NA 3C9HA 1QW0A 2FIXA 3V8XB 3SERA 3IJOB 4GWWA 2VOZA 4YICA 1IZ1A 1NUXA 1DPEA 2ZYOA 4EUOA 4ZZAA 3T9VA 1IITA 4F31B 4THIA 4ELPA 2F35A 4OVRA 3JV9A 2PFZA 4P1LA 4U4SA 4R9FA 1OLCA 3K00A 1Y9UA 2B3FA 2RC9A 1B58A 1J1NA 5H8QA 2XWOA 3OO6A 2F7CA 4RYAA 4GIZA 4U1OA 3SEVA 3TCGA 4QF9A 2QS3A 1SW2A 4GWXA 4FE8A 2M8CA 5I2KA 3V89B 3TCHA 1FSAA 1SW4A 3N6TA 2XX8A 4X48A 2ONRA 1O64A 3RY3A 1Y1ZA 4TQUQ 3EHSA 2A5SA 2P3NA 3RGYA 1LAFE 1NV5A 4YKPA 4M4GA 5DEXA 3HHGA 3KGCA 3MWBA 2F34A 4XF5A 5ITOA 3T1BA 2IEEA 4EXKA 3FJMA 1GVCA 4MFIA 1B5JA 3DP4A 1UIUA 4AS4A 1URDA 4G8NA 3C32A 1TFAA 2I6EA 2GHBA 4PFYA 2THIA 3K1PA 1JW1A 1XS5A 3RPLA 3P7IA 1FW0A 3HO7A 3FD3A 1NV4A 4GWOA 4KXPA 3FXRA 3TTKA 4OEVA 4FBPA 2VPOA 3NOHA 3K6VA 4ZEIA 3U92A 3H6UA 5CMKA 1KWHA 1SQYA 2GQ1A 2O1MA 1FTLA 1DTGA 1FQDA 1N3WA 3TKDA 3RLFE 2W7YA 4OQOA 3VXBA 1QVSA 4QHQA 1Q9DA 1Q1KA 3VVEA 4N6DA 1T0KA 2QMWA 4PFTA 4FEDA 3O6IA 1USYH 4F3PA 2ZYKA 2PBWA 2FBPA 3EN3A 1BLFA 1Y1MA 1SDXA 3FVNA 2ZNSA 4ESXA 4F18A 3OXNA 4JWYA 4G8MA 1SI0A 3EKIA 3OO9A 3W9VA 2Y7PA 5KCJA 4LONB 3MVXA 4EQ7A 3BBRA 4OERA 3FATA 1TWYA 3E79A 4DZ1A 1JW5A 2F8DA 3KOSA 2QJEA 1JEUA 1LB8A 3OOAA 4NWDA 2V25A 4MNCA 1LFHA 3CFLA 2CZHA 3DM0A 1NI9A 2PT1A 4PGPA 2VD3A 1H76A 4N81A 2UXAA 1PB9A 3MQ9A 4DXUA 2Q8MA 3K6WA 3D1RA 3MYUA 4XEQA 2XWKA 3I3VA 1LBXA 4N15A 4FIMA 1F9BA 3M8UA 5AA2D 3KN8A 1MXXA 3DP8A 4P11A 2F3DA 1H44A 1D4NA 4IB2A 1WVJA 3OO7A 3T9UA 4UABA 5L9MA 4IGTA 1RYOA 3MZBA 2O7UA 3PV0E 2DVCA 1XOCA 1BK4A 3K6UA 1NNFA 2CMOA 4POWA 4KI0E 4Q8RA 2V4CA 4ND9A 3Q25A 1PBQA 4MCOA 4I9DA 4MNIA 5IKBA 4NF8B 1B3EA 1MPDA 1SW1A 4O3CA 1FBHA 4QSDA 2AYSA 3N94A 3K1NA 5I2NB 1Z7NE 2X26A 1NL5A 5EHSA 3PUZE 1FPDA 4OEUA 5LOMA 1N76A 1ZKBA 5CMBA 1IUDA 3KBZA 1NV1A 1SYHA 2FHYA 1Q35A 1OVTA 4C0RA 1B3FA 4YB6A 4PBHA 3TQWA 4OETA 2F6GA 5H8QB 3VXCA 5AA3A 4NE4A 4EF1A 4DE8A 3GBBA 1VE4A 3LC8A 1PB7A 3MP6A 5AA1A 1NUWA 5I2KB 3B8BA 3SDFA 3EPEA 1URSA 4N8GA 4UACA 4BLAA 5EYHA 4X9TA 5EQAA 4ZEDA 4YZZA 4YKKA 4O7MA 3TMGA 3CFZA 4DIGA 3L6GA 4R6YA 3ISPA 2XXRA 3T0JA 1KA0A 5EYGA 2OCUA 3RUMA 5DEXB 4OHNA 2O7IA 1B4ZA 2VT5A 2DDKA 1B46A 3ZSFA 4F3BA 3VLWA 4Q0CA 2DXRA 3RQTA 2OK2A 3G3HA 4PF6A 2R71A 5FHMA 3H7MA 3PUVE 2CZIA 3I6VA 2F97A 1MQGA 3O6GA 3OD7A 4OVPA 3RPLB 1RKMA 4OMBA 2I48A 5EQ8A 3PPRA 4N6KA 1JQFA 1A8EA 4GD5A 1LB9A 1FTMA 3MSTA 4LZ8A 1B9JA 4PETA 4G8HA 4Z7EA 2KQZA 1WODA 1ZTYA 2H98A 3T96B 2HFBA 1AIVA 4QSCA 2QPQA 3O29A 1R1NA 2Z8FA 4JVIA 5F1QA 5TPAA 3FZVA 2NWJA 1FJ6A 3ILUB 5IZ3A 1A54A 3EHTA 3F11A 4LZ7A 5HPQA 3BIHA 1PEBA 5DVIA 5DYHA 4FATA 1DK4A 1KZ8A 4I40A 4HS7A 1JVYA 1FQAA 5KCJB 3SEXA 4GFRA 3ZKLA 3HN0A 3MPKA 3MP8A 3UK4A 4OYVA 4G2ZA 4WEPA 3TZAA 3R7XA 1YCJA 2VPNA 2G29A 4QBAA 4XTCQ 2Y7RA 4H8IA 1M5FA 4PAFA 4DLDA 4DXCA 3OSRA 2DVZA 1UTBA 3BIGA 2RINA 2ZZWA 3G3IA 5JK4A 1MXUA 2R6GE 1H45A 1MS7A 4X8RA 1FPFA 1QULA 3DLNA 4TLLB 1MXVA 1Y3PA 3ILTB 1P1OA 2ABHA 1YTVA 5DTBA 4RA1A 2LAOA 1DMBA 5AA4A 1LCTA 4NTLA 1MXYA 1PB8A 5K2YA 1QUKA 3MPLA 2ONKE 4KHZE 4GXAA 4ELRA 1FTOA 1RDYA 1B3GA 1DTZA 5IZZA 5CBRA 4PFIA 4H45A 2OBGA 1FPIA 3DELB 5EQ7A 3MW0A 4HE2A 3FVOA 4F1YA 2D5WA 4N17A 2ONSA 3IB2A 4PFRA 4U21A 3CIJA 4GWSA 2B3BA 2OZZA 3N6UA 4P0IA 2XXIA 2H4IA 2ZZXA 4YKJA 4PTKA 3TUSA 2XXTA 2HXRA 1LFGA 4TLMB 1OQHA 2WX9A 5ET7A 3A3CA 4GWYA 3CG3A 2DQVA 4HE1A 1B05A 4MAGA 1XT8A 4MBPA 1GR2A 1ZU0A 2UVHA 3KSXA 1N3XA 3UP9A 3MZ1A 4G77A 1B4HA 1WDNA 4KYSA 2QVVA 4NMYA 3HSTA 1GGGA 2WYKA 4LATA 4ZS9A 3O97A 5J1DA 1AWBA 4XKRA 3PD8A 2JJKA 1MRPA 3C35A 1NUYA 3UORA 1D9YA 4KR5A 3OO8A 3IK6B 5K2XA 4O3AA 4RJZA 3PUXE 3QSLA 3QAXA 2RKMA 4OWDA 4NN3A 1MDP1 4WKMA 2ZZVA 2F7AA 1INPA 3GYYA 5ITPA 4H5GA 4IO6A 1N0TA 4GBWA 4PGNA 3C34A 3KOTA 1EZ9A 5HM4B 3TPAA 4F2OA 1LAHE 1I6AA 4E0WA 1YZ0A 2F7BA 1EYKA 1RYXA 3IOWA 1R9LA 3W9WA 3PMWA 4RK2A 1FQFA 2Y7KA 5H8NA 4MNPA 4JSDA 4DDDA 3HPIA 1B1HA 5ET6A 1EU8A 5TPAB 3FVGA 1IMBA 2P2AA 2BJJX 4OFOA 2VD2A 4BDMA 3LSXA 1LBZA 2GFEA 3PD9A 3KFMA 5IZ3B 4JSOA 5ET8A 3OEMA 3BKIB 3RNNA 4PBQA 3M3KA 3M3LA 4LN5A 4RK9A 4PAIA 3ZS6A 2QRYA 4PF8A 3KN7A 1YPNA 5ET5A 4FORA 3QUJA 1P1NA 4YMBA 3KN3A 1GV8A 3H03A 5KDTB 4H67A 1CB6A 2XD3A 3FBPA 3GXAA 4IGRA 1ELJA 1FQBA 1FBGA 4GQOA 4NQ8A 1MQHA 1Y4CA 4XKPA 3LSWA 2F78A 1MH4A 3KJ7A 1D3KA 3KJTA 1FQEA 3FASA 4YB5A 4N13A 3B6TA 1UTBB 4LZ5A 2PX1A 5L8DA 5I58B 2D3IA 3TAJA 4UA8A 3FV2A 4N4UA 5I3SA 3RN8A 1LSTA 3TELA 1FBFA 5DW8A 3IAZA 2ZNUA 2F3BA 4DXBA 4OFJA 4NF6B 2CZKA 4R9GA 1LAXA 5AA4B 4GRKA 4I62A 4U23A 4Q5TA 2DWIA 4MX6A 1NV6A 3U8QA 4BDRA 2HAUA 3N26A 2ANJA 4ISUA 4X1BA 4IO7A 5I5PA 2CEXA 1Z7ME 4QFPA 1DSNA 3O9PA 3GLBA 2ALUA 2OLBA 4JB7A 3USDA 3LSLA 2DE2A 4PQJA 1H43A 2HCAA 2F5XA 3H6TA 2ZNTA 3FJ7A 3PPQA 2V3QA 2F36A 2OWTA 2WBBA 1IMEA 1A99A 1K9YA 1ATGA 1KA1A 2ZXTA 4EF2A 3VVFA 3VVDA 3HCQA 3BFTA 3MVYA 4K3FA 5JEIA 4HCWA 2XD2A 1Y3NA 2QL3A 5I56A 1NFTA 1BIYA 3JYRA 4P8BA 2Z22A 3O28A 3TTLA 1YXIA 3WAEA 5ICTA 4OVSA 3GBAA 3PPNA 3E78A 1MPCA 1XC1A 3TFLA 2Q8JA 3FVKA 2DWJA 1IXIA 1P1WA 4EDPA 2WKYA 1MQDA 1GTKA 2P1SA 4QRZA 2QSXA 3CR9A 3O2AA 5L9SA 3OENA 2Q74A 3LR1A 3TODA 4Q30B 3EQ1A 2XXPA 4R2BA 1IXGA 1PDAA 5ELVA 1FPLA 3CI8A 3PTYA 4NX1A 2O69A 2PFYA 4NF0A 2O6AA 4BDNA 2RC8A 3U1OA 3VFJA 1I6QA 4YMAA 2RF1A 4R72A 2I3WA 3IFCA 5CI5A 5H8HA 2I4CA 5M2VA 4O94A 3D4GA 1NV2A 2WEFA 4ESWA 1XVYA 2XXHA 5CC2A 3U94A 3ONMA 1SPIA 2G93A 4KCDA 3BFUA 3IJXB 1B5IA 4PE3A 3B6QA 4DI4B 5IZ1A 1JEVA 1QKBA 1HSEA 1LBWA 5CMMA 5H8NB 1B32A 1DCUA 5H8FA 3PU5A 1SI1A 4RNSA 3EHUA 4IY6A 4PAKA 5L9OA 3S9LC 4DI3D 2Z8EA 4PDHA 2REJA 2O51A 4LQ5A 4JWOA 2REGA 1BP5A 3EF7A 1UTHB 1XVXA 1LBYA 1USYE 4QFKA 1UIVA 2GRVA 4PP0A 4WXJA 5I84A 3PGFA 3RT8A 5TP9A 4YAHX 3G3GA 4ELOA 3CVGA 4QFNA 2OX3A 3T22A 1JP4A 1CE2A 1M5DA 1VDWA 5EYFA 2I0BA 1NNTA 1OQGA 4U4XA 2DWAA 1A55A 4OFLA 3U72A 2VGQA 2QFLA 2RC7A 2XXKA 3ROJA 1LCFA 2KR0A 2FNCA 5LDZA 2QMXA 4MHFA 1ZIUA 1YAEA 3LSFB 4U2RA 4OA4A 4NG7A 2Y5KA 1EYJA 2UYEA 1SW5A 2O84X 1H3DA 2XX7A 4KQPA 4LVQA 1G0HA 3H4ZA 4LA9A 4MJOA 3H3GA 2MKZA 3KC1A 4DCYA 3GZGA 2QS4A 3IL1B 1B5HA 1N84A 5IGAA 4G4PA 4GLIA 1OMPA 3MP1A 1JVXA 2XXWA 5KDTA 5AA2A 3G3FA 1N7WA 3SEUA 2PCRA 1FPJA 1ANFA 3I5OA 2XXXA 4RXLA 2R9JA 5IAIA 2HHMA 4PE5B 3UA8A 4G68A 5ICQA 4F22A 1JETA 5I58A 4JVCA 4F1VA 4PC9A 3C4MA 3FUZA 4IO3A 1QUJA 1N04A 2YPNA 3V5AA 3G7WA 2AL4A 1DBZA 4MIJA 4KFQA 4NF6A 3E13X 3QXMA 2I0CA 4F3SA 2CZLA 1FJ9A 5JTYA 1CNQA 4H5FA 4ZE8A 2D21A 2B4MA 4MF3A 3VLUA 4OANA 4F19A 1JW4A 3Q29A 4NGUA 2ZYMA 2XA5A 5I56B 5B7DA 2HZKA 3S4UA 1US5A 1VSOA 4NHBA 4YB7A 4GX3A 5CRYA 4H8JA 4C1TA 4N8YA 1NV0A 2DSFA 5A5LA 4RY1A 2NXOA 3R26A 3OSQA 2YJPA 1LGBC 2DE4A 4P3LA 3UGWA 4DCXA 4GXSB 2QVUA 4F29A 5DVJA 4X1DA 1MQIA 3CSBA 2H99A 2Z23A 2H9BA 4P56A 2R8TA 2YLNA 4PFWA 2PYYA 4U22A 2I49A 3C33A 4EQ9A 3IORA 4FECA 3S9MC 2GH9A 5H8HB 2HAVA 3R6UA 3B6WA 3U65A 1B7HA 3TYHA 3HV1A 3KC0A 3C31A 2XWIA 4HE0A 1N7XA 4H6DA 4G68C 1NNKA 2E0SA 1B1XA 2XXUA 3TDJA 1IMAA 2F6PA 5FTIA 1B0HA 1MY1A 4KPTA 3VLVA 4OXVA 5F7VA 2XXQA 2NOOA 2DYXA 1IEJA 5H8FB 4ELQA 4I3EA 1EYIA 4MH5A 3PPPA 4IO5A 4N91A 1B52A 4QSEA 1A7LA 2V93A 4R73A 1IMCA 2FA7A 1S50A 2DP8A 3OEKA 2Q2CA 1I69A 2B65A 5H8SA 3KZGA 3QYTA 3VDFA 5TP9B 1B6HA 3PMVA 3TEPA 1IXHA 1PC3A 3IOUA 3SESA 1NV7A 1FPEA 3G3JA 4ZECA 1MY4A 4NAPA 3CHGA 1R6ZA 3LBSA 1DPPA 2HEUA 4F3GA 4ZE9A 2BJIA 3PMXA 5FTHA 4FJPA 3S9NC 4E0XA 2Y7WA 3LUZA 4H65A 4PCDA 1L5TA 4OENA 3RYDA 4I8CA 3MVWA 1IMDA 4IO4A 1QJMA 1UTHA 4NWCA 1MM7A 2ESNA 4OZ9A 1II5A 3O6HA 2ZYNA 4R6HA 4POXA 4KYEA 3MAMA 3SZPA 4XKNA 1ZJLA 1O63A 4P1EA 4YU0A 3V83A 1VR5A 4C1UA 5I57A 4BDOA 4RPNA 3H6VA 3S2VA 3K1MA 2HPGA 2XHDA 3ODBA 1QUIA 5AA2B 4AS5A 4H46A 1Y4TA 1A40A 2Q89A 2QVRA 1NKXA 4X04A 3WAFA 1Y20A 4PDDA 3SEYA 1MXZA 1DOTA 1IIWA 5CM6A 3K6XA 3VE1B 1FQCA 3FXBA 1ZLQA 1MXWA 4G68B 3SETA 1FTAA 2AL5A 3E4RA 3K02A 1UQWA 3K01A 4FAJA 4KCCA 4PFBA 3MJNA 3CG1A 1XHYA 2UYFA 2RCBA 1NUZA 5JTYB 4MLQA 4ECFA 4MMPA 4OESA 3MBPA 4NEDA 3IX1A 3IOVA 3LV0A 3PUYE 3KG2A 4OTEA 4P47A 1POY1 3KSJA 3TQLA 4R74A 5FBPA 1IMFA 5LTCA 3A09A 1AL3A 3CRBA 2A5TA 4AQ4A 1B3LA 4I3YA 3Q28A 2PT2A 2UVGA 1AH5A 3PPOA 4GVOA 3MZ9A 4NF4A 3CSGA 4XXUA 1OLAA 4XFEA 3B7DA 1D9QA 3T9HB 5BWJA 5EQ9A
chains in the Genus database with same CATH topology
4TOZA 3SEWA 2DE3A 1QKAA 4AB5A 3RTFB 5EHMA 4R2FA 1HSLA 2NVUB 2Y84A 3IO6A 2I58A 5A5XB 4U1ZA 4M1VA 3S9EA 2DOJA 1NNPA 3UIFA 2QS2A 1MY0A 1SYIA 1B40A 3FGSA 4NF5A 1NH8A 3FXQA 2UVIA 4RPOA 3H6WA 1FTKA 4ZDMA 1SD3A 2I4BA 2RCAA 2Z8DA 1MDQA 2XXVA 3QK6A 5TU0A 3E9XA 3N5LA 3T93B 3LUYA 2H25A 5KZTA 3IOTA 4MLVA 4JDFA 2PMSA 1LBBA 2Q88A 1LFIA 3IR1A 3HHFA 1B0LA 1IQ7A 4HTGA 1NMUA 3ECRA 1TT1A 4JXIA 4GL8A 4IO2A 4ZEBA 4GL0A 5I59A 4Z0IA 1PBPA 1S9TA 5FHNA 3W15C 3MVZA 3L6HA 1BTJA 3A3UA 1EZPA 4ZEKA 4HW8A 1TFDA 5BUUA 4F2QA 1VFDA 3RT6B 3SKPA 2DWHA 4FEBA 1MH3A 1LLSA 3TTRA 1Y3QA 3QIMA 1HSJA 3G3KA 2QS1A 2VHAA 4BDLA 2GHAA 2HQ0A 1ZMGA 4N07A 1B3HA 5I57B 1O7TA 4KD5A 1B2HA 4HCYA 3DP6A 5FHOA 4QFOA 4O3BA 1A8FA 3T66A 1US4A 1MPBA 1URGA 1MY3A 2X7PA 1M5BA 3VV5A 1P99A 1VFEA 4LQ2A 1ZBMA 4XKQA 2AIXA 2V3UA 4L17A 3UN6A 5AE4A 3O66A 4N6PA 5DT6A 1I6BA 4AB6A 3H06B 2XX9A 2OWSA 2VP1A 1MQJA 3CFXA 3D4CA 3M3FA 1R9QA 1EZOA 2O68A 4F39A 3K2DA 3IO4A 2P0SA 3MUQA 3T9XB 1JNFA 2O1LA 2IA4A 4ZZEA 5B70A 3K4UA 3RPWA 3FV1A 2Q2AA 4H1XA 2I3VA 1LBCA 1IXCA 1MG1A 5HBCA 2A5TB 4LUBA 2KLFA 1MM6A 3Q27A 2NUVA 3Q26A 4JBZA 4LP2B 1B7UA 4ONYA 4NF4B 3C36A 1TXFA 1M5EA 1AMFA 5DVFA 3RTWB 3E3KA 4EXLA 3TTNA 3FJGA 3KEIA 3KBRA 3OELA 3QUFA 4IY5A 1P1QA 3FXUA 4F1UA 1BKAA 3IB0A 2XXYA 4PFUA 3ZKKA 2V84A 2UVJA 2Q9TA 1SBPA 3AXFA 4ZEFA 3TTMA 1OVBA 2HZLA 4YKIA 1S7YA 2H5YA 1B7ZA 1P1UA 4R6KA 1FTJA 4XIGQ 3MC2A 3TCFA 4GOTA 4P0GA 4R75A 1FCKA 4QFLA 4NF5B 3K0VA 2ZMBA 3JZJA 2FYIA 4WEDA 2DXYA 1LAGE 4JWXA 2X7QA 1B51A 4BDQA 4H0WA 2OJTA 1SVXB 2V3TA 3IB1A 3OMBA 2PVUA 4OVJA 2HXWA 5CBSA 1EH3A 5A5XA 1POTA 1AOVA 2E1SA 5ISUA 1OIBA 1NH7A 3U93A 4I1DA 3FIRA 2DS9A 1MY2A 5I59B 4EQBA 4KYDA 3THIA 2Y7IA 4NF8A 5CMCA 1M5CA 3PUWE 4GF8A 1D9VA 5I2NA 3C9HA 1QW0A 3V8XB 3SERA 3IJOB 2VOZA 4YICA 1IZ1A 1DPEA 2ZYOA 4EUOA 4ZZAA 3T9VA 1IITA 4F31B 4THIA 4ELPA 2F35A 3JV9A 4U4SA 4R9FA 1OLCA 3K00A 1Y9UA 2B3FA 2RC9A 1B58A 1J1NA 5H8QA 3OO6A 2F7CA 4RYAA 4GIZA 4U1OA 3SEVA 3TCGA 2QS3A 1SW2A 4QF9A 4FE8A 2M8CA 5I2KA 3V89B 3TCHA 1SW4A 3N6TA 2XX8A 4X48A 2ONRA 1O64A 3RY3A 1Y1ZA 4TQUQ 3EHSA 2A5SA 3RGYA 1LAFE 4YKPA 4M4GA 5DEXA 3HHGA 3KGCA 3MWBA 2F34A 5ITOA 2IEEA 4EXKA 3FJMA 1GVCA 4MFIA 1B5JA 3DP4A 1UIUA 1URDA 4G8NA 3C32A 1TFAA 2I6EA 2GHBA 4PFYA 2THIA 3K1PA 1JW1A 1XS5A 3P7IA 1FW0A 3HO7A 3FD3A 4GWOA 3FXRA 3TTKA 4OEVA 3K6VA 4ZEIA 3U92A 3H6UA 5CMKA 1KWHA 1SQYA 2O1MA 1FTLA 1DTGA 1FQDA 1N3WA 3TKDA 3RLFE 2W7YA 4OQOA 3VXBA 1QVSA 4QHQA 1Q1KA 3VVEA 1T0KA 2QMWA 4PFTA 4FEDA 3O6IA 1USYH 4F3PA 2ZYKA 2PBWA 3EN3A 1BLFA 1Y1MA 1SDXA 3FVNA 2ZNSA 4ESXA 4F18A 3OXNA 4JWYA 4G8MA 1SI0A 3OO9A 3W9VA 2Y7PA 5KCJA 4LONB 3MVXA 4EQ7A 3BBRA 4OERA 3FATA 1TWYA 4DZ1A 1JW5A 2F8DA 3KOSA 2QJEA 1JEUA 1LB8A 3OOAA 4NWDA 2V25A 1LFHA 3CFLA 3DM0A 2PT1A 2VD3A 1H76A 2UXAA 1PB9A 3MQ9A 4DXUA 3K6WA 3I3VA 4FIMA 1F9BA 3M8UA 5AA2D 3KN8A 1MXXA 3DP8A 4P11A 1H44A 1D4NA 4IB2A 1WVJA 3OO7A 3T9UA 5L9MA 4IGTA 1RYOA 3MZBA 2O7UA 3PV0E 2DVCA 1XOCA 3K6UA 1NNFA 2CMOA 4POWA 4KI0E 4Q8RA 4ND9A 3Q25A 1PBQA 4I9DA 5IKBA 4NF8B 1B3EA 1MPDA 1SW1A 4O3CA 4QSDA 2AYSA 3N94A 3K1NA 5I2NB 1Z7NE 2X26A 1NL5A 5EHSA 3PUZE 4OEUA 5LOMA 5CMBA 1N76A 1ZKBA 1IUDA 1SYHA 1Q35A 1OVTA 4C0RA 1B3FA 4YB6A 3TQWA 4OETA 2F6GA 5H8QB 3VXCA 5AA3A 4NE4A 4EF1A 4DE8A 3GBBA 1VE4A 3LC8A 1PB7A 3MP6A 5AA1A 5I2KB 3SDFA 3EPEA 1URSA 4UACA 4BLAA 4X9TA 4ZEDA 4YZZA 4YKKA 3TMGA 3CFZA 4DIGA 3L6GA 4R6YA 2XXRA 2OCUA 3RUMA 5DEXB 4OHNA 2O7IA 1B4ZA 1B46A 3ZSFA 4F3BA 3VLWA 4Q0CA 2DXRA 3RQTA 2OK2A 3G3HA 2R71A 5FHMA 3H7MA 3PUVE 3I6VA 2F97A 1MQGA 3O6GA 3OD7A 1RKMA 4OMBA 2I48A 3PPRA 1JQFA 1A8EA 4GD5A 1LB9A 1FTMA 4PETA 4LZ8A 1B9JA 4G8HA 4Z7EA 1WODA 1ZTYA 2H98A 3T96B 2HFBA 1AIVA 4QSCA 2QPQA 3O29A 1R1NA 2Z8FA 5F1QA 5TPAA 3FZVA 2NWJA 3ILUB 1A54A 3EHTA 3F11A 4LZ7A 5HPQA 1PEBA 5DVIA 5DYHA 4FATA 4HS7A 1JVYA 1FQAA 5KCJB 3SEXA 4GFRA 3ZKLA 3HN0A 3MPKA 3MP8A 3UK4A 4OYVA 4G2ZA 4WEPA 3TZAA 3R7XA 1YCJA 2G29A 4XTCQ 2Y7RA 4H8IA 1M5FA 4DLDA 4DXCA 3OSRA 2DVZA 1UTBA 2RINA 3G3IA 5JK4A 1MXUA 2R6GE 1H45A 1MS7A 1QULA 3DLNA 4TLLB 1MXVA 1Y3PA 3ILTB 1P1OA 2ABHA 1YTVA 5DTBA 4RA1A 2LAOA 1DMBA 5AA4A 1LCTA 4NTLA 1MXYA 1PB8A 5K2YA 1QUKA 3MPLA 2ONKE 4KHZE 4GXAA 4ELRA 1FTOA 1B3GA 1DTZA 5CBRA 2OBGA 3DELB 3MW0A 3FVOA 4F1YA 2D5WA 2ONSA 3IB2A 4U21A 3CIJA 2B3BA 2OZZA 3N6UA 4P0IA 2XXIA 2H4IA 4YKJA 3TUSA 2XXTA 1LFGA 4TLMB 1OQHA 3A3CA 3CG3A 2DQVA 1B05A 1XT8A 4MBPA 1GR2A 1ZU0A 2UVHA 3KSXA 1N3XA 3UP9A 3MZ1A 4G77A 1B4HA 1WDNA 4KYSA 4NMYA 3HSTA 1GGGA 4ZS9A 4LATA 3O97A 5J1DA 4XKRA 3PD8A 1MRPA 3C35A 3UORA 1D9YA 4KR5A 3OO8A 3IK6B 5K2XA 4O3AA 4RJZA 3PUXE 3QSLA 3QAXA 2RKMA 4OWDA 1MDP1 4WKMA 2F7AA 5ITPA 4H5GA 4IO6A 1N0TA 3C34A 3KOTA 1EZ9A 5HM4B 3TPAA 4F2OA 1LAHE 1I6AA 4E0WA 2F7BA 1RYXA 3IOWA 1R9LA 3W9WA 3PMWA 4RK2A 1FQFA 2Y7KA 5H8NA 4JSDA 4DDDA 3HPIA 1B1HA 5TPAB 1EU8A 3FVGA 2P2AA 2BJJX 4OFOA 2VD2A 4BDMA 3LSXA 2GFEA 3PD9A 3KFMA 4JSOA 3OEMA 3BKIB 3RNNA 3M3KA 3M3LA 4RK9A 3ZS6A 2QRYA 3KN7A 1YPNA 4FORA 3QUJA 1P1NA 4YMBA 3KN3A 1GV8A 3H03A 5KDTB 4H67A 1CB6A 2XD3A 3GXAA 4IGRA 1ELJA 1FQBA 4GQOA 1MQHA 1Y4CA 4XKPA 3LSWA 2F78A 1MH4A 3KJ7A 1D3KA 3KJTA 1FQEA 3FASA 4YB5A 4N13A 3B6TA 1UTBB 4LZ5A 2PX1A 5L8DA 5I58B 2D3IA 3TAJA 4UA8A 3FV2A 3RN8A 1LSTA 3TELA 3IAZA 2ZNUA 4DXBA 4OFJA 4NF6B 4R9GA 1LAXA 5AA4B 4GRKA 4I62A 4U23A 4Q5TA 2DWIA 3U8QA 4BDRA 2HAUA 3N26A 2ANJA 4ISUA 4X1BA 4IO7A 1Z7ME 4QFPA 1DSNA 3O9PA 3GLBA 2ALUA 2OLBA 4JB7A 3USDA 3LSLA 2DE2A 4PQJA 1H43A 2HCAA 2F5XA 3H6TA 2ZNTA 3FJ7A 3PPQA 2V3QA 2F36A 2OWTA 1A99A 1ATGA 2ZXTA 4EF2A 3VVFA 3VVDA 3HCQA 3BFTA 3MVYA 4K3FA 5JEIA 4HCWA 2XD2A 1Y3NA 2QL3A 5I56A 1NFTA 1BIYA 3JYRA 2Z22A 3O28A 3TTLA 3WAEA 5ICTA 3GBAA 3PPNA 1MPCA 1XC1A 3TFLA 2Q8JA 3FVKA 2DWJA 1IXIA 1P1WA 4EDPA 2WKYA 1MQDA 1GTKA 2P1SA 4QRZA 2QSXA 3CR9A 3O2AA 5L9SA 3OENA 3LR1A 3TODA 4Q30B 3EQ1A 2XXPA 4R2BA 1IXGA 1PDAA 5ELVA 3CI8A 2O69A 2O6AA 4BDNA 2RC8A 3U1OA 3VFJA 1I6QA 4YMAA 2RF1A 4R72A 2I3WA 5CI5A 5H8HA 2I4CA 5M2VA 3D4GA 4ESWA 1XVYA 2XXHA 5CC2A 3U94A 3ONMA 2G93A 4KCDA 3BFUA 3IJXB 1B5IA 3B6QA 1JEVA 1QKBA 1HSEA 5CMMA 5H8NB 1B32A 5H8FA 3PU5A 1SI1A 4RNSA 3EHUA 4IY6A 5L9OA 3S9LC 2Z8EA 2REJA 2O51A 4LQ5A 4JWOA 2REGA 1BP5A 3EF7A 1UTHB 1XVXA 1USYE 4QFKA 1UIVA 2GRVA 4PP0A 4WXJA 5I84A 3PGFA 3RT8A 5TP9A 4YAHX 4ELOA 3G3GA 3CVGA 4QFNA 3T22A 1CE2A 1M5DA 5EYFA 2I0BA 1NNTA 1OQGA 4U4XA 2DWAA 1A55A 4OFLA 3U72A 2VGQA 2RC7A 1LCFA 2FNCA 2QMXA 1ZIUA 1YAEA 3LSFB 4U2RA 2UYEA 1SW5A 2O84X 1H3DA 2XX7A 4KQPA 4LVQA 3H4ZA 4LA9A 3H3GA 4DCYA 3GZGA 2QS4A 3IL1B 1B5HA 1N84A 4G4PA 4GLIA 1OMPA 3MP1A 1JVXA 2XXWA 5KDTA 5AA2A 3G3FA 1N7WA 3SEUA 1ANFA 3I5OA 2XXXA 4RXLA 2R9JA 5IAIA 4PE5B 3UA8A 4G68A 5ICQA 4F22A 1JETA 5I58A 4F1VA 3C4MA 3FUZA 4IO3A 1QUJA 1N04A 2YPNA 3V5AA 3G7WA 2AL4A 4KFQA 4NF6A 3E13X 3QXMA 2I0CA 4F3SA 2CZLA 5JTYA 4H5FA 4ZE8A 2D21A 4MF3A 3VLUA 4F19A 1JW4A 3Q29A 2ZYMA 5I56B 5B7DA 2HZKA 3S4UA 1US5A 1VSOA 4YB7A 5CRYA 4H8JA 4C1TA 2DSFA 4RY1A 2NXOA 3R26A 3OSQA 2YJPA 1LGBC 2DE4A 3UGWA 4DCXA 4GXSB 4F29A 5DVJA 4X1DA 1MQIA 3CSBA 2H99A 2Z23A 2H9BA 2YLNA 4PFWA 2PYYA 4U22A 2I49A 3C33A 4EQ9A 3IORA 4FECA 3S9MC 2GH9A 5H8HB 2HAVA 3R6UA 3B6WA 1B7HA 3TYHA 3HV1A 3C31A 1N7XA 4H6DA 4G68C 1NNKA 2E0SA 1B1XA 2XXUA 3TDJA 2F6PA 5FTIA 1B0HA 1MY1A 4KPTA 3VLVA 4OXVA 5F7VA 2XXQA 2NOOA 2DYXA 1IEJA 5H8FB 4ELQA 4MH5A 3PPPA 4IO5A 1B52A 4QSEA 1A7LA 2V93A 4R73A 2FA7A 1S50A 2DP8A 3OEKA 2Q2CA 1I69A 2B65A 5H8SA 3KZGA 3QYTA 3VDFA 5TP9B 1B6HA 3PMVA 3TEPA 1IXHA 1PC3A 3IOUA 3SESA 3G3JA 4ZECA 1MY4A 1R6ZA 3LBSA 1DPPA 2HEUA 4F3GA 4ZE9A 3PMXA 5FTHA 4FJPA 3S9NC 4E0XA 2Y7WA 4H65A 1L5TA 4OENA 4I8CA 3MVWA 4IO4A 1QJMA 1UTHA 4NWCA 1MM7A 2ESNA 4OZ9A 1II5A 3O6HA 2ZYNA 4R6HA 4POXA 4KYEA 3MAMA 4XKNA 1ZJLA 1O63A 4YU0A 3V83A 1VR5A 4C1UA 5I57A 4BDOA 4RPNA 3H6VA 3S2VA 2XHDA 3K1MA 3ODBA 1QUIA 5AA2B 1Y4TA 1A40A 2Q89A 1NKXA 3WAFA 1Y20A 3SEYA 1MXZA 1DOTA 1IIWA 5CM6A 3K6XA 3VE1B 1FQCA 1ZLQA 1MXWA 4G68B 3SETA 2AL5A 3E4RA 3K02A 1UQWA 3K01A 4FAJA 4KCCA 3MJNA 3CG1A 1XHYA 2UYFA 2RCBA 5JTYB 4MLQA 4ECFA 4OESA 3MBPA 4NEDA 3IX1A 3IOVA 3PUYE 3KG2A 4OTEA 1POY1 3KSJA 3TQLA 4R74A 3A09A 1AL3A 3CRBA 2A5TA 4AQ4A 1B3LA 3Q28A 2PT2A 2UVGA 1AH5A 3PPOA 4GVOA 3MZ9A 4NF4A 3CSGA 4XXUA 1OLAA 3B7DA 3T9HB 5BWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TOZ A;  3SEW A;  2DE3 A;  1QKA A;  4AB5 A;  3RTF B;  5EHM A;  4R2F A;  1HSL A;  2NVU B;  2Y84 A;  3IO6 A;  2I58 A;  5A5X B;  4U1Z A;  4M1V A;  3S9E A;  2DOJ A;  1NNP A;  3UIF A;  2QS2 A;  1MY0 A;  1SYI A;  1B40 A;  3FGS A;  4NF5 A;  1NH8 A;  3FXQ A;  2UVI A;  4RPO A;  3H6W A;  1FTK A;  4ZDM A;  1SD3 A;  2I4B A;  2RCA A;  2Z8D A;  1MDQ A;  2XXV A;  3QK6 A;  5TU0 A;  3E9X A;  3N5L A;  3T93 B;  3LUY A;  2H25 A;  5KZT A;  3IOT A;  4MLV A;  4JDF A;  2PMS A;  1LBB A;  2Q88 A;  1LFI A;  3IR1 A;  3HHF A;  1B0L A;  1IQ7 A;  4HTG A;  1NMU A;  3ECR A;  1TT1 A;  4JXI A;  4GL8 A;  4IO2 A;  4ZEB A;  4GL0 A;  5I59 A;  4Z0I A;  1PBP A;  1S9T A;  5FHN A;  3W15 C;  3MVZ A;  3L6H A;  1BTJ A;  3A3U A;  1EZP A;  4ZEK A;  4HW8 A;  1TFD A;  5BUU A;  4F2Q A;  1VFD A;  3RT6 B;  3SKP A;  2DWH A;  4FEB A;  1MH3 A;  1LLS A;  3TTR A;  1Y3Q A;  3QIM A;  1HSJ A;  3G3K A;  2QS1 A;  2VHA A;  4BDL A;  2GHA A;  2HQ0 A;  1ZMG A;  4N07 A;  1B3H A;  5I57 B;  1O7T A;  4KD5 A;  1B2H A;  4HCY A;  3DP6 A;  5FHO A;  4QFO A;  4O3B A;  1A8F A;  3T66 A;  1US4 A;  1MPB A;  1URG A;  1MY3 A;  2X7P A;  1M5B A;  3VV5 A;  1P99 A;  1VFE A;  4LQ2 A;  1ZBM A;  4XKQ A;  2AIX A;  2V3U A;  4L17 A;  3UN6 A;  5AE4 A;  3O66 A;  4N6P A;  5DT6 A;  1I6B A;  4AB6 A;  3H06 B;  2XX9 A;  2OWS A;  2VP1 A;  1MQJ A;  3CFX A;  3D4C A;  3M3F A;  1R9Q A;  1EZO A;  2O68 A;  4F39 A;  3K2D A;  3IO4 A;  2P0S A;  3MUQ A;  3T9X B;  1JNF A;  2O1L A;  2IA4 A;  4ZZE A;  5B70 A;  3K4U A;  3RPW A;  3FV1 A;  2Q2A A;  4H1X A;  2I3V A;  1LBC A;  1IXC A;  1MG1 A;  5HBC A;  2A5T B;  4LUB A;  2KLF A;  1MM6 A;  3Q27 A;  2NUV A;  3Q26 A;  4JBZ A;  4LP2 B;  1B7U A;  4ONY A;  4NF4 B;  3C36 A;  1TXF A;  1M5E A;  1AMF A;  5DVF A;  3RTW B;  3E3K A;  4EXL A;  3TTN A;  3FJG A;  3KEI A;  3KBR A;  3OEL A;  3QUF A;  4IY5 A;  1P1Q A;  3FXU A;  4F1U A;  1BKA A;  3IB0 A;  2XXY A;  4PFU A;  3ZKK A;  2V84 A;  2UVJ A;  2Q9T A;  1SBP A;  3AXF A;  4ZEF A;  3TTM A;  1OVB A;  2HZL A;  4YKI A;  1S7Y A;  2H5Y A;  1B7Z A;  1P1U A;  4R6K A;  1FTJ A;  4XIG Q;  3MC2 A;  3TCF A;  4GOT A;  4P0G A;  4R75 A;  1FCK A;  4QFL A;  4NF5 B;  3K0V A;  2ZMB A;  3JZJ A;  2FYI A;  4WED A;  2DXY A;  1LAG E;  4JWX A;  2X7Q A;  1B51 A;  4BDQ A;  4H0W A;  2OJT A;  1SVX B;  2V3T A;  3IB1 A;  3OMB A;  2PVU A;  4OVJ A;  2HXW A;  5CBS A;  1EH3 A;  5A5X A;  1POT A;  1AOV A;  2E1S A;  5ISU A;  1OIB A;  1NH7 A;  3U93 A;  4I1D A;  3FIR A;  2DS9 A;  1MY2 A;  5I59 B;  4EQB A;  4KYD A;  3THI A;  2Y7I A;  4NF8 A;  5CMC A;  1M5C A;  3PUW E;  4GF8 A;  1D9V A;  5I2N A;  3C9H A;  1QW0 A;  3V8X B;  3SER A;  3IJO B;  2VOZ A;  4YIC A;  1IZ1 A;  1DPE A;  2ZYO A;  4EUO A;  4ZZA A;  3T9V A;  1IIT A;  4F31 B;  4THI A;  4ELP A;  2F35 A;  3JV9 A;  4U4S A;  4R9F A;  1OLC A;  3K00 A;  1Y9U A;  2B3F A;  2RC9 A;  1B58 A;  1J1N A;  5H8Q A;  3OO6 A;  2F7C A;  4RYA A;  4GIZ A;  4U1O A;  3SEV A;  3TCG A;  2QS3 A;  1SW2 A;  4QF9 A;  4FE8 A;  2M8C A;  5I2K A;  3V89 B;  3TCH A;  1SW4 A;  3N6T A;  2XX8 A;  4X48 A;  2ONR A;  1O64 A;  3RY3 A;  1Y1Z A;  4TQU Q;  3EHS A;  2A5S A;  3RGY A;  1LAF E;  4YKP A;  4M4G A;  5DEX A;  3HHG A;  3KGC A;  3MWB A;  2F34 A;  5ITO A;  2IEE A;  4EXK A;  3FJM A;  1GVC A;  4MFI A;  1B5J A;  3DP4 A;  1UIU A;  1URD A;  4G8N A;  3C32 A;  1TFA A;  2I6E A;  2GHB A;  4PFY A;  2THI A;  3K1P A;  1JW1 A;  1XS5 A;  3P7I A;  1FW0 A;  3HO7 A;  3FD3 A;  4GWO A;  3FXR A;  3TTK A;  4OEV A;  3K6V A;  4ZEI A;  3U92 A;  3H6U A;  5CMK A;  1KWH A;  1SQY A;  2O1M A;  1FTL A;  1DTG A;  1FQD A;  1N3W A;  3TKD A;  3RLF E;  2W7Y A;  4OQO A;  3VXB A;  1QVS A;  4QHQ A;  1Q1K A;  3VVE A;  1T0K A;  2QMW A;  4PFT A;  4FED A;  3O6I A;  1USY H;  4F3P A;  2ZYK A;  2PBW A;  3EN3 A;  1BLF A;  1Y1M A;  1SDX A;  3FVN A;  2ZNS A;  4ESX A;  4F18 A;  3OXN A;  4JWY A;  4G8M A;  1SI0 A;  3OO9 A;  3W9V A;  2Y7P A;  5KCJ A;  4LON B;  3MVX A;  4EQ7 A;  3BBR A;  4OER A;  3FAT A;  1TWY A;  4DZ1 A;  1JW5 A;  2F8D A;  3KOS A;  2QJE A;  1JEU A;  1LB8 A;  3OOA A;  4NWD A;  2V25 A;  1LFH A;  3CFL A;  3DM0 A;  2PT1 A;  2VD3 A;  1H76 A;  2UXA A;  1PB9 A;  3MQ9 A;  4DXU A;  3K6W A;  3I3V A;  4FIM A;  1F9B A;  3M8U A;  5AA2 D;  3KN8 A;  1MXX A;  3DP8 A;  4P11 A;  1H44 A;  1D4N A;  4IB2 A;  1WVJ A;  3OO7 A;  3T9U A;  5L9M A;  4IGT A;  1RYO A;  3MZB A;  2O7U A;  3PV0 E;  2DVC A;  1XOC A;  3K6U A;  1NNF A;  2CMO A;  4POW A;  4KI0 E;  4Q8R A;  4ND9 A;  3Q25 A;  1PBQ A;  4I9D A;  5IKB A;  4NF8 B;  1B3E A;  1MPD A;  1SW1 A;  4O3C A;  4QSD A;  2AYS A;  3N94 A;  3K1N A;  5I2N B;  1Z7N E;  2X26 A;  1NL5 A;  5EHS A;  3PUZ E;  4OEU A;  5LOM A;  5CMB A;  1N76 A;  1ZKB A;  1IUD A;  1SYH A;  1Q35 A;  1OVT A;  4C0R A;  1B3F A;  4YB6 A;  3TQW A;  4OET A;  2F6G A;  5H8Q B;  3VXC A;  5AA3 A;  4NE4 A;  4EF1 A;  4DE8 A;  3GBB A;  1VE4 A;  3LC8 A;  1PB7 A;  3MP6 A;  5AA1 A;  5I2K B;  3SDF A;  3EPE A;  1URS A;  4UAC A;  4BLA A;  4X9T A;  4ZED A;  4YZZ A;  4YKK A;  3TMG A;  3CFZ A;  4DIG A;  3L6G A;  4R6Y A;  2XXR A;  2OCU A;  3RUM A;  5DEX B;  4OHN A;  2O7I A;  1B4Z A;  1B46 A;  3ZSF A;  4F3B A;  3VLW A;  4Q0C A;  2DXR A;  3RQT A;  2OK2 A;  3G3H A;  2R71 A;  5FHM A;  3H7M A;  3PUV E;  3I6V A;  2F97 A;  1MQG A;  3O6G A;  3OD7 A;  1RKM A;  4OMB A;  2I48 A;  3PPR A;  1JQF A;  1A8E A;  4GD5 A;  1LB9 A;  1FTM A;  4PET A;  4LZ8 A;  1B9J A;  4G8H A;  4Z7E A;  1WOD A;  1ZTY A;  2H98 A;  3T96 B;  2HFB A;  1AIV A;  4QSC A;  2QPQ A;  3O29 A;  1R1N A;  2Z8F A;  5F1Q A;  5TPA A;  3FZV A;  2NWJ A;  3ILU B;  1A54 A;  3EHT A;  3F11 A;  4LZ7 A;  5HPQ A;  1PEB A;  5DVI A;  5DYH A;  4FAT A;  4HS7 A;  1JVY A;  1FQA A;  5KCJ B;  3SEX A;  4GFR A;  3ZKL A;  3HN0 A;  3MPK A;  3MP8 A;  3UK4 A;  4OYV A;  4G2Z A;  4WEP A;  3TZA A;  3R7X A;  1YCJ A;  2G29 A;  4XTC Q;  2Y7R A;  4H8I A;  1M5F A;  4DLD A;  4DXC A;  3OSR A;  2DVZ A;  1UTB A;  2RIN A;  3G3I A;  5JK4 A;  1MXU A;  2R6G E;  1H45 A;  1MS7 A;  1QUL A;  3DLN A;  4TLL B;  1MXV A;  1Y3P A;  3ILT B;  1P1O A;  2ABH A;  1YTV A;  5DTB A;  4RA1 A;  2LAO A;  1DMB A;  5AA4 A;  1LCT A;  4NTL A;  1MXY A;  1PB8 A;  5K2Y A;  1QUK A;  3MPL A;  2ONK E;  4KHZ E;  4GXA A;  4ELR A;  1FTO A;  1B3G A;  1DTZ A;  5CBR A;  2OBG A;  3DEL B;  3MW0 A;  3FVO A;  4F1Y A;  2D5W A;  2ONS A;  3IB2 A;  4U21 A;  3CIJ A;  2B3B A;  2OZZ A;  3N6U A;  4P0I A;  2XXI A;  2H4I A;  4YKJ A;  3TUS A;  2XXT A;  1LFG A;  4TLM B;  1OQH A;  3A3C A;  3CG3 A;  2DQV A;  1B05 A;  1XT8 A;  4MBP A;  1GR2 A;  1ZU0 A;  2UVH A;  3KSX A;  1N3X A;  3UP9 A;  3MZ1 A;  4G77 A;  1B4H A;  1WDN A;  4KYS A;  4NMY A;  3HST A;  1GGG A;  4ZS9 A;  4LAT A;  3O97 A;  5J1D A;  4XKR A;  3PD8 A;  1MRP A;  3C35 A;  3UOR A;  1D9Y A;  4KR5 A;  3OO8 A;  3IK6 B;  5K2X A;  4O3A A;  4RJZ A;  3PUX E;  3QSL A;  3QAX A;  2RKM A;  4OWD A;  1MDP 1;  4WKM A;  2F7A A;  5ITP A;  4H5G A;  4IO6 A;  1N0T A;  3C34 A;  3KOT A;  1EZ9 A;  5HM4 B;  3TPA A;  4F2O A;  1LAH E;  1I6A A;  4E0W A;  2F7B A;  1RYX A;  3IOW A;  1R9L A;  3W9W A;  3PMW A;  4RK2 A;  1FQF A;  2Y7K A;  5H8N A;  4JSD A;  4DDD A;  3HPI A;  1B1H A;  5TPA B;  1EU8 A;  3FVG A;  2P2A A;  2BJJ X;  4OFO A;  2VD2 A;  4BDM A;  3LSX A;  2GFE A;  3PD9 A;  3KFM A;  4JSO A;  3OEM A;  3BKI B;  3RNN A;  3M3K A;  3M3L A;  4RK9 A;  3ZS6 A;  2QRY A;  3KN7 A;  1YPN A;  4FOR A;  3QUJ A;  1P1N A;  4YMB A;  3KN3 A;  1GV8 A;  3H03 A;  5KDT B;  4H67 A;  1CB6 A;  2XD3 A;  3GXA A;  4IGR A;  1ELJ A;  1FQB A;  4GQO A;  1MQH A;  1Y4C A;  4XKP A;  3LSW A;  2F78 A;  1MH4 A;  3KJ7 A;  1D3K A;  3KJT A;  1FQE A;  3FAS A;  4YB5 A;  4N13 A;  3B6T A;  1UTB B;  4LZ5 A;  2PX1 A;  5L8D A;  5I58 B;  2D3I A;  3TAJ A;  4UA8 A;  3FV2 A;  3RN8 A;  1LST A;  3TEL A;  3IAZ A;  2ZNU A;  4DXB A;  4OFJ A;  4NF6 B;  4R9G A;  1LAX A;  5AA4 B;  4GRK A;  4I62 A;  4U23 A;  4Q5T A;  2DWI A;  3U8Q A;  4BDR A;  2HAU A;  3N26 A;  2ANJ A;  4ISU A;  4X1B A;  4IO7 A;  1Z7M E;  4QFP A;  1DSN A;  3O9P A;  3GLB A;  2ALU A;  2OLB A;  4JB7 A;  3USD A;  3LSL A;  2DE2 A;  4PQJ A;  1H43 A;  2HCA A;  2F5X A;  3H6T A;  2ZNT A;  3FJ7 A;  3PPQ A;  2V3Q A;  2F36 A;  2OWT A;  1A99 A;  1ATG A;  2ZXT A;  4EF2 A;  3VVF A;  3VVD A;  3HCQ A;  3BFT A;  3MVY A;  4K3F A;  5JEI A;  4HCW A;  2XD2 A;  1Y3N A;  2QL3 A;  5I56 A;  1NFT A;  1BIY A;  3JYR A;  2Z22 A;  3O28 A;  3TTL A;  3WAE A;  5ICT A;  3GBA A;  3PPN A;  1MPC A;  1XC1 A;  3TFL A;  2Q8J A;  3FVK A;  2DWJ A;  1IXI A;  1P1W A;  4EDP A;  2WKY A;  1MQD A;  1GTK A;  2P1S A;  4QRZ A;  2QSX A;  3CR9 A;  3O2A A;  5L9S A;  3OEN A;  3LR1 A;  3TOD A;  4Q30 B;  3EQ1 A;  2XXP A;  4R2B A;  1IXG A;  1PDA A;  5ELV A;  3CI8 A;  2O69 A;  2O6A A;  4BDN A;  2RC8 A;  3U1O A;  3VFJ A;  1I6Q A;  4YMA A;  2RF1 A;  4R72 A;  2I3W A;  5CI5 A;  5H8H A;  2I4C A;  5M2V A;  3D4G A;  4ESW A;  1XVY A;  2XXH A;  5CC2 A;  3U94 A;  3ONM A;  2G93 A;  4KCD A;  3BFU A;  3IJX B;  1B5I A;  3B6Q A;  1JEV A;  1QKB A;  1HSE A;  5CMM A;  5H8N B;  1B32 A;  5H8F A;  3PU5 A;  1SI1 A;  4RNS A;  3EHU A;  4IY6 A;  5L9O A;  3S9L C;  2Z8E A;  2REJ A;  2O51 A;  4LQ5 A;  4JWO A;  2REG A;  1BP5 A;  3EF7 A;  1UTH B;  1XVX A;  1USY E;  4QFK A;  1UIV A;  2GRV A;  4PP0 A;  4WXJ A;  5I84 A;  3PGF A;  3RT8 A;  5TP9 A;  4YAH X;  4ELO A;  3G3G A;  3CVG A;  4QFN A;  3T22 A;  1CE2 A;  1M5D A;  5EYF A;  2I0B A;  1NNT A;  1OQG A;  4U4X A;  2DWA A;  1A55 A;  4OFL A;  3U72 A;  2VGQ A;  2RC7 A;  1LCF A;  2FNC A;  2QMX A;  1ZIU A;  1YAE A;  3LSF B;  4U2R A;  2UYE A;  1SW5 A;  2O84 X;  1H3D A;  2XX7 A;  4KQP A;  4LVQ A;  3H4Z A;  4LA9 A;  3H3G A;  4DCY A;  3GZG A;  2QS4 A;  3IL1 B;  1B5H A;  1N84 A;  4G4P A;  4GLI A;  1OMP A;  3MP1 A;  1JVX A;  2XXW A;  5KDT A;  5AA2 A;  3G3F A;  1N7W A;  3SEU A;  1ANF A;  3I5O A;  2XXX A;  4RXL A;  2R9J A;  5IAI A;  4PE5 B;  3UA8 A;  4G68 A;  5ICQ A;  4F22 A;  1JET A;  5I58 A;  4F1V A;  3C4M A;  3FUZ A;  4IO3 A;  1QUJ A;  1N04 A;  2YPN A;  3V5A A;  3G7W A;  2AL4 A;  4KFQ A;  4NF6 A;  3E13 X;  3QXM A;  2I0C A;  4F3S A;  2CZL A;  5JTY A;  4H5F A;  4ZE8 A;  2D21 A;  4MF3 A;  3VLU A;  4F19 A;  1JW4 A;  3Q29 A;  2ZYM A;  5I56 B;  5B7D A;  2HZK A;  3S4U A;  1US5 A;  1VSO A;  4YB7 A;  5CRY A;  4H8J A;  4C1T A;  2DSF A;  4RY1 A;  2NXO A;  3R26 A;  3OSQ A;  2YJP A;  1LGB C;  2DE4 A;  3UGW A;  4DCX A;  4GXS B;  4F29 A;  5DVJ A;  4X1D A;  1MQI A;  3CSB A;  2H99 A;  2Z23 A;  2H9B A;  2YLN A;  4PFW A;  2PYY A;  4U22 A;  2I49 A;  3C33 A;  4EQ9 A;  3IOR A;  4FEC A;  3S9M C;  2GH9 A;  5H8H B;  2HAV A;  3R6U A;  3B6W A;  1B7H A;  3TYH A;  3HV1 A;  3C31 A;  1N7X A;  4H6D A;  4G68 C;  1NNK A;  2E0S A;  1B1X A;  2XXU A;  3TDJ A;  2F6P A;  5FTI A;  1B0H A;  1MY1 A;  4KPT A;  3VLV A;  4OXV A;  5F7V A;  2XXQ A;  2NOO A;  2DYX A;  1IEJ A;  5H8F B;  4ELQ A;  4MH5 A;  3PPP A;  4IO5 A;  1B52 A;  4QSE A;  1A7L A;  2V93 A;  4R73 A;  2FA7 A;  1S50 A;  2DP8 A;  3OEK A;  2Q2C A;  1I69 A;  2B65 A;  5H8S A;  3KZG A;  3QYT A;  3VDF A;  5TP9 B;  1B6H A;  3PMV A;  3TEP A;  1IXH A;  1PC3 A;  3IOU A;  3SES A;  3G3J A;  4ZEC A;  1MY4 A;  1R6Z A;  3LBS A;  1DPP A;  2HEU A;  4F3G A;  4ZE9 A;  3PMX A;  5FTH A;  4FJP A;  3S9N C;  4E0X A;  2Y7W A;  4H65 A;  1L5T A;  4OEN A;  4I8C A;  3MVW A;  4IO4 A;  1QJM A;  1UTH A;  4NWC A;  1MM7 A;  2ESN A;  4OZ9 A;  1II5 A;  3O6H A;  2ZYN A;  4R6H A;  4POX A;  4KYE A;  3MAM A;  4XKN A;  1ZJL A;  1O63 A;  4YU0 A;  3V83 A;  1VR5 A;  4C1U A;  5I57 A;  4BDO A;  4RPN A;  3H6V A;  3S2V A;  2XHD A;  3K1M A;  3ODB A;  1QUI A;  5AA2 B;  1Y4T A;  1A40 A;  2Q89 A;  1NKX A;  3WAF A;  1Y20 A;  3SEY A;  1MXZ A;  1DOT A;  1IIW A;  5CM6 A;  3K6X A;  3VE1 B;  1FQC A;  1ZLQ A;  1MXW A;  4G68 B;  3SET A;  2AL5 A;  3E4R A;  3K02 A;  1UQW A;  3K01 A;  4FAJ A;  4KCC A;  3MJN A;  3CG1 A;  1XHY A;  2UYF A;  2RCB A;  5JTY B;  4MLQ A;  4ECF A;  4OES A;  3MBP A;  4NED A;  3IX1 A;  3IOV A;  3PUY E;  3KG2 A;  4OTE A;  1POY 1;  3KSJ A;  3TQL A;  4R74 A;  3A09 A;  1AL3 A;  3CRB A;  2A5T A;  4AQ4 A;  1B3L A;  3Q28 A;  2PT2 A;  2UVG A;  1AH5 A;  3PPO A;  4GVO A;  3MZ9 A;  4NF4 A;  3CSG A;  4XXU A;  1OLA A;  3B7D A;  3T9H B;  5BWJ A; 
#chains in the Genus database with same CATH topology
 4P9K A;  4TOZ A;  3SEW A;  2XWV A;  2DE3 A;  1QKA A;  1FBC A;  4AB5 A;  3RTF B;  5EHM A;  4R2F A;  1HSL A;  2NVU B;  2Y84 A;  4O8M A;  3IFA A;  2I58 A;  3IO6 A;  5A5X B;  4U1Z A;  4M1V A;  3S9E A;  5T3J A;  2DOJ A;  1NNP A;  3UIF A;  2QS2 A;  1MY0 A;  1SYI A;  1B40 A;  3FGS A;  4NF5 A;  1NH8 A;  3FXQ A;  2UVI A;  4RPO A;  3HFU A;  1FPB A;  3H6W A;  1FTK A;  4HXV A;  4ZDM A;  1SD3 A;  2I4B A;  2RCA A;  1K9Z A;  2Z8D A;  1MDQ A;  2XXV A;  3QK6 A;  5TU0 A;  3E9X A;  3N5L A;  3T93 B;  3LUY A;  2H25 A;  5KZT A;  3IOT A;  4MLV A;  4JDF A;  2PMS A;  1LBB A;  2Q88 A;  1LFI A;  2L5V A;  3IR1 A;  3HHF A;  1QGX A;  1NV3 A;  1XI6 A;  1B0L A;  1IQ7 A;  4HTG A;  1NMU A;  3ECR A;  3QMF A;  1TT1 A;  4JXI A;  5ESY A;  4GL8 A;  4GX6 A;  4IO2 A;  4ZEB A;  4GL0 A;  5I59 A;  4Z0I A;  1PBP A;  1S9T A;  5FHN A;  1FBD A;  3W15 C;  3MVZ A;  3L6H A;  1BTJ A;  3A3U A;  3A29 A;  1EZP A;  4ZEK A;  4IR8 A;  4HW8 A;  1TFD A;  5BUU A;  4F2Q A;  2OWZ A;  1VFD A;  3RT6 B;  3SKP A;  2DWH A;  4FEB A;  1MH3 A;  1LLS A;  3TTR A;  1FRP A;  1Y3Q A;  3QIM A;  1HSJ A;  3G3K A;  1YYZ A;  2QS1 A;  2VHA A;  4BDL A;  4GWU A;  2GHA A;  2HQ0 A;  4JVD A;  1ZMG A;  4N07 A;  1B3H A;  5I57 B;  1O7T A;  2CEY A;  4KD5 A;  2WYP A;  1B2H A;  4HCY A;  3DP6 A;  2Y5L A;  5FHO A;  4QFO A;  5IM2 A;  4O3B A;  1A8F A;  3T66 A;  1US4 A;  1MPB A;  4QXD A;  1URG A;  1MY3 A;  2X7P A;  1M5B A;  3VV5 A;  2FVZ A;  4GWZ A;  1P99 A;  1VFE A;  4LQ2 A;  5J16 A;  1ZBM A;  4XKQ A;  4MEV A;  2AIX A;  2V3U A;  4L17 A;  3UN6 A;  5AE4 A;  3O66 A;  4N6P A;  5DT6 A;  1I6B A;  4AB6 A;  3H06 B;  2XX9 A;  2WBD A;  2OWS A;  2VP1 A;  1MQJ A;  3CFX A;  3D4C A;  3M3F A;  1R9Q A;  1EZO A;  2O68 A;  4F39 A;  3K2D A;  3IO4 A;  2P0S A;  3MUQ A;  3T9X B;  1JNF A;  2O1L A;  2IA4 A;  4ZZE A;  1RDZ A;  5B70 A;  3K4U A;  3RPW A;  3FV1 A;  2Q2A A;  4H1X A;  2I3V A;  1LBC A;  1IXC A;  1FBP A;  1FPK A;  1MG1 A;  1G0I A;  5HBC A;  2A5T B;  4LUB A;  2KLF A;  1MM6 A;  3Q27 A;  2NUV A;  3Q26 A;  4JBZ A;  4LP2 B;  1B7U A;  4ONY A;  4NF4 B;  3C36 A;  1TXF A;  4G61 A;  1M5E A;  1AMF A;  5DVF A;  3RTW B;  3E3K A;  4EXL A;  3TTN A;  3FJG A;  3KEI A;  3KBR A;  3OEL A;  3QUF A;  4IY5 A;  1P1Q A;  1RDX A;  3FXU A;  1LBV A;  4F1U A;  1BKA A;  3IB0 A;  2XXY A;  4PFU A;  3ZKK A;  2V84 A;  2UVJ A;  2Q9T A;  1SBP A;  3AXF A;  4ZEF A;  4O7I A;  3TTM A;  1OVB A;  2HZL A;  4YKI A;  1S7Y A;  2H5Y A;  1B7Z A;  1P1U A;  4R6K A;  1FTJ A;  2B4L A;  4XIG Q;  3MC2 A;  3TCF A;  4GOT A;  5F24 A;  4P0G A;  4R75 A;  5I7I A;  1FCK A;  4QFL A;  4NF5 B;  1LEV A;  3K0V A;  2ZMB A;  3JZJ A;  2FIE A;  2FYI A;  4WED A;  3B50 A;  2DXY A;  1LAG E;  4OVQ A;  4JWX A;  2X7Q A;  1B51 A;  4BDQ A;  4H0W A;  2OJT A;  1SVX B;  2V3T A;  3IB1 A;  3OMB A;  2PVU A;  4OVJ A;  2HXW A;  5CBS A;  1FBE A;  1EH3 A;  5A5X A;  1POT A;  2P3V A;  4OVT A;  1AOV A;  2E1S A;  5ISU A;  1OIB A;  1NH7 A;  3U93 A;  1FPG A;  4GBV A;  4I1D A;  3FIR A;  2DS9 A;  4GX4 A;  1MY2 A;  5I59 B;  4EQB A;  4KYD A;  3THI A;  2Y7I A;  4NF8 A;  5CMC A;  1M5C A;  3PUW E;  4GF8 A;  1D9V A;  5I2N A;  3C9H A;  1QW0 A;  2FIX A;  3V8X B;  3SER A;  3IJO B;  4GWW A;  2VOZ A;  4YIC A;  1IZ1 A;  1NUX A;  1DPE A;  2ZYO A;  4EUO A;  4ZZA A;  3T9V A;  1IIT A;  4F31 B;  4THI A;  4ELP A;  2F35 A;  4OVR A;  3JV9 A;  2PFZ A;  4P1L A;  4U4S A;  4R9F A;  1OLC A;  3K00 A;  1Y9U A;  2B3F A;  2RC9 A;  1B58 A;  1J1N A;  5H8Q A;  2XWO A;  3OO6 A;  2F7C A;  4RYA A;  4GIZ A;  4U1O A;  3SEV A;  3TCG A;  4QF9 A;  2QS3 A;  1SW2 A;  4GWX A;  4FE8 A;  2M8C A;  5I2K A;  3V89 B;  3TCH A;  1FSA A;  1SW4 A;  3N6T A;  2XX8 A;  4X48 A;  2ONR A;  1O64 A;  3RY3 A;  1Y1Z A;  4TQU Q;  3EHS A;  2A5S A;  2P3N A;  3RGY A;  1LAF E;  1NV5 A;  4YKP A;  4M4G A;  5DEX A;  3HHG A;  3KGC A;  3MWB A;  2F34 A;  4XF5 A;  5ITO A;  3T1B A;  2IEE A;  4EXK A;  3FJM A;  1GVC A;  4MFI A;  1B5J A;  3DP4 A;  1UIU A;  4AS4 A;  1URD A;  4G8N A;  3C32 A;  1TFA A;  2I6E A;  2GHB A;  4PFY A;  2THI A;  3K1P A;  1JW1 A;  1XS5 A;  3RPL A;  3P7I A;  1FW0 A;  3HO7 A;  3FD3 A;  1NV4 A;  4GWO A;  4KXP A;  3FXR A;  3TTK A;  4OEV A;  4FBP A;  2VPO A;  3NOH A;  3K6V A;  4ZEI A;  3U92 A;  3H6U A;  5CMK A;  1KWH A;  1SQY A;  2GQ1 A;  2O1M A;  1FTL A;  1DTG A;  1FQD A;  1N3W A;  3TKD A;  3RLF E;  2W7Y A;  4OQO A;  3VXB A;  1QVS A;  4QHQ A;  1Q9D A;  1Q1K A;  3VVE A;  4N6D A;  1T0K A;  2QMW A;  4PFT A;  4FED A;  3O6I A;  1USY H;  4F3P A;  2ZYK A;  2PBW A;  2FBP A;  3EN3 A;  1BLF A;  1Y1M A;  1SDX A;  3FVN A;  2ZNS A;  4ESX A;  4F18 A;  3OXN A;  4JWY A;  4G8M A;  1SI0 A;  3EKI A;  3OO9 A;  3W9V A;  2Y7P A;  5KCJ A;  4LON B;  3MVX A;  4EQ7 A;  3BBR A;  4OER A;  3FAT A;  1TWY A;  3E79 A;  4DZ1 A;  1JW5 A;  2F8D A;  3KOS A;  2QJE A;  1JEU A;  1LB8 A;  3OOA A;  4NWD A;  2V25 A;  4MNC A;  1LFH A;  3CFL A;  2CZH A;  3DM0 A;  1NI9 A;  2PT1 A;  4PGP A;  2VD3 A;  1H76 A;  4N81 A;  2UXA A;  1PB9 A;  3MQ9 A;  4DXU A;  2Q8M A;  3K6W A;  3D1R A;  3MYU A;  4XEQ A;  2XWK A;  3I3V A;  1LBX A;  4N15 A;  4FIM A;  1F9B A;  3M8U A;  5AA2 D;  3KN8 A;  1MXX A;  3DP8 A;  4P11 A;  2F3D A;  1H44 A;  1D4N A;  4IB2 A;  1WVJ A;  3OO7 A;  3T9U A;  4UAB A;  5L9M A;  4IGT A;  1RYO A;  3MZB A;  2O7U A;  3PV0 E;  2DVC A;  1XOC A;  1BK4 A;  3K6U A;  1NNF A;  2CMO A;  4POW A;  4KI0 E;  4Q8R A;  2V4C A;  4ND9 A;  3Q25 A;  1PBQ A;  4MCO A;  4I9D A;  4MNI A;  5IKB A;  4NF8 B;  1B3E A;  1MPD A;  1SW1 A;  4O3C A;  1FBH A;  4QSD A;  2AYS A;  3N94 A;  3K1N A;  5I2N B;  1Z7N E;  2X26 A;  1NL5 A;  5EHS A;  3PUZ E;  1FPD A;  4OEU A;  5LOM A;  1N76 A;  1ZKB A;  5CMB A;  1IUD A;  3KBZ A;  1NV1 A;  1SYH A;  2FHY A;  1Q35 A;  1OVT A;  4C0R A;  1B3F A;  4YB6 A;  4PBH A;  3TQW A;  4OET A;  2F6G A;  5H8Q B;  3VXC A;  5AA3 A;  4NE4 A;  4EF1 A;  4DE8 A;  3GBB A;  1VE4 A;  3LC8 A;  1PB7 A;  3MP6 A;  5AA1 A;  1NUW A;  5I2K B;  3B8B A;  3SDF A;  3EPE A;  1URS A;  4N8G A;  4UAC A;  4BLA A;  5EYH A;  4X9T A;  5EQA A;  4ZED A;  4YZZ A;  4YKK A;  4O7M A;  3TMG A;  3CFZ A;  4DIG A;  3L6G A;  4R6Y A;  3ISP A;  2XXR A;  3T0J A;  1KA0 A;  5EYG A;  2OCU A;  3RUM A;  5DEX B;  4OHN A;  2O7I A;  1B4Z A;  2VT5 A;  2DDK A;  1B46 A;  3ZSF A;  4F3B A;  3VLW A;  4Q0C A;  2DXR A;  3RQT A;  2OK2 A;  3G3H A;  4PF6 A;  2R71 A;  5FHM A;  3H7M A;  3PUV E;  2CZI A;  3I6V A;  2F97 A;  1MQG A;  3O6G A;  3OD7 A;  4OVP A;  3RPL B;  1RKM A;  4OMB A;  2I48 A;  5EQ8 A;  3PPR A;  4N6K A;  1JQF A;  1A8E A;  4GD5 A;  1LB9 A;  1FTM A;  3MST A;  4LZ8 A;  1B9J A;  4PET A;  4G8H A;  4Z7E A;  2KQZ A;  1WOD A;  1ZTY A;  2H98 A;  3T96 B;  2HFB A;  1AIV A;  4QSC A;  2QPQ A;  3O29 A;  1R1N A;  2Z8F A;  4JVI A;  5F1Q A;  5TPA A;  3FZV A;  2NWJ A;  1FJ6 A;  3ILU B;  5IZ3 A;  1A54 A;  3EHT A;  3F11 A;  4LZ7 A;  5HPQ A;  3BIH A;  1PEB A;  5DVI A;  5DYH A;  4FAT A;  1DK4 A;  1KZ8 A;  4I40 A;  4HS7 A;  1JVY A;  1FQA A;  5KCJ B;  3SEX A;  4GFR A;  3ZKL A;  3HN0 A;  3MPK A;  3MP8 A;  3UK4 A;  4OYV A;  4G2Z A;  4WEP A;  3TZA A;  3R7X A;  1YCJ A;  2VPN A;  2G29 A;  4QBA A;  4XTC Q;  2Y7R A;  4H8I A;  1M5F A;  4PAF A;  4DLD A;  4DXC A;  3OSR A;  2DVZ A;  1UTB A;  3BIG A;  2RIN A;  2ZZW A;  3G3I A;  5JK4 A;  1MXU A;  2R6G E;  1H45 A;  1MS7 A;  4X8R A;  1FPF A;  1QUL A;  3DLN A;  4TLL B;  1MXV A;  1Y3P A;  3ILT B;  1P1O A;  2ABH A;  1YTV A;  5DTB A;  4RA1 A;  2LAO A;  1DMB A;  5AA4 A;  1LCT A;  4NTL A;  1MXY A;  1PB8 A;  5K2Y A;  1QUK A;  3MPL A;  2ONK E;  4KHZ E;  4GXA A;  4ELR A;  1FTO A;  1RDY A;  1B3G A;  1DTZ A;  5IZZ A;  5CBR A;  4PFI A;  4H45 A;  2OBG A;  1FPI A;  3DEL B;  5EQ7 A;  3MW0 A;  4HE2 A;  3FVO A;  4F1Y A;  2D5W A;  4N17 A;  2ONS A;  3IB2 A;  4PFR A;  4U21 A;  3CIJ A;  4GWS A;  2B3B A;  2OZZ A;  3N6U A;  4P0I A;  2XXI A;  2H4I A;  2ZZX A;  4YKJ A;  4PTK A;  3TUS A;  2XXT A;  2HXR A;  1LFG A;  4TLM B;  1OQH A;  2WX9 A;  5ET7 A;  3A3C A;  4GWY A;  3CG3 A;  2DQV A;  4HE1 A;  1B05 A;  4MAG A;  1XT8 A;  4MBP A;  1GR2 A;  1ZU0 A;  2UVH A;  3KSX A;  1N3X A;  3UP9 A;  3MZ1 A;  4G77 A;  1B4H A;  1WDN A;  4KYS A;  2QVV A;  4NMY A;  3HST A;  1GGG A;  2WYK A;  4LAT A;  4ZS9 A;  3O97 A;  5J1D A;  1AWB A;  4XKR A;  3PD8 A;  2JJK A;  1MRP A;  3C35 A;  1NUY A;  3UOR A;  1D9Y A;  4KR5 A;  3OO8 A;  3IK6 B;  5K2X A;  4O3A A;  4RJZ A;  3PUX E;  3QSL A;  3QAX A;  2RKM A;  4OWD A;  4NN3 A;  1MDP 1;  4WKM A;  2ZZV A;  2F7A A;  1INP A;  3GYY A;  5ITP A;  4H5G A;  4IO6 A;  1N0T A;  4GBW A;  4PGN A;  3C34 A;  3KOT A;  1EZ9 A;  5HM4 B;  3TPA A;  4F2O A;  1LAH E;  1I6A A;  4E0W A;  1YZ0 A;  2F7B A;  1EYK A;  1RYX A;  3IOW A;  1R9L A;  3W9W A;  3PMW A;  4RK2 A;  1FQF A;  2Y7K A;  5H8N A;  4MNP A;  4JSD A;  4DDD A;  3HPI A;  1B1H A;  5ET6 A;  1EU8 A;  5TPA B;  3FVG A;  1IMB A;  2P2A A;  2BJJ X;  4OFO A;  2VD2 A;  4BDM A;  3LSX A;  1LBZ A;  2GFE A;  3PD9 A;  3KFM A;  5IZ3 B;  4JSO A;  5ET8 A;  3OEM A;  3BKI B;  3RNN A;  4PBQ A;  3M3K A;  3M3L A;  4LN5 A;  4RK9 A;  4PAI A;  3ZS6 A;  2QRY A;  4PF8 A;  3KN7 A;  1YPN A;  5ET5 A;  4FOR A;  3QUJ A;  1P1N A;  4YMB A;  3KN3 A;  1GV8 A;  3H03 A;  5KDT B;  4H67 A;  1CB6 A;  2XD3 A;  3FBP A;  3GXA A;  4IGR A;  1ELJ A;  1FQB A;  1FBG A;  4GQO A;  4NQ8 A;  1MQH A;  1Y4C A;  4XKP A;  3LSW A;  2F78 A;  1MH4 A;  3KJ7 A;  1D3K A;  3KJT A;  1FQE A;  3FAS A;  4YB5 A;  4N13 A;  3B6T A;  1UTB B;  4LZ5 A;  2PX1 A;  5L8D A;  5I58 B;  2D3I A;  3TAJ A;  4UA8 A;  3FV2 A;  4N4U A;  5I3S A;  3RN8 A;  1LST A;  3TEL A;  1FBF A;  5DW8 A;  3IAZ A;  2ZNU A;  2F3B A;  4DXB A;  4OFJ A;  4NF6 B;  2CZK A;  4R9G A;  1LAX A;  5AA4 B;  4GRK A;  4I62 A;  4U23 A;  4Q5T A;  2DWI A;  4MX6 A;  1NV6 A;  3U8Q A;  4BDR A;  2HAU A;  3N26 A;  2ANJ A;  4ISU A;  4X1B A;  4IO7 A;  5I5P A;  2CEX A;  1Z7M E;  4QFP A;  1DSN A;  3O9P A;  3GLB A;  2ALU A;  2OLB A;  4JB7 A;  3USD A;  3LSL A;  2DE2 A;  4PQJ A;  1H43 A;  2HCA A;  2F5X A;  3H6T A;  2ZNT A;  3FJ7 A;  3PPQ A;  2V3Q A;  2F36 A;  2OWT A;  2WBB A;  1IME A;  1A99 A;  1K9Y A;  1ATG A;  1KA1 A;  2ZXT A;  4EF2 A;  3VVF A;  3VVD A;  3HCQ A;  3BFT A;  3MVY A;  4K3F A;  5JEI A;  4HCW A;  2XD2 A;  1Y3N A;  2QL3 A;  5I56 A;  1NFT A;  1BIY A;  3JYR A;  4P8B A;  2Z22 A;  3O28 A;  3TTL A;  1YXI A;  3WAE A;  5ICT A;  4OVS A;  3GBA A;  3PPN A;  3E78 A;  1MPC A;  1XC1 A;  3TFL A;  2Q8J A;  3FVK A;  2DWJ A;  1IXI A;  1P1W A;  4EDP A;  2WKY A;  1MQD A;  1GTK A;  2P1S A;  4QRZ A;  2QSX A;  3CR9 A;  3O2A A;  5L9S A;  3OEN A;  2Q74 A;  3LR1 A;  3TOD A;  4Q30 B;  3EQ1 A;  2XXP A;  4R2B A;  1IXG A;  1PDA A;  5ELV A;  1FPL A;  3CI8 A;  3PTY A;  4NX1 A;  2O69 A;  2PFY A;  4NF0 A;  2O6A A;  4BDN A;  2RC8 A;  3U1O A;  3VFJ A;  1I6Q A;  4YMA A;  2RF1 A;  4R72 A;  2I3W A;  3IFC A;  5CI5 A;  5H8H A;  2I4C A;  5M2V A;  4O94 A;  3D4G A;  1NV2 A;  2WEF A;  4ESW A;  1XVY A;  2XXH A;  5CC2 A;  3U94 A;  3ONM A;  1SPI A;  2G93 A;  4KCD A;  3BFU A;  3IJX B;  1B5I A;  4PE3 A;  3B6Q A;  4DI4 B;  5IZ1 A;  1JEV A;  1QKB A;  1HSE A;  1LBW A;  5CMM A;  5H8N B;  1B32 A;  1DCU A;  5H8F A;  3PU5 A;  1SI1 A;  4RNS A;  3EHU A;  4IY6 A;  4PAK A;  5L9O A;  3S9L C;  4DI3 D;  2Z8E A;  4PDH A;  2REJ A;  2O51 A;  4LQ5 A;  4JWO A;  2REG A;  1BP5 A;  3EF7 A;  1UTH B;  1XVX A;  1LBY A;  1USY E;  4QFK A;  1UIV A;  2GRV A;  4PP0 A;  4WXJ A;  5I84 A;  3PGF A;  3RT8 A;  5TP9 A;  4YAH X;  3G3G A;  4ELO A;  3CVG A;  4QFN A;  2OX3 A;  3T22 A;  1JP4 A;  1CE2 A;  1M5D A;  1VDW A;  5EYF A;  2I0B A;  1NNT A;  1OQG A;  4U4X A;  2DWA A;  1A55 A;  4OFL A;  3U72 A;  2VGQ A;  2QFL A;  2RC7 A;  2XXK A;  3ROJ A;  1LCF A;  2KR0 A;  2FNC A;  5LDZ A;  2QMX A;  4MHF A;  1ZIU A;  1YAE A;  3LSF B;  4U2R A;  4OA4 A;  4NG7 A;  2Y5K A;  1EYJ A;  2UYE A;  1SW5 A;  2O84 X;  1H3D A;  2XX7 A;  4KQP A;  4LVQ A;  1G0H A;  3H4Z A;  4LA9 A;  4MJO A;  3H3G A;  2MKZ A;  3KC1 A;  4DCY A;  3GZG A;  2QS4 A;  3IL1 B;  1B5H A;  1N84 A;  5IGA A;  4G4P A;  4GLI A;  1OMP A;  3MP1 A;  1JVX A;  2XXW A;  5KDT A;  5AA2 A;  3G3F A;  1N7W A;  3SEU A;  2PCR A;  1FPJ A;  1ANF A;  3I5O A;  2XXX A;  4RXL A;  2R9J A;  5IAI A;  2HHM A;  4PE5 B;  3UA8 A;  4G68 A;  5ICQ A;  4F22 A;  1JET A;  5I58 A;  4JVC A;  4F1V A;  4PC9 A;  3C4M A;  3FUZ A;  4IO3 A;  1QUJ A;  1N04 A;  2YPN A;  3V5A A;  3G7W A;  2AL4 A;  1DBZ A;  4MIJ A;  4KFQ A;  4NF6 A;  3E13 X;  3QXM A;  2I0C A;  4F3S A;  2CZL A;  1FJ9 A;  5JTY A;  1CNQ A;  4H5F A;  4ZE8 A;  2D21 A;  2B4M A;  4MF3 A;  3VLU A;  4OAN A;  4F19 A;  1JW4 A;  3Q29 A;  4NGU A;  2ZYM A;  2XA5 A;  5I56 B;  5B7D A;  2HZK A;  3S4U A;  1US5 A;  1VSO A;  4NHB A;  4YB7 A;  4GX3 A;  5CRY A;  4H8J A;  4C1T A;  4N8Y A;  1NV0 A;  2DSF A;  5A5L A;  4RY1 A;  2NXO A;  3R26 A;  3OSQ A;  2YJP A;  1LGB C;  2DE4 A;  4P3L A;  3UGW A;  4DCX A;  4GXS B;  2QVU A;  4F29 A;  5DVJ A;  4X1D A;  1MQI A;  3CSB A;  2H99 A;  2Z23 A;  2H9B A;  4P56 A;  2R8T A;  2YLN A;  4PFW A;  2PYY A;  4U22 A;  2I49 A;  3C33 A;  4EQ9 A;  3IOR A;  4FEC A;  3S9M C;  2GH9 A;  5H8H B;  2HAV A;  3R6U A;  3B6W A;  3U65 A;  1B7H A;  3TYH A;  3HV1 A;  3KC0 A;  3C31 A;  2XWI A;  4HE0 A;  1N7X A;  4H6D A;  4G68 C;  1NNK A;  2E0S A;  1B1X A;  2XXU A;  3TDJ A;  1IMA A;  2F6P A;  5FTI A;  1B0H A;  1MY1 A;  4KPT A;  3VLV A;  4OXV A;  5F7V A;  2XXQ A;  2NOO A;  2DYX A;  1IEJ A;  5H8F B;  4ELQ A;  4I3E A;  1EYI A;  4MH5 A;  3PPP A;  4IO5 A;  4N91 A;  1B52 A;  4QSE A;  1A7L A;  2V93 A;  4R73 A;  1IMC A;  2FA7 A;  1S50 A;  2DP8 A;  3OEK A;  2Q2C A;  1I69 A;  2B65 A;  5H8S A;  3KZG A;  3QYT A;  3VDF A;  5TP9 B;  1B6H A;  3PMV A;  3TEP A;  1IXH A;  1PC3 A;  3IOU A;  3SES A;  1NV7 A;  1FPE A;  3G3J A;  4ZEC A;  1MY4 A;  4NAP A;  3CHG A;  1R6Z A;  3LBS A;  1DPP A;  2HEU A;  4F3G A;  4ZE9 A;  2BJI A;  3PMX A;  5FTH A;  4FJP A;  3S9N C;  4E0X A;  2Y7W A;  3LUZ A;  4H65 A;  4PCD A;  1L5T A;  4OEN A;  3RYD A;  4I8C A;  3MVW A;  1IMD A;  4IO4 A;  1QJM A;  1UTH A;  4NWC A;  1MM7 A;  2ESN A;  4OZ9 A;  1II5 A;  3O6H A;  2ZYN A;  4R6H A;  4POX A;  4KYE A;  3MAM A;  3SZP A;  4XKN A;  1ZJL A;  1O63 A;  4P1E A;  4YU0 A;  3V83 A;  1VR5 A;  4C1U A;  5I57 A;  4BDO A;  4RPN A;  3H6V A;  3S2V A;  3K1M A;  2HPG A;  2XHD A;  3ODB A;  1QUI A;  5AA2 B;  4AS5 A;  4H46 A;  1Y4T A;  1A40 A;  2Q89 A;  2QVR A;  1NKX A;  4X04 A;  3WAF A;  1Y20 A;  4PDD A;  3SEY A;  1MXZ A;  1DOT A;  1IIW A;  5CM6 A;  3K6X A;  3VE1 B;  1FQC A;  3FXB A;  1ZLQ A;  1MXW A;  4G68 B;  3SET A;  1FTA A;  2AL5 A;  3E4R A;  3K02 A;  1UQW A;  3K01 A;  4FAJ A;  4KCC A;  4PFB A;  3MJN A;  3CG1 A;  1XHY A;  2UYF A;  2RCB A;  1NUZ A;  5JTY B;  4MLQ A;  4ECF A;  4MMP A;  4OES A;  3MBP A;  4NED A;  3IX1 A;  3IOV A;  3LV0 A;  3PUY E;  3KG2 A;  4OTE A;  4P47 A;  1POY 1;  3KSJ A;  3TQL A;  4R74 A;  5FBP A;  1IMF A;  5LTC A;  3A09 A;  1AL3 A;  3CRB A;  2A5T A;  4AQ4 A;  1B3L A;  4I3Y A;  3Q28 A;  2PT2 A;  2UVG A;  1AH5 A;  3PPO A;  4GVO A;  3MZ9 A;  4NF4 A;  3CSG A;  4XXU A;  1OLA A;  4XFE A;  3B7D A;  1D9Q A;  3T9H B;  5BWJ A;  5EQ9 A; 
#chains in the Genus database with same CATH homology
 4TOZ A;  3SEW A;  2DE3 A;  1QKA A;  4AB5 A;  3RTF B;  5EHM A;  4R2F A;  1HSL A;  2NVU B;  2Y84 A;  3IO6 A;  2I58 A;  5A5X B;  4U1Z A;  4M1V A;  3S9E A;  2DOJ A;  1NNP A;  3UIF A;  2QS2 A;  1MY0 A;  1SYI A;  1B40 A;  3FGS A;  4NF5 A;  1NH8 A;  3FXQ A;  2UVI A;  4RPO A;  3H6W A;  1FTK A;  4ZDM A;  1SD3 A;  2I4B A;  2RCA A;  2Z8D A;  1MDQ A;  2XXV A;  3QK6 A;  5TU0 A;  3E9X A;  3N5L A;  3T93 B;  3LUY A;  2H25 A;  5KZT A;  3IOT A;  4MLV A;  4JDF A;  2PMS A;  1LBB A;  2Q88 A;  1LFI A;  3IR1 A;  3HHF A;  1B0L A;  1IQ7 A;  4HTG A;  1NMU A;  3ECR A;  1TT1 A;  4JXI A;  4GL8 A;  4IO2 A;  4ZEB A;  4GL0 A;  5I59 A;  4Z0I A;  1PBP A;  1S9T A;  5FHN A;  3W15 C;  3MVZ A;  3L6H A;  1BTJ A;  3A3U A;  1EZP A;  4ZEK A;  4HW8 A;  1TFD A;  5BUU A;  4F2Q A;  1VFD A;  3RT6 B;  3SKP A;  2DWH A;  4FEB A;  1MH3 A;  1LLS A;  3TTR A;  1Y3Q A;  3QIM A;  1HSJ A;  3G3K A;  2QS1 A;  2VHA A;  4BDL A;  2GHA A;  2HQ0 A;  1ZMG A;  4N07 A;  1B3H A;  5I57 B;  1O7T A;  4KD5 A;  1B2H A;  4HCY A;  3DP6 A;  5FHO A;  4QFO A;  4O3B A;  1A8F A;  3T66 A;  1US4 A;  1MPB A;  1URG A;  1MY3 A;  2X7P A;  1M5B A;  3VV5 A;  1P99 A;  1VFE A;  4LQ2 A;  1ZBM A;  4XKQ A;  2AIX A;  2V3U A;  4L17 A;  3UN6 A;  5AE4 A;  3O66 A;  4N6P A;  5DT6 A;  1I6B A;  4AB6 A;  3H06 B;  2XX9 A;  2OWS A;  2VP1 A;  1MQJ A;  3CFX A;  3D4C A;  3M3F A;  1R9Q A;  1EZO A;  2O68 A;  4F39 A;  3K2D A;  3IO4 A;  2P0S A;  3MUQ A;  3T9X B;  1JNF A;  2O1L A;  2IA4 A;  4ZZE A;  5B70 A;  3K4U A;  3RPW A;  3FV1 A;  2Q2A A;  4H1X A;  2I3V A;  1LBC A;  1IXC A;  1MG1 A;  5HBC A;  2A5T B;  4LUB A;  2KLF A;  1MM6 A;  3Q27 A;  2NUV A;  3Q26 A;  4JBZ A;  4LP2 B;  1B7U A;  4ONY A;  4NF4 B;  3C36 A;  1TXF A;  1M5E A;  1AMF A;  5DVF A;  3RTW B;  3E3K A;  4EXL A;  3TTN A;  3FJG A;  3KEI A;  3KBR A;  3OEL A;  3QUF A;  4IY5 A;  1P1Q A;  3FXU A;  4F1U A;  1BKA A;  3IB0 A;  2XXY A;  4PFU A;  3ZKK A;  2V84 A;  2UVJ A;  2Q9T A;  1SBP A;  3AXF A;  4ZEF A;  3TTM A;  1OVB A;  2HZL A;  4YKI A;  1S7Y A;  2H5Y A;  1B7Z A;  1P1U A;  4R6K A;  1FTJ A;  4XIG Q;  3MC2 A;  3TCF A;  4GOT A;  4P0G A;  4R75 A;  1FCK A;  4QFL A;  4NF5 B;  3K0V A;  2ZMB A;  3JZJ A;  2FYI A;  4WED A;  2DXY A;  1LAG E;  4JWX A;  2X7Q A;  1B51 A;  4BDQ A;  4H0W A;  2OJT A;  1SVX B;  2V3T A;  3IB1 A;  3OMB A;  2PVU A;  4OVJ A;  2HXW A;  5CBS A;  1EH3 A;  5A5X A;  1POT A;  1AOV A;  2E1S A;  5ISU A;  1OIB A;  1NH7 A;  3U93 A;  4I1D A;  3FIR A;  2DS9 A;  1MY2 A;  5I59 B;  4EQB A;  4KYD A;  3THI A;  2Y7I A;  4NF8 A;  5CMC A;  1M5C A;  3PUW E;  4GF8 A;  1D9V A;  5I2N A;  3C9H A;  1QW0 A;  3V8X B;  3SER A;  3IJO B;  2VOZ A;  4YIC A;  1IZ1 A;  1DPE A;  2ZYO A;  4EUO A;  4ZZA A;  3T9V A;  1IIT A;  4F31 B;  4THI A;  4ELP A;  2F35 A;  3JV9 A;  4U4S A;  4R9F A;  1OLC A;  3K00 A;  1Y9U A;  2B3F A;  2RC9 A;  1B58 A;  1J1N A;  5H8Q A;  3OO6 A;  2F7C A;  4RYA A;  4GIZ A;  4U1O A;  3SEV A;  3TCG A;  2QS3 A;  1SW2 A;  4QF9 A;  4FE8 A;  2M8C A;  5I2K A;  3V89 B;  3TCH A;  1SW4 A;  3N6T A;  2XX8 A;  4X48 A;  2ONR A;  1O64 A;  3RY3 A;  1Y1Z A;  4TQU Q;  3EHS A;  2A5S A;  3RGY A;  1LAF E;  4YKP A;  4M4G A;  5DEX A;  3HHG A;  3KGC A;  3MWB A;  2F34 A;  5ITO A;  2IEE A;  4EXK A;  3FJM A;  1GVC A;  4MFI A;  1B5J A;  3DP4 A;  1UIU A;  1URD A;  4G8N A;  3C32 A;  1TFA A;  2I6E A;  2GHB A;  4PFY A;  2THI A;  3K1P A;  1JW1 A;  1XS5 A;  3P7I A;  1FW0 A;  3HO7 A;  3FD3 A;  4GWO A;  3FXR A;  3TTK A;  4OEV A;  3K6V A;  4ZEI A;  3U92 A;  3H6U A;  5CMK A;  1KWH A;  1SQY A;  2O1M A;  1FTL A;  1DTG A;  1FQD A;  1N3W A;  3TKD A;  3RLF E;  2W7Y A;  4OQO A;  3VXB A;  1QVS A;  4QHQ A;  1Q1K A;  3VVE A;  1T0K A;  2QMW A;  4PFT A;  4FED A;  3O6I A;  1USY H;  4F3P A;  2ZYK A;  2PBW A;  3EN3 A;  1BLF A;  1Y1M A;  1SDX A;  3FVN A;  2ZNS A;  4ESX A;  4F18 A;  3OXN A;  4JWY A;  4G8M A;  1SI0 A;  3OO9 A;  3W9V A;  2Y7P A;  5KCJ A;  4LON B;  3MVX A;  4EQ7 A;  3BBR A;  4OER A;  3FAT A;  1TWY A;  4DZ1 A;  1JW5 A;  2F8D A;  3KOS A;  2QJE A;  1JEU A;  1LB8 A;  3OOA A;  4NWD A;  2V25 A;  1LFH A;  3CFL A;  3DM0 A;  2PT1 A;  2VD3 A;  1H76 A;  2UXA A;  1PB9 A;  3MQ9 A;  4DXU A;  3K6W A;  3I3V A;  4FIM A;  1F9B A;  3M8U A;  5AA2 D;  3KN8 A;  1MXX A;  3DP8 A;  4P11 A;  1H44 A;  1D4N A;  4IB2 A;  1WVJ A;  3OO7 A;  3T9U A;  5L9M A;  4IGT A;  1RYO A;  3MZB A;  2O7U A;  3PV0 E;  2DVC A;  1XOC A;  3K6U A;  1NNF A;  2CMO A;  4POW A;  4KI0 E;  4Q8R A;  4ND9 A;  3Q25 A;  1PBQ A;  4I9D A;  5IKB A;  4NF8 B;  1B3E A;  1MPD A;  1SW1 A;  4O3C A;  4QSD A;  2AYS A;  3N94 A;  3K1N A;  5I2N B;  1Z7N E;  2X26 A;  1NL5 A;  5EHS A;  3PUZ E;  4OEU A;  5LOM A;  5CMB A;  1N76 A;  1ZKB A;  1IUD A;  1SYH A;  1Q35 A;  1OVT A;  4C0R A;  1B3F A;  4YB6 A;  3TQW A;  4OET A;  2F6G A;  5H8Q B;  3VXC A;  5AA3 A;  4NE4 A;  4EF1 A;  4DE8 A;  3GBB A;  1VE4 A;  3LC8 A;  1PB7 A;  3MP6 A;  5AA1 A;  5I2K B;  3SDF A;  3EPE A;  1URS A;  4UAC A;  4BLA A;  4X9T A;  4ZED A;  4YZZ A;  4YKK A;  3TMG A;  3CFZ A;  4DIG A;  3L6G A;  4R6Y A;  2XXR A;  2OCU A;  3RUM A;  5DEX B;  4OHN A;  2O7I A;  1B4Z A;  1B46 A;  3ZSF A;  4F3B A;  3VLW A;  4Q0C A;  2DXR A;  3RQT A;  2OK2 A;  3G3H A;  2R71 A;  5FHM A;  3H7M A;  3PUV E;  3I6V A;  2F97 A;  1MQG A;  3O6G A;  3OD7 A;  1RKM A;  4OMB A;  2I48 A;  3PPR A;  1JQF A;  1A8E A;  4GD5 A;  1LB9 A;  1FTM A;  4PET A;  4LZ8 A;  1B9J A;  4G8H A;  4Z7E A;  1WOD A;  1ZTY A;  2H98 A;  3T96 B;  2HFB A;  1AIV A;  4QSC A;  2QPQ A;  3O29 A;  1R1N A;  2Z8F A;  5F1Q A;  5TPA A;  3FZV A;  2NWJ A;  3ILU B;  1A54 A;  3EHT A;  3F11 A;  4LZ7 A;  5HPQ A;  1PEB A;  5DVI A;  5DYH A;  4FAT A;  4HS7 A;  1JVY A;  1FQA A;  5KCJ B;  3SEX A;  4GFR A;  3ZKL A;  3HN0 A;  3MPK A;  3MP8 A;  3UK4 A;  4OYV A;  4G2Z A;  4WEP A;  3TZA A;  3R7X A;  1YCJ A;  2G29 A;  4XTC Q;  2Y7R A;  4H8I A;  1M5F A;  4DLD A;  4DXC A;  3OSR A;  2DVZ A;  1UTB A;  2RIN A;  3G3I A;  5JK4 A;  1MXU A;  2R6G E;  1H45 A;  1MS7 A;  1QUL A;  3DLN A;  4TLL B;  1MXV A;  1Y3P A;  3ILT B;  1P1O A;  2ABH A;  1YTV A;  5DTB A;  4RA1 A;  2LAO A;  1DMB A;  5AA4 A;  1LCT A;  4NTL A;  1MXY A;  1PB8 A;  5K2Y A;  1QUK A;  3MPL A;  2ONK E;  4KHZ E;  4GXA A;  4ELR A;  1FTO A;  1B3G A;  1DTZ A;  5CBR A;  2OBG A;  3DEL B;  3MW0 A;  3FVO A;  4F1Y A;  2D5W A;  2ONS A;  3IB2 A;  4U21 A;  3CIJ A;  2B3B A;  2OZZ A;  3N6U A;  4P0I A;  2XXI A;  2H4I A;  4YKJ A;  3TUS A;  2XXT A;  1LFG A;  4TLM B;  1OQH A;  3A3C A;  3CG3 A;  2DQV A;  1B05 A;  1XT8 A;  4MBP A;  1GR2 A;  1ZU0 A;  2UVH A;  3KSX A;  1N3X A;  3UP9 A;  3MZ1 A;  4G77 A;  1B4H A;  1WDN A;  4KYS A;  4NMY A;  3HST A;  1GGG A;  4ZS9 A;  4LAT A;  3O97 A;  5J1D A;  4XKR A;  3PD8 A;  1MRP A;  3C35 A;  3UOR A;  1D9Y A;  4KR5 A;  3OO8 A;  3IK6 B;  5K2X A;  4O3A A;  4RJZ A;  3PUX E;  3QSL A;  3QAX A;  2RKM A;  4OWD A;  1MDP 1;  4WKM A;  2F7A A;  5ITP A;  4H5G A;  4IO6 A;  1N0T A;  3C34 A;  3KOT A;  1EZ9 A;  5HM4 B;  3TPA A;  4F2O A;  1LAH E;  1I6A A;  4E0W A;  2F7B A;  1RYX A;  3IOW A;  1R9L A;  3W9W A;  3PMW A;  4RK2 A;  1FQF A;  2Y7K A;  5H8N A;  4JSD A;  4DDD A;  3HPI A;  1B1H A;  5TPA B;  1EU8 A;  3FVG A;  2P2A A;  2BJJ X;  4OFO A;  2VD2 A;  4BDM A;  3LSX A;  2GFE A;  3PD9 A;  3KFM A;  4JSO A;  3OEM A;  3BKI B;  3RNN A;  3M3K A;  3M3L A;  4RK9 A;  3ZS6 A;  2QRY A;  3KN7 A;  1YPN A;  4FOR A;  3QUJ A;  1P1N A;  4YMB A;  3KN3 A;  1GV8 A;  3H03 A;  5KDT B;  4H67 A;  1CB6 A;  2XD3 A;  3GXA A;  4IGR A;  1ELJ A;  1FQB A;  4GQO A;  1MQH A;  1Y4C A;  4XKP A;  3LSW A;  2F78 A;  1MH4 A;  3KJ7 A;  1D3K A;  3KJT A;  1FQE A;  3FAS A;  4YB5 A;  4N13 A;  3B6T A;  1UTB B;  4LZ5 A;  2PX1 A;  5L8D A;  5I58 B;  2D3I A;  3TAJ A;  4UA8 A;  3FV2 A;  3RN8 A;  1LST A;  3TEL A;  3IAZ A;  2ZNU A;  4DXB A;  4OFJ A;  4NF6 B;  4R9G A;  1LAX A;  5AA4 B;  4GRK A;  4I62 A;  4U23 A;  4Q5T A;  2DWI A;  3U8Q A;  4BDR A;  2HAU A;  3N26 A;  2ANJ A;  4ISU A;  4X1B A;  4IO7 A;  1Z7M E;  4QFP A;  1DSN A;  3O9P A;  3GLB A;  2ALU A;  2OLB A;  4JB7 A;  3USD A;  3LSL A;  2DE2 A;  4PQJ A;  1H43 A;  2HCA A;  2F5X A;  3H6T A;  2ZNT A;  3FJ7 A;  3PPQ A;  2V3Q A;  2F36 A;  2OWT A;  1A99 A;  1ATG A;  2ZXT A;  4EF2 A;  3VVF A;  3VVD A;  3HCQ A;  3BFT A;  3MVY A;  4K3F A;  5JEI A;  4HCW A;  2XD2 A;  1Y3N A;  2QL3 A;  5I56 A;  1NFT A;  1BIY A;  3JYR A;  2Z22 A;  3O28 A;  3TTL A;  3WAE A;  5ICT A;  3GBA A;  3PPN A;  1MPC A;  1XC1 A;  3TFL A;  2Q8J A;  3FVK A;  2DWJ A;  1IXI A;  1P1W A;  4EDP A;  2WKY A;  1MQD A;  1GTK A;  2P1S A;  4QRZ A;  2QSX A;  3CR9 A;  3O2A A;  5L9S A;  3OEN A;  3LR1 A;  3TOD A;  4Q30 B;  3EQ1 A;  2XXP A;  4R2B A;  1IXG A;  1PDA A;  5ELV A;  3CI8 A;  2O69 A;  2O6A A;  4BDN A;  2RC8 A;  3U1O A;  3VFJ A;  1I6Q A;  4YMA A;  2RF1 A;  4R72 A;  2I3W A;  5CI5 A;  5H8H A;  2I4C A;  5M2V A;  3D4G A;  4ESW A;  1XVY A;  2XXH A;  5CC2 A;  3U94 A;  3ONM A;  2G93 A;  4KCD A;  3BFU A;  3IJX B;  1B5I A;  3B6Q A;  1JEV A;  1QKB A;  1HSE A;  5CMM A;  5H8N B;  1B32 A;  5H8F A;  3PU5 A;  1SI1 A;  4RNS A;  3EHU A;  4IY6 A;  5L9O A;  3S9L C;  2Z8E A;  2REJ A;  2O51 A;  4LQ5 A;  4JWO A;  2REG A;  1BP5 A;  3EF7 A;  1UTH B;  1XVX A;  1USY E;  4QFK A;  1UIV A;  2GRV A;  4PP0 A;  4WXJ A;  5I84 A;  3PGF A;  3RT8 A;  5TP9 A;  4YAH X;  4ELO A;  3G3G A;  3CVG A;  4QFN A;  3T22 A;  1CE2 A;  1M5D A;  5EYF A;  2I0B A;  1NNT A;  1OQG A;  4U4X A;  2DWA A;  1A55 A;  4OFL A;  3U72 A;  2VGQ A;  2RC7 A;  1LCF A;  2FNC A;  2QMX A;  1ZIU A;  1YAE A;  3LSF B;  4U2R A;  2UYE A;  1SW5 A;  2O84 X;  1H3D A;  2XX7 A;  4KQP A;  4LVQ A;  3H4Z A;  4LA9 A;  3H3G A;  4DCY A;  3GZG A;  2QS4 A;  3IL1 B;  1B5H A;  1N84 A;  4G4P A;  4GLI A;  1OMP A;  3MP1 A;  1JVX A;  2XXW A;  5KDT A;  5AA2 A;  3G3F A;  1N7W A;  3SEU A;  1ANF A;  3I5O A;  2XXX A;  4RXL A;  2R9J A;  5IAI A;  4PE5 B;  3UA8 A;  4G68 A;  5ICQ A;  4F22 A;  1JET A;  5I58 A;  4F1V A;  3C4M A;  3FUZ A;  4IO3 A;  1QUJ A;  1N04 A;  2YPN A;  3V5A A;  3G7W A;  2AL4 A;  4KFQ A;  4NF6 A;  3E13 X;  3QXM A;  2I0C A;  4F3S A;  2CZL A;  5JTY A;  4H5F A;  4ZE8 A;  2D21 A;  4MF3 A;  3VLU A;  4F19 A;  1JW4 A;  3Q29 A;  2ZYM A;  5I56 B;  5B7D A;  2HZK A;  3S4U A;  1US5 A;  1VSO A;  4YB7 A;  5CRY A;  4H8J A;  4C1T A;  2DSF A;  4RY1 A;  2NXO A;  3R26 A;  3OSQ A;  2YJP A;  1LGB C;  2DE4 A;  3UGW A;  4DCX A;  4GXS B;  4F29 A;  5DVJ A;  4X1D A;  1MQI A;  3CSB A;  2H99 A;  2Z23 A;  2H9B A;  2YLN A;  4PFW A;  2PYY A;  4U22 A;  2I49 A;  3C33 A;  4EQ9 A;  3IOR A;  4FEC A;  3S9M C;  2GH9 A;  5H8H B;  2HAV A;  3R6U A;  3B6W A;  1B7H A;  3TYH A;  3HV1 A;  3C31 A;  1N7X A;  4H6D A;  4G68 C;  1NNK A;  2E0S A;  1B1X A;  2XXU A;  3TDJ A;  2F6P A;  5FTI A;  1B0H A;  1MY1 A;  4KPT A;  3VLV A;  4OXV A;  5F7V A;  2XXQ A;  2NOO A;  2DYX A;  1IEJ A;  5H8F B;  4ELQ A;  4MH5 A;  3PPP A;  4IO5 A;  1B52 A;  4QSE A;  1A7L A;  2V93 A;  4R73 A;  2FA7 A;  1S50 A;  2DP8 A;  3OEK A;  2Q2C A;  1I69 A;  2B65 A;  5H8S A;  3KZG A;  3QYT A;  3VDF A;  5TP9 B;  1B6H A;  3PMV A;  3TEP A;  1IXH A;  1PC3 A;  3IOU A;  3SES A;  3G3J A;  4ZEC A;  1MY4 A;  1R6Z A;  3LBS A;  1DPP A;  2HEU A;  4F3G A;  4ZE9 A;  3PMX A;  5FTH A;  4FJP A;  3S9N C;  4E0X A;  2Y7W A;  4H65 A;  1L5T A;  4OEN A;  4I8C A;  3MVW A;  4IO4 A;  1QJM A;  1UTH A;  4NWC A;  1MM7 A;  2ESN A;  4OZ9 A;  1II5 A;  3O6H A;  2ZYN A;  4R6H A;  4POX A;  4KYE A;  3MAM A;  4XKN A;  1ZJL A;  1O63 A;  4YU0 A;  3V83 A;  1VR5 A;  4C1U A;  5I57 A;  4BDO A;  4RPN A;  3H6V A;  3S2V A;  2XHD A;  3K1M A;  3ODB A;  1QUI A;  5AA2 B;  1Y4T A;  1A40 A;  2Q89 A;  1NKX A;  3WAF A;  1Y20 A;  3SEY A;  1MXZ A;  1DOT A;  1IIW A;  5CM6 A;  3K6X A;  3VE1 B;  1FQC A;  1ZLQ A;  1MXW A;  4G68 B;  3SET A;  2AL5 A;  3E4R A;  3K02 A;  1UQW A;  3K01 A;  4FAJ A;  4KCC A;  3MJN A;  3CG1 A;  1XHY A;  2UYF A;  2RCB A;  5JTY B;  4MLQ A;  4ECF A;  4OES A;  3MBP A;  4NED A;  3IX1 A;  3IOV A;  3PUY E;  3KG2 A;  4OTE A;  1POY 1;  3KSJ A;  3TQL A;  4R74 A;  3A09 A;  1AL3 A;  3CRB A;  2A5T A;  4AQ4 A;  1B3L A;  3Q28 A;  2PT2 A;  2UVG A;  1AH5 A;  3PPO A;  4GVO A;  3MZ9 A;  4NF4 A;  3CSG A;  4XXU A;  1OLA A;  3B7D A;  3T9H B;  5BWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...