3CVGA

Crystal structure of a periplasmic putative metal binding protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
270
Chain Sequence
EDVYDGPVQLRIGNGGAGQSGLVKELADAFIKSKVDSGFKVAWYKSDTTVTINYLKDGIVDVGITYSPVAERISIKHGISESPSYYAFRDHFMLIGPPSNPAKLSGDSDIADMFSKMHDAAEAGNTKPPVRFLSRYDKSATNIKEAELWLSIGQVPWATAYSTWYHQYITFPIQALTAAILLREYTITDYGTYLSIPRGLRDQMVIYKKGTNDADDPLLNPAHLLVGARAKNAEMAKEFAKWLVSKEGGQKVIEGFKKDGQQLYSPAPYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Putative metal binding protein
publication title Crystal structure of a periplasmic putative metal binding protein.
rcsb
source organism Coccidioides immitis
total genus 80
structure length 270
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cvgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cvgA02
4KI0E 3V83A 3T9UA 1R9QA 4IB2A 4ELRA 1QKBA 4TLLB 3TFLA 3H6WA 2GHBA 3UK4A 2RC7A 3KOTA 4POXA 4BDNA 2I3VA 3IOTA 1H3DA 5DT6A 4ONYA 3FGSA 5FHOA 3FVNA 1BKAA 3VVEA 2OWTA 3FJMA 2F78A 1US4A 4ISUA 1WODA 2X26A 3O6IA 3PUWE 4YKPA 2A5SA 1UQWA 4ESWA 4U23A 2XXPA 4F39A 2ONKE 4N13A 4OTEA 1B9JA 1MPDA 3FUZA 4UACA 3T66A 1MRPA 4KYSA 2H98A 3FVGA 2FYIA 3IX1A 5HBCA 3U8QA 5KDTB 1ZTYA 4O3AA 3OELA 4NMYA 5JTYB 3K01A 1IXGA 5DYHA 1M5EA 1OVBA 4OWDA 4ZZAA 3FVOA 4OENA 3JYRA 4LATA 5K2YA 5B70A 1EZOA 5CMKA 4GIZA 3CFXA 4OVJA 1EU8A 5FTHA 1MG1A 4Z7EA 3T96B 2Q88A 2UVHA 2I3WA 2F5XA 1POY1 2UVGA 1P1UA 4ZE8A 1ZMGA 2Z22A 2QPQA 3MWBA 3C36A 3E9XA 1Y3PA 4O3BA 4K3FA 1BP5A 1SVXB 1B0LA 4QSEA 4ZEKA 3A09A 4PP0A 3B6WA 3HPIA 4F18A 1H76A 3ECRA 3MQ9A 2F7BA 3KBRA 2I4BA 1ELJA 3OSQA 1MXYA 4EQ9A 1DOTA 1MXVA 3KJ7A 4C0RA 3IK6B 5I58A 4G68B 2R6GE 3VDFA 3SEUA 1JEVA 2F36A 1SW2A 1M5FA 3G3HA 4G2ZA 1WVJA 4JB7A 3L6HA 4C1UA 1NNPA 3TKDA 3S9NC 2UVIA 2PT2A 2V3QA 4HTGA 4PE5B 5I2NB 3TELA 2I48A 3EN3A 4LZ7A 2VD3A 4NF4B 4JSDA 4F3PA 4M4GA 2XXYA 3EHSA 4QFOA 4RY1A 1AOVA 3O97A 5DVIA 4F1UA 1KWHA 1ZU0A 2QSXA 1SW5A 4ND9A 2QMWA 3CG3A 1IXIA 4LZ8A 3RPWA 3RN8A 3U92A 5F7VA 3KSJA 2V84A 5FHMA 3TAJA 4HCYA 1GV8A 3IB0A 1NH7A 2XXQA 3IL1B 3IO6A 5DEXA 4GXSB 3MVXA 5AA4B 5CC2A 4Q0CA 5ISUA 5H8NB 4ZEBA 3TTNA 3HV1A 3E3KA 5L8DA 4XIGQ 4WKMA 4R73A 2Y7IA 3I6VA 1H44A 4ZZEA 3V8XB 4THIA 5CBRA 3OENA 2XXUA 4MH5A 3QK6A 1LBCA 2DS9A 2O68A 4NF8A 4XKNA 1QW0A 3MP1A 1P99A 1B6HA 1Y1ZA 2XX7A 3QIMA 3MZ1A 4QSDA 4H67A 3IOWA 1IIWA 2OJTA 3K1NA 4YZZA 5CI5A 4AB6A 1A99A 2D5WA 3GBBA 4FJPA 4JDFA 4P0GA 4LVQA 4HW8A 1PEBA 4DXCA 5H8FB 4EXLA 5JTYA 1B7UA 3GXAA 1F9BA 3K0VA 3H6TA 1IUDA 1M5BA 3K00A 4N6PA 4WXJA 2VHAA 2B3BA 4FEBA 4OFLA 1B3HA 3VLVA 2NVUB 5L9MA 3KFMA 3FD3A 1XOCA 1JEUA 2XXVA 3K6WA 4GQOA 1JNFA 3VVFA 2DOJA 2Q2AA 1I6AA 1B4HA 4BDMA 4F1YA 4YU0A 1LB8A 3ZKLA 3OMBA 2QS1A 2E1SA 2DWHA 3D4CA 3LR1A 3SDFA 3TTMA 2ZNUA 1B05A 3K4UA 1BLFA 5TPAB 2HFBA 3CVGA 4RXLA 1I69A 3TPAA 3Q25A 1QVSA 3FATA 3K02A 4RNSA 1Y9UA 1B0HA 2PMSA 4ZS9A 1MY2A 2G93A 3RTWB 3UA8A 3TEPA 1URSA 4GVOA 3K6VA 2Y7RA 3FXUA 2AL5A 3KG2A 5CMMA 1N3WA 3OEKA 3DM0A 3ZSFA 4F1VA 5I58B 1FTLA 1ZJLA 3TTRA 3P7IA 2V3TA 5I2NA 1ZLQA 4Z0IA 1HSLA 4GFRA 3HSTA 5CM6A 4R9FA 1A7LA 1IQ7A 4NF4A 4H0WA 3N5LA 3WAFA 1QUKA 4GRKA 3BKIB 4BDRA 1HSEA 2QJEA 2ESNA 4IO3A 5H8HB 1PDAA 2Q9TA 4JBZA 3SETA 4L17A 3G3FA 1B3GA 2UYFA 1A8EA 3FASA 4NF6A 3C34A 5EYFA 2A5TA 4U22A 5AE4A 4E0WA 1S9TA 5I56A 2CZLA 4IO4A 3G7WA 3LSXA 3CR9A 3C33A 1JW4A 4H6DA 4I62A 4F3BA 3QSLA 3TCHA 3HCQA 1BTJA 3W15C 4H1XA 2O51A 1O7TA 4OESA 4N07A 4YB6A 1LLSA 3G3IA 5HPQA 4OYVA 4H5FA 2YPNA 4FE8A 2UVJA 1FQBA 4GOTA 3S4UA 1LAGE 2OZZA 3GZGA 1RYOA 4I8CA 4I9DA 1M5CA 2XXIA 3IR1A 4X1BA 1MQDA 3MC2A 3N6TA 2P0SA 3H4ZA 4LA9A 1VSOA 4PETA 3RT8A 5HM4B 4UA8A 4ZE9A 1PB9A 4DXUA 2Y7KA 5TU0A 4EDPA 3K6XA 1JW5A 4NF8B 4I1DA 1ZBMA 2Y7WA 5EHMA 1FTOA 3FXRA 2H99A 3T22A 3C9HA 3KN7A 5KCJB 4KYEA 5H8FA 4QFLA 1IEJA 3EQ1A 2I58A 3BFTA 3OO9A 1AMFA 2XX8A 2AL4A 1GGGA 3TUSA 1XC1A 1AL3A 4G8MA 4MLQA 1AIVA 2RC9A 4G8NA 3MZBA 2E0SA 2B65A 2HAVA 2DE4A 3MVYA 5H8QB 1MDQA 1SYIA 2XHDA 1B1HA 1MXXA 1VFEA 4OEVA 1ATGA 4OXVA 3KSXA 3TZAA 1VE4A 1UIUA 2GRVA 1B5JA 1WDNA 3PV0E 3KJTA 4OEUA 5TPAA 1A40A 1MS7A 3GBAA 4FECA 1OVTA 2F7AA 3ZKKA 3O29A 5A5XB 1N76A 3BBRA 3PMVA 1USYE 3OXNA 2ZMBA 5CMCA 1OQHA 1OQGA 4R74A 4RK2A 1RYXA 1MM6A 3PMXA 4KYDA 4F22A 2VGQA 1EZPA 3TMGA 1HSJA 1O64A 3IORA 1B3EA 3G3KA 1DMBA 4U1OA 2ABHA 2QS3A 2Z8FA 2DE3A 4JWOA 2F34A 4YMAA 4NEDA 1T0KA 1YPNA 2BJJX 4YICA 1OIBA 2GFEA 1MQGA 2O6AA 4RJZA 2Y84A 2O7IA 4H5GA 2VOZA 2O69A 3S9EA 4GLIA 1LFIA 1TFAA 1US5A 3MBPA 4RK9A 2HZKA 4LZ5A 3UP9A 4R2BA 2DWJA 4IGTA 3Q27A 5H8HA 3UGWA 1B7ZA 1D9VA 3F11A 1DTGA 3FV2A 2D3IA 1N0TA 4LQ5A 3KZGA 3OO6A 5I2KA 4OERA 1N7WA 4KFQA 4Q30B 4NF6B 3LSLA 3RT6B 2A5TB 1H43A 4YKJA 4EUOA 5I56B 3CIJA 4U4XA 3LSFB 3MPLA 1II5A 2R9JA 5ICQA 1DPEA 5JK4A 3CSGA 3KEIA 4GL0A 3T9XB 3OO7A 1TFDA 3CFZA 2V93A 1FQEA 3BFUA 2DQVA 4U21A 1MQJA 1B2HA 3L6GA 5AA2D 4F3SA 3SEVA 3OD7A 4YB7A 2RC8A 2FA7A 3M3LA 3SERA 3DELB 1B40A 4LUBA 4QFKA 3C32A 2RCBA 1UTBB 4ESXA 3VV5A 4XXUA 1Y3NA 2F6PA 4AQ4A 4KPTA 3DP6A 3QUJA 1VR5A 3S2VA 3K6UA 4X9TA 3VXBA 2I6EA 3MPKA 4R9GA 4G77A 5KCJA 3IB1A 1JQFA 4LQ2A 4WEPA 1EZ9A 4R72A 3H03A 2ONRA 5K2XA 5L9OA 4BDOA 1P1NA 2O84X 2DXRA 2XD3A 1FTKA 5ITOA 4HS7A 2I0CA 3OO8A 2DP8A 1CE2A 3RUMA 1MY0A 5IAIA 4EQBA 5H8QA 1N84A 3TQWA 3O6HA 4NWDA 2RF1A 3SKPA 4XKPA 3S9LC 4ZEFA 5JEIA 4P0IA 3N6UA 2QRYA 4F29A 1SW1A 4PFTA 3DP4A 3PPOA 3RLFE 3EHUA 1A54A 3A3CA 3OSRA 3U93A 5A5XA 4RPOA 4QRZA 3MUQA 3N94A 4JXIA 2QL3A 3Q29A 1XVXA 3KN3A 1MXWA 2Q2CA 5DTBA 3M8UA 1RKMA 3QXMA 1EH3A 1LCTA 4PFWA 3IOUA 3E13X 1YCJA 4YKKA 4G8HA 2I0BA 5TP9A 2OWSA 2NXOA 1MXUA 2O7UA 2DVZA 2QS4A 2RINA 3MJNA 2B3FA 4GXAA 1A55A 3G3GA 3N26A 1GVCA 4QHQA 2DWAA 3KOSA 4DCXA 4RYAA 1N04A 5DVJA 5IKBA 2THIA 3PMWA 2V3UA 5H8SA 2FNCA 4H65A 5L9SA 1SBPA 1LFGA 4KHZE 1B46A 2LAOA 4F2QA 4TOZA 2PVUA 1DTZA 5AA1A 1B58A 1AH5A 3H3GA 2PX1A 1P1QA 1SD3A 4DIGA 1R6ZA 1FQDA 3PPNA 1JW1A 1IXHA 1SQYA 1Q1KA 1POTA 1P1OA 4P11A 1B1XA 5I84A 3FXQA 2XX9A 1NNKA 3FIRA 5ITPA 4FAJA 3O2AA 4FATA 1MH4A 3B6QA 2Z23A 2F6GA 1PB8A 3ODBA 3C4MA 1Q35A 3MVWA 1IITA 3KGCA 3C31A 5I2KB 1D4NA 3PGFA 3V5AA 2IA4A 2OLBA 1FQAA 2I49A 1TWYA 3DLNA 3TCGA 3W9WA 1PBPA 4C1TA 4R6HA 3ILTB 3SEWA 3R26A 1LB9A 2Z8EA 2Z8DA 3CG1A 1Y1MA 2I4CA 1B7HA 3MP8A 4OETA 1NMUA 1URDA 3R7XA 4HCWA 2M8CA 3IO4A 2ZNSA 1UTBA 4E0XA 4IO2A 3G3JA 3PUXE 4FEDA 5CBSA 3PU5A 5ELVA 2P2AA 2XXRA 1URGA 2RKMA 2GH9A 2REJA 1Z7NE 3HN0A 3LBSA 3ILUB 3A3UA 3I3VA 1B4ZA 2H9BA 5BUUA 2XXTA 3LSWA 3T9HB 4ZECA 1P1WA 4X48A 2Q89A 3IJOB 1PB7A 1Y20A 3HHGA 3MP6A 3O9PA 1B32A 4ZEDA 3Q28A 3U72A 3EPEA 3QAXA 1Y4CA 3TTLA 2HQ0A 3CSBA 1NNFA 1JVYA 2QS2A 1MQHA 1JETA 4ZEIA 1MY4A 2ZYOA 3VE1B 3U94A 5DVFA 1SI1A 3VFJA 3AXFA 4JSOA 4MBPA 5CRYA 1M5DA 2DYXA 5I57A 1TT1A 4NE4A 2YLNA 1BIYA 1ZKBA 2XXXA 3SESA 4TQUQ 5J1DA 2PBWA 4XKQA 1LAFE 3WAEA 4F19A 4XTCQ 4NTLA 3TODA 4GF8A 2P1SA 2F8DA 3HO7A 3RQTA 4DE8A 4OMBA 4EXKA 2X7PA 3DP8A 3UN6A 4ELPA 2OK2A 1FTJA 2UYEA 3CFLA 5AA2B 5TP9B 3PD8A 2RCAA 1O63A 1Y3QA 3IJXB 3MVZA 3FVKA 4Q8RA 3VLUA 3I5OA 1MPCA 2DE2A 2HCAA 1MDP1 4YKIA 2W7YA 1XS5A 4PFYA 4M1VA 2PYYA 2DXYA 3FJGA 3UIFA 1GR2A 2Y7PA 2X7QA 2H4IA 3CRBA 4R2FA 4PFUA 4OQOA 3M3KA 2YJPA 1R9LA 1B3FA 4AB5A 4QFNA 1IZ1A 3O6GA 2UXAA 2HAUA 1SYHA 3OEMA 4U4SA 5CMBA 3H6VA 1DSNA 1XHYA 1IXCA 1OLAA 4JWXA 1VFDA 4NF5B 2DSFA 3RGYA 1UTHA 5EHSA 4ELQA 3MAMA 1CB6A 2PT1A 4BLAA 1LFHA 2H5YA 1OLCA 4EF1A 5LOMA 3FZVA 1SI0A 4GD5A 4WEDA 2NWJA 1ZIUA 1TXFA 2F35A 2XXHA 4H8IA 3QYTA 2XXWA 4IO7A 4DDDA 3PD9A 4RPNA 1B5HA 4DCYA 3T9VA 5I59A 1YAEA 3PPQA 1NNTA 4LP2B 1GTKA 4O3CA 5B7DA 4F31B 4YAHX 1MXZA 2HEUA 3TTKA 1LAHE 3B6TA 4OZ9A 1L5TA 1PC3A 4BDQA 3RY3A 4OHNA 3K1MA 3VVDA 2DWIA 4QFPA 1D3KA 3TQLA 2HXWA 1SW4A 1FCKA 1MH3A 3PUVE 3EF7A 1MQIA 4EF2A 4IO5A 1FQFA 4ELOA 3V89B 3H06B 3GLBA 1USYH 4KCDA 2Q8JA 4H8JA 3PPRA 4GL8A 4LONB 4F3GA 2ZYKA 2HZLA 2WKYA 4PQJA 1D9YA 2VP1A 4TLMB 3K1PA 2DVCA 3PPPA 3JZJA 1YTVA 4QF9A 1N3XA 1XVYA 1A8FA 5KDTA 1LCFA 1JVXA 1DPPA 2V25A 4NWCA 3LUYA 4GWOA 1B5IA 4YB5A 1QJMA 4IY5A 3ZS6A 4KQPA 1MM7A 3T93B 3CI8A 3PUZE 2OCUA 2O1MA 5FTIA 2H25A 3FJ7A 5I57B 3UORA 3MW0A 3H6UA 4R75A 5M2VA 1PBQA 2F7CA 4MLVA 2ANJA 1NFTA 1B51A 3PUYE 1NH8A 4G4PA 1S7YA 4MFIA 4RA1A 3C35A 3O28A 4BDLA 2KLFA 1QKAA 5F1QA 2REGA 1FTMA 3LC8A 4R6YA 1I6QA 5BWJA 1UIVA 1B52A 4G68C 2NOOA 2O1LA 1FQCA 5FHNA 3IB2A 1NKXA 5AA2A 3U1OA 1N7XA 4U1ZA 3HHFA 3IAZA 2IEEA 1XT8A 1LSTA 1MPBA 4JWYA 4X1DA 3ONMA 1MY1A 3RNNA 1S50A 3IOVA 2QMXA 1B3LA 4IGRA 2GHAA 2ZNTA 2ALUA 4XKRA 1Z7ME 4OFOA 3EHTA 2ZYMA 4QSCA 3H7MA 3K2DA 2G29A 4F2OA 4G68A 4IY6A 4ZDMA 1NL5A 3D4GA 4POWA 1QUJA 2AIXA 5ICTA 2VD2A 3QUFA 1J1NA 5KZTA 1LBBA 3B7DA 4DZ1A 3S9MC 3M3FA 3KN8A 3W9VA 1LAXA 2F97A 2D21A 3VXCA 4NF5A 4DLDA 4OFJA 1LGBC 1FW0A 1OMPA 3THIA 2OBGA 3OOAA 5AA3A 4YMBA 1H45A 4KCCA 1UTHB 4ECFA 3O66A 1QULA 2CMOA 4MF3A 1I6BA 2AYSA 1MY3A 4FORA 3FV1A 3JV9A 3VLWA 3USDA 2ZXTA 2ZYNA 2ONSA 3TCFA 3TYHA 4FIMA 4EQ7A 1SDXA 2NUVA 4Q5TA 3RTFB 5AA4A 4KD5A 4U2RA 4DXBA 3MZ9A 3SEYA 2R71A 3Q26A 4IO6A 2XD2A 1QUIA 1ANFA 5H8NA 1Y4TA 1R1NA 3SEXA 5DEXB 3R6UA 4R6KA 5I59B 4KR5A 3E4RA 3TDJA
chains in the Genus database with same CATH superfamily
3U65A 4PFBA 4KI0E 3V83A 3T9UA 1R9QA 4IB2A 4ELRA 1QKBA 4TLLB 3TFLA 3H6WA 2GHBA 3UK4A 2L5VA 2RC7A 3KOTA 4POXA 4BDNA 2I3VA 3IOTA 1H3DA 5DT6A 2Y5LA 4ONYA 2XWIA 3FGSA 5FHOA 3FVNA 1BKAA 3VVEA 2OWTA 3FJMA 2F78A 1US4A 4ISUA 1WODA 2X26A 3O6IA 3PUWE 4YKPA 2A5SA 1UQWA 4ESWA 4U23A 2XXPA 4F39A 2ONKE 5DW8A 4N13A 4OTEA 1B9JA 1MPDA 3FUZA 4UACA 3T66A 1MRPA 4KYSA 2H98A 3FVGA 2FYIA 3IX1A 5HBCA 4QXDA 3U8QA 1ZTYA 5KDTB 4O3AA 3OELA 4NMYA 5JTYB 3K01A 3HFUA 1NUYA 1IXGA 5DYHA 1M5EA 1OVBA 4OWDA 4ZZAA 3FVOA 4HE2A 4OENA 1NV1A 4PGNA 3JYRA 4LATA 5K2YA 2OWZA 5B70A 1EZOA 2VPOA 5CMKA 4GIZA 3CFXA 4OVJA 2FIXA 1EU8A 5FTHA 1MG1A 4Z7EA 3T96B 2Q88A 2UVHA 2I3WA 2F5XA 1POY1 2UVGA 1P1UA 4PGPA 4ZE8A 1ZMGA 1FPIA 2Z22A 2QPQA 3MWBA 3C36A 4P56A 3E9XA 1Y3PA 4MAGA 4O3BA 1XI6A 4N91A 4P47A 4K3FA 1BP5A 4GBVA 1K9ZA 1SVXB 1B0LA 3B8BA 4QSEA 4ZEKA 1FBDA 1IMFA 3A09A 1JP4A 4PP0A 3B6WA 3HPIA 4F18A 1H76A 3ECRA 3MQ9A 2F7BA 3E79A 3KBRA 4KXPA 4X8RA 2DDKA 2I4BA 1ELJA 3OSQA 1MXYA 4EQ9A 1DOTA 1MXVA 1YZ0A 3KJ7A 4C0RA 3IK6B 5I58A 4G68B 2R6GE 4NN3A 3VDFA 3SEUA 1JEVA 2F36A 4H45A 4GX6A 1FSAA 1SW2A 3RYDA 5IZZA 1M5FA 3G3HA 1FBGA 1WVJA 4G2ZA 5ET7A 4JB7A 3L6HA 4C1UA 1NNPA 3TKDA 3S9NC 2UVIA 2PT2A 2V3QA 4HTGA 4PE5B 5I2NB 3TELA 2I48A 1LBVA 3EN3A 3CHGA 4GBWA 4LZ7A 2VD3A 4NF4B 4JSDA 4F3PA 4M4GA 2XXYA 3EHSA 4PAIA 4QFOA 1FBHA 2ZZXA 4RY1A 1AOVA 4MEVA 4X04A 3O97A 1FPDA 5DVIA 4F1UA 1KWHA 1ZU0A 2F3BA 2QSXA 3A29A 1G0IA 1SW5A 4ND9A 2QMWA 3CG3A 1IXIA 4LZ8A 3RPWA 1FJ9A 3RN8A 3U92A 1KZ8A 5F7VA 3KSJA 2V84A 5FHMA 3TAJA 4HCYA 1GV8A 3IB0A 1NH7A 4NHBA 4PCDA 2XXQA 3IL1B 3IO6A 5DEXA 4GXSB 5EYHA 3MVXA 5AA4B 1FPBA 5CC2A 4Q0CA 5ISUA 5H8NB 4ZEBA 3TTNA 3HV1A 4OVTA 5EQAA 3E3KA 5L8DA 4XIGQ 4WKMA 4P1EA 4R73A 2Y7IA 5LTCA 3I6VA 2B4LA 1H44A 4ZZEA 3V8XB 4THIA 5CBRA 3OENA 2XXUA 4MH5A 2WYPA 3QK6A 1LBCA 2DS9A 2O68A 4NF8A 4XKNA 1NUWA 1QW0A 3MP1A 1P99A 4GWZA 5ET6A 1LBWA 1B6HA 1Y1ZA 2XX7A 3QIMA 3MZ1A 4QSDA 4H67A 3IOWA 1IIWA 4P1LA 2OJTA 3K1NA 4YZZA 5CI5A 3IFAA 4AB6A 1A99A 2D5WA 3GBBA 4FJPA 4JDFA 4P0GA 4LVQA 4HW8A 2FIEA 1PEBA 4DXCA 5H8FB 4EXLA 5JTYA 1B7UA 3GXAA 1F9BA 3K0VA 3H6TA 1IUDA 1M5BA 3K00A 1FJ6A 4N6PA 4WXJA 2VHAA 2B3BA 2XXKA 4FEBA 4OFLA 1B3HA 3VLVA 2NVUB 3D1RA 5L9MA 3KFMA 1NV5A 3FD3A 1XOCA 1JEUA 2VPNA 2XXVA 3K6WA 4GQOA 1JNFA 3VVFA 2DOJA 2Q2AA 1I6AA 5LDZA 1B4HA 4BDMA 4F1YA 4YU0A 4MHFA 1FPKA 1D9QA 1LB8A 3ZKLA 3OMBA 2QS1A 2E1SA 2DWHA 5F24A 3D4CA 3LR1A 3SDFA 3TTMA 2ZNUA 1B05A 3K4UA 4MJOA 1BLFA 5TPAB 2HFBA 3CVGA 4RXLA 1I69A 3TPAA 1BK4A 3Q25A 1QVSA 3FATA 3K02A 4I3EA 4RNSA 1Y9UA 1B0HA 2PMSA 4ZS9A 1MY2A 2G93A 2B4MA 3MSTA 3RTWB 4DI3D 3UA8A 3TEPA 1URSA 4XF5A 2HXRA 4GVOA 3K6VA 2Y7RA 3FXUA 2AL5A 3KG2A 1RDYA 5CMMA 2KR0A 1N3WA 5I3SA 3IFCA 2MKZA 3OEKA 3DM0A 5ET5A 3ZSFA 4F1VA 5I58B 1FTLA 1ZJLA 3TTRA 3P7IA 2V3TA 5I2NA 1ZLQA 4Z0IA 1EYKA 1HSLA 4GFRA 3LV0A 3HSTA 5CM6A 4R9FA 1A7LA 1IQ7A 4NF4A 4H0WA 3N5LA 3WAFA 1QUKA 4GRKA 3BKIB 4PDHA 1FBCA 4BDRA 1HSEA 2QJEA 2ESNA 4IO3A 2QVUA 5H8HB 1PDAA 4FBPA 2Q9TA 3NOHA 4JBZA 3SETA 4OVQA 4L17A 3G3FA 1B3GA 2UYFA 1A8EA 3FASA 4NF6A 3C34A 5EYFA 2A5TA 4U22A 1FBPA 5AE4A 4E0WA 1S9TA 5I56A 2CZLA 4IO4A 3G7WA 3LSXA 3CR9A 3C33A 1JW4A 4H6DA 4I62A 4F3BA 4O8MA 3QSLA 3TCHA 3HCQA 1BTJA 4GX3A 3W15C 4H1XA 2O51A 1NUXA 1O7TA 4OESA 4N07A 4YB6A 1DK4A 1LLSA 3G3IA 5HPQA 4OYVA 1NV6A 4H5FA 1VDWA 2YPNA 4PDDA 4FE8A 2UVJA 1FQBA 4GOTA 3S4UA 1LAGE 2OZZA 3GZGA 1RYOA 4I8CA 4I9DA 1M5CA 2XXIA 3IR1A 4X1BA 1MQDA 3MC2A 4OA4A 3N6TA 2P0SA 4P9KA 3H4ZA 4UABA 4LA9A 1VSOA 4PETA 3RT8A 5HM4B 4UA8A 4ZE9A 1PB9A 4DXUA 2Y7KA 2QVVA 5TU0A 4EDPA 3K6XA 1LBYA 1JW5A 4NF8B 4I1DA 1ZBMA 2Y7WA 5EHMA 2WX9A 1FPGA 1FTOA 3FXRA 2H99A 4PC9A 4PAKA 4N15A 3T22A 3C9HA 1FPJA 3KN7A 5KCJB 4KYEA 5H8FA 4QFLA 4PFRA 1IEJA 3EQ1A 2I58A 3BFTA 3OO9A 1FBFA 1AMFA 3ISPA 4MIJA 2XX8A 2AL4A 5I5PA 1GGGA 3TUSA 1XC1A 4NF0A 1AL3A 4G8MA 4MLQA 5EQ7A 1AIVA 2RC9A 4G8NA 3MZBA 5EQ9A 2E0SA 2B65A 2HAVA 2DE4A 3MVYA 3B50A 1DBZA 1MDQA 5H8QB 1SYIA 2XHDA 1B1HA 1MXXA 2XWKA 1VFEA 4OEVA 1ATGA 4OXVA 3KSXA 3TZAA 1VE4A 1UIUA 2GRVA 1B5JA 1WDNA 4O7MA 3PV0E 3KJTA 4OEUA 5TPAA 1A40A 1MS7A 3GBAA 4LN5A 4FECA 1OVTA 2F7AA 3ZKKA 3O29A 5A5XB 1N76A 3BBRA 3PMVA 2Q8MA 1USYE 4NG7A 3OXNA 2ZMBA 2QVRA 5CMCA 1OQHA 1OQGA 4R74A 4RK2A 1RYXA 3MYUA 1MM6A 3PMXA 4KYDA 4F22A 2VGQA 1EZPA 4PTKA 3TMGA 1HSJA 1O64A 2CEYA 3IORA 1B3EA 3G3KA 1DMBA 4U1OA 2ABHA 2QS3A 2Z8FA 2DE3A 4JWOA 2F34A 4YMAA 4NEDA 1T0KA 1YPNA 2BJJX 4YICA 1FPEA 1OIBA 2GFEA 1MQGA 2O6AA 4RJZA 2Y84A 2O7IA 4H5GA 2VOZA 2O69A 3S9EA 4GLIA 1LFIA 4GWYA 1TFAA 4AS4A 1US5A 3MBPA 4RK9A 2HZKA 4LZ5A 3UP9A 4R2BA 2DWJA 4IGTA 3Q27A 5H8HA 5ESYA 3UGWA 1B7ZA 1D9VA 3F11A 1DTGA 3FV2A 1IMEA 2PFYA 4GWSA 2D3IA 1N0TA 4LQ5A 3KZGA 3OO6A 5I2KA 4OERA 3KC1A 1N7WA 4KFQA 1IMDA 4Q30B 4NF6B 3LSLA 3RT6B 2A5TB 1H43A 4YKJA 4EUOA 5I56B 3CIJA 2CZIA 4U4XA 3LSFB 3MPLA 1II5A 2R9JA 5ICQA 1FBEA 1DPEA 5JK4A 3CSGA 3KEIA 4GL0A 3T9XB 3OO7A 1TFDA 2XWVA 3CFZA 2V93A 2XA5A 1KA0A 1FQEA 5I7IA 3BFUA 2DQVA 1DCUA 4U21A 1MQJA 1B2HA 3L6GA 5AA2D 4F3SA 5EYGA 3SEVA 3OD7A 4YB7A 2RC8A 2FA7A 3M3LA 3SERA 3DELB 3QMFA 1B40A 4LUBA 4QFKA 3C32A 2RCBA 1UTBB 4ESXA 3VV5A 4XXUA 1Y3NA 2F6PA 4AQ4A 4KPTA 3DP6A 3QUJA 1VR5A 3S2VA 3K6UA 4X9TA 1NUZA 3VXBA 4PF6A 2I6EA 3MPKA 4R9GA 4G77A 5KCJA 3IB1A 1JQFA 4LQ2A 4WEPA 1EZ9A 4R72A 3H03A 4OANA 2ONRA 5K2XA 5L9OA 4BDOA 1P1NA 2O84X 2R8TA 2DXRA 1IMAA 2XD3A 1NV4A 1FTKA 5ITOA 4HS7A 2I0CA 4PBQA 4NQ8A 3OO8A 2DP8A 1CE2A 3RUMA 1MY0A 4AS5A 2KQZA 5IAIA 4EQBA 5H8QA 1N84A 3TQWA 3O6HA 4NWDA 4GWXA 1LBZA 2RF1A 3SKPA 4XKPA 3S9LC 4ZEFA 5JEIA 4P0IA 3N6UA 2QRYA 4F29A 1SW1A 4PFTA 1FRPA 3DP4A 2CZHA 3PPOA 3RLFE 3EHUA 2WYKA 1A54A 3A3CA 3OSRA 3U93A 5A5XA 4RPOA 4QRZA 3MUQA 3N94A 3KC0A 4JXIA 2QL3A 3PTYA 3Q29A 1XVXA 3KN3A 1MXWA 2Q2CA 5DTBA 3M8UA 4G61A 1RKMA 4XEQA 3QXMA 1EH3A 1LCTA 4PFWA 3IOUA 1FPLA 3E13X 1YCJA 4YKKA 4G8HA 2I0BA 5TP9A 2OWSA 2NXOA 1MXUA 2O7UA 2DVZA 2XWOA 3FBPA 2QS4A 2RINA 4P3LA 3MJNA 2B3FA 4GXAA 1A55A 3G3GA 3N26A 1GVCA 2WBDA 4QHQA 2DWAA 3KOSA 4DCXA 4RYAA 1N04A 5DVJA 5IKBA 2THIA 3PMWA 2V3UA 5H8SA 2HHMA 2FNCA 4H65A 5L9SA 4PFIA 1SBPA 1LFGA 4KHZE 1B46A 4O94A 2LAOA 4F2QA 1RDZA 2WBBA 4TOZA 2PVUA 1DTZA 5AA1A 1B58A 1AH5A 3H3GA 2PX1A 1P1QA 1SD3A 4DIGA 1R6ZA 1FQDA 3PPNA 1JW1A 1IXHA 2PCRA 4OVPA 1SQYA 1Q1KA 1POTA 3E78A 1P1OA 4P11A 1B1XA 5I84A 3FXQA 2XX9A 1NNKA 3FIRA 5ITPA 5ET8A 4FAJA 3O2AA 1INPA 4FATA 1MH4A 3B6QA 2Z23A 2F6GA 4N4UA 1PB8A 3T1BA 3ODBA 3C4MA 1Q35A 4N81A 3MVWA 1IITA 3KGCA 3C31A 5I2KB 1D4NA 3PGFA 3V5AA 2IA4A 2OLBA 1FQAA 2I49A 1TWYA 3DLNA 3TCGA 3W9WA 1PBPA 4O7IA 4C1TA 4R6HA 2JJKA 3ILTB 1NI9A 3SEWA 3R26A 1LB9A 2Z8EA 3SZPA 2Z8DA 4MMPA 3CG1A 1Y1MA 2I4CA 1B7HA 3MP8A 1FPFA 4OETA 1NMUA 1URDA 3R7XA 4HCWA 2M8CA 3IO4A 2ZNSA 1UTBA 4E0XA 4IO2A 3G3JA 3PUXE 4FEDA 5CBSA 3PU5A 5ELVA 1YXIA 3RPLA 2P2AA 2XXRA 1URGA 2RKMA 2GH9A 2REJA 1Z7NE 3HN0A 3LBSA 3ILUB 3A3UA 3I3VA 1B4ZA 2H9BA 4HE1A 5BUUA 4NAPA 2XXTA 3LSWA 1NV2A 3T9HB 4ZECA 4HE0A 1P1WA 4X48A 4OVSA 4I3YA 2Q89A 3IJOB 1PB7A 1Y20A 2CZKA 5T3JA 2HPGA 3HHGA 3MP6A 3O9PA 1B32A 4ZEDA 3Q28A 2Q74A 3U72A 3EPEA 3QAXA 1Y4CA 3TTLA 2HQ0A 3CSBA 1NNFA 1JVYA 2QS2A 1MQHA 1QGXA 1JETA 4ZEIA 1MY4A 2ZYOA 3VE1B 3U94A 5DVFA 1SI1A 3VFJA 3AXFA 4JSOA 4MBPA 5CRYA 3T0JA 1M5DA 4HXVA 5J16A 4JVCA 2DYXA 5IZ3A 5I57A 1TT1A 4N6KA 4NE4A 2YLNA 4OVRA 1BIYA 4N17A 1ZKBA 2XXXA 3SESA 4TQUQ 5J1DA 2PBWA 4XKQA 1LAFE 3WAEA 4F19A 4NX1A 4JVDA 4XTCQ 4NTLA 3TODA 4GF8A 2P1SA 2F8DA 2BJIA 3HO7A 3RQTA 4DE8A 4OMBA 4EXKA 2X7PA 4MNIA 3BIHA 5FBPA 3DP8A 1RDXA 3UN6A 4ELPA 2OK2A 1IMCA 1FTJA 2UYEA 3CFLA 2CEXA 5AA2B 5TP9B 3PD8A 2RCAA 1O63A 1Y3QA 3IJXB 3MVZA 3FVKA 1YYZA 4Q8RA 3VLUA 3I5OA 1MPCA 2DE2A 2HCAA 4PE3A 1MDP1 4YKIA 2W7YA 1XS5A 4PFYA 2V4CA 1NV3A 4M1VA 2PYYA 4P8BA 2DXYA 3FJGA 3UIFA 1GR2A 2Y7PA 2OX3A 2X7QA 2H4IA 3CRBA 4R2FA 4PFUA 4GWWA 4OQOA 3M3KA 2YJPA 1R9LA 1FTAA 1B3FA 4AB5A 4QFNA 1IZ1A 1LEVA 3O6GA 2UXAA 1NV0A 2HAUA 1SYHA 3OEMA 4U4SA 5CMBA 3H6VA 1DSNA 1XHYA 1IXCA 1OLAA 4JWXA 2QFLA 1VFDA 4NF5B 2DSFA 3RGYA 1UTHA 5EHSA 4ELQA 3MAMA 1CB6A 2PT1A 4BLAA 1LFHA 2H5YA 3FXBA 1OLCA 4EF1A 5LOMA 3FZVA 1SI0A 2FBPA 4GD5A 4WEDA 2NWJA 1ZIUA 1TXFA 1SPIA 4N6DA 2F35A 2XXHA 4H8IA 3QYTA 2XXWA 4IO7A 4DDDA 3PD9A 4RPNA 1B5HA 4DCYA 3T9VA 5I59A 1YAEA 3PPQA 1NNTA 4LP2B 1GTKA 4O3CA 5B7DA 4F31B 4YAHX 1MXZA 2GQ1A 2HEUA 3TTKA 1LAHE 3B6TA 4OZ9A 3RPLB 1L5TA 1PC3A 4BDQA 3RY3A 1G0HA 4OHNA 4MNPA 3K1MA 3VVDA 2DWIA 4QFPA 1D3KA 4N8GA 3TQLA 2HXWA 4MCOA 1SW4A 1FCKA 1MH3A 3PUVE 3EF7A 1MQIA 4EF2A 4IO5A 1FQFA 4ELOA 3GYYA 3V89B 3H06B 3GLBA 1K9YA 4GWUA 1USYH 3ROJA 4KCDA 2Q8JA 4H8JA 5IZ1A 3PPRA 4GL8A 4LONB 4F3GA 2ZYKA 2HZLA 2WKYA 4PQJA 1D9YA 2VP1A 4TLMB 3K1PA 2DVCA 3PPPA 3JZJA 4N8YA 1YTVA 4QF9A 2FVZA 1N3XA 1XVYA 1A8FA 5KDTA 1LCFA 1JVXA 1DPPA 2V25A 4DI4B 1NV7A 4NWCA 3LUYA 4GWOA 5IM2A 1B5IA 4YB5A 1QJMA 4IY5A 3ZS6A 4KQPA 1MM7A 2PFZA 3T93B 3CI8A 3PUZE 2OCUA 2O1MA 5FTIA 4IR8A 2H25A 5IZ3B 3FJ7A 5I57B 3UORA 3MW0A 3H6UA 4R75A 5M2VA 1PBQA 2F7CA 4MLVA 1Q9DA 2ANJA 1NFTA 1B51A 3PUYE 1NH8A 4G4PA 1S7YA 4MFIA 4RA1A 3C35A 3O28A 4BDLA 2KLFA 4GX4A 1QKAA 5F1QA 2REGA 3LUZA 4H46A 2WEFA 1FTMA 3LC8A 4R6YA 1I6QA 5BWJA 1UIVA 1B52A 4G68C 2NOOA 3EKIA 2O1LA 1FQCA 5FHNA 4QBAA 3IB2A 1NKXA 5AA2A 3U1OA 1N7XA 4U1ZA 3HHFA 3IAZA 1EYIA 1LBXA 1KA1A 2IEEA 4PAFA 1XT8A 3BIGA 1LSTA 1MPBA 4JWYA 4X1DA 3ONMA 1MY1A 3RNNA 1S50A 3IOVA 2QMXA 1B3LA 4IGRA 2GHAA 2ZNTA 2VT5A 2ALUA 4XKRA 1Z7ME 4OFOA 3EHTA 2ZYMA 4QSCA 2ZZVA 3H7MA 3K2DA 2G29A 4F2OA 4G68A 4IY6A 4ZDMA 1NL5A 3D4GA 4POWA 1QUJA 4NGUA 2AIXA 2P3NA 5ICTA 2VD2A 3QUFA 1J1NA 1EYJA 5KZTA 3KBZA 2ZZWA 1LBBA 3B7DA 1IMBA 4MX6A 4DZ1A 3S9MC 3M3FA 3KN8A 5IGAA 3W9VA 1LAXA 2F97A 2D21A 3VXCA 4NF5A 4DLDA 4OFJA 1LGBC 4MNCA 5EQ8A 1FW0A 1CNQA 1OMPA 2F3DA 3THIA 2OBGA 3OOAA 5AA3A 4YMBA 1H45A 4KCCA 1AWBA 1UTHB 4ECFA 3O66A 1QULA 2CMOA 4PBHA 4MF3A 2FHYA 1I6BA 2AYSA 4JVIA 2Y5KA 1MY3A 4I40A 4FORA 3FV1A 3JV9A 3VLWA 3USDA 2ZXTA 2ZYNA 2ONSA 3TCFA 3TYHA 4FIMA 4EQ7A 1SDXA 2NUVA 4Q5TA 3RTFB 5A5LA 5AA4A 4KD5A 4U2RA 4DXBA 3MZ9A 3SEYA 2R71A 3Q26A 4IO6A 2XD2A 1QUIA 1ANFA 5H8NA 1Y4TA 1R1NA 4PF8A 3SEXA 5DEXB 3R6UA 4XFEA 2P3VA 4R6KA 5I59B 4KR5A 3E4RA 3TDJA
chains in the Genus database with same CATH topology
4KI0E 3V83A 3T9UA 1R9QA 4IB2A 4ELRA 1QKBA 4TLLB 3TFLA 3H6WA 2GHBA 3UK4A 2RC7A 3KOTA 4POXA 4BDNA 2I3VA 3IOTA 1H3DA 5DT6A 4ONYA 3FGSA 5FHOA 3FVNA 1BKAA 3VVEA 2OWTA 3FJMA 2F78A 1US4A 4ISUA 1WODA 2X26A 3O6IA 3PUWE 4YKPA 2A5SA 1UQWA 4ESWA 4U23A 2XXPA 4F39A 2ONKE 4N13A 4OTEA 1B9JA 1MPDA 3FUZA 4UACA 3T66A 1MRPA 4KYSA 2H98A 3FVGA 2FYIA 3IX1A 5HBCA 3U8QA 5KDTB 1ZTYA 4O3AA 3OELA 4NMYA 5JTYB 3K01A 1IXGA 5DYHA 1M5EA 1OVBA 4OWDA 4ZZAA 3FVOA 4OENA 3JYRA 4LATA 5K2YA 5B70A 1EZOA 5CMKA 4GIZA 3CFXA 4OVJA 1EU8A 5FTHA 1MG1A 4Z7EA 3T96B 2Q88A 2UVHA 2I3WA 2F5XA 1POY1 2UVGA 1P1UA 4ZE8A 1ZMGA 2Z22A 2QPQA 3MWBA 3C36A 3E9XA 1Y3PA 4O3BA 4K3FA 1BP5A 1SVXB 1B0LA 4QSEA 4ZEKA 3A09A 4PP0A 3B6WA 3HPIA 4F18A 1H76A 3ECRA 3MQ9A 2F7BA 3KBRA 2I4BA 1ELJA 3OSQA 1MXYA 4EQ9A 1DOTA 1MXVA 3KJ7A 4C0RA 3IK6B 5I58A 4G68B 2R6GE 3VDFA 3SEUA 1JEVA 2F36A 1SW2A 1M5FA 3G3HA 4G2ZA 1WVJA 4JB7A 3L6HA 4C1UA 1NNPA 3TKDA 3S9NC 2UVIA 2PT2A 2V3QA 4HTGA 4PE5B 5I2NB 3TELA 2I48A 3EN3A 4LZ7A 2VD3A 4NF4B 4JSDA 4F3PA 4M4GA 2XXYA 3EHSA 4QFOA 4RY1A 1AOVA 3O97A 5DVIA 4F1UA 1KWHA 1ZU0A 2QSXA 1SW5A 4ND9A 2QMWA 3CG3A 1IXIA 4LZ8A 3RPWA 3RN8A 3U92A 5F7VA 3KSJA 2V84A 5FHMA 3TAJA 4HCYA 1GV8A 3IB0A 1NH7A 2XXQA 3IL1B 3IO6A 5DEXA 4GXSB 3MVXA 5AA4B 5CC2A 4Q0CA 5ISUA 5H8NB 4ZEBA 3TTNA 3HV1A 3E3KA 5L8DA 4XIGQ 4WKMA 4R73A 2Y7IA 3I6VA 1H44A 4ZZEA 3V8XB 4THIA 5CBRA 3OENA 2XXUA 4MH5A 3QK6A 1LBCA 2DS9A 2O68A 4NF8A 4XKNA 1QW0A 3MP1A 1P99A 1B6HA 1Y1ZA 2XX7A 3QIMA 3MZ1A 4QSDA 4H67A 3IOWA 1IIWA 2OJTA 3K1NA 4YZZA 5CI5A 4AB6A 1A99A 2D5WA 3GBBA 4FJPA 4JDFA 4P0GA 4LVQA 4HW8A 1PEBA 4DXCA 5H8FB 4EXLA 5JTYA 1B7UA 3GXAA 1F9BA 3K0VA 3H6TA 1IUDA 1M5BA 3K00A 4N6PA 4WXJA 2VHAA 2B3BA 4FEBA 4OFLA 1B3HA 3VLVA 2NVUB 5L9MA 3KFMA 3FD3A 1XOCA 1JEUA 2XXVA 3K6WA 4GQOA 1JNFA 3VVFA 2DOJA 2Q2AA 1I6AA 1B4HA 4BDMA 4F1YA 4YU0A 1LB8A 3ZKLA 3OMBA 2QS1A 2E1SA 2DWHA 3D4CA 3LR1A 3SDFA 3TTMA 2ZNUA 1B05A 3K4UA 1BLFA 5TPAB 2HFBA 3CVGA 4RXLA 1I69A 3TPAA 3Q25A 1QVSA 3FATA 3K02A 4RNSA 1Y9UA 1B0HA 2PMSA 4ZS9A 1MY2A 2G93A 3RTWB 3UA8A 3TEPA 1URSA 4GVOA 3K6VA 2Y7RA 3FXUA 2AL5A 3KG2A 5CMMA 1N3WA 3OEKA 3DM0A 3ZSFA 4F1VA 5I58B 1FTLA 1ZJLA 3TTRA 3P7IA 2V3TA 5I2NA 1ZLQA 4Z0IA 1HSLA 4GFRA 3HSTA 5CM6A 4R9FA 1A7LA 1IQ7A 4NF4A 4H0WA 3N5LA 3WAFA 1QUKA 4GRKA 3BKIB 4BDRA 1HSEA 2QJEA 2ESNA 4IO3A 5H8HB 1PDAA 2Q9TA 4JBZA 3SETA 4L17A 3G3FA 1B3GA 2UYFA 1A8EA 3FASA 4NF6A 3C34A 5EYFA 2A5TA 4U22A 5AE4A 4E0WA 1S9TA 5I56A 2CZLA 4IO4A 3G7WA 3LSXA 3CR9A 3C33A 1JW4A 4H6DA 4I62A 4F3BA 3QSLA 3TCHA 3HCQA 1BTJA 3W15C 4H1XA 2O51A 1O7TA 4OESA 4N07A 4YB6A 1LLSA 3G3IA 5HPQA 4OYVA 4H5FA 2YPNA 4FE8A 2UVJA 1FQBA 4GOTA 3S4UA 1LAGE 2OZZA 3GZGA 1RYOA 4I8CA 4I9DA 1M5CA 2XXIA 3IR1A 4X1BA 1MQDA 3MC2A 3N6TA 2P0SA 3H4ZA 4LA9A 1VSOA 4PETA 3RT8A 5HM4B 4UA8A 4ZE9A 1PB9A 4DXUA 2Y7KA 5TU0A 4EDPA 3K6XA 1JW5A 4NF8B 4I1DA 1ZBMA 2Y7WA 5EHMA 1FTOA 3FXRA 2H99A 3T22A 3C9HA 3KN7A 5KCJB 4KYEA 5H8FA 4QFLA 1IEJA 3EQ1A 2I58A 3BFTA 3OO9A 1AMFA 2XX8A 2AL4A 1GGGA 3TUSA 1XC1A 1AL3A 4G8MA 4MLQA 1AIVA 2RC9A 4G8NA 3MZBA 2E0SA 2B65A 2HAVA 2DE4A 3MVYA 5H8QB 1MDQA 1SYIA 2XHDA 1B1HA 1MXXA 1VFEA 4OEVA 1ATGA 4OXVA 3KSXA 3TZAA 1VE4A 1UIUA 2GRVA 1B5JA 1WDNA 3PV0E 3KJTA 4OEUA 5TPAA 1A40A 1MS7A 3GBAA 4FECA 1OVTA 2F7AA 3ZKKA 3O29A 5A5XB 1N76A 3BBRA 3PMVA 1USYE 3OXNA 2ZMBA 5CMCA 1OQHA 1OQGA 4R74A 4RK2A 1RYXA 1MM6A 3PMXA 4KYDA 4F22A 2VGQA 1EZPA 3TMGA 1HSJA 1O64A 3IORA 1B3EA 3G3KA 1DMBA 4U1OA 2ABHA 2QS3A 2Z8FA 2DE3A 4JWOA 2F34A 4YMAA 4NEDA 1T0KA 1YPNA 2BJJX 4YICA 1OIBA 2GFEA 1MQGA 2O6AA 4RJZA 2Y84A 2O7IA 4H5GA 2VOZA 2O69A 3S9EA 4GLIA 1LFIA 1TFAA 1US5A 3MBPA 4RK9A 2HZKA 4LZ5A 3UP9A 4R2BA 2DWJA 4IGTA 3Q27A 5H8HA 3UGWA 1B7ZA 1D9VA 3F11A 1DTGA 3FV2A 2D3IA 1N0TA 4LQ5A 3KZGA 3OO6A 5I2KA 4OERA 1N7WA 4KFQA 4Q30B 4NF6B 3LSLA 3RT6B 2A5TB 1H43A 4YKJA 4EUOA 5I56B 3CIJA 4U4XA 3LSFB 3MPLA 1II5A 2R9JA 5ICQA 1DPEA 5JK4A 3CSGA 3KEIA 4GL0A 3T9XB 3OO7A 1TFDA 3CFZA 2V93A 1FQEA 3BFUA 2DQVA 4U21A 1MQJA 1B2HA 3L6GA 5AA2D 4F3SA 3SEVA 3OD7A 4YB7A 2RC8A 2FA7A 3M3LA 3SERA 3DELB 1B40A 4LUBA 4QFKA 3C32A 2RCBA 1UTBB 4ESXA 3VV5A 4XXUA 1Y3NA 2F6PA 4AQ4A 4KPTA 3DP6A 3QUJA 1VR5A 3S2VA 3K6UA 4X9TA 3VXBA 2I6EA 3MPKA 4R9GA 4G77A 5KCJA 3IB1A 1JQFA 4LQ2A 4WEPA 1EZ9A 4R72A 3H03A 2ONRA 5K2XA 5L9OA 4BDOA 1P1NA 2O84X 2DXRA 2XD3A 1FTKA 5ITOA 4HS7A 2I0CA 3OO8A 2DP8A 1CE2A 3RUMA 1MY0A 5IAIA 4EQBA 5H8QA 1N84A 3TQWA 3O6HA 4NWDA 2RF1A 3SKPA 4XKPA 3S9LC 4ZEFA 5JEIA 4P0IA 3N6UA 2QRYA 4F29A 1SW1A 4PFTA 3DP4A 3PPOA 3RLFE 3EHUA 1A54A 3A3CA 3OSRA 3U93A 5A5XA 4RPOA 4QRZA 3MUQA 3N94A 4JXIA 2QL3A 3Q29A 1XVXA 3KN3A 1MXWA 2Q2CA 5DTBA 3M8UA 1RKMA 3QXMA 1EH3A 1LCTA 4PFWA 3IOUA 3E13X 1YCJA 4YKKA 4G8HA 2I0BA 5TP9A 2OWSA 2NXOA 1MXUA 2O7UA 2DVZA 2QS4A 2RINA 3MJNA 2B3FA 4GXAA 1A55A 3G3GA 3N26A 1GVCA 4QHQA 2DWAA 3KOSA 4DCXA 4RYAA 1N04A 5DVJA 5IKBA 2THIA 3PMWA 2V3UA 5H8SA 2FNCA 4H65A 5L9SA 1SBPA 1LFGA 4KHZE 1B46A 2LAOA 4F2QA 4TOZA 2PVUA 1DTZA 5AA1A 1B58A 1AH5A 3H3GA 2PX1A 1P1QA 1SD3A 4DIGA 1R6ZA 1FQDA 3PPNA 1JW1A 1IXHA 1SQYA 1Q1KA 1POTA 1P1OA 4P11A 1B1XA 5I84A 3FXQA 2XX9A 1NNKA 3FIRA 5ITPA 4FAJA 3O2AA 4FATA 1MH4A 3B6QA 2Z23A 2F6GA 1PB8A 3ODBA 3C4MA 1Q35A 3MVWA 1IITA 3KGCA 3C31A 5I2KB 1D4NA 3PGFA 3V5AA 2IA4A 2OLBA 1FQAA 2I49A 1TWYA 3DLNA 3TCGA 3W9WA 1PBPA 4C1TA 4R6HA 3ILTB 3SEWA 3R26A 1LB9A 2Z8EA 2Z8DA 3CG1A 1Y1MA 2I4CA 1B7HA 3MP8A 4OETA 1NMUA 1URDA 3R7XA 4HCWA 2M8CA 3IO4A 2ZNSA 1UTBA 4E0XA 4IO2A 3G3JA 3PUXE 4FEDA 5CBSA 3PU5A 5ELVA 2P2AA 2XXRA 1URGA 2RKMA 2GH9A 2REJA 1Z7NE 3HN0A 3LBSA 3ILUB 3A3UA 3I3VA 1B4ZA 2H9BA 5BUUA 2XXTA 3LSWA 3T9HB 4ZECA 1P1WA 4X48A 2Q89A 3IJOB 1PB7A 1Y20A 3HHGA 3MP6A 3O9PA 1B32A 4ZEDA 3Q28A 3U72A 3EPEA 3QAXA 1Y4CA 3TTLA 2HQ0A 3CSBA 1NNFA 1JVYA 2QS2A 1MQHA 1JETA 4ZEIA 1MY4A 2ZYOA 3VE1B 3U94A 5DVFA 1SI1A 3VFJA 3AXFA 4JSOA 4MBPA 5CRYA 1M5DA 2DYXA 5I57A 1TT1A 4NE4A 2YLNA 1BIYA 1ZKBA 2XXXA 3SESA 4TQUQ 5J1DA 2PBWA 4XKQA 1LAFE 3WAEA 4F19A 4XTCQ 4NTLA 3TODA 4GF8A 2P1SA 2F8DA 3HO7A 3RQTA 4DE8A 4OMBA 4EXKA 2X7PA 3DP8A 3UN6A 4ELPA 2OK2A 1FTJA 2UYEA 3CFLA 5AA2B 5TP9B 3PD8A 2RCAA 1O63A 1Y3QA 3IJXB 3MVZA 3FVKA 4Q8RA 3VLUA 3I5OA 1MPCA 2DE2A 2HCAA 1MDP1 4YKIA 2W7YA 1XS5A 4PFYA 4M1VA 2PYYA 2DXYA 3FJGA 3UIFA 1GR2A 2Y7PA 2X7QA 2H4IA 3CRBA 4R2FA 4PFUA 4OQOA 3M3KA 2YJPA 1R9LA 1B3FA 4AB5A 4QFNA 1IZ1A 3O6GA 2UXAA 2HAUA 1SYHA 3OEMA 4U4SA 5CMBA 3H6VA 1DSNA 1XHYA 1IXCA 1OLAA 4JWXA 1VFDA 4NF5B 2DSFA 3RGYA 1UTHA 5EHSA 4ELQA 3MAMA 1CB6A 2PT1A 4BLAA 1LFHA 2H5YA 1OLCA 4EF1A 5LOMA 3FZVA 1SI0A 4GD5A 4WEDA 2NWJA 1ZIUA 1TXFA 2F35A 2XXHA 4H8IA 3QYTA 2XXWA 4IO7A 4DDDA 3PD9A 4RPNA 1B5HA 4DCYA 3T9VA 5I59A 1YAEA 3PPQA 1NNTA 4LP2B 1GTKA 4O3CA 5B7DA 4F31B 4YAHX 1MXZA 2HEUA 3TTKA 1LAHE 3B6TA 4OZ9A 1L5TA 1PC3A 4BDQA 3RY3A 4OHNA 3K1MA 3VVDA 2DWIA 4QFPA 1D3KA 3TQLA 2HXWA 1SW4A 1FCKA 1MH3A 3PUVE 3EF7A 1MQIA 4EF2A 4IO5A 1FQFA 4ELOA 3V89B 3H06B 3GLBA 1USYH 4KCDA 2Q8JA 4H8JA 3PPRA 4GL8A 4LONB 4F3GA 2ZYKA 2HZLA 2WKYA 4PQJA 1D9YA 2VP1A 4TLMB 3K1PA 2DVCA 3PPPA 3JZJA 1YTVA 4QF9A 1N3XA 1XVYA 1A8FA 5KDTA 1LCFA 1JVXA 1DPPA 2V25A 4NWCA 3LUYA 4GWOA 1B5IA 4YB5A 1QJMA 4IY5A 3ZS6A 4KQPA 1MM7A 3T93B 3CI8A 3PUZE 2OCUA 2O1MA 5FTIA 2H25A 3FJ7A 5I57B 3UORA 3MW0A 3H6UA 4R75A 5M2VA 1PBQA 2F7CA 4MLVA 2ANJA 1NFTA 1B51A 3PUYE 1NH8A 4G4PA 1S7YA 4MFIA 4RA1A 3C35A 3O28A 4BDLA 2KLFA 1QKAA 5F1QA 2REGA 1FTMA 3LC8A 4R6YA 1I6QA 5BWJA 1UIVA 1B52A 4G68C 2NOOA 2O1LA 1FQCA 5FHNA 3IB2A 1NKXA 5AA2A 3U1OA 1N7XA 4U1ZA 3HHFA 3IAZA 2IEEA 1XT8A 1LSTA 1MPBA 4JWYA 4X1DA 3ONMA 1MY1A 3RNNA 1S50A 3IOVA 2QMXA 1B3LA 4IGRA 2GHAA 2ZNTA 2ALUA 4XKRA 1Z7ME 4OFOA 3EHTA 2ZYMA 4QSCA 3H7MA 3K2DA 2G29A 4F2OA 4G68A 4IY6A 4ZDMA 1NL5A 3D4GA 4POWA 1QUJA 2AIXA 5ICTA 2VD2A 3QUFA 1J1NA 5KZTA 1LBBA 3B7DA 4DZ1A 3S9MC 3M3FA 3KN8A 3W9VA 1LAXA 2F97A 2D21A 3VXCA 4NF5A 4DLDA 4OFJA 1LGBC 1FW0A 1OMPA 3THIA 2OBGA 3OOAA 5AA3A 4YMBA 1H45A 4KCCA 1UTHB 4ECFA 3O66A 1QULA 2CMOA 4MF3A 1I6BA 2AYSA 1MY3A 4FORA 3FV1A 3JV9A 3VLWA 3USDA 2ZXTA 2ZYNA 2ONSA 3TCFA 3TYHA 4FIMA 4EQ7A 1SDXA 2NUVA 4Q5TA 3RTFB 5AA4A 4KD5A 4U2RA 4DXBA 3MZ9A 3SEYA 2R71A 3Q26A 4IO6A 2XD2A 1QUIA 1ANFA 5H8NA 1Y4TA 1R1NA 3SEXA 5DEXB 3R6UA 4R6KA 5I59B 4KR5A 3E4RA 3TDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KI0 E;  3V83 A;  3T9U A;  1R9Q A;  4IB2 A;  4ELR A;  1QKB A;  4TLL B;  3TFL A;  3H6W A;  2GHB A;  3UK4 A;  2RC7 A;  3KOT A;  4POX A;  4BDN A;  2I3V A;  3IOT A;  1H3D A;  5DT6 A;  4ONY A;  3FGS A;  5FHO A;  3FVN A;  1BKA A;  3VVE A;  2OWT A;  3FJM A;  2F78 A;  1US4 A;  4ISU A;  1WOD A;  2X26 A;  3O6I A;  3PUW E;  4YKP A;  2A5S A;  1UQW A;  4ESW A;  4U23 A;  2XXP A;  4F39 A;  2ONK E;  4N13 A;  4OTE A;  1B9J A;  1MPD A;  3FUZ A;  4UAC A;  3T66 A;  1MRP A;  4KYS A;  2H98 A;  3FVG A;  2FYI A;  3IX1 A;  5HBC A;  3U8Q A;  5KDT B;  1ZTY A;  4O3A A;  3OEL A;  4NMY A;  5JTY B;  3K01 A;  1IXG A;  5DYH A;  1M5E A;  1OVB A;  4OWD A;  4ZZA A;  3FVO A;  4OEN A;  3JYR A;  4LAT A;  5K2Y A;  5B70 A;  1EZO A;  5CMK A;  4GIZ A;  3CFX A;  4OVJ A;  1EU8 A;  5FTH A;  1MG1 A;  4Z7E A;  3T96 B;  2Q88 A;  2UVH A;  2I3W A;  2F5X A;  1POY 1;  2UVG A;  1P1U A;  4ZE8 A;  1ZMG A;  2Z22 A;  2QPQ A;  3MWB A;  3C36 A;  3E9X A;  1Y3P A;  4O3B A;  4K3F A;  1BP5 A;  1SVX B;  1B0L A;  4QSE A;  4ZEK A;  3A09 A;  4PP0 A;  3B6W A;  3HPI A;  4F18 A;  1H76 A;  3ECR A;  3MQ9 A;  2F7B A;  3KBR A;  2I4B A;  1ELJ A;  3OSQ A;  1MXY A;  4EQ9 A;  1DOT A;  1MXV A;  3KJ7 A;  4C0R A;  3IK6 B;  5I58 A;  4G68 B;  2R6G E;  3VDF A;  3SEU A;  1JEV A;  2F36 A;  1SW2 A;  1M5F A;  3G3H A;  4G2Z A;  1WVJ A;  4JB7 A;  3L6H A;  4C1U A;  1NNP A;  3TKD A;  3S9N C;  2UVI A;  2PT2 A;  2V3Q A;  4HTG A;  4PE5 B;  5I2N B;  3TEL A;  2I48 A;  3EN3 A;  4LZ7 A;  2VD3 A;  4NF4 B;  4JSD A;  4F3P A;  4M4G A;  2XXY A;  3EHS A;  4QFO A;  4RY1 A;  1AOV A;  3O97 A;  5DVI A;  4F1U A;  1KWH A;  1ZU0 A;  2QSX A;  1SW5 A;  4ND9 A;  2QMW A;  3CG3 A;  1IXI A;  4LZ8 A;  3RPW A;  3RN8 A;  3U92 A;  5F7V A;  3KSJ A;  2V84 A;  5FHM A;  3TAJ A;  4HCY A;  1GV8 A;  3IB0 A;  1NH7 A;  2XXQ A;  3IL1 B;  3IO6 A;  5DEX A;  4GXS B;  3MVX A;  5AA4 B;  5CC2 A;  4Q0C A;  5ISU A;  5H8N B;  4ZEB A;  3TTN A;  3HV1 A;  3E3K A;  5L8D A;  4XIG Q;  4WKM A;  4R73 A;  2Y7I A;  3I6V A;  1H44 A;  4ZZE A;  3V8X B;  4THI A;  5CBR A;  3OEN A;  2XXU A;  4MH5 A;  3QK6 A;  1LBC A;  2DS9 A;  2O68 A;  4NF8 A;  4XKN A;  1QW0 A;  3MP1 A;  1P99 A;  1B6H A;  1Y1Z A;  2XX7 A;  3QIM A;  3MZ1 A;  4QSD A;  4H67 A;  3IOW A;  1IIW A;  2OJT A;  3K1N A;  4YZZ A;  5CI5 A;  4AB6 A;  1A99 A;  2D5W A;  3GBB A;  4FJP A;  4JDF A;  4P0G A;  4LVQ A;  4HW8 A;  1PEB A;  4DXC A;  5H8F B;  4EXL A;  5JTY A;  1B7U A;  3GXA A;  1F9B A;  3K0V A;  3H6T A;  1IUD A;  1M5B A;  3K00 A;  4N6P A;  4WXJ A;  2VHA A;  2B3B A;  4FEB A;  4OFL A;  1B3H A;  3VLV A;  2NVU B;  5L9M A;  3KFM A;  3FD3 A;  1XOC A;  1JEU A;  2XXV A;  3K6W A;  4GQO A;  1JNF A;  3VVF A;  2DOJ A;  2Q2A A;  1I6A A;  1B4H A;  4BDM A;  4F1Y A;  4YU0 A;  1LB8 A;  3ZKL A;  3OMB A;  2QS1 A;  2E1S A;  2DWH A;  3D4C A;  3LR1 A;  3SDF A;  3TTM A;  2ZNU A;  1B05 A;  3K4U A;  1BLF A;  5TPA B;  2HFB A;  3CVG A;  4RXL A;  1I69 A;  3TPA A;  3Q25 A;  1QVS A;  3FAT A;  3K02 A;  4RNS A;  1Y9U A;  1B0H A;  2PMS A;  4ZS9 A;  1MY2 A;  2G93 A;  3RTW B;  3UA8 A;  3TEP A;  1URS A;  4GVO A;  3K6V A;  2Y7R A;  3FXU A;  2AL5 A;  3KG2 A;  5CMM A;  1N3W A;  3OEK A;  3DM0 A;  3ZSF A;  4F1V A;  5I58 B;  1FTL A;  1ZJL A;  3TTR A;  3P7I A;  2V3T A;  5I2N A;  1ZLQ A;  4Z0I A;  1HSL A;  4GFR A;  3HST A;  5CM6 A;  4R9F A;  1A7L A;  1IQ7 A;  4NF4 A;  4H0W A;  3N5L A;  3WAF A;  1QUK A;  4GRK A;  3BKI B;  4BDR A;  1HSE A;  2QJE A;  2ESN A;  4IO3 A;  5H8H B;  1PDA A;  2Q9T A;  4JBZ A;  3SET A;  4L17 A;  3G3F A;  1B3G A;  2UYF A;  1A8E A;  3FAS A;  4NF6 A;  3C34 A;  5EYF A;  2A5T A;  4U22 A;  5AE4 A;  4E0W A;  1S9T A;  5I56 A;  2CZL A;  4IO4 A;  3G7W A;  3LSX A;  3CR9 A;  3C33 A;  1JW4 A;  4H6D A;  4I62 A;  4F3B A;  3QSL A;  3TCH A;  3HCQ A;  1BTJ A;  3W15 C;  4H1X A;  2O51 A;  1O7T A;  4OES A;  4N07 A;  4YB6 A;  1LLS A;  3G3I A;  5HPQ A;  4OYV A;  4H5F A;  2YPN A;  4FE8 A;  2UVJ A;  1FQB A;  4GOT A;  3S4U A;  1LAG E;  2OZZ A;  3GZG A;  1RYO A;  4I8C A;  4I9D A;  1M5C A;  2XXI A;  3IR1 A;  4X1B A;  1MQD A;  3MC2 A;  3N6T A;  2P0S A;  3H4Z A;  4LA9 A;  1VSO A;  4PET A;  3RT8 A;  5HM4 B;  4UA8 A;  4ZE9 A;  1PB9 A;  4DXU A;  2Y7K A;  5TU0 A;  4EDP A;  3K6X A;  1JW5 A;  4NF8 B;  4I1D A;  1ZBM A;  2Y7W A;  5EHM A;  1FTO A;  3FXR A;  2H99 A;  3T22 A;  3C9H A;  3KN7 A;  5KCJ B;  4KYE A;  5H8F A;  4QFL A;  1IEJ A;  3EQ1 A;  2I58 A;  3BFT A;  3OO9 A;  1AMF A;  2XX8 A;  2AL4 A;  1GGG A;  3TUS A;  1XC1 A;  1AL3 A;  4G8M A;  4MLQ A;  1AIV A;  2RC9 A;  4G8N A;  3MZB A;  2E0S A;  2B65 A;  2HAV A;  2DE4 A;  3MVY A;  5H8Q B;  1MDQ A;  1SYI A;  2XHD A;  1B1H A;  1MXX A;  1VFE A;  4OEV A;  1ATG A;  4OXV A;  3KSX A;  3TZA A;  1VE4 A;  1UIU A;  2GRV A;  1B5J A;  1WDN A;  3PV0 E;  3KJT A;  4OEU A;  5TPA A;  1A40 A;  1MS7 A;  3GBA A;  4FEC A;  1OVT A;  2F7A A;  3ZKK A;  3O29 A;  5A5X B;  1N76 A;  3BBR A;  3PMV A;  1USY E;  3OXN A;  2ZMB A;  5CMC A;  1OQH A;  1OQG A;  4R74 A;  4RK2 A;  1RYX A;  1MM6 A;  3PMX A;  4KYD A;  4F22 A;  2VGQ A;  1EZP A;  3TMG A;  1HSJ A;  1O64 A;  3IOR A;  1B3E A;  3G3K A;  1DMB A;  4U1O A;  2ABH A;  2QS3 A;  2Z8F A;  2DE3 A;  4JWO A;  2F34 A;  4YMA A;  4NED A;  1T0K A;  1YPN A;  2BJJ X;  4YIC A;  1OIB A;  2GFE A;  1MQG A;  2O6A A;  4RJZ A;  2Y84 A;  2O7I A;  4H5G A;  2VOZ A;  2O69 A;  3S9E A;  4GLI A;  1LFI A;  1TFA A;  1US5 A;  3MBP A;  4RK9 A;  2HZK A;  4LZ5 A;  3UP9 A;  4R2B A;  2DWJ A;  4IGT A;  3Q27 A;  5H8H A;  3UGW A;  1B7Z A;  1D9V A;  3F11 A;  1DTG A;  3FV2 A;  2D3I A;  1N0T A;  4LQ5 A;  3KZG A;  3OO6 A;  5I2K A;  4OER A;  1N7W A;  4KFQ A;  4Q30 B;  4NF6 B;  3LSL A;  3RT6 B;  2A5T B;  1H43 A;  4YKJ A;  4EUO A;  5I56 B;  3CIJ A;  4U4X A;  3LSF B;  3MPL A;  1II5 A;  2R9J A;  5ICQ A;  1DPE A;  5JK4 A;  3CSG A;  3KEI A;  4GL0 A;  3T9X B;  3OO7 A;  1TFD A;  3CFZ A;  2V93 A;  1FQE A;  3BFU A;  2DQV A;  4U21 A;  1MQJ A;  1B2H A;  3L6G A;  5AA2 D;  4F3S A;  3SEV A;  3OD7 A;  4YB7 A;  2RC8 A;  2FA7 A;  3M3L A;  3SER A;  3DEL B;  1B40 A;  4LUB A;  4QFK A;  3C32 A;  2RCB A;  1UTB B;  4ESX A;  3VV5 A;  4XXU A;  1Y3N A;  2F6P A;  4AQ4 A;  4KPT A;  3DP6 A;  3QUJ A;  1VR5 A;  3S2V A;  3K6U A;  4X9T A;  3VXB A;  2I6E A;  3MPK A;  4R9G A;  4G77 A;  5KCJ A;  3IB1 A;  1JQF A;  4LQ2 A;  4WEP A;  1EZ9 A;  4R72 A;  3H03 A;  2ONR A;  5K2X A;  5L9O A;  4BDO A;  1P1N A;  2O84 X;  2DXR A;  2XD3 A;  1FTK A;  5ITO A;  4HS7 A;  2I0C A;  3OO8 A;  2DP8 A;  1CE2 A;  3RUM A;  1MY0 A;  5IAI A;  4EQB A;  5H8Q A;  1N84 A;  3TQW A;  3O6H A;  4NWD A;  2RF1 A;  3SKP A;  4XKP A;  3S9L C;  4ZEF A;  5JEI A;  4P0I A;  3N6U A;  2QRY A;  4F29 A;  1SW1 A;  4PFT A;  3DP4 A;  3PPO A;  3RLF E;  3EHU A;  1A54 A;  3A3C A;  3OSR A;  3U93 A;  5A5X A;  4RPO A;  4QRZ A;  3MUQ A;  3N94 A;  4JXI A;  2QL3 A;  3Q29 A;  1XVX A;  3KN3 A;  1MXW A;  2Q2C A;  5DTB A;  3M8U A;  1RKM A;  3QXM A;  1EH3 A;  1LCT A;  4PFW A;  3IOU A;  3E13 X;  1YCJ A;  4YKK A;  4G8H A;  2I0B A;  5TP9 A;  2OWS A;  2NXO A;  1MXU A;  2O7U A;  2DVZ A;  2QS4 A;  2RIN A;  3MJN A;  2B3F A;  4GXA A;  1A55 A;  3G3G A;  3N26 A;  1GVC A;  4QHQ A;  2DWA A;  3KOS A;  4DCX A;  4RYA A;  1N04 A;  5DVJ A;  5IKB A;  2THI A;  3PMW A;  2V3U A;  5H8S A;  2FNC A;  4H65 A;  5L9S A;  1SBP A;  1LFG A;  4KHZ E;  1B46 A;  2LAO A;  4F2Q A;  4TOZ A;  2PVU A;  1DTZ A;  5AA1 A;  1B58 A;  1AH5 A;  3H3G A;  2PX1 A;  1P1Q A;  1SD3 A;  4DIG A;  1R6Z A;  1FQD A;  3PPN A;  1JW1 A;  1IXH A;  1SQY A;  1Q1K A;  1POT A;  1P1O A;  4P11 A;  1B1X A;  5I84 A;  3FXQ A;  2XX9 A;  1NNK A;  3FIR A;  5ITP A;  4FAJ A;  3O2A A;  4FAT A;  1MH4 A;  3B6Q A;  2Z23 A;  2F6G A;  1PB8 A;  3ODB A;  3C4M A;  1Q35 A;  3MVW A;  1IIT A;  3KGC A;  3C31 A;  5I2K B;  1D4N A;  3PGF A;  3V5A A;  2IA4 A;  2OLB A;  1FQA A;  2I49 A;  1TWY A;  3DLN A;  3TCG A;  3W9W A;  1PBP A;  4C1T A;  4R6H A;  3ILT B;  3SEW A;  3R26 A;  1LB9 A;  2Z8E A;  2Z8D A;  3CG1 A;  1Y1M A;  2I4C A;  1B7H A;  3MP8 A;  4OET A;  1NMU A;  1URD A;  3R7X A;  4HCW A;  2M8C A;  3IO4 A;  2ZNS A;  1UTB A;  4E0X A;  4IO2 A;  3G3J A;  3PUX E;  4FED A;  5CBS A;  3PU5 A;  5ELV A;  2P2A A;  2XXR A;  1URG A;  2RKM A;  2GH9 A;  2REJ A;  1Z7N E;  3HN0 A;  3LBS A;  3ILU B;  3A3U A;  3I3V A;  1B4Z A;  2H9B A;  5BUU A;  2XXT A;  3LSW A;  3T9H B;  4ZEC A;  1P1W A;  4X48 A;  2Q89 A;  3IJO B;  1PB7 A;  1Y20 A;  3HHG A;  3MP6 A;  3O9P A;  1B32 A;  4ZED A;  3Q28 A;  3U72 A;  3EPE A;  3QAX A;  1Y4C A;  3TTL A;  2HQ0 A;  3CSB A;  1NNF A;  1JVY A;  2QS2 A;  1MQH A;  1JET A;  4ZEI A;  1MY4 A;  2ZYO A;  3VE1 B;  3U94 A;  5DVF A;  1SI1 A;  3VFJ A;  3AXF A;  4JSO A;  4MBP A;  5CRY A;  1M5D A;  2DYX A;  5I57 A;  1TT1 A;  4NE4 A;  2YLN A;  1BIY A;  1ZKB A;  2XXX A;  3SES A;  4TQU Q;  5J1D A;  2PBW A;  4XKQ A;  1LAF E;  3WAE A;  4F19 A;  4XTC Q;  4NTL A;  3TOD A;  4GF8 A;  2P1S A;  2F8D A;  3HO7 A;  3RQT A;  4DE8 A;  4OMB A;  4EXK A;  2X7P A;  3DP8 A;  3UN6 A;  4ELP A;  2OK2 A;  1FTJ A;  2UYE A;  3CFL A;  5AA2 B;  5TP9 B;  3PD8 A;  2RCA A;  1O63 A;  1Y3Q A;  3IJX B;  3MVZ A;  3FVK A;  4Q8R A;  3VLU A;  3I5O A;  1MPC A;  2DE2 A;  2HCA A;  1MDP 1;  4YKI A;  2W7Y A;  1XS5 A;  4PFY A;  4M1V A;  2PYY A;  2DXY A;  3FJG A;  3UIF A;  1GR2 A;  2Y7P A;  2X7Q A;  2H4I A;  3CRB A;  4R2F A;  4PFU A;  4OQO A;  3M3K A;  2YJP A;  1R9L A;  1B3F A;  4AB5 A;  4QFN A;  1IZ1 A;  3O6G A;  2UXA A;  2HAU A;  1SYH A;  3OEM A;  4U4S A;  5CMB A;  3H6V A;  1DSN A;  1XHY A;  1IXC A;  1OLA A;  4JWX A;  1VFD A;  4NF5 B;  2DSF A;  3RGY A;  1UTH A;  5EHS A;  4ELQ A;  3MAM A;  1CB6 A;  2PT1 A;  4BLA A;  1LFH A;  2H5Y A;  1OLC A;  4EF1 A;  5LOM A;  3FZV A;  1SI0 A;  4GD5 A;  4WED A;  2NWJ A;  1ZIU A;  1TXF A;  2F35 A;  2XXH A;  4H8I A;  3QYT A;  2XXW A;  4IO7 A;  4DDD A;  3PD9 A;  4RPN A;  1B5H A;  4DCY A;  3T9V A;  5I59 A;  1YAE A;  3PPQ A;  1NNT A;  4LP2 B;  1GTK A;  4O3C A;  5B7D A;  4F31 B;  4YAH X;  1MXZ A;  2HEU A;  3TTK A;  1LAH E;  3B6T A;  4OZ9 A;  1L5T A;  1PC3 A;  4BDQ A;  3RY3 A;  4OHN A;  3K1M A;  3VVD A;  2DWI A;  4QFP A;  1D3K A;  3TQL A;  2HXW A;  1SW4 A;  1FCK A;  1MH3 A;  3PUV E;  3EF7 A;  1MQI A;  4EF2 A;  4IO5 A;  1FQF A;  4ELO A;  3V89 B;  3H06 B;  3GLB A;  1USY H;  4KCD A;  2Q8J A;  4H8J A;  3PPR A;  4GL8 A;  4LON B;  4F3G A;  2ZYK A;  2HZL A;  2WKY A;  4PQJ A;  1D9Y A;  2VP1 A;  4TLM B;  3K1P A;  2DVC A;  3PPP A;  3JZJ A;  1YTV A;  4QF9 A;  1N3X A;  1XVY A;  1A8F A;  5KDT A;  1LCF A;  1JVX A;  1DPP A;  2V25 A;  4NWC A;  3LUY A;  4GWO A;  1B5I A;  4YB5 A;  1QJM A;  4IY5 A;  3ZS6 A;  4KQP A;  1MM7 A;  3T93 B;  3CI8 A;  3PUZ E;  2OCU A;  2O1M A;  5FTI A;  2H25 A;  3FJ7 A;  5I57 B;  3UOR A;  3MW0 A;  3H6U A;  4R75 A;  5M2V A;  1PBQ A;  2F7C A;  4MLV A;  2ANJ A;  1NFT A;  1B51 A;  3PUY E;  1NH8 A;  4G4P A;  1S7Y A;  4MFI A;  4RA1 A;  3C35 A;  3O28 A;  4BDL A;  2KLF A;  1QKA A;  5F1Q A;  2REG A;  1FTM A;  3LC8 A;  4R6Y A;  1I6Q A;  5BWJ A;  1UIV A;  1B52 A;  4G68 C;  2NOO A;  2O1L A;  1FQC A;  5FHN A;  3IB2 A;  1NKX A;  5AA2 A;  3U1O A;  1N7X A;  4U1Z A;  3HHF A;  3IAZ A;  2IEE A;  1XT8 A;  1LST A;  1MPB A;  4JWY A;  4X1D A;  3ONM A;  1MY1 A;  3RNN A;  1S50 A;  3IOV A;  2QMX A;  1B3L A;  4IGR A;  2GHA A;  2ZNT A;  2ALU A;  4XKR A;  1Z7M E;  4OFO A;  3EHT A;  2ZYM A;  4QSC A;  3H7M A;  3K2D A;  2G29 A;  4F2O A;  4G68 A;  4IY6 A;  4ZDM A;  1NL5 A;  3D4G A;  4POW A;  1QUJ A;  2AIX A;  5ICT A;  2VD2 A;  3QUF A;  1J1N A;  5KZT A;  1LBB A;  3B7D A;  4DZ1 A;  3S9M C;  3M3F A;  3KN8 A;  3W9V A;  1LAX A;  2F97 A;  2D21 A;  3VXC A;  4NF5 A;  4DLD A;  4OFJ A;  1LGB C;  1FW0 A;  1OMP A;  3THI A;  2OBG A;  3OOA A;  5AA3 A;  4YMB A;  1H45 A;  4KCC A;  1UTH B;  4ECF A;  3O66 A;  1QUL A;  2CMO A;  4MF3 A;  1I6B A;  2AYS A;  1MY3 A;  4FOR A;  3FV1 A;  3JV9 A;  3VLW A;  3USD A;  2ZXT A;  2ZYN A;  2ONS A;  3TCF A;  3TYH A;  4FIM A;  4EQ7 A;  1SDX A;  2NUV A;  4Q5T A;  3RTF B;  5AA4 A;  4KD5 A;  4U2R A;  4DXB A;  3MZ9 A;  3SEY A;  2R71 A;  3Q26 A;  4IO6 A;  2XD2 A;  1QUI A;  1ANF A;  5H8N A;  1Y4T A;  1R1N A;  3SEX A;  5DEX B;  3R6U A;  4R6K A;  5I59 B;  4KR5 A;  3E4R A;  3TDJ A; 
#chains in the Genus database with same CATH topology
 3U65 A;  4PFB A;  4KI0 E;  3V83 A;  3T9U A;  1R9Q A;  4IB2 A;  4ELR A;  1QKB A;  4TLL B;  3TFL A;  3H6W A;  2GHB A;  3UK4 A;  2L5V A;  2RC7 A;  3KOT A;  4POX A;  4BDN A;  2I3V A;  3IOT A;  1H3D A;  5DT6 A;  2Y5L A;  4ONY A;  2XWI A;  3FGS A;  5FHO A;  3FVN A;  1BKA A;  3VVE A;  2OWT A;  3FJM A;  2F78 A;  1US4 A;  4ISU A;  1WOD A;  2X26 A;  3O6I A;  3PUW E;  4YKP A;  2A5S A;  1UQW A;  4ESW A;  4U23 A;  2XXP A;  4F39 A;  2ONK E;  5DW8 A;  4N13 A;  4OTE A;  1B9J A;  1MPD A;  3FUZ A;  4UAC A;  3T66 A;  1MRP A;  4KYS A;  2H98 A;  3FVG A;  2FYI A;  3IX1 A;  5HBC A;  4QXD A;  3U8Q A;  1ZTY A;  5KDT B;  4O3A A;  3OEL A;  4NMY A;  5JTY B;  3K01 A;  3HFU A;  1NUY A;  1IXG A;  5DYH A;  1M5E A;  1OVB A;  4OWD A;  4ZZA A;  3FVO A;  4HE2 A;  4OEN A;  1NV1 A;  4PGN A;  3JYR A;  4LAT A;  5K2Y A;  2OWZ A;  5B70 A;  1EZO A;  2VPO A;  5CMK A;  4GIZ A;  3CFX A;  4OVJ A;  2FIX A;  1EU8 A;  5FTH A;  1MG1 A;  4Z7E A;  3T96 B;  2Q88 A;  2UVH A;  2I3W A;  2F5X A;  1POY 1;  2UVG A;  1P1U A;  4PGP A;  4ZE8 A;  1ZMG A;  1FPI A;  2Z22 A;  2QPQ A;  3MWB A;  3C36 A;  4P56 A;  3E9X A;  1Y3P A;  4MAG A;  4O3B A;  1XI6 A;  4N91 A;  4P47 A;  4K3F A;  1BP5 A;  4GBV A;  1K9Z A;  1SVX B;  1B0L A;  3B8B A;  4QSE A;  4ZEK A;  1FBD A;  1IMF A;  3A09 A;  1JP4 A;  4PP0 A;  3B6W A;  3HPI A;  4F18 A;  1H76 A;  3ECR A;  3MQ9 A;  2F7B A;  3E79 A;  3KBR A;  4KXP A;  4X8R A;  2DDK A;  2I4B A;  1ELJ A;  3OSQ A;  1MXY A;  4EQ9 A;  1DOT A;  1MXV A;  1YZ0 A;  3KJ7 A;  4C0R A;  3IK6 B;  5I58 A;  4G68 B;  2R6G E;  4NN3 A;  3VDF A;  3SEU A;  1JEV A;  2F36 A;  4H45 A;  4GX6 A;  1FSA A;  1SW2 A;  3RYD A;  5IZZ A;  1M5F A;  3G3H A;  1FBG A;  1WVJ A;  4G2Z A;  5ET7 A;  4JB7 A;  3L6H A;  4C1U A;  1NNP A;  3TKD A;  3S9N C;  2UVI A;  2PT2 A;  2V3Q A;  4HTG A;  4PE5 B;  5I2N B;  3TEL A;  2I48 A;  1LBV A;  3EN3 A;  3CHG A;  4GBW A;  4LZ7 A;  2VD3 A;  4NF4 B;  4JSD A;  4F3P A;  4M4G A;  2XXY A;  3EHS A;  4PAI A;  4QFO A;  1FBH A;  2ZZX A;  4RY1 A;  1AOV A;  4MEV A;  4X04 A;  3O97 A;  1FPD A;  5DVI A;  4F1U A;  1KWH A;  1ZU0 A;  2F3B A;  2QSX A;  3A29 A;  1G0I A;  1SW5 A;  4ND9 A;  2QMW A;  3CG3 A;  1IXI A;  4LZ8 A;  3RPW A;  1FJ9 A;  3RN8 A;  3U92 A;  1KZ8 A;  5F7V A;  3KSJ A;  2V84 A;  5FHM A;  3TAJ A;  4HCY A;  1GV8 A;  3IB0 A;  1NH7 A;  4NHB A;  4PCD A;  2XXQ A;  3IL1 B;  3IO6 A;  5DEX A;  4GXS B;  5EYH A;  3MVX A;  5AA4 B;  1FPB A;  5CC2 A;  4Q0C A;  5ISU A;  5H8N B;  4ZEB A;  3TTN A;  3HV1 A;  4OVT A;  5EQA A;  3E3K A;  5L8D A;  4XIG Q;  4WKM A;  4P1E A;  4R73 A;  2Y7I A;  5LTC A;  3I6V A;  2B4L A;  1H44 A;  4ZZE A;  3V8X B;  4THI A;  5CBR A;  3OEN A;  2XXU A;  4MH5 A;  2WYP A;  3QK6 A;  1LBC A;  2DS9 A;  2O68 A;  4NF8 A;  4XKN A;  1NUW A;  1QW0 A;  3MP1 A;  1P99 A;  4GWZ A;  5ET6 A;  1LBW A;  1B6H A;  1Y1Z A;  2XX7 A;  3QIM A;  3MZ1 A;  4QSD A;  4H67 A;  3IOW A;  1IIW A;  4P1L A;  2OJT A;  3K1N A;  4YZZ A;  5CI5 A;  3IFA A;  4AB6 A;  1A99 A;  2D5W A;  3GBB A;  4FJP A;  4JDF A;  4P0G A;  4LVQ A;  4HW8 A;  2FIE A;  1PEB A;  4DXC A;  5H8F B;  4EXL A;  5JTY A;  1B7U A;  3GXA A;  1F9B A;  3K0V A;  3H6T A;  1IUD A;  1M5B A;  3K00 A;  1FJ6 A;  4N6P A;  4WXJ A;  2VHA A;  2B3B A;  2XXK A;  4FEB A;  4OFL A;  1B3H A;  3VLV A;  2NVU B;  3D1R A;  5L9M A;  3KFM A;  1NV5 A;  3FD3 A;  1XOC A;  1JEU A;  2VPN A;  2XXV A;  3K6W A;  4GQO A;  1JNF A;  3VVF A;  2DOJ A;  2Q2A A;  1I6A A;  5LDZ A;  1B4H A;  4BDM A;  4F1Y A;  4YU0 A;  4MHF A;  1FPK A;  1D9Q A;  1LB8 A;  3ZKL A;  3OMB A;  2QS1 A;  2E1S A;  2DWH A;  5F24 A;  3D4C A;  3LR1 A;  3SDF A;  3TTM A;  2ZNU A;  1B05 A;  3K4U A;  4MJO A;  1BLF A;  5TPA B;  2HFB A;  3CVG A;  4RXL A;  1I69 A;  3TPA A;  1BK4 A;  3Q25 A;  1QVS A;  3FAT A;  3K02 A;  4I3E A;  4RNS A;  1Y9U A;  1B0H A;  2PMS A;  4ZS9 A;  1MY2 A;  2G93 A;  2B4M A;  3MST A;  3RTW B;  4DI3 D;  3UA8 A;  3TEP A;  1URS A;  4XF5 A;  2HXR A;  4GVO A;  3K6V A;  2Y7R A;  3FXU A;  2AL5 A;  3KG2 A;  1RDY A;  5CMM A;  2KR0 A;  1N3W A;  5I3S A;  3IFC A;  2MKZ A;  3OEK A;  3DM0 A;  5ET5 A;  3ZSF A;  4F1V A;  5I58 B;  1FTL A;  1ZJL A;  3TTR A;  3P7I A;  2V3T A;  5I2N A;  1ZLQ A;  4Z0I A;  1EYK A;  1HSL A;  4GFR A;  3LV0 A;  3HST A;  5CM6 A;  4R9F A;  1A7L A;  1IQ7 A;  4NF4 A;  4H0W A;  3N5L A;  3WAF A;  1QUK A;  4GRK A;  3BKI B;  4PDH A;  1FBC A;  4BDR A;  1HSE A;  2QJE A;  2ESN A;  4IO3 A;  2QVU A;  5H8H B;  1PDA A;  4FBP A;  2Q9T A;  3NOH A;  4JBZ A;  3SET A;  4OVQ A;  4L17 A;  3G3F A;  1B3G A;  2UYF A;  1A8E A;  3FAS A;  4NF6 A;  3C34 A;  5EYF A;  2A5T A;  4U22 A;  1FBP A;  5AE4 A;  4E0W A;  1S9T A;  5I56 A;  2CZL A;  4IO4 A;  3G7W A;  3LSX A;  3CR9 A;  3C33 A;  1JW4 A;  4H6D A;  4I62 A;  4F3B A;  4O8M A;  3QSL A;  3TCH A;  3HCQ A;  1BTJ A;  4GX3 A;  3W15 C;  4H1X A;  2O51 A;  1NUX A;  1O7T A;  4OES A;  4N07 A;  4YB6 A;  1DK4 A;  1LLS A;  3G3I A;  5HPQ A;  4OYV A;  1NV6 A;  4H5F A;  1VDW A;  2YPN A;  4PDD A;  4FE8 A;  2UVJ A;  1FQB A;  4GOT A;  3S4U A;  1LAG E;  2OZZ A;  3GZG A;  1RYO A;  4I8C A;  4I9D A;  1M5C A;  2XXI A;  3IR1 A;  4X1B A;  1MQD A;  3MC2 A;  4OA4 A;  3N6T A;  2P0S A;  4P9K A;  3H4Z A;  4UAB A;  4LA9 A;  1VSO A;  4PET A;  3RT8 A;  5HM4 B;  4UA8 A;  4ZE9 A;  1PB9 A;  4DXU A;  2Y7K A;  2QVV A;  5TU0 A;  4EDP A;  3K6X A;  1LBY A;  1JW5 A;  4NF8 B;  4I1D A;  1ZBM A;  2Y7W A;  5EHM A;  2WX9 A;  1FPG A;  1FTO A;  3FXR A;  2H99 A;  4PC9 A;  4PAK A;  4N15 A;  3T22 A;  3C9H A;  1FPJ A;  3KN7 A;  5KCJ B;  4KYE A;  5H8F A;  4QFL A;  4PFR A;  1IEJ A;  3EQ1 A;  2I58 A;  3BFT A;  3OO9 A;  1FBF A;  1AMF A;  3ISP A;  4MIJ A;  2XX8 A;  2AL4 A;  5I5P A;  1GGG A;  3TUS A;  1XC1 A;  4NF0 A;  1AL3 A;  4G8M A;  4MLQ A;  5EQ7 A;  1AIV A;  2RC9 A;  4G8N A;  3MZB A;  5EQ9 A;  2E0S A;  2B65 A;  2HAV A;  2DE4 A;  3MVY A;  3B50 A;  1DBZ A;  1MDQ A;  5H8Q B;  1SYI A;  2XHD A;  1B1H A;  1MXX A;  2XWK A;  1VFE A;  4OEV A;  1ATG A;  4OXV A;  3KSX A;  3TZA A;  1VE4 A;  1UIU A;  2GRV A;  1B5J A;  1WDN A;  4O7M A;  3PV0 E;  3KJT A;  4OEU A;  5TPA A;  1A40 A;  1MS7 A;  3GBA A;  4LN5 A;  4FEC A;  1OVT A;  2F7A A;  3ZKK A;  3O29 A;  5A5X B;  1N76 A;  3BBR A;  3PMV A;  2Q8M A;  1USY E;  4NG7 A;  3OXN A;  2ZMB A;  2QVR A;  5CMC A;  1OQH A;  1OQG A;  4R74 A;  4RK2 A;  1RYX A;  3MYU A;  1MM6 A;  3PMX A;  4KYD A;  4F22 A;  2VGQ A;  1EZP A;  4PTK A;  3TMG A;  1HSJ A;  1O64 A;  2CEY A;  3IOR A;  1B3E A;  3G3K A;  1DMB A;  4U1O A;  2ABH A;  2QS3 A;  2Z8F A;  2DE3 A;  4JWO A;  2F34 A;  4YMA A;  4NED A;  1T0K A;  1YPN A;  2BJJ X;  4YIC A;  1FPE A;  1OIB A;  2GFE A;  1MQG A;  2O6A A;  4RJZ A;  2Y84 A;  2O7I A;  4H5G A;  2VOZ A;  2O69 A;  3S9E A;  4GLI A;  1LFI A;  4GWY A;  1TFA A;  4AS4 A;  1US5 A;  3MBP A;  4RK9 A;  2HZK A;  4LZ5 A;  3UP9 A;  4R2B A;  2DWJ A;  4IGT A;  3Q27 A;  5H8H A;  5ESY A;  3UGW A;  1B7Z A;  1D9V A;  3F11 A;  1DTG A;  3FV2 A;  1IME A;  2PFY A;  4GWS A;  2D3I A;  1N0T A;  4LQ5 A;  3KZG A;  3OO6 A;  5I2K A;  4OER A;  3KC1 A;  1N7W A;  4KFQ A;  1IMD A;  4Q30 B;  4NF6 B;  3LSL A;  3RT6 B;  2A5T B;  1H43 A;  4YKJ A;  4EUO A;  5I56 B;  3CIJ A;  2CZI A;  4U4X A;  3LSF B;  3MPL A;  1II5 A;  2R9J A;  5ICQ A;  1FBE A;  1DPE A;  5JK4 A;  3CSG A;  3KEI A;  4GL0 A;  3T9X B;  3OO7 A;  1TFD A;  2XWV A;  3CFZ A;  2V93 A;  2XA5 A;  1KA0 A;  1FQE A;  5I7I A;  3BFU A;  2DQV A;  1DCU A;  4U21 A;  1MQJ A;  1B2H A;  3L6G A;  5AA2 D;  4F3S A;  5EYG A;  3SEV A;  3OD7 A;  4YB7 A;  2RC8 A;  2FA7 A;  3M3L A;  3SER A;  3DEL B;  3QMF A;  1B40 A;  4LUB A;  4QFK A;  3C32 A;  2RCB A;  1UTB B;  4ESX A;  3VV5 A;  4XXU A;  1Y3N A;  2F6P A;  4AQ4 A;  4KPT A;  3DP6 A;  3QUJ A;  1VR5 A;  3S2V A;  3K6U A;  4X9T A;  1NUZ A;  3VXB A;  4PF6 A;  2I6E A;  3MPK A;  4R9G A;  4G77 A;  5KCJ A;  3IB1 A;  1JQF A;  4LQ2 A;  4WEP A;  1EZ9 A;  4R72 A;  3H03 A;  4OAN A;  2ONR A;  5K2X A;  5L9O A;  4BDO A;  1P1N A;  2O84 X;  2R8T A;  2DXR A;  1IMA A;  2XD3 A;  1NV4 A;  1FTK A;  5ITO A;  4HS7 A;  2I0C A;  4PBQ A;  4NQ8 A;  3OO8 A;  2DP8 A;  1CE2 A;  3RUM A;  1MY0 A;  4AS5 A;  2KQZ A;  5IAI A;  4EQB A;  5H8Q A;  1N84 A;  3TQW A;  3O6H A;  4NWD A;  4GWX A;  1LBZ A;  2RF1 A;  3SKP A;  4XKP A;  3S9L C;  4ZEF A;  5JEI A;  4P0I A;  3N6U A;  2QRY A;  4F29 A;  1SW1 A;  4PFT A;  1FRP A;  3DP4 A;  2CZH A;  3PPO A;  3RLF E;  3EHU A;  2WYK A;  1A54 A;  3A3C A;  3OSR A;  3U93 A;  5A5X A;  4RPO A;  4QRZ A;  3MUQ A;  3N94 A;  3KC0 A;  4JXI A;  2QL3 A;  3PTY A;  3Q29 A;  1XVX A;  3KN3 A;  1MXW A;  2Q2C A;  5DTB A;  3M8U A;  4G61 A;  1RKM A;  4XEQ A;  3QXM A;  1EH3 A;  1LCT A;  4PFW A;  3IOU A;  1FPL A;  3E13 X;  1YCJ A;  4YKK A;  4G8H A;  2I0B A;  5TP9 A;  2OWS A;  2NXO A;  1MXU A;  2O7U A;  2DVZ A;  2XWO A;  3FBP A;  2QS4 A;  2RIN A;  4P3L A;  3MJN A;  2B3F A;  4GXA A;  1A55 A;  3G3G A;  3N26 A;  1GVC A;  2WBD A;  4QHQ A;  2DWA A;  3KOS A;  4DCX A;  4RYA A;  1N04 A;  5DVJ A;  5IKB A;  2THI A;  3PMW A;  2V3U A;  5H8S A;  2HHM A;  2FNC A;  4H65 A;  5L9S A;  4PFI A;  1SBP A;  1LFG A;  4KHZ E;  1B46 A;  4O94 A;  2LAO A;  4F2Q A;  1RDZ A;  2WBB A;  4TOZ A;  2PVU A;  1DTZ A;  5AA1 A;  1B58 A;  1AH5 A;  3H3G A;  2PX1 A;  1P1Q A;  1SD3 A;  4DIG A;  1R6Z A;  1FQD A;  3PPN A;  1JW1 A;  1IXH A;  2PCR A;  4OVP A;  1SQY A;  1Q1K A;  1POT A;  3E78 A;  1P1O A;  4P11 A;  1B1X A;  5I84 A;  3FXQ A;  2XX9 A;  1NNK A;  3FIR A;  5ITP A;  5ET8 A;  4FAJ A;  3O2A A;  1INP A;  4FAT A;  1MH4 A;  3B6Q A;  2Z23 A;  2F6G A;  4N4U A;  1PB8 A;  3T1B A;  3ODB A;  3C4M A;  1Q35 A;  4N81 A;  3MVW A;  1IIT A;  3KGC A;  3C31 A;  5I2K B;  1D4N A;  3PGF A;  3V5A A;  2IA4 A;  2OLB A;  1FQA A;  2I49 A;  1TWY A;  3DLN A;  3TCG A;  3W9W A;  1PBP A;  4O7I A;  4C1T A;  4R6H A;  2JJK A;  3ILT B;  1NI9 A;  3SEW A;  3R26 A;  1LB9 A;  2Z8E A;  3SZP A;  2Z8D A;  4MMP A;  3CG1 A;  1Y1M A;  2I4C A;  1B7H A;  3MP8 A;  1FPF A;  4OET A;  1NMU A;  1URD A;  3R7X A;  4HCW A;  2M8C A;  3IO4 A;  2ZNS A;  1UTB A;  4E0X A;  4IO2 A;  3G3J A;  3PUX E;  4FED A;  5CBS A;  3PU5 A;  5ELV A;  1YXI A;  3RPL A;  2P2A A;  2XXR A;  1URG A;  2RKM A;  2GH9 A;  2REJ A;  1Z7N E;  3HN0 A;  3LBS A;  3ILU B;  3A3U A;  3I3V A;  1B4Z A;  2H9B A;  4HE1 A;  5BUU A;  4NAP A;  2XXT A;  3LSW A;  1NV2 A;  3T9H B;  4ZEC A;  4HE0 A;  1P1W A;  4X48 A;  4OVS A;  4I3Y A;  2Q89 A;  3IJO B;  1PB7 A;  1Y20 A;  2CZK A;  5T3J A;  2HPG A;  3HHG A;  3MP6 A;  3O9P A;  1B32 A;  4ZED A;  3Q28 A;  2Q74 A;  3U72 A;  3EPE A;  3QAX A;  1Y4C A;  3TTL A;  2HQ0 A;  3CSB A;  1NNF A;  1JVY A;  2QS2 A;  1MQH A;  1QGX A;  1JET A;  4ZEI A;  1MY4 A;  2ZYO A;  3VE1 B;  3U94 A;  5DVF A;  1SI1 A;  3VFJ A;  3AXF A;  4JSO A;  4MBP A;  5CRY A;  3T0J A;  1M5D A;  4HXV A;  5J16 A;  4JVC A;  2DYX A;  5IZ3 A;  5I57 A;  1TT1 A;  4N6K A;  4NE4 A;  2YLN A;  4OVR A;  1BIY A;  4N17 A;  1ZKB A;  2XXX A;  3SES A;  4TQU Q;  5J1D A;  2PBW A;  4XKQ A;  1LAF E;  3WAE A;  4F19 A;  4NX1 A;  4JVD A;  4XTC Q;  4NTL A;  3TOD A;  4GF8 A;  2P1S A;  2F8D A;  2BJI A;  3HO7 A;  3RQT A;  4DE8 A;  4OMB A;  4EXK A;  2X7P A;  4MNI A;  3BIH A;  5FBP A;  3DP8 A;  1RDX A;  3UN6 A;  4ELP A;  2OK2 A;  1IMC A;  1FTJ A;  2UYE A;  3CFL A;  2CEX A;  5AA2 B;  5TP9 B;  3PD8 A;  2RCA A;  1O63 A;  1Y3Q A;  3IJX B;  3MVZ A;  3FVK A;  1YYZ A;  4Q8R A;  3VLU A;  3I5O A;  1MPC A;  2DE2 A;  2HCA A;  4PE3 A;  1MDP 1;  4YKI A;  2W7Y A;  1XS5 A;  4PFY A;  2V4C A;  1NV3 A;  4M1V A;  2PYY A;  4P8B A;  2DXY A;  3FJG A;  3UIF A;  1GR2 A;  2Y7P A;  2OX3 A;  2X7Q A;  2H4I A;  3CRB A;  4R2F A;  4PFU A;  4GWW A;  4OQO A;  3M3K A;  2YJP A;  1R9L A;  1FTA A;  1B3F A;  4AB5 A;  4QFN A;  1IZ1 A;  1LEV A;  3O6G A;  2UXA A;  1NV0 A;  2HAU A;  1SYH A;  3OEM A;  4U4S A;  5CMB A;  3H6V A;  1DSN A;  1XHY A;  1IXC A;  1OLA A;  4JWX A;  2QFL A;  1VFD A;  4NF5 B;  2DSF A;  3RGY A;  1UTH A;  5EHS A;  4ELQ A;  3MAM A;  1CB6 A;  2PT1 A;  4BLA A;  1LFH A;  2H5Y A;  3FXB A;  1OLC A;  4EF1 A;  5LOM A;  3FZV A;  1SI0 A;  2FBP A;  4GD5 A;  4WED A;  2NWJ A;  1ZIU A;  1TXF A;  1SPI A;  4N6D A;  2F35 A;  2XXH A;  4H8I A;  3QYT A;  2XXW A;  4IO7 A;  4DDD A;  3PD9 A;  4RPN A;  1B5H A;  4DCY A;  3T9V A;  5I59 A;  1YAE A;  3PPQ A;  1NNT A;  4LP2 B;  1GTK A;  4O3C A;  5B7D A;  4F31 B;  4YAH X;  1MXZ A;  2GQ1 A;  2HEU A;  3TTK A;  1LAH E;  3B6T A;  4OZ9 A;  3RPL B;  1L5T A;  1PC3 A;  4BDQ A;  3RY3 A;  1G0H A;  4OHN A;  4MNP A;  3K1M A;  3VVD A;  2DWI A;  4QFP A;  1D3K A;  4N8G A;  3TQL A;  2HXW A;  4MCO A;  1SW4 A;  1FCK A;  1MH3 A;  3PUV E;  3EF7 A;  1MQI A;  4EF2 A;  4IO5 A;  1FQF A;  4ELO A;  3GYY A;  3V89 B;  3H06 B;  3GLB A;  1K9Y A;  4GWU A;  1USY H;  3ROJ A;  4KCD A;  2Q8J A;  4H8J A;  5IZ1 A;  3PPR A;  4GL8 A;  4LON B;  4F3G A;  2ZYK A;  2HZL A;  2WKY A;  4PQJ A;  1D9Y A;  2VP1 A;  4TLM B;  3K1P A;  2DVC A;  3PPP A;  3JZJ A;  4N8Y A;  1YTV A;  4QF9 A;  2FVZ A;  1N3X A;  1XVY A;  1A8F A;  5KDT A;  1LCF A;  1JVX A;  1DPP A;  2V25 A;  4DI4 B;  1NV7 A;  4NWC A;  3LUY A;  4GWO A;  5IM2 A;  1B5I A;  4YB5 A;  1QJM A;  4IY5 A;  3ZS6 A;  4KQP A;  1MM7 A;  2PFZ A;  3T93 B;  3CI8 A;  3PUZ E;  2OCU A;  2O1M A;  5FTI A;  4IR8 A;  2H25 A;  5IZ3 B;  3FJ7 A;  5I57 B;  3UOR A;  3MW0 A;  3H6U A;  4R75 A;  5M2V A;  1PBQ A;  2F7C A;  4MLV A;  1Q9D A;  2ANJ A;  1NFT A;  1B51 A;  3PUY E;  1NH8 A;  4G4P A;  1S7Y A;  4MFI A;  4RA1 A;  3C35 A;  3O28 A;  4BDL A;  2KLF A;  4GX4 A;  1QKA A;  5F1Q A;  2REG A;  3LUZ A;  4H46 A;  2WEF A;  1FTM A;  3LC8 A;  4R6Y A;  1I6Q A;  5BWJ A;  1UIV A;  1B52 A;  4G68 C;  2NOO A;  3EKI A;  2O1L A;  1FQC A;  5FHN A;  4QBA A;  3IB2 A;  1NKX A;  5AA2 A;  3U1O A;  1N7X A;  4U1Z A;  3HHF A;  3IAZ A;  1EYI A;  1LBX A;  1KA1 A;  2IEE A;  4PAF A;  1XT8 A;  3BIG A;  1LST A;  1MPB A;  4JWY A;  4X1D A;  3ONM A;  1MY1 A;  3RNN A;  1S50 A;  3IOV A;  2QMX A;  1B3L A;  4IGR A;  2GHA A;  2ZNT A;  2VT5 A;  2ALU A;  4XKR A;  1Z7M E;  4OFO A;  3EHT A;  2ZYM A;  4QSC A;  2ZZV A;  3H7M A;  3K2D A;  2G29 A;  4F2O A;  4G68 A;  4IY6 A;  4ZDM A;  1NL5 A;  3D4G A;  4POW A;  1QUJ A;  4NGU A;  2AIX A;  2P3N A;  5ICT A;  2VD2 A;  3QUF A;  1J1N A;  1EYJ A;  5KZT A;  3KBZ A;  2ZZW A;  1LBB A;  3B7D A;  1IMB A;  4MX6 A;  4DZ1 A;  3S9M C;  3M3F A;  3KN8 A;  5IGA A;  3W9V A;  1LAX A;  2F97 A;  2D21 A;  3VXC A;  4NF5 A;  4DLD A;  4OFJ A;  1LGB C;  4MNC A;  5EQ8 A;  1FW0 A;  1CNQ A;  1OMP A;  2F3D A;  3THI A;  2OBG A;  3OOA A;  5AA3 A;  4YMB A;  1H45 A;  4KCC A;  1AWB A;  1UTH B;  4ECF A;  3O66 A;  1QUL A;  2CMO A;  4PBH A;  4MF3 A;  2FHY A;  1I6B A;  2AYS A;  4JVI A;  2Y5K A;  1MY3 A;  4I40 A;  4FOR A;  3FV1 A;  3JV9 A;  3VLW A;  3USD A;  2ZXT A;  2ZYN A;  2ONS A;  3TCF A;  3TYH A;  4FIM A;  4EQ7 A;  1SDX A;  2NUV A;  4Q5T A;  3RTF B;  5A5L A;  5AA4 A;  4KD5 A;  4U2R A;  4DXB A;  3MZ9 A;  3SEY A;  2R71 A;  3Q26 A;  4IO6 A;  2XD2 A;  1QUI A;  1ANF A;  5H8N A;  1Y4T A;  1R1N A;  4PF8 A;  3SEX A;  5DEX B;  3R6U A;  4XFE A;  2P3V A;  4R6K A;  5I59 B;  4KR5 A;  3E4R A;  3TDJ A; 
#chains in the Genus database with same CATH homology
 4KI0 E;  3V83 A;  3T9U A;  1R9Q A;  4IB2 A;  4ELR A;  1QKB A;  4TLL B;  3TFL A;  3H6W A;  2GHB A;  3UK4 A;  2RC7 A;  3KOT A;  4POX A;  4BDN A;  2I3V A;  3IOT A;  1H3D A;  5DT6 A;  4ONY A;  3FGS A;  5FHO A;  3FVN A;  1BKA A;  3VVE A;  2OWT A;  3FJM A;  2F78 A;  1US4 A;  4ISU A;  1WOD A;  2X26 A;  3O6I A;  3PUW E;  4YKP A;  2A5S A;  1UQW A;  4ESW A;  4U23 A;  2XXP A;  4F39 A;  2ONK E;  4N13 A;  4OTE A;  1B9J A;  1MPD A;  3FUZ A;  4UAC A;  3T66 A;  1MRP A;  4KYS A;  2H98 A;  3FVG A;  2FYI A;  3IX1 A;  5HBC A;  3U8Q A;  5KDT B;  1ZTY A;  4O3A A;  3OEL A;  4NMY A;  5JTY B;  3K01 A;  1IXG A;  5DYH A;  1M5E A;  1OVB A;  4OWD A;  4ZZA A;  3FVO A;  4OEN A;  3JYR A;  4LAT A;  5K2Y A;  5B70 A;  1EZO A;  5CMK A;  4GIZ A;  3CFX A;  4OVJ A;  1EU8 A;  5FTH A;  1MG1 A;  4Z7E A;  3T96 B;  2Q88 A;  2UVH A;  2I3W A;  2F5X A;  1POY 1;  2UVG A;  1P1U A;  4ZE8 A;  1ZMG A;  2Z22 A;  2QPQ A;  3MWB A;  3C36 A;  3E9X A;  1Y3P A;  4O3B A;  4K3F A;  1BP5 A;  1SVX B;  1B0L A;  4QSE A;  4ZEK A;  3A09 A;  4PP0 A;  3B6W A;  3HPI A;  4F18 A;  1H76 A;  3ECR A;  3MQ9 A;  2F7B A;  3KBR A;  2I4B A;  1ELJ A;  3OSQ A;  1MXY A;  4EQ9 A;  1DOT A;  1MXV A;  3KJ7 A;  4C0R A;  3IK6 B;  5I58 A;  4G68 B;  2R6G E;  3VDF A;  3SEU A;  1JEV A;  2F36 A;  1SW2 A;  1M5F A;  3G3H A;  4G2Z A;  1WVJ A;  4JB7 A;  3L6H A;  4C1U A;  1NNP A;  3TKD A;  3S9N C;  2UVI A;  2PT2 A;  2V3Q A;  4HTG A;  4PE5 B;  5I2N B;  3TEL A;  2I48 A;  3EN3 A;  4LZ7 A;  2VD3 A;  4NF4 B;  4JSD A;  4F3P A;  4M4G A;  2XXY A;  3EHS A;  4QFO A;  4RY1 A;  1AOV A;  3O97 A;  5DVI A;  4F1U A;  1KWH A;  1ZU0 A;  2QSX A;  1SW5 A;  4ND9 A;  2QMW A;  3CG3 A;  1IXI A;  4LZ8 A;  3RPW A;  3RN8 A;  3U92 A;  5F7V A;  3KSJ A;  2V84 A;  5FHM A;  3TAJ A;  4HCY A;  1GV8 A;  3IB0 A;  1NH7 A;  2XXQ A;  3IL1 B;  3IO6 A;  5DEX A;  4GXS B;  3MVX A;  5AA4 B;  5CC2 A;  4Q0C A;  5ISU A;  5H8N B;  4ZEB A;  3TTN A;  3HV1 A;  3E3K A;  5L8D A;  4XIG Q;  4WKM A;  4R73 A;  2Y7I A;  3I6V A;  1H44 A;  4ZZE A;  3V8X B;  4THI A;  5CBR A;  3OEN A;  2XXU A;  4MH5 A;  3QK6 A;  1LBC A;  2DS9 A;  2O68 A;  4NF8 A;  4XKN A;  1QW0 A;  3MP1 A;  1P99 A;  1B6H A;  1Y1Z A;  2XX7 A;  3QIM A;  3MZ1 A;  4QSD A;  4H67 A;  3IOW A;  1IIW A;  2OJT A;  3K1N A;  4YZZ A;  5CI5 A;  4AB6 A;  1A99 A;  2D5W A;  3GBB A;  4FJP A;  4JDF A;  4P0G A;  4LVQ A;  4HW8 A;  1PEB A;  4DXC A;  5H8F B;  4EXL A;  5JTY A;  1B7U A;  3GXA A;  1F9B A;  3K0V A;  3H6T A;  1IUD A;  1M5B A;  3K00 A;  4N6P A;  4WXJ A;  2VHA A;  2B3B A;  4FEB A;  4OFL A;  1B3H A;  3VLV A;  2NVU B;  5L9M A;  3KFM A;  3FD3 A;  1XOC A;  1JEU A;  2XXV A;  3K6W A;  4GQO A;  1JNF A;  3VVF A;  2DOJ A;  2Q2A A;  1I6A A;  1B4H A;  4BDM A;  4F1Y A;  4YU0 A;  1LB8 A;  3ZKL A;  3OMB A;  2QS1 A;  2E1S A;  2DWH A;  3D4C A;  3LR1 A;  3SDF A;  3TTM A;  2ZNU A;  1B05 A;  3K4U A;  1BLF A;  5TPA B;  2HFB A;  3CVG A;  4RXL A;  1I69 A;  3TPA A;  3Q25 A;  1QVS A;  3FAT A;  3K02 A;  4RNS A;  1Y9U A;  1B0H A;  2PMS A;  4ZS9 A;  1MY2 A;  2G93 A;  3RTW B;  3UA8 A;  3TEP A;  1URS A;  4GVO A;  3K6V A;  2Y7R A;  3FXU A;  2AL5 A;  3KG2 A;  5CMM A;  1N3W A;  3OEK A;  3DM0 A;  3ZSF A;  4F1V A;  5I58 B;  1FTL A;  1ZJL A;  3TTR A;  3P7I A;  2V3T A;  5I2N A;  1ZLQ A;  4Z0I A;  1HSL A;  4GFR A;  3HST A;  5CM6 A;  4R9F A;  1A7L A;  1IQ7 A;  4NF4 A;  4H0W A;  3N5L A;  3WAF A;  1QUK A;  4GRK A;  3BKI B;  4BDR A;  1HSE A;  2QJE A;  2ESN A;  4IO3 A;  5H8H B;  1PDA A;  2Q9T A;  4JBZ A;  3SET A;  4L17 A;  3G3F A;  1B3G A;  2UYF A;  1A8E A;  3FAS A;  4NF6 A;  3C34 A;  5EYF A;  2A5T A;  4U22 A;  5AE4 A;  4E0W A;  1S9T A;  5I56 A;  2CZL A;  4IO4 A;  3G7W A;  3LSX A;  3CR9 A;  3C33 A;  1JW4 A;  4H6D A;  4I62 A;  4F3B A;  3QSL A;  3TCH A;  3HCQ A;  1BTJ A;  3W15 C;  4H1X A;  2O51 A;  1O7T A;  4OES A;  4N07 A;  4YB6 A;  1LLS A;  3G3I A;  5HPQ A;  4OYV A;  4H5F A;  2YPN A;  4FE8 A;  2UVJ A;  1FQB A;  4GOT A;  3S4U A;  1LAG E;  2OZZ A;  3GZG A;  1RYO A;  4I8C A;  4I9D A;  1M5C A;  2XXI A;  3IR1 A;  4X1B A;  1MQD A;  3MC2 A;  3N6T A;  2P0S A;  3H4Z A;  4LA9 A;  1VSO A;  4PET A;  3RT8 A;  5HM4 B;  4UA8 A;  4ZE9 A;  1PB9 A;  4DXU A;  2Y7K A;  5TU0 A;  4EDP A;  3K6X A;  1JW5 A;  4NF8 B;  4I1D A;  1ZBM A;  2Y7W A;  5EHM A;  1FTO A;  3FXR A;  2H99 A;  3T22 A;  3C9H A;  3KN7 A;  5KCJ B;  4KYE A;  5H8F A;  4QFL A;  1IEJ A;  3EQ1 A;  2I58 A;  3BFT A;  3OO9 A;  1AMF A;  2XX8 A;  2AL4 A;  1GGG A;  3TUS A;  1XC1 A;  1AL3 A;  4G8M A;  4MLQ A;  1AIV A;  2RC9 A;  4G8N A;  3MZB A;  2E0S A;  2B65 A;  2HAV A;  2DE4 A;  3MVY A;  5H8Q B;  1MDQ A;  1SYI A;  2XHD A;  1B1H A;  1MXX A;  1VFE A;  4OEV A;  1ATG A;  4OXV A;  3KSX A;  3TZA A;  1VE4 A;  1UIU A;  2GRV A;  1B5J A;  1WDN A;  3PV0 E;  3KJT A;  4OEU A;  5TPA A;  1A40 A;  1MS7 A;  3GBA A;  4FEC A;  1OVT A;  2F7A A;  3ZKK A;  3O29 A;  5A5X B;  1N76 A;  3BBR A;  3PMV A;  1USY E;  3OXN A;  2ZMB A;  5CMC A;  1OQH A;  1OQG A;  4R74 A;  4RK2 A;  1RYX A;  1MM6 A;  3PMX A;  4KYD A;  4F22 A;  2VGQ A;  1EZP A;  3TMG A;  1HSJ A;  1O64 A;  3IOR A;  1B3E A;  3G3K A;  1DMB A;  4U1O A;  2ABH A;  2QS3 A;  2Z8F A;  2DE3 A;  4JWO A;  2F34 A;  4YMA A;  4NED A;  1T0K A;  1YPN A;  2BJJ X;  4YIC A;  1OIB A;  2GFE A;  1MQG A;  2O6A A;  4RJZ A;  2Y84 A;  2O7I A;  4H5G A;  2VOZ A;  2O69 A;  3S9E A;  4GLI A;  1LFI A;  1TFA A;  1US5 A;  3MBP A;  4RK9 A;  2HZK A;  4LZ5 A;  3UP9 A;  4R2B A;  2DWJ A;  4IGT A;  3Q27 A;  5H8H A;  3UGW A;  1B7Z A;  1D9V A;  3F11 A;  1DTG A;  3FV2 A;  2D3I A;  1N0T A;  4LQ5 A;  3KZG A;  3OO6 A;  5I2K A;  4OER A;  1N7W A;  4KFQ A;  4Q30 B;  4NF6 B;  3LSL A;  3RT6 B;  2A5T B;  1H43 A;  4YKJ A;  4EUO A;  5I56 B;  3CIJ A;  4U4X A;  3LSF B;  3MPL A;  1II5 A;  2R9J A;  5ICQ A;  1DPE A;  5JK4 A;  3CSG A;  3KEI A;  4GL0 A;  3T9X B;  3OO7 A;  1TFD A;  3CFZ A;  2V93 A;  1FQE A;  3BFU A;  2DQV A;  4U21 A;  1MQJ A;  1B2H A;  3L6G A;  5AA2 D;  4F3S A;  3SEV A;  3OD7 A;  4YB7 A;  2RC8 A;  2FA7 A;  3M3L A;  3SER A;  3DEL B;  1B40 A;  4LUB A;  4QFK A;  3C32 A;  2RCB A;  1UTB B;  4ESX A;  3VV5 A;  4XXU A;  1Y3N A;  2F6P A;  4AQ4 A;  4KPT A;  3DP6 A;  3QUJ A;  1VR5 A;  3S2V A;  3K6U A;  4X9T A;  3VXB A;  2I6E A;  3MPK A;  4R9G A;  4G77 A;  5KCJ A;  3IB1 A;  1JQF A;  4LQ2 A;  4WEP A;  1EZ9 A;  4R72 A;  3H03 A;  2ONR A;  5K2X A;  5L9O A;  4BDO A;  1P1N A;  2O84 X;  2DXR A;  2XD3 A;  1FTK A;  5ITO A;  4HS7 A;  2I0C A;  3OO8 A;  2DP8 A;  1CE2 A;  3RUM A;  1MY0 A;  5IAI A;  4EQB A;  5H8Q A;  1N84 A;  3TQW A;  3O6H A;  4NWD A;  2RF1 A;  3SKP A;  4XKP A;  3S9L C;  4ZEF A;  5JEI A;  4P0I A;  3N6U A;  2QRY A;  4F29 A;  1SW1 A;  4PFT A;  3DP4 A;  3PPO A;  3RLF E;  3EHU A;  1A54 A;  3A3C A;  3OSR A;  3U93 A;  5A5X A;  4RPO A;  4QRZ A;  3MUQ A;  3N94 A;  4JXI A;  2QL3 A;  3Q29 A;  1XVX A;  3KN3 A;  1MXW A;  2Q2C A;  5DTB A;  3M8U A;  1RKM A;  3QXM A;  1EH3 A;  1LCT A;  4PFW A;  3IOU A;  3E13 X;  1YCJ A;  4YKK A;  4G8H A;  2I0B A;  5TP9 A;  2OWS A;  2NXO A;  1MXU A;  2O7U A;  2DVZ A;  2QS4 A;  2RIN A;  3MJN A;  2B3F A;  4GXA A;  1A55 A;  3G3G A;  3N26 A;  1GVC A;  4QHQ A;  2DWA A;  3KOS A;  4DCX A;  4RYA A;  1N04 A;  5DVJ A;  5IKB A;  2THI A;  3PMW A;  2V3U A;  5H8S A;  2FNC A;  4H65 A;  5L9S A;  1SBP A;  1LFG A;  4KHZ E;  1B46 A;  2LAO A;  4F2Q A;  4TOZ A;  2PVU A;  1DTZ A;  5AA1 A;  1B58 A;  1AH5 A;  3H3G A;  2PX1 A;  1P1Q A;  1SD3 A;  4DIG A;  1R6Z A;  1FQD A;  3PPN A;  1JW1 A;  1IXH A;  1SQY A;  1Q1K A;  1POT A;  1P1O A;  4P11 A;  1B1X A;  5I84 A;  3FXQ A;  2XX9 A;  1NNK A;  3FIR A;  5ITP A;  4FAJ A;  3O2A A;  4FAT A;  1MH4 A;  3B6Q A;  2Z23 A;  2F6G A;  1PB8 A;  3ODB A;  3C4M A;  1Q35 A;  3MVW A;  1IIT A;  3KGC A;  3C31 A;  5I2K B;  1D4N A;  3PGF A;  3V5A A;  2IA4 A;  2OLB A;  1FQA A;  2I49 A;  1TWY A;  3DLN A;  3TCG A;  3W9W A;  1PBP A;  4C1T A;  4R6H A;  3ILT B;  3SEW A;  3R26 A;  1LB9 A;  2Z8E A;  2Z8D A;  3CG1 A;  1Y1M A;  2I4C A;  1B7H A;  3MP8 A;  4OET A;  1NMU A;  1URD A;  3R7X A;  4HCW A;  2M8C A;  3IO4 A;  2ZNS A;  1UTB A;  4E0X A;  4IO2 A;  3G3J A;  3PUX E;  4FED A;  5CBS A;  3PU5 A;  5ELV A;  2P2A A;  2XXR A;  1URG A;  2RKM A;  2GH9 A;  2REJ A;  1Z7N E;  3HN0 A;  3LBS A;  3ILU B;  3A3U A;  3I3V A;  1B4Z A;  2H9B A;  5BUU A;  2XXT A;  3LSW A;  3T9H B;  4ZEC A;  1P1W A;  4X48 A;  2Q89 A;  3IJO B;  1PB7 A;  1Y20 A;  3HHG A;  3MP6 A;  3O9P A;  1B32 A;  4ZED A;  3Q28 A;  3U72 A;  3EPE A;  3QAX A;  1Y4C A;  3TTL A;  2HQ0 A;  3CSB A;  1NNF A;  1JVY A;  2QS2 A;  1MQH A;  1JET A;  4ZEI A;  1MY4 A;  2ZYO A;  3VE1 B;  3U94 A;  5DVF A;  1SI1 A;  3VFJ A;  3AXF A;  4JSO A;  4MBP A;  5CRY A;  1M5D A;  2DYX A;  5I57 A;  1TT1 A;  4NE4 A;  2YLN A;  1BIY A;  1ZKB A;  2XXX A;  3SES A;  4TQU Q;  5J1D A;  2PBW A;  4XKQ A;  1LAF E;  3WAE A;  4F19 A;  4XTC Q;  4NTL A;  3TOD A;  4GF8 A;  2P1S A;  2F8D A;  3HO7 A;  3RQT A;  4DE8 A;  4OMB A;  4EXK A;  2X7P A;  3DP8 A;  3UN6 A;  4ELP A;  2OK2 A;  1FTJ A;  2UYE A;  3CFL A;  5AA2 B;  5TP9 B;  3PD8 A;  2RCA A;  1O63 A;  1Y3Q A;  3IJX B;  3MVZ A;  3FVK A;  4Q8R A;  3VLU A;  3I5O A;  1MPC A;  2DE2 A;  2HCA A;  1MDP 1;  4YKI A;  2W7Y A;  1XS5 A;  4PFY A;  4M1V A;  2PYY A;  2DXY A;  3FJG A;  3UIF A;  1GR2 A;  2Y7P A;  2X7Q A;  2H4I A;  3CRB A;  4R2F A;  4PFU A;  4OQO A;  3M3K A;  2YJP A;  1R9L A;  1B3F A;  4AB5 A;  4QFN A;  1IZ1 A;  3O6G A;  2UXA A;  2HAU A;  1SYH A;  3OEM A;  4U4S A;  5CMB A;  3H6V A;  1DSN A;  1XHY A;  1IXC A;  1OLA A;  4JWX A;  1VFD A;  4NF5 B;  2DSF A;  3RGY A;  1UTH A;  5EHS A;  4ELQ A;  3MAM A;  1CB6 A;  2PT1 A;  4BLA A;  1LFH A;  2H5Y A;  1OLC A;  4EF1 A;  5LOM A;  3FZV A;  1SI0 A;  4GD5 A;  4WED A;  2NWJ A;  1ZIU A;  1TXF A;  2F35 A;  2XXH A;  4H8I A;  3QYT A;  2XXW A;  4IO7 A;  4DDD A;  3PD9 A;  4RPN A;  1B5H A;  4DCY A;  3T9V A;  5I59 A;  1YAE A;  3PPQ A;  1NNT A;  4LP2 B;  1GTK A;  4O3C A;  5B7D A;  4F31 B;  4YAH X;  1MXZ A;  2HEU A;  3TTK A;  1LAH E;  3B6T A;  4OZ9 A;  1L5T A;  1PC3 A;  4BDQ A;  3RY3 A;  4OHN A;  3K1M A;  3VVD A;  2DWI A;  4QFP A;  1D3K A;  3TQL A;  2HXW A;  1SW4 A;  1FCK A;  1MH3 A;  3PUV E;  3EF7 A;  1MQI A;  4EF2 A;  4IO5 A;  1FQF A;  4ELO A;  3V89 B;  3H06 B;  3GLB A;  1USY H;  4KCD A;  2Q8J A;  4H8J A;  3PPR A;  4GL8 A;  4LON B;  4F3G A;  2ZYK A;  2HZL A;  2WKY A;  4PQJ A;  1D9Y A;  2VP1 A;  4TLM B;  3K1P A;  2DVC A;  3PPP A;  3JZJ A;  1YTV A;  4QF9 A;  1N3X A;  1XVY A;  1A8F A;  5KDT A;  1LCF A;  1JVX A;  1DPP A;  2V25 A;  4NWC A;  3LUY A;  4GWO A;  1B5I A;  4YB5 A;  1QJM A;  4IY5 A;  3ZS6 A;  4KQP A;  1MM7 A;  3T93 B;  3CI8 A;  3PUZ E;  2OCU A;  2O1M A;  5FTI A;  2H25 A;  3FJ7 A;  5I57 B;  3UOR A;  3MW0 A;  3H6U A;  4R75 A;  5M2V A;  1PBQ A;  2F7C A;  4MLV A;  2ANJ A;  1NFT A;  1B51 A;  3PUY E;  1NH8 A;  4G4P A;  1S7Y A;  4MFI A;  4RA1 A;  3C35 A;  3O28 A;  4BDL A;  2KLF A;  1QKA A;  5F1Q A;  2REG A;  1FTM A;  3LC8 A;  4R6Y A;  1I6Q A;  5BWJ A;  1UIV A;  1B52 A;  4G68 C;  2NOO A;  2O1L A;  1FQC A;  5FHN A;  3IB2 A;  1NKX A;  5AA2 A;  3U1O A;  1N7X A;  4U1Z A;  3HHF A;  3IAZ A;  2IEE A;  1XT8 A;  1LST A;  1MPB A;  4JWY A;  4X1D A;  3ONM A;  1MY1 A;  3RNN A;  1S50 A;  3IOV A;  2QMX A;  1B3L A;  4IGR A;  2GHA A;  2ZNT A;  2ALU A;  4XKR A;  1Z7M E;  4OFO A;  3EHT A;  2ZYM A;  4QSC A;  3H7M A;  3K2D A;  2G29 A;  4F2O A;  4G68 A;  4IY6 A;  4ZDM A;  1NL5 A;  3D4G A;  4POW A;  1QUJ A;  2AIX A;  5ICT A;  2VD2 A;  3QUF A;  1J1N A;  5KZT A;  1LBB A;  3B7D A;  4DZ1 A;  3S9M C;  3M3F A;  3KN8 A;  3W9V A;  1LAX A;  2F97 A;  2D21 A;  3VXC A;  4NF5 A;  4DLD A;  4OFJ A;  1LGB C;  1FW0 A;  1OMP A;  3THI A;  2OBG A;  3OOA A;  5AA3 A;  4YMB A;  1H45 A;  4KCC A;  1UTH B;  4ECF A;  3O66 A;  1QUL A;  2CMO A;  4MF3 A;  1I6B A;  2AYS A;  1MY3 A;  4FOR A;  3FV1 A;  3JV9 A;  3VLW A;  3USD A;  2ZXT A;  2ZYN A;  2ONS A;  3TCF A;  3TYH A;  4FIM A;  4EQ7 A;  1SDX A;  2NUV A;  4Q5T A;  3RTF B;  5AA4 A;  4KD5 A;  4U2R A;  4DXB A;  3MZ9 A;  3SEY A;  2R71 A;  3Q26 A;  4IO6 A;  2XD2 A;  1QUI A;  1ANF A;  5H8N A;  1Y4T A;  1R1N A;  3SEX A;  5DEX B;  3R6U A;  4R6K A;  5I59 B;  4KR5 A;  3E4R A;  3TDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...