1WDNA

Glutamine-binding protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
223
structure length
223
Chain Sequence
KLVVATDTAFVPFEFKQGDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINE BINDING PROTEIN
publication title The structure of glutamine-binding protein complexed with glutamine at 1.94 A resolution: comparisons with other amino acid binding proteins.
pubmed doi rcsb
molecule tags Complex (binding protein/peptide)
total genus 74
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 1997-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1wdnA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1wdnA01
3TCGA 4F39A 1FQBA 2Q2CA 4PFWA 2I48A 4OZ9A 1ZMGA 3S9MC 2B3FA 3SDFA 4C0RA 4IO3A 3KJ7A 3O66A 2Q9TA 2DXYA 4GL0A 5H8HA 2F5XA 3N94A 2LAOA 2NUVA 2HCAA 5L9SA 2PT1A 3FVOA 5HBCA 1USYE 1B1XA 1QVSA 2AL5A 2P0SA 4YB7A 4OFLA 3H6TA 3KN8A 3G3KA 3RPWA 4HW8A 1HSEA 4FJPA 1FW0A 2UVGA 3E9XA 3TUSA 5H8HB 1EZPA 3IR1A 4QFPA 2O7UA 2X7QA 2VOZA 5EYFA 2XD2A 5DT6A 3G3HA 5DVFA 1Q1KA 1FTKA 4OFOA 3TCHA 3PU5A 2BJJX 4L17A 5KDTA 4G4PA 3BFTA 3MP1A 4FEDA 3B6TA 4ESWA 1SVXB 3OD7A 5EHSA 2DWJA 3N26A 2CMOA 1IXGA 1H44A 1FQDA 2XXPA 2DYXA 3D4GA 1XOCA 1QULA 3M3LA 1FTLA 1LCFA 4GF8A 5KDTB 3M3KA 3PUWE 3O28A 3Q26A 2DE3A 2ZNSA 3TYHA 4FEBA 4IO5A 2D21A 3R6UA 1SW2A 1NFTA 5ITOA 1PB8A 2GHBA 4DE8A 1T0KA 2XX9A 3CSBA 5AA4A 4RNSA 3G3IA 3IL1B 3SEVA 5I2KA 3PUXE 2R71A 1DPEA 4KD5A 2ALUA 1MXUA 1TXFA 2Z22A 3S9NC 1ZJLA 5IKBA 1URGA 3C31A 5AA4B 2QSXA 5H8FA 3KZGA 5I2KB 3I5OA 3C9HA 1ZIUA 1MH4A 1JQFA 2QRYA 5I58A 2OWTA 5FHMA 2ZMBA 1UIVA 1M5EA 2Z8DA 3SEWA 5H8FB 1M5CA 1LFHA 5CM6A 2H99A 3SETA 3KJTA 3VLVA 5I58B 3K01A 2P2AA 1N0TA 5HM4B 1J1NA 3MP6A 4F3GA 3IX1A 4DXBA 1PEBA 1Y1MA 3IO4A 4LATA 3A3UA 1SYIA 4WEPA 4TQUQ 3CSGA 2O68A 4LZ8A 1LGBC 1ZTYA 1Y1ZA 3MPKA 4O3CA 3PMXA 1HSJA 4DCXA 1NNPA 3RTFB 2DS9A 2HZLA 4UACA 2KLFA 4OETA 3K6VA 4POWA 1QUIA 4FATA 2I0CA 2CZLA 4OYVA 5AE4A 4NMYA 4IO2A 4R9GA 1S50A 4PP0A 4ZECA 3SEUA 4PE5B 3K6WA 4UA8A 3OXNA 2V3TA 1QKBA 4MH5A 1IXCA 3UGWA 3MVWA 1IEJA 3C35A 2REJA 1Y4CA 1MY0A 3RY3A 2H9BA 2NVUB 3SESA 2P1SA 3OSQA 4JSDA 1Z7NE 3PGFA 2HAVA 3PD9A 2NXOA 5B70A 2XXVA 4F31B 1B5IA 4ZEFA 1MQIA 3P7IA 1LFGA 1GV8A 4C1UA 1P1OA 4R74A 3HHFA 4H67A 5I2NA 1B3LA 2PX1A 2RC9A 4F29A 4POXA 4KPTA 5H8QA 2ZNTA 3T93B 3IOUA 4H8IA 5H8NA 3RLFE 3EHSA 4N07A 4U4XA 1O64A 1A55A 5I2NB 1AMFA 1LCTA 3KG2A 3MC2A 3OMBA 2VD3A 5M2VA 4XXUA 4F19A 3TTRA 5H8QB 4ESXA 4O3BA 2DWHA 5CMCA 5H8NB 4YB5A 1D9YA 1NMUA 3LSLA 3N5LA 5DTBA 3C36A 3EQ1A 1UQWA 5F1QA 1LAXA 1B9JA 3G3FA 1LAHE 2H5YA 4IGTA 4OXVA 3VV5A 3LC8A 3CG1A 4ELRA 4RY1A 3C33A 1SW4A 3K6XA 4EDPA 4I1DA 1B7HA 3HV1A 4U1OA 4NF8A 3H6VA 1R9LA 3THIA 2I49A 5CBRA 3ECRA 2GHAA 2XXUA 3V5AA 1FQAA 4TLLB 3TQWA 3R26A 2FYIA 3ONMA 4F1VA 3FVKA 4FECA 1GVCA 4F1YA 2HQ0A 3QUFA 4MLQA 1Y3PA 4NF8B 3BKIB 3OEKA 1LBBA 1B3GA 1USYH 3MW0A 2H98A 2QJEA 2X7PA 2QS4A 4U21A 5I57A 2Y7PA 2OCUA 1IZ1A 3SEYA 1LFIA 4OVJA 3PMWA 1TWYA 1B3EA 3TDJA 3K1NA 1PBQA 3K1MA 1JNFA 1LB8A 4OENA 3I6VA 4PETA 3K00A 3HSTA 5I57B 4LQ2A 4YMAA 4EQ9A 3GBBA 3CRBA 3FATA 4IO6A 2UYFA 3TKDA 3G3GA 4ZEKA 4BLAA 3QYTA 4I9DA 4LZ7A 1R9QA 1N84A 5AA3A 1EH3A 4U4SA 2W7YA 1H3DA 3K1PA 4KFQA 1JW1A 1NKXA 1I6BA 2B65A 4KYEA 2B3BA 4KCDA 4RYAA 5CRYA 4ZE9A 1NL5A 1A8FA 2DQVA 5FHOA 4RA1A 1Q35A 2I3VA 4AB5A 5LOMA 4GXSB 4YU0A 3CG3A 1GGGA 4ECFA 1A54A 5AA1A 1LSTA 2V3UA 4IB2A 2DWIA 1B3FA 4ZEDA 2QMWA 3KOSA 1DPPA 1O7TA 4H6DA 1IXIA 3DM0A 3FVNA 2RF1A 2Z23A 4XIGQ 5EHMA 3U94A 3UORA 1XVXA 3U1OA 3U92A 3MQ9A 4Q8RA 1ZLQA 1NNKA 3IK6B 4YAHX 3WAFA 3ILUB 3IOWA 2GH9A 4X1BA 1A7LA 2OK2A 2ZYOA 1NH8A 4EQBA 3FV2A 2ZYKA 4IY5A 2Y7RA 1B5JA 3OEMA 1ELJA 4YKJA 3N6UA 2QS3A 1LAGE 2ANJA 1OLAA 2H4IA 1IUDA 1UTBA 1B6HA 3OSRA 3KSXA 5I59A 4YICA 4PFTA 4PFUA 2GFEA 1LB9A 2V25A 3QAXA 2UVHA 3MPLA 2O7IA 3VLUA 3FGSA 1SI1A 1OQGA 5FHNA 4U1ZA 3FVGA 5BWJA 3ZKKA 1Y4TA 1UTBB 5I59B 2OWSA 4P11A 3TTKA 4YKIA 3Q28A 1N04A 2NOOA 2VP1A 4LQ5A 1B5HA 3Q25A 3ZKLA 1UTHA 4EXKA 1MDP1 3R7XA 4NWCA 1MPCA 3KOTA 3IORA 2F7CA 4G2ZA 1PB9A 1IXHA 3Q27A 4RPOA 3JV9A 4Q0CA 3K4UA 3E3KA 2Y7KA 2F78A 1N3XA 1RYOA 3FIRA 4JWXA 3K0VA 2UYEA 3PPRA 2XXIA 4I8CA 1WODA 3VVDA 3UN6A 3H03A 1MPDA 1UTHB 4O3AA 1FTOA 1EZOA 4FAJA 1OVBA 4KQPA 1FCKA 4GL8A 5KCJA 1XVYA 3A09A 3PV0E 4ELQA 5I84A 5K2YA 5I56A 5DYHA 2E1SA 1MXXA 4QSCA 5CC2A 4Z0IA 3B6WA 3LR1A 4RXLA 1R6ZA 4TOZA 3MAMA 3RT8A 1IIWA 2Z8EA 2XXQA 1IITA 5KCJB 1BTJA 5CMMA 3KBRA 4F3BA 2V93A 2XXYA 5I56B 2PT2A 3JYRA 1S9TA 3RNNA 4YMBA 1H76A 2WKYA 1Y20A 1Y3NA 4YB6A 3SEXA 3KEIA 2I4CA 1N7XA 3S2VA 3T96B 1MQJA 1DTGA 3CFXA 1B40A 3OOAA 1VSOA 3SKPA 3LBSA 5ISUA 3JZJA 1US5A 1P1UA 3DP8A 4ISUA 1Y9UA 1XC1A 4DZ1A 1POTA 1HSLA 1MXZA 2ZYMA 4F3SA 3S9LC 1WVJA 2Z8FA 3PPNA 2XXRA 4RJZA 1URSA 3QUJA 1B0HA 1NH7A 3MZ1A 3T22A 3TPAA 4HCWA 5ELVA 2FA7A 4N13A 3K6UA 1O63A 2F34A 1M5DA 4F1UA 4G8MA 2O51A 4PQJA 2F97A 4Z7EA 3HHGA 4C1TA 3VLWA 4LP2B 5AA2A 4QFLA 3HN0A 3MVYA 4E0WA 1AOVA 1PB7A 3RN8A 1B4ZA 1M5BA 4BDQA 4NTLA 3MP8A 3MWBA 1FQCA 2QS1A 1MG1A 2RCAA 1LAFE 2RINA 3W15C 1SBPA 1D4NA 1MS7A 3TEPA 1M5FA 4G68C 1B52A 4X48A 3FZVA 4H5GA 3B7DA 1BLFA 1QW0A 1MDQA 5AA2B 4P0IA 3H3GA 3C4MA 3IB1A 3L6GA 2O1MA 2THIA 3W9VA 1UIUA 4E0XA 2XD3A 4DIGA 2NWJA 3MVZA 3PMVA 4XKRA 4ND9A 4NF4A 2ONKE 4HS7A 3OO7A 4LUBA 2DVZA 4AQ4A 4ONYA 4ZEBA 1MQHA 4QFOA 4GXAA 2AYSA 1CE2A 4GLIA 2R6GE 1P1NA 1B0LA 2I6EA 1ZBMA 4LVQA 3USDA 2Q2AA 4ZZAA 1MQGA 3PD8A 1VFDA 4EUOA 1EU8A 1AL3A 3IB2A 2F7AA 3TODA 2PBWA 4FIMA 2XXXA 4QF9A 2R9JA 3DLNA 4NF6A 4R73A 4GFRA 4JWYA 4QRZA 4ZS9A 3KN7A 1TFDA 1ATGA 4WKMA 1JW5A 4HCYA 4MBPA 1A40A 1SDXA 3BBRA 3PUZE 1YPNA 1YCJA 1QUJA 1AH5A 4X9TA 2OZZA 3VXBA 1XT8A 4JSOA 1JVXA 1YTVA 2Y7IA 1F9BA 4OESA 1P99A 4NF6B 3TAJA 3VXCA 3T9XB 3OO8A 3MBPA 1DOTA 2XX7A 4F2OA 2I58A 3CFZA 1N7WA 1EZ9A 2Q8JA 1JVYA 4M1VA 3TTLA 3LSWA 4OMBA 5HPQA 1A99A 1IQ7A 2ZYNA 2YPNA 2XXTA 2M8CA 3E13X 4XTCQ 3GLBA 3ZSFA 5TU0A 4X1DA 4P0GA 2A5TA 3KGCA 4ZE8A 3UA8A 4OEUA 3VVFA 1WDNA 2I4BA 5DVIA 4ELPA 2UXAA 4YZZA 4ZZEA 4QHQA 4ZDMA 2D5WA 2AIXA 4QFNA 3TTMA 3G7WA 2A5TB 3EHUA 2Q88A 4R75A 4R9FA 1Y3QA 5TP9A 1VE4A 1NNTA 3U93A 3H4ZA 4ZEIA 1PC3A 4QFKA 3O6GA 3U8QA 4I62A 2F8DA 1I6AA 1GR2A 3OELA 2HAUA 1POY1 3GXAA 4K3FA 3FV1A 3PUYE 5BUUA 4Q5TA 5TP9B 3HCQA 3RQTA 2QL3A 3T66A 3QK6A 3RGYA 1MPBA 3MZBA 1JW4A 5L8DA 4FE8A 2ONSA 2Y7WA 1MY1A 1TT1A 5ITPA 4EF2A 4F22A 4XKNA 2YJPA 3T9VA 4BDMA 2ESNA 5DVJA 5J1DA 4N6PA 3TQLA 4HTGA 2OBGA 1QUKA 3EN3A 1OIBA 3OENA 4H0WA 2DWAA 2DVCA 4XKQA 1DMBA 3EPEA 2IA4A 4R6YA 3VDFA 2O6AA 5FTIA 1MXWA 3IAZA 4WEDA 3TFLA 4IO4A 4H5FA 4R2BA 4GD5A 1MXVA 3H7MA 5JTYA 4MLVA 4PFYA 4LONB 4R6HA 1A8EA 3O97A 1MM6A 5A5XA 3KFMA 1DSNA 1SW1A 2RC7A 1JEVA 2OJTA 1FQFA 1XHYA 2Q89A 4KHZE 1B2HA 4MFIA 2ZXTA 1VFEA 2DE2A 3T9UA 4Q30B 4BDLA 4THIA 5JTYB 5TPAA 1L5TA 2V84A 3OO9A 1MY2A 5A5XB 1YAEA 3M3FA 4OFJA 2YLNA 4DXUA 1TFAA 4EXLA 5IAIA 4LZ5A 2I3WA 3FD3A 2DSFA 1LLSA 3RT6B 4NE4A 3E4RA 4OTEA 1US4A 5CBSA 1PDAA 2QPQA 5TPAB 1MH3A 3O29A 1BKAA 2AL4A 3IJOB 1B51A 2ABHA 3RUMA 4GOTA 3DP6A 3MUQA 2O1LA 3Q29A 4ELOA 2PMSA 3OO6A 3V89B 4JWOA 2O84X 1VR5A 2DXRA 3H06B 4NF5A 2E0SA 1FTMA 3H6UA 3S9EA 4DXCA 5B7DA 3M8UA 2XXWA 4KR5A 3LSXA 4IO7A 3TELA 3VE1B 1MXYA 4NWDA 3UP9A 4G68A 1OVTA 3IO6A 3FXUA 2F6PA 4R2FA 1QJMA 3CIJA 4NF5B 4JB7A 1DTZA 1H43A 1XS5A 4KYDA 1B58A 1FQEA 3QIMA 2VHAA 4KCCA 1B05A 2UVIA 4U23A 3WAEA 4G68B 5ICTA 4F3PA 2D3IA 5L9OA 3F11A 3O2AA 4YKKA 3ILTB 3PPQA 3K2DA 4DLDA 4GWOA 2XHDA 3PUVE 3TTNA 1BIYA 4OQOA 4MF3A 3QXMA 3L6HA 3V83A 2UVJA 1D9VA 3ODBA 4IGRA 4OEVA 5JK4A 1SD3A 4GRKA 2VGQA 4M4GA 4QSDA 1Z7ME 2HFBA 2IEEA 1SQYA 2VD2A 5DEXA 1JETA 4F18A 1N3WA 2X26A 4U2RA 2FNCA 3VFJA 1URDA 4EF1A 1SI0A 1MRPA 2F36A 4H1XA 2V3QA 3MJNA 2PVUA 2H25A 3I3VA 1B3HA 3IB0A 4OERA 4YKPA 3FXQA 3KSJA 4KI0E 3SERA 5DEXB 4F2QA 2RC8A 2RCBA 1MM7A 2RKMA 3MZ9A 1P1QA 2ZNUA 3W9WA 3VVEA 4H8JA 4KYSA 2QS2A 1P1WA 5CMBA 3H6WA 5FTHA 1AIVA 3UK4A 3IJXB 4U22A 1MY3A 3CFLA 2OLBA 2A5SA 4LA9A 4OHNA 4JDFA 1B46A 1ANFA 1FTJA 3PPOA 4R72A 1R1NA 3EHTA 3B6QA 3S4UA 3KN3A 1JEUA 4IY6A 4GQOA 3TCFA 5K2XA 2XXHA 2XX8A 2HZKA 5JEIA 3QSLA 1N76A 2HXWA 4EQ7A 1LBCA 3BFUA 2O69A 1B7ZA 5KZTA 2F6GA 1OQHA 3MVXA 1B1HA 5AA2D 5L9MA 1MY4A 3FXRA 4BDNA 3FJMA 5CMKA 4JBZA 1OMPA 3IOTA 2DP8A 2G93A 4NF4B 4TLMB 5ICQA 1I6QA 4DCYA 1MQDA 1QKAA 5F7VA 4JXIA 4GVOA 1NNFA 3CI8A 1ZKBA 4NEDA 2Y84A 4GIZA 4R6KA 4RPNA 3T9HB 3FUZA 2GRVA 4OWDA 4FORA 2F35A 3PPPA 3CR9A 3TMGA 3RTWB 2G29A 2QMXA 1II5A 1B4HA 3DP4A 3IOVA 1B7UA 3G3JA 3N6TA 3O6HA 3GZGA 4G77A 2ONRA 1KWHA 4H65A 2HEUA 4BDOA 3C34A 1CB6A 1RKMA 3LSFB 1D3KA 3O6IA 3EF7A 1SYHA 5CI5A 1ZU0A 3D4CA 4RK9A 1RYXA 4G8NA 3V8XB 1I69A 3GBAA 1OLCA 3FJ7A 3TZAA 3FJGA 1BP5A 3C32A 2I0BA 1PBPA 1SW5A 3A3CA 1S7YA 3K02A 1H45A 3CVGA 3U72A 3LUYA 4XKPA 3HO7A 4G8HA 4QSEA 4WXJA 2REGA 4RK2A 3HPIA 4DDDA 4AB6A 2F7BA 2DOJA 3DELB 3FASA 4BDRA 3O9PA 3ZS6A 1GTKA 3UIFA 1B32A 2DE4A 2PYYA 3AXFA 5H8SA
chains in the Genus database with same CATH superfamily
3TCGA 4F39A 1FQBA 2Q2CA 4PFWA 2I48A 2OX3A 5ET8A 4OZ9A 1BK4A 1ZMGA 3S9MC 2B3FA 3SDFA 4DI4B 4C0RA 5IZZA 4IO3A 3KJ7A 3O66A 2Q9TA 1YYZA 2FBPA 2DXYA 4GL0A 5H8HA 2F5XA 3N94A 2LAOA 2NUVA 2HCAA 5L9SA 2PT1A 3FVOA 1LBYA 5HBCA 1USYE 1B1XA 4PGNA 1QVSA 2AL5A 2P0SA 4YB7A 4OFLA 4N15A 1LBWA 3H6TA 3KN8A 1FPJA 3G3KA 3RPWA 4I40A 4NQ8A 4HW8A 1HSEA 4FJPA 1FW0A 2UVGA 5IM2A 3E9XA 3TUSA 5H8HB 1EZPA 3IR1A 4QFPA 2O7UA 4GBVA 2X7QA 2VOZA 5EYFA 2Y5KA 2XD2A 5DT6A 3G3HA 5DVFA 1Q1KA 2WBBA 1FTKA 4OFOA 3TCHA 3PU5A 2KQZA 3BIHA 1FRPA 2BJJX 4L17A 4HE1A 5KDTA 4G4PA 3BFTA 3MP1A 4FEDA 3B6TA 4ESWA 1SVXB 3OD7A 5EHSA 2DWJA 3N26A 2CMOA 2CEXA 1IXGA 1H44A 1FQDA 2XXPA 4JVDA 2DYXA 3D4GA 1JP4A 1XOCA 1QULA 3M3LA 1FTLA 1LCFA 4GF8A 5EQ8A 5KDTB 3M3KA 3PUWE 3O28A 3Q26A 1FPGA 2DE3A 2ZNSA 3TYHA 4FEBA 2OWZA 2CEYA 3HFUA 4IO5A 2D21A 2GQ1A 3R6UA 1SW2A 1NFTA 4N81A 5ITOA 1PB8A 2GHBA 4DE8A 1T0KA 4N4UA 1IMBA 2XX9A 3CSBA 5AA4A 4RNSA 3G3IA 3IL1B 3SEVA 5I2KA 3PUXE 2R71A 1DPEA 4NGUA 4KD5A 2ALUA 1MXUA 1TXFA 2QVUA 4HXVA 2Z22A 3S9NC 1NV1A 1ZJLA 5IKBA 1URGA 3C31A 5AA4B 2QSXA 5ET6A 5H8FA 3KZGA 1KZ8A 5I2KB 3I5OA 3C9HA 4N6KA 1ZIUA 1MH4A 1JQFA 2QRYA 3KBZA 5I58A 2OWTA 2XXKA 5FHMA 1D9QA 2ZMBA 1UIVA 3PTYA 1M5EA 4QXDA 2Z8DA 3SEWA 5IZ1A 5H8FB 1M5CA 1LFHA 1RDZA 4XFEA 5CM6A 2H99A 2WYKA 3SETA 2F3DA 3KJTA 3VLVA 5I58B 3K01A 2P2AA 1N0TA 3NOHA 5HM4B 1J1NA 3MP6A 4F3GA 3IX1A 4DXBA 1PEBA 4AS5A 1Y1MA 3IO4A 2CZIA 4LATA 3A3UA 1SYIA 4WEPA 4TQUQ 4N8GA 3CSGA 5EQAA 2O68A 4LZ8A 1LGBC 4FBPA 1ZTYA 1Y1ZA 3MPKA 4O3CA 3PMXA 1HSJA 4DCXA 2R8TA 1NNPA 3RTFB 3T1BA 2DS9A 2HZLA 4UACA 2KLFA 4OETA 3K6VA 4POWA 1DK4A 1QUIA 4FATA 1FSAA 4GX6A 2I0CA 2CZLA 4OYVA 2FIXA 5AE4A 4NMYA 4IO2A 4R9GA 1S50A 4PP0A 4ZECA 3SEUA 2P3NA 4PE5B 3K6WA 4UA8A 1EYJA 3OXNA 2V3TA 1QKBA 1K9YA 4GWWA 4MH5A 1IXCA 3UGWA 3MVWA 1IEJA 1FPDA 3C35A 2REJA 3MSTA 1Y4CA 5T3JA 1MY0A 3RY3A 2H9BA 2NVUB 3SESA 2P1SA 3OSQA 4JSDA 1Z7NE 3GYYA 3PGFA 2HAVA 3PD9A 2NXOA 5B70A 2XXVA 4F31B 1B5IA 4ZEFA 1MQIA 1XI6A 3D1RA 3P7IA 1LFGA 1GV8A 4MMPA 1P1OA 4C1UA 4R74A 1G0HA 3HHFA 4H67A 5I2NA 4PCDA 4P47A 1B3LA 2PX1A 2RC9A 4F29A 1LBVA 4POXA 4KPTA 5H8QA 2ZNTA 1LBXA 3T93B 3IOUA 4H8IA 5H8NA 3RLFE 3EHSA 4N07A 4U4XA 1O64A 1A55A 5I2NB 1AMFA 1LBZA 1LCTA 3KG2A 3MC2A 2PFZA 3OMBA 2VD3A 5M2VA 4XXUA 4F19A 3TTRA 5H8QB 4ESXA 4O3BA 2DWHA 5CMCA 5H8NB 4YB5A 1D9YA 1NMUA 3LSLA 3N5LA 5DTBA 3C36A 3EQ1A 4P8BA 1UQWA 5F1QA 1LAXA 1IMEA 1B9JA 3G3FA 1LAHE 2H5YA 4PAFA 4IGTA 4OXVA 3VV5A 3LC8A 3CG1A 4ELRA 4RY1A 3C33A 3KC1A 4PFRA 1SW4A 3K6XA 1CNQA 4EDPA 4I1DA 1B7HA 3HV1A 4U1OA 1EYKA 4NF8A 3H6VA 1R9LA 3THIA 2I49A 2VPNA 1IMDA 5CBRA 3ECRA 4H45A 2GHAA 2XXUA 3V5AA 1FQAA 3E78A 4TLLB 2Q8MA 3TQWA 2CZKA 3R26A 2FYIA 3ONMA 4F1VA 3FVKA 4FECA 1GVCA 4F1YA 2HQ0A 3QUFA 4MLQA 1NUXA 1Y3PA 4NF8B 3BKIB 3OEKA 1LBBA 1B3GA 1USYH 3MW0A 2H98A 2QJEA 1NV3A 2X7PA 2QS4A 4MIJA 4U21A 3E79A 5I57A 2Y7PA 1YZ0A 2OCUA 4MNIA 1IZ1A 3SEYA 1LFIA 4OVJA 4UABA 2QFLA 3PMWA 1TWYA 1B3EA 3TDJA 3K1NA 1PBQA 3K1MA 1JNFA 2XWVA 1LB8A 4OENA 3I6VA 4PETA 3K00A 3ISPA 4NX1A 2L5VA 3RYDA 3HSTA 5I57B 1KA1A 4LQ2A 4N8YA 4EQ9A 4YMAA 3GBBA 3CRBA 1FBDA 3FATA 4IO6A 2UYFA 3TKDA 3G3GA 4ZEKA 4P56A 3QYTA 4BLAA 4I9DA 5FBPA 4LZ7A 1R9QA 1N84A 5AA3A 4OANA 3EKIA 1EH3A 4U4SA 2W7YA 5A5LA 1H3DA 3K1PA 4KFQA 1JW1A 1NKXA 1I6BA 2B65A 4KYEA 2B3BA 4KCDA 4RYAA 1NV0A 5CRYA 4ZE9A 1NL5A 1A8FA 2DQVA 5FHOA 4RA1A 1Q35A 2I3VA 4AB5A 5LOMA 4GXSB 4YU0A 2KR0A 2MKZA 3CG3A 1GGGA 4ECFA 1A54A 5AA1A 1LSTA 2V3UA 4IB2A 2DWIA 1B3FA 4ZEDA 2QMWA 3KOSA 1DPPA 1O7TA 4H6DA 1IXIA 2FHYA 3DM0A 3FVNA 4X8RA 2RF1A 4P1LA 1IMAA 2Z23A 4XIGQ 5EHMA 3U94A 3UORA 1XVXA 3U1OA 3U92A 3MQ9A 2F3BA 4Q8RA 1ZLQA 1NNKA 3IK6B 4YAHX 3WAFA 3ILUB 3IOWA 2GH9A 4X1BA 1A7LA 2XA5A 2OK2A 2ZYOA 1NH8A 4EQBA 3FV2A 1FBHA 2ZYKA 4IY5A 2WBDA 2Y7RA 1B5JA 3OEMA 1ELJA 4YKJA 3N6UA 2QS3A 1LAGE 2V4CA 1NUYA 2ANJA 1OLAA 2H4IA 1IUDA 1UTBA 1B6HA 3OSRA 3KSXA 5I59A 4YICA 4PFTA 4PFUA 2GFEA 1LB9A 5I5PA 2V25A 3QAXA 2UVHA 4GWXA 3MPLA 2O7IA 3U65A 3VLUA 3FGSA 1SI1A 1OQGA 5FHNA 4U1ZA 3FVGA 5BWJA 3ZKKA 1Y4TA 1UTBB 5EYHA 5I59B 2OWSA 4P11A 3TTKA 4YKIA 3Q28A 4MNPA 1N04A 1YXIA 2NOOA 2VP1A 4LQ5A 1B5HA 3Q25A 2QVVA 3ZKLA 1UTHA 5EYGA 4EXKA 1MDP1 3R7XA 4NWCA 1MPCA 3KOTA 3IORA 2F7CA 4G2ZA 1PB9A 4PGPA 1IXHA 3Q27A 4RPOA 3JV9A 4Q0CA 3K4UA 3E3KA 1FPBA 2Y7KA 2F78A 1N3XA 1RYOA 3FIRA 4JWXA 3K0VA 2UYEA 3PPRA 2XXIA 4I8CA 1WODA 3VVDA 3UN6A 3H03A 1MPDA 1UTHB 4O3AA 1NV5A 1FTOA 1EZOA 4FAJA 1OVBA 4KQPA 1FCKA 4GL8A 5KCJA 1XVYA 3A09A 3PV0E 4ELQA 5I84A 5K2YA 1FJ6A 4GBWA 5I56A 5DYHA 2E1SA 3FBPA 1MXXA 4QSCA 5CC2A 4Z0IA 3B6WA 3LR1A 4RXLA 3KC0A 4KXPA 1R6ZA 4TOZA 3MAMA 3RT8A 1IIWA 2Z8EA 2XXQA 1IITA 2ZZXA 5KCJB 1BTJA 5CMMA 4NG7A 5F24A 3KBRA 4F3BA 2V93A 2XXYA 4AS4A 5I56B 2PT2A 3JYRA 2HHMA 1S9TA 3RNNA 4YMBA 1H76A 2WKYA 1Y20A 1Y3NA 4YB6A 3SEXA 3KEIA 3A29A 4N17A 4GX3A 2I4CA 2VT5A 1N7XA 3MYUA 3S2VA 3T96B 1MQJA 1DTGA 3CFXA 1B40A 3OOAA 1VSOA 3SKPA 3LBSA 5ISUA 3B8BA 3JZJA 4PE3A 1US5A 1P1UA 3DP8A 4ISUA 1Y9UA 1XC1A 4DZ1A 1POTA 1HSLA 1MXZA 2ZYMA 4F3SA 1RDYA 1WVJA 3S9LC 2Z8FA 3PPNA 2XXRA 4RJZA 1URSA 3QUJA 1B0HA 1NH7A 3MZ1A 3T22A 3TPAA 4HCWA 5ELVA 4IR8A 2FA7A 4GWSA 4N13A 1NUWA 3K6UA 1FBEA 1O63A 2F34A 1M5DA 4F1UA 4G8MA 2O51A 4PQJA 2F97A 4Z7EA 3HHGA 4C1TA 3VLWA 4LP2B 5AA2A 4QFLA 2PCRA 3HN0A 2WEFA 4PBHA 3MVYA 4E0WA 1AOVA 1PB7A 3RN8A 1B4ZA 1M5BA 4BDQA 4NTLA 3MP8A 3MWBA 1FQCA 2QS1A 1MG1A 2RCAA 1LAFE 1NV4A 2RINA 3W15C 1SBPA 1D4NA 1MS7A 3TEPA 1M5FA 4G68C 1B52A 4X48A 3FZVA 4H5GA 3B7DA 1BLFA 1QW0A 1MDQA 5AA2B 4P0IA 3H3GA 3C4MA 3IB1A 3L6GA 2O1MA 2THIA 4XF5A 3W9VA 1UIUA 4PFBA 4E0XA 1FPIA 2XD3A 4DIGA 2NWJA 3MVZA 1Q9DA 3PMVA 4XKRA 2Q74A 4ND9A 4NF4A 4DI3D 4NAPA 2ONKE 4HS7A 3OO7A 4LUBA 4MHFA 2DVZA 3IFCA 4AQ4A 4ONYA 4ZEBA 1MQHA 4QFOA 4GXAA 2AYSA 1CE2A 4GLIA 2R6GE 1P1NA 5I7IA 1FBFA 1B0LA 2I6EA 1ZBMA 4LVQA 3USDA 2Q2AA 4ZZAA 1LEVA 1MQGA 3PD8A 1VFDA 4EUOA 1EU8A 1AL3A 3IB2A 4HE2A 2F7AA 3TODA 2PBWA 4FIMA 2XXXA 1FBGA 4QF9A 4N91A 2R9JA 4H46A 3DLNA 4R73A 4NF6A 4GFRA 3FXBA 2WX9A 4JWYA 4O94A 4QRZA 4ZS9A 3KN7A 1TFDA 1ATGA 4WKMA 1JW5A 4HCYA 4MBPA 1A40A 1SDXA 3BBRA 3PUZE 5IGAA 1YPNA 1YCJA 1QUJA 1AH5A 4X9TA 2OZZA 4OVTA 3VXBA 1XT8A 4GWYA 4JSOA 1JVXA 1YTVA 2Y7IA 1F9BA 4OESA 1P99A 4NF6B 3TAJA 3VXCA 3T9XB 3OO8A 3MBPA 1DOTA 2PFYA 2XX7A 2I58A 4F2OA 3CFZA 1N7WA 1EZ9A 2Q8JA 1JVYA 4M1VA 3TTLA 3LSWA 4OMBA 5HPQA 1A99A 1IQ7A 2ZYNA 2YPNA 2XXTA 2M8CA 3E13X 4XTCQ 1NV7A 3GLBA 4I3EA 3ZSFA 3ROJA 5TU0A 4X1DA 4P0GA 2A5TA 3KGCA 4ZE8A 3UA8A 4OEUA 3VVFA 1WDNA 2I4BA 4NN3A 5DVIA 4ELPA 2BJIA 3CHGA 1AWBA 2UXAA 4YZZA 4ZZEA 1FTAA 4QHQA 2B4LA 5J16A 4ZDMA 4P9KA 1FBCA 2D5WA 2AIXA 4QFNA 3TTMA 3G7WA 2A5TB 3EHUA 5IZ3A 2Q88A 4R75A 4R9FA 1Y3QA 5TP9A 1VE4A 1NNTA 3U93A 3H4ZA 4ZEIA 1PC3A 4QFKA 3O6GA 3U8QA 4I62A 2HPGA 2XWKA 2F8DA 4P1EA 1I6AA 1GR2A 3OELA 2HAUA 1POY1 3GXAA 4K3FA 5IZ3B 3FV1A 3PUYE 4PTKA 5BUUA 4Q5TA 5TP9B 3HCQA 3RQTA 2QL3A 3T66A 3QK6A 3RGYA 1IMFA 1MPBA 3MZBA 1JW4A 5L8DA 4FE8A 2ONSA 2Y7WA 1MY1A 1TT1A 5ITPA 4PFIA 4EF2A 4XKNA 4F22A 2YJPA 3T9VA 4BDMA 2ESNA 5DVJA 5J1DA 4N6PA 3TQLA 4HTGA 3LUZA 2OBGA 1QUKA 3EN3A 1OIBA 4JVIA 3OENA 4H0WA 2DWAA 2DVCA 4XKQA 1DMBA 3EPEA 1K9ZA 2IA4A 5EQ9A 4R6YA 3VDFA 2O6AA 5FTIA 1MXWA 3IAZA 2WYPA 4WEDA 4MX6A 3TFLA 4IO4A 4H5FA 4R2BA 4GD5A 1MXVA 3H7MA 5JTYA 4MLVA 4PFYA 1NUZA 4LONB 4R6HA 1A8EA 3O97A 1MM6A 5A5XA 3KFMA 1DSNA 1SW1A 2RC7A 1JEVA 2OJTA 4OVPA 1FQFA 2VPOA 1XHYA 2Q89A 4KHZE 1NV6A 1B2HA 4MFIA 4OVRA 2ZXTA 1VFEA 2DE2A 3T9UA 4Q30B 4BDLA 4THIA 4MEVA 1IMCA 5JTYB 4QBAA 5TPAA 1L5TA 2V84A 3OO9A 1MY2A 5A5XB 1YAEA 3M3FA 4OFJA 2YLNA 4DXUA 1TFAA 4EXLA 5IAIA 4LZ5A 2I3WA 1FPFA 4NHBA 3FD3A 4G61A 2DSFA 1LLSA 3RT6B 4NE4A 3E4RA 4OTEA 4PDDA 1US4A 5CBSA 1PDAA 2QPQA 5TPAB 1MH3A 3O29A 1BKAA 2AL4A 2ZZWA 1NV2A 1RDXA 4XEQA 3IJOB 1B51A 2ABHA 4N6DA 3RUMA 4GOTA 3DP6A 3MUQA 4MCOA 4OVSA 2O1LA 3Q29A 4ELOA 2PMSA 3OO6A 3V89B 5ET5A 4JWOA 2O84X 1VR5A 2DXRA 3H06B 4NF5A 2E0SA 1FTMA 3H6UA 4MNCA 3BIGA 4DXCA 3S9EA 5B7DA 3M8UA 2XXWA 4KR5A 3LSXA 4IO7A 3TELA 3VE1B 1MXYA 4NWDA 3UP9A 4G68A 3B50A 4I3YA 1OVTA 3IO6A 3FXUA 2F6PA 4R2FA 5ET7A 1QJMA 3CIJA 4NF5B 4JB7A 1DTZA 1H43A 1XS5A 4KYDA 1B58A 1FQEA 3QIMA 2VHAA 4KCCA 1B05A 2UVIA 4U23A 3WAEA 4G68B 5ICTA 4F3PA 2D3IA 5L9OA 3F11A 3O2AA 4HE0A 3T0JA 2JJKA 4YKKA 3ILTB 3PPQA 3K2DA 4JVCA 4DLDA 4GWOA 1INPA 2XHDA 2Y5LA 3PUVE 2XWIA 3TTNA 1BIYA 4OQOA 4MF3A 3QXMA 3L6HA 1G0IA 4PDHA 3V83A 4PAIA 2UVJA 1D9VA 3ODBA 5DW8A 4IGRA 4OEVA 5JK4A 1SD3A 5ESYA 4GRKA 4O7IA 4GX4A 2QVRA 2VGQA 4P3LA 4M4GA 4QSDA 1Z7ME 2HFBA 1DCUA 2IEEA 5LTCA 1SQYA 2VD2A 5DEXA 1JETA 4F18A 1FPEA 5EQ7A 3QMFA 1N3WA 2X26A 4U2RA 2FNCA 3VFJA 1URDA 4EF1A 1SI0A 1MRPA 3LV0A 2F36A 4H1XA 2V3QA 3MJNA 2PVUA 2H25A 3I3VA 4PF6A 1B3HA 2FVZA 3IB0A 3SZPA 4OERA 4YKPA 3FXQA 3KSJA 4KI0E 3SERA 5DEXB 4F2QA 2RC8A 2RCBA 1MM7A 2RKMA 3MZ9A 2ZZVA 1P1QA 2ZNUA 3W9WA 3RPLA 3VVEA 4H8JA 4KYSA 2QS2A 1P1WA 5CMBA 3H6WA 4OA4A 4PF8A 5FTHA 1AIVA 2DDKA 5LDZA 3UK4A 3IJXB 4U22A 1MY3A 3CFLA 2OLBA 2A5SA 4LA9A 1VDWA 4OHNA 4JDFA 1B46A 1FPLA 4X04A 1ANFA 1FTJA 3PPOA 4R72A 1R1NA 3EHTA 3RPLB 3B6QA 4O7MA 3S4UA 3KN3A 1JEUA 4IY6A 4GQOA 3TCFA 1FPKA 2XXHA 5K2XA 2XX8A 2HZKA 5JEIA 3QSLA 1N76A 2HXWA 4EQ7A 1LBCA 3BFUA 4LN5A 2O69A 2XWOA 1B7ZA 5KZTA 2F6GA 1OQHA 3MVXA 1B1HA 5AA2D 5L9MA 1MY4A 3FXRA 4BDNA 3FJMA 5CMKA 4JBZA 1OMPA 3IOTA 2DP8A 2G93A 4NF4B 4TLMB 4MJOA 5ICQA 1I6QA 4DCYA 4PAKA 1MQDA 1QKAA 4OVQA 3IFAA 5F7VA 4JXIA 4GVOA 2HXRA 1NNFA 4PC9A 3CI8A 1ZKBA 4NEDA 2Y84A 4GIZA 4R6KA 4RPNA 3T9HB 3FUZA 1EYIA 2GRVA 4OWDA 4FORA 2F35A 3PPPA 3CR9A 3TMGA 3RTWB 1FBPA 2G29A 2QMXA 1II5A 2B4MA 1B4HA 3DP4A 3IOVA 4GWZA 1B7UA 3G3JA 3N6TA 3O6HA 3GZGA 4G77A 2ONRA 1KWHA 4H65A 2HEUA 4BDOA 3C34A 1CB6A 1RKMA 3LSFB 1D3KA 3O6IA 3EF7A 1SYHA 5CI5A 1ZU0A 3D4CA 4RK9A 1RYXA 4G8NA 3V8XB 1I69A 3GBAA 1OLCA 3FJ7A 3TZAA 4GWUA 1DBZA 2CZHA 4NF0A 3FJGA 1BP5A 5I3SA 3C32A 2I0BA 1PBPA 1SW5A 3A3CA 1S7YA 3K02A 1H45A 3CVGA 3U72A 1KA0A 3LUYA 4XKPA 3HO7A 4G8HA 2P3VA 4QSEA 1NI9A 4WXJA 2REGA 4RK2A 3HPIA 4DDDA 1SPIA 4AB6A 4MAGA 2FIEA 2F7BA 2DOJA 3DELB 3FASA 4BDRA 1QGXA 3O9PA 3ZS6A 1GTKA 3UIFA 1B32A 4PBQA 2DE4A 2PYYA 3AXFA 4O8MA 5H8SA 1FJ9A
chains in the Genus database with same CATH topology
3TCGA 4F39A 1FQBA 2Q2CA 4PFWA 2I48A 4OZ9A 1ZMGA 3S9MC 2B3FA 3SDFA 4C0RA 4IO3A 3KJ7A 3O66A 2Q9TA 2DXYA 4GL0A 5H8HA 2F5XA 3N94A 2LAOA 2NUVA 2HCAA 5L9SA 2PT1A 3FVOA 5HBCA 1USYE 1B1XA 1QVSA 2AL5A 2P0SA 4YB7A 4OFLA 3H6TA 3KN8A 3G3KA 3RPWA 4HW8A 1HSEA 4FJPA 1FW0A 2UVGA 3E9XA 3TUSA 5H8HB 1EZPA 3IR1A 4QFPA 2O7UA 2X7QA 2VOZA 5EYFA 2XD2A 5DT6A 3G3HA 5DVFA 1Q1KA 1FTKA 4OFOA 3TCHA 3PU5A 2BJJX 4L17A 5KDTA 4G4PA 3BFTA 3MP1A 4FEDA 3B6TA 4ESWA 1SVXB 3OD7A 5EHSA 2DWJA 3N26A 2CMOA 1IXGA 1H44A 1FQDA 2XXPA 2DYXA 3D4GA 1XOCA 1QULA 3M3LA 1FTLA 1LCFA 4GF8A 5KDTB 3M3KA 3PUWE 3O28A 3Q26A 2DE3A 2ZNSA 3TYHA 4FEBA 4IO5A 2D21A 3R6UA 1SW2A 1NFTA 5ITOA 1PB8A 2GHBA 4DE8A 1T0KA 2XX9A 3CSBA 5AA4A 4RNSA 3G3IA 3IL1B 3SEVA 5I2KA 3PUXE 2R71A 1DPEA 4KD5A 2ALUA 1MXUA 1TXFA 2Z22A 3S9NC 1ZJLA 5IKBA 1URGA 3C31A 5AA4B 2QSXA 5H8FA 3KZGA 5I2KB 3I5OA 3C9HA 1ZIUA 1MH4A 1JQFA 2QRYA 5I58A 2OWTA 5FHMA 2ZMBA 1UIVA 1M5EA 2Z8DA 3SEWA 5H8FB 1M5CA 1LFHA 5CM6A 2H99A 3SETA 3KJTA 3VLVA 5I58B 3K01A 2P2AA 1N0TA 5HM4B 1J1NA 3MP6A 4F3GA 3IX1A 4DXBA 1PEBA 1Y1MA 3IO4A 4LATA 3A3UA 1SYIA 4WEPA 4TQUQ 3CSGA 2O68A 4LZ8A 1LGBC 1ZTYA 1Y1ZA 3MPKA 4O3CA 3PMXA 1HSJA 4DCXA 1NNPA 3RTFB 2DS9A 2HZLA 4UACA 2KLFA 4OETA 3K6VA 4POWA 1QUIA 4FATA 2I0CA 2CZLA 4OYVA 5AE4A 4NMYA 4IO2A 4R9GA 1S50A 4PP0A 4ZECA 3SEUA 4PE5B 3K6WA 4UA8A 3OXNA 2V3TA 1QKBA 4MH5A 1IXCA 3UGWA 3MVWA 1IEJA 3C35A 2REJA 1Y4CA 1MY0A 3RY3A 2H9BA 2NVUB 3SESA 2P1SA 3OSQA 4JSDA 1Z7NE 3PGFA 2HAVA 3PD9A 2NXOA 5B70A 2XXVA 4F31B 1B5IA 4ZEFA 1MQIA 3P7IA 1LFGA 1GV8A 4C1UA 1P1OA 4R74A 3HHFA 4H67A 5I2NA 1B3LA 2PX1A 2RC9A 4F29A 4POXA 4KPTA 5H8QA 2ZNTA 3T93B 3IOUA 4H8IA 5H8NA 3RLFE 3EHSA 4N07A 4U4XA 1O64A 1A55A 5I2NB 1AMFA 1LCTA 3KG2A 3MC2A 3OMBA 2VD3A 5M2VA 4XXUA 4F19A 3TTRA 5H8QB 4ESXA 4O3BA 2DWHA 5CMCA 5H8NB 4YB5A 1D9YA 1NMUA 3LSLA 3N5LA 5DTBA 3C36A 3EQ1A 1UQWA 5F1QA 1LAXA 1B9JA 3G3FA 1LAHE 2H5YA 4IGTA 4OXVA 3VV5A 3LC8A 3CG1A 4ELRA 4RY1A 3C33A 1SW4A 3K6XA 4EDPA 4I1DA 1B7HA 3HV1A 4U1OA 4NF8A 3H6VA 1R9LA 3THIA 2I49A 5CBRA 3ECRA 2GHAA 2XXUA 3V5AA 1FQAA 4TLLB 3TQWA 3R26A 2FYIA 3ONMA 4F1VA 3FVKA 4FECA 1GVCA 4F1YA 2HQ0A 3QUFA 4MLQA 1Y3PA 4NF8B 3BKIB 3OEKA 1LBBA 1B3GA 1USYH 3MW0A 2H98A 2QJEA 2X7PA 2QS4A 4U21A 5I57A 2Y7PA 2OCUA 1IZ1A 3SEYA 1LFIA 4OVJA 3PMWA 1TWYA 1B3EA 3TDJA 3K1NA 1PBQA 3K1MA 1JNFA 1LB8A 4OENA 3I6VA 4PETA 3K00A 3HSTA 5I57B 4LQ2A 4YMAA 4EQ9A 3GBBA 3CRBA 3FATA 4IO6A 2UYFA 3TKDA 3G3GA 4ZEKA 4BLAA 3QYTA 4I9DA 4LZ7A 1R9QA 1N84A 5AA3A 1EH3A 4U4SA 2W7YA 1H3DA 3K1PA 4KFQA 1JW1A 1NKXA 1I6BA 2B65A 4KYEA 2B3BA 4KCDA 4RYAA 5CRYA 4ZE9A 1NL5A 1A8FA 2DQVA 5FHOA 4RA1A 1Q35A 2I3VA 4AB5A 5LOMA 4GXSB 4YU0A 3CG3A 1GGGA 4ECFA 1A54A 5AA1A 1LSTA 2V3UA 4IB2A 2DWIA 1B3FA 4ZEDA 2QMWA 3KOSA 1DPPA 1O7TA 4H6DA 1IXIA 3DM0A 3FVNA 2RF1A 2Z23A 4XIGQ 5EHMA 3U94A 3UORA 1XVXA 3U1OA 3U92A 3MQ9A 4Q8RA 1ZLQA 1NNKA 3IK6B 4YAHX 3WAFA 3ILUB 3IOWA 2GH9A 4X1BA 1A7LA 2OK2A 2ZYOA 1NH8A 4EQBA 3FV2A 2ZYKA 4IY5A 2Y7RA 1B5JA 3OEMA 1ELJA 4YKJA 3N6UA 2QS3A 1LAGE 2ANJA 1OLAA 2H4IA 1IUDA 1UTBA 1B6HA 3OSRA 3KSXA 5I59A 4YICA 4PFTA 4PFUA 2GFEA 1LB9A 2V25A 3QAXA 2UVHA 3MPLA 2O7IA 3VLUA 3FGSA 1SI1A 1OQGA 5FHNA 4U1ZA 3FVGA 5BWJA 3ZKKA 1Y4TA 1UTBB 5I59B 2OWSA 4P11A 3TTKA 4YKIA 3Q28A 1N04A 2NOOA 2VP1A 4LQ5A 1B5HA 3Q25A 3ZKLA 1UTHA 4EXKA 1MDP1 3R7XA 4NWCA 1MPCA 3KOTA 3IORA 2F7CA 4G2ZA 1PB9A 1IXHA 3Q27A 4RPOA 3JV9A 4Q0CA 3K4UA 3E3KA 2Y7KA 2F78A 1N3XA 1RYOA 3FIRA 4JWXA 3K0VA 2UYEA 3PPRA 2XXIA 4I8CA 1WODA 3VVDA 3UN6A 3H03A 1MPDA 1UTHB 4O3AA 1FTOA 1EZOA 4FAJA 1OVBA 4KQPA 1FCKA 4GL8A 5KCJA 1XVYA 3A09A 3PV0E 4ELQA 5I84A 5K2YA 5I56A 5DYHA 2E1SA 1MXXA 4QSCA 5CC2A 4Z0IA 3B6WA 3LR1A 4RXLA 1R6ZA 4TOZA 3MAMA 3RT8A 1IIWA 2Z8EA 2XXQA 1IITA 5KCJB 1BTJA 5CMMA 3KBRA 4F3BA 2V93A 2XXYA 5I56B 2PT2A 3JYRA 1S9TA 3RNNA 4YMBA 1H76A 2WKYA 1Y20A 1Y3NA 4YB6A 3SEXA 3KEIA 2I4CA 1N7XA 3S2VA 3T96B 1MQJA 1DTGA 3CFXA 1B40A 3OOAA 1VSOA 3SKPA 3LBSA 5ISUA 3JZJA 1US5A 1P1UA 3DP8A 4ISUA 1Y9UA 1XC1A 4DZ1A 1POTA 1HSLA 1MXZA 2ZYMA 4F3SA 3S9LC 1WVJA 2Z8FA 3PPNA 2XXRA 4RJZA 1URSA 3QUJA 1B0HA 1NH7A 3MZ1A 3T22A 3TPAA 4HCWA 5ELVA 2FA7A 4N13A 3K6UA 1O63A 2F34A 1M5DA 4F1UA 4G8MA 2O51A 4PQJA 2F97A 4Z7EA 3HHGA 4C1TA 3VLWA 4LP2B 5AA2A 4QFLA 3HN0A 3MVYA 4E0WA 1AOVA 1PB7A 3RN8A 1B4ZA 1M5BA 4BDQA 4NTLA 3MP8A 3MWBA 1FQCA 2QS1A 1MG1A 2RCAA 1LAFE 2RINA 3W15C 1SBPA 1D4NA 1MS7A 3TEPA 1M5FA 4G68C 1B52A 4X48A 3FZVA 4H5GA 3B7DA 1BLFA 1QW0A 1MDQA 5AA2B 4P0IA 3H3GA 3C4MA 3IB1A 3L6GA 2O1MA 2THIA 3W9VA 1UIUA 4E0XA 2XD3A 4DIGA 2NWJA 3MVZA 3PMVA 4XKRA 4ND9A 4NF4A 2ONKE 4HS7A 3OO7A 4LUBA 2DVZA 4AQ4A 4ONYA 4ZEBA 1MQHA 4QFOA 4GXAA 2AYSA 1CE2A 4GLIA 2R6GE 1P1NA 1B0LA 2I6EA 1ZBMA 4LVQA 3USDA 2Q2AA 4ZZAA 1MQGA 3PD8A 1VFDA 4EUOA 1EU8A 1AL3A 3IB2A 2F7AA 3TODA 2PBWA 4FIMA 2XXXA 4QF9A 2R9JA 3DLNA 4NF6A 4R73A 4GFRA 4JWYA 4QRZA 4ZS9A 3KN7A 1TFDA 1ATGA 4WKMA 1JW5A 4HCYA 4MBPA 1A40A 1SDXA 3BBRA 3PUZE 1YPNA 1YCJA 1QUJA 1AH5A 4X9TA 2OZZA 3VXBA 1XT8A 4JSOA 1JVXA 1YTVA 2Y7IA 1F9BA 4OESA 1P99A 4NF6B 3TAJA 3VXCA 3T9XB 3OO8A 3MBPA 1DOTA 2XX7A 4F2OA 2I58A 3CFZA 1N7WA 1EZ9A 2Q8JA 1JVYA 4M1VA 3TTLA 3LSWA 4OMBA 5HPQA 1A99A 1IQ7A 2ZYNA 2YPNA 2XXTA 2M8CA 3E13X 4XTCQ 3GLBA 3ZSFA 5TU0A 4X1DA 4P0GA 2A5TA 3KGCA 4ZE8A 3UA8A 4OEUA 3VVFA 1WDNA 2I4BA 5DVIA 4ELPA 2UXAA 4YZZA 4ZZEA 4QHQA 4ZDMA 2D5WA 2AIXA 4QFNA 3TTMA 3G7WA 2A5TB 3EHUA 2Q88A 4R75A 4R9FA 1Y3QA 5TP9A 1VE4A 1NNTA 3U93A 3H4ZA 4ZEIA 1PC3A 4QFKA 3O6GA 3U8QA 4I62A 2F8DA 1I6AA 1GR2A 3OELA 2HAUA 1POY1 3GXAA 4K3FA 3FV1A 3PUYE 5BUUA 4Q5TA 5TP9B 3HCQA 3RQTA 2QL3A 3T66A 3QK6A 3RGYA 1MPBA 3MZBA 1JW4A 5L8DA 4FE8A 2ONSA 2Y7WA 1MY1A 1TT1A 5ITPA 4EF2A 4F22A 4XKNA 2YJPA 3T9VA 4BDMA 2ESNA 5DVJA 5J1DA 4N6PA 3TQLA 4HTGA 2OBGA 1QUKA 3EN3A 1OIBA 3OENA 4H0WA 2DWAA 2DVCA 4XKQA 1DMBA 3EPEA 2IA4A 4R6YA 3VDFA 2O6AA 5FTIA 1MXWA 3IAZA 4WEDA 3TFLA 4IO4A 4H5FA 4R2BA 4GD5A 1MXVA 3H7MA 5JTYA 4MLVA 4PFYA 4LONB 4R6HA 1A8EA 3O97A 1MM6A 5A5XA 3KFMA 1DSNA 1SW1A 2RC7A 1JEVA 2OJTA 1FQFA 1XHYA 2Q89A 4KHZE 1B2HA 4MFIA 2ZXTA 1VFEA 2DE2A 3T9UA 4Q30B 4BDLA 4THIA 5JTYB 5TPAA 1L5TA 2V84A 3OO9A 1MY2A 5A5XB 1YAEA 3M3FA 4OFJA 2YLNA 4DXUA 1TFAA 4EXLA 5IAIA 4LZ5A 2I3WA 3FD3A 2DSFA 1LLSA 3RT6B 4NE4A 3E4RA 4OTEA 1US4A 5CBSA 1PDAA 2QPQA 5TPAB 1MH3A 3O29A 1BKAA 2AL4A 3IJOB 1B51A 2ABHA 3RUMA 4GOTA 3DP6A 3MUQA 2O1LA 3Q29A 4ELOA 2PMSA 3OO6A 3V89B 4JWOA 2O84X 1VR5A 2DXRA 3H06B 4NF5A 2E0SA 1FTMA 3H6UA 3S9EA 4DXCA 5B7DA 3M8UA 2XXWA 4KR5A 3LSXA 4IO7A 3TELA 3VE1B 1MXYA 4NWDA 3UP9A 4G68A 1OVTA 3IO6A 3FXUA 2F6PA 4R2FA 1QJMA 3CIJA 4NF5B 4JB7A 1DTZA 1H43A 1XS5A 4KYDA 1B58A 1FQEA 3QIMA 2VHAA 4KCCA 1B05A 2UVIA 4U23A 3WAEA 4G68B 5ICTA 4F3PA 2D3IA 5L9OA 3F11A 3O2AA 4YKKA 3ILTB 3PPQA 3K2DA 4DLDA 4GWOA 2XHDA 3PUVE 3TTNA 1BIYA 4OQOA 4MF3A 3QXMA 3L6HA 3V83A 2UVJA 1D9VA 3ODBA 4IGRA 4OEVA 5JK4A 1SD3A 4GRKA 2VGQA 4M4GA 4QSDA 1Z7ME 2HFBA 2IEEA 1SQYA 2VD2A 5DEXA 1JETA 4F18A 1N3WA 2X26A 4U2RA 2FNCA 3VFJA 1URDA 4EF1A 1SI0A 1MRPA 2F36A 4H1XA 2V3QA 3MJNA 2PVUA 2H25A 3I3VA 1B3HA 3IB0A 4OERA 4YKPA 3FXQA 3KSJA 4KI0E 3SERA 5DEXB 4F2QA 2RC8A 2RCBA 1MM7A 2RKMA 3MZ9A 1P1QA 2ZNUA 3W9WA 3VVEA 4H8JA 4KYSA 2QS2A 1P1WA 5CMBA 3H6WA 5FTHA 1AIVA 3UK4A 3IJXB 4U22A 1MY3A 3CFLA 2OLBA 2A5SA 4LA9A 4OHNA 4JDFA 1B46A 1ANFA 1FTJA 3PPOA 4R72A 1R1NA 3EHTA 3B6QA 3S4UA 3KN3A 1JEUA 4IY6A 4GQOA 3TCFA 5K2XA 2XXHA 2XX8A 2HZKA 5JEIA 3QSLA 1N76A 2HXWA 4EQ7A 1LBCA 3BFUA 2O69A 1B7ZA 5KZTA 2F6GA 1OQHA 3MVXA 1B1HA 5AA2D 5L9MA 1MY4A 3FXRA 4BDNA 3FJMA 5CMKA 4JBZA 1OMPA 3IOTA 2DP8A 2G93A 4NF4B 4TLMB 5ICQA 1I6QA 4DCYA 1MQDA 1QKAA 5F7VA 4JXIA 4GVOA 1NNFA 3CI8A 1ZKBA 4NEDA 2Y84A 4GIZA 4R6KA 4RPNA 3T9HB 3FUZA 2GRVA 4OWDA 4FORA 2F35A 3PPPA 3CR9A 3TMGA 3RTWB 2G29A 2QMXA 1II5A 1B4HA 3DP4A 3IOVA 1B7UA 3G3JA 3N6TA 3O6HA 3GZGA 4G77A 2ONRA 1KWHA 4H65A 2HEUA 4BDOA 3C34A 1CB6A 1RKMA 3LSFB 1D3KA 3O6IA 3EF7A 1SYHA 5CI5A 1ZU0A 3D4CA 4RK9A 1RYXA 4G8NA 3V8XB 1I69A 3GBAA 1OLCA 3FJ7A 3TZAA 3FJGA 1BP5A 3C32A 2I0BA 1PBPA 1SW5A 3A3CA 1S7YA 3K02A 1H45A 3CVGA 3U72A 3LUYA 4XKPA 3HO7A 4G8HA 4QSEA 4WXJA 2REGA 4RK2A 3HPIA 4DDDA 4AB6A 2F7BA 2DOJA 3DELB 3FASA 4BDRA 3O9PA 3ZS6A 1GTKA 3UIFA 1B32A 2DE4A 2PYYA 3AXFA 5H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCG A;  4F39 A;  1FQB A;  2Q2C A;  4PFW A;  2I48 A;  4OZ9 A;  1ZMG A;  3S9M C;  2B3F A;  3SDF A;  4C0R A;  4IO3 A;  3KJ7 A;  3O66 A;  2Q9T A;  2DXY A;  4GL0 A;  5H8H A;  2F5X A;  3N94 A;  2LAO A;  2NUV A;  2HCA A;  5L9S A;  2PT1 A;  3FVO A;  5HBC A;  1USY E;  1B1X A;  1QVS A;  2AL5 A;  2P0S A;  4YB7 A;  4OFL A;  3H6T A;  3KN8 A;  3G3K A;  3RPW A;  4HW8 A;  1HSE A;  4FJP A;  1FW0 A;  2UVG A;  3E9X A;  3TUS A;  5H8H B;  1EZP A;  3IR1 A;  4QFP A;  2O7U A;  2X7Q A;  2VOZ A;  5EYF A;  2XD2 A;  5DT6 A;  3G3H A;  5DVF A;  1Q1K A;  1FTK A;  4OFO A;  3TCH A;  3PU5 A;  2BJJ X;  4L17 A;  5KDT A;  4G4P A;  3BFT A;  3MP1 A;  4FED A;  3B6T A;  4ESW A;  1SVX B;  3OD7 A;  5EHS A;  2DWJ A;  3N26 A;  2CMO A;  1IXG A;  1H44 A;  1FQD A;  2XXP A;  2DYX A;  3D4G A;  1XOC A;  1QUL A;  3M3L A;  1FTL A;  1LCF A;  4GF8 A;  5KDT B;  3M3K A;  3PUW E;  3O28 A;  3Q26 A;  2DE3 A;  2ZNS A;  3TYH A;  4FEB A;  4IO5 A;  2D21 A;  3R6U A;  1SW2 A;  1NFT A;  5ITO A;  1PB8 A;  2GHB A;  4DE8 A;  1T0K A;  2XX9 A;  3CSB A;  5AA4 A;  4RNS A;  3G3I A;  3IL1 B;  3SEV A;  5I2K A;  3PUX E;  2R71 A;  1DPE A;  4KD5 A;  2ALU A;  1MXU A;  1TXF A;  2Z22 A;  3S9N C;  1ZJL A;  5IKB A;  1URG A;  3C31 A;  5AA4 B;  2QSX A;  5H8F A;  3KZG A;  5I2K B;  3I5O A;  3C9H A;  1ZIU A;  1MH4 A;  1JQF A;  2QRY A;  5I58 A;  2OWT A;  5FHM A;  2ZMB A;  1UIV A;  1M5E A;  2Z8D A;  3SEW A;  5H8F B;  1M5C A;  1LFH A;  5CM6 A;  2H99 A;  3SET A;  3KJT A;  3VLV A;  5I58 B;  3K01 A;  2P2A A;  1N0T A;  5HM4 B;  1J1N A;  3MP6 A;  4F3G A;  3IX1 A;  4DXB A;  1PEB A;  1Y1M A;  3IO4 A;  4LAT A;  3A3U A;  1SYI A;  4WEP A;  4TQU Q;  3CSG A;  2O68 A;  4LZ8 A;  1LGB C;  1ZTY A;  1Y1Z A;  3MPK A;  4O3C A;  3PMX A;  1HSJ A;  4DCX A;  1NNP A;  3RTF B;  2DS9 A;  2HZL A;  4UAC A;  2KLF A;  4OET A;  3K6V A;  4POW A;  1QUI A;  4FAT A;  2I0C A;  2CZL A;  4OYV A;  5AE4 A;  4NMY A;  4IO2 A;  4R9G A;  1S50 A;  4PP0 A;  4ZEC A;  3SEU A;  4PE5 B;  3K6W A;  4UA8 A;  3OXN A;  2V3T A;  1QKB A;  4MH5 A;  1IXC A;  3UGW A;  3MVW A;  1IEJ A;  3C35 A;  2REJ A;  1Y4C A;  1MY0 A;  3RY3 A;  2H9B A;  2NVU B;  3SES A;  2P1S A;  3OSQ A;  4JSD A;  1Z7N E;  3PGF A;  2HAV A;  3PD9 A;  2NXO A;  5B70 A;  2XXV A;  4F31 B;  1B5I A;  4ZEF A;  1MQI A;  3P7I A;  1LFG A;  1GV8 A;  4C1U A;  1P1O A;  4R74 A;  3HHF A;  4H67 A;  5I2N A;  1B3L A;  2PX1 A;  2RC9 A;  4F29 A;  4POX A;  4KPT A;  5H8Q A;  2ZNT A;  3T93 B;  3IOU A;  4H8I A;  5H8N A;  3RLF E;  3EHS A;  4N07 A;  4U4X A;  1O64 A;  1A55 A;  5I2N B;  1AMF A;  1LCT A;  3KG2 A;  3MC2 A;  3OMB A;  2VD3 A;  5M2V A;  4XXU A;  4F19 A;  3TTR A;  5H8Q B;  4ESX A;  4O3B A;  2DWH A;  5CMC A;  5H8N B;  4YB5 A;  1D9Y A;  1NMU A;  3LSL A;  3N5L A;  5DTB A;  3C36 A;  3EQ1 A;  1UQW A;  5F1Q A;  1LAX A;  1B9J A;  3G3F A;  1LAH E;  2H5Y A;  4IGT A;  4OXV A;  3VV5 A;  3LC8 A;  3CG1 A;  4ELR A;  4RY1 A;  3C33 A;  1SW4 A;  3K6X A;  4EDP A;  4I1D A;  1B7H A;  3HV1 A;  4U1O A;  4NF8 A;  3H6V A;  1R9L A;  3THI A;  2I49 A;  5CBR A;  3ECR A;  2GHA A;  2XXU A;  3V5A A;  1FQA A;  4TLL B;  3TQW A;  3R26 A;  2FYI A;  3ONM A;  4F1V A;  3FVK A;  4FEC A;  1GVC A;  4F1Y A;  2HQ0 A;  3QUF A;  4MLQ A;  1Y3P A;  4NF8 B;  3BKI B;  3OEK A;  1LBB A;  1B3G A;  1USY H;  3MW0 A;  2H98 A;  2QJE A;  2X7P A;  2QS4 A;  4U21 A;  5I57 A;  2Y7P A;  2OCU A;  1IZ1 A;  3SEY A;  1LFI A;  4OVJ A;  3PMW A;  1TWY A;  1B3E A;  3TDJ A;  3K1N A;  1PBQ A;  3K1M A;  1JNF A;  1LB8 A;  4OEN A;  3I6V A;  4PET A;  3K00 A;  3HST A;  5I57 B;  4LQ2 A;  4YMA A;  4EQ9 A;  3GBB A;  3CRB A;  3FAT A;  4IO6 A;  2UYF A;  3TKD A;  3G3G A;  4ZEK A;  4BLA A;  3QYT A;  4I9D A;  4LZ7 A;  1R9Q A;  1N84 A;  5AA3 A;  1EH3 A;  4U4S A;  2W7Y A;  1H3D A;  3K1P A;  4KFQ A;  1JW1 A;  1NKX A;  1I6B A;  2B65 A;  4KYE A;  2B3B A;  4KCD A;  4RYA A;  5CRY A;  4ZE9 A;  1NL5 A;  1A8F A;  2DQV A;  5FHO A;  4RA1 A;  1Q35 A;  2I3V A;  4AB5 A;  5LOM A;  4GXS B;  4YU0 A;  3CG3 A;  1GGG A;  4ECF A;  1A54 A;  5AA1 A;  1LST A;  2V3U A;  4IB2 A;  2DWI A;  1B3F A;  4ZED A;  2QMW A;  3KOS A;  1DPP A;  1O7T A;  4H6D A;  1IXI A;  3DM0 A;  3FVN A;  2RF1 A;  2Z23 A;  4XIG Q;  5EHM A;  3U94 A;  3UOR A;  1XVX A;  3U1O A;  3U92 A;  3MQ9 A;  4Q8R A;  1ZLQ A;  1NNK A;  3IK6 B;  4YAH X;  3WAF A;  3ILU B;  3IOW A;  2GH9 A;  4X1B A;  1A7L A;  2OK2 A;  2ZYO A;  1NH8 A;  4EQB A;  3FV2 A;  2ZYK A;  4IY5 A;  2Y7R A;  1B5J A;  3OEM A;  1ELJ A;  4YKJ A;  3N6U A;  2QS3 A;  1LAG E;  2ANJ A;  1OLA A;  2H4I A;  1IUD A;  1UTB A;  1B6H A;  3OSR A;  3KSX A;  5I59 A;  4YIC A;  4PFT A;  4PFU A;  2GFE A;  1LB9 A;  2V25 A;  3QAX A;  2UVH A;  3MPL A;  2O7I A;  3VLU A;  3FGS A;  1SI1 A;  1OQG A;  5FHN A;  4U1Z A;  3FVG A;  5BWJ A;  3ZKK A;  1Y4T A;  1UTB B;  5I59 B;  2OWS A;  4P11 A;  3TTK A;  4YKI A;  3Q28 A;  1N04 A;  2NOO A;  2VP1 A;  4LQ5 A;  1B5H A;  3Q25 A;  3ZKL A;  1UTH A;  4EXK A;  1MDP 1;  3R7X A;  4NWC A;  1MPC A;  3KOT A;  3IOR A;  2F7C A;  4G2Z A;  1PB9 A;  1IXH A;  3Q27 A;  4RPO A;  3JV9 A;  4Q0C A;  3K4U A;  3E3K A;  2Y7K A;  2F78 A;  1N3X A;  1RYO A;  3FIR A;  4JWX A;  3K0V A;  2UYE A;  3PPR A;  2XXI A;  4I8C A;  1WOD A;  3VVD A;  3UN6 A;  3H03 A;  1MPD A;  1UTH B;  4O3A A;  1FTO A;  1EZO A;  4FAJ A;  1OVB A;  4KQP A;  1FCK A;  4GL8 A;  5KCJ A;  1XVY A;  3A09 A;  3PV0 E;  4ELQ A;  5I84 A;  5K2Y A;  5I56 A;  5DYH A;  2E1S A;  1MXX A;  4QSC A;  5CC2 A;  4Z0I A;  3B6W A;  3LR1 A;  4RXL A;  1R6Z A;  4TOZ A;  3MAM A;  3RT8 A;  1IIW A;  2Z8E A;  2XXQ A;  1IIT A;  5KCJ B;  1BTJ A;  5CMM A;  3KBR A;  4F3B A;  2V93 A;  2XXY A;  5I56 B;  2PT2 A;  3JYR A;  1S9T A;  3RNN A;  4YMB A;  1H76 A;  2WKY A;  1Y20 A;  1Y3N A;  4YB6 A;  3SEX A;  3KEI A;  2I4C A;  1N7X A;  3S2V A;  3T96 B;  1MQJ A;  1DTG A;  3CFX A;  1B40 A;  3OOA A;  1VSO A;  3SKP A;  3LBS A;  5ISU A;  3JZJ A;  1US5 A;  1P1U A;  3DP8 A;  4ISU A;  1Y9U A;  1XC1 A;  4DZ1 A;  1POT A;  1HSL A;  1MXZ A;  2ZYM A;  4F3S A;  3S9L C;  1WVJ A;  2Z8F A;  3PPN A;  2XXR A;  4RJZ A;  1URS A;  3QUJ A;  1B0H A;  1NH7 A;  3MZ1 A;  3T22 A;  3TPA A;  4HCW A;  5ELV A;  2FA7 A;  4N13 A;  3K6U A;  1O63 A;  2F34 A;  1M5D A;  4F1U A;  4G8M A;  2O51 A;  4PQJ A;  2F97 A;  4Z7E A;  3HHG A;  4C1T A;  3VLW A;  4LP2 B;  5AA2 A;  4QFL A;  3HN0 A;  3MVY A;  4E0W A;  1AOV A;  1PB7 A;  3RN8 A;  1B4Z A;  1M5B A;  4BDQ A;  4NTL A;  3MP8 A;  3MWB A;  1FQC A;  2QS1 A;  1MG1 A;  2RCA A;  1LAF E;  2RIN A;  3W15 C;  1SBP A;  1D4N A;  1MS7 A;  3TEP A;  1M5F A;  4G68 C;  1B52 A;  4X48 A;  3FZV A;  4H5G A;  3B7D A;  1BLF A;  1QW0 A;  1MDQ A;  5AA2 B;  4P0I A;  3H3G A;  3C4M A;  3IB1 A;  3L6G A;  2O1M A;  2THI A;  3W9V A;  1UIU A;  4E0X A;  2XD3 A;  4DIG A;  2NWJ A;  3MVZ A;  3PMV A;  4XKR A;  4ND9 A;  4NF4 A;  2ONK E;  4HS7 A;  3OO7 A;  4LUB A;  2DVZ A;  4AQ4 A;  4ONY A;  4ZEB A;  1MQH A;  4QFO A;  4GXA A;  2AYS A;  1CE2 A;  4GLI A;  2R6G E;  1P1N A;  1B0L A;  2I6E A;  1ZBM A;  4LVQ A;  3USD A;  2Q2A A;  4ZZA A;  1MQG A;  3PD8 A;  1VFD A;  4EUO A;  1EU8 A;  1AL3 A;  3IB2 A;  2F7A A;  3TOD A;  2PBW A;  4FIM A;  2XXX A;  4QF9 A;  2R9J A;  3DLN A;  4NF6 A;  4R73 A;  4GFR A;  4JWY A;  4QRZ A;  4ZS9 A;  3KN7 A;  1TFD A;  1ATG A;  4WKM A;  1JW5 A;  4HCY A;  4MBP A;  1A40 A;  1SDX A;  3BBR A;  3PUZ E;  1YPN A;  1YCJ A;  1QUJ A;  1AH5 A;  4X9T A;  2OZZ A;  3VXB A;  1XT8 A;  4JSO A;  1JVX A;  1YTV A;  2Y7I A;  1F9B A;  4OES A;  1P99 A;  4NF6 B;  3TAJ A;  3VXC A;  3T9X B;  3OO8 A;  3MBP A;  1DOT A;  2XX7 A;  4F2O A;  2I58 A;  3CFZ A;  1N7W A;  1EZ9 A;  2Q8J A;  1JVY A;  4M1V A;  3TTL A;  3LSW A;  4OMB A;  5HPQ A;  1A99 A;  1IQ7 A;  2ZYN A;  2YPN A;  2XXT A;  2M8C A;  3E13 X;  4XTC Q;  3GLB A;  3ZSF A;  5TU0 A;  4X1D A;  4P0G A;  2A5T A;  3KGC A;  4ZE8 A;  3UA8 A;  4OEU A;  3VVF A;  1WDN A;  2I4B A;  5DVI A;  4ELP A;  2UXA A;  4YZZ A;  4ZZE A;  4QHQ A;  4ZDM A;  2D5W A;  2AIX A;  4QFN A;  3TTM A;  3G7W A;  2A5T B;  3EHU A;  2Q88 A;  4R75 A;  4R9F A;  1Y3Q A;  5TP9 A;  1VE4 A;  1NNT A;  3U93 A;  3H4Z A;  4ZEI A;  1PC3 A;  4QFK A;  3O6G A;  3U8Q A;  4I62 A;  2F8D A;  1I6A A;  1GR2 A;  3OEL A;  2HAU A;  1POY 1;  3GXA A;  4K3F A;  3FV1 A;  3PUY E;  5BUU A;  4Q5T A;  5TP9 B;  3HCQ A;  3RQT A;  2QL3 A;  3T66 A;  3QK6 A;  3RGY A;  1MPB A;  3MZB A;  1JW4 A;  5L8D A;  4FE8 A;  2ONS A;  2Y7W A;  1MY1 A;  1TT1 A;  5ITP A;  4EF2 A;  4F22 A;  4XKN A;  2YJP A;  3T9V A;  4BDM A;  2ESN A;  5DVJ A;  5J1D A;  4N6P A;  3TQL A;  4HTG A;  2OBG A;  1QUK A;  3EN3 A;  1OIB A;  3OEN A;  4H0W A;  2DWA A;  2DVC A;  4XKQ A;  1DMB A;  3EPE A;  2IA4 A;  4R6Y A;  3VDF A;  2O6A A;  5FTI A;  1MXW A;  3IAZ A;  4WED A;  3TFL A;  4IO4 A;  4H5F A;  4R2B A;  4GD5 A;  1MXV A;  3H7M A;  5JTY A;  4MLV A;  4PFY A;  4LON B;  4R6H A;  1A8E A;  3O97 A;  1MM6 A;  5A5X A;  3KFM A;  1DSN A;  1SW1 A;  2RC7 A;  1JEV A;  2OJT A;  1FQF A;  1XHY A;  2Q89 A;  4KHZ E;  1B2H A;  4MFI A;  2ZXT A;  1VFE A;  2DE2 A;  3T9U A;  4Q30 B;  4BDL A;  4THI A;  5JTY B;  5TPA A;  1L5T A;  2V84 A;  3OO9 A;  1MY2 A;  5A5X B;  1YAE A;  3M3F A;  4OFJ A;  2YLN A;  4DXU A;  1TFA A;  4EXL A;  5IAI A;  4LZ5 A;  2I3W A;  3FD3 A;  2DSF A;  1LLS A;  3RT6 B;  4NE4 A;  3E4R A;  4OTE A;  1US4 A;  5CBS A;  1PDA A;  2QPQ A;  5TPA B;  1MH3 A;  3O29 A;  1BKA A;  2AL4 A;  3IJO B;  1B51 A;  2ABH A;  3RUM A;  4GOT A;  3DP6 A;  3MUQ A;  2O1L A;  3Q29 A;  4ELO A;  2PMS A;  3OO6 A;  3V89 B;  4JWO A;  2O84 X;  1VR5 A;  2DXR A;  3H06 B;  4NF5 A;  2E0S A;  1FTM A;  3H6U A;  3S9E A;  4DXC A;  5B7D A;  3M8U A;  2XXW A;  4KR5 A;  3LSX A;  4IO7 A;  3TEL A;  3VE1 B;  1MXY A;  4NWD A;  3UP9 A;  4G68 A;  1OVT A;  3IO6 A;  3FXU A;  2F6P A;  4R2F A;  1QJM A;  3CIJ A;  4NF5 B;  4JB7 A;  1DTZ A;  1H43 A;  1XS5 A;  4KYD A;  1B58 A;  1FQE A;  3QIM A;  2VHA A;  4KCC A;  1B05 A;  2UVI A;  4U23 A;  3WAE A;  4G68 B;  5ICT A;  4F3P A;  2D3I A;  5L9O A;  3F11 A;  3O2A A;  4YKK A;  3ILT B;  3PPQ A;  3K2D A;  4DLD A;  4GWO A;  2XHD A;  3PUV E;  3TTN A;  1BIY A;  4OQO A;  4MF3 A;  3QXM A;  3L6H A;  3V83 A;  2UVJ A;  1D9V A;  3ODB A;  4IGR A;  4OEV A;  5JK4 A;  1SD3 A;  4GRK A;  2VGQ A;  4M4G A;  4QSD A;  1Z7M E;  2HFB A;  2IEE A;  1SQY A;  2VD2 A;  5DEX A;  1JET A;  4F18 A;  1N3W A;  2X26 A;  4U2R A;  2FNC A;  3VFJ A;  1URD A;  4EF1 A;  1SI0 A;  1MRP A;  2F36 A;  4H1X A;  2V3Q A;  3MJN A;  2PVU A;  2H25 A;  3I3V A;  1B3H A;  3IB0 A;  4OER A;  4YKP A;  3FXQ A;  3KSJ A;  4KI0 E;  3SER A;  5DEX B;  4F2Q A;  2RC8 A;  2RCB A;  1MM7 A;  2RKM A;  3MZ9 A;  1P1Q A;  2ZNU A;  3W9W A;  3VVE A;  4H8J A;  4KYS A;  2QS2 A;  1P1W A;  5CMB A;  3H6W A;  5FTH A;  1AIV A;  3UK4 A;  3IJX B;  4U22 A;  1MY3 A;  3CFL A;  2OLB A;  2A5S A;  4LA9 A;  4OHN A;  4JDF A;  1B46 A;  1ANF A;  1FTJ A;  3PPO A;  4R72 A;  1R1N A;  3EHT A;  3B6Q A;  3S4U A;  3KN3 A;  1JEU A;  4IY6 A;  4GQO A;  3TCF A;  5K2X A;  2XXH A;  2XX8 A;  2HZK A;  5JEI A;  3QSL A;  1N76 A;  2HXW A;  4EQ7 A;  1LBC A;  3BFU A;  2O69 A;  1B7Z A;  5KZT A;  2F6G A;  1OQH A;  3MVX A;  1B1H A;  5AA2 D;  5L9M A;  1MY4 A;  3FXR A;  4BDN A;  3FJM A;  5CMK A;  4JBZ A;  1OMP A;  3IOT A;  2DP8 A;  2G93 A;  4NF4 B;  4TLM B;  5ICQ A;  1I6Q A;  4DCY A;  1MQD A;  1QKA A;  5F7V A;  4JXI A;  4GVO A;  1NNF A;  3CI8 A;  1ZKB A;  4NED A;  2Y84 A;  4GIZ A;  4R6K A;  4RPN A;  3T9H B;  3FUZ A;  2GRV A;  4OWD A;  4FOR A;  2F35 A;  3PPP A;  3CR9 A;  3TMG A;  3RTW B;  2G29 A;  2QMX A;  1II5 A;  1B4H A;  3DP4 A;  3IOV A;  1B7U A;  3G3J A;  3N6T A;  3O6H A;  3GZG A;  4G77 A;  2ONR A;  1KWH A;  4H65 A;  2HEU A;  4BDO A;  3C34 A;  1CB6 A;  1RKM A;  3LSF B;  1D3K A;  3O6I A;  3EF7 A;  1SYH A;  5CI5 A;  1ZU0 A;  3D4C A;  4RK9 A;  1RYX A;  4G8N A;  3V8X B;  1I69 A;  3GBA A;  1OLC A;  3FJ7 A;  3TZA A;  3FJG A;  1BP5 A;  3C32 A;  2I0B A;  1PBP A;  1SW5 A;  3A3C A;  1S7Y A;  3K02 A;  1H45 A;  3CVG A;  3U72 A;  3LUY A;  4XKP A;  3HO7 A;  4G8H A;  4QSE A;  4WXJ A;  2REG A;  4RK2 A;  3HPI A;  4DDD A;  4AB6 A;  2F7B A;  2DOJ A;  3DEL B;  3FAS A;  4BDR A;  3O9P A;  3ZS6 A;  1GTK A;  3UIF A;  1B32 A;  2DE4 A;  2PYY A;  3AXF A;  5H8S A; 
#chains in the Genus database with same CATH topology
 3TCG A;  4F39 A;  1FQB A;  2Q2C A;  4PFW A;  2I48 A;  2OX3 A;  5ET8 A;  4OZ9 A;  1BK4 A;  1ZMG A;  3S9M C;  2B3F A;  3SDF A;  4DI4 B;  4C0R A;  5IZZ A;  4IO3 A;  3KJ7 A;  3O66 A;  2Q9T A;  1YYZ A;  2FBP A;  2DXY A;  4GL0 A;  5H8H A;  2F5X A;  3N94 A;  2LAO A;  2NUV A;  2HCA A;  5L9S A;  2PT1 A;  3FVO A;  1LBY A;  5HBC A;  1USY E;  1B1X A;  4PGN A;  1QVS A;  2AL5 A;  2P0S A;  4YB7 A;  4OFL A;  4N15 A;  1LBW A;  3H6T A;  3KN8 A;  1FPJ A;  3G3K A;  3RPW A;  4I40 A;  4NQ8 A;  4HW8 A;  1HSE A;  4FJP A;  1FW0 A;  2UVG A;  5IM2 A;  3E9X A;  3TUS A;  5H8H B;  1EZP A;  3IR1 A;  4QFP A;  2O7U A;  4GBV A;  2X7Q A;  2VOZ A;  5EYF A;  2Y5K A;  2XD2 A;  5DT6 A;  3G3H A;  5DVF A;  1Q1K A;  2WBB A;  1FTK A;  4OFO A;  3TCH A;  3PU5 A;  2KQZ A;  3BIH A;  1FRP A;  2BJJ X;  4L17 A;  4HE1 A;  5KDT A;  4G4P A;  3BFT A;  3MP1 A;  4FED A;  3B6T A;  4ESW A;  1SVX B;  3OD7 A;  5EHS A;  2DWJ A;  3N26 A;  2CMO A;  2CEX A;  1IXG A;  1H44 A;  1FQD A;  2XXP A;  4JVD A;  2DYX A;  3D4G A;  1JP4 A;  1XOC A;  1QUL A;  3M3L A;  1FTL A;  1LCF A;  4GF8 A;  5EQ8 A;  5KDT B;  3M3K A;  3PUW E;  3O28 A;  3Q26 A;  1FPG A;  2DE3 A;  2ZNS A;  3TYH A;  4FEB A;  2OWZ A;  2CEY A;  3HFU A;  4IO5 A;  2D21 A;  2GQ1 A;  3R6U A;  1SW2 A;  1NFT A;  4N81 A;  5ITO A;  1PB8 A;  2GHB A;  4DE8 A;  1T0K A;  4N4U A;  1IMB A;  2XX9 A;  3CSB A;  5AA4 A;  4RNS A;  3G3I A;  3IL1 B;  3SEV A;  5I2K A;  3PUX E;  2R71 A;  1DPE A;  4NGU A;  4KD5 A;  2ALU A;  1MXU A;  1TXF A;  2QVU A;  4HXV A;  2Z22 A;  3S9N C;  1NV1 A;  1ZJL A;  5IKB A;  1URG A;  3C31 A;  5AA4 B;  2QSX A;  5ET6 A;  5H8F A;  3KZG A;  1KZ8 A;  5I2K B;  3I5O A;  3C9H A;  4N6K A;  1ZIU A;  1MH4 A;  1JQF A;  2QRY A;  3KBZ A;  5I58 A;  2OWT A;  2XXK A;  5FHM A;  1D9Q A;  2ZMB A;  1UIV A;  3PTY A;  1M5E A;  4QXD A;  2Z8D A;  3SEW A;  5IZ1 A;  5H8F B;  1M5C A;  1LFH A;  1RDZ A;  4XFE A;  5CM6 A;  2H99 A;  2WYK A;  3SET A;  2F3D A;  3KJT A;  3VLV A;  5I58 B;  3K01 A;  2P2A A;  1N0T A;  3NOH A;  5HM4 B;  1J1N A;  3MP6 A;  4F3G A;  3IX1 A;  4DXB A;  1PEB A;  4AS5 A;  1Y1M A;  3IO4 A;  2CZI A;  4LAT A;  3A3U A;  1SYI A;  4WEP A;  4TQU Q;  4N8G A;  3CSG A;  5EQA A;  2O68 A;  4LZ8 A;  1LGB C;  4FBP A;  1ZTY A;  1Y1Z A;  3MPK A;  4O3C A;  3PMX A;  1HSJ A;  4DCX A;  2R8T A;  1NNP A;  3RTF B;  3T1B A;  2DS9 A;  2HZL A;  4UAC A;  2KLF A;  4OET A;  3K6V A;  4POW A;  1DK4 A;  1QUI A;  4FAT A;  1FSA A;  4GX6 A;  2I0C A;  2CZL A;  4OYV A;  2FIX A;  5AE4 A;  4NMY A;  4IO2 A;  4R9G A;  1S50 A;  4PP0 A;  4ZEC A;  3SEU A;  2P3N A;  4PE5 B;  3K6W A;  4UA8 A;  1EYJ A;  3OXN A;  2V3T A;  1QKB A;  1K9Y A;  4GWW A;  4MH5 A;  1IXC A;  3UGW A;  3MVW A;  1IEJ A;  1FPD A;  3C35 A;  2REJ A;  3MST A;  1Y4C A;  5T3J A;  1MY0 A;  3RY3 A;  2H9B A;  2NVU B;  3SES A;  2P1S A;  3OSQ A;  4JSD A;  1Z7N E;  3GYY A;  3PGF A;  2HAV A;  3PD9 A;  2NXO A;  5B70 A;  2XXV A;  4F31 B;  1B5I A;  4ZEF A;  1MQI A;  1XI6 A;  3D1R A;  3P7I A;  1LFG A;  1GV8 A;  4MMP A;  1P1O A;  4C1U A;  4R74 A;  1G0H A;  3HHF A;  4H67 A;  5I2N A;  4PCD A;  4P47 A;  1B3L A;  2PX1 A;  2RC9 A;  4F29 A;  1LBV A;  4POX A;  4KPT A;  5H8Q A;  2ZNT A;  1LBX A;  3T93 B;  3IOU A;  4H8I A;  5H8N A;  3RLF E;  3EHS A;  4N07 A;  4U4X A;  1O64 A;  1A55 A;  5I2N B;  1AMF A;  1LBZ A;  1LCT A;  3KG2 A;  3MC2 A;  2PFZ A;  3OMB A;  2VD3 A;  5M2V A;  4XXU A;  4F19 A;  3TTR A;  5H8Q B;  4ESX A;  4O3B A;  2DWH A;  5CMC A;  5H8N B;  4YB5 A;  1D9Y A;  1NMU A;  3LSL A;  3N5L A;  5DTB A;  3C36 A;  3EQ1 A;  4P8B A;  1UQW A;  5F1Q A;  1LAX A;  1IME A;  1B9J A;  3G3F A;  1LAH E;  2H5Y A;  4PAF A;  4IGT A;  4OXV A;  3VV5 A;  3LC8 A;  3CG1 A;  4ELR A;  4RY1 A;  3C33 A;  3KC1 A;  4PFR A;  1SW4 A;  3K6X A;  1CNQ A;  4EDP A;  4I1D A;  1B7H A;  3HV1 A;  4U1O A;  1EYK A;  4NF8 A;  3H6V A;  1R9L A;  3THI A;  2I49 A;  2VPN A;  1IMD A;  5CBR A;  3ECR A;  4H45 A;  2GHA A;  2XXU A;  3V5A A;  1FQA A;  3E78 A;  4TLL B;  2Q8M A;  3TQW A;  2CZK A;  3R26 A;  2FYI A;  3ONM A;  4F1V A;  3FVK A;  4FEC A;  1GVC A;  4F1Y A;  2HQ0 A;  3QUF A;  4MLQ A;  1NUX A;  1Y3P A;  4NF8 B;  3BKI B;  3OEK A;  1LBB A;  1B3G A;  1USY H;  3MW0 A;  2H98 A;  2QJE A;  1NV3 A;  2X7P A;  2QS4 A;  4MIJ A;  4U21 A;  3E79 A;  5I57 A;  2Y7P A;  1YZ0 A;  2OCU A;  4MNI A;  1IZ1 A;  3SEY A;  1LFI A;  4OVJ A;  4UAB A;  2QFL A;  3PMW A;  1TWY A;  1B3E A;  3TDJ A;  3K1N A;  1PBQ A;  3K1M A;  1JNF A;  2XWV A;  1LB8 A;  4OEN A;  3I6V A;  4PET A;  3K00 A;  3ISP A;  4NX1 A;  2L5V A;  3RYD A;  3HST A;  5I57 B;  1KA1 A;  4LQ2 A;  4N8Y A;  4EQ9 A;  4YMA A;  3GBB A;  3CRB A;  1FBD A;  3FAT A;  4IO6 A;  2UYF A;  3TKD A;  3G3G A;  4ZEK A;  4P56 A;  3QYT A;  4BLA A;  4I9D A;  5FBP A;  4LZ7 A;  1R9Q A;  1N84 A;  5AA3 A;  4OAN A;  3EKI A;  1EH3 A;  4U4S A;  2W7Y A;  5A5L A;  1H3D A;  3K1P A;  4KFQ A;  1JW1 A;  1NKX A;  1I6B A;  2B65 A;  4KYE A;  2B3B A;  4KCD A;  4RYA A;  1NV0 A;  5CRY A;  4ZE9 A;  1NL5 A;  1A8F A;  2DQV A;  5FHO A;  4RA1 A;  1Q35 A;  2I3V A;  4AB5 A;  5LOM A;  4GXS B;  4YU0 A;  2KR0 A;  2MKZ A;  3CG3 A;  1GGG A;  4ECF A;  1A54 A;  5AA1 A;  1LST A;  2V3U A;  4IB2 A;  2DWI A;  1B3F A;  4ZED A;  2QMW A;  3KOS A;  1DPP A;  1O7T A;  4H6D A;  1IXI A;  2FHY A;  3DM0 A;  3FVN A;  4X8R A;  2RF1 A;  4P1L A;  1IMA A;  2Z23 A;  4XIG Q;  5EHM A;  3U94 A;  3UOR A;  1XVX A;  3U1O A;  3U92 A;  3MQ9 A;  2F3B A;  4Q8R A;  1ZLQ A;  1NNK A;  3IK6 B;  4YAH X;  3WAF A;  3ILU B;  3IOW A;  2GH9 A;  4X1B A;  1A7L A;  2XA5 A;  2OK2 A;  2ZYO A;  1NH8 A;  4EQB A;  3FV2 A;  1FBH A;  2ZYK A;  4IY5 A;  2WBD A;  2Y7R A;  1B5J A;  3OEM A;  1ELJ A;  4YKJ A;  3N6U A;  2QS3 A;  1LAG E;  2V4C A;  1NUY A;  2ANJ A;  1OLA A;  2H4I A;  1IUD A;  1UTB A;  1B6H A;  3OSR A;  3KSX A;  5I59 A;  4YIC A;  4PFT A;  4PFU A;  2GFE A;  1LB9 A;  5I5P A;  2V25 A;  3QAX A;  2UVH A;  4GWX A;  3MPL A;  2O7I A;  3U65 A;  3VLU A;  3FGS A;  1SI1 A;  1OQG A;  5FHN A;  4U1Z A;  3FVG A;  5BWJ A;  3ZKK A;  1Y4T A;  1UTB B;  5EYH A;  5I59 B;  2OWS A;  4P11 A;  3TTK A;  4YKI A;  3Q28 A;  4MNP A;  1N04 A;  1YXI A;  2NOO A;  2VP1 A;  4LQ5 A;  1B5H A;  3Q25 A;  2QVV A;  3ZKL A;  1UTH A;  5EYG A;  4EXK A;  1MDP 1;  3R7X A;  4NWC A;  1MPC A;  3KOT A;  3IOR A;  2F7C A;  4G2Z A;  1PB9 A;  4PGP A;  1IXH A;  3Q27 A;  4RPO A;  3JV9 A;  4Q0C A;  3K4U A;  3E3K A;  1FPB A;  2Y7K A;  2F78 A;  1N3X A;  1RYO A;  3FIR A;  4JWX A;  3K0V A;  2UYE A;  3PPR A;  2XXI A;  4I8C A;  1WOD A;  3VVD A;  3UN6 A;  3H03 A;  1MPD A;  1UTH B;  4O3A A;  1NV5 A;  1FTO A;  1EZO A;  4FAJ A;  1OVB A;  4KQP A;  1FCK A;  4GL8 A;  5KCJ A;  1XVY A;  3A09 A;  3PV0 E;  4ELQ A;  5I84 A;  5K2Y A;  1FJ6 A;  4GBW A;  5I56 A;  5DYH A;  2E1S A;  3FBP A;  1MXX A;  4QSC A;  5CC2 A;  4Z0I A;  3B6W A;  3LR1 A;  4RXL A;  3KC0 A;  4KXP A;  1R6Z A;  4TOZ A;  3MAM A;  3RT8 A;  1IIW A;  2Z8E A;  2XXQ A;  1IIT A;  2ZZX A;  5KCJ B;  1BTJ A;  5CMM A;  4NG7 A;  5F24 A;  3KBR A;  4F3B A;  2V93 A;  2XXY A;  4AS4 A;  5I56 B;  2PT2 A;  3JYR A;  2HHM A;  1S9T A;  3RNN A;  4YMB A;  1H76 A;  2WKY A;  1Y20 A;  1Y3N A;  4YB6 A;  3SEX A;  3KEI A;  3A29 A;  4N17 A;  4GX3 A;  2I4C A;  2VT5 A;  1N7X A;  3MYU A;  3S2V A;  3T96 B;  1MQJ A;  1DTG A;  3CFX A;  1B40 A;  3OOA A;  1VSO A;  3SKP A;  3LBS A;  5ISU A;  3B8B A;  3JZJ A;  4PE3 A;  1US5 A;  1P1U A;  3DP8 A;  4ISU A;  1Y9U A;  1XC1 A;  4DZ1 A;  1POT A;  1HSL A;  1MXZ A;  2ZYM A;  4F3S A;  1RDY A;  1WVJ A;  3S9L C;  2Z8F A;  3PPN A;  2XXR A;  4RJZ A;  1URS A;  3QUJ A;  1B0H A;  1NH7 A;  3MZ1 A;  3T22 A;  3TPA A;  4HCW A;  5ELV A;  4IR8 A;  2FA7 A;  4GWS A;  4N13 A;  1NUW A;  3K6U A;  1FBE A;  1O63 A;  2F34 A;  1M5D A;  4F1U A;  4G8M A;  2O51 A;  4PQJ A;  2F97 A;  4Z7E A;  3HHG A;  4C1T A;  3VLW A;  4LP2 B;  5AA2 A;  4QFL A;  2PCR A;  3HN0 A;  2WEF A;  4PBH A;  3MVY A;  4E0W A;  1AOV A;  1PB7 A;  3RN8 A;  1B4Z A;  1M5B A;  4BDQ A;  4NTL A;  3MP8 A;  3MWB A;  1FQC A;  2QS1 A;  1MG1 A;  2RCA A;  1LAF E;  1NV4 A;  2RIN A;  3W15 C;  1SBP A;  1D4N A;  1MS7 A;  3TEP A;  1M5F A;  4G68 C;  1B52 A;  4X48 A;  3FZV A;  4H5G A;  3B7D A;  1BLF A;  1QW0 A;  1MDQ A;  5AA2 B;  4P0I A;  3H3G A;  3C4M A;  3IB1 A;  3L6G A;  2O1M A;  2THI A;  4XF5 A;  3W9V A;  1UIU A;  4PFB A;  4E0X A;  1FPI A;  2XD3 A;  4DIG A;  2NWJ A;  3MVZ A;  1Q9D A;  3PMV A;  4XKR A;  2Q74 A;  4ND9 A;  4NF4 A;  4DI3 D;  4NAP A;  2ONK E;  4HS7 A;  3OO7 A;  4LUB A;  4MHF A;  2DVZ A;  3IFC A;  4AQ4 A;  4ONY A;  4ZEB A;  1MQH A;  4QFO A;  4GXA A;  2AYS A;  1CE2 A;  4GLI A;  2R6G E;  1P1N A;  5I7I A;  1FBF A;  1B0L A;  2I6E A;  1ZBM A;  4LVQ A;  3USD A;  2Q2A A;  4ZZA A;  1LEV A;  1MQG A;  3PD8 A;  1VFD A;  4EUO A;  1EU8 A;  1AL3 A;  3IB2 A;  4HE2 A;  2F7A A;  3TOD A;  2PBW A;  4FIM A;  2XXX A;  1FBG A;  4QF9 A;  4N91 A;  2R9J A;  4H46 A;  3DLN A;  4R73 A;  4NF6 A;  4GFR A;  3FXB A;  2WX9 A;  4JWY A;  4O94 A;  4QRZ A;  4ZS9 A;  3KN7 A;  1TFD A;  1ATG A;  4WKM A;  1JW5 A;  4HCY A;  4MBP A;  1A40 A;  1SDX A;  3BBR A;  3PUZ E;  5IGA A;  1YPN A;  1YCJ A;  1QUJ A;  1AH5 A;  4X9T A;  2OZZ A;  4OVT A;  3VXB A;  1XT8 A;  4GWY A;  4JSO A;  1JVX A;  1YTV A;  2Y7I A;  1F9B A;  4OES A;  1P99 A;  4NF6 B;  3TAJ A;  3VXC A;  3T9X B;  3OO8 A;  3MBP A;  1DOT A;  2PFY A;  2XX7 A;  2I58 A;  4F2O A;  3CFZ A;  1N7W A;  1EZ9 A;  2Q8J A;  1JVY A;  4M1V A;  3TTL A;  3LSW A;  4OMB A;  5HPQ A;  1A99 A;  1IQ7 A;  2ZYN A;  2YPN A;  2XXT A;  2M8C A;  3E13 X;  4XTC Q;  1NV7 A;  3GLB A;  4I3E A;  3ZSF A;  3ROJ A;  5TU0 A;  4X1D A;  4P0G A;  2A5T A;  3KGC A;  4ZE8 A;  3UA8 A;  4OEU A;  3VVF A;  1WDN A;  2I4B A;  4NN3 A;  5DVI A;  4ELP A;  2BJI A;  3CHG A;  1AWB A;  2UXA A;  4YZZ A;  4ZZE A;  1FTA A;  4QHQ A;  2B4L A;  5J16 A;  4ZDM A;  4P9K A;  1FBC A;  2D5W A;  2AIX A;  4QFN A;  3TTM A;  3G7W A;  2A5T B;  3EHU A;  5IZ3 A;  2Q88 A;  4R75 A;  4R9F A;  1Y3Q A;  5TP9 A;  1VE4 A;  1NNT A;  3U93 A;  3H4Z A;  4ZEI A;  1PC3 A;  4QFK A;  3O6G A;  3U8Q A;  4I62 A;  2HPG A;  2XWK A;  2F8D A;  4P1E A;  1I6A A;  1GR2 A;  3OEL A;  2HAU A;  1POY 1;  3GXA A;  4K3F A;  5IZ3 B;  3FV1 A;  3PUY E;  4PTK A;  5BUU A;  4Q5T A;  5TP9 B;  3HCQ A;  3RQT A;  2QL3 A;  3T66 A;  3QK6 A;  3RGY A;  1IMF A;  1MPB A;  3MZB A;  1JW4 A;  5L8D A;  4FE8 A;  2ONS A;  2Y7W A;  1MY1 A;  1TT1 A;  5ITP A;  4PFI A;  4EF2 A;  4XKN A;  4F22 A;  2YJP A;  3T9V A;  4BDM A;  2ESN A;  5DVJ A;  5J1D A;  4N6P A;  3TQL A;  4HTG A;  3LUZ A;  2OBG A;  1QUK A;  3EN3 A;  1OIB A;  4JVI A;  3OEN A;  4H0W A;  2DWA A;  2DVC A;  4XKQ A;  1DMB A;  3EPE A;  1K9Z A;  2IA4 A;  5EQ9 A;  4R6Y A;  3VDF A;  2O6A A;  5FTI A;  1MXW A;  3IAZ A;  2WYP A;  4WED A;  4MX6 A;  3TFL A;  4IO4 A;  4H5F A;  4R2B A;  4GD5 A;  1MXV A;  3H7M A;  5JTY A;  4MLV A;  4PFY A;  1NUZ A;  4LON B;  4R6H A;  1A8E A;  3O97 A;  1MM6 A;  5A5X A;  3KFM A;  1DSN A;  1SW1 A;  2RC7 A;  1JEV A;  2OJT A;  4OVP A;  1FQF A;  2VPO A;  1XHY A;  2Q89 A;  4KHZ E;  1NV6 A;  1B2H A;  4MFI A;  4OVR A;  2ZXT A;  1VFE A;  2DE2 A;  3T9U A;  4Q30 B;  4BDL A;  4THI A;  4MEV A;  1IMC A;  5JTY B;  4QBA A;  5TPA A;  1L5T A;  2V84 A;  3OO9 A;  1MY2 A;  5A5X B;  1YAE A;  3M3F A;  4OFJ A;  2YLN A;  4DXU A;  1TFA A;  4EXL A;  5IAI A;  4LZ5 A;  2I3W A;  1FPF A;  4NHB A;  3FD3 A;  4G61 A;  2DSF A;  1LLS A;  3RT6 B;  4NE4 A;  3E4R A;  4OTE A;  4PDD A;  1US4 A;  5CBS A;  1PDA A;  2QPQ A;  5TPA B;  1MH3 A;  3O29 A;  1BKA A;  2AL4 A;  2ZZW A;  1NV2 A;  1RDX A;  4XEQ A;  3IJO B;  1B51 A;  2ABH A;  4N6D A;  3RUM A;  4GOT A;  3DP6 A;  3MUQ A;  4MCO A;  4OVS A;  2O1L A;  3Q29 A;  4ELO A;  2PMS A;  3OO6 A;  3V89 B;  5ET5 A;  4JWO A;  2O84 X;  1VR5 A;  2DXR A;  3H06 B;  4NF5 A;  2E0S A;  1FTM A;  3H6U A;  4MNC A;  3BIG A;  4DXC A;  3S9E A;  5B7D A;  3M8U A;  2XXW A;  4KR5 A;  3LSX A;  4IO7 A;  3TEL A;  3VE1 B;  1MXY A;  4NWD A;  3UP9 A;  4G68 A;  3B50 A;  4I3Y A;  1OVT A;  3IO6 A;  3FXU A;  2F6P A;  4R2F A;  5ET7 A;  1QJM A;  3CIJ A;  4NF5 B;  4JB7 A;  1DTZ A;  1H43 A;  1XS5 A;  4KYD A;  1B58 A;  1FQE A;  3QIM A;  2VHA A;  4KCC A;  1B05 A;  2UVI A;  4U23 A;  3WAE A;  4G68 B;  5ICT A;  4F3P A;  2D3I A;  5L9O A;  3F11 A;  3O2A A;  4HE0 A;  3T0J A;  2JJK A;  4YKK A;  3ILT B;  3PPQ A;  3K2D A;  4JVC A;  4DLD A;  4GWO A;  1INP A;  2XHD A;  2Y5L A;  3PUV E;  2XWI A;  3TTN A;  1BIY A;  4OQO A;  4MF3 A;  3QXM A;  3L6H A;  1G0I A;  4PDH A;  3V83 A;  4PAI A;  2UVJ A;  1D9V A;  3ODB A;  5DW8 A;  4IGR A;  4OEV A;  5JK4 A;  1SD3 A;  5ESY A;  4GRK A;  4O7I A;  4GX4 A;  2QVR A;  2VGQ A;  4P3L A;  4M4G A;  4QSD A;  1Z7M E;  2HFB A;  1DCU A;  2IEE A;  5LTC A;  1SQY A;  2VD2 A;  5DEX A;  1JET A;  4F18 A;  1FPE A;  5EQ7 A;  3QMF A;  1N3W A;  2X26 A;  4U2R A;  2FNC A;  3VFJ A;  1URD A;  4EF1 A;  1SI0 A;  1MRP A;  3LV0 A;  2F36 A;  4H1X A;  2V3Q A;  3MJN A;  2PVU A;  2H25 A;  3I3V A;  4PF6 A;  1B3H A;  2FVZ A;  3IB0 A;  3SZP A;  4OER A;  4YKP A;  3FXQ A;  3KSJ A;  4KI0 E;  3SER A;  5DEX B;  4F2Q A;  2RC8 A;  2RCB A;  1MM7 A;  2RKM A;  3MZ9 A;  2ZZV A;  1P1Q A;  2ZNU A;  3W9W A;  3RPL A;  3VVE A;  4H8J A;  4KYS A;  2QS2 A;  1P1W A;  5CMB A;  3H6W A;  4OA4 A;  4PF8 A;  5FTH A;  1AIV A;  2DDK A;  5LDZ A;  3UK4 A;  3IJX B;  4U22 A;  1MY3 A;  3CFL A;  2OLB A;  2A5S A;  4LA9 A;  1VDW A;  4OHN A;  4JDF A;  1B46 A;  1FPL A;  4X04 A;  1ANF A;  1FTJ A;  3PPO A;  4R72 A;  1R1N A;  3EHT A;  3RPL B;  3B6Q A;  4O7M A;  3S4U A;  3KN3 A;  1JEU A;  4IY6 A;  4GQO A;  3TCF A;  1FPK A;  2XXH A;  5K2X A;  2XX8 A;  2HZK A;  5JEI A;  3QSL A;  1N76 A;  2HXW A;  4EQ7 A;  1LBC A;  3BFU A;  4LN5 A;  2O69 A;  2XWO A;  1B7Z A;  5KZT A;  2F6G A;  1OQH A;  3MVX A;  1B1H A;  5AA2 D;  5L9M A;  1MY4 A;  3FXR A;  4BDN A;  3FJM A;  5CMK A;  4JBZ A;  1OMP A;  3IOT A;  2DP8 A;  2G93 A;  4NF4 B;  4TLM B;  4MJO A;  5ICQ A;  1I6Q A;  4DCY A;  4PAK A;  1MQD A;  1QKA A;  4OVQ A;  3IFA A;  5F7V A;  4JXI A;  4GVO A;  2HXR A;  1NNF A;  4PC9 A;  3CI8 A;  1ZKB A;  4NED A;  2Y84 A;  4GIZ A;  4R6K A;  4RPN A;  3T9H B;  3FUZ A;  1EYI A;  2GRV A;  4OWD A;  4FOR A;  2F35 A;  3PPP A;  3CR9 A;  3TMG A;  3RTW B;  1FBP A;  2G29 A;  2QMX A;  1II5 A;  2B4M A;  1B4H A;  3DP4 A;  3IOV A;  4GWZ A;  1B7U A;  3G3J A;  3N6T A;  3O6H A;  3GZG A;  4G77 A;  2ONR A;  1KWH A;  4H65 A;  2HEU A;  4BDO A;  3C34 A;  1CB6 A;  1RKM A;  3LSF B;  1D3K A;  3O6I A;  3EF7 A;  1SYH A;  5CI5 A;  1ZU0 A;  3D4C A;  4RK9 A;  1RYX A;  4G8N A;  3V8X B;  1I69 A;  3GBA A;  1OLC A;  3FJ7 A;  3TZA A;  4GWU A;  1DBZ A;  2CZH A;  4NF0 A;  3FJG A;  1BP5 A;  5I3S A;  3C32 A;  2I0B A;  1PBP A;  1SW5 A;  3A3C A;  1S7Y A;  3K02 A;  1H45 A;  3CVG A;  3U72 A;  1KA0 A;  3LUY A;  4XKP A;  3HO7 A;  4G8H A;  2P3V A;  4QSE A;  1NI9 A;  4WXJ A;  2REG A;  4RK2 A;  3HPI A;  4DDD A;  1SPI A;  4AB6 A;  4MAG A;  2FIE A;  2F7B A;  2DOJ A;  3DEL B;  3FAS A;  4BDR A;  1QGX A;  3O9P A;  3ZS6 A;  1GTK A;  3UIF A;  1B32 A;  4PBQ A;  2DE4 A;  2PYY A;  3AXF A;  4O8M A;  5H8S A;  1FJ9 A; 
#chains in the Genus database with same CATH homology
 3TCG A;  4F39 A;  1FQB A;  2Q2C A;  4PFW A;  2I48 A;  4OZ9 A;  1ZMG A;  3S9M C;  2B3F A;  3SDF A;  4C0R A;  4IO3 A;  3KJ7 A;  3O66 A;  2Q9T A;  2DXY A;  4GL0 A;  5H8H A;  2F5X A;  3N94 A;  2LAO A;  2NUV A;  2HCA A;  5L9S A;  2PT1 A;  3FVO A;  5HBC A;  1USY E;  1B1X A;  1QVS A;  2AL5 A;  2P0S A;  4YB7 A;  4OFL A;  3H6T A;  3KN8 A;  3G3K A;  3RPW A;  4HW8 A;  1HSE A;  4FJP A;  1FW0 A;  2UVG A;  3E9X A;  3TUS A;  5H8H B;  1EZP A;  3IR1 A;  4QFP A;  2O7U A;  2X7Q A;  2VOZ A;  5EYF A;  2XD2 A;  5DT6 A;  3G3H A;  5DVF A;  1Q1K A;  1FTK A;  4OFO A;  3TCH A;  3PU5 A;  2BJJ X;  4L17 A;  5KDT A;  4G4P A;  3BFT A;  3MP1 A;  4FED A;  3B6T A;  4ESW A;  1SVX B;  3OD7 A;  5EHS A;  2DWJ A;  3N26 A;  2CMO A;  1IXG A;  1H44 A;  1FQD A;  2XXP A;  2DYX A;  3D4G A;  1XOC A;  1QUL A;  3M3L A;  1FTL A;  1LCF A;  4GF8 A;  5KDT B;  3M3K A;  3PUW E;  3O28 A;  3Q26 A;  2DE3 A;  2ZNS A;  3TYH A;  4FEB A;  4IO5 A;  2D21 A;  3R6U A;  1SW2 A;  1NFT A;  5ITO A;  1PB8 A;  2GHB A;  4DE8 A;  1T0K A;  2XX9 A;  3CSB A;  5AA4 A;  4RNS A;  3G3I A;  3IL1 B;  3SEV A;  5I2K A;  3PUX E;  2R71 A;  1DPE A;  4KD5 A;  2ALU A;  1MXU A;  1TXF A;  2Z22 A;  3S9N C;  1ZJL A;  5IKB A;  1URG A;  3C31 A;  5AA4 B;  2QSX A;  5H8F A;  3KZG A;  5I2K B;  3I5O A;  3C9H A;  1ZIU A;  1MH4 A;  1JQF A;  2QRY A;  5I58 A;  2OWT A;  5FHM A;  2ZMB A;  1UIV A;  1M5E A;  2Z8D A;  3SEW A;  5H8F B;  1M5C A;  1LFH A;  5CM6 A;  2H99 A;  3SET A;  3KJT A;  3VLV A;  5I58 B;  3K01 A;  2P2A A;  1N0T A;  5HM4 B;  1J1N A;  3MP6 A;  4F3G A;  3IX1 A;  4DXB A;  1PEB A;  1Y1M A;  3IO4 A;  4LAT A;  3A3U A;  1SYI A;  4WEP A;  4TQU Q;  3CSG A;  2O68 A;  4LZ8 A;  1LGB C;  1ZTY A;  1Y1Z A;  3MPK A;  4O3C A;  3PMX A;  1HSJ A;  4DCX A;  1NNP A;  3RTF B;  2DS9 A;  2HZL A;  4UAC A;  2KLF A;  4OET A;  3K6V A;  4POW A;  1QUI A;  4FAT A;  2I0C A;  2CZL A;  4OYV A;  5AE4 A;  4NMY A;  4IO2 A;  4R9G A;  1S50 A;  4PP0 A;  4ZEC A;  3SEU A;  4PE5 B;  3K6W A;  4UA8 A;  3OXN A;  2V3T A;  1QKB A;  4MH5 A;  1IXC A;  3UGW A;  3MVW A;  1IEJ A;  3C35 A;  2REJ A;  1Y4C A;  1MY0 A;  3RY3 A;  2H9B A;  2NVU B;  3SES A;  2P1S A;  3OSQ A;  4JSD A;  1Z7N E;  3PGF A;  2HAV A;  3PD9 A;  2NXO A;  5B70 A;  2XXV A;  4F31 B;  1B5I A;  4ZEF A;  1MQI A;  3P7I A;  1LFG A;  1GV8 A;  4C1U A;  1P1O A;  4R74 A;  3HHF A;  4H67 A;  5I2N A;  1B3L A;  2PX1 A;  2RC9 A;  4F29 A;  4POX A;  4KPT A;  5H8Q A;  2ZNT A;  3T93 B;  3IOU A;  4H8I A;  5H8N A;  3RLF E;  3EHS A;  4N07 A;  4U4X A;  1O64 A;  1A55 A;  5I2N B;  1AMF A;  1LCT A;  3KG2 A;  3MC2 A;  3OMB A;  2VD3 A;  5M2V A;  4XXU A;  4F19 A;  3TTR A;  5H8Q B;  4ESX A;  4O3B A;  2DWH A;  5CMC A;  5H8N B;  4YB5 A;  1D9Y A;  1NMU A;  3LSL A;  3N5L A;  5DTB A;  3C36 A;  3EQ1 A;  1UQW A;  5F1Q A;  1LAX A;  1B9J A;  3G3F A;  1LAH E;  2H5Y A;  4IGT A;  4OXV A;  3VV5 A;  3LC8 A;  3CG1 A;  4ELR A;  4RY1 A;  3C33 A;  1SW4 A;  3K6X A;  4EDP A;  4I1D A;  1B7H A;  3HV1 A;  4U1O A;  4NF8 A;  3H6V A;  1R9L A;  3THI A;  2I49 A;  5CBR A;  3ECR A;  2GHA A;  2XXU A;  3V5A A;  1FQA A;  4TLL B;  3TQW A;  3R26 A;  2FYI A;  3ONM A;  4F1V A;  3FVK A;  4FEC A;  1GVC A;  4F1Y A;  2HQ0 A;  3QUF A;  4MLQ A;  1Y3P A;  4NF8 B;  3BKI B;  3OEK A;  1LBB A;  1B3G A;  1USY H;  3MW0 A;  2H98 A;  2QJE A;  2X7P A;  2QS4 A;  4U21 A;  5I57 A;  2Y7P A;  2OCU A;  1IZ1 A;  3SEY A;  1LFI A;  4OVJ A;  3PMW A;  1TWY A;  1B3E A;  3TDJ A;  3K1N A;  1PBQ A;  3K1M A;  1JNF A;  1LB8 A;  4OEN A;  3I6V A;  4PET A;  3K00 A;  3HST A;  5I57 B;  4LQ2 A;  4YMA A;  4EQ9 A;  3GBB A;  3CRB A;  3FAT A;  4IO6 A;  2UYF A;  3TKD A;  3G3G A;  4ZEK A;  4BLA A;  3QYT A;  4I9D A;  4LZ7 A;  1R9Q A;  1N84 A;  5AA3 A;  1EH3 A;  4U4S A;  2W7Y A;  1H3D A;  3K1P A;  4KFQ A;  1JW1 A;  1NKX A;  1I6B A;  2B65 A;  4KYE A;  2B3B A;  4KCD A;  4RYA A;  5CRY A;  4ZE9 A;  1NL5 A;  1A8F A;  2DQV A;  5FHO A;  4RA1 A;  1Q35 A;  2I3V A;  4AB5 A;  5LOM A;  4GXS B;  4YU0 A;  3CG3 A;  1GGG A;  4ECF A;  1A54 A;  5AA1 A;  1LST A;  2V3U A;  4IB2 A;  2DWI A;  1B3F A;  4ZED A;  2QMW A;  3KOS A;  1DPP A;  1O7T A;  4H6D A;  1IXI A;  3DM0 A;  3FVN A;  2RF1 A;  2Z23 A;  4XIG Q;  5EHM A;  3U94 A;  3UOR A;  1XVX A;  3U1O A;  3U92 A;  3MQ9 A;  4Q8R A;  1ZLQ A;  1NNK A;  3IK6 B;  4YAH X;  3WAF A;  3ILU B;  3IOW A;  2GH9 A;  4X1B A;  1A7L A;  2OK2 A;  2ZYO A;  1NH8 A;  4EQB A;  3FV2 A;  2ZYK A;  4IY5 A;  2Y7R A;  1B5J A;  3OEM A;  1ELJ A;  4YKJ A;  3N6U A;  2QS3 A;  1LAG E;  2ANJ A;  1OLA A;  2H4I A;  1IUD A;  1UTB A;  1B6H A;  3OSR A;  3KSX A;  5I59 A;  4YIC A;  4PFT A;  4PFU A;  2GFE A;  1LB9 A;  2V25 A;  3QAX A;  2UVH A;  3MPL A;  2O7I A;  3VLU A;  3FGS A;  1SI1 A;  1OQG A;  5FHN A;  4U1Z A;  3FVG A;  5BWJ A;  3ZKK A;  1Y4T A;  1UTB B;  5I59 B;  2OWS A;  4P11 A;  3TTK A;  4YKI A;  3Q28 A;  1N04 A;  2NOO A;  2VP1 A;  4LQ5 A;  1B5H A;  3Q25 A;  3ZKL A;  1UTH A;  4EXK A;  1MDP 1;  3R7X A;  4NWC A;  1MPC A;  3KOT A;  3IOR A;  2F7C A;  4G2Z A;  1PB9 A;  1IXH A;  3Q27 A;  4RPO A;  3JV9 A;  4Q0C A;  3K4U A;  3E3K A;  2Y7K A;  2F78 A;  1N3X A;  1RYO A;  3FIR A;  4JWX A;  3K0V A;  2UYE A;  3PPR A;  2XXI A;  4I8C A;  1WOD A;  3VVD A;  3UN6 A;  3H03 A;  1MPD A;  1UTH B;  4O3A A;  1FTO A;  1EZO A;  4FAJ A;  1OVB A;  4KQP A;  1FCK A;  4GL8 A;  5KCJ A;  1XVY A;  3A09 A;  3PV0 E;  4ELQ A;  5I84 A;  5K2Y A;  5I56 A;  5DYH A;  2E1S A;  1MXX A;  4QSC A;  5CC2 A;  4Z0I A;  3B6W A;  3LR1 A;  4RXL A;  1R6Z A;  4TOZ A;  3MAM A;  3RT8 A;  1IIW A;  2Z8E A;  2XXQ A;  1IIT A;  5KCJ B;  1BTJ A;  5CMM A;  3KBR A;  4F3B A;  2V93 A;  2XXY A;  5I56 B;  2PT2 A;  3JYR A;  1S9T A;  3RNN A;  4YMB A;  1H76 A;  2WKY A;  1Y20 A;  1Y3N A;  4YB6 A;  3SEX A;  3KEI A;  2I4C A;  1N7X A;  3S2V A;  3T96 B;  1MQJ A;  1DTG A;  3CFX A;  1B40 A;  3OOA A;  1VSO A;  3SKP A;  3LBS A;  5ISU A;  3JZJ A;  1US5 A;  1P1U A;  3DP8 A;  4ISU A;  1Y9U A;  1XC1 A;  4DZ1 A;  1POT A;  1HSL A;  1MXZ A;  2ZYM A;  4F3S A;  3S9L C;  1WVJ A;  2Z8F A;  3PPN A;  2XXR A;  4RJZ A;  1URS A;  3QUJ A;  1B0H A;  1NH7 A;  3MZ1 A;  3T22 A;  3TPA A;  4HCW A;  5ELV A;  2FA7 A;  4N13 A;  3K6U A;  1O63 A;  2F34 A;  1M5D A;  4F1U A;  4G8M A;  2O51 A;  4PQJ A;  2F97 A;  4Z7E A;  3HHG A;  4C1T A;  3VLW A;  4LP2 B;  5AA2 A;  4QFL A;  3HN0 A;  3MVY A;  4E0W A;  1AOV A;  1PB7 A;  3RN8 A;  1B4Z A;  1M5B A;  4BDQ A;  4NTL A;  3MP8 A;  3MWB A;  1FQC A;  2QS1 A;  1MG1 A;  2RCA A;  1LAF E;  2RIN A;  3W15 C;  1SBP A;  1D4N A;  1MS7 A;  3TEP A;  1M5F A;  4G68 C;  1B52 A;  4X48 A;  3FZV A;  4H5G A;  3B7D A;  1BLF A;  1QW0 A;  1MDQ A;  5AA2 B;  4P0I A;  3H3G A;  3C4M A;  3IB1 A;  3L6G A;  2O1M A;  2THI A;  3W9V A;  1UIU A;  4E0X A;  2XD3 A;  4DIG A;  2NWJ A;  3MVZ A;  3PMV A;  4XKR A;  4ND9 A;  4NF4 A;  2ONK E;  4HS7 A;  3OO7 A;  4LUB A;  2DVZ A;  4AQ4 A;  4ONY A;  4ZEB A;  1MQH A;  4QFO A;  4GXA A;  2AYS A;  1CE2 A;  4GLI A;  2R6G E;  1P1N A;  1B0L A;  2I6E A;  1ZBM A;  4LVQ A;  3USD A;  2Q2A A;  4ZZA A;  1MQG A;  3PD8 A;  1VFD A;  4EUO A;  1EU8 A;  1AL3 A;  3IB2 A;  2F7A A;  3TOD A;  2PBW A;  4FIM A;  2XXX A;  4QF9 A;  2R9J A;  3DLN A;  4NF6 A;  4R73 A;  4GFR A;  4JWY A;  4QRZ A;  4ZS9 A;  3KN7 A;  1TFD A;  1ATG A;  4WKM A;  1JW5 A;  4HCY A;  4MBP A;  1A40 A;  1SDX A;  3BBR A;  3PUZ E;  1YPN A;  1YCJ A;  1QUJ A;  1AH5 A;  4X9T A;  2OZZ A;  3VXB A;  1XT8 A;  4JSO A;  1JVX A;  1YTV A;  2Y7I A;  1F9B A;  4OES A;  1P99 A;  4NF6 B;  3TAJ A;  3VXC A;  3T9X B;  3OO8 A;  3MBP A;  1DOT A;  2XX7 A;  4F2O A;  2I58 A;  3CFZ A;  1N7W A;  1EZ9 A;  2Q8J A;  1JVY A;  4M1V A;  3TTL A;  3LSW A;  4OMB A;  5HPQ A;  1A99 A;  1IQ7 A;  2ZYN A;  2YPN A;  2XXT A;  2M8C A;  3E13 X;  4XTC Q;  3GLB A;  3ZSF A;  5TU0 A;  4X1D A;  4P0G A;  2A5T A;  3KGC A;  4ZE8 A;  3UA8 A;  4OEU A;  3VVF A;  1WDN A;  2I4B A;  5DVI A;  4ELP A;  2UXA A;  4YZZ A;  4ZZE A;  4QHQ A;  4ZDM A;  2D5W A;  2AIX A;  4QFN A;  3TTM A;  3G7W A;  2A5T B;  3EHU A;  2Q88 A;  4R75 A;  4R9F A;  1Y3Q A;  5TP9 A;  1VE4 A;  1NNT A;  3U93 A;  3H4Z A;  4ZEI A;  1PC3 A;  4QFK A;  3O6G A;  3U8Q A;  4I62 A;  2F8D A;  1I6A A;  1GR2 A;  3OEL A;  2HAU A;  1POY 1;  3GXA A;  4K3F A;  3FV1 A;  3PUY E;  5BUU A;  4Q5T A;  5TP9 B;  3HCQ A;  3RQT A;  2QL3 A;  3T66 A;  3QK6 A;  3RGY A;  1MPB A;  3MZB A;  1JW4 A;  5L8D A;  4FE8 A;  2ONS A;  2Y7W A;  1MY1 A;  1TT1 A;  5ITP A;  4EF2 A;  4F22 A;  4XKN A;  2YJP A;  3T9V A;  4BDM A;  2ESN A;  5DVJ A;  5J1D A;  4N6P A;  3TQL A;  4HTG A;  2OBG A;  1QUK A;  3EN3 A;  1OIB A;  3OEN A;  4H0W A;  2DWA A;  2DVC A;  4XKQ A;  1DMB A;  3EPE A;  2IA4 A;  4R6Y A;  3VDF A;  2O6A A;  5FTI A;  1MXW A;  3IAZ A;  4WED A;  3TFL A;  4IO4 A;  4H5F A;  4R2B A;  4GD5 A;  1MXV A;  3H7M A;  5JTY A;  4MLV A;  4PFY A;  4LON B;  4R6H A;  1A8E A;  3O97 A;  1MM6 A;  5A5X A;  3KFM A;  1DSN A;  1SW1 A;  2RC7 A;  1JEV A;  2OJT A;  1FQF A;  1XHY A;  2Q89 A;  4KHZ E;  1B2H A;  4MFI A;  2ZXT A;  1VFE A;  2DE2 A;  3T9U A;  4Q30 B;  4BDL A;  4THI A;  5JTY B;  5TPA A;  1L5T A;  2V84 A;  3OO9 A;  1MY2 A;  5A5X B;  1YAE A;  3M3F A;  4OFJ A;  2YLN A;  4DXU A;  1TFA A;  4EXL A;  5IAI A;  4LZ5 A;  2I3W A;  3FD3 A;  2DSF A;  1LLS A;  3RT6 B;  4NE4 A;  3E4R A;  4OTE A;  1US4 A;  5CBS A;  1PDA A;  2QPQ A;  5TPA B;  1MH3 A;  3O29 A;  1BKA A;  2AL4 A;  3IJO B;  1B51 A;  2ABH A;  3RUM A;  4GOT A;  3DP6 A;  3MUQ A;  2O1L A;  3Q29 A;  4ELO A;  2PMS A;  3OO6 A;  3V89 B;  4JWO A;  2O84 X;  1VR5 A;  2DXR A;  3H06 B;  4NF5 A;  2E0S A;  1FTM A;  3H6U A;  3S9E A;  4DXC A;  5B7D A;  3M8U A;  2XXW A;  4KR5 A;  3LSX A;  4IO7 A;  3TEL A;  3VE1 B;  1MXY A;  4NWD A;  3UP9 A;  4G68 A;  1OVT A;  3IO6 A;  3FXU A;  2F6P A;  4R2F A;  1QJM A;  3CIJ A;  4NF5 B;  4JB7 A;  1DTZ A;  1H43 A;  1XS5 A;  4KYD A;  1B58 A;  1FQE A;  3QIM A;  2VHA A;  4KCC A;  1B05 A;  2UVI A;  4U23 A;  3WAE A;  4G68 B;  5ICT A;  4F3P A;  2D3I A;  5L9O A;  3F11 A;  3O2A A;  4YKK A;  3ILT B;  3PPQ A;  3K2D A;  4DLD A;  4GWO A;  2XHD A;  3PUV E;  3TTN A;  1BIY A;  4OQO A;  4MF3 A;  3QXM A;  3L6H A;  3V83 A;  2UVJ A;  1D9V A;  3ODB A;  4IGR A;  4OEV A;  5JK4 A;  1SD3 A;  4GRK A;  2VGQ A;  4M4G A;  4QSD A;  1Z7M E;  2HFB A;  2IEE A;  1SQY A;  2VD2 A;  5DEX A;  1JET A;  4F18 A;  1N3W A;  2X26 A;  4U2R A;  2FNC A;  3VFJ A;  1URD A;  4EF1 A;  1SI0 A;  1MRP A;  2F36 A;  4H1X A;  2V3Q A;  3MJN A;  2PVU A;  2H25 A;  3I3V A;  1B3H A;  3IB0 A;  4OER A;  4YKP A;  3FXQ A;  3KSJ A;  4KI0 E;  3SER A;  5DEX B;  4F2Q A;  2RC8 A;  2RCB A;  1MM7 A;  2RKM A;  3MZ9 A;  1P1Q A;  2ZNU A;  3W9W A;  3VVE A;  4H8J A;  4KYS A;  2QS2 A;  1P1W A;  5CMB A;  3H6W A;  5FTH A;  1AIV A;  3UK4 A;  3IJX B;  4U22 A;  1MY3 A;  3CFL A;  2OLB A;  2A5S A;  4LA9 A;  4OHN A;  4JDF A;  1B46 A;  1ANF A;  1FTJ A;  3PPO A;  4R72 A;  1R1N A;  3EHT A;  3B6Q A;  3S4U A;  3KN3 A;  1JEU A;  4IY6 A;  4GQO A;  3TCF A;  5K2X A;  2XXH A;  2XX8 A;  2HZK A;  5JEI A;  3QSL A;  1N76 A;  2HXW A;  4EQ7 A;  1LBC A;  3BFU A;  2O69 A;  1B7Z A;  5KZT A;  2F6G A;  1OQH A;  3MVX A;  1B1H A;  5AA2 D;  5L9M A;  1MY4 A;  3FXR A;  4BDN A;  3FJM A;  5CMK A;  4JBZ A;  1OMP A;  3IOT A;  2DP8 A;  2G93 A;  4NF4 B;  4TLM B;  5ICQ A;  1I6Q A;  4DCY A;  1MQD A;  1QKA A;  5F7V A;  4JXI A;  4GVO A;  1NNF A;  3CI8 A;  1ZKB A;  4NED A;  2Y84 A;  4GIZ A;  4R6K A;  4RPN A;  3T9H B;  3FUZ A;  2GRV A;  4OWD A;  4FOR A;  2F35 A;  3PPP A;  3CR9 A;  3TMG A;  3RTW B;  2G29 A;  2QMX A;  1II5 A;  1B4H A;  3DP4 A;  3IOV A;  1B7U A;  3G3J A;  3N6T A;  3O6H A;  3GZG A;  4G77 A;  2ONR A;  1KWH A;  4H65 A;  2HEU A;  4BDO A;  3C34 A;  1CB6 A;  1RKM A;  3LSF B;  1D3K A;  3O6I A;  3EF7 A;  1SYH A;  5CI5 A;  1ZU0 A;  3D4C A;  4RK9 A;  1RYX A;  4G8N A;  3V8X B;  1I69 A;  3GBA A;  1OLC A;  3FJ7 A;  3TZA A;  3FJG A;  1BP5 A;  3C32 A;  2I0B A;  1PBP A;  1SW5 A;  3A3C A;  1S7Y A;  3K02 A;  1H45 A;  3CVG A;  3U72 A;  3LUY A;  4XKP A;  3HO7 A;  4G8H A;  4QSE A;  4WXJ A;  2REG A;  4RK2 A;  3HPI A;  4DDD A;  4AB6 A;  2F7B A;  2DOJ A;  3DEL B;  3FAS A;  4BDR A;  3O9P A;  3ZS6 A;  1GTK A;  3UIF A;  1B32 A;  2DE4 A;  2PYY A;  3AXF A;  5H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...