1WDNA

Glutamine-binding protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
223
structure length
223
Chain Sequence
KLVVATDTAFVPFEFKQGDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (binding protein/peptide)
molecule keywords GLUTAMINE BINDING PROTEIN
publication title The structure of glutamine-binding protein complexed with glutamine at 1.94 A resolution: comparisons with other amino acid binding proteins.
pubmed doi rcsb
total genus 74
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 1997-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1wdnA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1wdnA01
5ITOA 2PBWA 1UTBA 5CC2A 2YLNA 2HCAA 4NWDA 2PYYA 5TPAB 2Q8JA 4F39A 4I9DA 4NE4A 1ATGA 2Y7WA 4H5FA 5I2NB 2YJPA 3ECRA 3JV9A 5L9OA 4GL8A 3OO8A 4I1DA 4ZE8A 4ISUA 4RPOA 2QS2A 3VV5A 4QHQA 3W15C 3VDFA 4QFLA 4DE8A 4JWYA 5I57B 3QXMA 1P99A 1GR2A 1SBPA 2VGQA 3FVOA 3S9MC 2RCAA 3HCQA 4OETA 5DT6A 1I6AA 2O7UA 1OQHA 2OCUA 3CG3A 2G93A 1B3FA 4U1OA 2AL4A 4OEVA 1BP5A 4MBPA 4ECFA 2QJEA 4QSCA 2REGA 4DCYA 2HAVA 4GIZA 4THIA 3KFMA 1ZIUA 4KI0E 2RF1A 4YICA 5DVIA 3G3KA 3IO4A 1H76A 1FQFA 4F3PA 3TMGA 3QUFA 2F6PA 3LUYA 4BDNA 3U92A 4QFOA 2B3BA 2Y7KA 4JDFA 1FQAA 2XX8A 3U72A 3UK4A 4QFPA 1SW5A 1PC3A 5EHSA 1TFAA 3E9XA 5FHNA 3VLWA 1NL5A 3G3HA 4LVQA 5H8SA 2GFEA 3IOTA 1ZU0A 2XX9A 3U94A 4F1VA 1TXFA 3OSQA 1YPNA 5ICTA 3FJMA 3ILUB 4F2OA 2QSXA 3QIMA 1DPPA 2KLFA 5I2NA 4LA9A 4C1UA 1IIWA 2QMWA 3FXQA 2ANJA 4LZ8A 3MP6A 1MY3A 4QSDA 2AYSA 1D4NA 3TYHA 5I57A 4LP2B 2XXUA 3CFLA 4TOZA 2F6GA 4U2RA 1QKAA 3S9NC 3RGYA 3C32A 3TELA 2V84A 3RLFE 2I0CA 1DSNA 2Y7PA 1D3KA 3UORA 2PMSA 3KZGA 2DSFA 4YKKA 2PT2A 2IEEA 1N7WA 4GQOA 2CZLA 3O9PA 4X1BA 4H8JA 3T96B 2QRYA 4GVOA 2HAUA 3D4GA 4NF4B 3IB1A 3V83A 1WVJA 4OMBA 3MPKA 1SW4A 4RXLA 1EZPA 1FQEA 3K6WA 5H8FB 2QMXA 4KPTA 4OQOA 5H8QB 1N3WA 1VFDA 4OVJA 4YMAA 3VFJA 4GFRA 3E4RA 2QL3A 4IO2A 4EQBA 5KZTA 3H6WA 1PEBA 3EPEA 1O64A 4GL0A 3KSXA 1I69A 4NF8B 1NH8A 1USYH 4YAHX 4RK2A 3TCFA 4H0WA 3G3IA 3CFXA 1GV8A 3P7IA 2ONRA 2XXYA 5CI5A 4ZZEA 5F1QA 2AL5A 1A40A 3KJTA 1YAEA 3Q28A 4R2BA 4KFQA 2DWHA 2ZNSA 4HW8A 4QFKA 2WKYA 1EU8A 5AA2D 3C9HA 3N26A 2ZNTA 3HSTA 2NOOA 3MBPA 3B7DA 2GHAA 4OZ9A 2DQVA 4FE8A 4ZEIA 4OFLA 4XKNA 4ZEKA 5DEXB 2HZKA 3OEKA 1VFEA 4N6PA 3RQTA 1VR5A 3IAZA 2FA7A 4C1TA 4RYAA 5KDTB 1I6QA 3HPIA 1B32A 2W7YA 2ZYMA 1MPDA 4NMYA 5ISUA 3M3FA 3KG2A 1MS7A 3T9HB 3OOAA 3SERA 1ANFA 1JW4A 4U23A 2Z8EA 1LGBC 4OTEA 3TUSA 2DOJA 3R26A 1FCKA 1N76A 2Z8DA 5TU0A 1IXCA 3TODA 4DXBA 3JYRA 3VLVA 3VE1B 3RY3A 5FHMA 4KCCA 2QS3A 4NF4A 5AA2B 1BTJA 1NFTA 5H8FA 3MP8A 3MVWA 2O1LA 5JEIA 3FZVA 3FVNA 1LAXA 4QFNA 1ZTYA 3FV2A 5JTYB 3Q29A 4ELPA 3TZAA 3LSFB 4NF8A 3M3KA 2REJA 5DVFA 1LFIA 3BKIB 3TCGA 1SW2A 4RPNA 2D5WA 4JB7A 4OERA 3T9VA 1H45A 3K6UA 2UVIA 3R6UA 4PFYA 3GLBA 3OSRA 5LOMA 2XXRA 4OWDA 1N84A 2PVUA 3T22A 4BDLA 4JSDA 2DWJA 4GOTA 2XXQA 2OK2A 4PETA 2I0BA 1JQFA 2GRVA 4U22A 3FUZA 1MQIA 2H9BA 1FTKA 1XVXA 4JWXA 3K0VA 1HSJA 3PUYE 5DEXA 4F1UA 1ZKBA 2I3VA 2ALUA 4OYVA 3IB2A 3RT6B 3K02A 1VE4A 4BDMA 3SEVA 5A5XB 3DP8A 4ZECA 4HCYA 4IB2A 3O6IA 3LSXA 5KDTA 3PPPA 1B5HA 1Y3NA 2O51A 4EQ9A 1MG1A 2A5TB 4I62A 1Y3PA 4YU0A 1SVXB 4ESWA 1Q35A 3PUVE 4RK9A 5I59B 4F3SA 1JEUA 3ZKLA 3BBRA 4EF2A 3PMXA 1B9JA 4IO3A 4F31B 4NWCA 4DXCA 3KGCA 2XXHA 4E0XA 1H3DA 1YCJA 3R7XA 2Y84A 3TKDA 1H44A 4ELRA 2Y7RA 3TTMA 1LB8A 1HSEA 3IO6A 5JTYA 4NF5B 3OD7A 3RPWA 2DE2A 5HM4B 3C35A 1P1OA 4AB6A 5H8NB 4G2ZA 2FNCA 2Y7IA 4WXJA 4Z0IA 1H43A 2H98A 4E0WA 1LLSA 3JZJA 1URGA 1O63A 4N13A 1NNKA 4F29A 4XXUA 1Y9UA 4X1DA 2HXWA 4TQUQ 3EN3A 3MAMA 2FYIA 4QRZA 2XXXA 2XXVA 4Q8RA 4G8MA 2UYEA 4AQ4A 3TTNA 2VHAA 1N3XA 2DWIA 3G3GA 1B1HA 4TLMB 5CM6A 4F19A 3HHFA 1D9YA 4YKPA 4ONYA 4YKIA 3Q26A 3V8XB 3MJNA 3HN0A 4N07A 3K1PA 5K2XA 2F7AA 2A5TA 2H25A 2UYFA 1XVYA 3N5LA 2DXRA 3EF7A 1S9TA 4F3GA 5BUUA 1S50A 2OJTA 2I48A 3UP9A 4G8HA 2VP1A 1EH3A 3A3CA 3DP6A 5I59A 3K6VA 1MY4A 3EHTA 1SDXA 4PFUA 3CG1A 4POXA 3IOUA 4KR5A 3MVZA 4XTCQ 1RKMA 4X9TA 2OBGA 5FHOA 1URSA 1B52A 1OIBA 3UGWA 4JSOA 4FORA 3QK6A 1M5CA 2AIXA 1PB8A 2UVHA 1B4ZA 4M1VA 1B40A 3K00A 2I58A 4LONB 1B5IA 4XKQA 1ELJA 2P0SA 2XD3A 3MZ9A 1Y3QA 3VVDA 2O1MA 1FQDA 4OFOA 3S9EA 5H8NA 3I3VA 1BKAA 4G77A 4F3BA 5DTBA 1SQYA 2OZZA 1PDAA 3KOSA 2NXOA 3VXBA 3LC8A 3KEIA 4GD5A 4FATA 4MH5A 5I84A 3U8QA 1MPBA 5L8DA 1MY2A 3FVKA 5TPAA 1CE2A 2ABHA 1RYXA 4RNSA 1JVXA 1Y1ZA 2OLBA 1LAGE 4DIGA 3QAXA 5DVJA 1MQJA 4PQJA 2PT1A 2XHDA 3VVEA 4U4XA 4OESA 1LAHE 2ZMBA 1IZ1A 1ZLQA 2I4CA 4OEUA 2ZNUA 5CMBA 4KCDA 1DTZA 3MP1A 3ONMA 1B51A 4MFIA 3SEYA 3H6VA 3Q25A 1B7ZA 3OO7A 1NMUA 3IOWA 2O69A 1R9LA 2BJJX 4PE5B 3O66A 1A8FA 4IO7A 3O28A 4H67A 3MUQA 3PV0E 1MPCA 1ZMGA 2H5YA 1IXHA 4LATA 3CSBA 1OQGA 2DE4A 4R2FA 1MH3A 1JW1A 1B0LA 1DOTA 2RC8A 4MLQA 3N6TA 3F11A 2DWAA 2HQ0A 4HCWA 2Q89A 2RINA 1IITA 3RTFB 2GH9A 1PBQA 2V93A 1ZJLA 3SEXA 3FVGA 3GBAA 3E13X 1MDP1 1PBPA 2R9JA 1OVBA 2Z23A 3I5OA 2RKMA 4H6DA 1QUJA 4U4SA 1Z7NE 4R9GA 1MXUA 4O3AA 3EHUA 3RT8A 2XXIA 1FW0A 3LR1A 3C34A 3IX1A 3PU5A 3RNNA 3MQ9A 2XXPA 1A99A 3M3LA 4UA8A 3ODBA 4EF1A 2ZXTA 4H8IA 2OWSA 4PFWA 3U1OA 1NH7A 2F8DA 3O29A 1FTJA 1AOVA 1AH5A 1TWYA 5I58B 2VD2A 3MZ1A 4R6YA 4F1YA 2QPQA 3M8UA 4RA1A 1FQBA 3LSLA 3BFUA 3FIRA 1LAFE 2D3IA 3TEPA 2HEUA 4FIMA 2E0SA 3FJGA 3IB0A 3T93B 1MQDA 3PUZE 2F78A 3T66A 4H1XA 2A5SA 3PMWA 1EZ9A 1RYOA 3EQ1A 2I49A 3ZS6A 3IL1B 4F22A 5CBRA 4Z7EA 5H8QA 3IORA 4K3FA 1VSOA 5AA3A 3H4ZA 1LFGA 3V5AA 1FTOA 5DYHA 3FV1A 4G68B 4ZZAA 1FTLA 5TP9B 4H65A 1EZOA 4PP0A 1SYHA 2R6GE 3PUWE 1T0KA 1QJMA 3PPRA 1N04A 5I56B 1L5TA 3PMVA 2Q88A 3PPQA 2DE3A 2DS9A 1S7YA 3MW0A 4P0GA 3VLUA 4UACA 4MLVA 4YB5A 1O7TA 1M5EA 2QS4A 1SD3A 1QVSA 1UIVA 3B6TA 3OELA 2ONSA 2H4IA 4ZEBA 2YPNA 5KCJB 5M2VA 4LQ5A 4Q0CA 3S4UA 4PFTA 2THIA 2UXAA 4RJZA 1MQHA 3SETA 2NWJA 1B0HA 2F7BA 5I58A 2E1SA 5B7DA 5CMKA 1MH4A 1MXXA 1D9VA 1MDQA 2O84X 2O68A 3TTLA 4DDDA 4OXVA 4YB6A 1B6HA 5ITPA 1QW0A 2ESNA 3UA8A 3Q27A 5FTHA 2RC9A 4F2QA 1B4HA 1N7XA 1US4A 3TDJA 2D21A 4M4GA 4GRKA 3EHSA 1R6ZA 4KYSA 3RN8A 5AA2A 5EHMA 3CRBA 4FEDA 2Q2CA 2RC7A 1GTKA 1FQCA 2LAOA 4R9FA 3SDFA 5B70A 2UVJA 5L9SA 2B65A 4G68A 2V3TA 1YTVA 1AMFA 1MQGA 3TTKA 3CIJA 3G7WA 5TP9A 4LZ5A 2XX7A 1GGGA 3K1MA 3O6HA 4XKRA 4BLAA 4NTLA 1B58A 1Y20A 4GLIA 4O3CA 3S9LC 3N6UA 5I56A 1JETA 4ZE9A 2V3UA 2Q9TA 3ILTB 3QUJA 2I6EA 1KWHA 3IR1A 1TT1A 1DMBA 1MXVA 1B05A 2HZLA 4NF6B 5I2KB 3C36A 3TFLA 3G3FA 1OLCA 3HV1A 5HPQA 1B5JA 3T9UA 3LSWA 1WODA 1Y1MA 2DVZA 4LZ7A 3DP4A 4ELQA 5KCJA 3IJOB 1LBCA 3PUXE 1P1QA 1UTHB 2XD2A 3OENA 5A5XA 3W9WA 5FTIA 4BDQA 1MXZA 3DLNA 1MXYA 4G4PA 1B7UA 2F34A 4G8NA 3C33A 1XHYA 4XKPA 4EDPA 3KJ7A 3DELB 4KYDA 3PD8A 3CR9A 4FAJA 4L17A 4EXKA 3SESA 4R6KA 5JK4A 1Q1KA 3UN6A 1DTGA 1IXGA 2ZYKA 3SEUA 1US5A 1QUIA 1A7LA 1QULA 2G29A 1JW5A 3WAEA 3TQLA 4R73A 1A54A 3A3UA 4GXSB 1A55A 3H03A 2Z22A 3K01A 3K1NA 2ZYOA 4I8CA 4NF5A 3O2AA 1B3LA 4ZS9A 4JWOA 3KN8A 3QSLA 3KN7A 2X7PA 3GBBA 4KHZE 1Y4CA 1M5FA 3FD3A 4YKJA 4HTGA 3H3GA 1CB6A 3TTRA 1B3HA 1B7HA 3PGFA 3PPNA 3D4CA 4C0RA 3E3KA 1MY0A 2X26A 2DVCA 5L9MA 3MZBA 2GHBA 4IGRA 5H8HB 4NF6A 1JEVA 1LBBA 2RCBA 5I2KA 5AA4B 3O6GA 3UIFA 3WAFA 1R1NA 1AIVA 3TAJA 4ZEFA 1JNFA 2B3FA 1JVYA 4Q30B 3DM0A 1I6BA 1UTHA 1POTA 3U93A 3G3JA 4X48A 1IXIA 2OWTA 1AL3A 4IO4A 4EQ7A 3KOTA 3MVXA 3IOVA 1TFDA 4YZZA 1J1NA 2VOZA 2XXTA 2HFBA 3MWBA 2NUVA 3K6XA 1MM7A 3L6GA 1BIYA 4P11A 2DYXA 5F7VA 3H6TA 5J1DA 2Q2AA 2O6AA 2R71A 3MVYA 1M5BA 4GF8A 1SYIA 1QKBA 1XT8A 2V25A 1OMPA 1NNTA 4ZEDA 1B3EA 2I3WA 3K2DA 3VXCA 1NNFA 1BLFA 3O97A 5IAIA 4OFJA 3HO7A 1LFHA 2O7IA 1Y4TA 2I4BA 4HS7A 1B1XA 3AXFA 1USYE 4POWA 3GZGA 1B2HA 4LQ2A 2F97A 1XC1A 1M5DA 4IO6A 1LB9A 2V3QA 5CBSA 1A8EA 1QUKA 3PD9A 3MPLA 2Z8FA 5H8HA 3HHGA 3TCHA 3USDA 4KQPA 3TPAA 3N94A 5AA4A 5CMMA 4WEPA 4EUOA 4DZ1A 5CMCA 4GXAA 4TLLB 2F35A 2F36A 3TQWA 3ZSFA 3BFTA 3C4MA 1WDNA 1XOCA 3B6WA 1HSLA 1DPEA 2H99A 3A09A 1SI1A 4AB5A 2P2AA 3OMBA 1Z7ME 3THIA 5AE4A 1MY1A 1LCTA 3ZKKA 4Q5TA 1GVCA 2VD3A 2X7QA 4BDRA 3H7MA 1LSTA 3W9VA 1SW1A 1IEJA 1B46A 1P1NA 1OLAA 1F9BA 1N0TA 3FGSA 4IO5A 4U1ZA 1LCFA 4DCXA 1OVTA 3FASA 4ND9A 4O3BA 4WKMA 4IGTA 1SI0A 3LBSA 3CI8A 3OXNA 1MM6A 2F5XA 5EYFA 2P1SA 3FXRA 4G68C 3FXUA 2PX1A 5ELVA 4U21A 4WEDA 1PB9A 2CMOA 4R72A 4KYEA 1POY1 1MRPA 4YMBA 1UIUA 2DP8A 3KBRA 3OO9A 1NKXA 4QSEA 1UTBB 4BDOA 1P1UA 2QS1A 4R75A 5AA1A 4YB7A 2DXYA 4P0IA 3S2VA 3CFZA 2UVGA 3KN3A 4GWOA 4FJPA 3CVGA 4JXIA 4RY1A 3MC2A 4ESXA 3CSGA 2M8CA 3FATA 4XIGQ 1UQWA 4OHNA 3SEWA 2F7CA 4F18A 5HBCA 3OEMA 3K4UA 3T9XB 2IA4A 1FTMA 3FJ7A 4FECA 4ELOA 1XS5A 3C31A 3H06B 1II5A 4EXLA 3IK6B 4NEDA 1IQ7A 3RUMA 3B6QA 3VVFA 1R9QA 4KD5A 4H5GA 4R6HA 5BWJA 3PPOA 4LUBA 3V89B 2ONKE 4DLDA 5ICQA 3H6UA 5K2YA 4R74A 4IY5A 4FEBA 3OO6A 1MXWA 4OENA 4ZDMA 1PB7A 5CRYA 3QYTA 5IKBA 2NVUB 2XXWA 1IUDA 4DXUA 3GXAA 3KSJA 4JBZA 3RTWB 1P1WA 1NNPA 4IY6A 3SKPA 1B3GA 1URDA 4QF9A 4MF3A 3L6HA 2ZYNA 1ZBMA 3IJXB 3I6VA
chains in the Genus database with same CATH superfamily
5ITOA 1NV3A 5IGAA 2PBWA 4O94A 1DCUA 1UTBA 5CC2A 2YLNA 2HCAA 4NWDA 2PYYA 5TPAB 2Q8JA 4F39A 4I9DA 1FPFA 2WYPA 4NE4A 1ATGA 2Y7WA 4H5FA 5I2NB 2YJPA 3ECRA 3JV9A 5L9OA 4N6DA 4GL8A 3OO8A 4I1DA 4ZE8A 4ISUA 2OX3A 4RPOA 2QS2A 3VV5A 4GWWA 4QHQA 3W15C 3FBPA 3VDFA 4QFLA 4DE8A 4JWYA 4MNCA 5I57B 3QXMA 1P99A 1GR2A 1SBPA 2VGQA 3FVOA 3S9MC 2RCAA 3HCQA 4OETA 5DT6A 1I6AA 2O7UA 1OQHA 2OCUA 1RDZA 3CG3A 2G93A 1B3FA 4U1OA 2AL4A 4OEVA 1BP5A 4MBPA 4ECFA 2QJEA 1FPBA 4QSCA 2REGA 4DCYA 2HAVA 4GIZA 4THIA 3KFMA 1LBVA 1ZIUA 4KI0E 2RF1A 4YICA 5DVIA 1KA1A 3G3KA 3IO4A 1H76A 1FQFA 4F3PA 1BK4A 1NI9A 3TMGA 3QUFA 2F6PA 5I5PA 3LUYA 4BDNA 3U92A 3LV0A 4QFOA 4PGNA 2B3BA 2Y7KA 4JDFA 1FQAA 2XX8A 3U72A 3UK4A 4QFPA 1SW5A 3FXBA 1PC3A 5EHSA 1TFAA 3E9XA 5FHNA 3VLWA 1NL5A 3G3HA 4LVQA 5H8SA 2GFEA 3IOTA 1ZU0A 2XX9A 3U94A 4F1VA 1TXFA 3NOHA 3OSQA 1YPNA 5ICTA 3FJMA 3ILUB 4F2OA 2QSXA 3QIMA 2HPGA 1DPPA 2KLFA 5I2NA 4LA9A 4C1UA 2WX9A 3ROJA 1IIWA 2QMWA 3FXQA 4PF6A 2ANJA 4LZ8A 4O7MA 3MP6A 1MY3A 4QSDA 2AYSA 1D4NA 3TYHA 5I57A 4LP2B 2XXUA 3IFAA 4AS5A 4H46A 3CFLA 4TOZA 2F6GA 4U2RA 1QKAA 3S9NC 3RGYA 3C32A 3TELA 2V84A 3B8BA 3RYDA 4MEVA 3RLFE 3SZPA 2I0CA 1DSNA 2Y7PA 1D3KA 3UORA 4PBQA 1RDXA 2WBDA 2PMSA 3KZGA 2DSFA 4YKKA 2PT2A 2IEEA 1N7WA 4GQOA 2CZLA 3O9PA 4X1BA 2KQZA 4H8JA 3T96B 1FPIA 2QRYA 4GVOA 2HAUA 3D4GA 4NF4B 3IB1A 3V83A 1WVJA 4OMBA 3MPKA 1SW4A 4RXLA 1EZPA 1FQEA 3K6WA 5H8FB 2QMXA 4KPTA 4OQOA 5H8QB 1N3WA 2XWOA 1VFDA 4OVJA 4YMAA 3VFJA 4GFRA 3E4RA 2QL3A 4IO2A 4EQBA 5KZTA 3H6WA 1PEBA 2FIEA 3EPEA 1O64A 2KR0A 4GL0A 4I3EA 4GWSA 3KSXA 1I69A 4NF8B 1NH8A 1USYH 4YAHX 4RK2A 3TCFA 4H0WA 3G3IA 2ZZVA 3CFXA 1KZ8A 1GV8A 2PFZA 3P7IA 2ONRA 2XXYA 5CI5A 4ZZEA 5F1QA 2AL5A 1A40A 3KJTA 1YAEA 3Q28A 4MMPA 4R2BA 4KFQA 2DWHA 2ZNSA 4HW8A 4QFKA 2WKYA 1EU8A 1YYZA 5AA2D 3C9HA 3N26A 2Y5LA 2ZNTA 4P9KA 1FTAA 1K9YA 1INPA 3HSTA 2NOOA 3MBPA 1NV6A 3B7DA 2GHAA 5ET8A 4OZ9A 2CZIA 2DQVA 4FE8A 2CZHA 4O7IA 4ZEIA 4OFLA 4XKNA 4ZEKA 5DEXB 2HZKA 2HHMA 3OEKA 1VFEA 4N6PA 3RQTA 1VR5A 3IAZA 2FA7A 4NN3A 4C1TA 5ET7A 2OWZA 4RYAA 4P1EA 5KDTB 1LBZA 1I6QA 5IZ1A 3HPIA 1B32A 2W7YA 2ZYMA 1XI6A 1MPDA 4NMYA 5ISUA 3M3FA 3KG2A 1MS7A 3T9HB 3OOAA 3SERA 4N4UA 1ANFA 1JW4A 4U23A 2B4LA 2Z8EA 1LGBC 3BIHA 1FBGA 4OTEA 3TUSA 2DOJA 3R26A 1FCKA 1N76A 2Z8DA 5TU0A 1IXCA 3TODA 4DXBA 2Y5KA 3JYRA 4P8BA 3VLVA 3VE1B 3RY3A 5FHMA 4GX3A 4KCCA 2QS3A 4NF4A 5AA2B 1BTJA 3MSTA 1NFTA 5H8FA 3MP8A 3MVWA 2O1LA 5JEIA 1IMEA 4PAFA 3FZVA 5ET5A 5DW8A 3FVNA 1LAXA 1VDWA 4QFNA 1ZTYA 3FV2A 5JTYB 3Q29A 4ELPA 3TZAA 3LSFB 4NF8A 3M3KA 2MKZA 3U65A 4HE0A 2REJA 5DVFA 1LFIA 3BKIB 3TCGA 1SW2A 4RPNA 2D5WA 4JB7A 4OERA 3T9VA 1H45A 3K6UA 2UVIA 2FIXA 3R6UA 4PFYA 3GLBA 3OSRA 5LOMA 2XXRA 4OWDA 2P3NA 1N84A 2PVUA 3T22A 4BDLA 4JSDA 2DWJA 4GOTA 2JJKA 2XXQA 2OK2A 4PETA 2I0BA 1JQFA 2GRVA 4U22A 3FUZA 1MQIA 2H9BA 2FBPA 1FTKA 5IZ3B 1XVXA 1NV4A 4JWXA 3K0VA 1HSJA 3PUYE 4N8GA 5DEXA 4F1UA 1ZKBA 2I3VA 2ALUA 4OYVA 3IB2A 3RT6B 3K02A 1VE4A 5EYHA 4BDMA 3SEVA 5A5XB 3DP8A 4ZECA 4HCYA 4G61A 4IB2A 3O6IA 5EQ9A 3LSXA 5KDTA 2WBBA 1YXIA 3PPPA 4XEQA 1B5HA 4GBVA 1Y3NA 2O51A 4EQ9A 1MG1A 2A5TB 4NGUA 4I62A 4FBPA 1IMBA 1Y3PA 4YU0A 1SVXB 4ESWA 4MJOA 1Q35A 3PUVE 4RK9A 4QXDA 5I59B 4F3SA 1JEUA 4MIJA 3ZKLA 3BBRA 4EF2A 3PMXA 1B9JA 4IO3A 4F31B 1FJ6A 4NWCA 4DXCA 4N6KA 3KGCA 2XXHA 4E0XA 1H3DA 1YCJA 3R7XA 4N81A 2Y84A 3TKDA 1H44A 4ELRA 4JVCA 2Y7RA 3TTMA 1LB8A 4PAIA 1HSEA 3IO6A 5JTYA 4NF5B 3OD7A 4JVDA 3RPWA 2DE2A 4MAGA 2ZZXA 5HM4B 4P47A 3C35A 1P1OA 4AB6A 5H8NB 4G2ZA 2FNCA 3RPLB 2Y7IA 4WXJA 2QVVA 4Z0IA 1H43A 2H98A 1NUZA 4PDDA 2VPOA 4E0WA 1LLSA 3JZJA 1URGA 1O63A 4N13A 1NNKA 4F29A 4OVTA 4XXUA 1Y9UA 4X1DA 2HXWA 4TQUQ 2CEXA 3EN3A 3MAMA 5IZ3A 2FYIA 4QRZA 2XXXA 1FBEA 2XXVA 4Q8RA 4G8MA 2UYEA 4P3LA 4AQ4A 3TTNA 2VHAA 1N3XA 2DWIA 4PGPA 3G3GA 1B1HA 4TLMB 5CM6A 4F19A 3HHFA 1D9YA 4YKPA 4ONYA 4YKIA 1CNQA 3Q26A 3V8XB 3MJNA 3HN0A 4N07A 3K1PA 5K2XA 2F7AA 4MNIA 2A5TA 4NF0A 2H25A 5EQ8A 1YZ0A 2UYFA 1XVYA 3N5LA 2DXRA 3EF7A 1S9TA 4F3GA 5BUUA 1S50A 2OJTA 2I48A 3UP9A 4G8HA 2VP1A 1EH3A 4N15A 3A3CA 3DP6A 5I59A 3K6VA 2VT5A 1MY4A 3EHTA 1SDXA 4PFUA 3CG1A 4POXA 3IOUA 4KR5A 3MVZA 4XTCQ 2F3BA 1RKMA 4X9TA 2OBGA 1FPDA 1NV5A 1URSA 5FHOA 1B52A 1OIBA 3UGWA 4JSOA 4FORA 4I40A 3QK6A 1M5CA 2AIXA 1PB8A 2UVHA 1B4ZA 2GQ1A 4M1VA 4DI3D 1B40A 3K00A 2I58A 4LONB 1B5IA 4XKQA 1ELJA 2P0SA 2XD3A 3MZ9A 1Y3QA 3VVDA 2O1MA 1FQDA 4I3YA 1FJ9A 4OFOA 4N91A 5H8NA 3S9EA 3I3VA 1BKAA 4G77A 4F3BA 5DTBA 1SQYA 2OZZA 4NQ8A 3RPLA 1PDAA 3KOSA 2NXOA 3VXBA 3LC8A 3KEIA 4GD5A 4H45A 1NV0A 4MH5A 4FATA 5I84A 3U8QA 1MPBA 5L8DA 1MY2A 3FVKA 5TPAA 1CE2A 2F3DA 4UABA 2ABHA 1RYXA 4RNSA 1JVXA 4OVRA 1Y1ZA 2OLBA 1LAGE 5ET6A 4DIGA 3QAXA 5DVJA 1MQJA 4PQJA 2DDKA 1EYJA 1G0HA 2PT1A 2XHDA 3VVEA 4U4XA 4OESA 1LAHE 4XFEA 2CZKA 2ZMBA 1IZ1A 2V4CA 1ZLQA 2I4CA 4OEUA 2ZNUA 5CMBA 4HXVA 1IMAA 4KCDA 5I7IA 5I3SA 1DTZA 3MP1A 3ONMA 1B51A 4MFIA 3SEYA 4NG7A 3H6VA 3Q25A 1B7ZA 3OO7A 3D1RA 1Q9DA 1NMUA 3IOWA 2O69A 1R9LA 4XF5A 2BJJX 4PE5B 3O66A 1A8FA 4IO7A 3O28A 4H67A 3MUQA 1FPJA 3PV0E 1MPCA 1ZMGA 2H5YA 1IXHA 3KC0A 4X04A 4LATA 3CSBA 1OQGA 2DE4A 4R2FA 4PF8A 1MH3A 1JW1A 1B0LA 1DOTA 2RC8A 3KBZA 4MLQA 3N6TA 3F11A 2DWAA 1LBWA 3ISPA 1FRPA 2HQ0A 4HCWA 2Q89A 2RINA 1IITA 3RTFB 2GH9A 1PBQA 2V93A 1ZJLA 3BIGA 3SEXA 3FVGA 1EYKA 1QGXA 3GBAA 3E13X 1FPGA 1MDP1 1PBPA 1FPEA 2R9JA 1OVBA 2Z23A 3I5OA 2RKMA 4H6DA 1QUJA 4U4SA 1Z7NE 4R9GA 1MXUA 2ZZWA 4O3AA 1G0IA 3EHUA 3RT8A 2XXIA 3IFCA 1FW0A 4GWUA 3LR1A 3C34A 3IX1A 3PU5A 3RNNA 3MQ9A 2XXPA 4OVQA 1A99A 3M3LA 4UA8A 3ODBA 4EF1A 2ZXTA 4H8IA 1SPIA 2OWSA 4PFWA 3U1OA 1NH7A 2F8DA 3O29A 1FTJA 4PCDA 1AOVA 1AH5A 1TWYA 5I58B 2WYKA 2VD2A 3MZ1A 4R6YA 4F1YA 2QPQA 3HFUA 3M8UA 4RA1A 1FQBA 3LSLA 3BFUA 1DBZA 3FIRA 1LAFE 4OANA 1EYIA 2D3IA 3TEPA 2HEUA 4FIMA 2E0SA 3FJGA 3IB0A 3T93B 1MQDA 3PUZE 2F78A 3T66A 4H1XA 2A5SA 3PMWA 1EZ9A 4PC9A 1RYOA 4MHFA 3EQ1A 2I49A 3ZS6A 3IL1B 4F22A 5CBRA 5F24A 4Z7EA 5H8QA 3IORA 4K3FA 5IZZA 1VSOA 4PFRA 5AA3A 3H4ZA 1LFGA 3V5AA 1FTOA 5EQAA 5DYHA 3FV1A 4G68B 4ZZAA 2XXKA 1FTLA 5TP9B 4H65A 1EZOA 4PP0A 1SYHA 2R6GE 1LBXA 3PUWE 1T0KA 1QJMA 1LEVA 3PPRA 1NV2A 1N04A 5I56B 1L5TA 3PMVA 2Q88A 3PPQA 2DE3A 2DS9A 1S7YA 3MW0A 4P0GA 3VLUA 4UACA 4MLVA 1O7TA 4YB5A 1M5EA 1NUXA 2QS4A 1SD3A 1QVSA 1UIVA 3B6TA 3OELA 2ONSA 2H4IA 4ZEBA 2YPNA 3QMFA 5KCJB 5M2VA 4N17A 4LQ5A 4Q0CA 3S4UA 4PFTA 2THIA 2UXAA 4RJZA 1MQHA 1IMDA 3SETA 2NWJA 1B0HA 2F7BA 5I58A 4PBHA 2E1SA 5B7DA 5CMKA 1MH4A 1MXXA 1D9VA 1MDQA 2O84X 2O68A 3TTLA 4DDDA 4OXVA 4YB6A 1B6HA 4MX6A 5ITPA 1QW0A 2ESNA 3UA8A 3Q27A 5FTHA 2RC9A 4F2QA 1B4HA 1N7XA 1US4A 3TDJA 2D21A 5IM2A 4M4GA 4NX1A 4GRKA 3EHSA 1R6ZA 4KYSA 3RN8A 5AA2A 5EHMA 5EYGA 3CRBA 4FEDA 2Q2CA 2RC7A 2CEYA 1GTKA 1FQCA 2LAOA 4R9FA 3SDFA 5B70A 2UVJA 5L9SA 2B65A 4GX6A 4G68A 2V3TA 1YTVA 1AMFA 1MQGA 3TTKA 3CIJA 3G7WA 5TP9A 4LZ5A 2XX7A 1GGGA 3K1MA 3O6HA 4XKRA 4BLAA 4NTLA 1B58A 1Y20A 4GLIA 4O3CA 3S9LC 3N6UA 5I56A 1JETA 2FVZA 4ZE9A 2V3UA 2Q9TA 3ILTB 3QUJA 2I6EA 5LTCA 1KWHA 3IR1A 1TT1A 1DMBA 1MXVA 3KC1A 1B05A 2HZLA 1FBPA 4NF6B 5I2KB 3C36A 3TFLA 3G3FA 1OLCA 3HV1A 5HPQA 4NHBA 1B5JA 3T9UA 3LSWA 1WODA 1Y1MA 2DVZA 1NUYA 4LZ7A 3DP4A 4ELQA 5KCJA 3IJOB 1LBCA 3PUXE 3MYUA 1P1QA 1UTHB 2XD2A 3OENA 5A5XA 3W9WA 5FTIA 4BDQA 2WEFA 1MXZA 3CHGA 3DLNA 5LDZA 1MXYA 4G4PA 5FBPA 1B7UA 2F34A 1FPLA 4G8NA 3C33A 4IR8A 4AS4A 1XHYA 4XKPA 4EDPA 5EQ7A 3KJ7A 3DELB 1AWBA 4KYDA 3PD8A 2FHYA 3CR9A 4FAJA 4L17A 4EXKA 3SESA 4R6KA 5JK4A 1Q1KA 3UN6A 1DTGA 1IXGA 1FBCA 4PDHA 2ZYKA 4GWXA 4NAPA 3SEUA 4PFIA 1US5A 1QUIA 1A7LA 1QULA 2G29A 1JW5A 3WAEA 3TQLA 4R73A 1A54A 3A3UA 4GXSB 1A55A 3H03A 2Z22A 2PCRA 3K01A 3K1NA 2ZYOA 4I8CA 2PFYA 4NF5A 3O2AA 3EKIA 1B3LA 4ZS9A 4JWOA 3KN8A 3QSLA 3KN7A 2X7PA 3GBBA 4KHZE 1RDYA 1Y4CA 1M5FA 3FD3A 4YKJA 4HTGA 3H3GA 1CB6A 3TTRA 1B3HA 2XWIA 1B7HA 4LN5A 3PGFA 3PPNA 1FBDA 3D4CA 4C0RA 3E3KA 1MY0A 2X26A 2DVCA 5L9MA 3MZBA 2GHBA 1KA0A 4IGRA 5H8HB 4NF6A 1JEVA 1LBBA 2RCBA 5I2KA 5AA4B 3O6GA 3UIFA 3WAFA 1R1NA 1AIVA 3A29A 3TAJA 4P1LA 4ZEFA 1JNFA 2B3FA 1JVYA 2BJIA 4Q30B 4HE2A 3DM0A 1I6BA 1UTHA 1POTA 3U93A 2P3VA 3G3JA 4X48A 1IXIA 2OWTA 1AL3A 4IO4A 4EQ7A 3KOTA 4GBWA 3MVXA 3IOVA 1TFDA 4YZZA 1J1NA 2VOZA 4OVSA 1FPKA 2XXTA 2HFBA 3MWBA 2NUVA 3K6XA 1MM7A 3L6GA 4PAKA 1BIYA 4P11A 2DYXA 5F7VA 3H6TA 5J1DA 2Q2AA 2O6AA 2R71A 2Q74A 3MVYA 2R8TA 1M5BA 4GF8A 1SYIA 1QKBA 1JP4A 1XT8A 2V25A 1OMPA 1NNTA 4OA4A 1NV1A 4ZEDA 1B3EA 1FBFA 2I3WA 3K2DA 3VXCA 1NNFA 1BLFA 3O97A 5IAIA 4OFJA 3HO7A 1LFHA 2O7IA 2QVRA 1Y4TA 2I4BA 3E79A 4HS7A 3GYYA 1B1XA 3AXFA 1USYE 4POWA 3GZGA 3PTYA 1B2HA 4LQ2A 2F97A 1XC1A 1M5DA 4IO6A 1LB9A 2V3QA 5CBSA 1A8EA 1QUKA 3PD9A 3MPLA 2Z8FA 5H8HA 3HHGA 3TCHA 3USDA 4KQPA 3TPAA 3N94A 5AA4A 5CMMA 4OVPA 4WEPA 4EUOA 4DZ1A 5CMCA 4GXAA 4TLLB 2F35A 2F36A 3TQWA 3ZSFA 3BFTA 3B50A 3C4MA 1WDNA 1XOCA 3B6WA 1HSLA 4PTKA 1DPEA 2H99A 3A09A 1SI1A 4AB5A 2P2AA 3OMBA 1Z7ME 3THIA 5AE4A 1MY1A 1LCTA 3ZKKA 4HE1A 4Q5TA 1GVCA 2VD3A 2X7QA 4BDRA 3H7MA 4GX4A 1LSTA 3W9VA 1SW1A 4DI4B 1IEJA 1B46A 1P1NA 4X8RA 5ESYA 1OLAA 1F9BA 1N0TA 3FGSA 4IO5A 4U1ZA 1LCFA 1IMFA 4DCXA 1FSAA 1OVTA 4N8YA 3FASA 4ND9A 1FBHA 4O3BA 4WKMA 4IGTA 1SI0A 3LBSA 3CI8A 3OXNA 1MM6A 2XA5A 2F5XA 5EYFA 2P1SA 2Q8MA 3FXRA 4G68C 3FXUA 2PX1A 5ELVA 5A5LA 4U21A 4WEDA 2XWVA 4O8MA 1PB9A 2CMOA 4R72A 2VPNA 5T3JA 4KYEA 1POY1 4P56A 1MRPA 4YMBA 1UIUA 2DP8A 3KBRA 3LUZA 3OO9A 1NKXA 2QVUA 4QSEA 1UTBB 4BDOA 1P1UA 2QS1A 4R75A 1LBYA 5AA1A 4YB7A 2DXYA 2XWKA 4P0IA 3S2VA 3CFZA 2UVGA 5J16A 3KN3A 4GWOA 4FJPA 3CVGA 1DK4A 4JXIA 4RY1A 3MC2A 4ESXA 4MNPA 3CSGA 4GWYA 2M8CA 1D9QA 3FATA 4XIGQ 1UQWA 4OHNA 3SEWA 2F7CA 4F18A 4MCOA 2L5VA 5HBCA 3OEMA 3K4UA 3T9XB 2IA4A 4PFBA 1FTMA 3FJ7A 4FECA 4ELOA 1XS5A 3C31A 3H06B 1II5A 4EXLA 3IK6B 1K9ZA 4NEDA 1IQ7A 3RUMA 3B6QA 4QBAA 3VVFA 1R9QA 4KD5A 4H5GA 4R6HA 3T1BA 5BWJA 1NUWA 3E78A 2HXRA 3PPOA 4LUBA 3V89B 2ONKE 4DLDA 5ICQA 1IMCA 4KXPA 3H6UA 5K2YA 4R74A 4IY5A 4FEBA 3OO6A 1MXWA 4GWZA 4OENA 3T0JA 4ZDMA 2B4MA 2QFLA 1PB7A 5CRYA 3QYTA 4JVIA 5IKBA 2NVUB 2XXWA 1IUDA 4DXUA 3GXAA 3KSJA 4JBZA 4PE3A 3RTWB 1P1WA 1NNPA 1NV7A 4IY6A 3SKPA 1B3GA 1URDA 4QF9A 4MF3A 3L6HA 2ZYNA 1ZBMA 3IJXB 3I6VA
chains in the Genus database with same CATH topology
5ITOA 2PBWA 1UTBA 5CC2A 2YLNA 2HCAA 4NWDA 2PYYA 5TPAB 2Q8JA 4F39A 4I9DA 4NE4A 1ATGA 2Y7WA 4H5FA 5I2NB 2YJPA 3ECRA 3JV9A 5L9OA 4GL8A 3OO8A 4I1DA 4ZE8A 4ISUA 4RPOA 2QS2A 3VV5A 4QHQA 3W15C 3VDFA 4QFLA 4DE8A 4JWYA 5I57B 3QXMA 1P99A 1GR2A 1SBPA 2VGQA 3FVOA 3S9MC 2RCAA 3HCQA 4OETA 5DT6A 1I6AA 2O7UA 1OQHA 2OCUA 3CG3A 2G93A 1B3FA 4U1OA 2AL4A 4OEVA 1BP5A 4MBPA 4ECFA 2QJEA 4QSCA 2REGA 4DCYA 2HAVA 4GIZA 4THIA 3KFMA 1ZIUA 4KI0E 2RF1A 4YICA 5DVIA 3G3KA 3IO4A 1H76A 1FQFA 4F3PA 3TMGA 3QUFA 2F6PA 3LUYA 4BDNA 3U92A 4QFOA 2B3BA 2Y7KA 4JDFA 1FQAA 2XX8A 3U72A 3UK4A 4QFPA 1SW5A 1PC3A 5EHSA 1TFAA 3E9XA 5FHNA 3VLWA 1NL5A 3G3HA 4LVQA 5H8SA 2GFEA 3IOTA 1ZU0A 2XX9A 3U94A 4F1VA 1TXFA 3OSQA 1YPNA 5ICTA 3FJMA 3ILUB 4F2OA 2QSXA 3QIMA 1DPPA 2KLFA 5I2NA 4LA9A 4C1UA 1IIWA 2QMWA 3FXQA 2ANJA 4LZ8A 3MP6A 1MY3A 4QSDA 2AYSA 1D4NA 3TYHA 5I57A 4LP2B 2XXUA 3CFLA 4TOZA 2F6GA 4U2RA 1QKAA 3S9NC 3RGYA 3C32A 3TELA 2V84A 3RLFE 2I0CA 1DSNA 2Y7PA 1D3KA 3UORA 2PMSA 3KZGA 2DSFA 4YKKA 2PT2A 2IEEA 1N7WA 4GQOA 2CZLA 3O9PA 4X1BA 4H8JA 3T96B 2QRYA 4GVOA 2HAUA 3D4GA 4NF4B 3IB1A 3V83A 1WVJA 4OMBA 3MPKA 1SW4A 4RXLA 1EZPA 1FQEA 3K6WA 5H8FB 2QMXA 4KPTA 4OQOA 5H8QB 1N3WA 1VFDA 4OVJA 4YMAA 3VFJA 4GFRA 3E4RA 2QL3A 4IO2A 4EQBA 5KZTA 3H6WA 1PEBA 3EPEA 1O64A 4GL0A 3KSXA 1I69A 4NF8B 1NH8A 1USYH 4YAHX 4RK2A 3TCFA 4H0WA 3G3IA 3CFXA 1GV8A 3P7IA 2ONRA 2XXYA 5CI5A 4ZZEA 5F1QA 2AL5A 1A40A 3KJTA 1YAEA 3Q28A 4R2BA 4KFQA 2DWHA 2ZNSA 4HW8A 4QFKA 2WKYA 1EU8A 5AA2D 3C9HA 3N26A 2ZNTA 3HSTA 2NOOA 3MBPA 3B7DA 2GHAA 4OZ9A 2DQVA 4FE8A 4ZEIA 4OFLA 4XKNA 4ZEKA 5DEXB 2HZKA 3OEKA 1VFEA 4N6PA 3RQTA 1VR5A 3IAZA 2FA7A 4C1TA 4RYAA 5KDTB 1I6QA 3HPIA 1B32A 2W7YA 2ZYMA 1MPDA 4NMYA 5ISUA 3M3FA 3KG2A 1MS7A 3T9HB 3OOAA 3SERA 1ANFA 1JW4A 4U23A 2Z8EA 1LGBC 4OTEA 3TUSA 2DOJA 3R26A 1FCKA 1N76A 2Z8DA 5TU0A 1IXCA 3TODA 4DXBA 3JYRA 3VLVA 3VE1B 3RY3A 5FHMA 4KCCA 2QS3A 4NF4A 5AA2B 1BTJA 1NFTA 5H8FA 3MP8A 3MVWA 2O1LA 5JEIA 3FZVA 3FVNA 1LAXA 4QFNA 1ZTYA 3FV2A 5JTYB 3Q29A 4ELPA 3TZAA 3LSFB 4NF8A 3M3KA 2REJA 5DVFA 1LFIA 3BKIB 3TCGA 1SW2A 4RPNA 2D5WA 4JB7A 4OERA 3T9VA 1H45A 3K6UA 2UVIA 3R6UA 4PFYA 3GLBA 3OSRA 5LOMA 2XXRA 4OWDA 1N84A 2PVUA 3T22A 4BDLA 4JSDA 2DWJA 4GOTA 2XXQA 2OK2A 4PETA 2I0BA 1JQFA 2GRVA 4U22A 3FUZA 1MQIA 2H9BA 1FTKA 1XVXA 4JWXA 3K0VA 1HSJA 3PUYE 5DEXA 4F1UA 1ZKBA 2I3VA 2ALUA 4OYVA 3IB2A 3RT6B 3K02A 1VE4A 4BDMA 3SEVA 5A5XB 3DP8A 4ZECA 4HCYA 4IB2A 3O6IA 3LSXA 5KDTA 3PPPA 1B5HA 1Y3NA 2O51A 4EQ9A 1MG1A 2A5TB 4I62A 1Y3PA 4YU0A 1SVXB 4ESWA 1Q35A 3PUVE 4RK9A 5I59B 4F3SA 1JEUA 3ZKLA 3BBRA 4EF2A 3PMXA 1B9JA 4IO3A 4F31B 4NWCA 4DXCA 3KGCA 2XXHA 4E0XA 1H3DA 1YCJA 3R7XA 2Y84A 3TKDA 1H44A 4ELRA 2Y7RA 3TTMA 1LB8A 1HSEA 3IO6A 5JTYA 4NF5B 3OD7A 3RPWA 2DE2A 5HM4B 3C35A 1P1OA 4AB6A 5H8NB 4G2ZA 2FNCA 2Y7IA 4WXJA 4Z0IA 1H43A 2H98A 4E0WA 1LLSA 3JZJA 1URGA 1O63A 4N13A 1NNKA 4F29A 4XXUA 1Y9UA 4X1DA 2HXWA 4TQUQ 3EN3A 3MAMA 2FYIA 4QRZA 2XXXA 2XXVA 4Q8RA 4G8MA 2UYEA 4AQ4A 3TTNA 2VHAA 1N3XA 2DWIA 3G3GA 1B1HA 4TLMB 5CM6A 4F19A 3HHFA 1D9YA 4YKPA 4ONYA 4YKIA 3Q26A 3V8XB 3MJNA 3HN0A 4N07A 3K1PA 5K2XA 2F7AA 2A5TA 2H25A 2UYFA 1XVYA 3N5LA 2DXRA 3EF7A 1S9TA 4F3GA 5BUUA 1S50A 2OJTA 2I48A 3UP9A 4G8HA 2VP1A 1EH3A 3A3CA 3DP6A 5I59A 3K6VA 1MY4A 3EHTA 1SDXA 4PFUA 3CG1A 4POXA 3IOUA 4KR5A 3MVZA 4XTCQ 1RKMA 4X9TA 2OBGA 5FHOA 1URSA 1B52A 1OIBA 3UGWA 4JSOA 4FORA 3QK6A 1M5CA 2AIXA 1PB8A 2UVHA 1B4ZA 4M1VA 1B40A 3K00A 2I58A 4LONB 1B5IA 4XKQA 1ELJA 2P0SA 2XD3A 3MZ9A 1Y3QA 3VVDA 2O1MA 1FQDA 4OFOA 3S9EA 5H8NA 3I3VA 1BKAA 4G77A 4F3BA 5DTBA 1SQYA 2OZZA 1PDAA 3KOSA 2NXOA 3VXBA 3LC8A 3KEIA 4GD5A 4FATA 4MH5A 5I84A 3U8QA 1MPBA 5L8DA 1MY2A 3FVKA 5TPAA 1CE2A 2ABHA 1RYXA 4RNSA 1JVXA 1Y1ZA 2OLBA 1LAGE 4DIGA 3QAXA 5DVJA 1MQJA 4PQJA 2PT1A 2XHDA 3VVEA 4U4XA 4OESA 1LAHE 2ZMBA 1IZ1A 1ZLQA 2I4CA 4OEUA 2ZNUA 5CMBA 4KCDA 1DTZA 3MP1A 3ONMA 1B51A 4MFIA 3SEYA 3H6VA 3Q25A 1B7ZA 3OO7A 1NMUA 3IOWA 2O69A 1R9LA 2BJJX 4PE5B 3O66A 1A8FA 4IO7A 3O28A 4H67A 3MUQA 3PV0E 1MPCA 1ZMGA 2H5YA 1IXHA 4LATA 3CSBA 1OQGA 2DE4A 4R2FA 1MH3A 1JW1A 1B0LA 1DOTA 2RC8A 4MLQA 3N6TA 3F11A 2DWAA 2HQ0A 4HCWA 2Q89A 2RINA 1IITA 3RTFB 2GH9A 1PBQA 2V93A 1ZJLA 3SEXA 3FVGA 3GBAA 3E13X 1MDP1 1PBPA 2R9JA 1OVBA 2Z23A 3I5OA 2RKMA 4H6DA 1QUJA 4U4SA 1Z7NE 4R9GA 1MXUA 4O3AA 3EHUA 3RT8A 2XXIA 1FW0A 3LR1A 3C34A 3IX1A 3PU5A 3RNNA 3MQ9A 2XXPA 1A99A 3M3LA 4UA8A 3ODBA 4EF1A 2ZXTA 4H8IA 2OWSA 4PFWA 3U1OA 1NH7A 2F8DA 3O29A 1FTJA 1AOVA 1AH5A 1TWYA 5I58B 2VD2A 3MZ1A 4R6YA 4F1YA 2QPQA 3M8UA 4RA1A 1FQBA 3LSLA 3BFUA 3FIRA 1LAFE 2D3IA 3TEPA 2HEUA 4FIMA 2E0SA 3FJGA 3IB0A 3T93B 1MQDA 3PUZE 2F78A 3T66A 4H1XA 2A5SA 3PMWA 1EZ9A 1RYOA 3EQ1A 2I49A 3ZS6A 3IL1B 4F22A 5CBRA 4Z7EA 5H8QA 3IORA 4K3FA 1VSOA 5AA3A 3H4ZA 1LFGA 3V5AA 1FTOA 5DYHA 3FV1A 4G68B 4ZZAA 1FTLA 5TP9B 4H65A 1EZOA 4PP0A 1SYHA 2R6GE 3PUWE 1T0KA 1QJMA 3PPRA 1N04A 5I56B 1L5TA 3PMVA 2Q88A 3PPQA 2DE3A 2DS9A 1S7YA 3MW0A 4P0GA 3VLUA 4UACA 4MLVA 4YB5A 1O7TA 1M5EA 2QS4A 1SD3A 1QVSA 1UIVA 3B6TA 3OELA 2ONSA 2H4IA 4ZEBA 2YPNA 5KCJB 5M2VA 4LQ5A 4Q0CA 3S4UA 4PFTA 2THIA 2UXAA 4RJZA 1MQHA 3SETA 2NWJA 1B0HA 2F7BA 5I58A 2E1SA 5B7DA 5CMKA 1MH4A 1MXXA 1D9VA 1MDQA 2O84X 2O68A 3TTLA 4DDDA 4OXVA 4YB6A 1B6HA 5ITPA 1QW0A 2ESNA 3UA8A 3Q27A 5FTHA 2RC9A 4F2QA 1B4HA 1N7XA 1US4A 3TDJA 2D21A 4M4GA 4GRKA 3EHSA 1R6ZA 4KYSA 3RN8A 5AA2A 5EHMA 3CRBA 4FEDA 2Q2CA 2RC7A 1GTKA 1FQCA 2LAOA 4R9FA 3SDFA 5B70A 2UVJA 5L9SA 2B65A 4G68A 2V3TA 1YTVA 1AMFA 1MQGA 3TTKA 3CIJA 3G7WA 5TP9A 4LZ5A 2XX7A 1GGGA 3K1MA 3O6HA 4XKRA 4BLAA 4NTLA 1B58A 1Y20A 4GLIA 4O3CA 3S9LC 3N6UA 5I56A 1JETA 4ZE9A 2V3UA 2Q9TA 3ILTB 3QUJA 2I6EA 1KWHA 3IR1A 1TT1A 1DMBA 1MXVA 1B05A 2HZLA 4NF6B 5I2KB 3C36A 3TFLA 3G3FA 1OLCA 3HV1A 5HPQA 1B5JA 3T9UA 3LSWA 1WODA 1Y1MA 2DVZA 4LZ7A 3DP4A 4ELQA 5KCJA 3IJOB 1LBCA 3PUXE 1P1QA 1UTHB 2XD2A 3OENA 5A5XA 3W9WA 5FTIA 4BDQA 1MXZA 3DLNA 1MXYA 4G4PA 1B7UA 2F34A 4G8NA 3C33A 1XHYA 4XKPA 4EDPA 3KJ7A 3DELB 4KYDA 3PD8A 3CR9A 4FAJA 4L17A 4EXKA 3SESA 4R6KA 5JK4A 1Q1KA 3UN6A 1DTGA 1IXGA 2ZYKA 3SEUA 1US5A 1QUIA 1A7LA 1QULA 2G29A 1JW5A 3WAEA 3TQLA 4R73A 1A54A 3A3UA 4GXSB 1A55A 3H03A 2Z22A 3K01A 3K1NA 2ZYOA 4I8CA 4NF5A 3O2AA 1B3LA 4ZS9A 4JWOA 3KN8A 3QSLA 3KN7A 2X7PA 3GBBA 4KHZE 1Y4CA 1M5FA 3FD3A 4YKJA 4HTGA 3H3GA 1CB6A 3TTRA 1B3HA 1B7HA 3PGFA 3PPNA 3D4CA 4C0RA 3E3KA 1MY0A 2X26A 2DVCA 5L9MA 3MZBA 2GHBA 4IGRA 5H8HB 4NF6A 1JEVA 1LBBA 2RCBA 5I2KA 5AA4B 3O6GA 3UIFA 3WAFA 1R1NA 1AIVA 3TAJA 4ZEFA 1JNFA 2B3FA 1JVYA 4Q30B 3DM0A 1I6BA 1UTHA 1POTA 3U93A 3G3JA 4X48A 1IXIA 2OWTA 1AL3A 4IO4A 4EQ7A 3KOTA 3MVXA 3IOVA 1TFDA 4YZZA 1J1NA 2VOZA 2XXTA 2HFBA 3MWBA 2NUVA 3K6XA 1MM7A 3L6GA 1BIYA 4P11A 2DYXA 5F7VA 3H6TA 5J1DA 2Q2AA 2O6AA 2R71A 3MVYA 1M5BA 4GF8A 1SYIA 1QKBA 1XT8A 2V25A 1OMPA 1NNTA 4ZEDA 1B3EA 2I3WA 3K2DA 3VXCA 1NNFA 1BLFA 3O97A 5IAIA 4OFJA 3HO7A 1LFHA 2O7IA 1Y4TA 2I4BA 4HS7A 1B1XA 3AXFA 1USYE 4POWA 3GZGA 1B2HA 4LQ2A 2F97A 1XC1A 1M5DA 4IO6A 1LB9A 2V3QA 5CBSA 1A8EA 1QUKA 3PD9A 3MPLA 2Z8FA 5H8HA 3HHGA 3TCHA 3USDA 4KQPA 3TPAA 3N94A 5AA4A 5CMMA 4WEPA 4EUOA 4DZ1A 5CMCA 4GXAA 4TLLB 2F35A 2F36A 3TQWA 3ZSFA 3BFTA 3C4MA 1WDNA 1XOCA 3B6WA 1HSLA 1DPEA 2H99A 3A09A 1SI1A 4AB5A 2P2AA 3OMBA 1Z7ME 3THIA 5AE4A 1MY1A 1LCTA 3ZKKA 4Q5TA 1GVCA 2VD3A 2X7QA 4BDRA 3H7MA 1LSTA 3W9VA 1SW1A 1IEJA 1B46A 1P1NA 1OLAA 1F9BA 1N0TA 3FGSA 4IO5A 4U1ZA 1LCFA 4DCXA 1OVTA 3FASA 4ND9A 4O3BA 4WKMA 4IGTA 1SI0A 3LBSA 3CI8A 3OXNA 1MM6A 2F5XA 5EYFA 2P1SA 3FXRA 4G68C 3FXUA 2PX1A 5ELVA 4U21A 4WEDA 1PB9A 2CMOA 4R72A 4KYEA 1POY1 1MRPA 4YMBA 1UIUA 2DP8A 3KBRA 3OO9A 1NKXA 4QSEA 1UTBB 4BDOA 1P1UA 2QS1A 4R75A 5AA1A 4YB7A 2DXYA 4P0IA 3S2VA 3CFZA 2UVGA 3KN3A 4GWOA 4FJPA 3CVGA 4JXIA 4RY1A 3MC2A 4ESXA 3CSGA 2M8CA 3FATA 4XIGQ 1UQWA 4OHNA 3SEWA 2F7CA 4F18A 5HBCA 3OEMA 3K4UA 3T9XB 2IA4A 1FTMA 3FJ7A 4FECA 4ELOA 1XS5A 3C31A 3H06B 1II5A 4EXLA 3IK6B 4NEDA 1IQ7A 3RUMA 3B6QA 3VVFA 1R9QA 4KD5A 4H5GA 4R6HA 5BWJA 3PPOA 4LUBA 3V89B 2ONKE 4DLDA 5ICQA 3H6UA 5K2YA 4R74A 4IY5A 4FEBA 3OO6A 1MXWA 4OENA 4ZDMA 1PB7A 5CRYA 3QYTA 5IKBA 2NVUB 2XXWA 1IUDA 4DXUA 3GXAA 3KSJA 4JBZA 3RTWB 1P1WA 1NNPA 4IY6A 3SKPA 1B3GA 1URDA 4QF9A 4MF3A 3L6HA 2ZYNA 1ZBMA 3IJXB 3I6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITO A;  2PBW A;  1UTB A;  5CC2 A;  2YLN A;  2HCA A;  4NWD A;  2PYY A;  5TPA B;  2Q8J A;  4F39 A;  4I9D A;  4NE4 A;  1ATG A;  2Y7W A;  4H5F A;  5I2N B;  2YJP A;  3ECR A;  3JV9 A;  5L9O A;  4GL8 A;  3OO8 A;  4I1D A;  4ZE8 A;  4ISU A;  4RPO A;  2QS2 A;  3VV5 A;  4QHQ A;  3W15 C;  3VDF A;  4QFL A;  4DE8 A;  4JWY A;  5I57 B;  3QXM A;  1P99 A;  1GR2 A;  1SBP A;  2VGQ A;  3FVO A;  3S9M C;  2RCA A;  3HCQ A;  4OET A;  5DT6 A;  1I6A A;  2O7U A;  1OQH A;  2OCU A;  3CG3 A;  2G93 A;  1B3F A;  4U1O A;  2AL4 A;  4OEV A;  1BP5 A;  4MBP A;  4ECF A;  2QJE A;  4QSC A;  2REG A;  4DCY A;  2HAV A;  4GIZ A;  4THI A;  3KFM A;  1ZIU A;  4KI0 E;  2RF1 A;  4YIC A;  5DVI A;  3G3K A;  3IO4 A;  1H76 A;  1FQF A;  4F3P A;  3TMG A;  3QUF A;  2F6P A;  3LUY A;  4BDN A;  3U92 A;  4QFO A;  2B3B A;  2Y7K A;  4JDF A;  1FQA A;  2XX8 A;  3U72 A;  3UK4 A;  4QFP A;  1SW5 A;  1PC3 A;  5EHS A;  1TFA A;  3E9X A;  5FHN A;  3VLW A;  1NL5 A;  3G3H A;  4LVQ A;  5H8S A;  2GFE A;  3IOT A;  1ZU0 A;  2XX9 A;  3U94 A;  4F1V A;  1TXF A;  3OSQ A;  1YPN A;  5ICT A;  3FJM A;  3ILU B;  4F2O A;  2QSX A;  3QIM A;  1DPP A;  2KLF A;  5I2N A;  4LA9 A;  4C1U A;  1IIW A;  2QMW A;  3FXQ A;  2ANJ A;  4LZ8 A;  3MP6 A;  1MY3 A;  4QSD A;  2AYS A;  1D4N A;  3TYH A;  5I57 A;  4LP2 B;  2XXU A;  3CFL A;  4TOZ A;  2F6G A;  4U2R A;  1QKA A;  3S9N C;  3RGY A;  3C32 A;  3TEL A;  2V84 A;  3RLF E;  2I0C A;  1DSN A;  2Y7P A;  1D3K A;  3UOR A;  2PMS A;  3KZG A;  2DSF A;  4YKK A;  2PT2 A;  2IEE A;  1N7W A;  4GQO A;  2CZL A;  3O9P A;  4X1B A;  4H8J A;  3T96 B;  2QRY A;  4GVO A;  2HAU A;  3D4G A;  4NF4 B;  3IB1 A;  3V83 A;  1WVJ A;  4OMB A;  3MPK A;  1SW4 A;  4RXL A;  1EZP A;  1FQE A;  3K6W A;  5H8F B;  2QMX A;  4KPT A;  4OQO A;  5H8Q B;  1N3W A;  1VFD A;  4OVJ A;  4YMA A;  3VFJ A;  4GFR A;  3E4R A;  2QL3 A;  4IO2 A;  4EQB A;  5KZT A;  3H6W A;  1PEB A;  3EPE A;  1O64 A;  4GL0 A;  3KSX A;  1I69 A;  4NF8 B;  1NH8 A;  1USY H;  4YAH X;  4RK2 A;  3TCF A;  4H0W A;  3G3I A;  3CFX A;  1GV8 A;  3P7I A;  2ONR A;  2XXY A;  5CI5 A;  4ZZE A;  5F1Q A;  2AL5 A;  1A40 A;  3KJT A;  1YAE A;  3Q28 A;  4R2B A;  4KFQ A;  2DWH A;  2ZNS A;  4HW8 A;  4QFK A;  2WKY A;  1EU8 A;  5AA2 D;  3C9H A;  3N26 A;  2ZNT A;  3HST A;  2NOO A;  3MBP A;  3B7D A;  2GHA A;  4OZ9 A;  2DQV A;  4FE8 A;  4ZEI A;  4OFL A;  4XKN A;  4ZEK A;  5DEX B;  2HZK A;  3OEK A;  1VFE A;  4N6P A;  3RQT A;  1VR5 A;  3IAZ A;  2FA7 A;  4C1T A;  4RYA A;  5KDT B;  1I6Q A;  3HPI A;  1B32 A;  2W7Y A;  2ZYM A;  1MPD A;  4NMY A;  5ISU A;  3M3F A;  3KG2 A;  1MS7 A;  3T9H B;  3OOA A;  3SER A;  1ANF A;  1JW4 A;  4U23 A;  2Z8E A;  1LGB C;  4OTE A;  3TUS A;  2DOJ A;  3R26 A;  1FCK A;  1N76 A;  2Z8D A;  5TU0 A;  1IXC A;  3TOD A;  4DXB A;  3JYR A;  3VLV A;  3VE1 B;  3RY3 A;  5FHM A;  4KCC A;  2QS3 A;  4NF4 A;  5AA2 B;  1BTJ A;  1NFT A;  5H8F A;  3MP8 A;  3MVW A;  2O1L A;  5JEI A;  3FZV A;  3FVN A;  1LAX A;  4QFN A;  1ZTY A;  3FV2 A;  5JTY B;  3Q29 A;  4ELP A;  3TZA A;  3LSF B;  4NF8 A;  3M3K A;  2REJ A;  5DVF A;  1LFI A;  3BKI B;  3TCG A;  1SW2 A;  4RPN A;  2D5W A;  4JB7 A;  4OER A;  3T9V A;  1H45 A;  3K6U A;  2UVI A;  3R6U A;  4PFY A;  3GLB A;  3OSR A;  5LOM A;  2XXR A;  4OWD A;  1N84 A;  2PVU A;  3T22 A;  4BDL A;  4JSD A;  2DWJ A;  4GOT A;  2XXQ A;  2OK2 A;  4PET A;  2I0B A;  1JQF A;  2GRV A;  4U22 A;  3FUZ A;  1MQI A;  2H9B A;  1FTK A;  1XVX A;  4JWX A;  3K0V A;  1HSJ A;  3PUY E;  5DEX A;  4F1U A;  1ZKB A;  2I3V A;  2ALU A;  4OYV A;  3IB2 A;  3RT6 B;  3K02 A;  1VE4 A;  4BDM A;  3SEV A;  5A5X B;  3DP8 A;  4ZEC A;  4HCY A;  4IB2 A;  3O6I A;  3LSX A;  5KDT A;  3PPP A;  1B5H A;  1Y3N A;  2O51 A;  4EQ9 A;  1MG1 A;  2A5T B;  4I62 A;  1Y3P A;  4YU0 A;  1SVX B;  4ESW A;  1Q35 A;  3PUV E;  4RK9 A;  5I59 B;  4F3S A;  1JEU A;  3ZKL A;  3BBR A;  4EF2 A;  3PMX A;  1B9J A;  4IO3 A;  4F31 B;  4NWC A;  4DXC A;  3KGC A;  2XXH A;  4E0X A;  1H3D A;  1YCJ A;  3R7X A;  2Y84 A;  3TKD A;  1H44 A;  4ELR A;  2Y7R A;  3TTM A;  1LB8 A;  1HSE A;  3IO6 A;  5JTY A;  4NF5 B;  3OD7 A;  3RPW A;  2DE2 A;  5HM4 B;  3C35 A;  1P1O A;  4AB6 A;  5H8N B;  4G2Z A;  2FNC A;  2Y7I A;  4WXJ A;  4Z0I A;  1H43 A;  2H98 A;  4E0W A;  1LLS A;  3JZJ A;  1URG A;  1O63 A;  4N13 A;  1NNK A;  4F29 A;  4XXU A;  1Y9U A;  4X1D A;  2HXW A;  4TQU Q;  3EN3 A;  3MAM A;  2FYI A;  4QRZ A;  2XXX A;  2XXV A;  4Q8R A;  4G8M A;  2UYE A;  4AQ4 A;  3TTN A;  2VHA A;  1N3X A;  2DWI A;  3G3G A;  1B1H A;  4TLM B;  5CM6 A;  4F19 A;  3HHF A;  1D9Y A;  4YKP A;  4ONY A;  4YKI A;  3Q26 A;  3V8X B;  3MJN A;  3HN0 A;  4N07 A;  3K1P A;  5K2X A;  2F7A A;  2A5T A;  2H25 A;  2UYF A;  1XVY A;  3N5L A;  2DXR A;  3EF7 A;  1S9T A;  4F3G A;  5BUU A;  1S50 A;  2OJT A;  2I48 A;  3UP9 A;  4G8H A;  2VP1 A;  1EH3 A;  3A3C A;  3DP6 A;  5I59 A;  3K6V A;  1MY4 A;  3EHT A;  1SDX A;  4PFU A;  3CG1 A;  4POX A;  3IOU A;  4KR5 A;  3MVZ A;  4XTC Q;  1RKM A;  4X9T A;  2OBG A;  5FHO A;  1URS A;  1B52 A;  1OIB A;  3UGW A;  4JSO A;  4FOR A;  3QK6 A;  1M5C A;  2AIX A;  1PB8 A;  2UVH A;  1B4Z A;  4M1V A;  1B40 A;  3K00 A;  2I58 A;  4LON B;  1B5I A;  4XKQ A;  1ELJ A;  2P0S A;  2XD3 A;  3MZ9 A;  1Y3Q A;  3VVD A;  2O1M A;  1FQD A;  4OFO A;  3S9E A;  5H8N A;  3I3V A;  1BKA A;  4G77 A;  4F3B A;  5DTB A;  1SQY A;  2OZZ A;  1PDA A;  3KOS A;  2NXO A;  3VXB A;  3LC8 A;  3KEI A;  4GD5 A;  4FAT A;  4MH5 A;  5I84 A;  3U8Q A;  1MPB A;  5L8D A;  1MY2 A;  3FVK A;  5TPA A;  1CE2 A;  2ABH A;  1RYX A;  4RNS A;  1JVX A;  1Y1Z A;  2OLB A;  1LAG E;  4DIG A;  3QAX A;  5DVJ A;  1MQJ A;  4PQJ A;  2PT1 A;  2XHD A;  3VVE A;  4U4X A;  4OES A;  1LAH E;  2ZMB A;  1IZ1 A;  1ZLQ A;  2I4C A;  4OEU A;  2ZNU A;  5CMB A;  4KCD A;  1DTZ A;  3MP1 A;  3ONM A;  1B51 A;  4MFI A;  3SEY A;  3H6V A;  3Q25 A;  1B7Z A;  3OO7 A;  1NMU A;  3IOW A;  2O69 A;  1R9L A;  2BJJ X;  4PE5 B;  3O66 A;  1A8F A;  4IO7 A;  3O28 A;  4H67 A;  3MUQ A;  3PV0 E;  1MPC A;  1ZMG A;  2H5Y A;  1IXH A;  4LAT A;  3CSB A;  1OQG A;  2DE4 A;  4R2F A;  1MH3 A;  1JW1 A;  1B0L A;  1DOT A;  2RC8 A;  4MLQ A;  3N6T A;  3F11 A;  2DWA A;  2HQ0 A;  4HCW A;  2Q89 A;  2RIN A;  1IIT A;  3RTF B;  2GH9 A;  1PBQ A;  2V93 A;  1ZJL A;  3SEX A;  3FVG A;  3GBA A;  3E13 X;  1MDP 1;  1PBP A;  2R9J A;  1OVB A;  2Z23 A;  3I5O A;  2RKM A;  4H6D A;  1QUJ A;  4U4S A;  1Z7N E;  4R9G A;  1MXU A;  4O3A A;  3EHU A;  3RT8 A;  2XXI A;  1FW0 A;  3LR1 A;  3C34 A;  3IX1 A;  3PU5 A;  3RNN A;  3MQ9 A;  2XXP A;  1A99 A;  3M3L A;  4UA8 A;  3ODB A;  4EF1 A;  2ZXT A;  4H8I A;  2OWS A;  4PFW A;  3U1O A;  1NH7 A;  2F8D A;  3O29 A;  1FTJ A;  1AOV A;  1AH5 A;  1TWY A;  5I58 B;  2VD2 A;  3MZ1 A;  4R6Y A;  4F1Y A;  2QPQ A;  3M8U A;  4RA1 A;  1FQB A;  3LSL A;  3BFU A;  3FIR A;  1LAF E;  2D3I A;  3TEP A;  2HEU A;  4FIM A;  2E0S A;  3FJG A;  3IB0 A;  3T93 B;  1MQD A;  3PUZ E;  2F78 A;  3T66 A;  4H1X A;  2A5S A;  3PMW A;  1EZ9 A;  1RYO A;  3EQ1 A;  2I49 A;  3ZS6 A;  3IL1 B;  4F22 A;  5CBR A;  4Z7E A;  5H8Q A;  3IOR A;  4K3F A;  1VSO A;  5AA3 A;  3H4Z A;  1LFG A;  3V5A A;  1FTO A;  5DYH A;  3FV1 A;  4G68 B;  4ZZA A;  1FTL A;  5TP9 B;  4H65 A;  1EZO A;  4PP0 A;  1SYH A;  2R6G E;  3PUW E;  1T0K A;  1QJM A;  3PPR A;  1N04 A;  5I56 B;  1L5T A;  3PMV A;  2Q88 A;  3PPQ A;  2DE3 A;  2DS9 A;  1S7Y A;  3MW0 A;  4P0G A;  3VLU A;  4UAC A;  4MLV A;  4YB5 A;  1O7T A;  1M5E A;  2QS4 A;  1SD3 A;  1QVS A;  1UIV A;  3B6T A;  3OEL A;  2ONS A;  2H4I A;  4ZEB A;  2YPN A;  5KCJ B;  5M2V A;  4LQ5 A;  4Q0C A;  3S4U A;  4PFT A;  2THI A;  2UXA A;  4RJZ A;  1MQH A;  3SET A;  2NWJ A;  1B0H A;  2F7B A;  5I58 A;  2E1S A;  5B7D A;  5CMK A;  1MH4 A;  1MXX A;  1D9V A;  1MDQ A;  2O84 X;  2O68 A;  3TTL A;  4DDD A;  4OXV A;  4YB6 A;  1B6H A;  5ITP A;  1QW0 A;  2ESN A;  3UA8 A;  3Q27 A;  5FTH A;  2RC9 A;  4F2Q A;  1B4H A;  1N7X A;  1US4 A;  3TDJ A;  2D21 A;  4M4G A;  4GRK A;  3EHS A;  1R6Z A;  4KYS A;  3RN8 A;  5AA2 A;  5EHM A;  3CRB A;  4FED A;  2Q2C A;  2RC7 A;  1GTK A;  1FQC A;  2LAO A;  4R9F A;  3SDF A;  5B70 A;  2UVJ A;  5L9S A;  2B65 A;  4G68 A;  2V3T A;  1YTV A;  1AMF A;  1MQG A;  3TTK A;  3CIJ A;  3G7W A;  5TP9 A;  4LZ5 A;  2XX7 A;  1GGG A;  3K1M A;  3O6H A;  4XKR A;  4BLA A;  4NTL A;  1B58 A;  1Y20 A;  4GLI A;  4O3C A;  3S9L C;  3N6U A;  5I56 A;  1JET A;  4ZE9 A;  2V3U A;  2Q9T A;  3ILT B;  3QUJ A;  2I6E A;  1KWH A;  3IR1 A;  1TT1 A;  1DMB A;  1MXV A;  1B05 A;  2HZL A;  4NF6 B;  5I2K B;  3C36 A;  3TFL A;  3G3F A;  1OLC A;  3HV1 A;  5HPQ A;  1B5J A;  3T9U A;  3LSW A;  1WOD A;  1Y1M A;  2DVZ A;  4LZ7 A;  3DP4 A;  4ELQ A;  5KCJ A;  3IJO B;  1LBC A;  3PUX E;  1P1Q A;  1UTH B;  2XD2 A;  3OEN A;  5A5X A;  3W9W A;  5FTI A;  4BDQ A;  1MXZ A;  3DLN A;  1MXY A;  4G4P A;  1B7U A;  2F34 A;  4G8N A;  3C33 A;  1XHY A;  4XKP A;  4EDP A;  3KJ7 A;  3DEL B;  4KYD A;  3PD8 A;  3CR9 A;  4FAJ A;  4L17 A;  4EXK A;  3SES A;  4R6K A;  5JK4 A;  1Q1K A;  3UN6 A;  1DTG A;  1IXG A;  2ZYK A;  3SEU A;  1US5 A;  1QUI A;  1A7L A;  1QUL A;  2G29 A;  1JW5 A;  3WAE A;  3TQL A;  4R73 A;  1A54 A;  3A3U A;  4GXS B;  1A55 A;  3H03 A;  2Z22 A;  3K01 A;  3K1N A;  2ZYO A;  4I8C A;  4NF5 A;  3O2A A;  1B3L A;  4ZS9 A;  4JWO A;  3KN8 A;  3QSL A;  3KN7 A;  2X7P A;  3GBB A;  4KHZ E;  1Y4C A;  1M5F A;  3FD3 A;  4YKJ A;  4HTG A;  3H3G A;  1CB6 A;  3TTR A;  1B3H A;  1B7H A;  3PGF A;  3PPN A;  3D4C A;  4C0R A;  3E3K A;  1MY0 A;  2X26 A;  2DVC A;  5L9M A;  3MZB A;  2GHB A;  4IGR A;  5H8H B;  4NF6 A;  1JEV A;  1LBB A;  2RCB A;  5I2K A;  5AA4 B;  3O6G A;  3UIF A;  3WAF A;  1R1N A;  1AIV A;  3TAJ A;  4ZEF A;  1JNF A;  2B3F A;  1JVY A;  4Q30 B;  3DM0 A;  1I6B A;  1UTH A;  1POT A;  3U93 A;  3G3J A;  4X48 A;  1IXI A;  2OWT A;  1AL3 A;  4IO4 A;  4EQ7 A;  3KOT A;  3MVX A;  3IOV A;  1TFD A;  4YZZ A;  1J1N A;  2VOZ A;  2XXT A;  2HFB A;  3MWB A;  2NUV A;  3K6X A;  1MM7 A;  3L6G A;  1BIY A;  4P11 A;  2DYX A;  5F7V A;  3H6T A;  5J1D A;  2Q2A A;  2O6A A;  2R71 A;  3MVY A;  1M5B A;  4GF8 A;  1SYI A;  1QKB A;  1XT8 A;  2V25 A;  1OMP A;  1NNT A;  4ZED A;  1B3E A;  2I3W A;  3K2D A;  3VXC A;  1NNF A;  1BLF A;  3O97 A;  5IAI A;  4OFJ A;  3HO7 A;  1LFH A;  2O7I A;  1Y4T A;  2I4B A;  4HS7 A;  1B1X A;  3AXF A;  1USY E;  4POW A;  3GZG A;  1B2H A;  4LQ2 A;  2F97 A;  1XC1 A;  1M5D A;  4IO6 A;  1LB9 A;  2V3Q A;  5CBS A;  1A8E A;  1QUK A;  3PD9 A;  3MPL A;  2Z8F A;  5H8H A;  3HHG A;  3TCH A;  3USD A;  4KQP A;  3TPA A;  3N94 A;  5AA4 A;  5CMM A;  4WEP A;  4EUO A;  4DZ1 A;  5CMC A;  4GXA A;  4TLL B;  2F35 A;  2F36 A;  3TQW A;  3ZSF A;  3BFT A;  3C4M A;  1WDN A;  1XOC A;  3B6W A;  1HSL A;  1DPE A;  2H99 A;  3A09 A;  1SI1 A;  4AB5 A;  2P2A A;  3OMB A;  1Z7M E;  3THI A;  5AE4 A;  1MY1 A;  1LCT A;  3ZKK A;  4Q5T A;  1GVC A;  2VD3 A;  2X7Q A;  4BDR A;  3H7M A;  1LST A;  3W9V A;  1SW1 A;  1IEJ A;  1B46 A;  1P1N A;  1OLA A;  1F9B A;  1N0T A;  3FGS A;  4IO5 A;  4U1Z A;  1LCF A;  4DCX A;  1OVT A;  3FAS A;  4ND9 A;  4O3B A;  4WKM A;  4IGT A;  1SI0 A;  3LBS A;  3CI8 A;  3OXN A;  1MM6 A;  2F5X A;  5EYF A;  2P1S A;  3FXR A;  4G68 C;  3FXU A;  2PX1 A;  5ELV A;  4U21 A;  4WED A;  1PB9 A;  2CMO A;  4R72 A;  4KYE A;  1POY 1;  1MRP A;  4YMB A;  1UIU A;  2DP8 A;  3KBR A;  3OO9 A;  1NKX A;  4QSE A;  1UTB B;  4BDO A;  1P1U A;  2QS1 A;  4R75 A;  5AA1 A;  4YB7 A;  2DXY A;  4P0I A;  3S2V A;  3CFZ A;  2UVG A;  3KN3 A;  4GWO A;  4FJP A;  3CVG A;  4JXI A;  4RY1 A;  3MC2 A;  4ESX A;  3CSG A;  2M8C A;  3FAT A;  4XIG Q;  1UQW A;  4OHN A;  3SEW A;  2F7C A;  4F18 A;  5HBC A;  3OEM A;  3K4U A;  3T9X B;  2IA4 A;  1FTM A;  3FJ7 A;  4FEC A;  4ELO A;  1XS5 A;  3C31 A;  3H06 B;  1II5 A;  4EXL A;  3IK6 B;  4NED A;  1IQ7 A;  3RUM A;  3B6Q A;  3VVF A;  1R9Q A;  4KD5 A;  4H5G A;  4R6H A;  5BWJ A;  3PPO A;  4LUB A;  3V89 B;  2ONK E;  4DLD A;  5ICQ A;  3H6U A;  5K2Y A;  4R74 A;  4IY5 A;  4FEB A;  3OO6 A;  1MXW A;  4OEN A;  4ZDM A;  1PB7 A;  5CRY A;  3QYT A;  5IKB A;  2NVU B;  2XXW A;  1IUD A;  4DXU A;  3GXA A;  3KSJ A;  4JBZ A;  3RTW B;  1P1W A;  1NNP A;  4IY6 A;  3SKP A;  1B3G A;  1URD A;  4QF9 A;  4MF3 A;  3L6H A;  2ZYN A;  1ZBM A;  3IJX B;  3I6V A; 
#chains in the Genus database with same CATH topology
 5ITO A;  1NV3 A;  5IGA A;  2PBW A;  4O94 A;  1DCU A;  1UTB A;  5CC2 A;  2YLN A;  2HCA A;  4NWD A;  2PYY A;  5TPA B;  2Q8J A;  4F39 A;  4I9D A;  1FPF A;  2WYP A;  4NE4 A;  1ATG A;  2Y7W A;  4H5F A;  5I2N B;  2YJP A;  3ECR A;  3JV9 A;  5L9O A;  4N6D A;  4GL8 A;  3OO8 A;  4I1D A;  4ZE8 A;  4ISU A;  2OX3 A;  4RPO A;  2QS2 A;  3VV5 A;  4GWW A;  4QHQ A;  3W15 C;  3FBP A;  3VDF A;  4QFL A;  4DE8 A;  4JWY A;  4MNC A;  5I57 B;  3QXM A;  1P99 A;  1GR2 A;  1SBP A;  2VGQ A;  3FVO A;  3S9M C;  2RCA A;  3HCQ A;  4OET A;  5DT6 A;  1I6A A;  2O7U A;  1OQH A;  2OCU A;  1RDZ A;  3CG3 A;  2G93 A;  1B3F A;  4U1O A;  2AL4 A;  4OEV A;  1BP5 A;  4MBP A;  4ECF A;  2QJE A;  1FPB A;  4QSC A;  2REG A;  4DCY A;  2HAV A;  4GIZ A;  4THI A;  3KFM A;  1LBV A;  1ZIU A;  4KI0 E;  2RF1 A;  4YIC A;  5DVI A;  1KA1 A;  3G3K A;  3IO4 A;  1H76 A;  1FQF A;  4F3P A;  1BK4 A;  1NI9 A;  3TMG A;  3QUF A;  2F6P A;  5I5P A;  3LUY A;  4BDN A;  3U92 A;  3LV0 A;  4QFO A;  4PGN A;  2B3B A;  2Y7K A;  4JDF A;  1FQA A;  2XX8 A;  3U72 A;  3UK4 A;  4QFP A;  1SW5 A;  3FXB A;  1PC3 A;  5EHS A;  1TFA A;  3E9X A;  5FHN A;  3VLW A;  1NL5 A;  3G3H A;  4LVQ A;  5H8S A;  2GFE A;  3IOT A;  1ZU0 A;  2XX9 A;  3U94 A;  4F1V A;  1TXF A;  3NOH A;  3OSQ A;  1YPN A;  5ICT A;  3FJM A;  3ILU B;  4F2O A;  2QSX A;  3QIM A;  2HPG A;  1DPP A;  2KLF A;  5I2N A;  4LA9 A;  4C1U A;  2WX9 A;  3ROJ A;  1IIW A;  2QMW A;  3FXQ A;  4PF6 A;  2ANJ A;  4LZ8 A;  4O7M A;  3MP6 A;  1MY3 A;  4QSD A;  2AYS A;  1D4N A;  3TYH A;  5I57 A;  4LP2 B;  2XXU A;  3IFA A;  4AS5 A;  4H46 A;  3CFL A;  4TOZ A;  2F6G A;  4U2R A;  1QKA A;  3S9N C;  3RGY A;  3C32 A;  3TEL A;  2V84 A;  3B8B A;  3RYD A;  4MEV A;  3RLF E;  3SZP A;  2I0C A;  1DSN A;  2Y7P A;  1D3K A;  3UOR A;  4PBQ A;  1RDX A;  2WBD A;  2PMS A;  3KZG A;  2DSF A;  4YKK A;  2PT2 A;  2IEE A;  1N7W A;  4GQO A;  2CZL A;  3O9P A;  4X1B A;  2KQZ A;  4H8J A;  3T96 B;  1FPI A;  2QRY A;  4GVO A;  2HAU A;  3D4G A;  4NF4 B;  3IB1 A;  3V83 A;  1WVJ A;  4OMB A;  3MPK A;  1SW4 A;  4RXL A;  1EZP A;  1FQE A;  3K6W A;  5H8F B;  2QMX A;  4KPT A;  4OQO A;  5H8Q B;  1N3W A;  2XWO A;  1VFD A;  4OVJ A;  4YMA A;  3VFJ A;  4GFR A;  3E4R A;  2QL3 A;  4IO2 A;  4EQB A;  5KZT A;  3H6W A;  1PEB A;  2FIE A;  3EPE A;  1O64 A;  2KR0 A;  4GL0 A;  4I3E A;  4GWS A;  3KSX A;  1I69 A;  4NF8 B;  1NH8 A;  1USY H;  4YAH X;  4RK2 A;  3TCF A;  4H0W A;  3G3I A;  2ZZV A;  3CFX A;  1KZ8 A;  1GV8 A;  2PFZ A;  3P7I A;  2ONR A;  2XXY A;  5CI5 A;  4ZZE A;  5F1Q A;  2AL5 A;  1A40 A;  3KJT A;  1YAE A;  3Q28 A;  4MMP A;  4R2B A;  4KFQ A;  2DWH A;  2ZNS A;  4HW8 A;  4QFK A;  2WKY A;  1EU8 A;  1YYZ A;  5AA2 D;  3C9H A;  3N26 A;  2Y5L A;  2ZNT A;  4P9K A;  1FTA A;  1K9Y A;  1INP A;  3HST A;  2NOO A;  3MBP A;  1NV6 A;  3B7D A;  2GHA A;  5ET8 A;  4OZ9 A;  2CZI A;  2DQV A;  4FE8 A;  2CZH A;  4O7I A;  4ZEI A;  4OFL A;  4XKN A;  4ZEK A;  5DEX B;  2HZK A;  2HHM A;  3OEK A;  1VFE A;  4N6P A;  3RQT A;  1VR5 A;  3IAZ A;  2FA7 A;  4NN3 A;  4C1T A;  5ET7 A;  2OWZ A;  4RYA A;  4P1E A;  5KDT B;  1LBZ A;  1I6Q A;  5IZ1 A;  3HPI A;  1B32 A;  2W7Y A;  2ZYM A;  1XI6 A;  1MPD A;  4NMY A;  5ISU A;  3M3F A;  3KG2 A;  1MS7 A;  3T9H B;  3OOA A;  3SER A;  4N4U A;  1ANF A;  1JW4 A;  4U23 A;  2B4L A;  2Z8E A;  1LGB C;  3BIH A;  1FBG A;  4OTE A;  3TUS A;  2DOJ A;  3R26 A;  1FCK A;  1N76 A;  2Z8D A;  5TU0 A;  1IXC A;  3TOD A;  4DXB A;  2Y5K A;  3JYR A;  4P8B A;  3VLV A;  3VE1 B;  3RY3 A;  5FHM A;  4GX3 A;  4KCC A;  2QS3 A;  4NF4 A;  5AA2 B;  1BTJ A;  3MST A;  1NFT A;  5H8F A;  3MP8 A;  3MVW A;  2O1L A;  5JEI A;  1IME A;  4PAF A;  3FZV A;  5ET5 A;  5DW8 A;  3FVN A;  1LAX A;  1VDW A;  4QFN A;  1ZTY A;  3FV2 A;  5JTY B;  3Q29 A;  4ELP A;  3TZA A;  3LSF B;  4NF8 A;  3M3K A;  2MKZ A;  3U65 A;  4HE0 A;  2REJ A;  5DVF A;  1LFI A;  3BKI B;  3TCG A;  1SW2 A;  4RPN A;  2D5W A;  4JB7 A;  4OER A;  3T9V A;  1H45 A;  3K6U A;  2UVI A;  2FIX A;  3R6U A;  4PFY A;  3GLB A;  3OSR A;  5LOM A;  2XXR A;  4OWD A;  2P3N A;  1N84 A;  2PVU A;  3T22 A;  4BDL A;  4JSD A;  2DWJ A;  4GOT A;  2JJK A;  2XXQ A;  2OK2 A;  4PET A;  2I0B A;  1JQF A;  2GRV A;  4U22 A;  3FUZ A;  1MQI A;  2H9B A;  2FBP A;  1FTK A;  5IZ3 B;  1XVX A;  1NV4 A;  4JWX A;  3K0V A;  1HSJ A;  3PUY E;  4N8G A;  5DEX A;  4F1U A;  1ZKB A;  2I3V A;  2ALU A;  4OYV A;  3IB2 A;  3RT6 B;  3K02 A;  1VE4 A;  5EYH A;  4BDM A;  3SEV A;  5A5X B;  3DP8 A;  4ZEC A;  4HCY A;  4G61 A;  4IB2 A;  3O6I A;  5EQ9 A;  3LSX A;  5KDT A;  2WBB A;  1YXI A;  3PPP A;  4XEQ A;  1B5H A;  4GBV A;  1Y3N A;  2O51 A;  4EQ9 A;  1MG1 A;  2A5T B;  4NGU A;  4I62 A;  4FBP A;  1IMB A;  1Y3P A;  4YU0 A;  1SVX B;  4ESW A;  4MJO A;  1Q35 A;  3PUV E;  4RK9 A;  4QXD A;  5I59 B;  4F3S A;  1JEU A;  4MIJ A;  3ZKL A;  3BBR A;  4EF2 A;  3PMX A;  1B9J A;  4IO3 A;  4F31 B;  1FJ6 A;  4NWC A;  4DXC A;  4N6K A;  3KGC A;  2XXH A;  4E0X A;  1H3D A;  1YCJ A;  3R7X A;  4N81 A;  2Y84 A;  3TKD A;  1H44 A;  4ELR A;  4JVC A;  2Y7R A;  3TTM A;  1LB8 A;  4PAI A;  1HSE A;  3IO6 A;  5JTY A;  4NF5 B;  3OD7 A;  4JVD A;  3RPW A;  2DE2 A;  4MAG A;  2ZZX A;  5HM4 B;  4P47 A;  3C35 A;  1P1O A;  4AB6 A;  5H8N B;  4G2Z A;  2FNC A;  3RPL B;  2Y7I A;  4WXJ A;  2QVV A;  4Z0I A;  1H43 A;  2H98 A;  1NUZ A;  4PDD A;  2VPO A;  4E0W A;  1LLS A;  3JZJ A;  1URG A;  1O63 A;  4N13 A;  1NNK A;  4F29 A;  4OVT A;  4XXU A;  1Y9U A;  4X1D A;  2HXW A;  4TQU Q;  2CEX A;  3EN3 A;  3MAM A;  5IZ3 A;  2FYI A;  4QRZ A;  2XXX A;  1FBE A;  2XXV A;  4Q8R A;  4G8M A;  2UYE A;  4P3L A;  4AQ4 A;  3TTN A;  2VHA A;  1N3X A;  2DWI A;  4PGP A;  3G3G A;  1B1H A;  4TLM B;  5CM6 A;  4F19 A;  3HHF A;  1D9Y A;  4YKP A;  4ONY A;  4YKI A;  1CNQ A;  3Q26 A;  3V8X B;  3MJN A;  3HN0 A;  4N07 A;  3K1P A;  5K2X A;  2F7A A;  4MNI A;  2A5T A;  4NF0 A;  2H25 A;  5EQ8 A;  1YZ0 A;  2UYF A;  1XVY A;  3N5L A;  2DXR A;  3EF7 A;  1S9T A;  4F3G A;  5BUU A;  1S50 A;  2OJT A;  2I48 A;  3UP9 A;  4G8H A;  2VP1 A;  1EH3 A;  4N15 A;  3A3C A;  3DP6 A;  5I59 A;  3K6V A;  2VT5 A;  1MY4 A;  3EHT A;  1SDX A;  4PFU A;  3CG1 A;  4POX A;  3IOU A;  4KR5 A;  3MVZ A;  4XTC Q;  2F3B A;  1RKM A;  4X9T A;  2OBG A;  1FPD A;  1NV5 A;  1URS A;  5FHO A;  1B52 A;  1OIB A;  3UGW A;  4JSO A;  4FOR A;  4I40 A;  3QK6 A;  1M5C A;  2AIX A;  1PB8 A;  2UVH A;  1B4Z A;  2GQ1 A;  4M1V A;  4DI3 D;  1B40 A;  3K00 A;  2I58 A;  4LON B;  1B5I A;  4XKQ A;  1ELJ A;  2P0S A;  2XD3 A;  3MZ9 A;  1Y3Q A;  3VVD A;  2O1M A;  1FQD A;  4I3Y A;  1FJ9 A;  4OFO A;  4N91 A;  5H8N A;  3S9E A;  3I3V A;  1BKA A;  4G77 A;  4F3B A;  5DTB A;  1SQY A;  2OZZ A;  4NQ8 A;  3RPL A;  1PDA A;  3KOS A;  2NXO A;  3VXB A;  3LC8 A;  3KEI A;  4GD5 A;  4H45 A;  1NV0 A;  4MH5 A;  4FAT A;  5I84 A;  3U8Q A;  1MPB A;  5L8D A;  1MY2 A;  3FVK A;  5TPA A;  1CE2 A;  2F3D A;  4UAB A;  2ABH A;  1RYX A;  4RNS A;  1JVX A;  4OVR A;  1Y1Z A;  2OLB A;  1LAG E;  5ET6 A;  4DIG A;  3QAX A;  5DVJ A;  1MQJ A;  4PQJ A;  2DDK A;  1EYJ A;  1G0H A;  2PT1 A;  2XHD A;  3VVE A;  4U4X A;  4OES A;  1LAH E;  4XFE A;  2CZK A;  2ZMB A;  1IZ1 A;  2V4C A;  1ZLQ A;  2I4C A;  4OEU A;  2ZNU A;  5CMB A;  4HXV A;  1IMA A;  4KCD A;  5I7I A;  5I3S A;  1DTZ A;  3MP1 A;  3ONM A;  1B51 A;  4MFI A;  3SEY A;  4NG7 A;  3H6V A;  3Q25 A;  1B7Z A;  3OO7 A;  3D1R A;  1Q9D A;  1NMU A;  3IOW A;  2O69 A;  1R9L A;  4XF5 A;  2BJJ X;  4PE5 B;  3O66 A;  1A8F A;  4IO7 A;  3O28 A;  4H67 A;  3MUQ A;  1FPJ A;  3PV0 E;  1MPC A;  1ZMG A;  2H5Y A;  1IXH A;  3KC0 A;  4X04 A;  4LAT A;  3CSB A;  1OQG A;  2DE4 A;  4R2F A;  4PF8 A;  1MH3 A;  1JW1 A;  1B0L A;  1DOT A;  2RC8 A;  3KBZ A;  4MLQ A;  3N6T A;  3F11 A;  2DWA A;  1LBW A;  3ISP A;  1FRP A;  2HQ0 A;  4HCW A;  2Q89 A;  2RIN A;  1IIT A;  3RTF B;  2GH9 A;  1PBQ A;  2V93 A;  1ZJL A;  3BIG A;  3SEX A;  3FVG A;  1EYK A;  1QGX A;  3GBA A;  3E13 X;  1FPG A;  1MDP 1;  1PBP A;  1FPE A;  2R9J A;  1OVB A;  2Z23 A;  3I5O A;  2RKM A;  4H6D A;  1QUJ A;  4U4S A;  1Z7N E;  4R9G A;  1MXU A;  2ZZW A;  4O3A A;  1G0I A;  3EHU A;  3RT8 A;  2XXI A;  3IFC A;  1FW0 A;  4GWU A;  3LR1 A;  3C34 A;  3IX1 A;  3PU5 A;  3RNN A;  3MQ9 A;  2XXP A;  4OVQ A;  1A99 A;  3M3L A;  4UA8 A;  3ODB A;  4EF1 A;  2ZXT A;  4H8I A;  1SPI A;  2OWS A;  4PFW A;  3U1O A;  1NH7 A;  2F8D A;  3O29 A;  1FTJ A;  4PCD A;  1AOV A;  1AH5 A;  1TWY A;  5I58 B;  2WYK A;  2VD2 A;  3MZ1 A;  4R6Y A;  4F1Y A;  2QPQ A;  3HFU A;  3M8U A;  4RA1 A;  1FQB A;  3LSL A;  3BFU A;  1DBZ A;  3FIR A;  1LAF E;  4OAN A;  1EYI A;  2D3I A;  3TEP A;  2HEU A;  4FIM A;  2E0S A;  3FJG A;  3IB0 A;  3T93 B;  1MQD A;  3PUZ E;  2F78 A;  3T66 A;  4H1X A;  2A5S A;  3PMW A;  1EZ9 A;  4PC9 A;  1RYO A;  4MHF A;  3EQ1 A;  2I49 A;  3ZS6 A;  3IL1 B;  4F22 A;  5CBR A;  5F24 A;  4Z7E A;  5H8Q A;  3IOR A;  4K3F A;  5IZZ A;  1VSO A;  4PFR A;  5AA3 A;  3H4Z A;  1LFG A;  3V5A A;  1FTO A;  5EQA A;  5DYH A;  3FV1 A;  4G68 B;  4ZZA A;  2XXK A;  1FTL A;  5TP9 B;  4H65 A;  1EZO A;  4PP0 A;  1SYH A;  2R6G E;  1LBX A;  3PUW E;  1T0K A;  1QJM A;  1LEV A;  3PPR A;  1NV2 A;  1N04 A;  5I56 B;  1L5T A;  3PMV A;  2Q88 A;  3PPQ A;  2DE3 A;  2DS9 A;  1S7Y A;  3MW0 A;  4P0G A;  3VLU A;  4UAC A;  4MLV A;  1O7T A;  4YB5 A;  1M5E A;  1NUX A;  2QS4 A;  1SD3 A;  1QVS A;  1UIV A;  3B6T A;  3OEL A;  2ONS A;  2H4I A;  4ZEB A;  2YPN A;  3QMF A;  5KCJ B;  5M2V A;  4N17 A;  4LQ5 A;  4Q0C A;  3S4U A;  4PFT A;  2THI A;  2UXA A;  4RJZ A;  1MQH A;  1IMD A;  3SET A;  2NWJ A;  1B0H A;  2F7B A;  5I58 A;  4PBH A;  2E1S A;  5B7D A;  5CMK A;  1MH4 A;  1MXX A;  1D9V A;  1MDQ A;  2O84 X;  2O68 A;  3TTL A;  4DDD A;  4OXV A;  4YB6 A;  1B6H A;  4MX6 A;  5ITP A;  1QW0 A;  2ESN A;  3UA8 A;  3Q27 A;  5FTH A;  2RC9 A;  4F2Q A;  1B4H A;  1N7X A;  1US4 A;  3TDJ A;  2D21 A;  5IM2 A;  4M4G A;  4NX1 A;  4GRK A;  3EHS A;  1R6Z A;  4KYS A;  3RN8 A;  5AA2 A;  5EHM A;  5EYG A;  3CRB A;  4FED A;  2Q2C A;  2RC7 A;  2CEY A;  1GTK A;  1FQC A;  2LAO A;  4R9F A;  3SDF A;  5B70 A;  2UVJ A;  5L9S A;  2B65 A;  4GX6 A;  4G68 A;  2V3T A;  1YTV A;  1AMF A;  1MQG A;  3TTK A;  3CIJ A;  3G7W A;  5TP9 A;  4LZ5 A;  2XX7 A;  1GGG A;  3K1M A;  3O6H A;  4XKR A;  4BLA A;  4NTL A;  1B58 A;  1Y20 A;  4GLI A;  4O3C A;  3S9L C;  3N6U A;  5I56 A;  1JET A;  2FVZ A;  4ZE9 A;  2V3U A;  2Q9T A;  3ILT B;  3QUJ A;  2I6E A;  5LTC A;  1KWH A;  3IR1 A;  1TT1 A;  1DMB A;  1MXV A;  3KC1 A;  1B05 A;  2HZL A;  1FBP A;  4NF6 B;  5I2K B;  3C36 A;  3TFL A;  3G3F A;  1OLC A;  3HV1 A;  5HPQ A;  4NHB A;  1B5J A;  3T9U A;  3LSW A;  1WOD A;  1Y1M A;  2DVZ A;  1NUY A;  4LZ7 A;  3DP4 A;  4ELQ A;  5KCJ A;  3IJO B;  1LBC A;  3PUX E;  3MYU A;  1P1Q A;  1UTH B;  2XD2 A;  3OEN A;  5A5X A;  3W9W A;  5FTI A;  4BDQ A;  2WEF A;  1MXZ A;  3CHG A;  3DLN A;  5LDZ A;  1MXY A;  4G4P A;  5FBP A;  1B7U A;  2F34 A;  1FPL A;  4G8N A;  3C33 A;  4IR8 A;  4AS4 A;  1XHY A;  4XKP A;  4EDP A;  5EQ7 A;  3KJ7 A;  3DEL B;  1AWB A;  4KYD A;  3PD8 A;  2FHY A;  3CR9 A;  4FAJ A;  4L17 A;  4EXK A;  3SES A;  4R6K A;  5JK4 A;  1Q1K A;  3UN6 A;  1DTG A;  1IXG A;  1FBC A;  4PDH A;  2ZYK A;  4GWX A;  4NAP A;  3SEU A;  4PFI A;  1US5 A;  1QUI A;  1A7L A;  1QUL A;  2G29 A;  1JW5 A;  3WAE A;  3TQL A;  4R73 A;  1A54 A;  3A3U A;  4GXS B;  1A55 A;  3H03 A;  2Z22 A;  2PCR A;  3K01 A;  3K1N A;  2ZYO A;  4I8C A;  2PFY A;  4NF5 A;  3O2A A;  3EKI A;  1B3L A;  4ZS9 A;  4JWO A;  3KN8 A;  3QSL A;  3KN7 A;  2X7P A;  3GBB A;  4KHZ E;  1RDY A;  1Y4C A;  1M5F A;  3FD3 A;  4YKJ A;  4HTG A;  3H3G A;  1CB6 A;  3TTR A;  1B3H A;  2XWI A;  1B7H A;  4LN5 A;  3PGF A;  3PPN A;  1FBD A;  3D4C A;  4C0R A;  3E3K A;  1MY0 A;  2X26 A;  2DVC A;  5L9M A;  3MZB A;  2GHB A;  1KA0 A;  4IGR A;  5H8H B;  4NF6 A;  1JEV A;  1LBB A;  2RCB A;  5I2K A;  5AA4 B;  3O6G A;  3UIF A;  3WAF A;  1R1N A;  1AIV A;  3A29 A;  3TAJ A;  4P1L A;  4ZEF A;  1JNF A;  2B3F A;  1JVY A;  2BJI A;  4Q30 B;  4HE2 A;  3DM0 A;  1I6B A;  1UTH A;  1POT A;  3U93 A;  2P3V A;  3G3J A;  4X48 A;  1IXI A;  2OWT A;  1AL3 A;  4IO4 A;  4EQ7 A;  3KOT A;  4GBW A;  3MVX A;  3IOV A;  1TFD A;  4YZZ A;  1J1N A;  2VOZ A;  4OVS A;  1FPK A;  2XXT A;  2HFB A;  3MWB A;  2NUV A;  3K6X A;  1MM7 A;  3L6G A;  4PAK A;  1BIY A;  4P11 A;  2DYX A;  5F7V A;  3H6T A;  5J1D A;  2Q2A A;  2O6A A;  2R71 A;  2Q74 A;  3MVY A;  2R8T A;  1M5B A;  4GF8 A;  1SYI A;  1QKB A;  1JP4 A;  1XT8 A;  2V25 A;  1OMP A;  1NNT A;  4OA4 A;  1NV1 A;  4ZED A;  1B3E A;  1FBF A;  2I3W A;  3K2D A;  3VXC A;  1NNF A;  1BLF A;  3O97 A;  5IAI A;  4OFJ A;  3HO7 A;  1LFH A;  2O7I A;  2QVR A;  1Y4T A;  2I4B A;  3E79 A;  4HS7 A;  3GYY A;  1B1X A;  3AXF A;  1USY E;  4POW A;  3GZG A;  3PTY A;  1B2H A;  4LQ2 A;  2F97 A;  1XC1 A;  1M5D A;  4IO6 A;  1LB9 A;  2V3Q A;  5CBS A;  1A8E A;  1QUK A;  3PD9 A;  3MPL A;  2Z8F A;  5H8H A;  3HHG A;  3TCH A;  3USD A;  4KQP A;  3TPA A;  3N94 A;  5AA4 A;  5CMM A;  4OVP A;  4WEP A;  4EUO A;  4DZ1 A;  5CMC A;  4GXA A;  4TLL B;  2F35 A;  2F36 A;  3TQW A;  3ZSF A;  3BFT A;  3B50 A;  3C4M A;  1WDN A;  1XOC A;  3B6W A;  1HSL A;  4PTK A;  1DPE A;  2H99 A;  3A09 A;  1SI1 A;  4AB5 A;  2P2A A;  3OMB A;  1Z7M E;  3THI A;  5AE4 A;  1MY1 A;  1LCT A;  3ZKK A;  4HE1 A;  4Q5T A;  1GVC A;  2VD3 A;  2X7Q A;  4BDR A;  3H7M A;  4GX4 A;  1LST A;  3W9V A;  1SW1 A;  4DI4 B;  1IEJ A;  1B46 A;  1P1N A;  4X8R A;  5ESY A;  1OLA A;  1F9B A;  1N0T A;  3FGS A;  4IO5 A;  4U1Z A;  1LCF A;  1IMF A;  4DCX A;  1FSA A;  1OVT A;  4N8Y A;  3FAS A;  4ND9 A;  1FBH A;  4O3B A;  4WKM A;  4IGT A;  1SI0 A;  3LBS A;  3CI8 A;  3OXN A;  1MM6 A;  2XA5 A;  2F5X A;  5EYF A;  2P1S A;  2Q8M A;  3FXR A;  4G68 C;  3FXU A;  2PX1 A;  5ELV A;  5A5L A;  4U21 A;  4WED A;  2XWV A;  4O8M A;  1PB9 A;  2CMO A;  4R72 A;  2VPN A;  5T3J A;  4KYE A;  1POY 1;  4P56 A;  1MRP A;  4YMB A;  1UIU A;  2DP8 A;  3KBR A;  3LUZ A;  3OO9 A;  1NKX A;  2QVU A;  4QSE A;  1UTB B;  4BDO A;  1P1U A;  2QS1 A;  4R75 A;  1LBY A;  5AA1 A;  4YB7 A;  2DXY A;  2XWK A;  4P0I A;  3S2V A;  3CFZ A;  2UVG A;  5J16 A;  3KN3 A;  4GWO A;  4FJP A;  3CVG A;  1DK4 A;  4JXI A;  4RY1 A;  3MC2 A;  4ESX A;  4MNP A;  3CSG A;  4GWY A;  2M8C A;  1D9Q A;  3FAT A;  4XIG Q;  1UQW A;  4OHN A;  3SEW A;  2F7C A;  4F18 A;  4MCO A;  2L5V A;  5HBC A;  3OEM A;  3K4U A;  3T9X B;  2IA4 A;  4PFB A;  1FTM A;  3FJ7 A;  4FEC A;  4ELO A;  1XS5 A;  3C31 A;  3H06 B;  1II5 A;  4EXL A;  3IK6 B;  1K9Z A;  4NED A;  1IQ7 A;  3RUM A;  3B6Q A;  4QBA A;  3VVF A;  1R9Q A;  4KD5 A;  4H5G A;  4R6H A;  3T1B A;  5BWJ A;  1NUW A;  3E78 A;  2HXR A;  3PPO A;  4LUB A;  3V89 B;  2ONK E;  4DLD A;  5ICQ A;  1IMC A;  4KXP A;  3H6U A;  5K2Y A;  4R74 A;  4IY5 A;  4FEB A;  3OO6 A;  1MXW A;  4GWZ A;  4OEN A;  3T0J A;  4ZDM A;  2B4M A;  2QFL A;  1PB7 A;  5CRY A;  3QYT A;  4JVI A;  5IKB A;  2NVU B;  2XXW A;  1IUD A;  4DXU A;  3GXA A;  3KSJ A;  4JBZ A;  4PE3 A;  3RTW B;  1P1W A;  1NNP A;  1NV7 A;  4IY6 A;  3SKP A;  1B3G A;  1URD A;  4QF9 A;  4MF3 A;  3L6H A;  2ZYN A;  1ZBM A;  3IJX B;  3I6V A; 
#chains in the Genus database with same CATH homology
 5ITO A;  2PBW A;  1UTB A;  5CC2 A;  2YLN A;  2HCA A;  4NWD A;  2PYY A;  5TPA B;  2Q8J A;  4F39 A;  4I9D A;  4NE4 A;  1ATG A;  2Y7W A;  4H5F A;  5I2N B;  2YJP A;  3ECR A;  3JV9 A;  5L9O A;  4GL8 A;  3OO8 A;  4I1D A;  4ZE8 A;  4ISU A;  4RPO A;  2QS2 A;  3VV5 A;  4QHQ A;  3W15 C;  3VDF A;  4QFL A;  4DE8 A;  4JWY A;  5I57 B;  3QXM A;  1P99 A;  1GR2 A;  1SBP A;  2VGQ A;  3FVO A;  3S9M C;  2RCA A;  3HCQ A;  4OET A;  5DT6 A;  1I6A A;  2O7U A;  1OQH A;  2OCU A;  3CG3 A;  2G93 A;  1B3F A;  4U1O A;  2AL4 A;  4OEV A;  1BP5 A;  4MBP A;  4ECF A;  2QJE A;  4QSC A;  2REG A;  4DCY A;  2HAV A;  4GIZ A;  4THI A;  3KFM A;  1ZIU A;  4KI0 E;  2RF1 A;  4YIC A;  5DVI A;  3G3K A;  3IO4 A;  1H76 A;  1FQF A;  4F3P A;  3TMG A;  3QUF A;  2F6P A;  3LUY A;  4BDN A;  3U92 A;  4QFO A;  2B3B A;  2Y7K A;  4JDF A;  1FQA A;  2XX8 A;  3U72 A;  3UK4 A;  4QFP A;  1SW5 A;  1PC3 A;  5EHS A;  1TFA A;  3E9X A;  5FHN A;  3VLW A;  1NL5 A;  3G3H A;  4LVQ A;  5H8S A;  2GFE A;  3IOT A;  1ZU0 A;  2XX9 A;  3U94 A;  4F1V A;  1TXF A;  3OSQ A;  1YPN A;  5ICT A;  3FJM A;  3ILU B;  4F2O A;  2QSX A;  3QIM A;  1DPP A;  2KLF A;  5I2N A;  4LA9 A;  4C1U A;  1IIW A;  2QMW A;  3FXQ A;  2ANJ A;  4LZ8 A;  3MP6 A;  1MY3 A;  4QSD A;  2AYS A;  1D4N A;  3TYH A;  5I57 A;  4LP2 B;  2XXU A;  3CFL A;  4TOZ A;  2F6G A;  4U2R A;  1QKA A;  3S9N C;  3RGY A;  3C32 A;  3TEL A;  2V84 A;  3RLF E;  2I0C A;  1DSN A;  2Y7P A;  1D3K A;  3UOR A;  2PMS A;  3KZG A;  2DSF A;  4YKK A;  2PT2 A;  2IEE A;  1N7W A;  4GQO A;  2CZL A;  3O9P A;  4X1B A;  4H8J A;  3T96 B;  2QRY A;  4GVO A;  2HAU A;  3D4G A;  4NF4 B;  3IB1 A;  3V83 A;  1WVJ A;  4OMB A;  3MPK A;  1SW4 A;  4RXL A;  1EZP A;  1FQE A;  3K6W A;  5H8F B;  2QMX A;  4KPT A;  4OQO A;  5H8Q B;  1N3W A;  1VFD A;  4OVJ A;  4YMA A;  3VFJ A;  4GFR A;  3E4R A;  2QL3 A;  4IO2 A;  4EQB A;  5KZT A;  3H6W A;  1PEB A;  3EPE A;  1O64 A;  4GL0 A;  3KSX A;  1I69 A;  4NF8 B;  1NH8 A;  1USY H;  4YAH X;  4RK2 A;  3TCF A;  4H0W A;  3G3I A;  3CFX A;  1GV8 A;  3P7I A;  2ONR A;  2XXY A;  5CI5 A;  4ZZE A;  5F1Q A;  2AL5 A;  1A40 A;  3KJT A;  1YAE A;  3Q28 A;  4R2B A;  4KFQ A;  2DWH A;  2ZNS A;  4HW8 A;  4QFK A;  2WKY A;  1EU8 A;  5AA2 D;  3C9H A;  3N26 A;  2ZNT A;  3HST A;  2NOO A;  3MBP A;  3B7D A;  2GHA A;  4OZ9 A;  2DQV A;  4FE8 A;  4ZEI A;  4OFL A;  4XKN A;  4ZEK A;  5DEX B;  2HZK A;  3OEK A;  1VFE A;  4N6P A;  3RQT A;  1VR5 A;  3IAZ A;  2FA7 A;  4C1T A;  4RYA A;  5KDT B;  1I6Q A;  3HPI A;  1B32 A;  2W7Y A;  2ZYM A;  1MPD A;  4NMY A;  5ISU A;  3M3F A;  3KG2 A;  1MS7 A;  3T9H B;  3OOA A;  3SER A;  1ANF A;  1JW4 A;  4U23 A;  2Z8E A;  1LGB C;  4OTE A;  3TUS A;  2DOJ A;  3R26 A;  1FCK A;  1N76 A;  2Z8D A;  5TU0 A;  1IXC A;  3TOD A;  4DXB A;  3JYR A;  3VLV A;  3VE1 B;  3RY3 A;  5FHM A;  4KCC A;  2QS3 A;  4NF4 A;  5AA2 B;  1BTJ A;  1NFT A;  5H8F A;  3MP8 A;  3MVW A;  2O1L A;  5JEI A;  3FZV A;  3FVN A;  1LAX A;  4QFN A;  1ZTY A;  3FV2 A;  5JTY B;  3Q29 A;  4ELP A;  3TZA A;  3LSF B;  4NF8 A;  3M3K A;  2REJ A;  5DVF A;  1LFI A;  3BKI B;  3TCG A;  1SW2 A;  4RPN A;  2D5W A;  4JB7 A;  4OER A;  3T9V A;  1H45 A;  3K6U A;  2UVI A;  3R6U A;  4PFY A;  3GLB A;  3OSR A;  5LOM A;  2XXR A;  4OWD A;  1N84 A;  2PVU A;  3T22 A;  4BDL A;  4JSD A;  2DWJ A;  4GOT A;  2XXQ A;  2OK2 A;  4PET A;  2I0B A;  1JQF A;  2GRV A;  4U22 A;  3FUZ A;  1MQI A;  2H9B A;  1FTK A;  1XVX A;  4JWX A;  3K0V A;  1HSJ A;  3PUY E;  5DEX A;  4F1U A;  1ZKB A;  2I3V A;  2ALU A;  4OYV A;  3IB2 A;  3RT6 B;  3K02 A;  1VE4 A;  4BDM A;  3SEV A;  5A5X B;  3DP8 A;  4ZEC A;  4HCY A;  4IB2 A;  3O6I A;  3LSX A;  5KDT A;  3PPP A;  1B5H A;  1Y3N A;  2O51 A;  4EQ9 A;  1MG1 A;  2A5T B;  4I62 A;  1Y3P A;  4YU0 A;  1SVX B;  4ESW A;  1Q35 A;  3PUV E;  4RK9 A;  5I59 B;  4F3S A;  1JEU A;  3ZKL A;  3BBR A;  4EF2 A;  3PMX A;  1B9J A;  4IO3 A;  4F31 B;  4NWC A;  4DXC A;  3KGC A;  2XXH A;  4E0X A;  1H3D A;  1YCJ A;  3R7X A;  2Y84 A;  3TKD A;  1H44 A;  4ELR A;  2Y7R A;  3TTM A;  1LB8 A;  1HSE A;  3IO6 A;  5JTY A;  4NF5 B;  3OD7 A;  3RPW A;  2DE2 A;  5HM4 B;  3C35 A;  1P1O A;  4AB6 A;  5H8N B;  4G2Z A;  2FNC A;  2Y7I A;  4WXJ A;  4Z0I A;  1H43 A;  2H98 A;  4E0W A;  1LLS A;  3JZJ A;  1URG A;  1O63 A;  4N13 A;  1NNK A;  4F29 A;  4XXU A;  1Y9U A;  4X1D A;  2HXW A;  4TQU Q;  3EN3 A;  3MAM A;  2FYI A;  4QRZ A;  2XXX A;  2XXV A;  4Q8R A;  4G8M A;  2UYE A;  4AQ4 A;  3TTN A;  2VHA A;  1N3X A;  2DWI A;  3G3G A;  1B1H A;  4TLM B;  5CM6 A;  4F19 A;  3HHF A;  1D9Y A;  4YKP A;  4ONY A;  4YKI A;  3Q26 A;  3V8X B;  3MJN A;  3HN0 A;  4N07 A;  3K1P A;  5K2X A;  2F7A A;  2A5T A;  2H25 A;  2UYF A;  1XVY A;  3N5L A;  2DXR A;  3EF7 A;  1S9T A;  4F3G A;  5BUU A;  1S50 A;  2OJT A;  2I48 A;  3UP9 A;  4G8H A;  2VP1 A;  1EH3 A;  3A3C A;  3DP6 A;  5I59 A;  3K6V A;  1MY4 A;  3EHT A;  1SDX A;  4PFU A;  3CG1 A;  4POX A;  3IOU A;  4KR5 A;  3MVZ A;  4XTC Q;  1RKM A;  4X9T A;  2OBG A;  5FHO A;  1URS A;  1B52 A;  1OIB A;  3UGW A;  4JSO A;  4FOR A;  3QK6 A;  1M5C A;  2AIX A;  1PB8 A;  2UVH A;  1B4Z A;  4M1V A;  1B40 A;  3K00 A;  2I58 A;  4LON B;  1B5I A;  4XKQ A;  1ELJ A;  2P0S A;  2XD3 A;  3MZ9 A;  1Y3Q A;  3VVD A;  2O1M A;  1FQD A;  4OFO A;  3S9E A;  5H8N A;  3I3V A;  1BKA A;  4G77 A;  4F3B A;  5DTB A;  1SQY A;  2OZZ A;  1PDA A;  3KOS A;  2NXO A;  3VXB A;  3LC8 A;  3KEI A;  4GD5 A;  4FAT A;  4MH5 A;  5I84 A;  3U8Q A;  1MPB A;  5L8D A;  1MY2 A;  3FVK A;  5TPA A;  1CE2 A;  2ABH A;  1RYX A;  4RNS A;  1JVX A;  1Y1Z A;  2OLB A;  1LAG E;  4DIG A;  3QAX A;  5DVJ A;  1MQJ A;  4PQJ A;  2PT1 A;  2XHD A;  3VVE A;  4U4X A;  4OES A;  1LAH E;  2ZMB A;  1IZ1 A;  1ZLQ A;  2I4C A;  4OEU A;  2ZNU A;  5CMB A;  4KCD A;  1DTZ A;  3MP1 A;  3ONM A;  1B51 A;  4MFI A;  3SEY A;  3H6V A;  3Q25 A;  1B7Z A;  3OO7 A;  1NMU A;  3IOW A;  2O69 A;  1R9L A;  2BJJ X;  4PE5 B;  3O66 A;  1A8F A;  4IO7 A;  3O28 A;  4H67 A;  3MUQ A;  3PV0 E;  1MPC A;  1ZMG A;  2H5Y A;  1IXH A;  4LAT A;  3CSB A;  1OQG A;  2DE4 A;  4R2F A;  1MH3 A;  1JW1 A;  1B0L A;  1DOT A;  2RC8 A;  4MLQ A;  3N6T A;  3F11 A;  2DWA A;  2HQ0 A;  4HCW A;  2Q89 A;  2RIN A;  1IIT A;  3RTF B;  2GH9 A;  1PBQ A;  2V93 A;  1ZJL A;  3SEX A;  3FVG A;  3GBA A;  3E13 X;  1MDP 1;  1PBP A;  2R9J A;  1OVB A;  2Z23 A;  3I5O A;  2RKM A;  4H6D A;  1QUJ A;  4U4S A;  1Z7N E;  4R9G A;  1MXU A;  4O3A A;  3EHU A;  3RT8 A;  2XXI A;  1FW0 A;  3LR1 A;  3C34 A;  3IX1 A;  3PU5 A;  3RNN A;  3MQ9 A;  2XXP A;  1A99 A;  3M3L A;  4UA8 A;  3ODB A;  4EF1 A;  2ZXT A;  4H8I A;  2OWS A;  4PFW A;  3U1O A;  1NH7 A;  2F8D A;  3O29 A;  1FTJ A;  1AOV A;  1AH5 A;  1TWY A;  5I58 B;  2VD2 A;  3MZ1 A;  4R6Y A;  4F1Y A;  2QPQ A;  3M8U A;  4RA1 A;  1FQB A;  3LSL A;  3BFU A;  3FIR A;  1LAF E;  2D3I A;  3TEP A;  2HEU A;  4FIM A;  2E0S A;  3FJG A;  3IB0 A;  3T93 B;  1MQD A;  3PUZ E;  2F78 A;  3T66 A;  4H1X A;  2A5S A;  3PMW A;  1EZ9 A;  1RYO A;  3EQ1 A;  2I49 A;  3ZS6 A;  3IL1 B;  4F22 A;  5CBR A;  4Z7E A;  5H8Q A;  3IOR A;  4K3F A;  1VSO A;  5AA3 A;  3H4Z A;  1LFG A;  3V5A A;  1FTO A;  5DYH A;  3FV1 A;  4G68 B;  4ZZA A;  1FTL A;  5TP9 B;  4H65 A;  1EZO A;  4PP0 A;  1SYH A;  2R6G E;  3PUW E;  1T0K A;  1QJM A;  3PPR A;  1N04 A;  5I56 B;  1L5T A;  3PMV A;  2Q88 A;  3PPQ A;  2DE3 A;  2DS9 A;  1S7Y A;  3MW0 A;  4P0G A;  3VLU A;  4UAC A;  4MLV A;  4YB5 A;  1O7T A;  1M5E A;  2QS4 A;  1SD3 A;  1QVS A;  1UIV A;  3B6T A;  3OEL A;  2ONS A;  2H4I A;  4ZEB A;  2YPN A;  5KCJ B;  5M2V A;  4LQ5 A;  4Q0C A;  3S4U A;  4PFT A;  2THI A;  2UXA A;  4RJZ A;  1MQH A;  3SET A;  2NWJ A;  1B0H A;  2F7B A;  5I58 A;  2E1S A;  5B7D A;  5CMK A;  1MH4 A;  1MXX A;  1D9V A;  1MDQ A;  2O84 X;  2O68 A;  3TTL A;  4DDD A;  4OXV A;  4YB6 A;  1B6H A;  5ITP A;  1QW0 A;  2ESN A;  3UA8 A;  3Q27 A;  5FTH A;  2RC9 A;  4F2Q A;  1B4H A;  1N7X A;  1US4 A;  3TDJ A;  2D21 A;  4M4G A;  4GRK A;  3EHS A;  1R6Z A;  4KYS A;  3RN8 A;  5AA2 A;  5EHM A;  3CRB A;  4FED A;  2Q2C A;  2RC7 A;  1GTK A;  1FQC A;  2LAO A;  4R9F A;  3SDF A;  5B70 A;  2UVJ A;  5L9S A;  2B65 A;  4G68 A;  2V3T A;  1YTV A;  1AMF A;  1MQG A;  3TTK A;  3CIJ A;  3G7W A;  5TP9 A;  4LZ5 A;  2XX7 A;  1GGG A;  3K1M A;  3O6H A;  4XKR A;  4BLA A;  4NTL A;  1B58 A;  1Y20 A;  4GLI A;  4O3C A;  3S9L C;  3N6U A;  5I56 A;  1JET A;  4ZE9 A;  2V3U A;  2Q9T A;  3ILT B;  3QUJ A;  2I6E A;  1KWH A;  3IR1 A;  1TT1 A;  1DMB A;  1MXV A;  1B05 A;  2HZL A;  4NF6 B;  5I2K B;  3C36 A;  3TFL A;  3G3F A;  1OLC A;  3HV1 A;  5HPQ A;  1B5J A;  3T9U A;  3LSW A;  1WOD A;  1Y1M A;  2DVZ A;  4LZ7 A;  3DP4 A;  4ELQ A;  5KCJ A;  3IJO B;  1LBC A;  3PUX E;  1P1Q A;  1UTH B;  2XD2 A;  3OEN A;  5A5X A;  3W9W A;  5FTI A;  4BDQ A;  1MXZ A;  3DLN A;  1MXY A;  4G4P A;  1B7U A;  2F34 A;  4G8N A;  3C33 A;  1XHY A;  4XKP A;  4EDP A;  3KJ7 A;  3DEL B;  4KYD A;  3PD8 A;  3CR9 A;  4FAJ A;  4L17 A;  4EXK A;  3SES A;  4R6K A;  5JK4 A;  1Q1K A;  3UN6 A;  1DTG A;  1IXG A;  2ZYK A;  3SEU A;  1US5 A;  1QUI A;  1A7L A;  1QUL A;  2G29 A;  1JW5 A;  3WAE A;  3TQL A;  4R73 A;  1A54 A;  3A3U A;  4GXS B;  1A55 A;  3H03 A;  2Z22 A;  3K01 A;  3K1N A;  2ZYO A;  4I8C A;  4NF5 A;  3O2A A;  1B3L A;  4ZS9 A;  4JWO A;  3KN8 A;  3QSL A;  3KN7 A;  2X7P A;  3GBB A;  4KHZ E;  1Y4C A;  1M5F A;  3FD3 A;  4YKJ A;  4HTG A;  3H3G A;  1CB6 A;  3TTR A;  1B3H A;  1B7H A;  3PGF A;  3PPN A;  3D4C A;  4C0R A;  3E3K A;  1MY0 A;  2X26 A;  2DVC A;  5L9M A;  3MZB A;  2GHB A;  4IGR A;  5H8H B;  4NF6 A;  1JEV A;  1LBB A;  2RCB A;  5I2K A;  5AA4 B;  3O6G A;  3UIF A;  3WAF A;  1R1N A;  1AIV A;  3TAJ A;  4ZEF A;  1JNF A;  2B3F A;  1JVY A;  4Q30 B;  3DM0 A;  1I6B A;  1UTH A;  1POT A;  3U93 A;  3G3J A;  4X48 A;  1IXI A;  2OWT A;  1AL3 A;  4IO4 A;  4EQ7 A;  3KOT A;  3MVX A;  3IOV A;  1TFD A;  4YZZ A;  1J1N A;  2VOZ A;  2XXT A;  2HFB A;  3MWB A;  2NUV A;  3K6X A;  1MM7 A;  3L6G A;  1BIY A;  4P11 A;  2DYX A;  5F7V A;  3H6T A;  5J1D A;  2Q2A A;  2O6A A;  2R71 A;  3MVY A;  1M5B A;  4GF8 A;  1SYI A;  1QKB A;  1XT8 A;  2V25 A;  1OMP A;  1NNT A;  4ZED A;  1B3E A;  2I3W A;  3K2D A;  3VXC A;  1NNF A;  1BLF A;  3O97 A;  5IAI A;  4OFJ A;  3HO7 A;  1LFH A;  2O7I A;  1Y4T A;  2I4B A;  4HS7 A;  1B1X A;  3AXF A;  1USY E;  4POW A;  3GZG A;  1B2H A;  4LQ2 A;  2F97 A;  1XC1 A;  1M5D A;  4IO6 A;  1LB9 A;  2V3Q A;  5CBS A;  1A8E A;  1QUK A;  3PD9 A;  3MPL A;  2Z8F A;  5H8H A;  3HHG A;  3TCH A;  3USD A;  4KQP A;  3TPA A;  3N94 A;  5AA4 A;  5CMM A;  4WEP A;  4EUO A;  4DZ1 A;  5CMC A;  4GXA A;  4TLL B;  2F35 A;  2F36 A;  3TQW A;  3ZSF A;  3BFT A;  3C4M A;  1WDN A;  1XOC A;  3B6W A;  1HSL A;  1DPE A;  2H99 A;  3A09 A;  1SI1 A;  4AB5 A;  2P2A A;  3OMB A;  1Z7M E;  3THI A;  5AE4 A;  1MY1 A;  1LCT A;  3ZKK A;  4Q5T A;  1GVC A;  2VD3 A;  2X7Q A;  4BDR A;  3H7M A;  1LST A;  3W9V A;  1SW1 A;  1IEJ A;  1B46 A;  1P1N A;  1OLA A;  1F9B A;  1N0T A;  3FGS A;  4IO5 A;  4U1Z A;  1LCF A;  4DCX A;  1OVT A;  3FAS A;  4ND9 A;  4O3B A;  4WKM A;  4IGT A;  1SI0 A;  3LBS A;  3CI8 A;  3OXN A;  1MM6 A;  2F5X A;  5EYF A;  2P1S A;  3FXR A;  4G68 C;  3FXU A;  2PX1 A;  5ELV A;  4U21 A;  4WED A;  1PB9 A;  2CMO A;  4R72 A;  4KYE A;  1POY 1;  1MRP A;  4YMB A;  1UIU A;  2DP8 A;  3KBR A;  3OO9 A;  1NKX A;  4QSE A;  1UTB B;  4BDO A;  1P1U A;  2QS1 A;  4R75 A;  5AA1 A;  4YB7 A;  2DXY A;  4P0I A;  3S2V A;  3CFZ A;  2UVG A;  3KN3 A;  4GWO A;  4FJP A;  3CVG A;  4JXI A;  4RY1 A;  3MC2 A;  4ESX A;  3CSG A;  2M8C A;  3FAT A;  4XIG Q;  1UQW A;  4OHN A;  3SEW A;  2F7C A;  4F18 A;  5HBC A;  3OEM A;  3K4U A;  3T9X B;  2IA4 A;  1FTM A;  3FJ7 A;  4FEC A;  4ELO A;  1XS5 A;  3C31 A;  3H06 B;  1II5 A;  4EXL A;  3IK6 B;  4NED A;  1IQ7 A;  3RUM A;  3B6Q A;  3VVF A;  1R9Q A;  4KD5 A;  4H5G A;  4R6H A;  5BWJ A;  3PPO A;  4LUB A;  3V89 B;  2ONK E;  4DLD A;  5ICQ A;  3H6U A;  5K2Y A;  4R74 A;  4IY5 A;  4FEB A;  3OO6 A;  1MXW A;  4OEN A;  4ZDM A;  1PB7 A;  5CRY A;  3QYT A;  5IKB A;  2NVU B;  2XXW A;  1IUD A;  4DXU A;  3GXA A;  3KSJ A;  4JBZ A;  3RTW B;  1P1W A;  1NNP A;  4IY6 A;  3SKP A;  1B3G A;  1URD A;  4QF9 A;  4MF3 A;  3L6H A;  2ZYN A;  1ZBM A;  3IJX B;  3I6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...