4KQPA

Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
230
structure length
230
Chain Sequence
ATPKKDVYTIASDNSFAPFEFQNDDKQFTGIDVDLLNAIAKNQGFKLKWNFIGFQAAVDSVQSGHADGMMSGMSITDARKQVFDYGSPYYSSNLTIATSSTDDSIKSWKDLKGKTLGAKNGTASFDYLNAHAKEYGYTVKTFTDATTMYSSLNNGSINALMDDEPVIKYAIKQGQKFATPIKPIPDGQYGFAVKKGSNPELIEMFNNGLANLRANGEYDKIIDKYLESDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Glutamine ABC transporter permease and substrate binding pro
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
total genus 79
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2013-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kqpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kqpA02
1B3GA 3Q27A 4LQ2A 1MPBA 3A09A 3OO6A 2Z22A 1JETA 3T9XB 1LAFE 1SW5A 4MLVA 5H8HA 2HAUA 1FTLA 3O6GA 1TFAA 1VSOA 4DXBA 4FATA 3QAXA 3K1NA 3ODBA 4ONYA 3KOTA 4Z7EA 1B52A 4QF9A 5A5XA 1GVCA 2G93A 5I59A 3MVWA 1O64A 2Q2CA 4XKRA 2XXYA 1FW0A 3GLBA 2W7YA 4GLIA 1OLCA 3N6TA 1H44A 1YCJA 3Q26A 1LB9A 2VGQA 4GL8A 3VXCA 3N94A 1B3HA 4ZDMA 3MW0A 3FVKA 3H6VA 3PMWA 4NF8A 2QS2A 2F97A 3E9XA 4Q30B 3PPNA 3G3JA 1EZPA 1MY4A 1S9TA 1SW4A 3H03A 1D4NA 2PT1A 2XX8A 1N7WA 3VE1B 2I3VA 3HPIA 1HSEA 3IX1A 4OVJA 4I8CA 3MPLA 3MP1A 2V3QA 1FCKA 3K0VA 5KCJB 4NF4B 3CR9A 4ESXA 5I58A 5AA2D 1FTOA 4JBZA 3N6UA 2XXVA 4EF1A 2ZMBA 2ONKE 5HBCA 1JVYA 1MPDA 2XXPA 3TELA 3K00A 3T93B 2PBWA 2AL5A 1MY3A 3FZVA 4YB6A 1MS7A 4Q8RA 1PB7A 3OEKA 1YAEA 2D3IA 4LZ7A 3HSTA 4G8MA 3QK6A 4HW8A 1MM7A 5L9OA 1YTVA 4HS7A 2AL4A 3TPAA 1MXYA 4KD5A 1AL3A 2OCUA 3L6HA 2XHDA 1USYE 3RY3A 5DEXB 1O63A 3C31A 2I49A 5L9SA 1B4ZA 5CI5A 3FD3A 2HZKA 2UYFA 1PEBA 3PU5A 5CBSA 3FVGA 3EF7A 4NEDA 1JEVA 2PVUA 3IOVA 1B9JA 4XKQA 4P11A 5IKBA 3W9VA 3K01A 3N26A 5I2KA 1DPEA 3ZSFA 4NMYA 3T9UA 2AYSA 4WXJA 2V3TA 5AE4A 1IIWA 2ZNTA 2RC9A 1EZ9A 4F3PA 4OZ9A 4I1DA 3W9WA 1JNFA 3IO6A 5H8HB 5H8NA 3MZ1A 3BFUA 1S50A 3IORA 2FYIA 3K02A 3MVYA 1XVXA 2RKMA 4H67A 4OEVA 1POY1 3DP6A 3U72A 3GZGA 2GHAA 4ZEDA 1Y1MA 2UVJA 3CSBA 4ZE9A 1H45A 4YKIA 5DVFA 1RYXA 1AMFA 3D4CA 3C34A 2P1SA 3T96B 5EYFA 1Y3PA 4NE4A 4IO6A 1WVJA 3F11A 2X26A 2HQ0A 3PD9A 1Y3QA 2NXOA 2PMSA 1I6QA 1XS5A 2PYYA 2HFBA 4PFWA 2DYXA 4RYAA 3JV9A 2F36A 3I5OA 5H8SA 2X7PA 3E4RA 3T66A 1UQWA 3VLWA 1A8FA 4YKKA 4YKJA 4ESWA 2KLFA 1ZKBA 1CE2A 3LSLA 5M2VA 4WKMA 3V83A 3FV1A 4C1UA 1A8EA 1LB8A 1FQCA 2I0BA 2XXXA 1EH3A 3TTLA 1IXGA 1H76A 1N04A 1FQEA 2HEUA 1LFHA 2QS3A 5FTIA 3IB0A 3H4ZA 3S9LC 4OFLA 2O68A 4F2QA 2VD2A 4P0GA 3C32A 5CMCA 3B6WA 4EUOA 4MLQA 4X1BA 1SI0A 2I4BA 3ZKKA 4OETA 3V89B 1M5DA 3U8QA 5TPAA 4G8HA 3L6GA 2DE4A 3FXUA 1IEJA 4H1XA 4OFOA 1RKMA 1LAXA 1LBCA 5I2NA 3K6WA 5TP9A 4H0WA 1SW1A 4F39A 3K1MA 4PETA 2H25A 4PFUA 2R6GE 3GXAA 4KPTA 3O66A 1GGGA 3MQ9A 4OEUA 4R6HA 4F1VA 2PT2A 4X1DA 5BWJA 3M3KA 2QS4A 1OVBA 2Y7RA 4RY1A 4GQOA 1VFEA 1MG1A 4GD5A 3TMGA 1XOCA 5CBRA 3PMVA 4X48A 5KZTA 2XXWA 1SD3A 4EXKA 1SYHA 1MRPA 2DP8A 2QSXA 4F18A 3LR1A 5H8NB 2HXWA 3OEMA 5LOMA 1P99A 4LP2B 4R2FA 2DXYA 3RT6B 1MXWA 2NOOA 4KCDA 3UGWA 4QFKA 2DXRA 3O2AA 2OK2A 5AA1A 2DSFA 1Y9UA 4LA9A 4U23A 2O1LA 1GV8A 2OJTA 1IITA 1ZJLA 3CSGA 5TU0A 1IXIA 1FTMA 1OIBA 3G3IA 4ZS9A 1CB6A 4N13A 4JSDA 3QUFA 4DE8A 2O84X 2XXRA 3PGFA 1NH8A 1Y4TA 1N76A 2H99A 3VLUA 5CMKA 3RN8A 2VP1A 4ZE8A 1TT1A 3LSFB 1Q1KA 3KN7A 1XHYA 3IAZA 5IAIA 2XXIA 2I3WA 1AIVA 3PUVE 4E0XA 1ZMGA 3O6IA 4IY5A 5L9MA 1Z7ME 2QRYA 2Y7IA 4LZ8A 1B51A 3DM0A 1NFTA 1MY2A 2I0CA 1QW0A 3G3KA 4IO3A 4IO2A 4HCWA 2H98A 4G68B 3O6HA 3W15C 3M8UA 4ZEKA 2HAVA 2D21A 1B58A 4ELOA 1S7YA 2UVGA 1ZU0A 1B7UA 3MVXA 3TQWA 1N3WA 5HPQA 4AB5A 3FVNA 4KHZE 3T9VA 1WDNA 5TPAB 3K6XA 3IOTA 3UP9A 2A5SA 4YICA 3IL1B 2DOJA 1JW4A 4F19A 4HTGA 1QKAA 4Q5TA 1B7ZA 3QSLA 3T22A 3RGYA 5I2NB 3OSQA 5TP9B 1HSJA 3R7XA 4GRKA 3CFZA 1NH7A 1N7XA 2O1MA 3DP4A 3FVOA 4RXLA 3K1PA 3QXMA 2YLNA 4F31B 3H3GA 1MH3A 2R9JA 3B6QA 3RTWB 4EQBA 5K2XA 4TQUQ 3IJXB 3HCQA 4F29A 3H06B 4YZZA 2O7UA 4OESA 1D9YA 4Q0CA 1MPCA 4GF8A 1M5EA 1R9LA 1OQGA 2XXHA 1I6AA 1DTGA 1ATGA 5DT6A 4QSDA 1SYIA 3R6UA 3TYHA 1JEUA 1URGA 3Q28A 1Y4CA 4F3GA 4FIMA 2OWTA 3DP8A 5I56B 3H7MA 5EHMA 1DOTA 5K2YA 4RPOA 4PQJA 2Z8FA 2RINA 2VOZA 4BDLA 4QFNA 5JK4A 1SVXB 2XXUA 1RYOA 3ILTB 4R75A 3MZBA 4UACA 4ISUA 2IA4A 5AA3A 4KQPA 1GTKA 3GBBA 3KBRA 1MY1A 2H4IA 2DVZA 4QSCA 4WEDA 5H8FA 1JQFA 4IGTA 1UTBB 4IY6A 2O7IA 1QUKA 3VV5A 3FIRA 3DELB 5AA4B 2DQVA 4X9TA 1A55A 3FJGA 3PV0E 2QMXA 5I57B 1BLFA 5H8QB 1NNTA 5J1DA 2IEEA 3KG2A 5EHSA 3DLNA 1H43A 3FJ7A 2ANJA 1MXUA 1NNKA 3OD7A 4C1TA 2ZYNA 5B7DA 3C36A 3TDJA 1MXVA 4HCYA 4ELRA 3LC8A 4G2ZA 3TCHA 1MQJA 3IOUA 4R2BA 3MBPA 4YAHX 3SKPA 4Z0IA 1UIVA 2ZNUA 3H6UA 3U92A 2DWHA 4OHNA 4DDDA 2B3BA 2XD2A 3I3VA 2D5WA 4E0WA 4EXLA 4ELPA 3LUYA 4R72A 2RCAA 1B1XA 2F8DA 3GBAA 5ICTA 3TAJA 3UIFA 4ZZEA 3SDFA 4BLAA 3O97A 1P1UA 4FECA 1QVSA 3PUZE 5JTYB 3S4UA 4IO5A 3MJNA 4YB5A 3FXRA 3SEXA 3TEPA 3PUWE 1NL5A 4R9FA 2Z23A 2LAOA 3PUXE 1O7TA 3VXBA 5FHMA 1US5A 3MUQA 1TXFA 1US4A 1IQ7A 4RK2A 1FQFA 5HM4B 3TCFA 1D3KA 3H6WA 3TTNA 1NNPA 4U4XA 2ESNA 2XXTA 4G4PA 3RPWA 1N3XA 3PPRA 4G68A 4YU0A 3S9EA 3WAFA 2DE3A 1MH4A 4R73A 3FV2A 3ECRA 2ONSA 2Y7PA 3OOAA 1IZ1A 4K3FA 1MY0A 3IK6B 4GOTA 5ISUA 1R1NA 1PC3A 3HV1A 3BKIB 2HZLA 3MC2A 1MQIA 3G3GA 5H8FB 3TUSA 4U21A 2B3FA 4NF5B 3V5AA 4QFPA 1LBBA 4NTLA 4GXSB 3UORA 2QL3A 5F1QA 2F6PA 3TKDA 3BBRA 2RC7A 2OLBA 3G7WA 3FASA 2UXAA 1DSNA 2ONRA 5KDTA 1MM6A 3PMXA 3RLFE 4MFIA 4XIGQ 5FHNA 3OO9A 2FA7A 4O3BA 2I4CA 5B70A 4WEPA 4PFYA 4R9GA 4AQ4A 3SEUA 3EHTA 4DZ1A 1NMUA 2B65A 3KSXA 4QFLA 3UA8A 4GWOA 1Z7NE 2ZNSA 1II5A 1PBPA 4G77A 4XKPA 1P1WA 4OMBA 2XX7A 3CRBA 1B3LA 2DVCA 4RA1A 1VE4A 2PX1A 4U2RA 4ZEIA 2FNCA 5I56A 1H3DA 2Y7WA 4AB6A 4LONB 4TOZA 2NVUB 1M5FA 4H5FA 1JVXA 4BDMA 3TTRA 4H5GA 2F5XA 4F3SA 3VVFA 2ZYMA 4U1ZA 3A3UA 4JSOA 4I9DA 2F7CA 1PB9A 3O9PA 1POTA 3TTKA 1WODA 1MQDA 4H8IA 4BDQA 1LFGA 2V84A 3QIMA 3EQ1A 3HO7A 4F1YA 4THIA 3ZKLA 1UTBA 1LFIA 2DWIA 1SDXA 3FUZA 2GH9A 4JWOA 4F2OA 2GRVA 1BP5A 3MP8A 3AXFA 5AA4A 1B2HA 4MH5A 2RF1A 4FAJA 5I57A 4N07A 3EHSA 4YMAA 5BUUA 1B3EA 3SETA 5CMBA 2ABHA 4JWXA 2R71A 5H8QA 1B7HA 2F35A 4XTCQ 4YB7A 3T9HB 1B1HA 5JEIA 1LLSA 3KGCA 4EDPA 3E3KA 4OYVA 2DWJA 3THIA 1JW1A 1QUJA 3CVGA 4BDNA 1A7LA 1FTKA 1B0LA 3K2DA 2XXQA 1VFDA 3QUJA 2VD3A 3JYRA 2DE2A 2O51A 3ONMA 2QMWA 4FEDA 2Z8EA 1LAHE 3KJ7A 2E0SA 3C9HA 4FORA 1Q35A 4R6KA 5CMMA 3BFTA 3LBSA 4JWYA 1SW2A 1XT8A 4XKNA 5CRYA 1FQDA 4OENA 2AIXA 1M5BA 2OZZA 4O3CA 1ANFA 3WAEA 3UN6A 1JW5A 2NWJA 3SEYA 3C4MA 3B6TA 3PPPA 4G8NA 5KDTB 1AH5A 1LCFA 4RJZA 4KYSA 3I6VA 3OO8A 1QUIA 1I6BA 1NKXA 1B0HA 3N5LA 2REGA 2M8CA 1A54A 1QKBA 3LSXA 4ECFA 5JTYA 5FTHA 3KEIA 3VVEA 2ALUA 1P1QA 3CFXA 4IB2A 2A5TA 3OXNA 4BDRA 3VVDA 4YKPA 4L17A 4DIGA 4F3BA 3HHFA 1B40A 4C0RA 3E13X 2I6EA 4PP0A 4M4GA 1LAGE 4PE5B 1D9VA 3IOWA 3FJMA 1Y20A 1PBQA 3ILUB 4U4SA 4FEBA 2O69A 4GIZA 4LUBA 2ZYKA 2XX9A 4RK9A 1DPPA 1HSLA 1NNFA 3JZJA 4NWCA 4JDFA 4LATA 1B5JA 5AA2A 4IO7A 2OBGA 3VFJA 4OQOA 4GXAA 1FQBA 4KI0E 1ELJA 3SERA 4NF5A 3CI8A 3TFLA 1QULA 2BJJX 3KOSA 4F22A 2H9BA 1SBPA 4H8JA 2X7QA 2HCAA 3RTFB 1ZIUA 3KN8A 3U94A 1YPNA 4PFTA 1PDAA 3M3FA 3ZS6A 3TZAA 4N6PA 4POWA 3S2VA 2VHAA 3IO4A 2Q89A 4NF6A 2P2AA 1PB8A 2REJA 5DTBA 4OFJA 4TLMB 4ND9A 1A40A 3CFLA 3TTMA 2Q9TA 2YJPA 3MZ9A 2ZYOA 4OXVA 1Y1ZA 4UA8A 5ITOA 3OENA 1URDA 2NUVA 2CZLA 1VR5A 3G3HA 5L8DA 3K6UA 2OWSA 3O29A 1FQAA 3K6VA 3HN0A 4H65A 1QJMA 1KWHA 1B5IA 1TWYA 2GHBA 4QRZA 2V93A 4DXUA 3M3LA 5F7VA 1TFDA 1UTHA 3MWBA 4ZECA 3PUYE 1B3FA 3SEVA 1MDP1 1R6ZA 4H6DA 3S9MC 2CMOA 1P1OA 2THIA 5A5XB 1GR2A 2UVIA 5I59B 4QSEA 3FGSA 4JXIA 1R9QA 3A3CA 2QS1A 2E1SA 1B5HA 3KJTA 1L5TA 4JB7A 5FHOA 2Q8JA 4OERA 4KYEA 3OELA 3CG3A 3P7IA 1N84A 2G29A 1LGBC 1MDQA 2Z8DA 2QJEA 2RCBA 4KYDA 4G68C 4U1OA 2Q2AA 2DWAA 2A5TB 4GVOA 1URSA 1LSTA 4NF8B 4EF2A 2GFEA 4IO4A 3TQLA 4DCYA 2F78A 2Y84A 2H5YA 1MQHA 3C35A 4R74A 3KFMA 2UYEA 3U93A 4YMBA 5DYHA 3CG1A 3RUMA 1ZLQA 3LSWA 3HHGA 1MQGA 4DXCA 1EU8A 1OLAA 5ITPA 1M5CA 1OMPA 4KFQA 4MF3A 4TLLB 4U22A 3IJOB 1MXXA 2DS9A 2Q88A 4F1UA 2F34A 1F9BA 5DVJA 5I58B 3PD8A 2Y7KA 1IXCA 4FE8A 5AA2B 1OVTA 3G3FA 3CIJA 1B05A 3C33A 3R26A 4IGRA 1N0TA 3OSRA 1OQHA 4KR5A 3IR1A 2I58A 1B6HA 4I62A 2YPNA 1ZTYA 3EPEA 1AOVA 1EZOA 2P0SA 2QPQA 2V3UA 3MP6A 3TCGA 3PPOA 4NF6B 4LQ5A 3IB1A 4KCCA 1FTJA 3IB2A 2ZXTA 4RPNA 3H6TA 5CM6A 3RNNA 1BKAA 2V25A 4BDOA 3KSJA 1Y3NA 2I48A 4QFOA 5I2KB 3O28A 1SQYA 4LZ5A 4M1VA 1DMBA 4EQ7A 3VLVA 3OO7A 4ELQA 3EN3A 2XD3A 1UTHB 4GL0A 2UVHA 4R6YA 4LVQA 3MPKA 1BTJA 5DVIA 5KCJA 5ICQA 4NF4A 3RT8A 3RQTA 3FXQA 3QYTA 1T0KA 1B32A 4ZEFA 4FJPA 4XXUA 2F7AA 3VDFA 4RNSA 3TODA 4O3AA 1P1NA 3MVZA 4ZZAA 1IXHA 1A99A 3SESA 4DLDA 4P0IA 4QHQA 1IUDA 4NWDA 3K4UA 4POXA 3SEWA 1MXZA 1J1NA 5I84A 2F6GA 3EHUA 2O6AA 1SI1A 3S9NC 1UIUA 4GFRA 3OMBA 4DCXA 1XC1A 3FATA 3U1OA 4ZEBA 5CC2A 2RC8A 5DEXA 3V8XB 3Q29A 1LCTA 4OWDA 3KN3A 5ELVA 1B46A 1ZBMA 3USDA 3KZGA 1XVYA 4EQ9A 1B4HA 3PPQA 3MAMA 1I69A 1DTZA 2WKYA 1BIYA 2F7BA 4MBPA 3UK4A 3B7DA 3Q25A 1USYH 4OTEA 3D4GA
chains in the Genus database with same CATH superfamily
1B3GA 1NV4A 3Q27A 4LQ2A 1MPBA 1FBEA 3A09A 3OO6A 2Z22A 1JETA 3T9XB 1LAFE 1SW5A 4MLVA 5H8HA 2HAUA 4OVPA 1NUWA 1FTLA 4O7IA 4N8YA 3O6GA 1TFAA 1VSOA 4DXBA 4HE1A 4FATA 3QAXA 3K1NA 4GX6A 3ODBA 4ONYA 3KOTA 4Z7EA 2FIEA 1B52A 2HXRA 4QF9A 5A5XA 1GVCA 2G93A 5I59A 3MVWA 1O64A 2Q2CA 4XKRA 2XXYA 1FW0A 1FPFA 3GLBA 3T0JA 4PBQA 2VPNA 1FPKA 2W7YA 4GLIA 1OLCA 3N6TA 1H44A 1YCJA 3Q26A 1LB9A 2VGQA 4GL8A 3VXCA 3N94A 1B3HA 4ZDMA 3MW0A 1FBFA 2GQ1A 1YZ0A 3FVKA 3H6VA 1CNQA 1INPA 3PMWA 4NF8A 2QS2A 2F97A 3E9XA 1FPBA 4Q30B 3PPNA 3G3JA 1EZPA 1MY4A 1S9TA 1SW4A 3H03A 1D4NA 2PT1A 5EQAA 2XX8A 1N7WA 3VE1B 2I3VA 4MNPA 3HPIA 1HSEA 5IM2A 4MEVA 3IX1A 5EYHA 4OVJA 4I8CA 3MPLA 3MP1A 2V3QA 1FCKA 4O94A 3K0VA 5KCJB 4NF4B 3CR9A 4ESXA 5I58A 5AA2D 1FTOA 2ZZVA 4JBZA 3N6UA 2XXVA 4EF1A 2ZMBA 2ONKE 2PFYA 5HBCA 4PGPA 1JVYA 1MPDA 2XXPA 3TELA 3K00A 2PBWA 3T93B 2AL5A 1MY3A 3FZVA 4YB6A 1MS7A 4Q8RA 1PB7A 3OEKA 1YAEA 3MSTA 2Q74A 2D3IA 4LZ7A 3HSTA 1NUXA 4G8MA 3QK6A 4HW8A 1LBYA 1MM7A 5L9OA 1YTVA 4GWYA 4HS7A 2AL4A 3TPAA 1MXYA 4KD5A 4OVTA 1AL3A 2OCUA 3L6HA 2XHDA 1USYE 4OANA 3RY3A 5DEXB 1O63A 3C31A 2I49A 1NV7A 5L9SA 1B4ZA 3B50A 1DBZA 3FD3A 2HZKA 5CI5A 2UYFA 1PEBA 3PU5A 5CBSA 3FVGA 3EF7A 4NEDA 1JEVA 2PVUA 4GBWA 1LBWA 3IOVA 1B9JA 4XKQA 4P11A 5IKBA 3W9VA 3K01A 2MKZA 3N26A 5I2KA 1DPEA 3ZSFA 4NMYA 3T9UA 2AYSA 4WXJA 2V3TA 5AE4A 1IIWA 5ET8A 1NUZA 2ZNTA 2RC9A 1LBZA 2XXKA 1EZ9A 4F3PA 4OZ9A 4I1DA 1FJ9A 3W9WA 1JNFA 3IO6A 5H8HB 5H8NA 3MZ1A 1NUYA 3BFUA 1S50A 3IORA 2FYIA 3K02A 3MVYA 1XVXA 1K9ZA 2CEYA 2RKMA 4H67A 4OEVA 1KZ8A 1POY1 3DP6A 3U72A 3GZGA 2GHAA 4MCOA 4ZEDA 2ZZWA 1Y1MA 2UVJA 3CSBA 4ZE9A 1H45A 4YKIA 5DVFA 1RYXA 1AMFA 3D4CA 3C34A 2P1SA 3T96B 5EYFA 1Y3PA 4NE4A 4O8MA 4P9KA 4IO6A 1WVJA 1FBDA 3F11A 2X26A 2HQ0A 2WYPA 3SZPA 3PD9A 1Y3QA 2NXOA 2PMSA 4OA4A 1I6QA 1XS5A 2PYYA 2BJIA 4XFEA 4PAFA 2HFBA 4PFWA 2DYXA 4RYAA 3JV9A 2F36A 3I5OA 5H8SA 2X7PA 4PDDA 3E4RA 5T3JA 3T66A 1UQWA 3VLWA 1A8FA 4YKKA 4YKJA 4ESWA 4IR8A 2KLFA 2XWVA 2P3NA 1ZKBA 1CE2A 3LSLA 5M2VA 4WKMA 3V83A 3FV1A 4C1UA 1FTAA 1A8EA 1LB8A 1FQCA 1FBHA 2I0BA 2XXXA 1EH3A 3TTLA 1IXGA 1H76A 1N04A 1FQEA 2HEUA 3KC0A 1LFHA 2QS3A 5FTIA 3IB0A 3H4ZA 1NI9A 3S9LC 4OFLA 2O68A 4F2QA 2VD2A 4P0GA 3C32A 5CMCA 3B6WA 4EUOA 4MLQA 4X1BA 4OVRA 3KC1A 2Y5KA 1SI0A 2I4BA 3ZKKA 4OETA 3V89B 1M5DA 3U8QA 5TPAA 4PCDA 4G8HA 3L6GA 2DE4A 3FXUA 2Q8MA 1IEJA 4H1XA 5I5PA 4OFOA 1RKMA 1LAXA 3D1RA 2CZIA 1LBCA 5I2NA 3K6WA 5TP9A 1FPDA 1XI6A 3GYYA 4H0WA 3BIGA 1SW1A 2VT5A 4F39A 3K1MA 4PETA 2H25A 4PFUA 2R6GE 1DCUA 3GXAA 4KPTA 3O66A 1GGGA 3MQ9A 4OEUA 4R6HA 4F1VA 2PT2A 4X1DA 5BWJA 3M3KA 2QS4A 1OVBA 2Y7RA 4RY1A 4GQOA 1VFEA 1MG1A 4GD5A 4MMPA 4JVCA 3TMGA 1XOCA 5CBRA 3PMVA 4MAGA 4X48A 5KZTA 2XXWA 1SD3A 4EXKA 1SYHA 1MRPA 2DP8A 2QSXA 4F18A 3LR1A 5H8NB 2HXWA 2JJKA 3OEMA 5LOMA 1P99A 4LP2B 4R2FA 2DXYA 3RT6B 2KR0A 1MXWA 2NOOA 4N6KA 1RDXA 4KCDA 3UGWA 4HE2A 4QFKA 5ET5A 2DXRA 3O2AA 1FPJA 2OK2A 5AA1A 2DSFA 1Y9UA 4LA9A 4U23A 2O1LA 1GV8A 2OJTA 1IITA 1ZJLA 3CSGA 5TU0A 1IXIA 1FTMA 1OIBA 3G3IA 4ZS9A 1CB6A 4N13A 4JSDA 3QUFA 4DE8A 2O84X 2XXRA 3PGFA 1NH8A 1Y4TA 1N76A 2H99A 3VLUA 5CMKA 3RN8A 2VP1A 4ZE8A 1TT1A 3ISPA 3LSFB 1Q1KA 3KN7A 1XHYA 3IAZA 5IAIA 2XXIA 1LEVA 3A29A 2I3WA 1AIVA 3PUVE 4FBPA 1ZMGA 4E0XA 1D9QA 1QGXA 3O6IA 4IY5A 5L9MA 1Z7ME 2QRYA 2Y7IA 4LZ8A 1B51A 3DM0A 1NFTA 1MY2A 2I0CA 1QW0A 3G3KA 4IO3A 4IO2A 4HCWA 2H98A 4G68B 3O6HA 3W15C 3M8UA 4ZEKA 2HAVA 2D21A 1B58A 4ELOA 1S7YA 2UVGA 1ZU0A 2R8TA 1B7UA 3MVXA 3TQWA 1N3WA 5HPQA 4AB5A 3FVNA 4KHZE 3T9VA 1WDNA 5TPAB 3K6XA 4UABA 2ZZXA 3IOTA 3UP9A 2A5SA 4YICA 3IL1B 2DOJA 1JW4A 3E79A 4F19A 4HTGA 1QKAA 4Q5TA 1B7ZA 3QSLA 3T22A 5LDZA 3RGYA 5I2NB 3OSQA 5TP9B 1HSJA 4OVQA 3R7XA 4GRKA 3CFZA 1NH7A 1N7XA 2O1MA 3DP4A 2P3VA 3FVOA 4RXLA 3K1PA 3QXMA 2YLNA 4F31B 3H3GA 1MH3A 2R9JA 3B6QA 3RTWB 4EQBA 5K2XA 2WEFA 4TQUQ 3IJXB 3HCQA 4F29A 3H06B 4YZZA 2O7UA 4OESA 1D9YA 4Q0CA 1MPCA 1DK4A 4GF8A 1M5EA 1R9LA 1OQGA 2XXHA 1I6AA 3U65A 1DTGA 1ATGA 4I3YA 5DT6A 4QSDA 1SYIA 4GWSA 3R6UA 3TYHA 1JEUA 1URGA 3Q28A 1Y4CA 2QVUA 4F3GA 4I3EA 4FIMA 2OWTA 3DP8A 5I56B 3H7MA 5EHMA 1DOTA 5K2YA 4RPOA 1FJ6A 5IZ3B 4PQJA 2Z8FA 2RINA 4PAIA 2VOZA 4BDLA 4QFNA 5JK4A 1SVXB 4GWXA 2XXUA 2CEXA 1RYOA 3ILTB 4R75A 3MZBA 4UACA 4ISUA 2IA4A 5AA3A 4KQPA 1GTKA 3GBBA 3KBRA 1MY1A 3T1BA 1K9YA 2H4IA 2DVZA 2KQZA 4QSCA 4WEDA 5H8FA 4NGUA 1JQFA 4G61A 4IGTA 1UTBB 4IY6A 2O7IA 1QUKA 3VV5A 3FIRA 3DELB 5AA4B 2DQVA 4X9TA 1A55A 1G0HA 3KBZA 3FJGA 3PV0E 2QMXA 5I57B 1BLFA 4LN5A 5H8QB 1NV0A 4GWUA 1NNTA 5J1DA 1IMFA 2IEEA 3KG2A 5EHSA 3DLNA 1H43A 3FJ7A 5ET7A 2ANJA 1MXUA 1NV5A 1NNKA 3OD7A 4C1TA 5EQ9A 2ZYNA 5B7DA 3C36A 4N91A 3TDJA 1MXVA 4HCYA 4G2ZA 3LC8A 3TCHA 4ELRA 1MQJA 3IOUA 4R2BA 3MBPA 3ROJA 4YAHX 3SKPA 4H45A 4Z0IA 2WBDA 3BIHA 1UIVA 2ZNUA 3H6UA 3U92A 2DWHA 4MIJA 4OHNA 4DDDA 2B3BA 2XD2A 5EQ8A 1IMDA 3I3VA 1VDWA 2D5WA 4E0WA 4EXLA 4ELPA 1KA1A 3LUYA 3PTYA 4R72A 4P8BA 2RCAA 1B1XA 2F8DA 3GBAA 5ICTA 3TAJA 3UIFA 4NG7A 4ZZEA 3SDFA 4BLAA 3O97A 1P1UA 4NAPA 4FECA 1QVSA 3PUZE 5JTYB 4QXDA 3S4UA 4OVSA 4IO5A 3MJNA 4YB5A 3FXRA 3SEXA 3TEPA 3PUWE 1NL5A 1FRPA 4PF8A 4R9FA 2Z23A 3RYDA 2LAOA 3PUXE 1O7TA 3VXBA 5FHMA 1US5A 2B4LA 3MUQA 2Y5LA 1TXFA 1US4A 1IQ7A 4RK2A 1FQFA 5HM4B 3TCFA 1D3KA 2XWIA 3H6WA 2CZKA 3TTNA 1NNPA 4U4XA 2ESNA 2XXTA 4G4PA 3RPWA 1N3XA 3PPRA 4G68A 4YU0A 3S9EA 3WAFA 2DE3A 1MH4A 4R73A 3FV2A 3ECRA 2DDKA 2ONSA 2Y7PA 4PF6A 2PCRA 1Q9DA 3OOAA 1IZ1A 4K3FA 1MY0A 3IK6B 4GOTA 5ISUA 4PTKA 1R1NA 4H46A 2HHMA 1PC3A 3HV1A 3BKIB 2HZLA 3MC2A 1MQIA 3G3GA 5H8FB 3TUSA 4U21A 2B3FA 4NF5B 3V5AA 4QFPA 1LBBA 4NTLA 4GXSB 3UORA 2QL3A 4PFIA 5F1QA 2F6PA 3TKDA 3BBRA 2RC7A 4DI3D 2OLBA 3G7WA 3FASA 2UXAA 1DSNA 2ONRA 3QMFA 5ET6A 1KA0A 5KDTA 1MM6A 1SPIA 3PMXA 3RLFE 4MFIA 4XIGQ 5FHNA 3OO9A 2FA7A 4O3BA 2I4CA 5B70A 1BK4A 4WEPA 4PFYA 4R9GA 4AQ4A 3SEUA 4PDHA 3EHTA 4DZ1A 1NMUA 2B65A 3KSXA 4QFLA 3UA8A 4GWOA 1Z7NE 4PAKA 2ZNSA 1II5A 4X04A 1JP4A 4GBVA 1PBPA 4G77A 4XKPA 1EYIA 1P1WA 4OMBA 2XX7A 3CRBA 1B3LA 2DVCA 4RA1A 1VE4A 2L5VA 2PX1A 3FXBA 4U2RA 4ZEIA 2FNCA 5I56A 1H3DA 4X8RA 2Y7WA 1EYKA 4AB6A 4LONB 4TOZA 2NVUB 1M5FA 4H5FA 5IZ3A 1JVXA 4BDMA 3TTRA 4H5GA 2F5XA 4F3SA 2QFLA 3VVFA 2ZYMA 4U1ZA 3A3UA 4JSOA 4I9DA 2F7CA 3FBPA 1PB9A 3O9PA 1POTA 3TTKA 2FIXA 1WODA 1MQDA 4H8IA 4MNCA 4BDQA 3MYUA 1LFGA 2V84A 3QIMA 1FPIA 3EQ1A 3HO7A 4F1YA 4THIA 3ZKLA 1NV3A 1UTBA 1LFIA 2DWIA 1SDXA 3FUZA 2GH9A 4JWOA 4F2OA 4P47A 2GRVA 1BP5A 3MP8A 3AXFA 2XWOA 5AA4A 3CHGA 1B2HA 4MH5A 4P1EA 2RF1A 4FAJA 5I57A 4N07A 3EHSA 4YMAA 5BUUA 3E78A 1B3EA 3SETA 1FBPA 5CMBA 2ABHA 4JWXA 2R71A 5H8QA 1B7HA 4MJOA 2F35A 4XTCQ 4YB7A 3T9HB 1B1HA 5JEIA 1LLSA 3KGCA 4EDPA 3E3KA 4OYVA 2DWJA 3THIA 1JW1A 1QUJA 3CVGA 4BDNA 4P3LA 1A7LA 3K2DA 1FTKA 1B0LA 1FBCA 2XXQA 1VFDA 3QUJA 2VD3A 3JYRA 2DE2A 2O51A 3ONMA 5IZZA 2QMWA 4FEDA 2Z8EA 1LAHE 3KJ7A 4QBAA 2E0SA 2WYKA 3C9HA 4FORA 1Q35A 4R6KA 5CMMA 3BFTA 3LBSA 4JWYA 1SW2A 1XT8A 4XKNA 5CRYA 1G0IA 1FQDA 4OENA 2AIXA 1M5BA 1FBGA 2OZZA 4O3CA 1ANFA 4KXPA 3WAEA 3UN6A 4PFBA 1JW5A 2NWJA 3SEYA 3C4MA 3B6TA 3PPPA 4G8NA 5KDTB 1RDYA 1AH5A 1LCFA 4RJZA 4KYSA 3I6VA 3OO8A 1QUIA 1I6BA 1NKXA 1B0HA 3N5LA 2REGA 2M8CA 1A54A 3IFCA 1QKBA 3LSXA 4ECFA 5JTYA 5FTHA 3KEIA 5EYGA 3VVEA 2ALUA 1P1QA 3CFXA 4IB2A 2A5TA 3OXNA 4BDRA 3VVDA 4YKPA 4L17A 4DIGA 4F3BA 1FPLA 5DW8A 3HHFA 1B40A 4C0RA 3E13X 2OX3A 2I6EA 4PP0A 4M4GA 1LAGE 4PE5B 1D9VA 4XF5A 3IOWA 3FJMA 1FSAA 1Y20A 1PBQA 3ILUB 4U4SA 4FEBA 2O69A 4GIZA 4LUBA 2ZYKA 2XX9A 4RK9A 1DPPA 1HSLA 1NNFA 3JZJA 4NWCA 4MX6A 4JDFA 4LATA 1IMBA 1B5JA 5AA2A 4IO7A 5F24A 2OBGA 2FHYA 3VFJA 4OQOA 4HE0A 4GXAA 1FQBA 1RDZA 4XEQA 4KI0E 1ELJA 3LV0A 3SERA 5A5LA 4NF5A 3CI8A 3TFLA 2B4MA 1QULA 2BJJX 3RPLB 3KOSA 4F22A 2H9BA 4NX1A 1SBPA 4H8JA 1IMAA 2X7QA 2HCAA 3RTFB 1ZIUA 3KN8A 3U94A 1YPNA 4PFTA 1PDAA 1NV2A 3M3FA 3ZS6A 3TZAA 4N6PA 4POWA 3S2VA 4O7MA 1NV1A 2VHAA 4JVIA 3IO4A 2Q89A 1LBXA 4NF6A 4DI4B 2P2AA 1PB8A 2REJA 5DTBA 1AWBA 4OFJA 4TLMB 4ND9A 1A40A 3CFLA 1YYZA 3TTMA 2Q9TA 2YJPA 3MZ9A 2ZYOA 4OXVA 1Y1ZA 4UA8A 5ITOA 3OENA 1URDA 2NUVA 2CZLA 1VR5A 3G3HA 5L8DA 4N8GA 3LUZA 2FVZA 3K6UA 2OWSA 3O29A 1FQAA 1FPGA 3K6VA 3HN0A 4H65A 1YXIA 1QJMA 1KWHA 1B5IA 1TWYA 2GHBA 4QRZA 2V93A 2HPGA 4DXUA 3M3LA 5F7VA 1TFDA 1UTHA 3MWBA 5I3SA 4ZECA 3PUYE 1B3FA 3SEVA 1MDP1 1R6ZA 4H6DA 3S9MC 2CMOA 1P1OA 2THIA 5A5XB 1GR2A 2UVIA 5I59B 4QSEA 3FGSA 4JXIA 4AS4A 1R9QA 3A3CA 2QS1A 2E1SA 1B5HA 3KJTA 2FBPA 1L5TA 4MHFA 4JB7A 5FHOA 2XWKA 2Q8JA 4OERA 4KYEA 2VPOA 3OELA 3CG3A 3P7IA 1N84A 2G29A 1LGBC 1MDQA 2Z8DA 2QJEA 2RCBA 4KYDA 4G68C 4U1OA 2Q2AA 2DWAA 2A5TB 4GVOA 1URSA 2F3DA 1LSTA 1NV6A 4NF8B 4EF2A 2GFEA 4IO4A 5I7IA 3TQLA 4GX3A 4DCYA 4PBHA 2F78A 4NN3A 2Y84A 2H5YA 1MQHA 3C35A 4R74A 3KFMA 2UYEA 3U93A 4YMBA 5DYHA 3CG1A 3RUMA 5ESYA 1ZLQA 3LSWA 3HHGA 1MQGA 4DXCA 1EU8A 1OLAA 5ITPA 1M5CA 3IFAA 1OMPA 4KFQA 4PC9A 4MF3A 4TLLB 4U22A 3IJOB 1MXXA 2DS9A 2Q88A 4F1UA 2F34A 1F9BA 5IZ1A 5DVJA 5I58B 3PD8A 2Y7KA 1IXCA 4FE8A 5AA2B 1OVTA 4P1LA 3G3FA 3NOHA 3CIJA 1B05A 3C33A 4GX4A 3R26A 4PGNA 4IGRA 5LTCA 4NHBA 1N0TA 3OSRA 1OQHA 4GWWA 4N6DA 4KR5A 3IR1A 2I58A 1B6HA 4I62A 2YPNA 2QVRA 4PFRA 1ZTYA 3EPEA 2WBBA 1AOVA 1EZOA 2P0SA 2QPQA 1EYJA 2V3UA 3MP6A 3TCGA 3PPOA 4NF6B 2V4CA 4LQ5A 3IB1A 5FBPA 1IMEA 4KCCA 1FTJA 3IB2A 2ZXTA 4RPNA 4P56A 3H6TA 5CM6A 3RNNA 1BKAA 4I40A 2CZHA 2V25A 4BDOA 3KSJA 1Y3NA 2I48A 3B8BA 4QFOA 5I2KB 3O28A 1SQYA 4NQ8A 2PFZA 4LZ5A 4M1VA 1DMBA 4EQ7A 3VLVA 3OO7A 4ELQA 3EN3A 2XD3A 1UTHB 3EKIA 4GL0A 2UVHA 1LBVA 4R6YA 4LVQA 3MPKA 4JVDA 1BTJA 5DVIA 2XA5A 5KCJA 5ICQA 4NF0A 4NF4A 4MNIA 2QVVA 4AS5A 3RT8A 3RQTA 3FXQA 3QYTA 1T0KA 1B32A 4ZEFA 4FJPA 1FPEA 4XXUA 2WX9A 2F7AA 3VDFA 4RNSA 3TODA 2F3BA 4O3AA 1P1NA 3MVZA 4ZZAA 1IXHA 4HXVA 3RPLA 1A99A 3SESA 4DLDA 4P0IA 4QHQA 1IUDA 4NWDA 3K4UA 4POXA 3SEWA 1MXZA 1J1NA 5I84A 2F6GA 3EHUA 2O6AA 1SI1A 3S9NC 1IMCA 1UIUA 4GFRA 3OMBA 4DCXA 1XC1A 3FATA 2OWZA 3U1OA 5IGAA 4PE3A 4ZEBA 5CC2A 5J16A 4N15A 2RC8A 5DEXA 3V8XB 3Q29A 1LCTA 4OWDA 3KN3A 5ELVA 1B46A 4N17A 1ZBMA 3USDA 3KZGA 1XVYA 4EQ9A 1B4HA 5EQ7A 3PPQA 3MAMA 1I69A 1DTZA 2WKYA 4N81A 1BIYA 2F7BA 3HFUA 4MBPA 3UK4A 3B7DA 3Q25A 4GWZA 4N4UA 1USYH 4OTEA 3D4GA
chains in the Genus database with same CATH topology
1B3GA 3Q27A 4LQ2A 1MPBA 3A09A 3OO6A 2Z22A 1JETA 3T9XB 1LAFE 1SW5A 4MLVA 5H8HA 2HAUA 1FTLA 3O6GA 1TFAA 1VSOA 4DXBA 4FATA 3QAXA 3K1NA 3ODBA 4ONYA 3KOTA 4Z7EA 1B52A 4QF9A 5A5XA 1GVCA 2G93A 5I59A 3MVWA 1O64A 2Q2CA 4XKRA 2XXYA 1FW0A 3GLBA 2W7YA 4GLIA 1OLCA 3N6TA 1H44A 1YCJA 3Q26A 1LB9A 2VGQA 4GL8A 3VXCA 3N94A 1B3HA 4ZDMA 3MW0A 3FVKA 3H6VA 3PMWA 4NF8A 2QS2A 2F97A 3E9XA 4Q30B 3PPNA 3G3JA 1EZPA 1MY4A 1S9TA 1SW4A 3H03A 1D4NA 2PT1A 2XX8A 1N7WA 3VE1B 2I3VA 3HPIA 1HSEA 3IX1A 4OVJA 4I8CA 3MPLA 3MP1A 2V3QA 1FCKA 3K0VA 5KCJB 4NF4B 3CR9A 4ESXA 5I58A 5AA2D 1FTOA 4JBZA 3N6UA 2XXVA 4EF1A 2ZMBA 2ONKE 5HBCA 1JVYA 1MPDA 2XXPA 3TELA 3K00A 3T93B 2PBWA 2AL5A 1MY3A 3FZVA 4YB6A 1MS7A 4Q8RA 1PB7A 3OEKA 1YAEA 2D3IA 4LZ7A 3HSTA 4G8MA 3QK6A 4HW8A 1MM7A 5L9OA 1YTVA 4HS7A 2AL4A 3TPAA 1MXYA 4KD5A 1AL3A 2OCUA 3L6HA 2XHDA 1USYE 3RY3A 5DEXB 1O63A 3C31A 2I49A 5L9SA 1B4ZA 5CI5A 3FD3A 2HZKA 2UYFA 1PEBA 3PU5A 5CBSA 3FVGA 3EF7A 4NEDA 1JEVA 2PVUA 3IOVA 1B9JA 4XKQA 4P11A 5IKBA 3W9VA 3K01A 3N26A 5I2KA 1DPEA 3ZSFA 4NMYA 3T9UA 2AYSA 4WXJA 2V3TA 5AE4A 1IIWA 2ZNTA 2RC9A 1EZ9A 4F3PA 4OZ9A 4I1DA 3W9WA 1JNFA 3IO6A 5H8HB 5H8NA 3MZ1A 3BFUA 1S50A 3IORA 2FYIA 3K02A 3MVYA 1XVXA 2RKMA 4H67A 4OEVA 1POY1 3DP6A 3U72A 3GZGA 2GHAA 4ZEDA 1Y1MA 2UVJA 3CSBA 4ZE9A 1H45A 4YKIA 5DVFA 1RYXA 1AMFA 3D4CA 3C34A 2P1SA 3T96B 5EYFA 1Y3PA 4NE4A 4IO6A 1WVJA 3F11A 2X26A 2HQ0A 3PD9A 1Y3QA 2NXOA 2PMSA 1I6QA 1XS5A 2PYYA 2HFBA 4PFWA 2DYXA 4RYAA 3JV9A 2F36A 3I5OA 5H8SA 2X7PA 3E4RA 3T66A 1UQWA 3VLWA 1A8FA 4YKKA 4YKJA 4ESWA 2KLFA 1ZKBA 1CE2A 3LSLA 5M2VA 4WKMA 3V83A 3FV1A 4C1UA 1A8EA 1LB8A 1FQCA 2I0BA 2XXXA 1EH3A 3TTLA 1IXGA 1H76A 1N04A 1FQEA 2HEUA 1LFHA 2QS3A 5FTIA 3IB0A 3H4ZA 3S9LC 4OFLA 2O68A 4F2QA 2VD2A 4P0GA 3C32A 5CMCA 3B6WA 4EUOA 4MLQA 4X1BA 1SI0A 2I4BA 3ZKKA 4OETA 3V89B 1M5DA 3U8QA 5TPAA 4G8HA 3L6GA 2DE4A 3FXUA 1IEJA 4H1XA 4OFOA 1RKMA 1LAXA 1LBCA 5I2NA 3K6WA 5TP9A 4H0WA 1SW1A 4F39A 3K1MA 4PETA 2H25A 4PFUA 2R6GE 3GXAA 4KPTA 3O66A 1GGGA 3MQ9A 4OEUA 4R6HA 4F1VA 2PT2A 4X1DA 5BWJA 3M3KA 2QS4A 1OVBA 2Y7RA 4RY1A 4GQOA 1VFEA 1MG1A 4GD5A 3TMGA 1XOCA 5CBRA 3PMVA 4X48A 5KZTA 2XXWA 1SD3A 4EXKA 1SYHA 1MRPA 2DP8A 2QSXA 4F18A 3LR1A 5H8NB 2HXWA 3OEMA 5LOMA 1P99A 4LP2B 4R2FA 2DXYA 3RT6B 1MXWA 2NOOA 4KCDA 3UGWA 4QFKA 2DXRA 3O2AA 2OK2A 5AA1A 2DSFA 1Y9UA 4LA9A 4U23A 2O1LA 1GV8A 2OJTA 1IITA 1ZJLA 3CSGA 5TU0A 1IXIA 1FTMA 1OIBA 3G3IA 4ZS9A 1CB6A 4N13A 4JSDA 3QUFA 4DE8A 2O84X 2XXRA 3PGFA 1NH8A 1Y4TA 1N76A 2H99A 3VLUA 5CMKA 3RN8A 2VP1A 4ZE8A 1TT1A 3LSFB 1Q1KA 3KN7A 1XHYA 3IAZA 5IAIA 2XXIA 2I3WA 1AIVA 3PUVE 4E0XA 1ZMGA 3O6IA 4IY5A 5L9MA 1Z7ME 2QRYA 2Y7IA 4LZ8A 1B51A 3DM0A 1NFTA 1MY2A 2I0CA 1QW0A 3G3KA 4IO3A 4IO2A 4HCWA 2H98A 4G68B 3O6HA 3W15C 3M8UA 4ZEKA 2HAVA 2D21A 1B58A 4ELOA 1S7YA 2UVGA 1ZU0A 1B7UA 3MVXA 3TQWA 1N3WA 5HPQA 4AB5A 3FVNA 4KHZE 3T9VA 1WDNA 5TPAB 3K6XA 3IOTA 3UP9A 2A5SA 4YICA 3IL1B 2DOJA 1JW4A 4F19A 4HTGA 1QKAA 4Q5TA 1B7ZA 3QSLA 3T22A 3RGYA 5I2NB 3OSQA 5TP9B 1HSJA 3R7XA 4GRKA 3CFZA 1NH7A 1N7XA 2O1MA 3DP4A 3FVOA 4RXLA 3K1PA 3QXMA 2YLNA 4F31B 3H3GA 1MH3A 2R9JA 3B6QA 3RTWB 4EQBA 5K2XA 4TQUQ 3IJXB 3HCQA 4F29A 3H06B 4YZZA 2O7UA 4OESA 1D9YA 4Q0CA 1MPCA 4GF8A 1M5EA 1R9LA 1OQGA 2XXHA 1I6AA 1DTGA 1ATGA 5DT6A 4QSDA 1SYIA 3R6UA 3TYHA 1JEUA 1URGA 3Q28A 1Y4CA 4F3GA 4FIMA 2OWTA 3DP8A 5I56B 3H7MA 5EHMA 1DOTA 5K2YA 4RPOA 4PQJA 2Z8FA 2RINA 2VOZA 4BDLA 4QFNA 5JK4A 1SVXB 2XXUA 1RYOA 3ILTB 4R75A 3MZBA 4UACA 4ISUA 2IA4A 5AA3A 4KQPA 1GTKA 3GBBA 3KBRA 1MY1A 2H4IA 2DVZA 4QSCA 4WEDA 5H8FA 1JQFA 4IGTA 1UTBB 4IY6A 2O7IA 1QUKA 3VV5A 3FIRA 3DELB 5AA4B 2DQVA 4X9TA 1A55A 3FJGA 3PV0E 2QMXA 5I57B 1BLFA 5H8QB 1NNTA 5J1DA 2IEEA 3KG2A 5EHSA 3DLNA 1H43A 3FJ7A 2ANJA 1MXUA 1NNKA 3OD7A 4C1TA 2ZYNA 5B7DA 3C36A 3TDJA 1MXVA 4HCYA 4ELRA 3LC8A 4G2ZA 3TCHA 1MQJA 3IOUA 4R2BA 3MBPA 4YAHX 3SKPA 4Z0IA 1UIVA 2ZNUA 3H6UA 3U92A 2DWHA 4OHNA 4DDDA 2B3BA 2XD2A 3I3VA 2D5WA 4E0WA 4EXLA 4ELPA 3LUYA 4R72A 2RCAA 1B1XA 2F8DA 3GBAA 5ICTA 3TAJA 3UIFA 4ZZEA 3SDFA 4BLAA 3O97A 1P1UA 4FECA 1QVSA 3PUZE 5JTYB 3S4UA 4IO5A 3MJNA 4YB5A 3FXRA 3SEXA 3TEPA 3PUWE 1NL5A 4R9FA 2Z23A 2LAOA 3PUXE 1O7TA 3VXBA 5FHMA 1US5A 3MUQA 1TXFA 1US4A 1IQ7A 4RK2A 1FQFA 5HM4B 3TCFA 1D3KA 3H6WA 3TTNA 1NNPA 4U4XA 2ESNA 2XXTA 4G4PA 3RPWA 1N3XA 3PPRA 4G68A 4YU0A 3S9EA 3WAFA 2DE3A 1MH4A 4R73A 3FV2A 3ECRA 2ONSA 2Y7PA 3OOAA 1IZ1A 4K3FA 1MY0A 3IK6B 4GOTA 5ISUA 1R1NA 1PC3A 3HV1A 3BKIB 2HZLA 3MC2A 1MQIA 3G3GA 5H8FB 3TUSA 4U21A 2B3FA 4NF5B 3V5AA 4QFPA 1LBBA 4NTLA 4GXSB 3UORA 2QL3A 5F1QA 2F6PA 3TKDA 3BBRA 2RC7A 2OLBA 3G7WA 3FASA 2UXAA 1DSNA 2ONRA 5KDTA 1MM6A 3PMXA 3RLFE 4MFIA 4XIGQ 5FHNA 3OO9A 2FA7A 4O3BA 2I4CA 5B70A 4WEPA 4PFYA 4R9GA 4AQ4A 3SEUA 3EHTA 4DZ1A 1NMUA 2B65A 3KSXA 4QFLA 3UA8A 4GWOA 1Z7NE 2ZNSA 1II5A 1PBPA 4G77A 4XKPA 1P1WA 4OMBA 2XX7A 3CRBA 1B3LA 2DVCA 4RA1A 1VE4A 2PX1A 4U2RA 4ZEIA 2FNCA 5I56A 1H3DA 2Y7WA 4AB6A 4LONB 4TOZA 2NVUB 1M5FA 4H5FA 1JVXA 4BDMA 3TTRA 4H5GA 2F5XA 4F3SA 3VVFA 2ZYMA 4U1ZA 3A3UA 4JSOA 4I9DA 2F7CA 1PB9A 3O9PA 1POTA 3TTKA 1WODA 1MQDA 4H8IA 4BDQA 1LFGA 2V84A 3QIMA 3EQ1A 3HO7A 4F1YA 4THIA 3ZKLA 1UTBA 1LFIA 2DWIA 1SDXA 3FUZA 2GH9A 4JWOA 4F2OA 2GRVA 1BP5A 3MP8A 3AXFA 5AA4A 1B2HA 4MH5A 2RF1A 4FAJA 5I57A 4N07A 3EHSA 4YMAA 5BUUA 1B3EA 3SETA 5CMBA 2ABHA 4JWXA 2R71A 5H8QA 1B7HA 2F35A 4XTCQ 4YB7A 3T9HB 1B1HA 5JEIA 1LLSA 3KGCA 4EDPA 3E3KA 4OYVA 2DWJA 3THIA 1JW1A 1QUJA 3CVGA 4BDNA 1A7LA 1FTKA 1B0LA 3K2DA 2XXQA 1VFDA 3QUJA 2VD3A 3JYRA 2DE2A 2O51A 3ONMA 2QMWA 4FEDA 2Z8EA 1LAHE 3KJ7A 2E0SA 3C9HA 4FORA 1Q35A 4R6KA 5CMMA 3BFTA 3LBSA 4JWYA 1SW2A 1XT8A 4XKNA 5CRYA 1FQDA 4OENA 2AIXA 1M5BA 2OZZA 4O3CA 1ANFA 3WAEA 3UN6A 1JW5A 2NWJA 3SEYA 3C4MA 3B6TA 3PPPA 4G8NA 5KDTB 1AH5A 1LCFA 4RJZA 4KYSA 3I6VA 3OO8A 1QUIA 1I6BA 1NKXA 1B0HA 3N5LA 2REGA 2M8CA 1A54A 1QKBA 3LSXA 4ECFA 5JTYA 5FTHA 3KEIA 3VVEA 2ALUA 1P1QA 3CFXA 4IB2A 2A5TA 3OXNA 4BDRA 3VVDA 4YKPA 4L17A 4DIGA 4F3BA 3HHFA 1B40A 4C0RA 3E13X 2I6EA 4PP0A 4M4GA 1LAGE 4PE5B 1D9VA 3IOWA 3FJMA 1Y20A 1PBQA 3ILUB 4U4SA 4FEBA 2O69A 4GIZA 4LUBA 2ZYKA 2XX9A 4RK9A 1DPPA 1HSLA 1NNFA 3JZJA 4NWCA 4JDFA 4LATA 1B5JA 5AA2A 4IO7A 2OBGA 3VFJA 4OQOA 4GXAA 1FQBA 4KI0E 1ELJA 3SERA 4NF5A 3CI8A 3TFLA 1QULA 2BJJX 3KOSA 4F22A 2H9BA 1SBPA 4H8JA 2X7QA 2HCAA 3RTFB 1ZIUA 3KN8A 3U94A 1YPNA 4PFTA 1PDAA 3M3FA 3ZS6A 3TZAA 4N6PA 4POWA 3S2VA 2VHAA 3IO4A 2Q89A 4NF6A 2P2AA 1PB8A 2REJA 5DTBA 4OFJA 4TLMB 4ND9A 1A40A 3CFLA 3TTMA 2Q9TA 2YJPA 3MZ9A 2ZYOA 4OXVA 1Y1ZA 4UA8A 5ITOA 3OENA 1URDA 2NUVA 2CZLA 1VR5A 3G3HA 5L8DA 3K6UA 2OWSA 3O29A 1FQAA 3K6VA 3HN0A 4H65A 1QJMA 1KWHA 1B5IA 1TWYA 2GHBA 4QRZA 2V93A 4DXUA 3M3LA 5F7VA 1TFDA 1UTHA 3MWBA 4ZECA 3PUYE 1B3FA 3SEVA 1MDP1 1R6ZA 4H6DA 3S9MC 2CMOA 1P1OA 2THIA 5A5XB 1GR2A 2UVIA 5I59B 4QSEA 3FGSA 4JXIA 1R9QA 3A3CA 2QS1A 2E1SA 1B5HA 3KJTA 1L5TA 4JB7A 5FHOA 2Q8JA 4OERA 4KYEA 3OELA 3CG3A 3P7IA 1N84A 2G29A 1LGBC 1MDQA 2Z8DA 2QJEA 2RCBA 4KYDA 4G68C 4U1OA 2Q2AA 2DWAA 2A5TB 4GVOA 1URSA 1LSTA 4NF8B 4EF2A 2GFEA 4IO4A 3TQLA 4DCYA 2F78A 2Y84A 2H5YA 1MQHA 3C35A 4R74A 3KFMA 2UYEA 3U93A 4YMBA 5DYHA 3CG1A 3RUMA 1ZLQA 3LSWA 3HHGA 1MQGA 4DXCA 1EU8A 1OLAA 5ITPA 1M5CA 1OMPA 4KFQA 4MF3A 4TLLB 4U22A 3IJOB 1MXXA 2DS9A 2Q88A 4F1UA 2F34A 1F9BA 5DVJA 5I58B 3PD8A 2Y7KA 1IXCA 4FE8A 5AA2B 1OVTA 3G3FA 3CIJA 1B05A 3C33A 3R26A 4IGRA 1N0TA 3OSRA 1OQHA 4KR5A 3IR1A 2I58A 1B6HA 4I62A 2YPNA 1ZTYA 3EPEA 1AOVA 1EZOA 2P0SA 2QPQA 2V3UA 3MP6A 3TCGA 3PPOA 4NF6B 4LQ5A 3IB1A 4KCCA 1FTJA 3IB2A 2ZXTA 4RPNA 3H6TA 5CM6A 3RNNA 1BKAA 2V25A 4BDOA 3KSJA 1Y3NA 2I48A 4QFOA 5I2KB 3O28A 1SQYA 4LZ5A 4M1VA 1DMBA 4EQ7A 3VLVA 3OO7A 4ELQA 3EN3A 2XD3A 1UTHB 4GL0A 2UVHA 4R6YA 4LVQA 3MPKA 1BTJA 5DVIA 5KCJA 5ICQA 4NF4A 3RT8A 3RQTA 3FXQA 3QYTA 1T0KA 1B32A 4ZEFA 4FJPA 4XXUA 2F7AA 3VDFA 4RNSA 3TODA 4O3AA 1P1NA 3MVZA 4ZZAA 1IXHA 1A99A 3SESA 4DLDA 4P0IA 4QHQA 1IUDA 4NWDA 3K4UA 4POXA 3SEWA 1MXZA 1J1NA 5I84A 2F6GA 3EHUA 2O6AA 1SI1A 3S9NC 1UIUA 4GFRA 3OMBA 4DCXA 1XC1A 3FATA 3U1OA 4ZEBA 5CC2A 2RC8A 5DEXA 3V8XB 3Q29A 1LCTA 4OWDA 3KN3A 5ELVA 1B46A 1ZBMA 3USDA 3KZGA 1XVYA 4EQ9A 1B4HA 3PPQA 3MAMA 1I69A 1DTZA 2WKYA 1BIYA 2F7BA 4MBPA 3UK4A 3B7DA 3Q25A 1USYH 4OTEA 3D4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3G A;  3Q27 A;  4LQ2 A;  1MPB A;  3A09 A;  3OO6 A;  2Z22 A;  1JET A;  3T9X B;  1LAF E;  1SW5 A;  4MLV A;  5H8H A;  2HAU A;  1FTL A;  3O6G A;  1TFA A;  1VSO A;  4DXB A;  4FAT A;  3QAX A;  3K1N A;  3ODB A;  4ONY A;  3KOT A;  4Z7E A;  1B52 A;  4QF9 A;  5A5X A;  1GVC A;  2G93 A;  5I59 A;  3MVW A;  1O64 A;  2Q2C A;  4XKR A;  2XXY A;  1FW0 A;  3GLB A;  2W7Y A;  4GLI A;  1OLC A;  3N6T A;  1H44 A;  1YCJ A;  3Q26 A;  1LB9 A;  2VGQ A;  4GL8 A;  3VXC A;  3N94 A;  1B3H A;  4ZDM A;  3MW0 A;  3FVK A;  3H6V A;  3PMW A;  4NF8 A;  2QS2 A;  2F97 A;  3E9X A;  4Q30 B;  3PPN A;  3G3J A;  1EZP A;  1MY4 A;  1S9T A;  1SW4 A;  3H03 A;  1D4N A;  2PT1 A;  2XX8 A;  1N7W A;  3VE1 B;  2I3V A;  3HPI A;  1HSE A;  3IX1 A;  4OVJ A;  4I8C A;  3MPL A;  3MP1 A;  2V3Q A;  1FCK A;  3K0V A;  5KCJ B;  4NF4 B;  3CR9 A;  4ESX A;  5I58 A;  5AA2 D;  1FTO A;  4JBZ A;  3N6U A;  2XXV A;  4EF1 A;  2ZMB A;  2ONK E;  5HBC A;  1JVY A;  1MPD A;  2XXP A;  3TEL A;  3K00 A;  3T93 B;  2PBW A;  2AL5 A;  1MY3 A;  3FZV A;  4YB6 A;  1MS7 A;  4Q8R A;  1PB7 A;  3OEK A;  1YAE A;  2D3I A;  4LZ7 A;  3HST A;  4G8M A;  3QK6 A;  4HW8 A;  1MM7 A;  5L9O A;  1YTV A;  4HS7 A;  2AL4 A;  3TPA A;  1MXY A;  4KD5 A;  1AL3 A;  2OCU A;  3L6H A;  2XHD A;  1USY E;  3RY3 A;  5DEX B;  1O63 A;  3C31 A;  2I49 A;  5L9S A;  1B4Z A;  5CI5 A;  3FD3 A;  2HZK A;  2UYF A;  1PEB A;  3PU5 A;  5CBS A;  3FVG A;  3EF7 A;  4NED A;  1JEV A;  2PVU A;  3IOV A;  1B9J A;  4XKQ A;  4P11 A;  5IKB A;  3W9V A;  3K01 A;  3N26 A;  5I2K A;  1DPE A;  3ZSF A;  4NMY A;  3T9U A;  2AYS A;  4WXJ A;  2V3T A;  5AE4 A;  1IIW A;  2ZNT A;  2RC9 A;  1EZ9 A;  4F3P A;  4OZ9 A;  4I1D A;  3W9W A;  1JNF A;  3IO6 A;  5H8H B;  5H8N A;  3MZ1 A;  3BFU A;  1S50 A;  3IOR A;  2FYI A;  3K02 A;  3MVY A;  1XVX A;  2RKM A;  4H67 A;  4OEV A;  1POY 1;  3DP6 A;  3U72 A;  3GZG A;  2GHA A;  4ZED A;  1Y1M A;  2UVJ A;  3CSB A;  4ZE9 A;  1H45 A;  4YKI A;  5DVF A;  1RYX A;  1AMF A;  3D4C A;  3C34 A;  2P1S A;  3T96 B;  5EYF A;  1Y3P A;  4NE4 A;  4IO6 A;  1WVJ A;  3F11 A;  2X26 A;  2HQ0 A;  3PD9 A;  1Y3Q A;  2NXO A;  2PMS A;  1I6Q A;  1XS5 A;  2PYY A;  2HFB A;  4PFW A;  2DYX A;  4RYA A;  3JV9 A;  2F36 A;  3I5O A;  5H8S A;  2X7P A;  3E4R A;  3T66 A;  1UQW A;  3VLW A;  1A8F A;  4YKK A;  4YKJ A;  4ESW A;  2KLF A;  1ZKB A;  1CE2 A;  3LSL A;  5M2V A;  4WKM A;  3V83 A;  3FV1 A;  4C1U A;  1A8E A;  1LB8 A;  1FQC A;  2I0B A;  2XXX A;  1EH3 A;  3TTL A;  1IXG A;  1H76 A;  1N04 A;  1FQE A;  2HEU A;  1LFH A;  2QS3 A;  5FTI A;  3IB0 A;  3H4Z A;  3S9L C;  4OFL A;  2O68 A;  4F2Q A;  2VD2 A;  4P0G A;  3C32 A;  5CMC A;  3B6W A;  4EUO A;  4MLQ A;  4X1B A;  1SI0 A;  2I4B A;  3ZKK A;  4OET A;  3V89 B;  1M5D A;  3U8Q A;  5TPA A;  4G8H A;  3L6G A;  2DE4 A;  3FXU A;  1IEJ A;  4H1X A;  4OFO A;  1RKM A;  1LAX A;  1LBC A;  5I2N A;  3K6W A;  5TP9 A;  4H0W A;  1SW1 A;  4F39 A;  3K1M A;  4PET A;  2H25 A;  4PFU A;  2R6G E;  3GXA A;  4KPT A;  3O66 A;  1GGG A;  3MQ9 A;  4OEU A;  4R6H A;  4F1V A;  2PT2 A;  4X1D A;  5BWJ A;  3M3K A;  2QS4 A;  1OVB A;  2Y7R A;  4RY1 A;  4GQO A;  1VFE A;  1MG1 A;  4GD5 A;  3TMG A;  1XOC A;  5CBR A;  3PMV A;  4X48 A;  5KZT A;  2XXW A;  1SD3 A;  4EXK A;  1SYH A;  1MRP A;  2DP8 A;  2QSX A;  4F18 A;  3LR1 A;  5H8N B;  2HXW A;  3OEM A;  5LOM A;  1P99 A;  4LP2 B;  4R2F A;  2DXY A;  3RT6 B;  1MXW A;  2NOO A;  4KCD A;  3UGW A;  4QFK A;  2DXR A;  3O2A A;  2OK2 A;  5AA1 A;  2DSF A;  1Y9U A;  4LA9 A;  4U23 A;  2O1L A;  1GV8 A;  2OJT A;  1IIT A;  1ZJL A;  3CSG A;  5TU0 A;  1IXI A;  1FTM A;  1OIB A;  3G3I A;  4ZS9 A;  1CB6 A;  4N13 A;  4JSD A;  3QUF A;  4DE8 A;  2O84 X;  2XXR A;  3PGF A;  1NH8 A;  1Y4T A;  1N76 A;  2H99 A;  3VLU A;  5CMK A;  3RN8 A;  2VP1 A;  4ZE8 A;  1TT1 A;  3LSF B;  1Q1K A;  3KN7 A;  1XHY A;  3IAZ A;  5IAI A;  2XXI A;  2I3W A;  1AIV A;  3PUV E;  4E0X A;  1ZMG A;  3O6I A;  4IY5 A;  5L9M A;  1Z7M E;  2QRY A;  2Y7I A;  4LZ8 A;  1B51 A;  3DM0 A;  1NFT A;  1MY2 A;  2I0C A;  1QW0 A;  3G3K A;  4IO3 A;  4IO2 A;  4HCW A;  2H98 A;  4G68 B;  3O6H A;  3W15 C;  3M8U A;  4ZEK A;  2HAV A;  2D21 A;  1B58 A;  4ELO A;  1S7Y A;  2UVG A;  1ZU0 A;  1B7U A;  3MVX A;  3TQW A;  1N3W A;  5HPQ A;  4AB5 A;  3FVN A;  4KHZ E;  3T9V A;  1WDN A;  5TPA B;  3K6X A;  3IOT A;  3UP9 A;  2A5S A;  4YIC A;  3IL1 B;  2DOJ A;  1JW4 A;  4F19 A;  4HTG A;  1QKA A;  4Q5T A;  1B7Z A;  3QSL A;  3T22 A;  3RGY A;  5I2N B;  3OSQ A;  5TP9 B;  1HSJ A;  3R7X A;  4GRK A;  3CFZ A;  1NH7 A;  1N7X A;  2O1M A;  3DP4 A;  3FVO A;  4RXL A;  3K1P A;  3QXM A;  2YLN A;  4F31 B;  3H3G A;  1MH3 A;  2R9J A;  3B6Q A;  3RTW B;  4EQB A;  5K2X A;  4TQU Q;  3IJX B;  3HCQ A;  4F29 A;  3H06 B;  4YZZ A;  2O7U A;  4OES A;  1D9Y A;  4Q0C A;  1MPC A;  4GF8 A;  1M5E A;  1R9L A;  1OQG A;  2XXH A;  1I6A A;  1DTG A;  1ATG A;  5DT6 A;  4QSD A;  1SYI A;  3R6U A;  3TYH A;  1JEU A;  1URG A;  3Q28 A;  1Y4C A;  4F3G A;  4FIM A;  2OWT A;  3DP8 A;  5I56 B;  3H7M A;  5EHM A;  1DOT A;  5K2Y A;  4RPO A;  4PQJ A;  2Z8F A;  2RIN A;  2VOZ A;  4BDL A;  4QFN A;  5JK4 A;  1SVX B;  2XXU A;  1RYO A;  3ILT B;  4R75 A;  3MZB A;  4UAC A;  4ISU A;  2IA4 A;  5AA3 A;  4KQP A;  1GTK A;  3GBB A;  3KBR A;  1MY1 A;  2H4I A;  2DVZ A;  4QSC A;  4WED A;  5H8F A;  1JQF A;  4IGT A;  1UTB B;  4IY6 A;  2O7I A;  1QUK A;  3VV5 A;  3FIR A;  3DEL B;  5AA4 B;  2DQV A;  4X9T A;  1A55 A;  3FJG A;  3PV0 E;  2QMX A;  5I57 B;  1BLF A;  5H8Q B;  1NNT A;  5J1D A;  2IEE A;  3KG2 A;  5EHS A;  3DLN A;  1H43 A;  3FJ7 A;  2ANJ A;  1MXU A;  1NNK A;  3OD7 A;  4C1T A;  2ZYN A;  5B7D A;  3C36 A;  3TDJ A;  1MXV A;  4HCY A;  4ELR A;  3LC8 A;  4G2Z A;  3TCH A;  1MQJ A;  3IOU A;  4R2B A;  3MBP A;  4YAH X;  3SKP A;  4Z0I A;  1UIV A;  2ZNU A;  3H6U A;  3U92 A;  2DWH A;  4OHN A;  4DDD A;  2B3B A;  2XD2 A;  3I3V A;  2D5W A;  4E0W A;  4EXL A;  4ELP A;  3LUY A;  4R72 A;  2RCA A;  1B1X A;  2F8D A;  3GBA A;  5ICT A;  3TAJ A;  3UIF A;  4ZZE A;  3SDF A;  4BLA A;  3O97 A;  1P1U A;  4FEC A;  1QVS A;  3PUZ E;  5JTY B;  3S4U A;  4IO5 A;  3MJN A;  4YB5 A;  3FXR A;  3SEX A;  3TEP A;  3PUW E;  1NL5 A;  4R9F A;  2Z23 A;  2LAO A;  3PUX E;  1O7T A;  3VXB A;  5FHM A;  1US5 A;  3MUQ A;  1TXF A;  1US4 A;  1IQ7 A;  4RK2 A;  1FQF A;  5HM4 B;  3TCF A;  1D3K A;  3H6W A;  3TTN A;  1NNP A;  4U4X A;  2ESN A;  2XXT A;  4G4P A;  3RPW A;  1N3X A;  3PPR A;  4G68 A;  4YU0 A;  3S9E A;  3WAF A;  2DE3 A;  1MH4 A;  4R73 A;  3FV2 A;  3ECR A;  2ONS A;  2Y7P A;  3OOA A;  1IZ1 A;  4K3F A;  1MY0 A;  3IK6 B;  4GOT A;  5ISU A;  1R1N A;  1PC3 A;  3HV1 A;  3BKI B;  2HZL A;  3MC2 A;  1MQI A;  3G3G A;  5H8F B;  3TUS A;  4U21 A;  2B3F A;  4NF5 B;  3V5A A;  4QFP A;  1LBB A;  4NTL A;  4GXS B;  3UOR A;  2QL3 A;  5F1Q A;  2F6P A;  3TKD A;  3BBR A;  2RC7 A;  2OLB A;  3G7W A;  3FAS A;  2UXA A;  1DSN A;  2ONR A;  5KDT A;  1MM6 A;  3PMX A;  3RLF E;  4MFI A;  4XIG Q;  5FHN A;  3OO9 A;  2FA7 A;  4O3B A;  2I4C A;  5B70 A;  4WEP A;  4PFY A;  4R9G A;  4AQ4 A;  3SEU A;  3EHT A;  4DZ1 A;  1NMU A;  2B65 A;  3KSX A;  4QFL A;  3UA8 A;  4GWO A;  1Z7N E;  2ZNS A;  1II5 A;  1PBP A;  4G77 A;  4XKP A;  1P1W A;  4OMB A;  2XX7 A;  3CRB A;  1B3L A;  2DVC A;  4RA1 A;  1VE4 A;  2PX1 A;  4U2R A;  4ZEI A;  2FNC A;  5I56 A;  1H3D A;  2Y7W A;  4AB6 A;  4LON B;  4TOZ A;  2NVU B;  1M5F A;  4H5F A;  1JVX A;  4BDM A;  3TTR A;  4H5G A;  2F5X A;  4F3S A;  3VVF A;  2ZYM A;  4U1Z A;  3A3U A;  4JSO A;  4I9D A;  2F7C A;  1PB9 A;  3O9P A;  1POT A;  3TTK A;  1WOD A;  1MQD A;  4H8I A;  4BDQ A;  1LFG A;  2V84 A;  3QIM A;  3EQ1 A;  3HO7 A;  4F1Y A;  4THI A;  3ZKL A;  1UTB A;  1LFI A;  2DWI A;  1SDX A;  3FUZ A;  2GH9 A;  4JWO A;  4F2O A;  2GRV A;  1BP5 A;  3MP8 A;  3AXF A;  5AA4 A;  1B2H A;  4MH5 A;  2RF1 A;  4FAJ A;  5I57 A;  4N07 A;  3EHS A;  4YMA A;  5BUU A;  1B3E A;  3SET A;  5CMB A;  2ABH A;  4JWX A;  2R71 A;  5H8Q A;  1B7H A;  2F35 A;  4XTC Q;  4YB7 A;  3T9H B;  1B1H A;  5JEI A;  1LLS A;  3KGC A;  4EDP A;  3E3K A;  4OYV A;  2DWJ A;  3THI A;  1JW1 A;  1QUJ A;  3CVG A;  4BDN A;  1A7L A;  1FTK A;  1B0L A;  3K2D A;  2XXQ A;  1VFD A;  3QUJ A;  2VD3 A;  3JYR A;  2DE2 A;  2O51 A;  3ONM A;  2QMW A;  4FED A;  2Z8E A;  1LAH E;  3KJ7 A;  2E0S A;  3C9H A;  4FOR A;  1Q35 A;  4R6K A;  5CMM A;  3BFT A;  3LBS A;  4JWY A;  1SW2 A;  1XT8 A;  4XKN A;  5CRY A;  1FQD A;  4OEN A;  2AIX A;  1M5B A;  2OZZ A;  4O3C A;  1ANF A;  3WAE A;  3UN6 A;  1JW5 A;  2NWJ A;  3SEY A;  3C4M A;  3B6T A;  3PPP A;  4G8N A;  5KDT B;  1AH5 A;  1LCF A;  4RJZ A;  4KYS A;  3I6V A;  3OO8 A;  1QUI A;  1I6B A;  1NKX A;  1B0H A;  3N5L A;  2REG A;  2M8C A;  1A54 A;  1QKB A;  3LSX A;  4ECF A;  5JTY A;  5FTH A;  3KEI A;  3VVE A;  2ALU A;  1P1Q A;  3CFX A;  4IB2 A;  2A5T A;  3OXN A;  4BDR A;  3VVD A;  4YKP A;  4L17 A;  4DIG A;  4F3B A;  3HHF A;  1B40 A;  4C0R A;  3E13 X;  2I6E A;  4PP0 A;  4M4G A;  1LAG E;  4PE5 B;  1D9V A;  3IOW A;  3FJM A;  1Y20 A;  1PBQ A;  3ILU B;  4U4S A;  4FEB A;  2O69 A;  4GIZ A;  4LUB A;  2ZYK A;  2XX9 A;  4RK9 A;  1DPP A;  1HSL A;  1NNF A;  3JZJ A;  4NWC A;  4JDF A;  4LAT A;  1B5J A;  5AA2 A;  4IO7 A;  2OBG A;  3VFJ A;  4OQO A;  4GXA A;  1FQB A;  4KI0 E;  1ELJ A;  3SER A;  4NF5 A;  3CI8 A;  3TFL A;  1QUL A;  2BJJ X;  3KOS A;  4F22 A;  2H9B A;  1SBP A;  4H8J A;  2X7Q A;  2HCA A;  3RTF B;  1ZIU A;  3KN8 A;  3U94 A;  1YPN A;  4PFT A;  1PDA A;  3M3F A;  3ZS6 A;  3TZA A;  4N6P A;  4POW A;  3S2V A;  2VHA A;  3IO4 A;  2Q89 A;  4NF6 A;  2P2A A;  1PB8 A;  2REJ A;  5DTB A;  4OFJ A;  4TLM B;  4ND9 A;  1A40 A;  3CFL A;  3TTM A;  2Q9T A;  2YJP A;  3MZ9 A;  2ZYO A;  4OXV A;  1Y1Z A;  4UA8 A;  5ITO A;  3OEN A;  1URD A;  2NUV A;  2CZL A;  1VR5 A;  3G3H A;  5L8D A;  3K6U A;  2OWS A;  3O29 A;  1FQA A;  3K6V A;  3HN0 A;  4H65 A;  1QJM A;  1KWH A;  1B5I A;  1TWY A;  2GHB A;  4QRZ A;  2V93 A;  4DXU A;  3M3L A;  5F7V A;  1TFD A;  1UTH A;  3MWB A;  4ZEC A;  3PUY E;  1B3F A;  3SEV A;  1MDP 1;  1R6Z A;  4H6D A;  3S9M C;  2CMO A;  1P1O A;  2THI A;  5A5X B;  1GR2 A;  2UVI A;  5I59 B;  4QSE A;  3FGS A;  4JXI A;  1R9Q A;  3A3C A;  2QS1 A;  2E1S A;  1B5H A;  3KJT A;  1L5T A;  4JB7 A;  5FHO A;  2Q8J A;  4OER A;  4KYE A;  3OEL A;  3CG3 A;  3P7I A;  1N84 A;  2G29 A;  1LGB C;  1MDQ A;  2Z8D A;  2QJE A;  2RCB A;  4KYD A;  4G68 C;  4U1O A;  2Q2A A;  2DWA A;  2A5T B;  4GVO A;  1URS A;  1LST A;  4NF8 B;  4EF2 A;  2GFE A;  4IO4 A;  3TQL A;  4DCY A;  2F78 A;  2Y84 A;  2H5Y A;  1MQH A;  3C35 A;  4R74 A;  3KFM A;  2UYE A;  3U93 A;  4YMB A;  5DYH A;  3CG1 A;  3RUM A;  1ZLQ A;  3LSW A;  3HHG A;  1MQG A;  4DXC A;  1EU8 A;  1OLA A;  5ITP A;  1M5C A;  1OMP A;  4KFQ A;  4MF3 A;  4TLL B;  4U22 A;  3IJO B;  1MXX A;  2DS9 A;  2Q88 A;  4F1U A;  2F34 A;  1F9B A;  5DVJ A;  5I58 B;  3PD8 A;  2Y7K A;  1IXC A;  4FE8 A;  5AA2 B;  1OVT A;  3G3F A;  3CIJ A;  1B05 A;  3C33 A;  3R26 A;  4IGR A;  1N0T A;  3OSR A;  1OQH A;  4KR5 A;  3IR1 A;  2I58 A;  1B6H A;  4I62 A;  2YPN A;  1ZTY A;  3EPE A;  1AOV A;  1EZO A;  2P0S A;  2QPQ A;  2V3U A;  3MP6 A;  3TCG A;  3PPO A;  4NF6 B;  4LQ5 A;  3IB1 A;  4KCC A;  1FTJ A;  3IB2 A;  2ZXT A;  4RPN A;  3H6T A;  5CM6 A;  3RNN A;  1BKA A;  2V25 A;  4BDO A;  3KSJ A;  1Y3N A;  2I48 A;  4QFO A;  5I2K B;  3O28 A;  1SQY A;  4LZ5 A;  4M1V A;  1DMB A;  4EQ7 A;  3VLV A;  3OO7 A;  4ELQ A;  3EN3 A;  2XD3 A;  1UTH B;  4GL0 A;  2UVH A;  4R6Y A;  4LVQ A;  3MPK A;  1BTJ A;  5DVI A;  5KCJ A;  5ICQ A;  4NF4 A;  3RT8 A;  3RQT A;  3FXQ A;  3QYT A;  1T0K A;  1B32 A;  4ZEF A;  4FJP A;  4XXU A;  2F7A A;  3VDF A;  4RNS A;  3TOD A;  4O3A A;  1P1N A;  3MVZ A;  4ZZA A;  1IXH A;  1A99 A;  3SES A;  4DLD A;  4P0I A;  4QHQ A;  1IUD A;  4NWD A;  3K4U A;  4POX A;  3SEW A;  1MXZ A;  1J1N A;  5I84 A;  2F6G A;  3EHU A;  2O6A A;  1SI1 A;  3S9N C;  1UIU A;  4GFR A;  3OMB A;  4DCX A;  1XC1 A;  3FAT A;  3U1O A;  4ZEB A;  5CC2 A;  2RC8 A;  5DEX A;  3V8X B;  3Q29 A;  1LCT A;  4OWD A;  3KN3 A;  5ELV A;  1B46 A;  1ZBM A;  3USD A;  3KZG A;  1XVY A;  4EQ9 A;  1B4H A;  3PPQ A;  3MAM A;  1I69 A;  1DTZ A;  2WKY A;  1BIY A;  2F7B A;  4MBP A;  3UK4 A;  3B7D A;  3Q25 A;  1USY H;  4OTE A;  3D4G A; 
#chains in the Genus database with same CATH topology
 1B3G A;  1NV4 A;  3Q27 A;  4LQ2 A;  1MPB A;  1FBE A;  3A09 A;  3OO6 A;  2Z22 A;  1JET A;  3T9X B;  1LAF E;  1SW5 A;  4MLV A;  5H8H A;  2HAU A;  4OVP A;  1NUW A;  1FTL A;  4O7I A;  4N8Y A;  3O6G A;  1TFA A;  1VSO A;  4DXB A;  4HE1 A;  4FAT A;  3QAX A;  3K1N A;  4GX6 A;  3ODB A;  4ONY A;  3KOT A;  4Z7E A;  2FIE A;  1B52 A;  2HXR A;  4QF9 A;  5A5X A;  1GVC A;  2G93 A;  5I59 A;  3MVW A;  1O64 A;  2Q2C A;  4XKR A;  2XXY A;  1FW0 A;  1FPF A;  3GLB A;  3T0J A;  4PBQ A;  2VPN A;  1FPK A;  2W7Y A;  4GLI A;  1OLC A;  3N6T A;  1H44 A;  1YCJ A;  3Q26 A;  1LB9 A;  2VGQ A;  4GL8 A;  3VXC A;  3N94 A;  1B3H A;  4ZDM A;  3MW0 A;  1FBF A;  2GQ1 A;  1YZ0 A;  3FVK A;  3H6V A;  1CNQ A;  1INP A;  3PMW A;  4NF8 A;  2QS2 A;  2F97 A;  3E9X A;  1FPB A;  4Q30 B;  3PPN A;  3G3J A;  1EZP A;  1MY4 A;  1S9T A;  1SW4 A;  3H03 A;  1D4N A;  2PT1 A;  5EQA A;  2XX8 A;  1N7W A;  3VE1 B;  2I3V A;  4MNP A;  3HPI A;  1HSE A;  5IM2 A;  4MEV A;  3IX1 A;  5EYH A;  4OVJ A;  4I8C A;  3MPL A;  3MP1 A;  2V3Q A;  1FCK A;  4O94 A;  3K0V A;  5KCJ B;  4NF4 B;  3CR9 A;  4ESX A;  5I58 A;  5AA2 D;  1FTO A;  2ZZV A;  4JBZ A;  3N6U A;  2XXV A;  4EF1 A;  2ZMB A;  2ONK E;  2PFY A;  5HBC A;  4PGP A;  1JVY A;  1MPD A;  2XXP A;  3TEL A;  3K00 A;  2PBW A;  3T93 B;  2AL5 A;  1MY3 A;  3FZV A;  4YB6 A;  1MS7 A;  4Q8R A;  1PB7 A;  3OEK A;  1YAE A;  3MST A;  2Q74 A;  2D3I A;  4LZ7 A;  3HST A;  1NUX A;  4G8M A;  3QK6 A;  4HW8 A;  1LBY A;  1MM7 A;  5L9O A;  1YTV A;  4GWY A;  4HS7 A;  2AL4 A;  3TPA A;  1MXY A;  4KD5 A;  4OVT A;  1AL3 A;  2OCU A;  3L6H A;  2XHD A;  1USY E;  4OAN A;  3RY3 A;  5DEX B;  1O63 A;  3C31 A;  2I49 A;  1NV7 A;  5L9S A;  1B4Z A;  3B50 A;  1DBZ A;  3FD3 A;  2HZK A;  5CI5 A;  2UYF A;  1PEB A;  3PU5 A;  5CBS A;  3FVG A;  3EF7 A;  4NED A;  1JEV A;  2PVU A;  4GBW A;  1LBW A;  3IOV A;  1B9J A;  4XKQ A;  4P11 A;  5IKB A;  3W9V A;  3K01 A;  2MKZ A;  3N26 A;  5I2K A;  1DPE A;  3ZSF A;  4NMY A;  3T9U A;  2AYS A;  4WXJ A;  2V3T A;  5AE4 A;  1IIW A;  5ET8 A;  1NUZ A;  2ZNT A;  2RC9 A;  1LBZ A;  2XXK A;  1EZ9 A;  4F3P A;  4OZ9 A;  4I1D A;  1FJ9 A;  3W9W A;  1JNF A;  3IO6 A;  5H8H B;  5H8N A;  3MZ1 A;  1NUY A;  3BFU A;  1S50 A;  3IOR A;  2FYI A;  3K02 A;  3MVY A;  1XVX A;  1K9Z A;  2CEY A;  2RKM A;  4H67 A;  4OEV A;  1KZ8 A;  1POY 1;  3DP6 A;  3U72 A;  3GZG A;  2GHA A;  4MCO A;  4ZED A;  2ZZW A;  1Y1M A;  2UVJ A;  3CSB A;  4ZE9 A;  1H45 A;  4YKI A;  5DVF A;  1RYX A;  1AMF A;  3D4C A;  3C34 A;  2P1S A;  3T96 B;  5EYF A;  1Y3P A;  4NE4 A;  4O8M A;  4P9K A;  4IO6 A;  1WVJ A;  1FBD A;  3F11 A;  2X26 A;  2HQ0 A;  2WYP A;  3SZP A;  3PD9 A;  1Y3Q A;  2NXO A;  2PMS A;  4OA4 A;  1I6Q A;  1XS5 A;  2PYY A;  2BJI A;  4XFE A;  4PAF A;  2HFB A;  4PFW A;  2DYX A;  4RYA A;  3JV9 A;  2F36 A;  3I5O A;  5H8S A;  2X7P A;  4PDD A;  3E4R A;  5T3J A;  3T66 A;  1UQW A;  3VLW A;  1A8F A;  4YKK A;  4YKJ A;  4ESW A;  4IR8 A;  2KLF A;  2XWV A;  2P3N A;  1ZKB A;  1CE2 A;  3LSL A;  5M2V A;  4WKM A;  3V83 A;  3FV1 A;  4C1U A;  1FTA A;  1A8E A;  1LB8 A;  1FQC A;  1FBH A;  2I0B A;  2XXX A;  1EH3 A;  3TTL A;  1IXG A;  1H76 A;  1N04 A;  1FQE A;  2HEU A;  3KC0 A;  1LFH A;  2QS3 A;  5FTI A;  3IB0 A;  3H4Z A;  1NI9 A;  3S9L C;  4OFL A;  2O68 A;  4F2Q A;  2VD2 A;  4P0G A;  3C32 A;  5CMC A;  3B6W A;  4EUO A;  4MLQ A;  4X1B A;  4OVR A;  3KC1 A;  2Y5K A;  1SI0 A;  2I4B A;  3ZKK A;  4OET A;  3V89 B;  1M5D A;  3U8Q A;  5TPA A;  4PCD A;  4G8H A;  3L6G A;  2DE4 A;  3FXU A;  2Q8M A;  1IEJ A;  4H1X A;  5I5P A;  4OFO A;  1RKM A;  1LAX A;  3D1R A;  2CZI A;  1LBC A;  5I2N A;  3K6W A;  5TP9 A;  1FPD A;  1XI6 A;  3GYY A;  4H0W A;  3BIG A;  1SW1 A;  2VT5 A;  4F39 A;  3K1M A;  4PET A;  2H25 A;  4PFU A;  2R6G E;  1DCU A;  3GXA A;  4KPT A;  3O66 A;  1GGG A;  3MQ9 A;  4OEU A;  4R6H A;  4F1V A;  2PT2 A;  4X1D A;  5BWJ A;  3M3K A;  2QS4 A;  1OVB A;  2Y7R A;  4RY1 A;  4GQO A;  1VFE A;  1MG1 A;  4GD5 A;  4MMP A;  4JVC A;  3TMG A;  1XOC A;  5CBR A;  3PMV A;  4MAG A;  4X48 A;  5KZT A;  2XXW A;  1SD3 A;  4EXK A;  1SYH A;  1MRP A;  2DP8 A;  2QSX A;  4F18 A;  3LR1 A;  5H8N B;  2HXW A;  2JJK A;  3OEM A;  5LOM A;  1P99 A;  4LP2 B;  4R2F A;  2DXY A;  3RT6 B;  2KR0 A;  1MXW A;  2NOO A;  4N6K A;  1RDX A;  4KCD A;  3UGW A;  4HE2 A;  4QFK A;  5ET5 A;  2DXR A;  3O2A A;  1FPJ A;  2OK2 A;  5AA1 A;  2DSF A;  1Y9U A;  4LA9 A;  4U23 A;  2O1L A;  1GV8 A;  2OJT A;  1IIT A;  1ZJL A;  3CSG A;  5TU0 A;  1IXI A;  1FTM A;  1OIB A;  3G3I A;  4ZS9 A;  1CB6 A;  4N13 A;  4JSD A;  3QUF A;  4DE8 A;  2O84 X;  2XXR A;  3PGF A;  1NH8 A;  1Y4T A;  1N76 A;  2H99 A;  3VLU A;  5CMK A;  3RN8 A;  2VP1 A;  4ZE8 A;  1TT1 A;  3ISP A;  3LSF B;  1Q1K A;  3KN7 A;  1XHY A;  3IAZ A;  5IAI A;  2XXI A;  1LEV A;  3A29 A;  2I3W A;  1AIV A;  3PUV E;  4FBP A;  1ZMG A;  4E0X A;  1D9Q A;  1QGX A;  3O6I A;  4IY5 A;  5L9M A;  1Z7M E;  2QRY A;  2Y7I A;  4LZ8 A;  1B51 A;  3DM0 A;  1NFT A;  1MY2 A;  2I0C A;  1QW0 A;  3G3K A;  4IO3 A;  4IO2 A;  4HCW A;  2H98 A;  4G68 B;  3O6H A;  3W15 C;  3M8U A;  4ZEK A;  2HAV A;  2D21 A;  1B58 A;  4ELO A;  1S7Y A;  2UVG A;  1ZU0 A;  2R8T A;  1B7U A;  3MVX A;  3TQW A;  1N3W A;  5HPQ A;  4AB5 A;  3FVN A;  4KHZ E;  3T9V A;  1WDN A;  5TPA B;  3K6X A;  4UAB A;  2ZZX A;  3IOT A;  3UP9 A;  2A5S A;  4YIC A;  3IL1 B;  2DOJ A;  1JW4 A;  3E79 A;  4F19 A;  4HTG A;  1QKA A;  4Q5T A;  1B7Z A;  3QSL A;  3T22 A;  5LDZ A;  3RGY A;  5I2N B;  3OSQ A;  5TP9 B;  1HSJ A;  4OVQ A;  3R7X A;  4GRK A;  3CFZ A;  1NH7 A;  1N7X A;  2O1M A;  3DP4 A;  2P3V A;  3FVO A;  4RXL A;  3K1P A;  3QXM A;  2YLN A;  4F31 B;  3H3G A;  1MH3 A;  2R9J A;  3B6Q A;  3RTW B;  4EQB A;  5K2X A;  2WEF A;  4TQU Q;  3IJX B;  3HCQ A;  4F29 A;  3H06 B;  4YZZ A;  2O7U A;  4OES A;  1D9Y A;  4Q0C A;  1MPC A;  1DK4 A;  4GF8 A;  1M5E A;  1R9L A;  1OQG A;  2XXH A;  1I6A A;  3U65 A;  1DTG A;  1ATG A;  4I3Y A;  5DT6 A;  4QSD A;  1SYI A;  4GWS A;  3R6U A;  3TYH A;  1JEU A;  1URG A;  3Q28 A;  1Y4C A;  2QVU A;  4F3G A;  4I3E A;  4FIM A;  2OWT A;  3DP8 A;  5I56 B;  3H7M A;  5EHM A;  1DOT A;  5K2Y A;  4RPO A;  1FJ6 A;  5IZ3 B;  4PQJ A;  2Z8F A;  2RIN A;  4PAI A;  2VOZ A;  4BDL A;  4QFN A;  5JK4 A;  1SVX B;  4GWX A;  2XXU A;  2CEX A;  1RYO A;  3ILT B;  4R75 A;  3MZB A;  4UAC A;  4ISU A;  2IA4 A;  5AA3 A;  4KQP A;  1GTK A;  3GBB A;  3KBR A;  1MY1 A;  3T1B A;  1K9Y A;  2H4I A;  2DVZ A;  2KQZ A;  4QSC A;  4WED A;  5H8F A;  4NGU A;  1JQF A;  4G61 A;  4IGT A;  1UTB B;  4IY6 A;  2O7I A;  1QUK A;  3VV5 A;  3FIR A;  3DEL B;  5AA4 B;  2DQV A;  4X9T A;  1A55 A;  1G0H A;  3KBZ A;  3FJG A;  3PV0 E;  2QMX A;  5I57 B;  1BLF A;  4LN5 A;  5H8Q B;  1NV0 A;  4GWU A;  1NNT A;  5J1D A;  1IMF A;  2IEE A;  3KG2 A;  5EHS A;  3DLN A;  1H43 A;  3FJ7 A;  5ET7 A;  2ANJ A;  1MXU A;  1NV5 A;  1NNK A;  3OD7 A;  4C1T A;  5EQ9 A;  2ZYN A;  5B7D A;  3C36 A;  4N91 A;  3TDJ A;  1MXV A;  4HCY A;  4G2Z A;  3LC8 A;  3TCH A;  4ELR A;  1MQJ A;  3IOU A;  4R2B A;  3MBP A;  3ROJ A;  4YAH X;  3SKP A;  4H45 A;  4Z0I A;  2WBD A;  3BIH A;  1UIV A;  2ZNU A;  3H6U A;  3U92 A;  2DWH A;  4MIJ A;  4OHN A;  4DDD A;  2B3B A;  2XD2 A;  5EQ8 A;  1IMD A;  3I3V A;  1VDW A;  2D5W A;  4E0W A;  4EXL A;  4ELP A;  1KA1 A;  3LUY A;  3PTY A;  4R72 A;  4P8B A;  2RCA A;  1B1X A;  2F8D A;  3GBA A;  5ICT A;  3TAJ A;  3UIF A;  4NG7 A;  4ZZE A;  3SDF A;  4BLA A;  3O97 A;  1P1U A;  4NAP A;  4FEC A;  1QVS A;  3PUZ E;  5JTY B;  4QXD A;  3S4U A;  4OVS A;  4IO5 A;  3MJN A;  4YB5 A;  3FXR A;  3SEX A;  3TEP A;  3PUW E;  1NL5 A;  1FRP A;  4PF8 A;  4R9F A;  2Z23 A;  3RYD A;  2LAO A;  3PUX E;  1O7T A;  3VXB A;  5FHM A;  1US5 A;  2B4L A;  3MUQ A;  2Y5L A;  1TXF A;  1US4 A;  1IQ7 A;  4RK2 A;  1FQF A;  5HM4 B;  3TCF A;  1D3K A;  2XWI A;  3H6W A;  2CZK A;  3TTN A;  1NNP A;  4U4X A;  2ESN A;  2XXT A;  4G4P A;  3RPW A;  1N3X A;  3PPR A;  4G68 A;  4YU0 A;  3S9E A;  3WAF A;  2DE3 A;  1MH4 A;  4R73 A;  3FV2 A;  3ECR A;  2DDK A;  2ONS A;  2Y7P A;  4PF6 A;  2PCR A;  1Q9D A;  3OOA A;  1IZ1 A;  4K3F A;  1MY0 A;  3IK6 B;  4GOT A;  5ISU A;  4PTK A;  1R1N A;  4H46 A;  2HHM A;  1PC3 A;  3HV1 A;  3BKI B;  2HZL A;  3MC2 A;  1MQI A;  3G3G A;  5H8F B;  3TUS A;  4U21 A;  2B3F A;  4NF5 B;  3V5A A;  4QFP A;  1LBB A;  4NTL A;  4GXS B;  3UOR A;  2QL3 A;  4PFI A;  5F1Q A;  2F6P A;  3TKD A;  3BBR A;  2RC7 A;  4DI3 D;  2OLB A;  3G7W A;  3FAS A;  2UXA A;  1DSN A;  2ONR A;  3QMF A;  5ET6 A;  1KA0 A;  5KDT A;  1MM6 A;  1SPI A;  3PMX A;  3RLF E;  4MFI A;  4XIG Q;  5FHN A;  3OO9 A;  2FA7 A;  4O3B A;  2I4C A;  5B70 A;  1BK4 A;  4WEP A;  4PFY A;  4R9G A;  4AQ4 A;  3SEU A;  4PDH A;  3EHT A;  4DZ1 A;  1NMU A;  2B65 A;  3KSX A;  4QFL A;  3UA8 A;  4GWO A;  1Z7N E;  4PAK A;  2ZNS A;  1II5 A;  4X04 A;  1JP4 A;  4GBV A;  1PBP A;  4G77 A;  4XKP A;  1EYI A;  1P1W A;  4OMB A;  2XX7 A;  3CRB A;  1B3L A;  2DVC A;  4RA1 A;  1VE4 A;  2L5V A;  2PX1 A;  3FXB A;  4U2R A;  4ZEI A;  2FNC A;  5I56 A;  1H3D A;  4X8R A;  2Y7W A;  1EYK A;  4AB6 A;  4LON B;  4TOZ A;  2NVU B;  1M5F A;  4H5F A;  5IZ3 A;  1JVX A;  4BDM A;  3TTR A;  4H5G A;  2F5X A;  4F3S A;  2QFL A;  3VVF A;  2ZYM A;  4U1Z A;  3A3U A;  4JSO A;  4I9D A;  2F7C A;  3FBP A;  1PB9 A;  3O9P A;  1POT A;  3TTK A;  2FIX A;  1WOD A;  1MQD A;  4H8I A;  4MNC A;  4BDQ A;  3MYU A;  1LFG A;  2V84 A;  3QIM A;  1FPI A;  3EQ1 A;  3HO7 A;  4F1Y A;  4THI A;  3ZKL A;  1NV3 A;  1UTB A;  1LFI A;  2DWI A;  1SDX A;  3FUZ A;  2GH9 A;  4JWO A;  4F2O A;  4P47 A;  2GRV A;  1BP5 A;  3MP8 A;  3AXF A;  2XWO A;  5AA4 A;  3CHG A;  1B2H A;  4MH5 A;  4P1E A;  2RF1 A;  4FAJ A;  5I57 A;  4N07 A;  3EHS A;  4YMA A;  5BUU A;  3E78 A;  1B3E A;  3SET A;  1FBP A;  5CMB A;  2ABH A;  4JWX A;  2R71 A;  5H8Q A;  1B7H A;  4MJO A;  2F35 A;  4XTC Q;  4YB7 A;  3T9H B;  1B1H A;  5JEI A;  1LLS A;  3KGC A;  4EDP A;  3E3K A;  4OYV A;  2DWJ A;  3THI A;  1JW1 A;  1QUJ A;  3CVG A;  4BDN A;  4P3L A;  1A7L A;  3K2D A;  1FTK A;  1B0L A;  1FBC A;  2XXQ A;  1VFD A;  3QUJ A;  2VD3 A;  3JYR A;  2DE2 A;  2O51 A;  3ONM A;  5IZZ A;  2QMW A;  4FED A;  2Z8E A;  1LAH E;  3KJ7 A;  4QBA A;  2E0S A;  2WYK A;  3C9H A;  4FOR A;  1Q35 A;  4R6K A;  5CMM A;  3BFT A;  3LBS A;  4JWY A;  1SW2 A;  1XT8 A;  4XKN A;  5CRY A;  1G0I A;  1FQD A;  4OEN A;  2AIX A;  1M5B A;  1FBG A;  2OZZ A;  4O3C A;  1ANF A;  4KXP A;  3WAE A;  3UN6 A;  4PFB A;  1JW5 A;  2NWJ A;  3SEY A;  3C4M A;  3B6T A;  3PPP A;  4G8N A;  5KDT B;  1RDY A;  1AH5 A;  1LCF A;  4RJZ A;  4KYS A;  3I6V A;  3OO8 A;  1QUI A;  1I6B A;  1NKX A;  1B0H A;  3N5L A;  2REG A;  2M8C A;  1A54 A;  3IFC A;  1QKB A;  3LSX A;  4ECF A;  5JTY A;  5FTH A;  3KEI A;  5EYG A;  3VVE A;  2ALU A;  1P1Q A;  3CFX A;  4IB2 A;  2A5T A;  3OXN A;  4BDR A;  3VVD A;  4YKP A;  4L17 A;  4DIG A;  4F3B A;  1FPL A;  5DW8 A;  3HHF A;  1B40 A;  4C0R A;  3E13 X;  2OX3 A;  2I6E A;  4PP0 A;  4M4G A;  1LAG E;  4PE5 B;  1D9V A;  4XF5 A;  3IOW A;  3FJM A;  1FSA A;  1Y20 A;  1PBQ A;  3ILU B;  4U4S A;  4FEB A;  2O69 A;  4GIZ A;  4LUB A;  2ZYK A;  2XX9 A;  4RK9 A;  1DPP A;  1HSL A;  1NNF A;  3JZJ A;  4NWC A;  4MX6 A;  4JDF A;  4LAT A;  1IMB A;  1B5J A;  5AA2 A;  4IO7 A;  5F24 A;  2OBG A;  2FHY A;  3VFJ A;  4OQO A;  4HE0 A;  4GXA A;  1FQB A;  1RDZ A;  4XEQ A;  4KI0 E;  1ELJ A;  3LV0 A;  3SER A;  5A5L A;  4NF5 A;  3CI8 A;  3TFL A;  2B4M A;  1QUL A;  2BJJ X;  3RPL B;  3KOS A;  4F22 A;  2H9B A;  4NX1 A;  1SBP A;  4H8J A;  1IMA A;  2X7Q A;  2HCA A;  3RTF B;  1ZIU A;  3KN8 A;  3U94 A;  1YPN A;  4PFT A;  1PDA A;  1NV2 A;  3M3F A;  3ZS6 A;  3TZA A;  4N6P A;  4POW A;  3S2V A;  4O7M A;  1NV1 A;  2VHA A;  4JVI A;  3IO4 A;  2Q89 A;  1LBX A;  4NF6 A;  4DI4 B;  2P2A A;  1PB8 A;  2REJ A;  5DTB A;  1AWB A;  4OFJ A;  4TLM B;  4ND9 A;  1A40 A;  3CFL A;  1YYZ A;  3TTM A;  2Q9T A;  2YJP A;  3MZ9 A;  2ZYO A;  4OXV A;  1Y1Z A;  4UA8 A;  5ITO A;  3OEN A;  1URD A;  2NUV A;  2CZL A;  1VR5 A;  3G3H A;  5L8D A;  4N8G A;  3LUZ A;  2FVZ A;  3K6U A;  2OWS A;  3O29 A;  1FQA A;  1FPG A;  3K6V A;  3HN0 A;  4H65 A;  1YXI A;  1QJM A;  1KWH A;  1B5I A;  1TWY A;  2GHB A;  4QRZ A;  2V93 A;  2HPG A;  4DXU A;  3M3L A;  5F7V A;  1TFD A;  1UTH A;  3MWB A;  5I3S A;  4ZEC A;  3PUY E;  1B3F A;  3SEV A;  1MDP 1;  1R6Z A;  4H6D A;  3S9M C;  2CMO A;  1P1O A;  2THI A;  5A5X B;  1GR2 A;  2UVI A;  5I59 B;  4QSE A;  3FGS A;  4JXI A;  4AS4 A;  1R9Q A;  3A3C A;  2QS1 A;  2E1S A;  1B5H A;  3KJT A;  2FBP A;  1L5T A;  4MHF A;  4JB7 A;  5FHO A;  2XWK A;  2Q8J A;  4OER A;  4KYE A;  2VPO A;  3OEL A;  3CG3 A;  3P7I A;  1N84 A;  2G29 A;  1LGB C;  1MDQ A;  2Z8D A;  2QJE A;  2RCB A;  4KYD A;  4G68 C;  4U1O A;  2Q2A A;  2DWA A;  2A5T B;  4GVO A;  1URS A;  2F3D A;  1LST A;  1NV6 A;  4NF8 B;  4EF2 A;  2GFE A;  4IO4 A;  5I7I A;  3TQL A;  4GX3 A;  4DCY A;  4PBH A;  2F78 A;  4NN3 A;  2Y84 A;  2H5Y A;  1MQH A;  3C35 A;  4R74 A;  3KFM A;  2UYE A;  3U93 A;  4YMB A;  5DYH A;  3CG1 A;  3RUM A;  5ESY A;  1ZLQ A;  3LSW A;  3HHG A;  1MQG A;  4DXC A;  1EU8 A;  1OLA A;  5ITP A;  1M5C A;  3IFA A;  1OMP A;  4KFQ A;  4PC9 A;  4MF3 A;  4TLL B;  4U22 A;  3IJO B;  1MXX A;  2DS9 A;  2Q88 A;  4F1U A;  2F34 A;  1F9B A;  5IZ1 A;  5DVJ A;  5I58 B;  3PD8 A;  2Y7K A;  1IXC A;  4FE8 A;  5AA2 B;  1OVT A;  4P1L A;  3G3F A;  3NOH A;  3CIJ A;  1B05 A;  3C33 A;  4GX4 A;  3R26 A;  4PGN A;  4IGR A;  5LTC A;  4NHB A;  1N0T A;  3OSR A;  1OQH A;  4GWW A;  4N6D A;  4KR5 A;  3IR1 A;  2I58 A;  1B6H A;  4I62 A;  2YPN A;  2QVR A;  4PFR A;  1ZTY A;  3EPE A;  2WBB A;  1AOV A;  1EZO A;  2P0S A;  2QPQ A;  1EYJ A;  2V3U A;  3MP6 A;  3TCG A;  3PPO A;  4NF6 B;  2V4C A;  4LQ5 A;  3IB1 A;  5FBP A;  1IME A;  4KCC A;  1FTJ A;  3IB2 A;  2ZXT A;  4RPN A;  4P56 A;  3H6T A;  5CM6 A;  3RNN A;  1BKA A;  4I40 A;  2CZH A;  2V25 A;  4BDO A;  3KSJ A;  1Y3N A;  2I48 A;  3B8B A;  4QFO A;  5I2K B;  3O28 A;  1SQY A;  4NQ8 A;  2PFZ A;  4LZ5 A;  4M1V A;  1DMB A;  4EQ7 A;  3VLV A;  3OO7 A;  4ELQ A;  3EN3 A;  2XD3 A;  1UTH B;  3EKI A;  4GL0 A;  2UVH A;  1LBV A;  4R6Y A;  4LVQ A;  3MPK A;  4JVD A;  1BTJ A;  5DVI A;  2XA5 A;  5KCJ A;  5ICQ A;  4NF0 A;  4NF4 A;  4MNI A;  2QVV A;  4AS5 A;  3RT8 A;  3RQT A;  3FXQ A;  3QYT A;  1T0K A;  1B32 A;  4ZEF A;  4FJP A;  1FPE A;  4XXU A;  2WX9 A;  2F7A A;  3VDF A;  4RNS A;  3TOD A;  2F3B A;  4O3A A;  1P1N A;  3MVZ A;  4ZZA A;  1IXH A;  4HXV A;  3RPL A;  1A99 A;  3SES A;  4DLD A;  4P0I A;  4QHQ A;  1IUD A;  4NWD A;  3K4U A;  4POX A;  3SEW A;  1MXZ A;  1J1N A;  5I84 A;  2F6G A;  3EHU A;  2O6A A;  1SI1 A;  3S9N C;  1IMC A;  1UIU A;  4GFR A;  3OMB A;  4DCX A;  1XC1 A;  3FAT A;  2OWZ A;  3U1O A;  5IGA A;  4PE3 A;  4ZEB A;  5CC2 A;  5J16 A;  4N15 A;  2RC8 A;  5DEX A;  3V8X B;  3Q29 A;  1LCT A;  4OWD A;  3KN3 A;  5ELV A;  1B46 A;  4N17 A;  1ZBM A;  3USD A;  3KZG A;  1XVY A;  4EQ9 A;  1B4H A;  5EQ7 A;  3PPQ A;  3MAM A;  1I69 A;  1DTZ A;  2WKY A;  4N81 A;  1BIY A;  2F7B A;  3HFU A;  4MBP A;  3UK4 A;  3B7D A;  3Q25 A;  4GWZ A;  4N4U A;  1USY H;  4OTE A;  3D4G A; 
#chains in the Genus database with same CATH homology
 1B3G A;  3Q27 A;  4LQ2 A;  1MPB A;  3A09 A;  3OO6 A;  2Z22 A;  1JET A;  3T9X B;  1LAF E;  1SW5 A;  4MLV A;  5H8H A;  2HAU A;  1FTL A;  3O6G A;  1TFA A;  1VSO A;  4DXB A;  4FAT A;  3QAX A;  3K1N A;  3ODB A;  4ONY A;  3KOT A;  4Z7E A;  1B52 A;  4QF9 A;  5A5X A;  1GVC A;  2G93 A;  5I59 A;  3MVW A;  1O64 A;  2Q2C A;  4XKR A;  2XXY A;  1FW0 A;  3GLB A;  2W7Y A;  4GLI A;  1OLC A;  3N6T A;  1H44 A;  1YCJ A;  3Q26 A;  1LB9 A;  2VGQ A;  4GL8 A;  3VXC A;  3N94 A;  1B3H A;  4ZDM A;  3MW0 A;  3FVK A;  3H6V A;  3PMW A;  4NF8 A;  2QS2 A;  2F97 A;  3E9X A;  4Q30 B;  3PPN A;  3G3J A;  1EZP A;  1MY4 A;  1S9T A;  1SW4 A;  3H03 A;  1D4N A;  2PT1 A;  2XX8 A;  1N7W A;  3VE1 B;  2I3V A;  3HPI A;  1HSE A;  3IX1 A;  4OVJ A;  4I8C A;  3MPL A;  3MP1 A;  2V3Q A;  1FCK A;  3K0V A;  5KCJ B;  4NF4 B;  3CR9 A;  4ESX A;  5I58 A;  5AA2 D;  1FTO A;  4JBZ A;  3N6U A;  2XXV A;  4EF1 A;  2ZMB A;  2ONK E;  5HBC A;  1JVY A;  1MPD A;  2XXP A;  3TEL A;  3K00 A;  3T93 B;  2PBW A;  2AL5 A;  1MY3 A;  3FZV A;  4YB6 A;  1MS7 A;  4Q8R A;  1PB7 A;  3OEK A;  1YAE A;  2D3I A;  4LZ7 A;  3HST A;  4G8M A;  3QK6 A;  4HW8 A;  1MM7 A;  5L9O A;  1YTV A;  4HS7 A;  2AL4 A;  3TPA A;  1MXY A;  4KD5 A;  1AL3 A;  2OCU A;  3L6H A;  2XHD A;  1USY E;  3RY3 A;  5DEX B;  1O63 A;  3C31 A;  2I49 A;  5L9S A;  1B4Z A;  5CI5 A;  3FD3 A;  2HZK A;  2UYF A;  1PEB A;  3PU5 A;  5CBS A;  3FVG A;  3EF7 A;  4NED A;  1JEV A;  2PVU A;  3IOV A;  1B9J A;  4XKQ A;  4P11 A;  5IKB A;  3W9V A;  3K01 A;  3N26 A;  5I2K A;  1DPE A;  3ZSF A;  4NMY A;  3T9U A;  2AYS A;  4WXJ A;  2V3T A;  5AE4 A;  1IIW A;  2ZNT A;  2RC9 A;  1EZ9 A;  4F3P A;  4OZ9 A;  4I1D A;  3W9W A;  1JNF A;  3IO6 A;  5H8H B;  5H8N A;  3MZ1 A;  3BFU A;  1S50 A;  3IOR A;  2FYI A;  3K02 A;  3MVY A;  1XVX A;  2RKM A;  4H67 A;  4OEV A;  1POY 1;  3DP6 A;  3U72 A;  3GZG A;  2GHA A;  4ZED A;  1Y1M A;  2UVJ A;  3CSB A;  4ZE9 A;  1H45 A;  4YKI A;  5DVF A;  1RYX A;  1AMF A;  3D4C A;  3C34 A;  2P1S A;  3T96 B;  5EYF A;  1Y3P A;  4NE4 A;  4IO6 A;  1WVJ A;  3F11 A;  2X26 A;  2HQ0 A;  3PD9 A;  1Y3Q A;  2NXO A;  2PMS A;  1I6Q A;  1XS5 A;  2PYY A;  2HFB A;  4PFW A;  2DYX A;  4RYA A;  3JV9 A;  2F36 A;  3I5O A;  5H8S A;  2X7P A;  3E4R A;  3T66 A;  1UQW A;  3VLW A;  1A8F A;  4YKK A;  4YKJ A;  4ESW A;  2KLF A;  1ZKB A;  1CE2 A;  3LSL A;  5M2V A;  4WKM A;  3V83 A;  3FV1 A;  4C1U A;  1A8E A;  1LB8 A;  1FQC A;  2I0B A;  2XXX A;  1EH3 A;  3TTL A;  1IXG A;  1H76 A;  1N04 A;  1FQE A;  2HEU A;  1LFH A;  2QS3 A;  5FTI A;  3IB0 A;  3H4Z A;  3S9L C;  4OFL A;  2O68 A;  4F2Q A;  2VD2 A;  4P0G A;  3C32 A;  5CMC A;  3B6W A;  4EUO A;  4MLQ A;  4X1B A;  1SI0 A;  2I4B A;  3ZKK A;  4OET A;  3V89 B;  1M5D A;  3U8Q A;  5TPA A;  4G8H A;  3L6G A;  2DE4 A;  3FXU A;  1IEJ A;  4H1X A;  4OFO A;  1RKM A;  1LAX A;  1LBC A;  5I2N A;  3K6W A;  5TP9 A;  4H0W A;  1SW1 A;  4F39 A;  3K1M A;  4PET A;  2H25 A;  4PFU A;  2R6G E;  3GXA A;  4KPT A;  3O66 A;  1GGG A;  3MQ9 A;  4OEU A;  4R6H A;  4F1V A;  2PT2 A;  4X1D A;  5BWJ A;  3M3K A;  2QS4 A;  1OVB A;  2Y7R A;  4RY1 A;  4GQO A;  1VFE A;  1MG1 A;  4GD5 A;  3TMG A;  1XOC A;  5CBR A;  3PMV A;  4X48 A;  5KZT A;  2XXW A;  1SD3 A;  4EXK A;  1SYH A;  1MRP A;  2DP8 A;  2QSX A;  4F18 A;  3LR1 A;  5H8N B;  2HXW A;  3OEM A;  5LOM A;  1P99 A;  4LP2 B;  4R2F A;  2DXY A;  3RT6 B;  1MXW A;  2NOO A;  4KCD A;  3UGW A;  4QFK A;  2DXR A;  3O2A A;  2OK2 A;  5AA1 A;  2DSF A;  1Y9U A;  4LA9 A;  4U23 A;  2O1L A;  1GV8 A;  2OJT A;  1IIT A;  1ZJL A;  3CSG A;  5TU0 A;  1IXI A;  1FTM A;  1OIB A;  3G3I A;  4ZS9 A;  1CB6 A;  4N13 A;  4JSD A;  3QUF A;  4DE8 A;  2O84 X;  2XXR A;  3PGF A;  1NH8 A;  1Y4T A;  1N76 A;  2H99 A;  3VLU A;  5CMK A;  3RN8 A;  2VP1 A;  4ZE8 A;  1TT1 A;  3LSF B;  1Q1K A;  3KN7 A;  1XHY A;  3IAZ A;  5IAI A;  2XXI A;  2I3W A;  1AIV A;  3PUV E;  4E0X A;  1ZMG A;  3O6I A;  4IY5 A;  5L9M A;  1Z7M E;  2QRY A;  2Y7I A;  4LZ8 A;  1B51 A;  3DM0 A;  1NFT A;  1MY2 A;  2I0C A;  1QW0 A;  3G3K A;  4IO3 A;  4IO2 A;  4HCW A;  2H98 A;  4G68 B;  3O6H A;  3W15 C;  3M8U A;  4ZEK A;  2HAV A;  2D21 A;  1B58 A;  4ELO A;  1S7Y A;  2UVG A;  1ZU0 A;  1B7U A;  3MVX A;  3TQW A;  1N3W A;  5HPQ A;  4AB5 A;  3FVN A;  4KHZ E;  3T9V A;  1WDN A;  5TPA B;  3K6X A;  3IOT A;  3UP9 A;  2A5S A;  4YIC A;  3IL1 B;  2DOJ A;  1JW4 A;  4F19 A;  4HTG A;  1QKA A;  4Q5T A;  1B7Z A;  3QSL A;  3T22 A;  3RGY A;  5I2N B;  3OSQ A;  5TP9 B;  1HSJ A;  3R7X A;  4GRK A;  3CFZ A;  1NH7 A;  1N7X A;  2O1M A;  3DP4 A;  3FVO A;  4RXL A;  3K1P A;  3QXM A;  2YLN A;  4F31 B;  3H3G A;  1MH3 A;  2R9J A;  3B6Q A;  3RTW B;  4EQB A;  5K2X A;  4TQU Q;  3IJX B;  3HCQ A;  4F29 A;  3H06 B;  4YZZ A;  2O7U A;  4OES A;  1D9Y A;  4Q0C A;  1MPC A;  4GF8 A;  1M5E A;  1R9L A;  1OQG A;  2XXH A;  1I6A A;  1DTG A;  1ATG A;  5DT6 A;  4QSD A;  1SYI A;  3R6U A;  3TYH A;  1JEU A;  1URG A;  3Q28 A;  1Y4C A;  4F3G A;  4FIM A;  2OWT A;  3DP8 A;  5I56 B;  3H7M A;  5EHM A;  1DOT A;  5K2Y A;  4RPO A;  4PQJ A;  2Z8F A;  2RIN A;  2VOZ A;  4BDL A;  4QFN A;  5JK4 A;  1SVX B;  2XXU A;  1RYO A;  3ILT B;  4R75 A;  3MZB A;  4UAC A;  4ISU A;  2IA4 A;  5AA3 A;  4KQP A;  1GTK A;  3GBB A;  3KBR A;  1MY1 A;  2H4I A;  2DVZ A;  4QSC A;  4WED A;  5H8F A;  1JQF A;  4IGT A;  1UTB B;  4IY6 A;  2O7I A;  1QUK A;  3VV5 A;  3FIR A;  3DEL B;  5AA4 B;  2DQV A;  4X9T A;  1A55 A;  3FJG A;  3PV0 E;  2QMX A;  5I57 B;  1BLF A;  5H8Q B;  1NNT A;  5J1D A;  2IEE A;  3KG2 A;  5EHS A;  3DLN A;  1H43 A;  3FJ7 A;  2ANJ A;  1MXU A;  1NNK A;  3OD7 A;  4C1T A;  2ZYN A;  5B7D A;  3C36 A;  3TDJ A;  1MXV A;  4HCY A;  4ELR A;  3LC8 A;  4G2Z A;  3TCH A;  1MQJ A;  3IOU A;  4R2B A;  3MBP A;  4YAH X;  3SKP A;  4Z0I A;  1UIV A;  2ZNU A;  3H6U A;  3U92 A;  2DWH A;  4OHN A;  4DDD A;  2B3B A;  2XD2 A;  3I3V A;  2D5W A;  4E0W A;  4EXL A;  4ELP A;  3LUY A;  4R72 A;  2RCA A;  1B1X A;  2F8D A;  3GBA A;  5ICT A;  3TAJ A;  3UIF A;  4ZZE A;  3SDF A;  4BLA A;  3O97 A;  1P1U A;  4FEC A;  1QVS A;  3PUZ E;  5JTY B;  3S4U A;  4IO5 A;  3MJN A;  4YB5 A;  3FXR A;  3SEX A;  3TEP A;  3PUW E;  1NL5 A;  4R9F A;  2Z23 A;  2LAO A;  3PUX E;  1O7T A;  3VXB A;  5FHM A;  1US5 A;  3MUQ A;  1TXF A;  1US4 A;  1IQ7 A;  4RK2 A;  1FQF A;  5HM4 B;  3TCF A;  1D3K A;  3H6W A;  3TTN A;  1NNP A;  4U4X A;  2ESN A;  2XXT A;  4G4P A;  3RPW A;  1N3X A;  3PPR A;  4G68 A;  4YU0 A;  3S9E A;  3WAF A;  2DE3 A;  1MH4 A;  4R73 A;  3FV2 A;  3ECR A;  2ONS A;  2Y7P A;  3OOA A;  1IZ1 A;  4K3F A;  1MY0 A;  3IK6 B;  4GOT A;  5ISU A;  1R1N A;  1PC3 A;  3HV1 A;  3BKI B;  2HZL A;  3MC2 A;  1MQI A;  3G3G A;  5H8F B;  3TUS A;  4U21 A;  2B3F A;  4NF5 B;  3V5A A;  4QFP A;  1LBB A;  4NTL A;  4GXS B;  3UOR A;  2QL3 A;  5F1Q A;  2F6P A;  3TKD A;  3BBR A;  2RC7 A;  2OLB A;  3G7W A;  3FAS A;  2UXA A;  1DSN A;  2ONR A;  5KDT A;  1MM6 A;  3PMX A;  3RLF E;  4MFI A;  4XIG Q;  5FHN A;  3OO9 A;  2FA7 A;  4O3B A;  2I4C A;  5B70 A;  4WEP A;  4PFY A;  4R9G A;  4AQ4 A;  3SEU A;  3EHT A;  4DZ1 A;  1NMU A;  2B65 A;  3KSX A;  4QFL A;  3UA8 A;  4GWO A;  1Z7N E;  2ZNS A;  1II5 A;  1PBP A;  4G77 A;  4XKP A;  1P1W A;  4OMB A;  2XX7 A;  3CRB A;  1B3L A;  2DVC A;  4RA1 A;  1VE4 A;  2PX1 A;  4U2R A;  4ZEI A;  2FNC A;  5I56 A;  1H3D A;  2Y7W A;  4AB6 A;  4LON B;  4TOZ A;  2NVU B;  1M5F A;  4H5F A;  1JVX A;  4BDM A;  3TTR A;  4H5G A;  2F5X A;  4F3S A;  3VVF A;  2ZYM A;  4U1Z A;  3A3U A;  4JSO A;  4I9D A;  2F7C A;  1PB9 A;  3O9P A;  1POT A;  3TTK A;  1WOD A;  1MQD A;  4H8I A;  4BDQ A;  1LFG A;  2V84 A;  3QIM A;  3EQ1 A;  3HO7 A;  4F1Y A;  4THI A;  3ZKL A;  1UTB A;  1LFI A;  2DWI A;  1SDX A;  3FUZ A;  2GH9 A;  4JWO A;  4F2O A;  2GRV A;  1BP5 A;  3MP8 A;  3AXF A;  5AA4 A;  1B2H A;  4MH5 A;  2RF1 A;  4FAJ A;  5I57 A;  4N07 A;  3EHS A;  4YMA A;  5BUU A;  1B3E A;  3SET A;  5CMB A;  2ABH A;  4JWX A;  2R71 A;  5H8Q A;  1B7H A;  2F35 A;  4XTC Q;  4YB7 A;  3T9H B;  1B1H A;  5JEI A;  1LLS A;  3KGC A;  4EDP A;  3E3K A;  4OYV A;  2DWJ A;  3THI A;  1JW1 A;  1QUJ A;  3CVG A;  4BDN A;  1A7L A;  1FTK A;  1B0L A;  3K2D A;  2XXQ A;  1VFD A;  3QUJ A;  2VD3 A;  3JYR A;  2DE2 A;  2O51 A;  3ONM A;  2QMW A;  4FED A;  2Z8E A;  1LAH E;  3KJ7 A;  2E0S A;  3C9H A;  4FOR A;  1Q35 A;  4R6K A;  5CMM A;  3BFT A;  3LBS A;  4JWY A;  1SW2 A;  1XT8 A;  4XKN A;  5CRY A;  1FQD A;  4OEN A;  2AIX A;  1M5B A;  2OZZ A;  4O3C A;  1ANF A;  3WAE A;  3UN6 A;  1JW5 A;  2NWJ A;  3SEY A;  3C4M A;  3B6T A;  3PPP A;  4G8N A;  5KDT B;  1AH5 A;  1LCF A;  4RJZ A;  4KYS A;  3I6V A;  3OO8 A;  1QUI A;  1I6B A;  1NKX A;  1B0H A;  3N5L A;  2REG A;  2M8C A;  1A54 A;  1QKB A;  3LSX A;  4ECF A;  5JTY A;  5FTH A;  3KEI A;  3VVE A;  2ALU A;  1P1Q A;  3CFX A;  4IB2 A;  2A5T A;  3OXN A;  4BDR A;  3VVD A;  4YKP A;  4L17 A;  4DIG A;  4F3B A;  3HHF A;  1B40 A;  4C0R A;  3E13 X;  2I6E A;  4PP0 A;  4M4G A;  1LAG E;  4PE5 B;  1D9V A;  3IOW A;  3FJM A;  1Y20 A;  1PBQ A;  3ILU B;  4U4S A;  4FEB A;  2O69 A;  4GIZ A;  4LUB A;  2ZYK A;  2XX9 A;  4RK9 A;  1DPP A;  1HSL A;  1NNF A;  3JZJ A;  4NWC A;  4JDF A;  4LAT A;  1B5J A;  5AA2 A;  4IO7 A;  2OBG A;  3VFJ A;  4OQO A;  4GXA A;  1FQB A;  4KI0 E;  1ELJ A;  3SER A;  4NF5 A;  3CI8 A;  3TFL A;  1QUL A;  2BJJ X;  3KOS A;  4F22 A;  2H9B A;  1SBP A;  4H8J A;  2X7Q A;  2HCA A;  3RTF B;  1ZIU A;  3KN8 A;  3U94 A;  1YPN A;  4PFT A;  1PDA A;  3M3F A;  3ZS6 A;  3TZA A;  4N6P A;  4POW A;  3S2V A;  2VHA A;  3IO4 A;  2Q89 A;  4NF6 A;  2P2A A;  1PB8 A;  2REJ A;  5DTB A;  4OFJ A;  4TLM B;  4ND9 A;  1A40 A;  3CFL A;  3TTM A;  2Q9T A;  2YJP A;  3MZ9 A;  2ZYO A;  4OXV A;  1Y1Z A;  4UA8 A;  5ITO A;  3OEN A;  1URD A;  2NUV A;  2CZL A;  1VR5 A;  3G3H A;  5L8D A;  3K6U A;  2OWS A;  3O29 A;  1FQA A;  3K6V A;  3HN0 A;  4H65 A;  1QJM A;  1KWH A;  1B5I A;  1TWY A;  2GHB A;  4QRZ A;  2V93 A;  4DXU A;  3M3L A;  5F7V A;  1TFD A;  1UTH A;  3MWB A;  4ZEC A;  3PUY E;  1B3F A;  3SEV A;  1MDP 1;  1R6Z A;  4H6D A;  3S9M C;  2CMO A;  1P1O A;  2THI A;  5A5X B;  1GR2 A;  2UVI A;  5I59 B;  4QSE A;  3FGS A;  4JXI A;  1R9Q A;  3A3C A;  2QS1 A;  2E1S A;  1B5H A;  3KJT A;  1L5T A;  4JB7 A;  5FHO A;  2Q8J A;  4OER A;  4KYE A;  3OEL A;  3CG3 A;  3P7I A;  1N84 A;  2G29 A;  1LGB C;  1MDQ A;  2Z8D A;  2QJE A;  2RCB A;  4KYD A;  4G68 C;  4U1O A;  2Q2A A;  2DWA A;  2A5T B;  4GVO A;  1URS A;  1LST A;  4NF8 B;  4EF2 A;  2GFE A;  4IO4 A;  3TQL A;  4DCY A;  2F78 A;  2Y84 A;  2H5Y A;  1MQH A;  3C35 A;  4R74 A;  3KFM A;  2UYE A;  3U93 A;  4YMB A;  5DYH A;  3CG1 A;  3RUM A;  1ZLQ A;  3LSW A;  3HHG A;  1MQG A;  4DXC A;  1EU8 A;  1OLA A;  5ITP A;  1M5C A;  1OMP A;  4KFQ A;  4MF3 A;  4TLL B;  4U22 A;  3IJO B;  1MXX A;  2DS9 A;  2Q88 A;  4F1U A;  2F34 A;  1F9B A;  5DVJ A;  5I58 B;  3PD8 A;  2Y7K A;  1IXC A;  4FE8 A;  5AA2 B;  1OVT A;  3G3F A;  3CIJ A;  1B05 A;  3C33 A;  3R26 A;  4IGR A;  1N0T A;  3OSR A;  1OQH A;  4KR5 A;  3IR1 A;  2I58 A;  1B6H A;  4I62 A;  2YPN A;  1ZTY A;  3EPE A;  1AOV A;  1EZO A;  2P0S A;  2QPQ A;  2V3U A;  3MP6 A;  3TCG A;  3PPO A;  4NF6 B;  4LQ5 A;  3IB1 A;  4KCC A;  1FTJ A;  3IB2 A;  2ZXT A;  4RPN A;  3H6T A;  5CM6 A;  3RNN A;  1BKA A;  2V25 A;  4BDO A;  3KSJ A;  1Y3N A;  2I48 A;  4QFO A;  5I2K B;  3O28 A;  1SQY A;  4LZ5 A;  4M1V A;  1DMB A;  4EQ7 A;  3VLV A;  3OO7 A;  4ELQ A;  3EN3 A;  2XD3 A;  1UTH B;  4GL0 A;  2UVH A;  4R6Y A;  4LVQ A;  3MPK A;  1BTJ A;  5DVI A;  5KCJ A;  5ICQ A;  4NF4 A;  3RT8 A;  3RQT A;  3FXQ A;  3QYT A;  1T0K A;  1B32 A;  4ZEF A;  4FJP A;  4XXU A;  2F7A A;  3VDF A;  4RNS A;  3TOD A;  4O3A A;  1P1N A;  3MVZ A;  4ZZA A;  1IXH A;  1A99 A;  3SES A;  4DLD A;  4P0I A;  4QHQ A;  1IUD A;  4NWD A;  3K4U A;  4POX A;  3SEW A;  1MXZ A;  1J1N A;  5I84 A;  2F6G A;  3EHU A;  2O6A A;  1SI1 A;  3S9N C;  1UIU A;  4GFR A;  3OMB A;  4DCX A;  1XC1 A;  3FAT A;  3U1O A;  4ZEB A;  5CC2 A;  2RC8 A;  5DEX A;  3V8X B;  3Q29 A;  1LCT A;  4OWD A;  3KN3 A;  5ELV A;  1B46 A;  1ZBM A;  3USD A;  3KZG A;  1XVY A;  4EQ9 A;  1B4H A;  3PPQ A;  3MAM A;  1I69 A;  1DTZ A;  2WKY A;  1BIY A;  2F7B A;  4MBP A;  3UK4 A;  3B7D A;  3Q25 A;  1USY H;  4OTE A;  3D4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...