4KQPA

Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
230
structure length
230
Chain Sequence
ATPKKDVYTIASDNSFAPFEFQNDDKQFTGIDVDLLNAIAKNQGFKLKWNFIGFQAAVDSVQSGHADGMMSGMSITDARKQVFDYGSPYYSSNLTIATSSTDDSIKSWKDLKGKTLGAKNGTASFDYLNAHAKEYGYTVKTFTDATTMYSSLNNGSINALMDDEPVIKYAIKQGQKFATPIKPIPDGQYGFAVKKGSNPELIEMFNNGLANLRANGEYDKIIDKYLESDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamine ABC transporter permease and substrate binding pro
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transport protein
total genus 79
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2013-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kqpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kqpA02
1B7UA 1MDP1 4EF1A 3PPRA 1UIVA 1MXVA 3D4CA 2F35A 5DVFA 4WEDA 3OOAA 3C33A 1MPBA 4R6HA 3EPEA 4H67A 3F11A 3LUYA 3L6GA 4Q5TA 3KEIA 4BDRA 2XXVA 1SW2A 3CSGA 5I2KA 3KZGA 1H3DA 2NUVA 3MP1A 1ZU0A 1DPEA 4G68B 3AXFA 3OENA 4DXCA 4IO2A 1B2HA 4LVQA 3TCGA 4I62A 4U1OA 1UIUA 3PD9A 4OTEA 3CG1A 3TQWA 1LFHA 4O3CA 4ELPA 4FEBA 4NF4A 1XS5A 3Q29A 1NNTA 2GH9A 3H6VA 4XKNA 3BFTA 4H1XA 1ZKBA 4IO5A 3ECRA 3IOUA 2Q88A 5IKBA 2XHDA 5DEXA 2DWIA 3I6VA 2ONRA 4L17A 4MLQA 4F39A 3ILTB 1LGBC 4XIGQ 2VP1A 4YZZA 2QMXA 2H25A 3IJOB 1ANFA 3S9LC 2UYFA 4MFIA 3JV9A 1JVYA 3MAMA 5AE4A 2W7YA 2HQ0A 1B5HA 3UORA 4PFWA 3O29A 5ICTA 4C1UA 1Y9UA 5I56A 4TLMB 3WAFA 1ELJA 3RT6B 1IXHA 3QUJA 2I0BA 2PX1A 2F6GA 3L6HA 1A8FA 3IORA 1LFGA 3RUMA 4DIGA 3JZJA 1LCTA 2XXYA 3K6VA 1M5EA 4MLVA 3U72A 4TLLB 2O6AA 1USYE 3TELA 1B5IA 4H0WA 3RY3A 2XX7A 4ND9A 1IXGA 4RK9A 4EQ9A 4F1VA 4FECA 3IO6A 5I58B 1Y3NA 1NNFA 1B7HA 1H44A 3IL1B 1N0TA 3N5LA 4OMBA 1AOVA 3MC2A 2O84X 3KOTA 2F8DA 3V8XB 3W9WA 2V3TA 3HO7A 5TPAB 1B6HA 3ZSFA 2PT1A 3IB1A 4X1DA 2OWTA 1JVXA 3TODA 3LSXA 1M5BA 5K2XA 2DXYA 2XXWA 3VE1B 1NMUA 1B0HA 3IK6B 3E13X 4OWDA 2UVJA 2DWHA 4F2QA 1SW4A 3G3FA 4C1TA 3IB0A 2O7UA 4F3SA 2RC9A 5AA2A 5JTYB 3CG3A 4ZE9A 3K1MA 3IOTA 2I3VA 3TUSA 4QFNA 1WVJA 2AYSA 4EDPA 4PETA 3EHSA 4HW8A 2REJA 3PPPA 4H65A 4HCWA 5HBCA 3KN7A 4P11A 2XX9A 3OEMA 5CMBA 3O97A 1S50A 1JETA 3IR1A 2GHAA 4ZEKA 1B0LA 1UTBA 4OHNA 2QJEA 2VD3A 1QUKA 3BKIB 4Q8RA 5H8QB 4EQBA 2ANJA 2X26A 1CE2A 5A5XB 3VXCA 5DTBA 1FTMA 5CBRA 3BBRA 1JEVA 1BTJA 2R6GE 3VV5A 3PMWA 4AB5A 3PPOA 3GXAA 3HV1A 2THIA 2O69A 2PYYA 4IGTA 4G8NA 2Y7KA 2YJPA 5ELVA 2B3BA 4U23A 3FUZA 5I59B 3IX1A 3D4GA 3HHFA 4KD5A 3CIJA 3KJTA 5EHMA 3PV0E 4DLDA 1N3WA 4JDFA 4ECFA 3CFLA 4NTLA 4EXLA 4GVOA 1YPNA 5TU0A 4JWXA 4K3FA 3B6WA 3CI8A 5I57A 4QSDA 1FTKA 3KN8A 4Z0IA 4UACA 3MVXA 3QIMA 1POTA 2ZXTA 4PFTA 4YKJA 1IZ1A 1J1NA 3VDFA 4IO6A 1MQIA 3CRBA 2ZNTA 3IOVA 4OFOA 2E0SA 1SVXB 3EN3A 2Z23A 5JEIA 5CM6A 3VLVA 1URSA 4IO4A 4ZEIA 4ISUA 1NH8A 4RPNA 3VXBA 3ODBA 1TXFA 2XD2A 4IO7A 1QKAA 4F22A 4DXBA 3TTLA 1LB9A 4G2ZA 5CI5A 2E1SA 5H8FA 1MXZA 1FQBA 1VR5A 1B32A 1YCJA 4Q0CA 4KQPA 2F36A 5K2YA 3FXUA 3HN0A 2OBGA 1S9TA 3MVZA 4GD5A 4JXIA 3G3JA 4PQJA 1AIVA 2Y7IA 4PE5B 1IEJA 4F3PA 2V84A 2Y7WA 1Y1MA 4R9FA 5ITPA 2H99A 4OXVA 4GFRA 2I49A 3G3GA 3K00A 3PUWE 3TQLA 3G3HA 2H98A 3PU5A 3EQ1A 3PD8A 3TKDA 3K1NA 2ZNSA 2ZYOA 5AA4A 1JNFA 3MQ9A 2QSXA 3PUYE 2HFBA 1URDA 5TP9A 2XXRA 1NNKA 1DTZA 3TAJA 3FJGA 4H5FA 4NF5A 3T93B 3N6TA 2QS2A 3FD3A 4C0RA 2ABHA 5I2NA 1A40A 3FXRA 5H8NB 1NKXA 2ALUA 2I58A 2F34A 2DE3A 1B3HA 3JYRA 3K02A 1B05A 2DOJA 2O51A 4XKQA 2V93A 3TTMA 2OK2A 4F1UA 3EHTA 3Q26A 3SEUA 1H45A 1JW1A 1MXYA 3Q27A 4O3AA 5BWJA 2UXAA 4H6DA 1MH4A 2Q9TA 3C31A 1GR2A 3B6TA 1MXXA 3DP8A 1WDNA 1Q35A 2R9JA 3U1OA 3OMBA 3OO9A 1OLAA 1FQAA 2F7AA 1UTHB 4U1ZA 1R1NA 1XOCA 3H4ZA 4OETA 2UYEA 4YKPA 3PMVA 3O2AA 4R75A 3TFLA 1OVTA 1B4HA 2NVUB 4FJPA 1I6AA 2ZYNA 3OD7A 4HCYA 4DCYA 1O63A 2Q89A 2ONSA 3H6WA 1MH3A 4XTCQ 3TDJA 2O68A 3RNNA 4R74A 5HPQA 4H5GA 1XVXA 4NF6A 4IY5A 1N76A 3FIRA 3MP6A 1QVSA 1H43A 4NF8A 2DE4A 3PGFA 3K6UA 4KYDA 2RC8A 3E3KA 1XT8A 5KCJA 5KZTA 2NWJA 2F7BA 5CMMA 2UVGA 3CFZA 4WEPA 1II5A 5L9SA 2F5XA 1I6QA 5CMKA 1MY4A 3C4MA 3TPAA 3T66A 3RLFE 3G7WA 2ZYKA 4OQOA 1ZBMA 4E0WA 5B7DA 3GLBA 3HSTA 4RYAA 3MP8A 1RYXA 3Q28A 3TTNA 1B4ZA 3LBSA 4JBZA 1MPDA 2DWJA 4LUBA 3K2DA 4EUOA 3QXMA 2D3IA 4E0XA 3UIFA 4GXAA 4LATA 1PB7A 1OIBA 3B6QA 3KSXA 2P1SA 4G4PA 1P1UA 3PPQA 4BLAA 3OXNA 1MQHA 1Y1ZA 1MQJA 1AMFA 2Z8EA 4NMYA 1ZLQA 3FVOA 2R71A 1MY1A 5CBSA 2DP8A 2REGA 1B5JA 1N84A 4FEDA 3GZGA 4KYSA 1FTJA 1NL5A 1EZOA 1ZTYA 3SETA 4XKPA 3K1PA 3MJNA 2XXXA 5B70A 4YU0A 4QRZA 3A3CA 2H4IA 3E4RA 2Y7RA 5IAIA 4OVJA 1Y20A 3S2VA 4M1VA 3S4UA 2Y7PA 3T22A 1VE4A 2RF1A 3EF7A 3P7IA 1FQDA 1SBPA 3TEPA 3RT8A 1OQGA 2RINA 4ESXA 2QS3A 4R72A 3IB2A 4JB7A 1B7ZA 2V3UA 3RN8A 4NWCA 2DWAA 3RPWA 3M3LA 1SI1A 1AH5A 2RCAA 4ZDMA 1JW4A 2Y84A 2XXQA 1A8EA 5I2KB 3HPIA 1PC3A 1H76A 2NXOA 2AL5A 2FYIA 3MZ1A 4DDDA 4OFJA 4I8CA 4GQOA 4KHZE 2I3WA 3UN6A 5F1QA 1PB8A 4YB6A 4GOTA 4NF4B 2DXRA 4MF3A 1B58A 1LAHE 4RNSA 1QULA 2QMWA 1P99A 3SEWA 1Z7ME 1XHYA 2X7PA 3FVNA 3LSFB 3M8UA 1MM6A 3PUZE 4F1YA 4U21A 4YMAA 1FQCA 2ESNA 3UP9A 4JSOA 3UK4A 5DEXB 1O64A 4BDMA 4KCCA 2OWSA 3VVFA 1N7WA 3UGWA 1RKMA 5AA1A 3OSRA 3DP6A 5AA3A 3TYHA 3FATA 1UQWA 5I84A 4BDOA 5H8HA 2HZLA 4JWYA 2IEEA 3MPKA 3G3IA 2AIXA 3UA8A 2A5TA 1M5FA 3RGYA 2F97A 5I56B 1PBQA 2FA7A 2QS1A 1SYIA 1JW5A 5KDTA 4R73A 3HCQA 2Q8JA 2OLBA 3OO6A 1LSTA 2Z8FA 1NNPA 1A99A 4X9TA 3R7XA 5M2VA 4AQ4A 2DVCA 3THIA 1IIWA 4FE8A 2PVUA 2RC7A 4ELOA 2DS9A 2IA4A 1YTVA 4OENA 3K6WA 1OVBA 1JQFA 1ZIUA 4OEUA 5JK4A 4YB5A 4I9DA 4POWA 3CSBA 1FTLA 3OELA 4BDQA 3I3VA 4GF8A 1I6BA 1MXUA 4DE8A 3K01A 4ZZEA 4ZEBA 4G68A 3QAXA 3K4UA 4NEDA 3M3KA 1MY0A 5DT6A 3C35A 2PBWA 3EHUA 4ZS9A 4YKKA 2HAUA 2DVZA 4FIMA 1LAFE 2QL3A 1PB9A 4KYEA 1P1OA 2I48A 5AA2B 2Z8DA 1ZMGA 2DYXA 3LSLA 4LQ5A 3H06B 4F3GA 2X7QA 4N07A 2BJJX 2NOOA 2Q2AA 4N6PA 4ZE8A 5EHSA 1F9BA 5EYFA 3FVGA 1FQFA 3O6GA 1LBBA 1GVCA 4QFKA 3GBAA 3T9UA 1SW5A 1Z7NE 4HS7A 1O7TA 3SEXA 1IQ7A 1D3KA 2M8CA 2KLFA 3FJMA 1UTBB 3IOWA 1IXCA 1RYOA 4G68C 4RY1A 1OLCA 1N7XA 2UVHA 3MPLA 3N6UA 1QUIA 4LONB 1XC1A 3TCHA 3GBBA 4OYVA 1TT1A 1LAGE 1M5CA 3S9MC 3RQTA 4ZEDA 3MVWA 2D21A 4BDLA 2XXUA 3K6XA 2HZKA 5CC2A 3QUFA 4RPOA 4RXLA 3O6HA 4Z7EA 1TFAA 3G3KA 4LZ5A 4GRKA 1BKAA 1WODA 4M4GA 5AA2D 2OJTA 2XXHA 4OEVA 5CRYA 1B3LA 3CR9A 2V25A 1QUJA 5KDTB 4THIA 4YB7A 4KR5A 5I58A 1KWHA 5H8SA 2HEUA 2V3QA 3USDA 1MQGA 4XKRA 2OCUA 4U2RA 2ZMBA 4NWDA 2XX8A 1SW1A 4G8MA 1Y3PA 5TPAA 1CB6A 2WKYA 3E9XA 1POY1 1R6ZA 5I57B 4QF9A 3OO8A 1I69A 1DOTA 2H9BA 1B3EA 2F7CA 3SESA 1P1NA 1OQHA 4RA1A 3QYTA 5DYHA 5LOMA 5FHOA 1IITA 3SDFA 1EZPA 2P2AA 2AL4A 2HXWA 4QFLA 3U8QA 4JWOA 5JTYA 3FV1A 4MH5A 1NH7A 4YAHX 1LLSA 2UVIA 1BP5A 2O7IA 3WAEA 4OERA 4WKMA 1MM7A 1N3XA 3OO7A 5H8FB 4DZ1A 4ESWA 2B65A 1MXWA 2VGQA 4ZZAA 1EZ9A 4LQ2A 2I6EA 1BLFA 4QFPA 3C9HA 3QSLA 3SKPA 1B1XA 5H8QA 4RK2A 4I1DA 4ZEFA 1US4A 1NFTA 3ZS6A 1HSJA 5A5XA 1D4NA 2A5SA 4R9GA 3VLUA 1URGA 3SERA 3MZBA 4GIZA 2H5YA 3VLWA 3KSJA 4GXSB 4TOZA 3KFMA 4F31B 1B1HA 3SEVA 1YAEA 1B51A 4GL8A 5AA4B 1IXIA 4XXUA 1USYH 1XVYA 4U4XA 5TP9B 5DVJA 3KOSA 1Q1KA 4R2FA 1B46A 4NF5B 3ZKLA 5I2NB 1JEUA 3KGCA 5I59A 3Q25A 3A3UA 4LP2B 3C36A 3N26A 3FVKA 3KN3A 1T0KA 1MRPA 1B9JA 2QS4A 3C32A 1TFDA 2Z22A 3H7MA 3V83A 4IO3A 2RCBA 4GLIA 2PMSA 1MDQA 1VSOA 2DE2A 1SI0A 1R9LA 2F6PA 4F29A 4JSDA 4DCXA 3U93A 5ICQA 2O1LA 1US5A 3ZKKA 3TMGA 3FZVA 4QFOA 5FHMA 3LR1A 2O1MA 3IAZA 3W15C 4KFQA 1BIYA 1EU8A 1MS7A 1R9QA 5CMCA 4PP0A 2G93A 3T9HB 4YICA 2ZYMA 1LAXA 1DPPA 1LFIA 1SDXA 1SYHA 1LCFA 2VD2A 4GWOA 4QHQA 3VVDA 5L9OA 3BFUA 1MQDA 3FV2A 2HCAA 3CFXA 2XD3A 3N94A 4NF6B 2XXIA 4FATA 4R6KA 4NF8B 2YPNA 3FASA 2YLNA 3MUQA 4F3BA 3ONMA 4G77A 5KCJB 4Q30B 2XXTA 2ZNUA 3H6UA 4PFYA 1D9YA 4ZECA 5F7VA 4UA8A 4N13A 2VHAA 1HSLA 3QK6A 3FXQA 1VFEA 3K0VA 4OZ9A 1Y4CA 4KPTA 3LSWA 4NE4A 3I5OA 5L8DA 3MW0A 1GGGA 1A55A 1SD3A 3RTWB 2GRVA 1B40A 1OMPA 3C34A 3FJ7A 3TCFA 1GV8A 4MBPA 5H8NA 1A54A 3H6TA 3DELB 4G8HA 3R26A 1GTKA 1AL3A 3A09A 2LAOA 4KCDA 4FORA 1QW0A 4ONYA 3V5AA 2XXPA 3R6UA 1PBPA 2I4CA 2RKMA 4EXKA 4QSEA 1Y4TA 1MY2A 4OESA 5FHNA 4FAJA 3O9PA 2GHBA 2QRYA 3T9XB 4PFUA 3W9VA 4HTGA 4P0GA 1PEBA 2VOZA 3TTKA 3O66A 1M5DA 3OSQA 4POXA 1UTHA 2DSFA 5L9MA 3PUVE 3RTFB 5FTIA 4H8IA 4IY6A 1D9VA 1ZJLA 1DMBA 5FTHA 1Y3QA 2Q2CA 3LC8A 2I4BA 5HM4B 3O6IA 4U22A 3H03A 1ATGA 1P1QA 2QPQA 4EF2A 4IGRA 2D5WA 3OEKA 4X48A 3MZ9A 1QJMA 1S7YA 4WXJA 4P0IA 3ILUB 3DP4A 3KJ7A 3H3GA 2CMOA 3DLNA 4LA9A 3TTRA 1LBCA 4O3BA 3M3FA 4H8JA 2DQVA 3TZAA 1SQYA 1DSNA 1MY3A 5J1DA 5BUUA 3KBRA 2P0SA 2B3FA 3T96B 4F18A 1FW0A 4LZ7A 4F2OA 1HSEA 1TWYA 4LZ8A 5ISUA 1P1WA 2F78A 2HAVA 2CZLA 2ONKE 3IO4A 4R6YA 3T9VA 3VFJA 4R2BA 4YKIA 4X1BA 3DM0A 3MVYA 1L5TA 1B3GA 1B3FA 3S9EA 2PT2A 4AB6A 4ELQA 1FQEA 1VFDA 3O28A 5ITOA 3B7DA 4RJZA 4QSCA 2OZZA 5H8HB 3HHGA 3V89B 1LB8A 1MG1A 4U4SA 5DVIA 4GL0A 1A7LA 1B52A 3PMXA 2A5TB 3KG2A 1QKBA 2G29A 2I0CA 3PPNA 4DXUA 3CVGA 1N04A 2FNCA 4EQ7A 3MWBA 4OFLA 2GFEA 3VVEA 4F19A 3SEYA 3MBPA 1IUDA 4ELRA 3PUXE 1DTGA 3IJXB 4TQUQ 1FCKA 3U94A 1PDAA 4YMBA 3FGSA 4KI0E 1FTOA 4BDNA 1EH3A 3U92A 4IB2A 3S9NC 1MPCA
chains in the Genus database with same CATH superfamily
1B7UA 1MDP1 1IMFA 4EF1A 4OVPA 3PPRA 1UIVA 1MXVA 3D4CA 2F35A 5DVFA 4WEDA 3OOAA 3C33A 1MPBA 4R6HA 3EPEA 4H67A 4MMPA 3F11A 3LUYA 4NX1A 3L6GA 4Q5TA 3KEIA 4BDRA 2XXVA 1SW2A 3CSGA 5ET7A 3KZGA 5I2KA 1H3DA 2NUVA 3MP1A 1ZU0A 1DPEA 4G68B 3AXFA 3OENA 4DXCA 1NUYA 4IO2A 1DK4A 1B2HA 4LVQA 5ET8A 3TCGA 4PDHA 4I62A 4U1OA 1UIUA 3PD9A 4OANA 4OTEA 3CG1A 3TQWA 1LFHA 4O3CA 3BIHA 4ELPA 4FEBA 4NF4A 1XS5A 3Q29A 1NNTA 2GH9A 3H6VA 4XKNA 3BFTA 4H1XA 5ET6A 3FXBA 1RDZA 1ZKBA 4IO5A 3ECRA 3IOUA 2Q88A 2Q74A 1Q9DA 5IKBA 2XHDA 5DEXA 2DWIA 2WYPA 3I6VA 2ONRA 2JJKA 5I5PA 4L17A 4MLQA 4F39A 3D1RA 1LBVA 3ILTB 1LGBC 4I3YA 4XIGQ 2VP1A 4YZZA 2QMXA 2H25A 3IJOB 1ANFA 3S9LC 2UYFA 5IZ3A 4MFIA 4PAFA 3JV9A 1JVYA 3MAMA 5AE4A 2W7YA 2HQ0A 2WBDA 1B5HA 3UORA 4PFWA 3O29A 5ICTA 4C1UA 1Y9UA 5I56A 1LBZA 4TLMB 3WAFA 1ELJA 3RT6B 1IXHA 3QUJA 1FBEA 2I0BA 2PX1A 1NV7A 4X8RA 2F6GA 3SZPA 3L6HA 1A8FA 3IORA 4GWSA 1LFGA 3RUMA 4DIGA 3JZJA 1LCTA 2XXYA 3K6VA 1M5EA 5I7IA 4MLVA 3U72A 4TLLB 2O6AA 1USYE 3TELA 1B5IA 4H0WA 3RY3A 2XX7A 4ND9A 1IXGA 4RK9A 4EQ9A 4F1VA 4N17A 4OVSA 4FECA 3IO6A 5I58B 1Y3NA 1NNFA 1B7HA 1H44A 3IL1B 1N0TA 3N5LA 4OMBA 1AOVA 3MC2A 2O84X 3KOTA 2F8DA 3V8XB 3W9WA 5IGAA 1IMBA 2V3TA 3HO7A 5TPAB 1B6HA 3ZSFA 2PT1A 3IB1A 4X1DA 2OWTA 1JVXA 3TODA 3LSXA 1M5BA 5K2XA 3MYUA 2DXYA 2XXWA 3VE1B 1NMUA 1B0HA 3IK6B 3E13X 4GX3A 4OWDA 2UVJA 2DWHA 4F2QA 1SW4A 3G3FA 4C1TA 3IB0A 2O7UA 4F3SA 2RC9A 5AA2A 5JTYB 3CG3A 4ZE9A 3K1MA 3IOTA 2I3VA 3TUSA 4QFNA 2ZZWA 1WVJA 2AYSA 4EDPA 4PETA 3EHSA 3FBPA 4HW8A 2REJA 3PPPA 4H65A 4HCWA 5HBCA 3KN7A 4P11A 4P1EA 5IM2A 2XX9A 3OEMA 5CMBA 3O97A 1S50A 1JETA 3IR1A 2GHAA 4ZEKA 1B0LA 1UTBA 4OHNA 2QJEA 2VD3A 1QUKA 3BKIB 4Q8RA 5H8QB 4EQBA 2ANJA 2X26A 1CE2A 5A5XB 1FBFA 3VXCA 1VDWA 2Y5LA 5DTBA 1FBGA 1FTMA 5CBRA 3BBRA 1YYZA 1JEVA 1BTJA 2R6GE 3VV5A 3IFAA 3PMWA 4AB5A 2FIXA 3PPOA 3GXAA 3HV1A 2THIA 2ZZVA 2O69A 1DCUA 2PYYA 4IGTA 4G8NA 2Y7KA 2YJPA 5ELVA 2B3BA 3U65A 2ZZXA 4U23A 3FUZA 5I59B 3IX1A 3D4GA 3HHFA 4KD5A 3CIJA 3KJTA 5EHMA 3PV0E 4DLDA 1N3WA 4JDFA 4ECFA 3CFLA 4NTLA 1IMEA 2L5VA 4EXLA 4GVOA 1YPNA 5TU0A 4JWXA 4K3FA 3B6WA 3CI8A 1RDXA 5I57A 3BIGA 1NV4A 4QSDA 1FTKA 3KN8A 4O94A 4Z0IA 4UACA 3MVXA 3QIMA 1POTA 2ZXTA 4PFTA 4YKJA 4XFEA 1IZ1A 4MNIA 2BJIA 1J1NA 3VDFA 4IO6A 2CEYA 1MQIA 3CRBA 2ZNTA 3IOVA 4MX6A 4OFOA 2E0SA 1SVXB 2WBBA 3EN3A 2Z23A 5JEIA 4PAKA 4G61A 5CM6A 3VLVA 1URSA 2OWZA 4IO4A 4ZEIA 4ISUA 1NH8A 4RPNA 3VXBA 3ODBA 1TXFA 2XD2A 4IO7A 1QKAA 4F22A 1NUZA 4DXBA 3RPLB 1LB9A 3TTLA 4G2ZA 5CI5A 2E1SA 5H8FA 1MXZA 1FQBA 1VR5A 1B32A 1YCJA 4Q0CA 4KQPA 1NV5A 4MJOA 2F36A 5K2YA 3FXUA 3HN0A 2OBGA 1S9TA 3MVZA 4GD5A 4JXIA 3G3JA 4PQJA 1AIVA 2Y7IA 4PE5B 5DW8A 1IEJA 4F3PA 2V84A 2Y7WA 1Y1MA 4R9FA 5ITPA 1IMCA 2H99A 5LTCA 4OXVA 4GFRA 2I49A 3G3GA 3K00A 3PUWE 3TQLA 3G3HA 2H98A 3PU5A 3EQ1A 3PD8A 4AS5A 4MHFA 3TKDA 3K1NA 2F3DA 2ZNSA 4FBPA 2ZYOA 5AA4A 1JNFA 3MQ9A 2QSXA 3PUYE 2HFBA 1URDA 4GX6A 5TP9A 2XXRA 1NNKA 4GWZA 1DTZA 3TAJA 3FJGA 4H5FA 4NF5A 3T93B 3N6TA 2QS2A 3FD3A 4C0RA 2ABHA 5I2NA 3E78A 1A40A 3FXRA 5H8NB 1NKXA 2ALUA 2I58A 2F34A 2DE3A 1B3HA 4NGUA 3JYRA 1QGXA 3K02A 1B05A 2DOJA 4UABA 2O51A 4XKQA 2V93A 3TTMA 2OK2A 4F1UA 3B50A 3EHTA 1EYKA 3Q26A 4GWUA 3SEUA 1H45A 1JW1A 4NAPA 1MXYA 3Q27A 4O3AA 5BWJA 2UXAA 4H6DA 1NV2A 3A29A 1MH4A 2Q9TA 3C31A 1GR2A 3B6TA 1MXXA 3DP8A 1WDNA 1Q35A 2R9JA 3U1OA 3OMBA 3OO9A 1OLAA 1FQAA 2F7AA 1UTHB 4PCDA 1R1NA 1XOCA 4U1ZA 3H4ZA 4OETA 2UYEA 4YKPA 3PMVA 2VPNA 3O2AA 1FPBA 4R75A 3TFLA 1OVTA 1B4HA 5ESYA 4FJPA 2NVUB 1I6AA 1FBCA 3QMFA 2ZYNA 4N81A 4P3LA 4O7IA 3OD7A 4HCYA 5EYGA 4DCYA 1O63A 2Q89A 4JVIA 2ONSA 3H6WA 1MH3A 4XTCQ 1K9YA 3TDJA 2O68A 3RNNA 4R74A 5HPQA 4H5GA 2VT5A 1XVXA 4NF6A 4IY5A 1N76A 3FIRA 3MP6A 1QVSA 1H43A 4NF8A 2DE4A 1FPLA 3PGFA 3K6UA 4KYDA 2RC8A 3E3KA 5ET5A 1XT8A 2WX9A 5KCJA 5KZTA 2NWJA 2F7BA 5CMMA 2UVGA 3CFZA 4WEPA 1II5A 5L9SA 2F5XA 3ISPA 1FBHA 1I6QA 5CMKA 1MY4A 3C4MA 3TPAA 3T66A 3RLFE 3G7WA 4PAIA 2ZYKA 4OQOA 1ZBMA 4E0WA 5B7DA 3GLBA 3HSTA 4MIJA 4RYAA 3MP8A 1RYXA 3Q28A 3TTNA 1B4ZA 5FBPA 3LBSA 4JBZA 1MPDA 4MAGA 2DWJA 4LUBA 3K2DA 4EUOA 3QXMA 4NG7A 4OVQA 2D3IA 3IFCA 1BK4A 4E0XA 3UIFA 4GXAA 4LATA 1PB7A 1OIBA 3B6QA 2PFZA 3KSXA 2P1SA 4G4PA 1P1UA 3E79A 3PPQA 3OXNA 4BLAA 1MQHA 1Y1ZA 1MQJA 1AMFA 2Z8EA 4NMYA 1ZLQA 2VPOA 3FVOA 2R71A 1MY1A 2F3BA 5CBSA 4GWXA 2DDKA 2DP8A 4PFBA 2REGA 1B5JA 1N84A 4FEDA 3GZGA 4KYSA 1FTJA 4PF6A 3NOHA 1NL5A 1EZOA 1ZTYA 4PGNA 3SETA 4XKPA 3B8BA 3K1PA 3MJNA 4DI3D 4HE1A 2XXXA 5B70A 1JP4A 4YU0A 4QRZA 3T1BA 3A3CA 2H4IA 5EQAA 3E4RA 2Y7RA 5IAIA 4OVJA 1Y20A 3S2VA 4M1VA 3S4UA 2Y7PA 3T22A 1VE4A 2RF1A 3EF7A 3P7IA 1FQDA 3KC0A 1SBPA 3TEPA 1IMDA 3RT8A 1OQGA 2RINA 4ESXA 2QS3A 4R72A 3IB2A 4JB7A 1B7ZA 2V3UA 3RN8A 2FBPA 4NWCA 2DWAA 1NV0A 3M3LA 3RPWA 1SI1A 1AH5A 2RCAA 4ZDMA 1JW4A 2Y84A 2XXQA 3CHGA 1A8EA 5I2KB 3HPIA 1FPFA 4XEQA 1PC3A 4N15A 2XA5A 1H76A 2NXOA 2AL5A 2FYIA 3MZ1A 4DDDA 4OFJA 4I8CA 4GQOA 4KHZE 2I3WA 3UN6A 5F1QA 1NUXA 1PB8A 4YB6A 4GOTA 4NF4B 2DXRA 4MF3A 1B58A 1LAHE 4RNSA 4H45A 1QULA 4HE2A 2QMWA 1P99A 3SEWA 1Z7ME 1XHYA 2X7PA 3FVNA 3LSFB 3M8UA 1MM6A 3PUZE 2XWOA 4F1YA 4U21A 3MSTA 4YMAA 1FQCA 2ESNA 1NI9A 3UP9A 4JSOA 3UK4A 5DEXB 1O64A 4BDMA 4KCCA 2OWSA 3VVFA 1N7WA 5EYHA 4HE0A 3UGWA 1RKMA 3LUZA 5AA1A 3OSRA 3DP6A 3TYHA 5AA3A 3FATA 1UQWA 5I84A 5IZ3B 4BDOA 5H8HA 2HZLA 4JWYA 2IEEA 3MPKA 3G3IA 2AIXA 3UA8A 2A5TA 1FPIA 1M5FA 4PTKA 3RGYA 4OVTA 2F97A 5I56B 3EKIA 2CEXA 1PBQA 1NV1A 2FA7A 2P3NA 2QS1A 2MKZA 1SYIA 1JW5A 4NHBA 2FVZA 5KDTA 4R73A 1FPDA 3HCQA 2Q8JA 2OLBA 3OO6A 1LSTA 2Z8FA 5EQ9A 1NNPA 1A99A 2QVVA 4X9TA 3R7XA 5M2VA 1YZ0A 1LEVA 4AQ4A 2DVCA 3THIA 1IIWA 4FE8A 4NN3A 2PVUA 2RC7A 4ELOA 2DS9A 2FIEA 1KA1A 2IA4A 1YTVA 4H46A 4OENA 3K6WA 3GYYA 1OVBA 1JQFA 1ZIUA 2CZHA 4OEUA 5JK4A 4YB5A 4I9DA 4POWA 3CSBA 1FTLA 3OELA 4BDQA 3I3VA 4GF8A 4O8MA 1I6BA 1MXUA 4DE8A 3K01A 4ZZEA 4ZEBA 4G68A 1RDYA 3QAXA 3K4UA 4NEDA 3M3KA 1MY0A 5DT6A 3C35A 4QXDA 2PBWA 3EHUA 1EYIA 4ZS9A 4YKKA 2HAUA 2DVZA 2B4MA 4FIMA 1LAFE 3T0JA 2QL3A 1CNQA 1PB9A 4KYEA 1P1OA 4PGPA 2I48A 5AA2B 2Z8DA 4P8BA 1ZMGA 2DYXA 3LSLA 4LQ5A 3H06B 4F3GA 2X7QA 4N07A 2BJJX 2NOOA 2Q2AA 4P9KA 4N6PA 4ZE8A 5EHSA 1F9BA 5EYFA 3FVGA 1FQFA 3O6GA 1LBBA 1GVCA 4QFKA 3GBAA 3T9UA 5F24A 1SW5A 1Z7NE 4HS7A 1O7TA 3SEXA 1IQ7A 1D3KA 2M8CA 3KBZA 2KLFA 1D9QA 3FJMA 1UTBB 3IOWA 1IXCA 1RYOA 1G0IA 4G68C 4RY1A 2OX3A 1OLCA 1N7XA 2CZIA 2UVHA 3MPLA 5T3JA 3N6UA 1XI6A 1QUIA 4LONB 1XC1A 3TCHA 3GBBA 4OYVA 1TT1A 1LAGE 1M5CA 3S9MC 3RQTA 4ZEDA 3MVWA 2D21A 4BDLA 2XXUA 3K6XA 2HZKA 5CC2A 3QUFA 4RPOA 4RXLA 3O6HA 4GX4A 4Z7EA 4P47A 4N91A 1TFAA 3G3KA 4LZ5A 4GRKA 1BKAA 1WODA 4M4GA 5AA2D 2OJTA 2XXHA 4OEVA 5CRYA 2XWIA 1B3LA 3CR9A 2QVRA 1FBDA 1NV3A 2V25A 3KC1A 1QUJA 5KDTB 4THIA 4YB7A 4KR5A 5I58A 1KWHA 5H8SA 2HEUA 2V3QA 3USDA 1MQGA 4XKRA 2OCUA 4U2RA 4MCOA 4KXPA 2ZMBA 4NWDA 2XX8A 4GWYA 2KR0A 1SW1A 4G8MA 1SPIA 1Y3PA 1IMAA 5TPAA 1CB6A 2WKYA 3E9XA 1POY1 1R6ZA 5I57B 4QF9A 3OO8A 1I69A 1DOTA 2H9BA 1B3EA 2F7CA 3SESA 1P1NA 1OQHA 4RA1A 3QYTA 4XF5A 5DYHA 5LOMA 5FHOA 1IITA 3PTYA 3SDFA 1EZPA 2P2AA 2AL4A 4PBQA 2HXWA 4QFLA 3U8QA 4JWOA 5JTYA 3FV1A 4MH5A 1NH7A 4N6KA 2Y5KA 4YAHX 1LLSA 2UVIA 1BP5A 2O7IA 3WAEA 4OERA 4WKMA 2QFLA 1FBPA 1MM7A 1N3XA 3OO7A 5H8FB 4DZ1A 4ESWA 2B65A 1MXWA 2VGQA 4ZZAA 1EZ9A 5I3SA 2PCRA 4LQ2A 2I6EA 1BLFA 4QFPA 2B4LA 3C9HA 3QSLA 4GBWA 2WEFA 3SKPA 1B1XA 5H8QA 4RK2A 4I1DA 4ZEFA 1US4A 1NFTA 3ZS6A 1HSJA 5A5XA 1D4NA 1LBWA 1LBXA 2A5SA 4I3EA 4R9GA 3VLUA 1URGA 3SERA 3MZBA 4GIZA 2H5YA 1FPGA 3VLWA 3KSJA 4GXSB 4TOZA 2HPGA 2XXKA 3KFMA 4F31B 1B1HA 3SEVA 4N6DA 1YAEA 1B51A 4GL8A 5AA4B 1IXIA 4XXUA 1USYH 1XVYA 4U4XA 5TP9B 1FPJA 5DVJA 1KZ8A 3KOSA 1Q1KA 4R2FA 1B46A 4NF5B 3ZKLA 5I2NB 1JEUA 3KGCA 5I59A 4GWWA 3Q25A 3A3UA 4LP2B 1NUWA 3C36A 3FVKA 3KN3A 3N26A 1T0KA 1MRPA 1B9JA 1G0HA 2QS4A 3C32A 1TFDA 2Z22A 3H7MA 3V83A 1AWBA 4X04A 4IO3A 2RCBA 4GLIA 2PMSA 1MDQA 1VSOA 2DE2A 5IZZA 1SI0A 1R9LA 2F6PA 2GQ1A 2Q8MA 3HFUA 4F29A 4JSDA 2WYKA 4DCXA 3U93A 5ICQA 2O1LA 1US5A 3ZKKA 3TMGA 3FZVA 2FHYA 4QFOA 5IZ1A 5FHMA 3LR1A 2O1MA 3IAZA 3W15C 4KFQA 5EQ7A 1BIYA 1EU8A 1FJ6A 1MS7A 1R9QA 5CMCA 4PP0A 2G93A 3T9HB 4YICA 2ZYMA 1LAXA 1DPPA 1LFIA 1SDXA 4OA4A 1SYHA 1LCFA 2VD2A 4GWOA 4QHQA 4PF8A 1FSAA 4NQ8A 3VVDA 5L9OA 3BFUA 1MQDA 4MEVA 4I40A 4LN5A 3FV2A 1FPEA 2HCAA 3CFXA 3RPLA 4IR8A 2XD3A 3N94A 4NF6B 2XXIA 4FATA 4R6KA 4NF8B 2YPNA 4AS4A 3FASA 2P3VA 2YLNA 3MUQA 1K9ZA 4F3BA 3ONMA 4G77A 5KCJB 4Q30B 4OVRA 2XXTA 2ZNUA 2R8TA 4HXVA 2HXRA 3H6UA 4PFYA 1D9YA 4N4UA 4ZECA 5F7VA 4UA8A 4N13A 2VHAA 4PFRA 1HSLA 3QK6A 3FXQA 1VFEA 3K0VA 4OZ9A 1Y4CA 2V4CA 4KPTA 3LSWA 4NE4A 3I5OA 4NF0A 5L8DA 1LBYA 3MW0A 4P1LA 1GGGA 1SD3A 1A55A 3RTWB 2GRVA 1B40A 1OMPA 3ROJA 3C34A 3FJ7A 3TCFA 1GV8A 4MBPA 5H8NA 1A54A 3H6TA 3DELB 4G8HA 3R26A 1GTKA 1AL3A 3A09A 2LAOA 4QBAA 1KA0A 4KCDA 4FORA 1QW0A 4ONYA 3V5AA 2XXPA 3R6UA 1PBPA 2I4CA 4PFIA 2RKMA 4EXKA 4QSEA 4MNCA 1Y4TA 1MY2A 4OESA 5FHNA 4FAJA 4JVDA 3O9PA 1EYJA 2GHBA 2QRYA 3T9XB 4PFUA 3W9VA 4JVCA 4HTGA 4P0GA 1PEBA 2VOZA 3TTKA 2QVUA 3O66A 1M5DA 3OSQA 4POXA 1FTAA 1UTHA 2DSFA 5L9MA 3PUVE 3RTFB 5FTIA 4H8IA 4IY6A 1D9VA 1ZJLA 1DMBA 5FTHA 1Y3QA 2Q2CA 3LC8A 2I4BA 5HM4B 1DBZA 3O6IA 4U22A 3H03A 1ATGA 1P1QA 2QPQA 4EF2A 4IGRA 4P56A 2D5WA 4N8YA 3OEKA 4X48A 3MZ9A 1QJMA 1S7YA 4WXJA 1FPKA 4P0IA 3ILUB 3DP4A 3KJ7A 3H3GA 4N8GA 4MNPA 2PFYA 2CMOA 3DLNA 4LA9A 3TTRA 4DI4B 1LBCA 4PDDA 4O3BA 3M3FA 4H8JA 2DQVA 3TZAA 1SQYA 1DSNA 1MY3A 5J1DA 5BUUA 3KBRA 2P0SA 2B3FA 3T96B 4F18A 2XWKA 1FW0A 3RYDA 4LZ7A 4F2OA 1HSEA 1TWYA 4LZ8A 5ISUA 1P1WA 2HHMA 2F78A 4GBVA 2HAVA 5EQ8A 2CZLA 2ONKE 3IO4A 4R6YA 3T9VA 3VFJA 1FJ9A 4R2BA 4YKIA 2CZKA 4X1BA 3LV0A 3DM0A 3MVYA 1L5TA 1B3GA 1B3FA 3S9EA 4PBHA 2PT2A 4AB6A 5LDZA 4ELQA 1FQEA 1VFDA 5J16A 3O28A 5ITOA 3B7DA 4RJZA 4QSCA 2OZZA 1FRPA 5H8HB 3HHGA 4O7MA 3V89B 1LB8A 1MG1A 4U4SA 5DVIA 1YXIA 4GL0A 1A7LA 1B52A 3PMXA 2A5TB 3KG2A 1QKBA 2G29A 2I0CA 3PPNA 2KQZA 4DXUA 3CVGA 1N04A 2FNCA 4PC9A 4EQ7A 4PE3A 3MWBA 4OFLA 5A5LA 2GFEA 3VVEA 1NV6A 4F19A 3SEYA 3MBPA 1IUDA 4ELRA 3PUXE 1DTGA 3IJXB 4TQUQ 1FCKA 3U94A 2XWVA 1PDAA 4YMBA 3FGSA 4KI0E 1FTOA 4BDNA 1INPA 1EH3A 3U92A 4IB2A 3S9NC 1MPCA
chains in the Genus database with same CATH topology
1B7UA 1MDP1 4EF1A 3PPRA 1UIVA 1MXVA 3D4CA 2F35A 5DVFA 4WEDA 3OOAA 3C33A 1MPBA 4R6HA 3EPEA 4H67A 3F11A 3LUYA 3L6GA 4Q5TA 3KEIA 4BDRA 2XXVA 1SW2A 3CSGA 5I2KA 3KZGA 1H3DA 2NUVA 3MP1A 1ZU0A 1DPEA 4G68B 3AXFA 3OENA 4DXCA 4IO2A 1B2HA 4LVQA 3TCGA 4I62A 4U1OA 1UIUA 3PD9A 4OTEA 3CG1A 3TQWA 1LFHA 4O3CA 4ELPA 4FEBA 4NF4A 1XS5A 3Q29A 1NNTA 2GH9A 3H6VA 4XKNA 3BFTA 4H1XA 1ZKBA 4IO5A 3ECRA 3IOUA 2Q88A 5IKBA 2XHDA 5DEXA 2DWIA 3I6VA 2ONRA 4L17A 4MLQA 4F39A 3ILTB 1LGBC 4XIGQ 2VP1A 4YZZA 2QMXA 2H25A 3IJOB 1ANFA 3S9LC 2UYFA 4MFIA 3JV9A 1JVYA 3MAMA 5AE4A 2W7YA 2HQ0A 1B5HA 3UORA 4PFWA 3O29A 5ICTA 4C1UA 1Y9UA 5I56A 4TLMB 3WAFA 1ELJA 3RT6B 1IXHA 3QUJA 2I0BA 2PX1A 2F6GA 3L6HA 1A8FA 3IORA 1LFGA 3RUMA 4DIGA 3JZJA 1LCTA 2XXYA 3K6VA 1M5EA 4MLVA 3U72A 4TLLB 2O6AA 1USYE 3TELA 1B5IA 4H0WA 3RY3A 2XX7A 4ND9A 1IXGA 4RK9A 4EQ9A 4F1VA 4FECA 3IO6A 5I58B 1Y3NA 1NNFA 1B7HA 1H44A 3IL1B 1N0TA 3N5LA 4OMBA 1AOVA 3MC2A 2O84X 3KOTA 2F8DA 3V8XB 3W9WA 2V3TA 3HO7A 5TPAB 1B6HA 3ZSFA 2PT1A 3IB1A 4X1DA 2OWTA 1JVXA 3TODA 3LSXA 1M5BA 5K2XA 2DXYA 2XXWA 3VE1B 1NMUA 1B0HA 3IK6B 3E13X 4OWDA 2UVJA 2DWHA 4F2QA 1SW4A 3G3FA 4C1TA 3IB0A 2O7UA 4F3SA 2RC9A 5AA2A 5JTYB 3CG3A 4ZE9A 3K1MA 3IOTA 2I3VA 3TUSA 4QFNA 1WVJA 2AYSA 4EDPA 4PETA 3EHSA 4HW8A 2REJA 3PPPA 4H65A 4HCWA 5HBCA 3KN7A 4P11A 2XX9A 3OEMA 5CMBA 3O97A 1S50A 1JETA 3IR1A 2GHAA 4ZEKA 1B0LA 1UTBA 4OHNA 2QJEA 2VD3A 1QUKA 3BKIB 4Q8RA 5H8QB 4EQBA 2ANJA 2X26A 1CE2A 5A5XB 3VXCA 5DTBA 1FTMA 5CBRA 3BBRA 1JEVA 1BTJA 2R6GE 3VV5A 3PMWA 4AB5A 3PPOA 3GXAA 3HV1A 2THIA 2O69A 2PYYA 4IGTA 4G8NA 2Y7KA 2YJPA 5ELVA 2B3BA 4U23A 3FUZA 5I59B 3IX1A 3D4GA 3HHFA 4KD5A 3CIJA 3KJTA 5EHMA 3PV0E 4DLDA 1N3WA 4JDFA 4ECFA 3CFLA 4NTLA 4EXLA 4GVOA 1YPNA 5TU0A 4JWXA 4K3FA 3B6WA 3CI8A 5I57A 4QSDA 1FTKA 3KN8A 4Z0IA 4UACA 3MVXA 3QIMA 1POTA 2ZXTA 4PFTA 4YKJA 1IZ1A 1J1NA 3VDFA 4IO6A 1MQIA 3CRBA 2ZNTA 3IOVA 4OFOA 2E0SA 1SVXB 3EN3A 2Z23A 5JEIA 5CM6A 3VLVA 1URSA 4IO4A 4ZEIA 4ISUA 1NH8A 4RPNA 3VXBA 3ODBA 1TXFA 2XD2A 4IO7A 1QKAA 4F22A 4DXBA 3TTLA 1LB9A 4G2ZA 5CI5A 2E1SA 5H8FA 1MXZA 1FQBA 1VR5A 1B32A 1YCJA 4Q0CA 4KQPA 2F36A 5K2YA 3FXUA 3HN0A 2OBGA 1S9TA 3MVZA 4GD5A 4JXIA 3G3JA 4PQJA 1AIVA 2Y7IA 4PE5B 1IEJA 4F3PA 2V84A 2Y7WA 1Y1MA 4R9FA 5ITPA 2H99A 4OXVA 4GFRA 2I49A 3G3GA 3K00A 3PUWE 3TQLA 3G3HA 2H98A 3PU5A 3EQ1A 3PD8A 3TKDA 3K1NA 2ZNSA 2ZYOA 5AA4A 1JNFA 3MQ9A 2QSXA 3PUYE 2HFBA 1URDA 5TP9A 2XXRA 1NNKA 1DTZA 3TAJA 3FJGA 4H5FA 4NF5A 3T93B 3N6TA 2QS2A 3FD3A 4C0RA 2ABHA 5I2NA 1A40A 3FXRA 5H8NB 1NKXA 2ALUA 2I58A 2F34A 2DE3A 1B3HA 3JYRA 3K02A 1B05A 2DOJA 2O51A 4XKQA 2V93A 3TTMA 2OK2A 4F1UA 3EHTA 3Q26A 3SEUA 1H45A 1JW1A 1MXYA 3Q27A 4O3AA 5BWJA 2UXAA 4H6DA 1MH4A 2Q9TA 3C31A 1GR2A 3B6TA 1MXXA 3DP8A 1WDNA 1Q35A 2R9JA 3U1OA 3OMBA 3OO9A 1OLAA 1FQAA 2F7AA 1UTHB 4U1ZA 1R1NA 1XOCA 3H4ZA 4OETA 2UYEA 4YKPA 3PMVA 3O2AA 4R75A 3TFLA 1OVTA 1B4HA 2NVUB 4FJPA 1I6AA 2ZYNA 3OD7A 4HCYA 4DCYA 1O63A 2Q89A 2ONSA 3H6WA 1MH3A 4XTCQ 3TDJA 2O68A 3RNNA 4R74A 5HPQA 4H5GA 1XVXA 4NF6A 4IY5A 1N76A 3FIRA 3MP6A 1QVSA 1H43A 4NF8A 2DE4A 3PGFA 3K6UA 4KYDA 2RC8A 3E3KA 1XT8A 5KCJA 5KZTA 2NWJA 2F7BA 5CMMA 2UVGA 3CFZA 4WEPA 1II5A 5L9SA 2F5XA 1I6QA 5CMKA 1MY4A 3C4MA 3TPAA 3T66A 3RLFE 3G7WA 2ZYKA 4OQOA 1ZBMA 4E0WA 5B7DA 3GLBA 3HSTA 4RYAA 3MP8A 1RYXA 3Q28A 3TTNA 1B4ZA 3LBSA 4JBZA 1MPDA 2DWJA 4LUBA 3K2DA 4EUOA 3QXMA 2D3IA 4E0XA 3UIFA 4GXAA 4LATA 1PB7A 1OIBA 3B6QA 3KSXA 2P1SA 4G4PA 1P1UA 3PPQA 4BLAA 3OXNA 1MQHA 1Y1ZA 1MQJA 1AMFA 2Z8EA 4NMYA 1ZLQA 3FVOA 2R71A 1MY1A 5CBSA 2DP8A 2REGA 1B5JA 1N84A 4FEDA 3GZGA 4KYSA 1FTJA 1NL5A 1EZOA 1ZTYA 3SETA 4XKPA 3K1PA 3MJNA 2XXXA 5B70A 4YU0A 4QRZA 3A3CA 2H4IA 3E4RA 2Y7RA 5IAIA 4OVJA 1Y20A 3S2VA 4M1VA 3S4UA 2Y7PA 3T22A 1VE4A 2RF1A 3EF7A 3P7IA 1FQDA 1SBPA 3TEPA 3RT8A 1OQGA 2RINA 4ESXA 2QS3A 4R72A 3IB2A 4JB7A 1B7ZA 2V3UA 3RN8A 4NWCA 2DWAA 3RPWA 3M3LA 1SI1A 1AH5A 2RCAA 4ZDMA 1JW4A 2Y84A 2XXQA 1A8EA 5I2KB 3HPIA 1PC3A 1H76A 2NXOA 2AL5A 2FYIA 3MZ1A 4DDDA 4OFJA 4I8CA 4GQOA 4KHZE 2I3WA 3UN6A 5F1QA 1PB8A 4YB6A 4GOTA 4NF4B 2DXRA 4MF3A 1B58A 1LAHE 4RNSA 1QULA 2QMWA 1P99A 3SEWA 1Z7ME 1XHYA 2X7PA 3FVNA 3LSFB 3M8UA 1MM6A 3PUZE 4F1YA 4U21A 4YMAA 1FQCA 2ESNA 3UP9A 4JSOA 3UK4A 5DEXB 1O64A 4BDMA 4KCCA 2OWSA 3VVFA 1N7WA 3UGWA 1RKMA 5AA1A 3OSRA 3DP6A 5AA3A 3TYHA 3FATA 1UQWA 5I84A 4BDOA 5H8HA 2HZLA 4JWYA 2IEEA 3MPKA 3G3IA 2AIXA 3UA8A 2A5TA 1M5FA 3RGYA 2F97A 5I56B 1PBQA 2FA7A 2QS1A 1SYIA 1JW5A 5KDTA 4R73A 3HCQA 2Q8JA 2OLBA 3OO6A 1LSTA 2Z8FA 1NNPA 1A99A 4X9TA 3R7XA 5M2VA 4AQ4A 2DVCA 3THIA 1IIWA 4FE8A 2PVUA 2RC7A 4ELOA 2DS9A 2IA4A 1YTVA 4OENA 3K6WA 1OVBA 1JQFA 1ZIUA 4OEUA 5JK4A 4YB5A 4I9DA 4POWA 3CSBA 1FTLA 3OELA 4BDQA 3I3VA 4GF8A 1I6BA 1MXUA 4DE8A 3K01A 4ZZEA 4ZEBA 4G68A 3QAXA 3K4UA 4NEDA 3M3KA 1MY0A 5DT6A 3C35A 2PBWA 3EHUA 4ZS9A 4YKKA 2HAUA 2DVZA 4FIMA 1LAFE 2QL3A 1PB9A 4KYEA 1P1OA 2I48A 5AA2B 2Z8DA 1ZMGA 2DYXA 3LSLA 4LQ5A 3H06B 4F3GA 2X7QA 4N07A 2BJJX 2NOOA 2Q2AA 4N6PA 4ZE8A 5EHSA 1F9BA 5EYFA 3FVGA 1FQFA 3O6GA 1LBBA 1GVCA 4QFKA 3GBAA 3T9UA 1SW5A 1Z7NE 4HS7A 1O7TA 3SEXA 1IQ7A 1D3KA 2M8CA 2KLFA 3FJMA 1UTBB 3IOWA 1IXCA 1RYOA 4G68C 4RY1A 1OLCA 1N7XA 2UVHA 3MPLA 3N6UA 1QUIA 4LONB 1XC1A 3TCHA 3GBBA 4OYVA 1TT1A 1LAGE 1M5CA 3S9MC 3RQTA 4ZEDA 3MVWA 2D21A 4BDLA 2XXUA 3K6XA 2HZKA 5CC2A 3QUFA 4RPOA 4RXLA 3O6HA 4Z7EA 1TFAA 3G3KA 4LZ5A 4GRKA 1BKAA 1WODA 4M4GA 5AA2D 2OJTA 2XXHA 4OEVA 5CRYA 1B3LA 3CR9A 2V25A 1QUJA 5KDTB 4THIA 4YB7A 4KR5A 5I58A 1KWHA 5H8SA 2HEUA 2V3QA 3USDA 1MQGA 4XKRA 2OCUA 4U2RA 2ZMBA 4NWDA 2XX8A 1SW1A 4G8MA 1Y3PA 5TPAA 1CB6A 2WKYA 3E9XA 1POY1 1R6ZA 5I57B 4QF9A 3OO8A 1I69A 1DOTA 2H9BA 1B3EA 2F7CA 3SESA 1P1NA 1OQHA 4RA1A 3QYTA 5DYHA 5LOMA 5FHOA 1IITA 3SDFA 1EZPA 2P2AA 2AL4A 2HXWA 4QFLA 3U8QA 4JWOA 5JTYA 3FV1A 4MH5A 1NH7A 4YAHX 1LLSA 2UVIA 1BP5A 2O7IA 3WAEA 4OERA 4WKMA 1MM7A 1N3XA 3OO7A 5H8FB 4DZ1A 4ESWA 2B65A 1MXWA 2VGQA 4ZZAA 1EZ9A 4LQ2A 2I6EA 1BLFA 4QFPA 3C9HA 3QSLA 3SKPA 1B1XA 5H8QA 4RK2A 4I1DA 4ZEFA 1US4A 1NFTA 3ZS6A 1HSJA 5A5XA 1D4NA 2A5SA 4R9GA 3VLUA 1URGA 3SERA 3MZBA 4GIZA 2H5YA 3VLWA 3KSJA 4GXSB 4TOZA 3KFMA 4F31B 1B1HA 3SEVA 1YAEA 1B51A 4GL8A 5AA4B 1IXIA 4XXUA 1USYH 1XVYA 4U4XA 5TP9B 5DVJA 3KOSA 1Q1KA 4R2FA 1B46A 4NF5B 3ZKLA 5I2NB 1JEUA 3KGCA 5I59A 3Q25A 3A3UA 4LP2B 3C36A 3N26A 3FVKA 3KN3A 1T0KA 1MRPA 1B9JA 2QS4A 3C32A 1TFDA 2Z22A 3H7MA 3V83A 4IO3A 2RCBA 4GLIA 2PMSA 1MDQA 1VSOA 2DE2A 1SI0A 1R9LA 2F6PA 4F29A 4JSDA 4DCXA 3U93A 5ICQA 2O1LA 1US5A 3ZKKA 3TMGA 3FZVA 4QFOA 5FHMA 3LR1A 2O1MA 3IAZA 3W15C 4KFQA 1BIYA 1EU8A 1MS7A 1R9QA 5CMCA 4PP0A 2G93A 3T9HB 4YICA 2ZYMA 1LAXA 1DPPA 1LFIA 1SDXA 1SYHA 1LCFA 2VD2A 4GWOA 4QHQA 3VVDA 5L9OA 3BFUA 1MQDA 3FV2A 2HCAA 3CFXA 2XD3A 3N94A 4NF6B 2XXIA 4FATA 4R6KA 4NF8B 2YPNA 3FASA 2YLNA 3MUQA 4F3BA 3ONMA 4G77A 5KCJB 4Q30B 2XXTA 2ZNUA 3H6UA 4PFYA 1D9YA 4ZECA 5F7VA 4UA8A 4N13A 2VHAA 1HSLA 3QK6A 3FXQA 1VFEA 3K0VA 4OZ9A 1Y4CA 4KPTA 3LSWA 4NE4A 3I5OA 5L8DA 3MW0A 1GGGA 1A55A 1SD3A 3RTWB 2GRVA 1B40A 1OMPA 3C34A 3FJ7A 3TCFA 1GV8A 4MBPA 5H8NA 1A54A 3H6TA 3DELB 4G8HA 3R26A 1GTKA 1AL3A 3A09A 2LAOA 4KCDA 4FORA 1QW0A 4ONYA 3V5AA 2XXPA 3R6UA 1PBPA 2I4CA 2RKMA 4EXKA 4QSEA 1Y4TA 1MY2A 4OESA 5FHNA 4FAJA 3O9PA 2GHBA 2QRYA 3T9XB 4PFUA 3W9VA 4HTGA 4P0GA 1PEBA 2VOZA 3TTKA 3O66A 1M5DA 3OSQA 4POXA 1UTHA 2DSFA 5L9MA 3PUVE 3RTFB 5FTIA 4H8IA 4IY6A 1D9VA 1ZJLA 1DMBA 5FTHA 1Y3QA 2Q2CA 3LC8A 2I4BA 5HM4B 3O6IA 4U22A 3H03A 1ATGA 1P1QA 2QPQA 4EF2A 4IGRA 2D5WA 3OEKA 4X48A 3MZ9A 1QJMA 1S7YA 4WXJA 4P0IA 3ILUB 3DP4A 3KJ7A 3H3GA 2CMOA 3DLNA 4LA9A 3TTRA 1LBCA 4O3BA 3M3FA 4H8JA 2DQVA 3TZAA 1SQYA 1DSNA 1MY3A 5J1DA 5BUUA 3KBRA 2P0SA 2B3FA 3T96B 4F18A 1FW0A 4LZ7A 4F2OA 1HSEA 1TWYA 4LZ8A 5ISUA 1P1WA 2F78A 2HAVA 2CZLA 2ONKE 3IO4A 4R6YA 3T9VA 3VFJA 4R2BA 4YKIA 4X1BA 3DM0A 3MVYA 1L5TA 1B3GA 1B3FA 3S9EA 2PT2A 4AB6A 4ELQA 1FQEA 1VFDA 3O28A 5ITOA 3B7DA 4RJZA 4QSCA 2OZZA 5H8HB 3HHGA 3V89B 1LB8A 1MG1A 4U4SA 5DVIA 4GL0A 1A7LA 1B52A 3PMXA 2A5TB 3KG2A 1QKBA 2G29A 2I0CA 3PPNA 4DXUA 3CVGA 1N04A 2FNCA 4EQ7A 3MWBA 4OFLA 2GFEA 3VVEA 4F19A 3SEYA 3MBPA 1IUDA 4ELRA 3PUXE 1DTGA 3IJXB 4TQUQ 1FCKA 3U94A 1PDAA 4YMBA 3FGSA 4KI0E 1FTOA 4BDNA 1EH3A 3U92A 4IB2A 3S9NC 1MPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7U A;  1MDP 1;  4EF1 A;  3PPR A;  1UIV A;  1MXV A;  3D4C A;  2F35 A;  5DVF A;  4WED A;  3OOA A;  3C33 A;  1MPB A;  4R6H A;  3EPE A;  4H67 A;  3F11 A;  3LUY A;  3L6G A;  4Q5T A;  3KEI A;  4BDR A;  2XXV A;  1SW2 A;  3CSG A;  5I2K A;  3KZG A;  1H3D A;  2NUV A;  3MP1 A;  1ZU0 A;  1DPE A;  4G68 B;  3AXF A;  3OEN A;  4DXC A;  4IO2 A;  1B2H A;  4LVQ A;  3TCG A;  4I62 A;  4U1O A;  1UIU A;  3PD9 A;  4OTE A;  3CG1 A;  3TQW A;  1LFH A;  4O3C A;  4ELP A;  4FEB A;  4NF4 A;  1XS5 A;  3Q29 A;  1NNT A;  2GH9 A;  3H6V A;  4XKN A;  3BFT A;  4H1X A;  1ZKB A;  4IO5 A;  3ECR A;  3IOU A;  2Q88 A;  5IKB A;  2XHD A;  5DEX A;  2DWI A;  3I6V A;  2ONR A;  4L17 A;  4MLQ A;  4F39 A;  3ILT B;  1LGB C;  4XIG Q;  2VP1 A;  4YZZ A;  2QMX A;  2H25 A;  3IJO B;  1ANF A;  3S9L C;  2UYF A;  4MFI A;  3JV9 A;  1JVY A;  3MAM A;  5AE4 A;  2W7Y A;  2HQ0 A;  1B5H A;  3UOR A;  4PFW A;  3O29 A;  5ICT A;  4C1U A;  1Y9U A;  5I56 A;  4TLM B;  3WAF A;  1ELJ A;  3RT6 B;  1IXH A;  3QUJ A;  2I0B A;  2PX1 A;  2F6G A;  3L6H A;  1A8F A;  3IOR A;  1LFG A;  3RUM A;  4DIG A;  3JZJ A;  1LCT A;  2XXY A;  3K6V A;  1M5E A;  4MLV A;  3U72 A;  4TLL B;  2O6A A;  1USY E;  3TEL A;  1B5I A;  4H0W A;  3RY3 A;  2XX7 A;  4ND9 A;  1IXG A;  4RK9 A;  4EQ9 A;  4F1V A;  4FEC A;  3IO6 A;  5I58 B;  1Y3N A;  1NNF A;  1B7H A;  1H44 A;  3IL1 B;  1N0T A;  3N5L A;  4OMB A;  1AOV A;  3MC2 A;  2O84 X;  3KOT A;  2F8D A;  3V8X B;  3W9W A;  2V3T A;  3HO7 A;  5TPA B;  1B6H A;  3ZSF A;  2PT1 A;  3IB1 A;  4X1D A;  2OWT A;  1JVX A;  3TOD A;  3LSX A;  1M5B A;  5K2X A;  2DXY A;  2XXW A;  3VE1 B;  1NMU A;  1B0H A;  3IK6 B;  3E13 X;  4OWD A;  2UVJ A;  2DWH A;  4F2Q A;  1SW4 A;  3G3F A;  4C1T A;  3IB0 A;  2O7U A;  4F3S A;  2RC9 A;  5AA2 A;  5JTY B;  3CG3 A;  4ZE9 A;  3K1M A;  3IOT A;  2I3V A;  3TUS A;  4QFN A;  1WVJ A;  2AYS A;  4EDP A;  4PET A;  3EHS A;  4HW8 A;  2REJ A;  3PPP A;  4H65 A;  4HCW A;  5HBC A;  3KN7 A;  4P11 A;  2XX9 A;  3OEM A;  5CMB A;  3O97 A;  1S50 A;  1JET A;  3IR1 A;  2GHA A;  4ZEK A;  1B0L A;  1UTB A;  4OHN A;  2QJE A;  2VD3 A;  1QUK A;  3BKI B;  4Q8R A;  5H8Q B;  4EQB A;  2ANJ A;  2X26 A;  1CE2 A;  5A5X B;  3VXC A;  5DTB A;  1FTM A;  5CBR A;  3BBR A;  1JEV A;  1BTJ A;  2R6G E;  3VV5 A;  3PMW A;  4AB5 A;  3PPO A;  3GXA A;  3HV1 A;  2THI A;  2O69 A;  2PYY A;  4IGT A;  4G8N A;  2Y7K A;  2YJP A;  5ELV A;  2B3B A;  4U23 A;  3FUZ A;  5I59 B;  3IX1 A;  3D4G A;  3HHF A;  4KD5 A;  3CIJ A;  3KJT A;  5EHM A;  3PV0 E;  4DLD A;  1N3W A;  4JDF A;  4ECF A;  3CFL A;  4NTL A;  4EXL A;  4GVO A;  1YPN A;  5TU0 A;  4JWX A;  4K3F A;  3B6W A;  3CI8 A;  5I57 A;  4QSD A;  1FTK A;  3KN8 A;  4Z0I A;  4UAC A;  3MVX A;  3QIM A;  1POT A;  2ZXT A;  4PFT A;  4YKJ A;  1IZ1 A;  1J1N A;  3VDF A;  4IO6 A;  1MQI A;  3CRB A;  2ZNT A;  3IOV A;  4OFO A;  2E0S A;  1SVX B;  3EN3 A;  2Z23 A;  5JEI A;  5CM6 A;  3VLV A;  1URS A;  4IO4 A;  4ZEI A;  4ISU A;  1NH8 A;  4RPN A;  3VXB A;  3ODB A;  1TXF A;  2XD2 A;  4IO7 A;  1QKA A;  4F22 A;  4DXB A;  3TTL A;  1LB9 A;  4G2Z A;  5CI5 A;  2E1S A;  5H8F A;  1MXZ A;  1FQB A;  1VR5 A;  1B32 A;  1YCJ A;  4Q0C A;  4KQP A;  2F36 A;  5K2Y A;  3FXU A;  3HN0 A;  2OBG A;  1S9T A;  3MVZ A;  4GD5 A;  4JXI A;  3G3J A;  4PQJ A;  1AIV A;  2Y7I A;  4PE5 B;  1IEJ A;  4F3P A;  2V84 A;  2Y7W A;  1Y1M A;  4R9F A;  5ITP A;  2H99 A;  4OXV A;  4GFR A;  2I49 A;  3G3G A;  3K00 A;  3PUW E;  3TQL A;  3G3H A;  2H98 A;  3PU5 A;  3EQ1 A;  3PD8 A;  3TKD A;  3K1N A;  2ZNS A;  2ZYO A;  5AA4 A;  1JNF A;  3MQ9 A;  2QSX A;  3PUY E;  2HFB A;  1URD A;  5TP9 A;  2XXR A;  1NNK A;  1DTZ A;  3TAJ A;  3FJG A;  4H5F A;  4NF5 A;  3T93 B;  3N6T A;  2QS2 A;  3FD3 A;  4C0R A;  2ABH A;  5I2N A;  1A40 A;  3FXR A;  5H8N B;  1NKX A;  2ALU A;  2I58 A;  2F34 A;  2DE3 A;  1B3H A;  3JYR A;  3K02 A;  1B05 A;  2DOJ A;  2O51 A;  4XKQ A;  2V93 A;  3TTM A;  2OK2 A;  4F1U A;  3EHT A;  3Q26 A;  3SEU A;  1H45 A;  1JW1 A;  1MXY A;  3Q27 A;  4O3A A;  5BWJ A;  2UXA A;  4H6D A;  1MH4 A;  2Q9T A;  3C31 A;  1GR2 A;  3B6T A;  1MXX A;  3DP8 A;  1WDN A;  1Q35 A;  2R9J A;  3U1O A;  3OMB A;  3OO9 A;  1OLA A;  1FQA A;  2F7A A;  1UTH B;  4U1Z A;  1R1N A;  1XOC A;  3H4Z A;  4OET A;  2UYE A;  4YKP A;  3PMV A;  3O2A A;  4R75 A;  3TFL A;  1OVT A;  1B4H A;  2NVU B;  4FJP A;  1I6A A;  2ZYN A;  3OD7 A;  4HCY A;  4DCY A;  1O63 A;  2Q89 A;  2ONS A;  3H6W A;  1MH3 A;  4XTC Q;  3TDJ A;  2O68 A;  3RNN A;  4R74 A;  5HPQ A;  4H5G A;  1XVX A;  4NF6 A;  4IY5 A;  1N76 A;  3FIR A;  3MP6 A;  1QVS A;  1H43 A;  4NF8 A;  2DE4 A;  3PGF A;  3K6U A;  4KYD A;  2RC8 A;  3E3K A;  1XT8 A;  5KCJ A;  5KZT A;  2NWJ A;  2F7B A;  5CMM A;  2UVG A;  3CFZ A;  4WEP A;  1II5 A;  5L9S A;  2F5X A;  1I6Q A;  5CMK A;  1MY4 A;  3C4M A;  3TPA A;  3T66 A;  3RLF E;  3G7W A;  2ZYK A;  4OQO A;  1ZBM A;  4E0W A;  5B7D A;  3GLB A;  3HST A;  4RYA A;  3MP8 A;  1RYX A;  3Q28 A;  3TTN A;  1B4Z A;  3LBS A;  4JBZ A;  1MPD A;  2DWJ A;  4LUB A;  3K2D A;  4EUO A;  3QXM A;  2D3I A;  4E0X A;  3UIF A;  4GXA A;  4LAT A;  1PB7 A;  1OIB A;  3B6Q A;  3KSX A;  2P1S A;  4G4P A;  1P1U A;  3PPQ A;  4BLA A;  3OXN A;  1MQH A;  1Y1Z A;  1MQJ A;  1AMF A;  2Z8E A;  4NMY A;  1ZLQ A;  3FVO A;  2R71 A;  1MY1 A;  5CBS A;  2DP8 A;  2REG A;  1B5J A;  1N84 A;  4FED A;  3GZG A;  4KYS A;  1FTJ A;  1NL5 A;  1EZO A;  1ZTY A;  3SET A;  4XKP A;  3K1P A;  3MJN A;  2XXX A;  5B70 A;  4YU0 A;  4QRZ A;  3A3C A;  2H4I A;  3E4R A;  2Y7R A;  5IAI A;  4OVJ A;  1Y20 A;  3S2V A;  4M1V A;  3S4U A;  2Y7P A;  3T22 A;  1VE4 A;  2RF1 A;  3EF7 A;  3P7I A;  1FQD A;  1SBP A;  3TEP A;  3RT8 A;  1OQG A;  2RIN A;  4ESX A;  2QS3 A;  4R72 A;  3IB2 A;  4JB7 A;  1B7Z A;  2V3U A;  3RN8 A;  4NWC A;  2DWA A;  3RPW A;  3M3L A;  1SI1 A;  1AH5 A;  2RCA A;  4ZDM A;  1JW4 A;  2Y84 A;  2XXQ A;  1A8E A;  5I2K B;  3HPI A;  1PC3 A;  1H76 A;  2NXO A;  2AL5 A;  2FYI A;  3MZ1 A;  4DDD A;  4OFJ A;  4I8C A;  4GQO A;  4KHZ E;  2I3W A;  3UN6 A;  5F1Q A;  1PB8 A;  4YB6 A;  4GOT A;  4NF4 B;  2DXR A;  4MF3 A;  1B58 A;  1LAH E;  4RNS A;  1QUL A;  2QMW A;  1P99 A;  3SEW A;  1Z7M E;  1XHY A;  2X7P A;  3FVN A;  3LSF B;  3M8U A;  1MM6 A;  3PUZ E;  4F1Y A;  4U21 A;  4YMA A;  1FQC A;  2ESN A;  3UP9 A;  4JSO A;  3UK4 A;  5DEX B;  1O64 A;  4BDM A;  4KCC A;  2OWS A;  3VVF A;  1N7W A;  3UGW A;  1RKM A;  5AA1 A;  3OSR A;  3DP6 A;  5AA3 A;  3TYH A;  3FAT A;  1UQW A;  5I84 A;  4BDO A;  5H8H A;  2HZL A;  4JWY A;  2IEE A;  3MPK A;  3G3I A;  2AIX A;  3UA8 A;  2A5T A;  1M5F A;  3RGY A;  2F97 A;  5I56 B;  1PBQ A;  2FA7 A;  2QS1 A;  1SYI A;  1JW5 A;  5KDT A;  4R73 A;  3HCQ A;  2Q8J A;  2OLB A;  3OO6 A;  1LST A;  2Z8F A;  1NNP A;  1A99 A;  4X9T A;  3R7X A;  5M2V A;  4AQ4 A;  2DVC A;  3THI A;  1IIW A;  4FE8 A;  2PVU A;  2RC7 A;  4ELO A;  2DS9 A;  2IA4 A;  1YTV A;  4OEN A;  3K6W A;  1OVB A;  1JQF A;  1ZIU A;  4OEU A;  5JK4 A;  4YB5 A;  4I9D A;  4POW A;  3CSB A;  1FTL A;  3OEL A;  4BDQ A;  3I3V A;  4GF8 A;  1I6B A;  1MXU A;  4DE8 A;  3K01 A;  4ZZE A;  4ZEB A;  4G68 A;  3QAX A;  3K4U A;  4NED A;  3M3K A;  1MY0 A;  5DT6 A;  3C35 A;  2PBW A;  3EHU A;  4ZS9 A;  4YKK A;  2HAU A;  2DVZ A;  4FIM A;  1LAF E;  2QL3 A;  1PB9 A;  4KYE A;  1P1O A;  2I48 A;  5AA2 B;  2Z8D A;  1ZMG A;  2DYX A;  3LSL A;  4LQ5 A;  3H06 B;  4F3G A;  2X7Q A;  4N07 A;  2BJJ X;  2NOO A;  2Q2A A;  4N6P A;  4ZE8 A;  5EHS A;  1F9B A;  5EYF A;  3FVG A;  1FQF A;  3O6G A;  1LBB A;  1GVC A;  4QFK A;  3GBA A;  3T9U A;  1SW5 A;  1Z7N E;  4HS7 A;  1O7T A;  3SEX A;  1IQ7 A;  1D3K A;  2M8C A;  2KLF A;  3FJM A;  1UTB B;  3IOW A;  1IXC A;  1RYO A;  4G68 C;  4RY1 A;  1OLC A;  1N7X A;  2UVH A;  3MPL A;  3N6U A;  1QUI A;  4LON B;  1XC1 A;  3TCH A;  3GBB A;  4OYV A;  1TT1 A;  1LAG E;  1M5C A;  3S9M C;  3RQT A;  4ZED A;  3MVW A;  2D21 A;  4BDL A;  2XXU A;  3K6X A;  2HZK A;  5CC2 A;  3QUF A;  4RPO A;  4RXL A;  3O6H A;  4Z7E A;  1TFA A;  3G3K A;  4LZ5 A;  4GRK A;  1BKA A;  1WOD A;  4M4G A;  5AA2 D;  2OJT A;  2XXH A;  4OEV A;  5CRY A;  1B3L A;  3CR9 A;  2V25 A;  1QUJ A;  5KDT B;  4THI A;  4YB7 A;  4KR5 A;  5I58 A;  1KWH A;  5H8S A;  2HEU A;  2V3Q A;  3USD A;  1MQG A;  4XKR A;  2OCU A;  4U2R A;  2ZMB A;  4NWD A;  2XX8 A;  1SW1 A;  4G8M A;  1Y3P A;  5TPA A;  1CB6 A;  2WKY A;  3E9X A;  1POY 1;  1R6Z A;  5I57 B;  4QF9 A;  3OO8 A;  1I69 A;  1DOT A;  2H9B A;  1B3E A;  2F7C A;  3SES A;  1P1N A;  1OQH A;  4RA1 A;  3QYT A;  5DYH A;  5LOM A;  5FHO A;  1IIT A;  3SDF A;  1EZP A;  2P2A A;  2AL4 A;  2HXW A;  4QFL A;  3U8Q A;  4JWO A;  5JTY A;  3FV1 A;  4MH5 A;  1NH7 A;  4YAH X;  1LLS A;  2UVI A;  1BP5 A;  2O7I A;  3WAE A;  4OER A;  4WKM A;  1MM7 A;  1N3X A;  3OO7 A;  5H8F B;  4DZ1 A;  4ESW A;  2B65 A;  1MXW A;  2VGQ A;  4ZZA A;  1EZ9 A;  4LQ2 A;  2I6E A;  1BLF A;  4QFP A;  3C9H A;  3QSL A;  3SKP A;  1B1X A;  5H8Q A;  4RK2 A;  4I1D A;  4ZEF A;  1US4 A;  1NFT A;  3ZS6 A;  1HSJ A;  5A5X A;  1D4N A;  2A5S A;  4R9G A;  3VLU A;  1URG A;  3SER A;  3MZB A;  4GIZ A;  2H5Y A;  3VLW A;  3KSJ A;  4GXS B;  4TOZ A;  3KFM A;  4F31 B;  1B1H A;  3SEV A;  1YAE A;  1B51 A;  4GL8 A;  5AA4 B;  1IXI A;  4XXU A;  1USY H;  1XVY A;  4U4X A;  5TP9 B;  5DVJ A;  3KOS A;  1Q1K A;  4R2F A;  1B46 A;  4NF5 B;  3ZKL A;  5I2N B;  1JEU A;  3KGC A;  5I59 A;  3Q25 A;  3A3U A;  4LP2 B;  3C36 A;  3N26 A;  3FVK A;  3KN3 A;  1T0K A;  1MRP A;  1B9J A;  2QS4 A;  3C32 A;  1TFD A;  2Z22 A;  3H7M A;  3V83 A;  4IO3 A;  2RCB A;  4GLI A;  2PMS A;  1MDQ A;  1VSO A;  2DE2 A;  1SI0 A;  1R9L A;  2F6P A;  4F29 A;  4JSD A;  4DCX A;  3U93 A;  5ICQ A;  2O1L A;  1US5 A;  3ZKK A;  3TMG A;  3FZV A;  4QFO A;  5FHM A;  3LR1 A;  2O1M A;  3IAZ A;  3W15 C;  4KFQ A;  1BIY A;  1EU8 A;  1MS7 A;  1R9Q A;  5CMC A;  4PP0 A;  2G93 A;  3T9H B;  4YIC A;  2ZYM A;  1LAX A;  1DPP A;  1LFI A;  1SDX A;  1SYH A;  1LCF A;  2VD2 A;  4GWO A;  4QHQ A;  3VVD A;  5L9O A;  3BFU A;  1MQD A;  3FV2 A;  2HCA A;  3CFX A;  2XD3 A;  3N94 A;  4NF6 B;  2XXI A;  4FAT A;  4R6K A;  4NF8 B;  2YPN A;  3FAS A;  2YLN A;  3MUQ A;  4F3B A;  3ONM A;  4G77 A;  5KCJ B;  4Q30 B;  2XXT A;  2ZNU A;  3H6U A;  4PFY A;  1D9Y A;  4ZEC A;  5F7V A;  4UA8 A;  4N13 A;  2VHA A;  1HSL A;  3QK6 A;  3FXQ A;  1VFE A;  3K0V A;  4OZ9 A;  1Y4C A;  4KPT A;  3LSW A;  4NE4 A;  3I5O A;  5L8D A;  3MW0 A;  1GGG A;  1A55 A;  1SD3 A;  3RTW B;  2GRV A;  1B40 A;  1OMP A;  3C34 A;  3FJ7 A;  3TCF A;  1GV8 A;  4MBP A;  5H8N A;  1A54 A;  3H6T A;  3DEL B;  4G8H A;  3R26 A;  1GTK A;  1AL3 A;  3A09 A;  2LAO A;  4KCD A;  4FOR A;  1QW0 A;  4ONY A;  3V5A A;  2XXP A;  3R6U A;  1PBP A;  2I4C A;  2RKM A;  4EXK A;  4QSE A;  1Y4T A;  1MY2 A;  4OES A;  5FHN A;  4FAJ A;  3O9P A;  2GHB A;  2QRY A;  3T9X B;  4PFU A;  3W9V A;  4HTG A;  4P0G A;  1PEB A;  2VOZ A;  3TTK A;  3O66 A;  1M5D A;  3OSQ A;  4POX A;  1UTH A;  2DSF A;  5L9M A;  3PUV E;  3RTF B;  5FTI A;  4H8I A;  4IY6 A;  1D9V A;  1ZJL A;  1DMB A;  5FTH A;  1Y3Q A;  2Q2C A;  3LC8 A;  2I4B A;  5HM4 B;  3O6I A;  4U22 A;  3H03 A;  1ATG A;  1P1Q A;  2QPQ A;  4EF2 A;  4IGR A;  2D5W A;  3OEK A;  4X48 A;  3MZ9 A;  1QJM A;  1S7Y A;  4WXJ A;  4P0I A;  3ILU B;  3DP4 A;  3KJ7 A;  3H3G A;  2CMO A;  3DLN A;  4LA9 A;  3TTR A;  1LBC A;  4O3B A;  3M3F A;  4H8J A;  2DQV A;  3TZA A;  1SQY A;  1DSN A;  1MY3 A;  5J1D A;  5BUU A;  3KBR A;  2P0S A;  2B3F A;  3T96 B;  4F18 A;  1FW0 A;  4LZ7 A;  4F2O A;  1HSE A;  1TWY A;  4LZ8 A;  5ISU A;  1P1W A;  2F78 A;  2HAV A;  2CZL A;  2ONK E;  3IO4 A;  4R6Y A;  3T9V A;  3VFJ A;  4R2B A;  4YKI A;  4X1B A;  3DM0 A;  3MVY A;  1L5T A;  1B3G A;  1B3F A;  3S9E A;  2PT2 A;  4AB6 A;  4ELQ A;  1FQE A;  1VFD A;  3O28 A;  5ITO A;  3B7D A;  4RJZ A;  4QSC A;  2OZZ A;  5H8H B;  3HHG A;  3V89 B;  1LB8 A;  1MG1 A;  4U4S A;  5DVI A;  4GL0 A;  1A7L A;  1B52 A;  3PMX A;  2A5T B;  3KG2 A;  1QKB A;  2G29 A;  2I0C A;  3PPN A;  4DXU A;  3CVG A;  1N04 A;  2FNC A;  4EQ7 A;  3MWB A;  4OFL A;  2GFE A;  3VVE A;  4F19 A;  3SEY A;  3MBP A;  1IUD A;  4ELR A;  3PUX E;  1DTG A;  3IJX B;  4TQU Q;  1FCK A;  3U94 A;  1PDA A;  4YMB A;  3FGS A;  4KI0 E;  1FTO A;  4BDN A;  1EH3 A;  3U92 A;  4IB2 A;  3S9N C;  1MPC A; 
#chains in the Genus database with same CATH topology
 1B7U A;  1MDP 1;  1IMF A;  4EF1 A;  4OVP A;  3PPR A;  1UIV A;  1MXV A;  3D4C A;  2F35 A;  5DVF A;  4WED A;  3OOA A;  3C33 A;  1MPB A;  4R6H A;  3EPE A;  4H67 A;  4MMP A;  3F11 A;  3LUY A;  4NX1 A;  3L6G A;  4Q5T A;  3KEI A;  4BDR A;  2XXV A;  1SW2 A;  3CSG A;  5ET7 A;  3KZG A;  5I2K A;  1H3D A;  2NUV A;  3MP1 A;  1ZU0 A;  1DPE A;  4G68 B;  3AXF A;  3OEN A;  4DXC A;  1NUY A;  4IO2 A;  1DK4 A;  1B2H A;  4LVQ A;  5ET8 A;  3TCG A;  4PDH A;  4I62 A;  4U1O A;  1UIU A;  3PD9 A;  4OAN A;  4OTE A;  3CG1 A;  3TQW A;  1LFH A;  4O3C A;  3BIH A;  4ELP A;  4FEB A;  4NF4 A;  1XS5 A;  3Q29 A;  1NNT A;  2GH9 A;  3H6V A;  4XKN A;  3BFT A;  4H1X A;  5ET6 A;  3FXB A;  1RDZ A;  1ZKB A;  4IO5 A;  3ECR A;  3IOU A;  2Q88 A;  2Q74 A;  1Q9D A;  5IKB A;  2XHD A;  5DEX A;  2DWI A;  2WYP A;  3I6V A;  2ONR A;  2JJK A;  5I5P A;  4L17 A;  4MLQ A;  4F39 A;  3D1R A;  1LBV A;  3ILT B;  1LGB C;  4I3Y A;  4XIG Q;  2VP1 A;  4YZZ A;  2QMX A;  2H25 A;  3IJO B;  1ANF A;  3S9L C;  2UYF A;  5IZ3 A;  4MFI A;  4PAF A;  3JV9 A;  1JVY A;  3MAM A;  5AE4 A;  2W7Y A;  2HQ0 A;  2WBD A;  1B5H A;  3UOR A;  4PFW A;  3O29 A;  5ICT A;  4C1U A;  1Y9U A;  5I56 A;  1LBZ A;  4TLM B;  3WAF A;  1ELJ A;  3RT6 B;  1IXH A;  3QUJ A;  1FBE A;  2I0B A;  2PX1 A;  1NV7 A;  4X8R A;  2F6G A;  3SZP A;  3L6H A;  1A8F A;  3IOR A;  4GWS A;  1LFG A;  3RUM A;  4DIG A;  3JZJ A;  1LCT A;  2XXY A;  3K6V A;  1M5E A;  5I7I A;  4MLV A;  3U72 A;  4TLL B;  2O6A A;  1USY E;  3TEL A;  1B5I A;  4H0W A;  3RY3 A;  2XX7 A;  4ND9 A;  1IXG A;  4RK9 A;  4EQ9 A;  4F1V A;  4N17 A;  4OVS A;  4FEC A;  3IO6 A;  5I58 B;  1Y3N A;  1NNF A;  1B7H A;  1H44 A;  3IL1 B;  1N0T A;  3N5L A;  4OMB A;  1AOV A;  3MC2 A;  2O84 X;  3KOT A;  2F8D A;  3V8X B;  3W9W A;  5IGA A;  1IMB A;  2V3T A;  3HO7 A;  5TPA B;  1B6H A;  3ZSF A;  2PT1 A;  3IB1 A;  4X1D A;  2OWT A;  1JVX A;  3TOD A;  3LSX A;  1M5B A;  5K2X A;  3MYU A;  2DXY A;  2XXW A;  3VE1 B;  1NMU A;  1B0H A;  3IK6 B;  3E13 X;  4GX3 A;  4OWD A;  2UVJ A;  2DWH A;  4F2Q A;  1SW4 A;  3G3F A;  4C1T A;  3IB0 A;  2O7U A;  4F3S A;  2RC9 A;  5AA2 A;  5JTY B;  3CG3 A;  4ZE9 A;  3K1M A;  3IOT A;  2I3V A;  3TUS A;  4QFN A;  2ZZW A;  1WVJ A;  2AYS A;  4EDP A;  4PET A;  3EHS A;  3FBP A;  4HW8 A;  2REJ A;  3PPP A;  4H65 A;  4HCW A;  5HBC A;  3KN7 A;  4P11 A;  4P1E A;  5IM2 A;  2XX9 A;  3OEM A;  5CMB A;  3O97 A;  1S50 A;  1JET A;  3IR1 A;  2GHA A;  4ZEK A;  1B0L A;  1UTB A;  4OHN A;  2QJE A;  2VD3 A;  1QUK A;  3BKI B;  4Q8R A;  5H8Q B;  4EQB A;  2ANJ A;  2X26 A;  1CE2 A;  5A5X B;  1FBF A;  3VXC A;  1VDW A;  2Y5L A;  5DTB A;  1FBG A;  1FTM A;  5CBR A;  3BBR A;  1YYZ A;  1JEV A;  1BTJ A;  2R6G E;  3VV5 A;  3IFA A;  3PMW A;  4AB5 A;  2FIX A;  3PPO A;  3GXA A;  3HV1 A;  2THI A;  2ZZV A;  2O69 A;  1DCU A;  2PYY A;  4IGT A;  4G8N A;  2Y7K A;  2YJP A;  5ELV A;  2B3B A;  3U65 A;  2ZZX A;  4U23 A;  3FUZ A;  5I59 B;  3IX1 A;  3D4G A;  3HHF A;  4KD5 A;  3CIJ A;  3KJT A;  5EHM A;  3PV0 E;  4DLD A;  1N3W A;  4JDF A;  4ECF A;  3CFL A;  4NTL A;  1IME A;  2L5V A;  4EXL A;  4GVO A;  1YPN A;  5TU0 A;  4JWX A;  4K3F A;  3B6W A;  3CI8 A;  1RDX A;  5I57 A;  3BIG A;  1NV4 A;  4QSD A;  1FTK A;  3KN8 A;  4O94 A;  4Z0I A;  4UAC A;  3MVX A;  3QIM A;  1POT A;  2ZXT A;  4PFT A;  4YKJ A;  4XFE A;  1IZ1 A;  4MNI A;  2BJI A;  1J1N A;  3VDF A;  4IO6 A;  2CEY A;  1MQI A;  3CRB A;  2ZNT A;  3IOV A;  4MX6 A;  4OFO A;  2E0S A;  1SVX B;  2WBB A;  3EN3 A;  2Z23 A;  5JEI A;  4PAK A;  4G61 A;  5CM6 A;  3VLV A;  1URS A;  2OWZ A;  4IO4 A;  4ZEI A;  4ISU A;  1NH8 A;  4RPN A;  3VXB A;  3ODB A;  1TXF A;  2XD2 A;  4IO7 A;  1QKA A;  4F22 A;  1NUZ A;  4DXB A;  3RPL B;  1LB9 A;  3TTL A;  4G2Z A;  5CI5 A;  2E1S A;  5H8F A;  1MXZ A;  1FQB A;  1VR5 A;  1B32 A;  1YCJ A;  4Q0C A;  4KQP A;  1NV5 A;  4MJO A;  2F36 A;  5K2Y A;  3FXU A;  3HN0 A;  2OBG A;  1S9T A;  3MVZ A;  4GD5 A;  4JXI A;  3G3J A;  4PQJ A;  1AIV A;  2Y7I A;  4PE5 B;  5DW8 A;  1IEJ A;  4F3P A;  2V84 A;  2Y7W A;  1Y1M A;  4R9F A;  5ITP A;  1IMC A;  2H99 A;  5LTC A;  4OXV A;  4GFR A;  2I49 A;  3G3G A;  3K00 A;  3PUW E;  3TQL A;  3G3H A;  2H98 A;  3PU5 A;  3EQ1 A;  3PD8 A;  4AS5 A;  4MHF A;  3TKD A;  3K1N A;  2F3D A;  2ZNS A;  4FBP A;  2ZYO A;  5AA4 A;  1JNF A;  3MQ9 A;  2QSX A;  3PUY E;  2HFB A;  1URD A;  4GX6 A;  5TP9 A;  2XXR A;  1NNK A;  4GWZ A;  1DTZ A;  3TAJ A;  3FJG A;  4H5F A;  4NF5 A;  3T93 B;  3N6T A;  2QS2 A;  3FD3 A;  4C0R A;  2ABH A;  5I2N A;  3E78 A;  1A40 A;  3FXR A;  5H8N B;  1NKX A;  2ALU A;  2I58 A;  2F34 A;  2DE3 A;  1B3H A;  4NGU A;  3JYR A;  1QGX A;  3K02 A;  1B05 A;  2DOJ A;  4UAB A;  2O51 A;  4XKQ A;  2V93 A;  3TTM A;  2OK2 A;  4F1U A;  3B50 A;  3EHT A;  1EYK A;  3Q26 A;  4GWU A;  3SEU A;  1H45 A;  1JW1 A;  4NAP A;  1MXY A;  3Q27 A;  4O3A A;  5BWJ A;  2UXA A;  4H6D A;  1NV2 A;  3A29 A;  1MH4 A;  2Q9T A;  3C31 A;  1GR2 A;  3B6T A;  1MXX A;  3DP8 A;  1WDN A;  1Q35 A;  2R9J A;  3U1O A;  3OMB A;  3OO9 A;  1OLA A;  1FQA A;  2F7A A;  1UTH B;  4PCD A;  1R1N A;  1XOC A;  4U1Z A;  3H4Z A;  4OET A;  2UYE A;  4YKP A;  3PMV A;  2VPN A;  3O2A A;  1FPB A;  4R75 A;  3TFL A;  1OVT A;  1B4H A;  5ESY A;  4FJP A;  2NVU B;  1I6A A;  1FBC A;  3QMF A;  2ZYN A;  4N81 A;  4P3L A;  4O7I A;  3OD7 A;  4HCY A;  5EYG A;  4DCY A;  1O63 A;  2Q89 A;  4JVI A;  2ONS A;  3H6W A;  1MH3 A;  4XTC Q;  1K9Y A;  3TDJ A;  2O68 A;  3RNN A;  4R74 A;  5HPQ A;  4H5G A;  2VT5 A;  1XVX A;  4NF6 A;  4IY5 A;  1N76 A;  3FIR A;  3MP6 A;  1QVS A;  1H43 A;  4NF8 A;  2DE4 A;  1FPL A;  3PGF A;  3K6U A;  4KYD A;  2RC8 A;  3E3K A;  5ET5 A;  1XT8 A;  2WX9 A;  5KCJ A;  5KZT A;  2NWJ A;  2F7B A;  5CMM A;  2UVG A;  3CFZ A;  4WEP A;  1II5 A;  5L9S A;  2F5X A;  3ISP A;  1FBH A;  1I6Q A;  5CMK A;  1MY4 A;  3C4M A;  3TPA A;  3T66 A;  3RLF E;  3G7W A;  4PAI A;  2ZYK A;  4OQO A;  1ZBM A;  4E0W A;  5B7D A;  3GLB A;  3HST A;  4MIJ A;  4RYA A;  3MP8 A;  1RYX A;  3Q28 A;  3TTN A;  1B4Z A;  5FBP A;  3LBS A;  4JBZ A;  1MPD A;  4MAG A;  2DWJ A;  4LUB A;  3K2D A;  4EUO A;  3QXM A;  4NG7 A;  4OVQ A;  2D3I A;  3IFC A;  1BK4 A;  4E0X A;  3UIF A;  4GXA A;  4LAT A;  1PB7 A;  1OIB A;  3B6Q A;  2PFZ A;  3KSX A;  2P1S A;  4G4P A;  1P1U A;  3E79 A;  3PPQ A;  3OXN A;  4BLA A;  1MQH A;  1Y1Z A;  1MQJ A;  1AMF A;  2Z8E A;  4NMY A;  1ZLQ A;  2VPO A;  3FVO A;  2R71 A;  1MY1 A;  2F3B A;  5CBS A;  4GWX A;  2DDK A;  2DP8 A;  4PFB A;  2REG A;  1B5J A;  1N84 A;  4FED A;  3GZG A;  4KYS A;  1FTJ A;  4PF6 A;  3NOH A;  1NL5 A;  1EZO A;  1ZTY A;  4PGN A;  3SET A;  4XKP A;  3B8B A;  3K1P A;  3MJN A;  4DI3 D;  4HE1 A;  2XXX A;  5B70 A;  1JP4 A;  4YU0 A;  4QRZ A;  3T1B A;  3A3C A;  2H4I A;  5EQA A;  3E4R A;  2Y7R A;  5IAI A;  4OVJ A;  1Y20 A;  3S2V A;  4M1V A;  3S4U A;  2Y7P A;  3T22 A;  1VE4 A;  2RF1 A;  3EF7 A;  3P7I A;  1FQD A;  3KC0 A;  1SBP A;  3TEP A;  1IMD A;  3RT8 A;  1OQG A;  2RIN A;  4ESX A;  2QS3 A;  4R72 A;  3IB2 A;  4JB7 A;  1B7Z A;  2V3U A;  3RN8 A;  2FBP A;  4NWC A;  2DWA A;  1NV0 A;  3M3L A;  3RPW A;  1SI1 A;  1AH5 A;  2RCA A;  4ZDM A;  1JW4 A;  2Y84 A;  2XXQ A;  3CHG A;  1A8E A;  5I2K B;  3HPI A;  1FPF A;  4XEQ A;  1PC3 A;  4N15 A;  2XA5 A;  1H76 A;  2NXO A;  2AL5 A;  2FYI A;  3MZ1 A;  4DDD A;  4OFJ A;  4I8C A;  4GQO A;  4KHZ E;  2I3W A;  3UN6 A;  5F1Q A;  1NUX A;  1PB8 A;  4YB6 A;  4GOT A;  4NF4 B;  2DXR A;  4MF3 A;  1B58 A;  1LAH E;  4RNS A;  4H45 A;  1QUL A;  4HE2 A;  2QMW A;  1P99 A;  3SEW A;  1Z7M E;  1XHY A;  2X7P A;  3FVN A;  3LSF B;  3M8U A;  1MM6 A;  3PUZ E;  2XWO A;  4F1Y A;  4U21 A;  3MST A;  4YMA A;  1FQC A;  2ESN A;  1NI9 A;  3UP9 A;  4JSO A;  3UK4 A;  5DEX B;  1O64 A;  4BDM A;  4KCC A;  2OWS A;  3VVF A;  1N7W A;  5EYH A;  4HE0 A;  3UGW A;  1RKM A;  3LUZ A;  5AA1 A;  3OSR A;  3DP6 A;  3TYH A;  5AA3 A;  3FAT A;  1UQW A;  5I84 A;  5IZ3 B;  4BDO A;  5H8H A;  2HZL A;  4JWY A;  2IEE A;  3MPK A;  3G3I A;  2AIX A;  3UA8 A;  2A5T A;  1FPI A;  1M5F A;  4PTK A;  3RGY A;  4OVT A;  2F97 A;  5I56 B;  3EKI A;  2CEX A;  1PBQ A;  1NV1 A;  2FA7 A;  2P3N A;  2QS1 A;  2MKZ A;  1SYI A;  1JW5 A;  4NHB A;  2FVZ A;  5KDT A;  4R73 A;  1FPD A;  3HCQ A;  2Q8J A;  2OLB A;  3OO6 A;  1LST A;  2Z8F A;  5EQ9 A;  1NNP A;  1A99 A;  2QVV A;  4X9T A;  3R7X A;  5M2V A;  1YZ0 A;  1LEV A;  4AQ4 A;  2DVC A;  3THI A;  1IIW A;  4FE8 A;  4NN3 A;  2PVU A;  2RC7 A;  4ELO A;  2DS9 A;  2FIE A;  1KA1 A;  2IA4 A;  1YTV A;  4H46 A;  4OEN A;  3K6W A;  3GYY A;  1OVB A;  1JQF A;  1ZIU A;  2CZH A;  4OEU A;  5JK4 A;  4YB5 A;  4I9D A;  4POW A;  3CSB A;  1FTL A;  3OEL A;  4BDQ A;  3I3V A;  4GF8 A;  4O8M A;  1I6B A;  1MXU A;  4DE8 A;  3K01 A;  4ZZE A;  4ZEB A;  4G68 A;  1RDY A;  3QAX A;  3K4U A;  4NED A;  3M3K A;  1MY0 A;  5DT6 A;  3C35 A;  4QXD A;  2PBW A;  3EHU A;  1EYI A;  4ZS9 A;  4YKK A;  2HAU A;  2DVZ A;  2B4M A;  4FIM A;  1LAF E;  3T0J A;  2QL3 A;  1CNQ A;  1PB9 A;  4KYE A;  1P1O A;  4PGP A;  2I48 A;  5AA2 B;  2Z8D A;  4P8B A;  1ZMG A;  2DYX A;  3LSL A;  4LQ5 A;  3H06 B;  4F3G A;  2X7Q A;  4N07 A;  2BJJ X;  2NOO A;  2Q2A A;  4P9K A;  4N6P A;  4ZE8 A;  5EHS A;  1F9B A;  5EYF A;  3FVG A;  1FQF A;  3O6G A;  1LBB A;  1GVC A;  4QFK A;  3GBA A;  3T9U A;  5F24 A;  1SW5 A;  1Z7N E;  4HS7 A;  1O7T A;  3SEX A;  1IQ7 A;  1D3K A;  2M8C A;  3KBZ A;  2KLF A;  1D9Q A;  3FJM A;  1UTB B;  3IOW A;  1IXC A;  1RYO A;  1G0I A;  4G68 C;  4RY1 A;  2OX3 A;  1OLC A;  1N7X A;  2CZI A;  2UVH A;  3MPL A;  5T3J A;  3N6U A;  1XI6 A;  1QUI A;  4LON B;  1XC1 A;  3TCH A;  3GBB A;  4OYV A;  1TT1 A;  1LAG E;  1M5C A;  3S9M C;  3RQT A;  4ZED A;  3MVW A;  2D21 A;  4BDL A;  2XXU A;  3K6X A;  2HZK A;  5CC2 A;  3QUF A;  4RPO A;  4RXL A;  3O6H A;  4GX4 A;  4Z7E A;  4P47 A;  4N91 A;  1TFA A;  3G3K A;  4LZ5 A;  4GRK A;  1BKA A;  1WOD A;  4M4G A;  5AA2 D;  2OJT A;  2XXH A;  4OEV A;  5CRY A;  2XWI A;  1B3L A;  3CR9 A;  2QVR A;  1FBD A;  1NV3 A;  2V25 A;  3KC1 A;  1QUJ A;  5KDT B;  4THI A;  4YB7 A;  4KR5 A;  5I58 A;  1KWH A;  5H8S A;  2HEU A;  2V3Q A;  3USD A;  1MQG A;  4XKR A;  2OCU A;  4U2R A;  4MCO A;  4KXP A;  2ZMB A;  4NWD A;  2XX8 A;  4GWY A;  2KR0 A;  1SW1 A;  4G8M A;  1SPI A;  1Y3P A;  1IMA A;  5TPA A;  1CB6 A;  2WKY A;  3E9X A;  1POY 1;  1R6Z A;  5I57 B;  4QF9 A;  3OO8 A;  1I69 A;  1DOT A;  2H9B A;  1B3E A;  2F7C A;  3SES A;  1P1N A;  1OQH A;  4RA1 A;  3QYT A;  4XF5 A;  5DYH A;  5LOM A;  5FHO A;  1IIT A;  3PTY A;  3SDF A;  1EZP A;  2P2A A;  2AL4 A;  4PBQ A;  2HXW A;  4QFL A;  3U8Q A;  4JWO A;  5JTY A;  3FV1 A;  4MH5 A;  1NH7 A;  4N6K A;  2Y5K A;  4YAH X;  1LLS A;  2UVI A;  1BP5 A;  2O7I A;  3WAE A;  4OER A;  4WKM A;  2QFL A;  1FBP A;  1MM7 A;  1N3X A;  3OO7 A;  5H8F B;  4DZ1 A;  4ESW A;  2B65 A;  1MXW A;  2VGQ A;  4ZZA A;  1EZ9 A;  5I3S A;  2PCR A;  4LQ2 A;  2I6E A;  1BLF A;  4QFP A;  2B4L A;  3C9H A;  3QSL A;  4GBW A;  2WEF A;  3SKP A;  1B1X A;  5H8Q A;  4RK2 A;  4I1D A;  4ZEF A;  1US4 A;  1NFT A;  3ZS6 A;  1HSJ A;  5A5X A;  1D4N A;  1LBW A;  1LBX A;  2A5S A;  4I3E A;  4R9G A;  3VLU A;  1URG A;  3SER A;  3MZB A;  4GIZ A;  2H5Y A;  1FPG A;  3VLW A;  3KSJ A;  4GXS B;  4TOZ A;  2HPG A;  2XXK A;  3KFM A;  4F31 B;  1B1H A;  3SEV A;  4N6D A;  1YAE A;  1B51 A;  4GL8 A;  5AA4 B;  1IXI A;  4XXU A;  1USY H;  1XVY A;  4U4X A;  5TP9 B;  1FPJ A;  5DVJ A;  1KZ8 A;  3KOS A;  1Q1K A;  4R2F A;  1B46 A;  4NF5 B;  3ZKL A;  5I2N B;  1JEU A;  3KGC A;  5I59 A;  4GWW A;  3Q25 A;  3A3U A;  4LP2 B;  1NUW A;  3C36 A;  3FVK A;  3KN3 A;  3N26 A;  1T0K A;  1MRP A;  1B9J A;  1G0H A;  2QS4 A;  3C32 A;  1TFD A;  2Z22 A;  3H7M A;  3V83 A;  1AWB A;  4X04 A;  4IO3 A;  2RCB A;  4GLI A;  2PMS A;  1MDQ A;  1VSO A;  2DE2 A;  5IZZ A;  1SI0 A;  1R9L A;  2F6P A;  2GQ1 A;  2Q8M A;  3HFU A;  4F29 A;  4JSD A;  2WYK A;  4DCX A;  3U93 A;  5ICQ A;  2O1L A;  1US5 A;  3ZKK A;  3TMG A;  3FZV A;  2FHY A;  4QFO A;  5IZ1 A;  5FHM A;  3LR1 A;  2O1M A;  3IAZ A;  3W15 C;  4KFQ A;  5EQ7 A;  1BIY A;  1EU8 A;  1FJ6 A;  1MS7 A;  1R9Q A;  5CMC A;  4PP0 A;  2G93 A;  3T9H B;  4YIC A;  2ZYM A;  1LAX A;  1DPP A;  1LFI A;  1SDX A;  4OA4 A;  1SYH A;  1LCF A;  2VD2 A;  4GWO A;  4QHQ A;  4PF8 A;  1FSA A;  4NQ8 A;  3VVD A;  5L9O A;  3BFU A;  1MQD A;  4MEV A;  4I40 A;  4LN5 A;  3FV2 A;  1FPE A;  2HCA A;  3CFX A;  3RPL A;  4IR8 A;  2XD3 A;  3N94 A;  4NF6 B;  2XXI A;  4FAT A;  4R6K A;  4NF8 B;  2YPN A;  4AS4 A;  3FAS A;  2P3V A;  2YLN A;  3MUQ A;  1K9Z A;  4F3B A;  3ONM A;  4G77 A;  5KCJ B;  4Q30 B;  4OVR A;  2XXT A;  2ZNU A;  2R8T A;  4HXV A;  2HXR A;  3H6U A;  4PFY A;  1D9Y A;  4N4U A;  4ZEC A;  5F7V A;  4UA8 A;  4N13 A;  2VHA A;  4PFR A;  1HSL A;  3QK6 A;  3FXQ A;  1VFE A;  3K0V A;  4OZ9 A;  1Y4C A;  2V4C A;  4KPT A;  3LSW A;  4NE4 A;  3I5O A;  4NF0 A;  5L8D A;  1LBY A;  3MW0 A;  4P1L A;  1GGG A;  1SD3 A;  1A55 A;  3RTW B;  2GRV A;  1B40 A;  1OMP A;  3ROJ A;  3C34 A;  3FJ7 A;  3TCF A;  1GV8 A;  4MBP A;  5H8N A;  1A54 A;  3H6T A;  3DEL B;  4G8H A;  3R26 A;  1GTK A;  1AL3 A;  3A09 A;  2LAO A;  4QBA A;  1KA0 A;  4KCD A;  4FOR A;  1QW0 A;  4ONY A;  3V5A A;  2XXP A;  3R6U A;  1PBP A;  2I4C A;  4PFI A;  2RKM A;  4EXK A;  4QSE A;  4MNC A;  1Y4T A;  1MY2 A;  4OES A;  5FHN A;  4FAJ A;  4JVD A;  3O9P A;  1EYJ A;  2GHB A;  2QRY A;  3T9X B;  4PFU A;  3W9V A;  4JVC A;  4HTG A;  4P0G A;  1PEB A;  2VOZ A;  3TTK A;  2QVU A;  3O66 A;  1M5D A;  3OSQ A;  4POX A;  1FTA A;  1UTH A;  2DSF A;  5L9M A;  3PUV E;  3RTF B;  5FTI A;  4H8I A;  4IY6 A;  1D9V A;  1ZJL A;  1DMB A;  5FTH A;  1Y3Q A;  2Q2C A;  3LC8 A;  2I4B A;  5HM4 B;  1DBZ A;  3O6I A;  4U22 A;  3H03 A;  1ATG A;  1P1Q A;  2QPQ A;  4EF2 A;  4IGR A;  4P56 A;  2D5W A;  4N8Y A;  3OEK A;  4X48 A;  3MZ9 A;  1QJM A;  1S7Y A;  4WXJ A;  1FPK A;  4P0I A;  3ILU B;  3DP4 A;  3KJ7 A;  3H3G A;  4N8G A;  4MNP A;  2PFY A;  2CMO A;  3DLN A;  4LA9 A;  3TTR A;  4DI4 B;  1LBC A;  4PDD A;  4O3B A;  3M3F A;  4H8J A;  2DQV A;  3TZA A;  1SQY A;  1DSN A;  1MY3 A;  5J1D A;  5BUU A;  3KBR A;  2P0S A;  2B3F A;  3T96 B;  4F18 A;  2XWK A;  1FW0 A;  3RYD A;  4LZ7 A;  4F2O A;  1HSE A;  1TWY A;  4LZ8 A;  5ISU A;  1P1W A;  2HHM A;  2F78 A;  4GBV A;  2HAV A;  5EQ8 A;  2CZL A;  2ONK E;  3IO4 A;  4R6Y A;  3T9V A;  3VFJ A;  1FJ9 A;  4R2B A;  4YKI A;  2CZK A;  4X1B A;  3LV0 A;  3DM0 A;  3MVY A;  1L5T A;  1B3G A;  1B3F A;  3S9E A;  4PBH A;  2PT2 A;  4AB6 A;  5LDZ A;  4ELQ A;  1FQE A;  1VFD A;  5J16 A;  3O28 A;  5ITO A;  3B7D A;  4RJZ A;  4QSC A;  2OZZ A;  1FRP A;  5H8H B;  3HHG A;  4O7M A;  3V89 B;  1LB8 A;  1MG1 A;  4U4S A;  5DVI A;  1YXI A;  4GL0 A;  1A7L A;  1B52 A;  3PMX A;  2A5T B;  3KG2 A;  1QKB A;  2G29 A;  2I0C A;  3PPN A;  2KQZ A;  4DXU A;  3CVG A;  1N04 A;  2FNC A;  4PC9 A;  4EQ7 A;  4PE3 A;  3MWB A;  4OFL A;  5A5L A;  2GFE A;  3VVE A;  1NV6 A;  4F19 A;  3SEY A;  3MBP A;  1IUD A;  4ELR A;  3PUX E;  1DTG A;  3IJX B;  4TQU Q;  1FCK A;  3U94 A;  2XWV A;  1PDA A;  4YMB A;  3FGS A;  4KI0 E;  1FTO A;  4BDN A;  1INP A;  1EH3 A;  3U92 A;  4IB2 A;  3S9N C;  1MPC A; 
#chains in the Genus database with same CATH homology
 1B7U A;  1MDP 1;  4EF1 A;  3PPR A;  1UIV A;  1MXV A;  3D4C A;  2F35 A;  5DVF A;  4WED A;  3OOA A;  3C33 A;  1MPB A;  4R6H A;  3EPE A;  4H67 A;  3F11 A;  3LUY A;  3L6G A;  4Q5T A;  3KEI A;  4BDR A;  2XXV A;  1SW2 A;  3CSG A;  5I2K A;  3KZG A;  1H3D A;  2NUV A;  3MP1 A;  1ZU0 A;  1DPE A;  4G68 B;  3AXF A;  3OEN A;  4DXC A;  4IO2 A;  1B2H A;  4LVQ A;  3TCG A;  4I62 A;  4U1O A;  1UIU A;  3PD9 A;  4OTE A;  3CG1 A;  3TQW A;  1LFH A;  4O3C A;  4ELP A;  4FEB A;  4NF4 A;  1XS5 A;  3Q29 A;  1NNT A;  2GH9 A;  3H6V A;  4XKN A;  3BFT A;  4H1X A;  1ZKB A;  4IO5 A;  3ECR A;  3IOU A;  2Q88 A;  5IKB A;  2XHD A;  5DEX A;  2DWI A;  3I6V A;  2ONR A;  4L17 A;  4MLQ A;  4F39 A;  3ILT B;  1LGB C;  4XIG Q;  2VP1 A;  4YZZ A;  2QMX A;  2H25 A;  3IJO B;  1ANF A;  3S9L C;  2UYF A;  4MFI A;  3JV9 A;  1JVY A;  3MAM A;  5AE4 A;  2W7Y A;  2HQ0 A;  1B5H A;  3UOR A;  4PFW A;  3O29 A;  5ICT A;  4C1U A;  1Y9U A;  5I56 A;  4TLM B;  3WAF A;  1ELJ A;  3RT6 B;  1IXH A;  3QUJ A;  2I0B A;  2PX1 A;  2F6G A;  3L6H A;  1A8F A;  3IOR A;  1LFG A;  3RUM A;  4DIG A;  3JZJ A;  1LCT A;  2XXY A;  3K6V A;  1M5E A;  4MLV A;  3U72 A;  4TLL B;  2O6A A;  1USY E;  3TEL A;  1B5I A;  4H0W A;  3RY3 A;  2XX7 A;  4ND9 A;  1IXG A;  4RK9 A;  4EQ9 A;  4F1V A;  4FEC A;  3IO6 A;  5I58 B;  1Y3N A;  1NNF A;  1B7H A;  1H44 A;  3IL1 B;  1N0T A;  3N5L A;  4OMB A;  1AOV A;  3MC2 A;  2O84 X;  3KOT A;  2F8D A;  3V8X B;  3W9W A;  2V3T A;  3HO7 A;  5TPA B;  1B6H A;  3ZSF A;  2PT1 A;  3IB1 A;  4X1D A;  2OWT A;  1JVX A;  3TOD A;  3LSX A;  1M5B A;  5K2X A;  2DXY A;  2XXW A;  3VE1 B;  1NMU A;  1B0H A;  3IK6 B;  3E13 X;  4OWD A;  2UVJ A;  2DWH A;  4F2Q A;  1SW4 A;  3G3F A;  4C1T A;  3IB0 A;  2O7U A;  4F3S A;  2RC9 A;  5AA2 A;  5JTY B;  3CG3 A;  4ZE9 A;  3K1M A;  3IOT A;  2I3V A;  3TUS A;  4QFN A;  1WVJ A;  2AYS A;  4EDP A;  4PET A;  3EHS A;  4HW8 A;  2REJ A;  3PPP A;  4H65 A;  4HCW A;  5HBC A;  3KN7 A;  4P11 A;  2XX9 A;  3OEM A;  5CMB A;  3O97 A;  1S50 A;  1JET A;  3IR1 A;  2GHA A;  4ZEK A;  1B0L A;  1UTB A;  4OHN A;  2QJE A;  2VD3 A;  1QUK A;  3BKI B;  4Q8R A;  5H8Q B;  4EQB A;  2ANJ A;  2X26 A;  1CE2 A;  5A5X B;  3VXC A;  5DTB A;  1FTM A;  5CBR A;  3BBR A;  1JEV A;  1BTJ A;  2R6G E;  3VV5 A;  3PMW A;  4AB5 A;  3PPO A;  3GXA A;  3HV1 A;  2THI A;  2O69 A;  2PYY A;  4IGT A;  4G8N A;  2Y7K A;  2YJP A;  5ELV A;  2B3B A;  4U23 A;  3FUZ A;  5I59 B;  3IX1 A;  3D4G A;  3HHF A;  4KD5 A;  3CIJ A;  3KJT A;  5EHM A;  3PV0 E;  4DLD A;  1N3W A;  4JDF A;  4ECF A;  3CFL A;  4NTL A;  4EXL A;  4GVO A;  1YPN A;  5TU0 A;  4JWX A;  4K3F A;  3B6W A;  3CI8 A;  5I57 A;  4QSD A;  1FTK A;  3KN8 A;  4Z0I A;  4UAC A;  3MVX A;  3QIM A;  1POT A;  2ZXT A;  4PFT A;  4YKJ A;  1IZ1 A;  1J1N A;  3VDF A;  4IO6 A;  1MQI A;  3CRB A;  2ZNT A;  3IOV A;  4OFO A;  2E0S A;  1SVX B;  3EN3 A;  2Z23 A;  5JEI A;  5CM6 A;  3VLV A;  1URS A;  4IO4 A;  4ZEI A;  4ISU A;  1NH8 A;  4RPN A;  3VXB A;  3ODB A;  1TXF A;  2XD2 A;  4IO7 A;  1QKA A;  4F22 A;  4DXB A;  3TTL A;  1LB9 A;  4G2Z A;  5CI5 A;  2E1S A;  5H8F A;  1MXZ A;  1FQB A;  1VR5 A;  1B32 A;  1YCJ A;  4Q0C A;  4KQP A;  2F36 A;  5K2Y A;  3FXU A;  3HN0 A;  2OBG A;  1S9T A;  3MVZ A;  4GD5 A;  4JXI A;  3G3J A;  4PQJ A;  1AIV A;  2Y7I A;  4PE5 B;  1IEJ A;  4F3P A;  2V84 A;  2Y7W A;  1Y1M A;  4R9F A;  5ITP A;  2H99 A;  4OXV A;  4GFR A;  2I49 A;  3G3G A;  3K00 A;  3PUW E;  3TQL A;  3G3H A;  2H98 A;  3PU5 A;  3EQ1 A;  3PD8 A;  3TKD A;  3K1N A;  2ZNS A;  2ZYO A;  5AA4 A;  1JNF A;  3MQ9 A;  2QSX A;  3PUY E;  2HFB A;  1URD A;  5TP9 A;  2XXR A;  1NNK A;  1DTZ A;  3TAJ A;  3FJG A;  4H5F A;  4NF5 A;  3T93 B;  3N6T A;  2QS2 A;  3FD3 A;  4C0R A;  2ABH A;  5I2N A;  1A40 A;  3FXR A;  5H8N B;  1NKX A;  2ALU A;  2I58 A;  2F34 A;  2DE3 A;  1B3H A;  3JYR A;  3K02 A;  1B05 A;  2DOJ A;  2O51 A;  4XKQ A;  2V93 A;  3TTM A;  2OK2 A;  4F1U A;  3EHT A;  3Q26 A;  3SEU A;  1H45 A;  1JW1 A;  1MXY A;  3Q27 A;  4O3A A;  5BWJ A;  2UXA A;  4H6D A;  1MH4 A;  2Q9T A;  3C31 A;  1GR2 A;  3B6T A;  1MXX A;  3DP8 A;  1WDN A;  1Q35 A;  2R9J A;  3U1O A;  3OMB A;  3OO9 A;  1OLA A;  1FQA A;  2F7A A;  1UTH B;  4U1Z A;  1R1N A;  1XOC A;  3H4Z A;  4OET A;  2UYE A;  4YKP A;  3PMV A;  3O2A A;  4R75 A;  3TFL A;  1OVT A;  1B4H A;  2NVU B;  4FJP A;  1I6A A;  2ZYN A;  3OD7 A;  4HCY A;  4DCY A;  1O63 A;  2Q89 A;  2ONS A;  3H6W A;  1MH3 A;  4XTC Q;  3TDJ A;  2O68 A;  3RNN A;  4R74 A;  5HPQ A;  4H5G A;  1XVX A;  4NF6 A;  4IY5 A;  1N76 A;  3FIR A;  3MP6 A;  1QVS A;  1H43 A;  4NF8 A;  2DE4 A;  3PGF A;  3K6U A;  4KYD A;  2RC8 A;  3E3K A;  1XT8 A;  5KCJ A;  5KZT A;  2NWJ A;  2F7B A;  5CMM A;  2UVG A;  3CFZ A;  4WEP A;  1II5 A;  5L9S A;  2F5X A;  1I6Q A;  5CMK A;  1MY4 A;  3C4M A;  3TPA A;  3T66 A;  3RLF E;  3G7W A;  2ZYK A;  4OQO A;  1ZBM A;  4E0W A;  5B7D A;  3GLB A;  3HST A;  4RYA A;  3MP8 A;  1RYX A;  3Q28 A;  3TTN A;  1B4Z A;  3LBS A;  4JBZ A;  1MPD A;  2DWJ A;  4LUB A;  3K2D A;  4EUO A;  3QXM A;  2D3I A;  4E0X A;  3UIF A;  4GXA A;  4LAT A;  1PB7 A;  1OIB A;  3B6Q A;  3KSX A;  2P1S A;  4G4P A;  1P1U A;  3PPQ A;  4BLA A;  3OXN A;  1MQH A;  1Y1Z A;  1MQJ A;  1AMF A;  2Z8E A;  4NMY A;  1ZLQ A;  3FVO A;  2R71 A;  1MY1 A;  5CBS A;  2DP8 A;  2REG A;  1B5J A;  1N84 A;  4FED A;  3GZG A;  4KYS A;  1FTJ A;  1NL5 A;  1EZO A;  1ZTY A;  3SET A;  4XKP A;  3K1P A;  3MJN A;  2XXX A;  5B70 A;  4YU0 A;  4QRZ A;  3A3C A;  2H4I A;  3E4R A;  2Y7R A;  5IAI A;  4OVJ A;  1Y20 A;  3S2V A;  4M1V A;  3S4U A;  2Y7P A;  3T22 A;  1VE4 A;  2RF1 A;  3EF7 A;  3P7I A;  1FQD A;  1SBP A;  3TEP A;  3RT8 A;  1OQG A;  2RIN A;  4ESX A;  2QS3 A;  4R72 A;  3IB2 A;  4JB7 A;  1B7Z A;  2V3U A;  3RN8 A;  4NWC A;  2DWA A;  3RPW A;  3M3L A;  1SI1 A;  1AH5 A;  2RCA A;  4ZDM A;  1JW4 A;  2Y84 A;  2XXQ A;  1A8E A;  5I2K B;  3HPI A;  1PC3 A;  1H76 A;  2NXO A;  2AL5 A;  2FYI A;  3MZ1 A;  4DDD A;  4OFJ A;  4I8C A;  4GQO A;  4KHZ E;  2I3W A;  3UN6 A;  5F1Q A;  1PB8 A;  4YB6 A;  4GOT A;  4NF4 B;  2DXR A;  4MF3 A;  1B58 A;  1LAH E;  4RNS A;  1QUL A;  2QMW A;  1P99 A;  3SEW A;  1Z7M E;  1XHY A;  2X7P A;  3FVN A;  3LSF B;  3M8U A;  1MM6 A;  3PUZ E;  4F1Y A;  4U21 A;  4YMA A;  1FQC A;  2ESN A;  3UP9 A;  4JSO A;  3UK4 A;  5DEX B;  1O64 A;  4BDM A;  4KCC A;  2OWS A;  3VVF A;  1N7W A;  3UGW A;  1RKM A;  5AA1 A;  3OSR A;  3DP6 A;  5AA3 A;  3TYH A;  3FAT A;  1UQW A;  5I84 A;  4BDO A;  5H8H A;  2HZL A;  4JWY A;  2IEE A;  3MPK A;  3G3I A;  2AIX A;  3UA8 A;  2A5T A;  1M5F A;  3RGY A;  2F97 A;  5I56 B;  1PBQ A;  2FA7 A;  2QS1 A;  1SYI A;  1JW5 A;  5KDT A;  4R73 A;  3HCQ A;  2Q8J A;  2OLB A;  3OO6 A;  1LST A;  2Z8F A;  1NNP A;  1A99 A;  4X9T A;  3R7X A;  5M2V A;  4AQ4 A;  2DVC A;  3THI A;  1IIW A;  4FE8 A;  2PVU A;  2RC7 A;  4ELO A;  2DS9 A;  2IA4 A;  1YTV A;  4OEN A;  3K6W A;  1OVB A;  1JQF A;  1ZIU A;  4OEU A;  5JK4 A;  4YB5 A;  4I9D A;  4POW A;  3CSB A;  1FTL A;  3OEL A;  4BDQ A;  3I3V A;  4GF8 A;  1I6B A;  1MXU A;  4DE8 A;  3K01 A;  4ZZE A;  4ZEB A;  4G68 A;  3QAX A;  3K4U A;  4NED A;  3M3K A;  1MY0 A;  5DT6 A;  3C35 A;  2PBW A;  3EHU A;  4ZS9 A;  4YKK A;  2HAU A;  2DVZ A;  4FIM A;  1LAF E;  2QL3 A;  1PB9 A;  4KYE A;  1P1O A;  2I48 A;  5AA2 B;  2Z8D A;  1ZMG A;  2DYX A;  3LSL A;  4LQ5 A;  3H06 B;  4F3G A;  2X7Q A;  4N07 A;  2BJJ X;  2NOO A;  2Q2A A;  4N6P A;  4ZE8 A;  5EHS A;  1F9B A;  5EYF A;  3FVG A;  1FQF A;  3O6G A;  1LBB A;  1GVC A;  4QFK A;  3GBA A;  3T9U A;  1SW5 A;  1Z7N E;  4HS7 A;  1O7T A;  3SEX A;  1IQ7 A;  1D3K A;  2M8C A;  2KLF A;  3FJM A;  1UTB B;  3IOW A;  1IXC A;  1RYO A;  4G68 C;  4RY1 A;  1OLC A;  1N7X A;  2UVH A;  3MPL A;  3N6U A;  1QUI A;  4LON B;  1XC1 A;  3TCH A;  3GBB A;  4OYV A;  1TT1 A;  1LAG E;  1M5C A;  3S9M C;  3RQT A;  4ZED A;  3MVW A;  2D21 A;  4BDL A;  2XXU A;  3K6X A;  2HZK A;  5CC2 A;  3QUF A;  4RPO A;  4RXL A;  3O6H A;  4Z7E A;  1TFA A;  3G3K A;  4LZ5 A;  4GRK A;  1BKA A;  1WOD A;  4M4G A;  5AA2 D;  2OJT A;  2XXH A;  4OEV A;  5CRY A;  1B3L A;  3CR9 A;  2V25 A;  1QUJ A;  5KDT B;  4THI A;  4YB7 A;  4KR5 A;  5I58 A;  1KWH A;  5H8S A;  2HEU A;  2V3Q A;  3USD A;  1MQG A;  4XKR A;  2OCU A;  4U2R A;  2ZMB A;  4NWD A;  2XX8 A;  1SW1 A;  4G8M A;  1Y3P A;  5TPA A;  1CB6 A;  2WKY A;  3E9X A;  1POY 1;  1R6Z A;  5I57 B;  4QF9 A;  3OO8 A;  1I69 A;  1DOT A;  2H9B A;  1B3E A;  2F7C A;  3SES A;  1P1N A;  1OQH A;  4RA1 A;  3QYT A;  5DYH A;  5LOM A;  5FHO A;  1IIT A;  3SDF A;  1EZP A;  2P2A A;  2AL4 A;  2HXW A;  4QFL A;  3U8Q A;  4JWO A;  5JTY A;  3FV1 A;  4MH5 A;  1NH7 A;  4YAH X;  1LLS A;  2UVI A;  1BP5 A;  2O7I A;  3WAE A;  4OER A;  4WKM A;  1MM7 A;  1N3X A;  3OO7 A;  5H8F B;  4DZ1 A;  4ESW A;  2B65 A;  1MXW A;  2VGQ A;  4ZZA A;  1EZ9 A;  4LQ2 A;  2I6E A;  1BLF A;  4QFP A;  3C9H A;  3QSL A;  3SKP A;  1B1X A;  5H8Q A;  4RK2 A;  4I1D A;  4ZEF A;  1US4 A;  1NFT A;  3ZS6 A;  1HSJ A;  5A5X A;  1D4N A;  2A5S A;  4R9G A;  3VLU A;  1URG A;  3SER A;  3MZB A;  4GIZ A;  2H5Y A;  3VLW A;  3KSJ A;  4GXS B;  4TOZ A;  3KFM A;  4F31 B;  1B1H A;  3SEV A;  1YAE A;  1B51 A;  4GL8 A;  5AA4 B;  1IXI A;  4XXU A;  1USY H;  1XVY A;  4U4X A;  5TP9 B;  5DVJ A;  3KOS A;  1Q1K A;  4R2F A;  1B46 A;  4NF5 B;  3ZKL A;  5I2N B;  1JEU A;  3KGC A;  5I59 A;  3Q25 A;  3A3U A;  4LP2 B;  3C36 A;  3N26 A;  3FVK A;  3KN3 A;  1T0K A;  1MRP A;  1B9J A;  2QS4 A;  3C32 A;  1TFD A;  2Z22 A;  3H7M A;  3V83 A;  4IO3 A;  2RCB A;  4GLI A;  2PMS A;  1MDQ A;  1VSO A;  2DE2 A;  1SI0 A;  1R9L A;  2F6P A;  4F29 A;  4JSD A;  4DCX A;  3U93 A;  5ICQ A;  2O1L A;  1US5 A;  3ZKK A;  3TMG A;  3FZV A;  4QFO A;  5FHM A;  3LR1 A;  2O1M A;  3IAZ A;  3W15 C;  4KFQ A;  1BIY A;  1EU8 A;  1MS7 A;  1R9Q A;  5CMC A;  4PP0 A;  2G93 A;  3T9H B;  4YIC A;  2ZYM A;  1LAX A;  1DPP A;  1LFI A;  1SDX A;  1SYH A;  1LCF A;  2VD2 A;  4GWO A;  4QHQ A;  3VVD A;  5L9O A;  3BFU A;  1MQD A;  3FV2 A;  2HCA A;  3CFX A;  2XD3 A;  3N94 A;  4NF6 B;  2XXI A;  4FAT A;  4R6K A;  4NF8 B;  2YPN A;  3FAS A;  2YLN A;  3MUQ A;  4F3B A;  3ONM A;  4G77 A;  5KCJ B;  4Q30 B;  2XXT A;  2ZNU A;  3H6U A;  4PFY A;  1D9Y A;  4ZEC A;  5F7V A;  4UA8 A;  4N13 A;  2VHA A;  1HSL A;  3QK6 A;  3FXQ A;  1VFE A;  3K0V A;  4OZ9 A;  1Y4C A;  4KPT A;  3LSW A;  4NE4 A;  3I5O A;  5L8D A;  3MW0 A;  1GGG A;  1A55 A;  1SD3 A;  3RTW B;  2GRV A;  1B40 A;  1OMP A;  3C34 A;  3FJ7 A;  3TCF A;  1GV8 A;  4MBP A;  5H8N A;  1A54 A;  3H6T A;  3DEL B;  4G8H A;  3R26 A;  1GTK A;  1AL3 A;  3A09 A;  2LAO A;  4KCD A;  4FOR A;  1QW0 A;  4ONY A;  3V5A A;  2XXP A;  3R6U A;  1PBP A;  2I4C A;  2RKM A;  4EXK A;  4QSE A;  1Y4T A;  1MY2 A;  4OES A;  5FHN A;  4FAJ A;  3O9P A;  2GHB A;  2QRY A;  3T9X B;  4PFU A;  3W9V A;  4HTG A;  4P0G A;  1PEB A;  2VOZ A;  3TTK A;  3O66 A;  1M5D A;  3OSQ A;  4POX A;  1UTH A;  2DSF A;  5L9M A;  3PUV E;  3RTF B;  5FTI A;  4H8I A;  4IY6 A;  1D9V A;  1ZJL A;  1DMB A;  5FTH A;  1Y3Q A;  2Q2C A;  3LC8 A;  2I4B A;  5HM4 B;  3O6I A;  4U22 A;  3H03 A;  1ATG A;  1P1Q A;  2QPQ A;  4EF2 A;  4IGR A;  2D5W A;  3OEK A;  4X48 A;  3MZ9 A;  1QJM A;  1S7Y A;  4WXJ A;  4P0I A;  3ILU B;  3DP4 A;  3KJ7 A;  3H3G A;  2CMO A;  3DLN A;  4LA9 A;  3TTR A;  1LBC A;  4O3B A;  3M3F A;  4H8J A;  2DQV A;  3TZA A;  1SQY A;  1DSN A;  1MY3 A;  5J1D A;  5BUU A;  3KBR A;  2P0S A;  2B3F A;  3T96 B;  4F18 A;  1FW0 A;  4LZ7 A;  4F2O A;  1HSE A;  1TWY A;  4LZ8 A;  5ISU A;  1P1W A;  2F78 A;  2HAV A;  2CZL A;  2ONK E;  3IO4 A;  4R6Y A;  3T9V A;  3VFJ A;  4R2B A;  4YKI A;  4X1B A;  3DM0 A;  3MVY A;  1L5T A;  1B3G A;  1B3F A;  3S9E A;  2PT2 A;  4AB6 A;  4ELQ A;  1FQE A;  1VFD A;  3O28 A;  5ITO A;  3B7D A;  4RJZ A;  4QSC A;  2OZZ A;  5H8H B;  3HHG A;  3V89 B;  1LB8 A;  1MG1 A;  4U4S A;  5DVI A;  4GL0 A;  1A7L A;  1B52 A;  3PMX A;  2A5T B;  3KG2 A;  1QKB A;  2G29 A;  2I0C A;  3PPN A;  4DXU A;  3CVG A;  1N04 A;  2FNC A;  4EQ7 A;  3MWB A;  4OFL A;  2GFE A;  3VVE A;  4F19 A;  3SEY A;  3MBP A;  1IUD A;  4ELR A;  3PUX E;  1DTG A;  3IJX B;  4TQU Q;  1FCK A;  3U94 A;  1PDA A;  4YMB A;  3FGS A;  4KI0 E;  1FTO A;  4BDN A;  1EH3 A;  3U92 A;  4IB2 A;  3S9N C;  1MPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...