1EU8A

Structure of trehalose maltose binding protein from thermococcus litoralis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
407
structure length
407
Chain Sequence
IEEGKIVFAVGGAPNEIEYWKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIASGWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYSKPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKDGKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYAWGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYSVQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKYVNSALAGKISPQEALDKAQKEAEELVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TREHALOSE/MALTOSE BINDING PROTEIN
publication title The crystal structure of a liganded trehalose/maltose-binding protein from the hyperthermophilic Archaeon Thermococcus litoralis at 1.85 A.
pubmed doi rcsb
source organism Thermococcus litoralis
molecule tags Sugar binding protein
total genus 144
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A01
3UGWA 5H8FB 2Z23A 2O7UA 1H45A 1LAXA 2R71A 1B5HA 1EU8A 5AA1A 4X48A 5EHSA 1MS7A 4LATA 3MVYA 4R73A 5AA4A 3DM0A 1Y1ZA 5I58B 4QFOA 1LCFA 1OQGA 4H6DA 1Z7ME 3MC2A 5DEXA 3PUVE 1PB8A 4O3AA 1WDNA 1B58A 4ZS9A 2PYYA 2ANJA 2VP1A 3I3VA 4Q5TA 1QULA 2F6GA 3RGYA 4IO2A 3VE1B 4YU0A 4AQ4A 1B51A 3TODA 3ILTB 5I59A 4R74A 1BKAA 3IORA 2Y7RA 4G68B 1S9TA 1DPPA 5L9MA 1IIWA 1ZLQA 2Y7PA 2RCAA 5H8HB 3O97A 1MQJA 3TEPA 3PPNA 4EQ7A 1FTOA 4YMAA 4PFTA 1BIYA 4NF6A 4DE8A 3PUXE 2AIXA 1O63A 1MQIA 2CMOA 4ZZAA 4LP2B 4KR5A 1B4HA 3DP4A 3M3KA 1F9BA 4F1VA 1JETA 3MP6A 2DYXA 3C35A 4QFLA 1WODA 2RC9A 1FQCA 5AE4A 3K00A 4G68A 5CM6A 3C4MA 4IB2A 2IA4A 4OTEA 4PE5B 3IO4A 1FTMA 1EH3A 1ZKBA 5H8HA 3HN0A 3FXQA 1DTGA 4ZZEA 2HZLA 3K01A 1JEVA 3PPQA 1SW2A 4GL0A 2VD2A 1A8EA 2W7YA 4ZDMA 1GVCA 1I69A 5KCJB 4EF1A 2P0SA 1Y9UA 3TELA 4ZEKA 2DE2A 4NF8B 3LSWA 2VHAA 3K4UA 4F18A 5CC2A 5A5XA 3GBBA 2NVUB 1IXIA 5FTHA 1O7TA 2XD2A 4EXLA 3JYRA 1P1QA 1B52A 3EPEA 5DVJA 1B5IA 5HPQA 1IEJA 4YB6A 4PETA 1SW4A 1J1NA 1B7ZA 3V83A 3O29A 1B4ZA 4N13A 5LOMA 1QW0A 2A5TB 4OVJA 5KCJA 3O2AA 4HTGA 2QMWA 4OQOA 2F7AA 4FJPA 1IXGA 2OCUA 1N84A 4NF8A 4U4SA 4BDMA 1Y4CA 3TTNA 3H6VA 4TLLB 3MJNA 2RC7A 2XHDA 1M5BA 1USYH 4NMYA 1GR2A 3ILUB 2F34A 1TFDA 3E13X 1POTA 3MZ9A 4IO6A 3UN6A 3MPLA 4YICA 1RYOA 3IO6A 4JB7A 2HEUA 3PPOA 1UQWA 4NF5B 4X1DA 3K0VA 2A5TA 2I6EA 4IGRA 1JW1A 5I84A 5H8SA 1MQHA 4R6HA 4AB6A 4HW8A 1ELJA 2O1LA 2XD3A 3Q27A 4GWOA 3QSLA 1EZ9A 2YJPA 2Z22A 3KEIA 2XX9A 4IO4A 4QSDA 4LQ2A 1IUDA 4JXIA 2KLFA 2RINA 3U94A 3E9XA 4WEPA 2X26A 2QL3A 3FJMA 3GBAA 5H8NA 4IO5A 4OFJA 2UVHA 3IX1A 3H3GA 2D5WA 1ZBMA 5H8QB 3O6HA 1LFHA 1QUKA 2H25A 2FYIA 1SD3A 1R6ZA 1Y1MA 4BDOA 1SYHA 4EQBA 4ESWA 1MXUA 3JV9A 2F8DA 1XVXA 4F3SA 4XKNA 3FZVA 4OYVA 3M3LA 1JW5A 3H6WA 3PD9A 4F3GA 2XXXA 4R9GA 3SEVA 1TT1A 1LAHE 3HV1A 3VVFA 4EF2A 4OFLA 3PV0E 3G7WA 4KI0E 1N3XA 3IB1A 3S4UA 5CMKA 1A7LA 2QSXA 4JWXA 4L17A 3TPAA 1N7XA 1I6BA 4I9DA 1B6HA 3VDFA 4HS7A 3CRBA 1AOVA 3HO7A 4KFQA 1FTKA 1P1NA 1Y20A 1MH3A 4MBPA 1LFGA 5CRYA 3CFXA 3VFJA 2UXAA 3TYHA 2PVUA 4GLIA 1NNFA 3U1OA 2XXTA 3K6XA 3HHGA 3D4GA 2H98A 5ICQA 1A99A 3HSTA 1II5A 2UVGA 2DE3A 1DSNA 1DMBA 1UTBB 4XKRA 4WEDA 5KDTB 1QJMA 4F22A 1XC1A 5ELVA 3C32A 1AH5A 3OELA 4KPTA 3QK6A 4RYAA 1AMFA 3B6TA 3MPKA 3C34A 1MDQA 1A54A 2F97A 4AB5A 3LR1A 5JK4A 2HFBA 5IKBA 3H6TA 3TTKA 3ZS6A 1M5CA 4THIA 3CIJA 4ELPA 3Q29A 3QIMA 3IOVA 4YKKA 3O6GA 5AA3A 1OLCA 4POXA 5DVFA 2Q9TA 4Z7EA 4OERA 4OWDA 1UTBA 4H67A 3B6QA 5KDTA 3OSRA 3U8QA 1MPBA 3CSGA 3MVWA 4IO7A 4U1ZA 1T0KA 2V3UA 3OSQA 1MDP1 1IITA 1P99A 3O9PA 4QHQA 3G3IA 3FGSA 3KSJA 5CMMA 2QMXA 2D21A 1R1NA 2OZZA 5DEXB 4NTLA 2OWTA 2A5SA 1Z7NE 2Z8FA 3OD7A 3TKDA 4PFUA 5I57B 2I48A 2V3TA 1H44A 3UK4A 1FQEA 3OEMA 3LSXA 4ELQA 3KBRA 5K2XA 5DT6A 4FE8A 3IOWA 5I59B 4GL8A 1D3KA 4P0GA 2X7QA 1B1XA 3KOSA 4YMBA 2ZNUA 1A55A 1Y3PA 3KOTA 1RYXA 3A3CA 4KYEA 1HSEA 4NF6B 4BDRA 2QJEA 4EQ9A 2OLBA 3TTRA 4ESXA 5I57A 2HAUA 1VFEA 3R6UA 4QRZA 2B65A 5DYHA 4LVQA 1M5DA 1MY2A 3UIFA 1ZTYA 4TQUQ 2G29A 3K1NA 2Y84A 2Y7WA 2RCBA 1B3FA 4I62A 4XTCQ 3KJTA 3U72A 1ZMGA 4ZE8A 2I4CA 3ECRA 1VSOA 1FTLA 5ITOA 4LUBA 4GXSB 2Q88A 4JBZA 4XKQA 3OENA 4P0IA 3PUZE 1VFDA 4G77A 1MRPA 4R6YA 4H8JA 2ONSA 2LAOA 2RF1A 2GFEA 3FXUA 3V5AA 1PB9A 4G8MA 3FVKA 1LAFE 1I6AA 4LZ7A 3F11A 3BKIB 3SDFA 4FIMA 2H5YA 5TPAB 2PMSA 5A5XB 5CBSA 4F31B 2XXWA 3KN7A 4RPOA 1B7UA 3LBSA 3T9VA 2OJTA 4R72A 2V84A 4P11A 4I1DA 2F35A 3FIRA 1PB7A 1MPDA 4DXUA 3QYTA 2PT2A 1URSA 4IO3A 3EQ1A 4KYSA 1FQDA 2Z8EA 2GRVA 1B46A 1OVBA 5L9SA 4M4GA 1MQDA 5TPAA 3G3GA 3V89B 2XXIA 2O69A 3K1PA 4R75A 3IB0A 5TP9B 2I0CA 4HCWA 3CG3A 3MW0A 5BWJA 1Q1KA 4LA9A 5CMCA 3OXNA 3B7DA 3MZBA 3OOAA 1JEUA 3IK6B 3V8XB 3T9HB 3KSXA 4POWA 1VE4A 3Q26A 4YB7A 3LSFB 1BLFA 3KG2A 3TFLA 1SW5A 2UVJA 4TOZA 4LONB 1NFTA 2DVCA 3FJGA 1SBPA 4ZE9A 3T96B 3P7IA 3I6VA 5FTIA 2RC8A 5CBRA 4QFPA 1URDA 1DPEA 4U22A 5TP9A 3RTWB 1UIVA 4U4XA 1PBQA 3FASA 1RKMA 2OWSA 4I8CA 1B5JA 2XXUA 4RY1A 2UYEA 1QUIA 2ZNTA 4F19A 1FW0A 5H8NB 5KZTA 1VR5A 3GXAA 3U92A 2V25A 4PFWA 1SDXA 2PT1A 1NNPA 1TXFA 4XIGQ 1FQBA 1MH4A 3MP1A 1DTZA 4NWDA 4KQPA 1A8FA 2DS9A 1I6QA 3FVOA 3QUFA 4GVOA 5DTBA 4H5FA 4KHZE 3RTFB 3SEUA 2P2AA 4ZECA 1A40A 3RN8A 4XKPA 1MY1A 3FUZA 3O66A 1H3DA 2R6GE 5L8DA 3LSLA 2ZMBA 1OIBA 4MFIA 3VXBA 3N26A 2I58A 1ANFA 2F5XA 3DP6A 3D4CA 1MXWA 2DSFA 1MY0A 3E4RA 3G3JA 5FHNA 2IEEA 3S9LC 5B7DA 2DWAA 1FCKA 1MY3A 1KWHA 4U23A 2ZYNA 3HPIA 1XT8A 2RKMA 3MVZA 4OXVA 3ZKLA 3CG1A 3MUQA 2QS1A 4R2FA 4ZEBA 1B3LA 1SQYA 2FNCA 2Q89A 2HQ0A 5DVIA 2B3BA 3TCFA 5CMBA 1JQFA 2Q2AA 1AIVA 2ONKE 3IOTA 1TFAA 4G8HA 2ZXTA 3G3HA 4DZ1A 3K02A 3L6HA 2YLNA 4G8NA 4G68C 4JSDA 1YCJA 1D9YA 1BTJA 4EXKA 2AL5A 4NE4A 1IXHA 3JZJA 2XXVA 4ELOA 1US4A 4DIGA 4M1VA 1GGGA 3KN8A 1FQFA 2XXHA 4YKJA 1L5TA 4YKPA 1M5FA 1US5A 3PMVA 1OVTA 3Q28A 3MAMA 3RUMA 3H7MA 2F7CA 1MG1A 4R9FA 1NNTA 2E1SA 3OO9A 4FECA 3CR9A 3T9UA 2ZYOA 1P1UA 2F78A 2QPQA 3UP9A 5M2VA 3RT6B 3PGFA 3TZAA 1YAEA 3PMWA 1NKXA 1IZ1A 2NOOA 1BP5A 3TMGA 2NWJA 2V3QA 3L6GA 3TQLA 3BFUA 3E3KA 3PUYE 3WAFA 4H5GA 4E0WA 4F3BA 5I2KB 3KFMA 1XOCA 4F29A 1SI1A 4OZ9A 4RK2A 4C0RA 4GFRA 3FJ7A 3TAJA 2GH9A 3TQWA 1JNFA 1NNKA 3VVEA 3M8UA 1ZJLA 3MBPA 4DCXA 1OQHA 3IAZA 5IAIA 3U93A 2OK2A 2DWHA 3RQTA 3FVGA 4NEDA 3C31A 1PBPA 1Y3QA 4KCCA 4F2OA 5JEIA 5I2KA 4RXLA 3EHSA 3PMXA 3MWBA 1PEBA 4LQ5A 5FHMA 4BLAA 4GIZA 5F7VA 4WXJA 4H65A 1MXZA 3OMBA 3K6WA 3KN3A 4RNSA 4GRKA 4HCYA 2CZLA 4DXBA 1HSJA 4XXUA 3PPRA 4FAJA 3EHTA 4FEDA 1Q35A 2REGA 4OFOA 1LAGE 3SEYA 4ONYA 3A09A 5F1QA 3W9VA 3QXMA 2DP8A 1LFIA 3MQ9A 1B3GA 5L9OA 1Y4TA 4ZEIA 3VXCA 1OLAA 3H6UA 4C1UA 3RLFE 5H8FA 5BUUA 5HBCA 3SEXA 2DOJA 1QVSA 1FTJA 4UACA 3EN3A 4PP0A 3RNNA 1M5EA 1B40A 1P1WA 4BDLA 3RY3A 3OO8A 5I58A 4LZ5A 1TWYA 2HAVA 3IL1B 1NMUA 3ONMA 4KD5A 4YZZA 5B70A 4GQOA 4QSEA 3T66A 2FA7A 4N07A 1URGA 4YKIA 1SVXB 4OEVA 3USDA 2HZKA 1D9VA 3TTLA 2I3WA 3N5LA 3MVXA 3UA8A 4F3PA 1AL3A 4R2BA 1B0LA 2XXPA 5ICTA 1CB6A 4IY6A 1LSTA 3C36A 2VD3A 3CFLA 4YB5A 2VOZA 4O3CA 5CI5A 3VLVA 3GZGA 3EF7A 1B3HA 4WKMA 4GF8A 4MLQA 2NUVA 3FV1A 1LGBC 3S9NC 3PU5A 3H4ZA 3IB2A 2DVZA 1B32A 1D4NA 3T93B 3S9EA 2QS2A 3SESA 3TCGA 3CFZA 4QFKA 2XXYA 1H76A 4QFNA 4F39A 1MM7A 3B6WA 3OEKA 3VV5A 3PPPA 3KZGA 2UVIA 2ESNA 3LUYA 3UORA 4RPNA 4YAHX 3IR1A 4ND9A 3O6IA 2D3IA 1XVYA 3ZSFA 1POY1 1CE2A 1JVYA 3C9HA 4QSCA 3FATA 4F1UA 3Q25A 4NWCA 4ZEDA 2GHBA 3G3KA 3N94A 1XS5A 2I0BA 3QUJA 1O64A 4PQJA 3T22A 4KYDA 1B7HA 2G93A 3SEWA 3DP8A 4H1XA 1IXCA 2ZYMA 2HXWA 2I4BA 3TDJA 3S2VA 4GD5A 3CVGA 2X7PA 4GXAA 4RA1A 3T9XB 5TU0A 5J1DA 4Q0CA 3VLUA 3RPWA 2DQVA 1R9QA 1MPCA 5AA2D 1H43A 3BFTA 4BDNA 3LC8A 4ISUA 4F1YA 2BJJX 3PD8A 4JWOA 3M3FA 4N6PA 5HM4B 5AA2B 1NH7A 1GTKA 2P1SA 2F7BA 3QAXA 3SKPA 4GOTA 4TLMB 1USYE 1NL5A 3A3UA 2HCAA 4Q30B 4MF3A 1JW4A 2DWIA 1GV8A 2Y7IA 4NF4B 1UIUA 1ZU0A 4R6KA 5I2NB 1N76A 3MZ1A 1DOTA 5ITPA 4K3FA 2DWJA 2QS4A 4E0XA 3FXRA 3FV2A 1MQGA 2Q2CA 5JTYB 2E0SA 1B2HA 4JWYA 2B3FA 3H06B 3SERA 2XXQA 1LLSA 3C33A 4OHNA 3THIA 4OMBA 4ZEFA 5AA2A 2PX1A 2F6PA 1LCTA 3AXFA 4NF5A 2XX8A 3TCHA 4H8IA 2ONRA 3OO6A 4Z0IA 4ELRA 2Z8DA 2F36A 3PUWE 1EZOA 2YPNA 3O28A 4DCYA 4NF4A 4IY5A 4O3BA 1LBCA 3FD3A 2QS3A 5FHOA 5I2NA 1MXXA 3GLBA 2AYSA 3DELB 4FATA 4Q8RA 1N04A 4H0WA 4ECFA 1JVXA 1B05A 3S9MC 2O51A 2H9BA 5JTYA 3R26A 3WAEA 5EHMA 2WKYA 4G4PA 3K6VA 1S50A 3MP8A 2ABHA 1S7YA 3BBRA 1N7WA 4U2RA 1P1OA 4UA8A 3VLWA 1QUJA 2O6AA 3TTMA 3IJOB 1ZIUA 3FVNA 3G3FA 1B3EA 2DE4A 2ZYKA 3HHFA 4FORA 4F2QA 1B1HA 5H8QA 1R9LA 4RK9A 4QF9A 1FQAA 4LZ8A 1MM6A 1B9JA 4RJZA 3HCQA 3IOUA 2PBWA 2AL4A 3W9WA 5K2YA 4DDDA 2VGQA 1IQ7A 1LB8A 3ZKKA 3TUSA 3H03A 1MY4A 1N3WA 4C1TA 2O7IA 3K2DA 1MXYA 4JDFA 1YTVA 3EHUA 4U1OA 3CI8A 1UTHB 2DXRA 1LBBA 1SI0A 4OEUA 1QKAA 4DLDA 1SYIA 4DXCA 2ALUA 2DXYA 2O1MA 4X1BA 4OENA 2O68A 5ISUA 2UYFA 3K6UA 3N6UA 4OESA 1XHYA 1SW1A 2QRYA 2I3VA 3KGCA 1B0HA 4MLVA 4EDPA 3ODBA 1PC3A 4X9TA 3K1MA 2XX7A 1HSLA 3SETA 2THIA 1WVJA 2I49A 1ATGA 1PDAA 4EUOA 3W15C 1N0TA 4KCDA 3R7XA 2XXRA 4G2ZA 2O84X 5I56B 4OETA 4JSOA 2ZNSA 1OMPA 1UTHA 1QKBA 3VVDA 2R9JA 1NH8A 3IJXB 5EYFA 1Y3NA 2H99A 1YPNA 4IGTA 3CSBA 5AA4B 2REJA 2V93A 2Y7KA 4MH5A 3OO7A 2OBGA 2M8CA 3I5OA 4BDQA 1LB9A 4PFYA 4FEBA 2GHAA 1EZPA 3DLNA 1MXVA 3KJ7A 4U21A 3RT8A 2Q8JA 5I56A 2H4IA 3N6TA 2NXOA
chains in the Genus database with same CATH superfamily
3UGWA 5H8FB 2Z23A 2O7UA 1H45A 1LAXA 2R71A 1B5HA 1EU8A 5AA1A 5EYHA 4GWWA 4X48A 5EHSA 1MS7A 4LATA 3MVYA 4R73A 2ZZWA 5AA4A 3DM0A 1Y1ZA 5I58B 4QFOA 1LCFA 1OQGA 4H6DA 1Z7ME 3MC2A 5DEXA 5EQAA 3T1BA 1FRPA 3PUVE 1PB8A 4O3AA 4DI3D 1WDNA 4MCOA 1B58A 1FPJA 4ZS9A 2PYYA 2ANJA 2VP1A 3I3VA 1INPA 4Q5TA 1QULA 2F6GA 3RGYA 4IO2A 3VE1B 4YU0A 4AQ4A 1B51A 5I3SA 3ILTB 3TODA 5I59A 4R74A 1BKAA 1FPBA 3IORA 2Y7RA 2L5VA 4G68B 1S9TA 1DPPA 4GWSA 5L9MA 1IIWA 1ZLQA 2Y7PA 2RCAA 5H8HB 3O97A 1MQJA 3TEPA 3PPNA 2FIXA 4EQ7A 1FTOA 4YMAA 4PFTA 1BIYA 4NF6A 2KR0A 4DE8A 3PUXE 2AIXA 1O63A 1NUXA 1MQIA 2CMOA 5IZ1A 4ZZAA 4LP2B 4KR5A 1B4HA 3DP4A 3CHGA 3M3KA 1F9BA 4F1VA 1JETA 3MP6A 2DYXA 3C35A 4QFLA 1WODA 2RC9A 1FQCA 5AE4A 3K00A 4G68A 5CM6A 3C4MA 4IB2A 2IA4A 4OTEA 4PE5B 3IO4A 1FTMA 1EH3A 4GBWA 1ZKBA 5H8HA 3HN0A 3FXQA 1DTGA 4ZZEA 1SPIA 2HZLA 1G0IA 4JVIA 3K01A 2KQZA 1JEVA 3PPQA 1SW2A 2XWKA 3KC0A 4OVQA 4GL0A 4HXVA 2VD2A 1A8EA 4MX6A 2W7YA 4ZDMA 1GVCA 1I69A 5KCJB 4EF1A 2P0SA 4AS5A 1Y9UA 3TELA 4ZEKA 2DE2A 4XEQA 4NF8B 3LSWA 2VHAA 3K4UA 4F18A 5CC2A 4P1EA 5A5XA 3GBBA 4NX1A 2NVUB 1IMEA 1IXIA 5FTHA 1O7TA 2XD2A 4EXLA 3JYRA 4N8YA 1P1QA 1B52A 3EPEA 5DVJA 1NV1A 4PF8A 5T3JA 1B5IA 5HPQA 1IEJA 4YB6A 4PETA 1SW4A 4PF6A 1J1NA 1B7ZA 3V83A 3O29A 1B4ZA 4N13A 5LOMA 1QW0A 2GQ1A 2A5TB 4OVJA 5KCJA 3O2AA 4HTGA 2QMWA 4OQOA 2F7AA 5IM2A 4FJPA 1IXGA 2OCUA 2CEXA 1IMDA 1N84A 4NF8A 4U4SA 4BDMA 1Y4CA 3TTNA 2XA5A 3H6VA 4TLLB 3MJNA 2RC7A 2XHDA 1M5BA 1USYH 4NMYA 1GR2A 3ILUB 4H45A 2F34A 1TFDA 3E13X 1POTA 3MZ9A 4IO6A 3UN6A 3MPLA 4YICA 1RYOA 3IO6A 4JB7A 2HEUA 3PPOA 1UQWA 4NF5B 4X1DA 3K0VA 2A5TA 4OA4A 2Q74A 2I6EA 4IGRA 1JW1A 5I84A 3BIHA 5H8SA 1MQHA 4R6HA 4AB6A 4HW8A 1ELJA 2O1LA 2XD3A 3Q27A 4GWOA 3QSLA 1EZ9A 4NG7A 2YJPA 2Z22A 3KEIA 2XX9A 4IO4A 2Y5LA 1BK4A 4I3EA 4QSDA 4LQ2A 1IUDA 4JXIA 2KLFA 2RINA 3U94A 3E9XA 4GBVA 4WEPA 2X26A 2QL3A 3FJMA 4GWUA 3GBAA 5H8NA 5FBPA 4IO5A 4OFJA 2UVHA 3IX1A 3H3GA 5LDZA 1FPKA 3U65A 2D5WA 1ZBMA 5H8QB 3O6HA 1LFHA 1QUKA 2H25A 2FYIA 1SD3A 1R6ZA 1Y1MA 4BDOA 3HFUA 4JVDA 1SYHA 4EQBA 4ESWA 1MXUA 3JV9A 2F8DA 1XVXA 4F3SA 4XKNA 3FZVA 4OYVA 2FVZA 2CZHA 3M3LA 1JW5A 3H6WA 3PD9A 4F3GA 2XXXA 4R9GA 3SEVA 1TT1A 1LAHE 3HV1A 3VVFA 4EF2A 4OFLA 1DCUA 3PV0E 3G7WA 4KI0E 1N3XA 3IB1A 3S4UA 5CMKA 1A7LA 2QVVA 2QSXA 3B8BA 4JWXA 4L17A 3TPAA 1N7XA 1I6BA 4I9DA 1B6HA 3VDFA 4HS7A 3CRBA 1AOVA 3HO7A 4KFQA 1FTKA 1P1NA 5ET6A 1Y20A 1MH3A 4MBPA 1LFGA 5CRYA 3CFXA 3VFJA 2UXAA 3TYHA 2PVUA 4GLIA 1NNFA 3U1OA 2XXTA 3K6XA 3HHGA 1LBWA 3D4GA 4O94A 1EYKA 2DDKA 2H98A 5ICQA 1A99A 1VDWA 3HSTA 1II5A 2UVGA 2DE3A 1DSNA 1DMBA 1UTBB 4XKRA 4WEDA 5KDTB 1NUZA 1QJMA 4F22A 1XC1A 5ELVA 3C32A 1AH5A 3OELA 4KPTA 3QK6A 4RYAA 1AMFA 3B6TA 4PTKA 3MPKA 3C34A 1MDQA 1A54A 4NGUA 2F97A 4AB5A 3B50A 4FBPA 3LR1A 5JK4A 1NI9A 2HFBA 5IKBA 3H6TA 3TTKA 4N6DA 3ZS6A 1M5CA 4THIA 3CIJA 4ELPA 3Q29A 3QIMA 3IOVA 4YKKA 3O6GA 5AA3A 1OLCA 4POXA 5DVFA 2Q9TA 4Z7EA 4OERA 4OWDA 1UTBA 4H67A 3B6QA 5KDTA 3OSRA 3U8QA 4N81A 1MPBA 3CSGA 3MVWA 4IO7A 4U1ZA 5IZ3B 1T0KA 2V3UA 3OSQA 1MDP1 1IITA 1P99A 2HXRA 3O9PA 4QHQA 3G3IA 3FGSA 3KSJA 5CMMA 3IFCA 2QMXA 2D21A 1R1NA 2OZZA 4N8GA 5DEXB 4NTLA 2OWTA 2A5SA 1Z7NE 2Z8FA 3OD7A 3TKDA 4PFUA 5I57B 4PAIA 2I48A 2V3TA 1H44A 3UK4A 1FQEA 3OEMA 3LSXA 4ELQA 5ET8A 3KBRA 5K2XA 5DT6A 1FBHA 4FE8A 3IOWA 5I59B 4GL8A 1FJ9A 1FBPA 1RDYA 1D3KA 4P0GA 2X7QA 1B1XA 3KOSA 4YMBA 5IZ3A 4N17A 2ZNUA 1A55A 1Y3PA 3KOTA 1RYXA 3A3CA 4KYEA 1HSEA 4NF6B 1FPDA 3BIGA 4BDRA 2QJEA 4EQ9A 2OLBA 4MNIA 2XWVA 3TTRA 4ESXA 5I57A 4JVCA 2HAUA 1VFEA 3R6UA 4QRZA 1FBDA 4P8BA 2B65A 5DYHA 4LVQA 1M5DA 1MY2A 5ET7A 3UIFA 1ZTYA 4TQUQ 2G29A 3K1NA 2Y84A 4NN3A 2QFLA 2Y7WA 2RCBA 1B3FA 4I62A 4XTCQ 3KJTA 3U72A 4PFBA 1ZMGA 4ZE8A 2I4CA 3ECRA 1VSOA 1FTLA 5ITOA 4LUBA 4GXSB 2Q88A 4JBZA 4XKQA 1NV5A 3OENA 4P0IA 3PUZE 1VFDA 4G77A 1MRPA 4R6YA 4H8JA 2ONSA 2LAOA 2RF1A 2GFEA 3FXUA 3V5AA 1PB9A 4G8MA 3FVKA 1LAFE 5EQ7A 1I6AA 4LZ7A 3F11A 1FPIA 3BKIB 3SDFA 4FIMA 2H5YA 5TPAB 2PMSA 1LBZA 5A5XB 5CBSA 4F31B 2XXWA 1FSAA 3KN7A 4RPOA 1B7UA 3LBSA 3T9VA 2OJTA 4R72A 2V84A 4P11A 3LUZA 4PDDA 4I1DA 2F35A 3FIRA 1PB7A 3GYYA 1MPDA 5IZZA 4DXUA 3QYTA 2PT2A 2WEFA 1URSA 4IO3A 3EQ1A 4KYSA 1FQDA 2Z8EA 3E79A 2GRVA 4OVSA 4PBQA 1B46A 1OVBA 5L9SA 4M4GA 1MQDA 5TPAA 3G3GA 3V89B 4QXDA 2XXIA 2O69A 3K1PA 4R75A 3D1RA 3IB0A 5TP9B 2I0CA 2VPNA 4HCWA 3CG3A 3MW0A 5BWJA 1QGXA 1Q1KA 4LA9A 5CMCA 3OXNA 2B4LA 3B7DA 3MZBA 3OOAA 1JEUA 3IK6B 3V8XB 3T9HB 3KSXA 4XF5A 4POWA 1VE4A 3Q26A 4YB7A 3LSFB 1BLFA 3KG2A 1EYJA 3TFLA 1SW5A 2UVJA 4TOZA 4LONB 1NFTA 2DVCA 3FJGA 1SBPA 4ZE9A 3T96B 3P7IA 3I6VA 5FTIA 4MJOA 4OVRA 2RC8A 5CBRA 4QFPA 1KA1A 1URDA 2ZZXA 1DPEA 4U22A 5TP9A 3RTWB 4N91A 1UIVA 4U4XA 1PBQA 3FASA 1RKMA 2OWSA 4I8CA 1B5JA 2XXUA 4RY1A 2UYEA 4PFIA 1QUIA 2ZNTA 4I40A 4F19A 1FW0A 5H8NB 5KZTA 1IMBA 1VR5A 3GXAA 3U92A 5IGAA 1G0HA 2V25A 4PFWA 1SDXA 2PT1A 1NNPA 1TXFA 4XIGQ 1FQBA 1MH4A 3MP1A 1DTZA 4NWDA 3LV0A 4KQPA 1A8FA 2DS9A 1I6QA 3FVOA 3QUFA 4GVOA 5DTBA 4H5FA 4KHZE 4O7MA 3RTFB 3SEUA 2F3DA 2P2AA 4ZECA 1A40A 3RN8A 4XKPA 1MY1A 3FUZA 3O66A 1H3DA 2R6GE 5L8DA 3LSLA 4GWZA 2ZMBA 1OIBA 4MFIA 3VXBA 3N26A 2I58A 1ANFA 1NV0A 2F5XA 3DP6A 3D4CA 1DBZA 1MXWA 2DSFA 5A5LA 1MY0A 3E4RA 3G3JA 5FHNA 2IEEA 4PC9A 3S9LC 5B7DA 2DWAA 1FCKA 1AWBA 4MIJA 1MY3A 1KWHA 4N6KA 4U23A 2ZYNA 3HPIA 1XT8A 2RKMA 3MVZA 4OXVA 4GX6A 3ZKLA 3CG1A 2XWIA 2WBBA 4G61A 5EQ9A 2QVRA 3MUQA 2QS1A 4R2FA 4ZEBA 1B3LA 1SQYA 2Y5KA 2FNCA 1JP4A 2Q89A 4AS4A 2HQ0A 5DVIA 2B3BA 1DK4A 3TCFA 5CMBA 1JQFA 2Q2AA 4OVTA 1AIVA 2ONKE 3IOTA 1TFAA 4G8HA 1IMCA 3MYUA 2ZXTA 5I7IA 3G3HA 4DZ1A 3K02A 3L6HA 1NUYA 2YLNA 4G8NA 4G68C 4JSDA 4NF0A 4GWYA 1YCJA 3A29A 1D9YA 1IMFA 1BTJA 4MNPA 4EXKA 2AL5A 4NE4A 1IXHA 3JZJA 2XXVA 4ELOA 1US4A 4DIGA 4M1VA 1GGGA 3KN8A 2R8TA 1FQFA 2XXHA 4YKJA 1L5TA 1NV6A 4YKPA 1M5FA 1US5A 3PMVA 1YZ0A 1OVTA 1RDZA 3Q28A 3MAMA 3RUMA 2XXKA 3H7MA 1FPGA 2F7CA 4DI4B 1MG1A 4R9FA 1NV4A 1NNTA 2E1SA 1FPEA 3OO9A 2XWOA 4FECA 2HHMA 3CR9A 3T9UA 2ZYOA 4PAFA 1P1UA 3RPLB 2F78A 5ET5A 2QPQA 4HE2A 1NV7A 4P47A 3UP9A 5M2VA 3RT6B 3PGFA 1YYZA 3TZAA 1YAEA 3PMWA 1NKXA 1IZ1A 2NOOA 1BP5A 4PDHA 3TMGA 2NWJA 3KC1A 2B4MA 2V3QA 4PBHA 3L6GA 3TQLA 3BFUA 3E3KA 3PUYE 3WAFA 4H5GA 4E0WA 4F3BA 5I2KB 3KFMA 1Q9DA 1XOCA 4HE1A 4F29A 1SI1A 4OZ9A 4RK2A 3RPLA 4C0RA 4GFRA 3FJ7A 1FPLA 4MMPA 3TAJA 4MHFA 2GH9A 3TQWA 4P56A 4MEVA 1JNFA 1NNKA 1XI6A 3VVEA 4O8MA 3M8UA 1ZJLA 4UABA 3MBPA 4DCXA 1OQHA 4OVPA 3IAZA 5IAIA 3U93A 1NUWA 2OK2A 2DWHA 3RQTA 3FVGA 4PAKA 4NEDA 1LBVA 3C31A 2WBDA 1PBPA 1Y3QA 4KCCA 4F2OA 5JEIA 2F3BA 5I2KA 4RXLA 3EHSA 3PMXA 3MWBA 1PEBA 4LQ5A 3QMFA 2FBPA 5FHMA 4BLAA 4GIZA 5F7VA 4WXJA 1RDXA 4H65A 1MXZA 3OMBA 4PGPA 3K6WA 3KN3A 4RNSA 4GRKA 4HCYA 2CZLA 4DXBA 1HSJA 4XXUA 3PPRA 4FAJA 3EHTA 4FEDA 1FPFA 3ROJA 1Q35A 2PCRA 2REGA 4OFOA 1LAGE 3SEYA 3FBPA 4ONYA 3A09A 5F1QA 3W9VA 2FIEA 3QXMA 2DP8A 1LFIA 3MQ9A 1B3GA 5L9OA 1Y4TA 4ZEIA 3VXCA 1OLAA 3H6UA 1K9ZA 4C1UA 5DW8A 3RLFE 5H8FA 4NHBA 5BUUA 5HBCA 3SEXA 2DOJA 1QVSA 1FTJA 4UACA 3EN3A 4PP0A 4PCDA 3RNNA 1M5EA 1B40A 1P1WA 4BDLA 3RY3A 3OO8A 5I58A 1KA0A 2QVUA 1FBCA 4LZ5A 1TWYA 2HAVA 4MAGA 2CZIA 3IL1B 1NMUA 3ONMA 4KD5A 4YZZA 5B70A 3NOHA 4GQOA 4QSEA 2CZKA 3T66A 2FA7A 5I5PA 4N07A 1URGA 4YKIA 1SVXB 4OEVA 4GX3A 1CNQA 3USDA 2HZKA 1D9VA 3TTLA 2I3WA 3N5LA 3MVXA 3UA8A 4MNCA 4F3PA 1AL3A 4R2BA 5EQ8A 1B0LA 2XXPA 5ICTA 1CB6A 4IY6A 1LSTA 3C36A 2VD3A 3CFLA 4YB5A 4GX4A 2VOZA 4O3CA 5CI5A 4X04A 3VLVA 3GZGA 3EF7A 1B3HA 4WKMA 4GF8A 4MLQA 2NUVA 3FV1A 1LGBC 3S9NC 3PU5A 3H4ZA 3IB2A 2DVZA 1B32A 1FJ6A 1D4NA 3T93B 3S9EA 2QS2A 3SESA 3TCGA 3CFZA 2CEYA 4P9KA 4QFKA 2XXYA 1H76A 4QFNA 3SZPA 4F39A 1MM7A 2BJIA 3B6WA 3OEKA 3VV5A 3PPPA 3KZGA 2UVIA 2ESNA 3LUYA 3UORA 4RPNA 4YAHX 3IR1A 4ND9A 3O6IA 2D3IA 3MSTA 1XVYA 3ZSFA 1POY1 1CE2A 2OWZA 1JVYA 3C9HA 4QSCA 3FATA 4F1UA 4PFRA 1FTAA 3Q25A 4NWCA 2GHBA 1YXIA 3G3KA 4ZEDA 3N94A 1XS5A 2I0BA 3QUJA 1KZ8A 1O64A 4PQJA 3T22A 5LTCA 4KYDA 1B7HA 2G93A 3SEWA 3DP8A 4H1XA 1IXCA 2ZYMA 2HXWA 2I4BA 3TDJA 1NV2A 3S2VA 4NAPA 4GD5A 4PE3A 3CVGA 3FXBA 3KBZA 2X7PA 4GXAA 4RA1A 4QBAA 3T9XB 5TU0A 5J1DA 2VT5A 4Q0CA 3VLUA 2JJKA 3RPWA 2DQVA 1R9QA 1MPCA 5AA2D 3ISPA 1H43A 3BFTA 4BDNA 3LC8A 4ISUA 3E78A 4F1YA 2BJJX 3PD8A 4JWOA 3M3FA 4N6PA 4PGNA 2PFZA 5HM4B 5AA2B 4N15A 1NH7A 1GTKA 2P1SA 2F7BA 3QAXA 3SKPA 4GOTA 4TLMB 1USYE 1NL5A 3A3UA 2HCAA 4GWXA 4Q30B 4MF3A 1JW4A 2DWIA 1GV8A 2Y7IA 4NF4B 1UIUA 1ZU0A 4R6KA 5I2NB 1N76A 3MZ1A 1DOTA 5ITPA 5F24A 4K3FA 2MKZA 2DWJA 2QS4A 4E0XA 3FXRA 3FV2A 1MQGA 2Q2CA 5JTYB 2E0SA 1B2HA 4JWYA 2B3FA 3H06B 1FBGA 3SERA 2WX9A 2XXQA 1LLSA 3C33A 4OHNA 3THIA 4OMBA 4ZEFA 5AA2A 2PX1A 2F6PA 1LCTA 3AXFA 4XFEA 4NF5A 2XX8A 3TCHA 4H8IA 2ONRA 3OO6A 4Z0IA 4ELRA 2Z8DA 2F36A 3PUWE 1EZOA 2YPNA 3O28A 4DCYA 4NF4A 4IY5A 2V4CA 4O3BA 1LBCA 3FD3A 2QS3A 5FHOA 5I2NA 1MXXA 1K9YA 3GLBA 2AYSA 3DELB 4FATA 4Q8RA 1N04A 4H0WA 4ECFA 1JVXA 1B05A 3S9MC 2O51A 2H9BA 5JTYA 3R26A 3WAEA 2OX3A 5EHMA 2WKYA 4HE0A 1NV3A 4G4PA 3K6VA 1EYIA 1S50A 3MP8A 2ABHA 1S7YA 3BBRA 3PTYA 1N7WA 4U2RA 1P1OA 4UA8A 3VLWA 1LBYA 1QUJA 2O6AA 3TTMA 3IJOB 1ZIUA 3FVNA 3G3FA 1B3EA 2DE4A 2ZYKA 3HHFA 4FORA 4F2QA 1B1HA 5H8QA 1R9LA 5J16A 4RK9A 4QF9A 1FQAA 4LZ8A 1MM6A 1B9JA 4RJZA 3HCQA 3IOUA 2PBWA 2AL4A 3W9WA 4KXPA 2FHYA 4IR8A 4N4UA 5K2YA 5ESYA 2WYKA 4DDDA 2VGQA 1IQ7A 1LB8A 3ZKKA 3TUSA 1IMAA 3H03A 1LEVA 1MY4A 1N3WA 4C1TA 2O7IA 3K2DA 1MXYA 4JDFA 1YTVA 3EHUA 4U1OA 3CI8A 1UTHB 4H46A 2DXRA 1LBBA 1SI0A 4OEUA 1QKAA 4DLDA 1FBFA 1SYIA 4DXCA 2ALUA 2DXYA 2O1MA 4X1BA 4OENA 2O68A 5ISUA 2UYFA 3K6UA 3N6UA 1FBEA 4OESA 4O7IA 1XHYA 5EYGA 1SW1A 2QRYA 2I3VA 3KGCA 1B0HA 4MLVA 4EDPA 3ODBA 1PC3A 4X9TA 3K1MA 2XX7A 1HSLA 2HPGA 3SETA 2P3VA 2THIA 1WVJA 2WYPA 3IFAA 2I49A 2VPOA 1ATGA 1PDAA 4EUOA 3RYDA 4P3LA 3W15C 1N0TA 4KCDA 3R7XA 2XXRA 1LBXA 4G2ZA 2O84X 5I56B 4OETA 4JSOA 2ZNSA 1OMPA 1UTHA 1QKBA 3VVDA 2R9JA 1NH8A 3IJXB 5EYFA 1Y3NA 2H99A 1YPNA 4IGTA 4NQ8A 3CSBA 5AA4B 2PFYA 3T0JA 2REJA 2V93A 2Y7KA 4X8RA 4MH5A 3OO7A 2OBGA 2P3NA 2M8CA 3I5OA 4BDQA 1LB9A 3EKIA 4I3YA 4PFYA 4FEBA 2GHAA 2ZZVA 1EZPA 3DLNA 1MXVA 3KJ7A 4U21A 1D9QA 2Q8MA 3RT8A 4LN5A 4OANA 2Q8JA 5I56A 2H4IA 3N6TA 4P1LA 2NXOA
chains in the Genus database with same CATH topology
3UGWA 5H8FB 2Z23A 2O7UA 1H45A 1LAXA 2R71A 1B5HA 1EU8A 5AA1A 4X48A 5EHSA 1MS7A 4LATA 3MVYA 4R73A 5AA4A 3DM0A 1Y1ZA 5I58B 4QFOA 1LCFA 1OQGA 4H6DA 1Z7ME 3MC2A 5DEXA 3PUVE 1PB8A 4O3AA 1WDNA 1B58A 4ZS9A 2PYYA 2ANJA 2VP1A 3I3VA 4Q5TA 1QULA 2F6GA 3RGYA 4IO2A 3VE1B 4YU0A 4AQ4A 1B51A 3TODA 3ILTB 5I59A 4R74A 1BKAA 3IORA 2Y7RA 4G68B 1S9TA 1DPPA 5L9MA 1IIWA 1ZLQA 2Y7PA 2RCAA 5H8HB 3O97A 1MQJA 3TEPA 3PPNA 4EQ7A 1FTOA 4YMAA 4PFTA 1BIYA 4NF6A 4DE8A 3PUXE 2AIXA 1O63A 1MQIA 2CMOA 4ZZAA 4LP2B 4KR5A 1B4HA 3DP4A 3M3KA 1F9BA 4F1VA 1JETA 3MP6A 2DYXA 3C35A 4QFLA 1WODA 2RC9A 1FQCA 5AE4A 3K00A 4G68A 5CM6A 3C4MA 4IB2A 2IA4A 4OTEA 4PE5B 3IO4A 1FTMA 1EH3A 1ZKBA 5H8HA 3HN0A 3FXQA 1DTGA 4ZZEA 2HZLA 3K01A 1JEVA 3PPQA 1SW2A 4GL0A 2VD2A 1A8EA 2W7YA 4ZDMA 1GVCA 1I69A 5KCJB 4EF1A 2P0SA 1Y9UA 3TELA 4ZEKA 2DE2A 4NF8B 3LSWA 2VHAA 3K4UA 4F18A 5CC2A 5A5XA 3GBBA 2NVUB 1IXIA 5FTHA 1O7TA 2XD2A 4EXLA 3JYRA 1P1QA 1B52A 3EPEA 5DVJA 1B5IA 5HPQA 1IEJA 4YB6A 4PETA 1SW4A 1J1NA 1B7ZA 3V83A 3O29A 1B4ZA 4N13A 5LOMA 1QW0A 2A5TB 4OVJA 5KCJA 3O2AA 4HTGA 2QMWA 4OQOA 2F7AA 4FJPA 1IXGA 2OCUA 1N84A 4NF8A 4U4SA 4BDMA 1Y4CA 3TTNA 3H6VA 4TLLB 3MJNA 2RC7A 2XHDA 1M5BA 1USYH 4NMYA 1GR2A 3ILUB 2F34A 1TFDA 3E13X 1POTA 3MZ9A 4IO6A 3UN6A 3MPLA 4YICA 1RYOA 3IO6A 4JB7A 2HEUA 3PPOA 1UQWA 4NF5B 4X1DA 3K0VA 2A5TA 2I6EA 4IGRA 1JW1A 5I84A 5H8SA 1MQHA 4R6HA 4AB6A 4HW8A 1ELJA 2O1LA 2XD3A 3Q27A 4GWOA 3QSLA 1EZ9A 2YJPA 2Z22A 3KEIA 2XX9A 4IO4A 4QSDA 4LQ2A 1IUDA 4JXIA 2KLFA 2RINA 3U94A 3E9XA 4WEPA 2X26A 2QL3A 3FJMA 3GBAA 5H8NA 4IO5A 4OFJA 2UVHA 3IX1A 3H3GA 2D5WA 1ZBMA 5H8QB 3O6HA 1LFHA 1QUKA 2H25A 2FYIA 1SD3A 1R6ZA 1Y1MA 4BDOA 1SYHA 4EQBA 4ESWA 1MXUA 3JV9A 2F8DA 1XVXA 4F3SA 4XKNA 3FZVA 4OYVA 3M3LA 1JW5A 3H6WA 3PD9A 4F3GA 2XXXA 4R9GA 3SEVA 1TT1A 1LAHE 3HV1A 3VVFA 4EF2A 4OFLA 3PV0E 3G7WA 4KI0E 1N3XA 3IB1A 3S4UA 5CMKA 1A7LA 2QSXA 4JWXA 4L17A 3TPAA 1N7XA 1I6BA 4I9DA 1B6HA 3VDFA 4HS7A 3CRBA 1AOVA 3HO7A 4KFQA 1FTKA 1P1NA 1Y20A 1MH3A 4MBPA 1LFGA 5CRYA 3CFXA 3VFJA 2UXAA 3TYHA 2PVUA 4GLIA 1NNFA 3U1OA 2XXTA 3K6XA 3HHGA 3D4GA 2H98A 5ICQA 1A99A 3HSTA 1II5A 2UVGA 2DE3A 1DSNA 1DMBA 1UTBB 4XKRA 4WEDA 5KDTB 1QJMA 4F22A 1XC1A 5ELVA 3C32A 1AH5A 3OELA 4KPTA 3QK6A 4RYAA 1AMFA 3B6TA 3MPKA 3C34A 1MDQA 1A54A 2F97A 4AB5A 3LR1A 5JK4A 2HFBA 5IKBA 3H6TA 3TTKA 3ZS6A 1M5CA 4THIA 3CIJA 4ELPA 3Q29A 3QIMA 3IOVA 4YKKA 3O6GA 5AA3A 1OLCA 4POXA 5DVFA 2Q9TA 4Z7EA 4OERA 4OWDA 1UTBA 4H67A 3B6QA 5KDTA 3OSRA 3U8QA 1MPBA 3CSGA 3MVWA 4IO7A 4U1ZA 1T0KA 2V3UA 3OSQA 1MDP1 1IITA 1P99A 3O9PA 4QHQA 3G3IA 3FGSA 3KSJA 5CMMA 2QMXA 2D21A 1R1NA 2OZZA 5DEXB 4NTLA 2OWTA 2A5SA 1Z7NE 2Z8FA 3OD7A 3TKDA 4PFUA 5I57B 2I48A 2V3TA 1H44A 3UK4A 1FQEA 3OEMA 3LSXA 4ELQA 3KBRA 5K2XA 5DT6A 4FE8A 3IOWA 5I59B 4GL8A 1D3KA 4P0GA 2X7QA 1B1XA 3KOSA 4YMBA 2ZNUA 1A55A 1Y3PA 3KOTA 1RYXA 3A3CA 4KYEA 1HSEA 4NF6B 4BDRA 2QJEA 4EQ9A 2OLBA 3TTRA 4ESXA 5I57A 2HAUA 1VFEA 3R6UA 4QRZA 2B65A 5DYHA 4LVQA 1M5DA 1MY2A 3UIFA 1ZTYA 4TQUQ 2G29A 3K1NA 2Y84A 2Y7WA 2RCBA 1B3FA 4I62A 4XTCQ 3KJTA 3U72A 1ZMGA 4ZE8A 2I4CA 3ECRA 1VSOA 1FTLA 5ITOA 4LUBA 4GXSB 2Q88A 4JBZA 4XKQA 3OENA 4P0IA 3PUZE 1VFDA 4G77A 1MRPA 4R6YA 4H8JA 2ONSA 2LAOA 2RF1A 2GFEA 3FXUA 3V5AA 1PB9A 4G8MA 3FVKA 1LAFE 1I6AA 4LZ7A 3F11A 3BKIB 3SDFA 4FIMA 2H5YA 5TPAB 2PMSA 5A5XB 5CBSA 4F31B 2XXWA 3KN7A 4RPOA 1B7UA 3LBSA 3T9VA 2OJTA 4R72A 2V84A 4P11A 4I1DA 2F35A 3FIRA 1PB7A 1MPDA 4DXUA 3QYTA 2PT2A 1URSA 4IO3A 3EQ1A 4KYSA 1FQDA 2Z8EA 2GRVA 1B46A 1OVBA 5L9SA 4M4GA 1MQDA 5TPAA 3G3GA 3V89B 2XXIA 2O69A 3K1PA 4R75A 3IB0A 5TP9B 2I0CA 4HCWA 3CG3A 3MW0A 5BWJA 1Q1KA 4LA9A 5CMCA 3OXNA 3B7DA 3MZBA 3OOAA 1JEUA 3IK6B 3V8XB 3T9HB 3KSXA 4POWA 1VE4A 3Q26A 4YB7A 3LSFB 1BLFA 3KG2A 3TFLA 1SW5A 2UVJA 4TOZA 4LONB 1NFTA 2DVCA 3FJGA 1SBPA 4ZE9A 3T96B 3P7IA 3I6VA 5FTIA 2RC8A 5CBRA 4QFPA 1URDA 1DPEA 4U22A 5TP9A 3RTWB 1UIVA 4U4XA 1PBQA 3FASA 1RKMA 2OWSA 4I8CA 1B5JA 2XXUA 4RY1A 2UYEA 1QUIA 2ZNTA 4F19A 1FW0A 5H8NB 5KZTA 1VR5A 3GXAA 3U92A 2V25A 4PFWA 1SDXA 2PT1A 1NNPA 1TXFA 4XIGQ 1FQBA 1MH4A 3MP1A 1DTZA 4NWDA 4KQPA 1A8FA 2DS9A 1I6QA 3FVOA 3QUFA 4GVOA 5DTBA 4H5FA 4KHZE 3RTFB 3SEUA 2P2AA 4ZECA 1A40A 3RN8A 4XKPA 1MY1A 3FUZA 3O66A 1H3DA 2R6GE 5L8DA 3LSLA 2ZMBA 1OIBA 4MFIA 3VXBA 3N26A 2I58A 1ANFA 2F5XA 3DP6A 3D4CA 1MXWA 2DSFA 1MY0A 3E4RA 3G3JA 5FHNA 2IEEA 3S9LC 5B7DA 2DWAA 1FCKA 1MY3A 1KWHA 4U23A 2ZYNA 3HPIA 1XT8A 2RKMA 3MVZA 4OXVA 3ZKLA 3CG1A 3MUQA 2QS1A 4R2FA 4ZEBA 1B3LA 1SQYA 2FNCA 2Q89A 2HQ0A 5DVIA 2B3BA 3TCFA 5CMBA 1JQFA 2Q2AA 1AIVA 2ONKE 3IOTA 1TFAA 4G8HA 2ZXTA 3G3HA 4DZ1A 3K02A 3L6HA 2YLNA 4G8NA 4G68C 4JSDA 1YCJA 1D9YA 1BTJA 4EXKA 2AL5A 4NE4A 1IXHA 3JZJA 2XXVA 4ELOA 1US4A 4DIGA 4M1VA 1GGGA 3KN8A 1FQFA 2XXHA 4YKJA 1L5TA 4YKPA 1M5FA 1US5A 3PMVA 1OVTA 3Q28A 3MAMA 3RUMA 3H7MA 2F7CA 1MG1A 4R9FA 1NNTA 2E1SA 3OO9A 4FECA 3CR9A 3T9UA 2ZYOA 1P1UA 2F78A 2QPQA 3UP9A 5M2VA 3RT6B 3PGFA 3TZAA 1YAEA 3PMWA 1NKXA 1IZ1A 2NOOA 1BP5A 3TMGA 2NWJA 2V3QA 3L6GA 3TQLA 3BFUA 3E3KA 3PUYE 3WAFA 4H5GA 4E0WA 4F3BA 5I2KB 3KFMA 1XOCA 4F29A 1SI1A 4OZ9A 4RK2A 4C0RA 4GFRA 3FJ7A 3TAJA 2GH9A 3TQWA 1JNFA 1NNKA 3VVEA 3M8UA 1ZJLA 3MBPA 4DCXA 1OQHA 3IAZA 5IAIA 3U93A 2OK2A 2DWHA 3RQTA 3FVGA 4NEDA 3C31A 1PBPA 1Y3QA 4KCCA 4F2OA 5JEIA 5I2KA 4RXLA 3EHSA 3PMXA 3MWBA 1PEBA 4LQ5A 5FHMA 4BLAA 4GIZA 5F7VA 4WXJA 4H65A 1MXZA 3OMBA 3K6WA 3KN3A 4RNSA 4GRKA 4HCYA 2CZLA 4DXBA 1HSJA 4XXUA 3PPRA 4FAJA 3EHTA 4FEDA 1Q35A 2REGA 4OFOA 1LAGE 3SEYA 4ONYA 3A09A 5F1QA 3W9VA 3QXMA 2DP8A 1LFIA 3MQ9A 1B3GA 5L9OA 1Y4TA 4ZEIA 3VXCA 1OLAA 3H6UA 4C1UA 3RLFE 5H8FA 5BUUA 5HBCA 3SEXA 2DOJA 1QVSA 1FTJA 4UACA 3EN3A 4PP0A 3RNNA 1M5EA 1B40A 1P1WA 4BDLA 3RY3A 3OO8A 5I58A 4LZ5A 1TWYA 2HAVA 3IL1B 1NMUA 3ONMA 4KD5A 4YZZA 5B70A 4GQOA 4QSEA 3T66A 2FA7A 4N07A 1URGA 4YKIA 1SVXB 4OEVA 3USDA 2HZKA 1D9VA 3TTLA 2I3WA 3N5LA 3MVXA 3UA8A 4F3PA 1AL3A 4R2BA 1B0LA 2XXPA 5ICTA 1CB6A 4IY6A 1LSTA 3C36A 2VD3A 3CFLA 4YB5A 2VOZA 4O3CA 5CI5A 3VLVA 3GZGA 3EF7A 1B3HA 4WKMA 4GF8A 4MLQA 2NUVA 3FV1A 1LGBC 3S9NC 3PU5A 3H4ZA 3IB2A 2DVZA 1B32A 1D4NA 3T93B 3S9EA 2QS2A 3SESA 3TCGA 3CFZA 4QFKA 2XXYA 1H76A 4QFNA 4F39A 1MM7A 3B6WA 3OEKA 3VV5A 3PPPA 3KZGA 2UVIA 2ESNA 3LUYA 3UORA 4RPNA 4YAHX 3IR1A 4ND9A 3O6IA 2D3IA 1XVYA 3ZSFA 1POY1 1CE2A 1JVYA 3C9HA 4QSCA 3FATA 4F1UA 3Q25A 4NWCA 4ZEDA 2GHBA 3G3KA 3N94A 1XS5A 2I0BA 3QUJA 1O64A 4PQJA 3T22A 4KYDA 1B7HA 2G93A 3SEWA 3DP8A 4H1XA 1IXCA 2ZYMA 2HXWA 2I4BA 3TDJA 3S2VA 4GD5A 3CVGA 2X7PA 4GXAA 4RA1A 3T9XB 5TU0A 5J1DA 4Q0CA 3VLUA 3RPWA 2DQVA 1R9QA 1MPCA 5AA2D 1H43A 3BFTA 4BDNA 3LC8A 4ISUA 4F1YA 2BJJX 3PD8A 4JWOA 3M3FA 4N6PA 5HM4B 5AA2B 1NH7A 1GTKA 2P1SA 2F7BA 3QAXA 3SKPA 4GOTA 4TLMB 1USYE 1NL5A 3A3UA 2HCAA 4Q30B 4MF3A 1JW4A 2DWIA 1GV8A 2Y7IA 4NF4B 1UIUA 1ZU0A 4R6KA 5I2NB 1N76A 3MZ1A 1DOTA 5ITPA 4K3FA 2DWJA 2QS4A 4E0XA 3FXRA 3FV2A 1MQGA 2Q2CA 5JTYB 2E0SA 1B2HA 4JWYA 2B3FA 3H06B 3SERA 2XXQA 1LLSA 3C33A 4OHNA 3THIA 4OMBA 4ZEFA 5AA2A 2PX1A 2F6PA 1LCTA 3AXFA 4NF5A 2XX8A 3TCHA 4H8IA 2ONRA 3OO6A 4Z0IA 4ELRA 2Z8DA 2F36A 3PUWE 1EZOA 2YPNA 3O28A 4DCYA 4NF4A 4IY5A 4O3BA 1LBCA 3FD3A 2QS3A 5FHOA 5I2NA 1MXXA 3GLBA 2AYSA 3DELB 4FATA 4Q8RA 1N04A 4H0WA 4ECFA 1JVXA 1B05A 3S9MC 2O51A 2H9BA 5JTYA 3R26A 3WAEA 5EHMA 2WKYA 4G4PA 3K6VA 1S50A 3MP8A 2ABHA 1S7YA 3BBRA 1N7WA 4U2RA 1P1OA 4UA8A 3VLWA 1QUJA 2O6AA 3TTMA 3IJOB 1ZIUA 3FVNA 3G3FA 1B3EA 2DE4A 2ZYKA 3HHFA 4FORA 4F2QA 1B1HA 5H8QA 1R9LA 4RK9A 4QF9A 1FQAA 4LZ8A 1MM6A 1B9JA 4RJZA 3HCQA 3IOUA 2PBWA 2AL4A 3W9WA 5K2YA 4DDDA 2VGQA 1IQ7A 1LB8A 3ZKKA 3TUSA 3H03A 1MY4A 1N3WA 4C1TA 2O7IA 3K2DA 1MXYA 4JDFA 1YTVA 3EHUA 4U1OA 3CI8A 1UTHB 2DXRA 1LBBA 1SI0A 4OEUA 1QKAA 4DLDA 1SYIA 4DXCA 2ALUA 2DXYA 2O1MA 4X1BA 4OENA 2O68A 5ISUA 2UYFA 3K6UA 3N6UA 4OESA 1XHYA 1SW1A 2QRYA 2I3VA 3KGCA 1B0HA 4MLVA 4EDPA 3ODBA 1PC3A 4X9TA 3K1MA 2XX7A 1HSLA 3SETA 2THIA 1WVJA 2I49A 1ATGA 1PDAA 4EUOA 3W15C 1N0TA 4KCDA 3R7XA 2XXRA 4G2ZA 2O84X 5I56B 4OETA 4JSOA 2ZNSA 1OMPA 1UTHA 1QKBA 3VVDA 2R9JA 1NH8A 3IJXB 5EYFA 1Y3NA 2H99A 1YPNA 4IGTA 3CSBA 5AA4B 2REJA 2V93A 2Y7KA 4MH5A 3OO7A 2OBGA 2M8CA 3I5OA 4BDQA 1LB9A 4PFYA 4FEBA 2GHAA 1EZPA 3DLNA 1MXVA 3KJ7A 4U21A 3RT8A 2Q8JA 5I56A 2H4IA 3N6TA 2NXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGW A;  5H8F B;  2Z23 A;  2O7U A;  1H45 A;  1LAX A;  2R71 A;  1B5H A;  1EU8 A;  5AA1 A;  4X48 A;  5EHS A;  1MS7 A;  4LAT A;  3MVY A;  4R73 A;  5AA4 A;  3DM0 A;  1Y1Z A;  5I58 B;  4QFO A;  1LCF A;  1OQG A;  4H6D A;  1Z7M E;  3MC2 A;  5DEX A;  3PUV E;  1PB8 A;  4O3A A;  1WDN A;  1B58 A;  4ZS9 A;  2PYY A;  2ANJ A;  2VP1 A;  3I3V A;  4Q5T A;  1QUL A;  2F6G A;  3RGY A;  4IO2 A;  3VE1 B;  4YU0 A;  4AQ4 A;  1B51 A;  3TOD A;  3ILT B;  5I59 A;  4R74 A;  1BKA A;  3IOR A;  2Y7R A;  4G68 B;  1S9T A;  1DPP A;  5L9M A;  1IIW A;  1ZLQ A;  2Y7P A;  2RCA A;  5H8H B;  3O97 A;  1MQJ A;  3TEP A;  3PPN A;  4EQ7 A;  1FTO A;  4YMA A;  4PFT A;  1BIY A;  4NF6 A;  4DE8 A;  3PUX E;  2AIX A;  1O63 A;  1MQI A;  2CMO A;  4ZZA A;  4LP2 B;  4KR5 A;  1B4H A;  3DP4 A;  3M3K A;  1F9B A;  4F1V A;  1JET A;  3MP6 A;  2DYX A;  3C35 A;  4QFL A;  1WOD A;  2RC9 A;  1FQC A;  5AE4 A;  3K00 A;  4G68 A;  5CM6 A;  3C4M A;  4IB2 A;  2IA4 A;  4OTE A;  4PE5 B;  3IO4 A;  1FTM A;  1EH3 A;  1ZKB A;  5H8H A;  3HN0 A;  3FXQ A;  1DTG A;  4ZZE A;  2HZL A;  3K01 A;  1JEV A;  3PPQ A;  1SW2 A;  4GL0 A;  2VD2 A;  1A8E A;  2W7Y A;  4ZDM A;  1GVC A;  1I69 A;  5KCJ B;  4EF1 A;  2P0S A;  1Y9U A;  3TEL A;  4ZEK A;  2DE2 A;  4NF8 B;  3LSW A;  2VHA A;  3K4U A;  4F18 A;  5CC2 A;  5A5X A;  3GBB A;  2NVU B;  1IXI A;  5FTH A;  1O7T A;  2XD2 A;  4EXL A;  3JYR A;  1P1Q A;  1B52 A;  3EPE A;  5DVJ A;  1B5I A;  5HPQ A;  1IEJ A;  4YB6 A;  4PET A;  1SW4 A;  1J1N A;  1B7Z A;  3V83 A;  3O29 A;  1B4Z A;  4N13 A;  5LOM A;  1QW0 A;  2A5T B;  4OVJ A;  5KCJ A;  3O2A A;  4HTG A;  2QMW A;  4OQO A;  2F7A A;  4FJP A;  1IXG A;  2OCU A;  1N84 A;  4NF8 A;  4U4S A;  4BDM A;  1Y4C A;  3TTN A;  3H6V A;  4TLL B;  3MJN A;  2RC7 A;  2XHD A;  1M5B A;  1USY H;  4NMY A;  1GR2 A;  3ILU B;  2F34 A;  1TFD A;  3E13 X;  1POT A;  3MZ9 A;  4IO6 A;  3UN6 A;  3MPL A;  4YIC A;  1RYO A;  3IO6 A;  4JB7 A;  2HEU A;  3PPO A;  1UQW A;  4NF5 B;  4X1D A;  3K0V A;  2A5T A;  2I6E A;  4IGR A;  1JW1 A;  5I84 A;  5H8S A;  1MQH A;  4R6H A;  4AB6 A;  4HW8 A;  1ELJ A;  2O1L A;  2XD3 A;  3Q27 A;  4GWO A;  3QSL A;  1EZ9 A;  2YJP A;  2Z22 A;  3KEI A;  2XX9 A;  4IO4 A;  4QSD A;  4LQ2 A;  1IUD A;  4JXI A;  2KLF A;  2RIN A;  3U94 A;  3E9X A;  4WEP A;  2X26 A;  2QL3 A;  3FJM A;  3GBA A;  5H8N A;  4IO5 A;  4OFJ A;  2UVH A;  3IX1 A;  3H3G A;  2D5W A;  1ZBM A;  5H8Q B;  3O6H A;  1LFH A;  1QUK A;  2H25 A;  2FYI A;  1SD3 A;  1R6Z A;  1Y1M A;  4BDO A;  1SYH A;  4EQB A;  4ESW A;  1MXU A;  3JV9 A;  2F8D A;  1XVX A;  4F3S A;  4XKN A;  3FZV A;  4OYV A;  3M3L A;  1JW5 A;  3H6W A;  3PD9 A;  4F3G A;  2XXX A;  4R9G A;  3SEV A;  1TT1 A;  1LAH E;  3HV1 A;  3VVF A;  4EF2 A;  4OFL A;  3PV0 E;  3G7W A;  4KI0 E;  1N3X A;  3IB1 A;  3S4U A;  5CMK A;  1A7L A;  2QSX A;  4JWX A;  4L17 A;  3TPA A;  1N7X A;  1I6B A;  4I9D A;  1B6H A;  3VDF A;  4HS7 A;  3CRB A;  1AOV A;  3HO7 A;  4KFQ A;  1FTK A;  1P1N A;  1Y20 A;  1MH3 A;  4MBP A;  1LFG A;  5CRY A;  3CFX A;  3VFJ A;  2UXA A;  3TYH A;  2PVU A;  4GLI A;  1NNF A;  3U1O A;  2XXT A;  3K6X A;  3HHG A;  3D4G A;  2H98 A;  5ICQ A;  1A99 A;  3HST A;  1II5 A;  2UVG A;  2DE3 A;  1DSN A;  1DMB A;  1UTB B;  4XKR A;  4WED A;  5KDT B;  1QJM A;  4F22 A;  1XC1 A;  5ELV A;  3C32 A;  1AH5 A;  3OEL A;  4KPT A;  3QK6 A;  4RYA A;  1AMF A;  3B6T A;  3MPK A;  3C34 A;  1MDQ A;  1A54 A;  2F97 A;  4AB5 A;  3LR1 A;  5JK4 A;  2HFB A;  5IKB A;  3H6T A;  3TTK A;  3ZS6 A;  1M5C A;  4THI A;  3CIJ A;  4ELP A;  3Q29 A;  3QIM A;  3IOV A;  4YKK A;  3O6G A;  5AA3 A;  1OLC A;  4POX A;  5DVF A;  2Q9T A;  4Z7E A;  4OER A;  4OWD A;  1UTB A;  4H67 A;  3B6Q A;  5KDT A;  3OSR A;  3U8Q A;  1MPB A;  3CSG A;  3MVW A;  4IO7 A;  4U1Z A;  1T0K A;  2V3U A;  3OSQ A;  1MDP 1;  1IIT A;  1P99 A;  3O9P A;  4QHQ A;  3G3I A;  3FGS A;  3KSJ A;  5CMM A;  2QMX A;  2D21 A;  1R1N A;  2OZZ A;  5DEX B;  4NTL A;  2OWT A;  2A5S A;  1Z7N E;  2Z8F A;  3OD7 A;  3TKD A;  4PFU A;  5I57 B;  2I48 A;  2V3T A;  1H44 A;  3UK4 A;  1FQE A;  3OEM A;  3LSX A;  4ELQ A;  3KBR A;  5K2X A;  5DT6 A;  4FE8 A;  3IOW A;  5I59 B;  4GL8 A;  1D3K A;  4P0G A;  2X7Q A;  1B1X A;  3KOS A;  4YMB A;  2ZNU A;  1A55 A;  1Y3P A;  3KOT A;  1RYX A;  3A3C A;  4KYE A;  1HSE A;  4NF6 B;  4BDR A;  2QJE A;  4EQ9 A;  2OLB A;  3TTR A;  4ESX A;  5I57 A;  2HAU A;  1VFE A;  3R6U A;  4QRZ A;  2B65 A;  5DYH A;  4LVQ A;  1M5D A;  1MY2 A;  3UIF A;  1ZTY A;  4TQU Q;  2G29 A;  3K1N A;  2Y84 A;  2Y7W A;  2RCB A;  1B3F A;  4I62 A;  4XTC Q;  3KJT A;  3U72 A;  1ZMG A;  4ZE8 A;  2I4C A;  3ECR A;  1VSO A;  1FTL A;  5ITO A;  4LUB A;  4GXS B;  2Q88 A;  4JBZ A;  4XKQ A;  3OEN A;  4P0I A;  3PUZ E;  1VFD A;  4G77 A;  1MRP A;  4R6Y A;  4H8J A;  2ONS A;  2LAO A;  2RF1 A;  2GFE A;  3FXU A;  3V5A A;  1PB9 A;  4G8M A;  3FVK A;  1LAF E;  1I6A A;  4LZ7 A;  3F11 A;  3BKI B;  3SDF A;  4FIM A;  2H5Y A;  5TPA B;  2PMS A;  5A5X B;  5CBS A;  4F31 B;  2XXW A;  3KN7 A;  4RPO A;  1B7U A;  3LBS A;  3T9V A;  2OJT A;  4R72 A;  2V84 A;  4P11 A;  4I1D A;  2F35 A;  3FIR A;  1PB7 A;  1MPD A;  4DXU A;  3QYT A;  2PT2 A;  1URS A;  4IO3 A;  3EQ1 A;  4KYS A;  1FQD A;  2Z8E A;  2GRV A;  1B46 A;  1OVB A;  5L9S A;  4M4G A;  1MQD A;  5TPA A;  3G3G A;  3V89 B;  2XXI A;  2O69 A;  3K1P A;  4R75 A;  3IB0 A;  5TP9 B;  2I0C A;  4HCW A;  3CG3 A;  3MW0 A;  5BWJ A;  1Q1K A;  4LA9 A;  5CMC A;  3OXN A;  3B7D A;  3MZB A;  3OOA A;  1JEU A;  3IK6 B;  3V8X B;  3T9H B;  3KSX A;  4POW A;  1VE4 A;  3Q26 A;  4YB7 A;  3LSF B;  1BLF A;  3KG2 A;  3TFL A;  1SW5 A;  2UVJ A;  4TOZ A;  4LON B;  1NFT A;  2DVC A;  3FJG A;  1SBP A;  4ZE9 A;  3T96 B;  3P7I A;  3I6V A;  5FTI A;  2RC8 A;  5CBR A;  4QFP A;  1URD A;  1DPE A;  4U22 A;  5TP9 A;  3RTW B;  1UIV A;  4U4X A;  1PBQ A;  3FAS A;  1RKM A;  2OWS A;  4I8C A;  1B5J A;  2XXU A;  4RY1 A;  2UYE A;  1QUI A;  2ZNT A;  4F19 A;  1FW0 A;  5H8N B;  5KZT A;  1VR5 A;  3GXA A;  3U92 A;  2V25 A;  4PFW A;  1SDX A;  2PT1 A;  1NNP A;  1TXF A;  4XIG Q;  1FQB A;  1MH4 A;  3MP1 A;  1DTZ A;  4NWD A;  4KQP A;  1A8F A;  2DS9 A;  1I6Q A;  3FVO A;  3QUF A;  4GVO A;  5DTB A;  4H5F A;  4KHZ E;  3RTF B;  3SEU A;  2P2A A;  4ZEC A;  1A40 A;  3RN8 A;  4XKP A;  1MY1 A;  3FUZ A;  3O66 A;  1H3D A;  2R6G E;  5L8D A;  3LSL A;  2ZMB A;  1OIB A;  4MFI A;  3VXB A;  3N26 A;  2I58 A;  1ANF A;  2F5X A;  3DP6 A;  3D4C A;  1MXW A;  2DSF A;  1MY0 A;  3E4R A;  3G3J A;  5FHN A;  2IEE A;  3S9L C;  5B7D A;  2DWA A;  1FCK A;  1MY3 A;  1KWH A;  4U23 A;  2ZYN A;  3HPI A;  1XT8 A;  2RKM A;  3MVZ A;  4OXV A;  3ZKL A;  3CG1 A;  3MUQ A;  2QS1 A;  4R2F A;  4ZEB A;  1B3L A;  1SQY A;  2FNC A;  2Q89 A;  2HQ0 A;  5DVI A;  2B3B A;  3TCF A;  5CMB A;  1JQF A;  2Q2A A;  1AIV A;  2ONK E;  3IOT A;  1TFA A;  4G8H A;  2ZXT A;  3G3H A;  4DZ1 A;  3K02 A;  3L6H A;  2YLN A;  4G8N A;  4G68 C;  4JSD A;  1YCJ A;  1D9Y A;  1BTJ A;  4EXK A;  2AL5 A;  4NE4 A;  1IXH A;  3JZJ A;  2XXV A;  4ELO A;  1US4 A;  4DIG A;  4M1V A;  1GGG A;  3KN8 A;  1FQF A;  2XXH A;  4YKJ A;  1L5T A;  4YKP A;  1M5F A;  1US5 A;  3PMV A;  1OVT A;  3Q28 A;  3MAM A;  3RUM A;  3H7M A;  2F7C A;  1MG1 A;  4R9F A;  1NNT A;  2E1S A;  3OO9 A;  4FEC A;  3CR9 A;  3T9U A;  2ZYO A;  1P1U A;  2F78 A;  2QPQ A;  3UP9 A;  5M2V A;  3RT6 B;  3PGF A;  3TZA A;  1YAE A;  3PMW A;  1NKX A;  1IZ1 A;  2NOO A;  1BP5 A;  3TMG A;  2NWJ A;  2V3Q A;  3L6G A;  3TQL A;  3BFU A;  3E3K A;  3PUY E;  3WAF A;  4H5G A;  4E0W A;  4F3B A;  5I2K B;  3KFM A;  1XOC A;  4F29 A;  1SI1 A;  4OZ9 A;  4RK2 A;  4C0R A;  4GFR A;  3FJ7 A;  3TAJ A;  2GH9 A;  3TQW A;  1JNF A;  1NNK A;  3VVE A;  3M8U A;  1ZJL A;  3MBP A;  4DCX A;  1OQH A;  3IAZ A;  5IAI A;  3U93 A;  2OK2 A;  2DWH A;  3RQT A;  3FVG A;  4NED A;  3C31 A;  1PBP A;  1Y3Q A;  4KCC A;  4F2O A;  5JEI A;  5I2K A;  4RXL A;  3EHS A;  3PMX A;  3MWB A;  1PEB A;  4LQ5 A;  5FHM A;  4BLA A;  4GIZ A;  5F7V A;  4WXJ A;  4H65 A;  1MXZ A;  3OMB A;  3K6W A;  3KN3 A;  4RNS A;  4GRK A;  4HCY A;  2CZL A;  4DXB A;  1HSJ A;  4XXU A;  3PPR A;  4FAJ A;  3EHT A;  4FED A;  1Q35 A;  2REG A;  4OFO A;  1LAG E;  3SEY A;  4ONY A;  3A09 A;  5F1Q A;  3W9V A;  3QXM A;  2DP8 A;  1LFI A;  3MQ9 A;  1B3G A;  5L9O A;  1Y4T A;  4ZEI A;  3VXC A;  1OLA A;  3H6U A;  4C1U A;  3RLF E;  5H8F A;  5BUU A;  5HBC A;  3SEX A;  2DOJ A;  1QVS A;  1FTJ A;  4UAC A;  3EN3 A;  4PP0 A;  3RNN A;  1M5E A;  1B40 A;  1P1W A;  4BDL A;  3RY3 A;  3OO8 A;  5I58 A;  4LZ5 A;  1TWY A;  2HAV A;  3IL1 B;  1NMU A;  3ONM A;  4KD5 A;  4YZZ A;  5B70 A;  4GQO A;  4QSE A;  3T66 A;  2FA7 A;  4N07 A;  1URG A;  4YKI A;  1SVX B;  4OEV A;  3USD A;  2HZK A;  1D9V A;  3TTL A;  2I3W A;  3N5L A;  3MVX A;  3UA8 A;  4F3P A;  1AL3 A;  4R2B A;  1B0L A;  2XXP A;  5ICT A;  1CB6 A;  4IY6 A;  1LST A;  3C36 A;  2VD3 A;  3CFL A;  4YB5 A;  2VOZ A;  4O3C A;  5CI5 A;  3VLV A;  3GZG A;  3EF7 A;  1B3H A;  4WKM A;  4GF8 A;  4MLQ A;  2NUV A;  3FV1 A;  1LGB C;  3S9N C;  3PU5 A;  3H4Z A;  3IB2 A;  2DVZ A;  1B32 A;  1D4N A;  3T93 B;  3S9E A;  2QS2 A;  3SES A;  3TCG A;  3CFZ A;  4QFK A;  2XXY A;  1H76 A;  4QFN A;  4F39 A;  1MM7 A;  3B6W A;  3OEK A;  3VV5 A;  3PPP A;  3KZG A;  2UVI A;  2ESN A;  3LUY A;  3UOR A;  4RPN A;  4YAH X;  3IR1 A;  4ND9 A;  3O6I A;  2D3I A;  1XVY A;  3ZSF A;  1POY 1;  1CE2 A;  1JVY A;  3C9H A;  4QSC A;  3FAT A;  4F1U A;  3Q25 A;  4NWC A;  4ZED A;  2GHB A;  3G3K A;  3N94 A;  1XS5 A;  2I0B A;  3QUJ A;  1O64 A;  4PQJ A;  3T22 A;  4KYD A;  1B7H A;  2G93 A;  3SEW A;  3DP8 A;  4H1X A;  1IXC A;  2ZYM A;  2HXW A;  2I4B A;  3TDJ A;  3S2V A;  4GD5 A;  3CVG A;  2X7P A;  4GXA A;  4RA1 A;  3T9X B;  5TU0 A;  5J1D A;  4Q0C A;  3VLU A;  3RPW A;  2DQV A;  1R9Q A;  1MPC A;  5AA2 D;  1H43 A;  3BFT A;  4BDN A;  3LC8 A;  4ISU A;  4F1Y A;  2BJJ X;  3PD8 A;  4JWO A;  3M3F A;  4N6P A;  5HM4 B;  5AA2 B;  1NH7 A;  1GTK A;  2P1S A;  2F7B A;  3QAX A;  3SKP A;  4GOT A;  4TLM B;  1USY E;  1NL5 A;  3A3U A;  2HCA A;  4Q30 B;  4MF3 A;  1JW4 A;  2DWI A;  1GV8 A;  2Y7I A;  4NF4 B;  1UIU A;  1ZU0 A;  4R6K A;  5I2N B;  1N76 A;  3MZ1 A;  1DOT A;  5ITP A;  4K3F A;  2DWJ A;  2QS4 A;  4E0X A;  3FXR A;  3FV2 A;  1MQG A;  2Q2C A;  5JTY B;  2E0S A;  1B2H A;  4JWY A;  2B3F A;  3H06 B;  3SER A;  2XXQ A;  1LLS A;  3C33 A;  4OHN A;  3THI A;  4OMB A;  4ZEF A;  5AA2 A;  2PX1 A;  2F6P A;  1LCT A;  3AXF A;  4NF5 A;  2XX8 A;  3TCH A;  4H8I A;  2ONR A;  3OO6 A;  4Z0I A;  4ELR A;  2Z8D A;  2F36 A;  3PUW E;  1EZO A;  2YPN A;  3O28 A;  4DCY A;  4NF4 A;  4IY5 A;  4O3B A;  1LBC A;  3FD3 A;  2QS3 A;  5FHO A;  5I2N A;  1MXX A;  3GLB A;  2AYS A;  3DEL B;  4FAT A;  4Q8R A;  1N04 A;  4H0W A;  4ECF A;  1JVX A;  1B05 A;  3S9M C;  2O51 A;  2H9B A;  5JTY A;  3R26 A;  3WAE A;  5EHM A;  2WKY A;  4G4P A;  3K6V A;  1S50 A;  3MP8 A;  2ABH A;  1S7Y A;  3BBR A;  1N7W A;  4U2R A;  1P1O A;  4UA8 A;  3VLW A;  1QUJ A;  2O6A A;  3TTM A;  3IJO B;  1ZIU A;  3FVN A;  3G3F A;  1B3E A;  2DE4 A;  2ZYK A;  3HHF A;  4FOR A;  4F2Q A;  1B1H A;  5H8Q A;  1R9L A;  4RK9 A;  4QF9 A;  1FQA A;  4LZ8 A;  1MM6 A;  1B9J A;  4RJZ A;  3HCQ A;  3IOU A;  2PBW A;  2AL4 A;  3W9W A;  5K2Y A;  4DDD A;  2VGQ A;  1IQ7 A;  1LB8 A;  3ZKK A;  3TUS A;  3H03 A;  1MY4 A;  1N3W A;  4C1T A;  2O7I A;  3K2D A;  1MXY A;  4JDF A;  1YTV A;  3EHU A;  4U1O A;  3CI8 A;  1UTH B;  2DXR A;  1LBB A;  1SI0 A;  4OEU A;  1QKA A;  4DLD A;  1SYI A;  4DXC A;  2ALU A;  2DXY A;  2O1M A;  4X1B A;  4OEN A;  2O68 A;  5ISU A;  2UYF A;  3K6U A;  3N6U A;  4OES A;  1XHY A;  1SW1 A;  2QRY A;  2I3V A;  3KGC A;  1B0H A;  4MLV A;  4EDP A;  3ODB A;  1PC3 A;  4X9T A;  3K1M A;  2XX7 A;  1HSL A;  3SET A;  2THI A;  1WVJ A;  2I49 A;  1ATG A;  1PDA A;  4EUO A;  3W15 C;  1N0T A;  4KCD A;  3R7X A;  2XXR A;  4G2Z A;  2O84 X;  5I56 B;  4OET A;  4JSO A;  2ZNS A;  1OMP A;  1UTH A;  1QKB A;  3VVD A;  2R9J A;  1NH8 A;  3IJX B;  5EYF A;  1Y3N A;  2H99 A;  1YPN A;  4IGT A;  3CSB A;  5AA4 B;  2REJ A;  2V93 A;  2Y7K A;  4MH5 A;  3OO7 A;  2OBG A;  2M8C A;  3I5O A;  4BDQ A;  1LB9 A;  4PFY A;  4FEB A;  2GHA A;  1EZP A;  3DLN A;  1MXV A;  3KJ7 A;  4U21 A;  3RT8 A;  2Q8J A;  5I56 A;  2H4I A;  3N6T A;  2NXO A; 
#chains in the Genus database with same CATH topology
 3UGW A;  5H8F B;  2Z23 A;  2O7U A;  1H45 A;  1LAX A;  2R71 A;  1B5H A;  1EU8 A;  5AA1 A;  5EYH A;  4GWW A;  4X48 A;  5EHS A;  1MS7 A;  4LAT A;  3MVY A;  4R73 A;  2ZZW A;  5AA4 A;  3DM0 A;  1Y1Z A;  5I58 B;  4QFO A;  1LCF A;  1OQG A;  4H6D A;  1Z7M E;  3MC2 A;  5DEX A;  5EQA A;  3T1B A;  1FRP A;  3PUV E;  1PB8 A;  4O3A A;  4DI3 D;  1WDN A;  4MCO A;  1B58 A;  1FPJ A;  4ZS9 A;  2PYY A;  2ANJ A;  2VP1 A;  3I3V A;  1INP A;  4Q5T A;  1QUL A;  2F6G A;  3RGY A;  4IO2 A;  3VE1 B;  4YU0 A;  4AQ4 A;  1B51 A;  5I3S A;  3ILT B;  3TOD A;  5I59 A;  4R74 A;  1BKA A;  1FPB A;  3IOR A;  2Y7R A;  2L5V A;  4G68 B;  1S9T A;  1DPP A;  4GWS A;  5L9M A;  1IIW A;  1ZLQ A;  2Y7P A;  2RCA A;  5H8H B;  3O97 A;  1MQJ A;  3TEP A;  3PPN A;  2FIX A;  4EQ7 A;  1FTO A;  4YMA A;  4PFT A;  1BIY A;  4NF6 A;  2KR0 A;  4DE8 A;  3PUX E;  2AIX A;  1O63 A;  1NUX A;  1MQI A;  2CMO A;  5IZ1 A;  4ZZA A;  4LP2 B;  4KR5 A;  1B4H A;  3DP4 A;  3CHG A;  3M3K A;  1F9B A;  4F1V A;  1JET A;  3MP6 A;  2DYX A;  3C35 A;  4QFL A;  1WOD A;  2RC9 A;  1FQC A;  5AE4 A;  3K00 A;  4G68 A;  5CM6 A;  3C4M A;  4IB2 A;  2IA4 A;  4OTE A;  4PE5 B;  3IO4 A;  1FTM A;  1EH3 A;  4GBW A;  1ZKB A;  5H8H A;  3HN0 A;  3FXQ A;  1DTG A;  4ZZE A;  1SPI A;  2HZL A;  1G0I A;  4JVI A;  3K01 A;  2KQZ A;  1JEV A;  3PPQ A;  1SW2 A;  2XWK A;  3KC0 A;  4OVQ A;  4GL0 A;  4HXV A;  2VD2 A;  1A8E A;  4MX6 A;  2W7Y A;  4ZDM A;  1GVC A;  1I69 A;  5KCJ B;  4EF1 A;  2P0S A;  4AS5 A;  1Y9U A;  3TEL A;  4ZEK A;  2DE2 A;  4XEQ A;  4NF8 B;  3LSW A;  2VHA A;  3K4U A;  4F18 A;  5CC2 A;  4P1E A;  5A5X A;  3GBB A;  4NX1 A;  2NVU B;  1IME A;  1IXI A;  5FTH A;  1O7T A;  2XD2 A;  4EXL A;  3JYR A;  4N8Y A;  1P1Q A;  1B52 A;  3EPE A;  5DVJ A;  1NV1 A;  4PF8 A;  5T3J A;  1B5I A;  5HPQ A;  1IEJ A;  4YB6 A;  4PET A;  1SW4 A;  4PF6 A;  1J1N A;  1B7Z A;  3V83 A;  3O29 A;  1B4Z A;  4N13 A;  5LOM A;  1QW0 A;  2GQ1 A;  2A5T B;  4OVJ A;  5KCJ A;  3O2A A;  4HTG A;  2QMW A;  4OQO A;  2F7A A;  5IM2 A;  4FJP A;  1IXG A;  2OCU A;  2CEX A;  1IMD A;  1N84 A;  4NF8 A;  4U4S A;  4BDM A;  1Y4C A;  3TTN A;  2XA5 A;  3H6V A;  4TLL B;  3MJN A;  2RC7 A;  2XHD A;  1M5B A;  1USY H;  4NMY A;  1GR2 A;  3ILU B;  4H45 A;  2F34 A;  1TFD A;  3E13 X;  1POT A;  3MZ9 A;  4IO6 A;  3UN6 A;  3MPL A;  4YIC A;  1RYO A;  3IO6 A;  4JB7 A;  2HEU A;  3PPO A;  1UQW A;  4NF5 B;  4X1D A;  3K0V A;  2A5T A;  4OA4 A;  2Q74 A;  2I6E A;  4IGR A;  1JW1 A;  5I84 A;  3BIH A;  5H8S A;  1MQH A;  4R6H A;  4AB6 A;  4HW8 A;  1ELJ A;  2O1L A;  2XD3 A;  3Q27 A;  4GWO A;  3QSL A;  1EZ9 A;  4NG7 A;  2YJP A;  2Z22 A;  3KEI A;  2XX9 A;  4IO4 A;  2Y5L A;  1BK4 A;  4I3E A;  4QSD A;  4LQ2 A;  1IUD A;  4JXI A;  2KLF A;  2RIN A;  3U94 A;  3E9X A;  4GBV A;  4WEP A;  2X26 A;  2QL3 A;  3FJM A;  4GWU A;  3GBA A;  5H8N A;  5FBP A;  4IO5 A;  4OFJ A;  2UVH A;  3IX1 A;  3H3G A;  5LDZ A;  1FPK A;  3U65 A;  2D5W A;  1ZBM A;  5H8Q B;  3O6H A;  1LFH A;  1QUK A;  2H25 A;  2FYI A;  1SD3 A;  1R6Z A;  1Y1M A;  4BDO A;  3HFU A;  4JVD A;  1SYH A;  4EQB A;  4ESW A;  1MXU A;  3JV9 A;  2F8D A;  1XVX A;  4F3S A;  4XKN A;  3FZV A;  4OYV A;  2FVZ A;  2CZH A;  3M3L A;  1JW5 A;  3H6W A;  3PD9 A;  4F3G A;  2XXX A;  4R9G A;  3SEV A;  1TT1 A;  1LAH E;  3HV1 A;  3VVF A;  4EF2 A;  4OFL A;  1DCU A;  3PV0 E;  3G7W A;  4KI0 E;  1N3X A;  3IB1 A;  3S4U A;  5CMK A;  1A7L A;  2QVV A;  2QSX A;  3B8B A;  4JWX A;  4L17 A;  3TPA A;  1N7X A;  1I6B A;  4I9D A;  1B6H A;  3VDF A;  4HS7 A;  3CRB A;  1AOV A;  3HO7 A;  4KFQ A;  1FTK A;  1P1N A;  5ET6 A;  1Y20 A;  1MH3 A;  4MBP A;  1LFG A;  5CRY A;  3CFX A;  3VFJ A;  2UXA A;  3TYH A;  2PVU A;  4GLI A;  1NNF A;  3U1O A;  2XXT A;  3K6X A;  3HHG A;  1LBW A;  3D4G A;  4O94 A;  1EYK A;  2DDK A;  2H98 A;  5ICQ A;  1A99 A;  1VDW A;  3HST A;  1II5 A;  2UVG A;  2DE3 A;  1DSN A;  1DMB A;  1UTB B;  4XKR A;  4WED A;  5KDT B;  1NUZ A;  1QJM A;  4F22 A;  1XC1 A;  5ELV A;  3C32 A;  1AH5 A;  3OEL A;  4KPT A;  3QK6 A;  4RYA A;  1AMF A;  3B6T A;  4PTK A;  3MPK A;  3C34 A;  1MDQ A;  1A54 A;  4NGU A;  2F97 A;  4AB5 A;  3B50 A;  4FBP A;  3LR1 A;  5JK4 A;  1NI9 A;  2HFB A;  5IKB A;  3H6T A;  3TTK A;  4N6D A;  3ZS6 A;  1M5C A;  4THI A;  3CIJ A;  4ELP A;  3Q29 A;  3QIM A;  3IOV A;  4YKK A;  3O6G A;  5AA3 A;  1OLC A;  4POX A;  5DVF A;  2Q9T A;  4Z7E A;  4OER A;  4OWD A;  1UTB A;  4H67 A;  3B6Q A;  5KDT A;  3OSR A;  3U8Q A;  4N81 A;  1MPB A;  3CSG A;  3MVW A;  4IO7 A;  4U1Z A;  5IZ3 B;  1T0K A;  2V3U A;  3OSQ A;  1MDP 1;  1IIT A;  1P99 A;  2HXR A;  3O9P A;  4QHQ A;  3G3I A;  3FGS A;  3KSJ A;  5CMM A;  3IFC A;  2QMX A;  2D21 A;  1R1N A;  2OZZ A;  4N8G A;  5DEX B;  4NTL A;  2OWT A;  2A5S A;  1Z7N E;  2Z8F A;  3OD7 A;  3TKD A;  4PFU A;  5I57 B;  4PAI A;  2I48 A;  2V3T A;  1H44 A;  3UK4 A;  1FQE A;  3OEM A;  3LSX A;  4ELQ A;  5ET8 A;  3KBR A;  5K2X A;  5DT6 A;  1FBH A;  4FE8 A;  3IOW A;  5I59 B;  4GL8 A;  1FJ9 A;  1FBP A;  1RDY A;  1D3K A;  4P0G A;  2X7Q A;  1B1X A;  3KOS A;  4YMB A;  5IZ3 A;  4N17 A;  2ZNU A;  1A55 A;  1Y3P A;  3KOT A;  1RYX A;  3A3C A;  4KYE A;  1HSE A;  4NF6 B;  1FPD A;  3BIG A;  4BDR A;  2QJE A;  4EQ9 A;  2OLB A;  4MNI A;  2XWV A;  3TTR A;  4ESX A;  5I57 A;  4JVC A;  2HAU A;  1VFE A;  3R6U A;  4QRZ A;  1FBD A;  4P8B A;  2B65 A;  5DYH A;  4LVQ A;  1M5D A;  1MY2 A;  5ET7 A;  3UIF A;  1ZTY A;  4TQU Q;  2G29 A;  3K1N A;  2Y84 A;  4NN3 A;  2QFL A;  2Y7W A;  2RCB A;  1B3F A;  4I62 A;  4XTC Q;  3KJT A;  3U72 A;  4PFB A;  1ZMG A;  4ZE8 A;  2I4C A;  3ECR A;  1VSO A;  1FTL A;  5ITO A;  4LUB A;  4GXS B;  2Q88 A;  4JBZ A;  4XKQ A;  1NV5 A;  3OEN A;  4P0I A;  3PUZ E;  1VFD A;  4G77 A;  1MRP A;  4R6Y A;  4H8J A;  2ONS A;  2LAO A;  2RF1 A;  2GFE A;  3FXU A;  3V5A A;  1PB9 A;  4G8M A;  3FVK A;  1LAF E;  5EQ7 A;  1I6A A;  4LZ7 A;  3F11 A;  1FPI A;  3BKI B;  3SDF A;  4FIM A;  2H5Y A;  5TPA B;  2PMS A;  1LBZ A;  5A5X B;  5CBS A;  4F31 B;  2XXW A;  1FSA A;  3KN7 A;  4RPO A;  1B7U A;  3LBS A;  3T9V A;  2OJT A;  4R72 A;  2V84 A;  4P11 A;  3LUZ A;  4PDD A;  4I1D A;  2F35 A;  3FIR A;  1PB7 A;  3GYY A;  1MPD A;  5IZZ A;  4DXU A;  3QYT A;  2PT2 A;  2WEF A;  1URS A;  4IO3 A;  3EQ1 A;  4KYS A;  1FQD A;  2Z8E A;  3E79 A;  2GRV A;  4OVS A;  4PBQ A;  1B46 A;  1OVB A;  5L9S A;  4M4G A;  1MQD A;  5TPA A;  3G3G A;  3V89 B;  4QXD A;  2XXI A;  2O69 A;  3K1P A;  4R75 A;  3D1R A;  3IB0 A;  5TP9 B;  2I0C A;  2VPN A;  4HCW A;  3CG3 A;  3MW0 A;  5BWJ A;  1QGX A;  1Q1K A;  4LA9 A;  5CMC A;  3OXN A;  2B4L A;  3B7D A;  3MZB A;  3OOA A;  1JEU A;  3IK6 B;  3V8X B;  3T9H B;  3KSX A;  4XF5 A;  4POW A;  1VE4 A;  3Q26 A;  4YB7 A;  3LSF B;  1BLF A;  3KG2 A;  1EYJ A;  3TFL A;  1SW5 A;  2UVJ A;  4TOZ A;  4LON B;  1NFT A;  2DVC A;  3FJG A;  1SBP A;  4ZE9 A;  3T96 B;  3P7I A;  3I6V A;  5FTI A;  4MJO A;  4OVR A;  2RC8 A;  5CBR A;  4QFP A;  1KA1 A;  1URD A;  2ZZX A;  1DPE A;  4U22 A;  5TP9 A;  3RTW B;  4N91 A;  1UIV A;  4U4X A;  1PBQ A;  3FAS A;  1RKM A;  2OWS A;  4I8C A;  1B5J A;  2XXU A;  4RY1 A;  2UYE A;  4PFI A;  1QUI A;  2ZNT A;  4I40 A;  4F19 A;  1FW0 A;  5H8N B;  5KZT A;  1IMB A;  1VR5 A;  3GXA A;  3U92 A;  5IGA A;  1G0H A;  2V25 A;  4PFW A;  1SDX A;  2PT1 A;  1NNP A;  1TXF A;  4XIG Q;  1FQB A;  1MH4 A;  3MP1 A;  1DTZ A;  4NWD A;  3LV0 A;  4KQP A;  1A8F A;  2DS9 A;  1I6Q A;  3FVO A;  3QUF A;  4GVO A;  5DTB A;  4H5F A;  4KHZ E;  4O7M A;  3RTF B;  3SEU A;  2F3D A;  2P2A A;  4ZEC A;  1A40 A;  3RN8 A;  4XKP A;  1MY1 A;  3FUZ A;  3O66 A;  1H3D A;  2R6G E;  5L8D A;  3LSL A;  4GWZ A;  2ZMB A;  1OIB A;  4MFI A;  3VXB A;  3N26 A;  2I58 A;  1ANF A;  1NV0 A;  2F5X A;  3DP6 A;  3D4C A;  1DBZ A;  1MXW A;  2DSF A;  5A5L A;  1MY0 A;  3E4R A;  3G3J A;  5FHN A;  2IEE A;  4PC9 A;  3S9L C;  5B7D A;  2DWA A;  1FCK A;  1AWB A;  4MIJ A;  1MY3 A;  1KWH A;  4N6K A;  4U23 A;  2ZYN A;  3HPI A;  1XT8 A;  2RKM A;  3MVZ A;  4OXV A;  4GX6 A;  3ZKL A;  3CG1 A;  2XWI A;  2WBB A;  4G61 A;  5EQ9 A;  2QVR A;  3MUQ A;  2QS1 A;  4R2F A;  4ZEB A;  1B3L A;  1SQY A;  2Y5K A;  2FNC A;  1JP4 A;  2Q89 A;  4AS4 A;  2HQ0 A;  5DVI A;  2B3B A;  1DK4 A;  3TCF A;  5CMB A;  1JQF A;  2Q2A A;  4OVT A;  1AIV A;  2ONK E;  3IOT A;  1TFA A;  4G8H A;  1IMC A;  3MYU A;  2ZXT A;  5I7I A;  3G3H A;  4DZ1 A;  3K02 A;  3L6H A;  1NUY A;  2YLN A;  4G8N A;  4G68 C;  4JSD A;  4NF0 A;  4GWY A;  1YCJ A;  3A29 A;  1D9Y A;  1IMF A;  1BTJ A;  4MNP A;  4EXK A;  2AL5 A;  4NE4 A;  1IXH A;  3JZJ A;  2XXV A;  4ELO A;  1US4 A;  4DIG A;  4M1V A;  1GGG A;  3KN8 A;  2R8T A;  1FQF A;  2XXH A;  4YKJ A;  1L5T A;  1NV6 A;  4YKP A;  1M5F A;  1US5 A;  3PMV A;  1YZ0 A;  1OVT A;  1RDZ A;  3Q28 A;  3MAM A;  3RUM A;  2XXK A;  3H7M A;  1FPG A;  2F7C A;  4DI4 B;  1MG1 A;  4R9F A;  1NV4 A;  1NNT A;  2E1S A;  1FPE A;  3OO9 A;  2XWO A;  4FEC A;  2HHM A;  3CR9 A;  3T9U A;  2ZYO A;  4PAF A;  1P1U A;  3RPL B;  2F78 A;  5ET5 A;  2QPQ A;  4HE2 A;  1NV7 A;  4P47 A;  3UP9 A;  5M2V A;  3RT6 B;  3PGF A;  1YYZ A;  3TZA A;  1YAE A;  3PMW A;  1NKX A;  1IZ1 A;  2NOO A;  1BP5 A;  4PDH A;  3TMG A;  2NWJ A;  3KC1 A;  2B4M A;  2V3Q A;  4PBH A;  3L6G A;  3TQL A;  3BFU A;  3E3K A;  3PUY E;  3WAF A;  4H5G A;  4E0W A;  4F3B A;  5I2K B;  3KFM A;  1Q9D A;  1XOC A;  4HE1 A;  4F29 A;  1SI1 A;  4OZ9 A;  4RK2 A;  3RPL A;  4C0R A;  4GFR A;  3FJ7 A;  1FPL A;  4MMP A;  3TAJ A;  4MHF A;  2GH9 A;  3TQW A;  4P56 A;  4MEV A;  1JNF A;  1NNK A;  1XI6 A;  3VVE A;  4O8M A;  3M8U A;  1ZJL A;  4UAB A;  3MBP A;  4DCX A;  1OQH A;  4OVP A;  3IAZ A;  5IAI A;  3U93 A;  1NUW A;  2OK2 A;  2DWH A;  3RQT A;  3FVG A;  4PAK A;  4NED A;  1LBV A;  3C31 A;  2WBD A;  1PBP A;  1Y3Q A;  4KCC A;  4F2O A;  5JEI A;  2F3B A;  5I2K A;  4RXL A;  3EHS A;  3PMX A;  3MWB A;  1PEB A;  4LQ5 A;  3QMF A;  2FBP A;  5FHM A;  4BLA A;  4GIZ A;  5F7V A;  4WXJ A;  1RDX A;  4H65 A;  1MXZ A;  3OMB A;  4PGP A;  3K6W A;  3KN3 A;  4RNS A;  4GRK A;  4HCY A;  2CZL A;  4DXB A;  1HSJ A;  4XXU A;  3PPR A;  4FAJ A;  3EHT A;  4FED A;  1FPF A;  3ROJ A;  1Q35 A;  2PCR A;  2REG A;  4OFO A;  1LAG E;  3SEY A;  3FBP A;  4ONY A;  3A09 A;  5F1Q A;  3W9V A;  2FIE A;  3QXM A;  2DP8 A;  1LFI A;  3MQ9 A;  1B3G A;  5L9O A;  1Y4T A;  4ZEI A;  3VXC A;  1OLA A;  3H6U A;  1K9Z A;  4C1U A;  5DW8 A;  3RLF E;  5H8F A;  4NHB A;  5BUU A;  5HBC A;  3SEX A;  2DOJ A;  1QVS A;  1FTJ A;  4UAC A;  3EN3 A;  4PP0 A;  4PCD A;  3RNN A;  1M5E A;  1B40 A;  1P1W A;  4BDL A;  3RY3 A;  3OO8 A;  5I58 A;  1KA0 A;  2QVU A;  1FBC A;  4LZ5 A;  1TWY A;  2HAV A;  4MAG A;  2CZI A;  3IL1 B;  1NMU A;  3ONM A;  4KD5 A;  4YZZ A;  5B70 A;  3NOH A;  4GQO A;  4QSE A;  2CZK A;  3T66 A;  2FA7 A;  5I5P A;  4N07 A;  1URG A;  4YKI A;  1SVX B;  4OEV A;  4GX3 A;  1CNQ A;  3USD A;  2HZK A;  1D9V A;  3TTL A;  2I3W A;  3N5L A;  3MVX A;  3UA8 A;  4MNC A;  4F3P A;  1AL3 A;  4R2B A;  5EQ8 A;  1B0L A;  2XXP A;  5ICT A;  1CB6 A;  4IY6 A;  1LST A;  3C36 A;  2VD3 A;  3CFL A;  4YB5 A;  4GX4 A;  2VOZ A;  4O3C A;  5CI5 A;  4X04 A;  3VLV A;  3GZG A;  3EF7 A;  1B3H A;  4WKM A;  4GF8 A;  4MLQ A;  2NUV A;  3FV1 A;  1LGB C;  3S9N C;  3PU5 A;  3H4Z A;  3IB2 A;  2DVZ A;  1B32 A;  1FJ6 A;  1D4N A;  3T93 B;  3S9E A;  2QS2 A;  3SES A;  3TCG A;  3CFZ A;  2CEY A;  4P9K A;  4QFK A;  2XXY A;  1H76 A;  4QFN A;  3SZP A;  4F39 A;  1MM7 A;  2BJI A;  3B6W A;  3OEK A;  3VV5 A;  3PPP A;  3KZG A;  2UVI A;  2ESN A;  3LUY A;  3UOR A;  4RPN A;  4YAH X;  3IR1 A;  4ND9 A;  3O6I A;  2D3I A;  3MST A;  1XVY A;  3ZSF A;  1POY 1;  1CE2 A;  2OWZ A;  1JVY A;  3C9H A;  4QSC A;  3FAT A;  4F1U A;  4PFR A;  1FTA A;  3Q25 A;  4NWC A;  2GHB A;  1YXI A;  3G3K A;  4ZED A;  3N94 A;  1XS5 A;  2I0B A;  3QUJ A;  1KZ8 A;  1O64 A;  4PQJ A;  3T22 A;  5LTC A;  4KYD A;  1B7H A;  2G93 A;  3SEW A;  3DP8 A;  4H1X A;  1IXC A;  2ZYM A;  2HXW A;  2I4B A;  3TDJ A;  1NV2 A;  3S2V A;  4NAP A;  4GD5 A;  4PE3 A;  3CVG A;  3FXB A;  3KBZ A;  2X7P A;  4GXA A;  4RA1 A;  4QBA A;  3T9X B;  5TU0 A;  5J1D A;  2VT5 A;  4Q0C A;  3VLU A;  2JJK A;  3RPW A;  2DQV A;  1R9Q A;  1MPC A;  5AA2 D;  3ISP A;  1H43 A;  3BFT A;  4BDN A;  3LC8 A;  4ISU A;  3E78 A;  4F1Y A;  2BJJ X;  3PD8 A;  4JWO A;  3M3F A;  4N6P A;  4PGN A;  2PFZ A;  5HM4 B;  5AA2 B;  4N15 A;  1NH7 A;  1GTK A;  2P1S A;  2F7B A;  3QAX A;  3SKP A;  4GOT A;  4TLM B;  1USY E;  1NL5 A;  3A3U A;  2HCA A;  4GWX A;  4Q30 B;  4MF3 A;  1JW4 A;  2DWI A;  1GV8 A;  2Y7I A;  4NF4 B;  1UIU A;  1ZU0 A;  4R6K A;  5I2N B;  1N76 A;  3MZ1 A;  1DOT A;  5ITP A;  5F24 A;  4K3F A;  2MKZ A;  2DWJ A;  2QS4 A;  4E0X A;  3FXR A;  3FV2 A;  1MQG A;  2Q2C A;  5JTY B;  2E0S A;  1B2H A;  4JWY A;  2B3F A;  3H06 B;  1FBG A;  3SER A;  2WX9 A;  2XXQ A;  1LLS A;  3C33 A;  4OHN A;  3THI A;  4OMB A;  4ZEF A;  5AA2 A;  2PX1 A;  2F6P A;  1LCT A;  3AXF A;  4XFE A;  4NF5 A;  2XX8 A;  3TCH A;  4H8I A;  2ONR A;  3OO6 A;  4Z0I A;  4ELR A;  2Z8D A;  2F36 A;  3PUW E;  1EZO A;  2YPN A;  3O28 A;  4DCY A;  4NF4 A;  4IY5 A;  2V4C A;  4O3B A;  1LBC A;  3FD3 A;  2QS3 A;  5FHO A;  5I2N A;  1MXX A;  1K9Y A;  3GLB A;  2AYS A;  3DEL B;  4FAT A;  4Q8R A;  1N04 A;  4H0W A;  4ECF A;  1JVX A;  1B05 A;  3S9M C;  2O51 A;  2H9B A;  5JTY A;  3R26 A;  3WAE A;  2OX3 A;  5EHM A;  2WKY A;  4HE0 A;  1NV3 A;  4G4P A;  3K6V A;  1EYI A;  1S50 A;  3MP8 A;  2ABH A;  1S7Y A;  3BBR A;  3PTY A;  1N7W A;  4U2R A;  1P1O A;  4UA8 A;  3VLW A;  1LBY A;  1QUJ A;  2O6A A;  3TTM A;  3IJO B;  1ZIU A;  3FVN A;  3G3F A;  1B3E A;  2DE4 A;  2ZYK A;  3HHF A;  4FOR A;  4F2Q A;  1B1H A;  5H8Q A;  1R9L A;  5J16 A;  4RK9 A;  4QF9 A;  1FQA A;  4LZ8 A;  1MM6 A;  1B9J A;  4RJZ A;  3HCQ A;  3IOU A;  2PBW A;  2AL4 A;  3W9W A;  4KXP A;  2FHY A;  4IR8 A;  4N4U A;  5K2Y A;  5ESY A;  2WYK A;  4DDD A;  2VGQ A;  1IQ7 A;  1LB8 A;  3ZKK A;  3TUS A;  1IMA A;  3H03 A;  1LEV A;  1MY4 A;  1N3W A;  4C1T A;  2O7I A;  3K2D A;  1MXY A;  4JDF A;  1YTV A;  3EHU A;  4U1O A;  3CI8 A;  1UTH B;  4H46 A;  2DXR A;  1LBB A;  1SI0 A;  4OEU A;  1QKA A;  4DLD A;  1FBF A;  1SYI A;  4DXC A;  2ALU A;  2DXY A;  2O1M A;  4X1B A;  4OEN A;  2O68 A;  5ISU A;  2UYF A;  3K6U A;  3N6U A;  1FBE A;  4OES A;  4O7I A;  1XHY A;  5EYG A;  1SW1 A;  2QRY A;  2I3V A;  3KGC A;  1B0H A;  4MLV A;  4EDP A;  3ODB A;  1PC3 A;  4X9T A;  3K1M A;  2XX7 A;  1HSL A;  2HPG A;  3SET A;  2P3V A;  2THI A;  1WVJ A;  2WYP A;  3IFA A;  2I49 A;  2VPO A;  1ATG A;  1PDA A;  4EUO A;  3RYD A;  4P3L A;  3W15 C;  1N0T A;  4KCD A;  3R7X A;  2XXR A;  1LBX A;  4G2Z A;  2O84 X;  5I56 B;  4OET A;  4JSO A;  2ZNS A;  1OMP A;  1UTH A;  1QKB A;  3VVD A;  2R9J A;  1NH8 A;  3IJX B;  5EYF A;  1Y3N A;  2H99 A;  1YPN A;  4IGT A;  4NQ8 A;  3CSB A;  5AA4 B;  2PFY A;  3T0J A;  2REJ A;  2V93 A;  2Y7K A;  4X8R A;  4MH5 A;  3OO7 A;  2OBG A;  2P3N A;  2M8C A;  3I5O A;  4BDQ A;  1LB9 A;  3EKI A;  4I3Y A;  4PFY A;  4FEB A;  2GHA A;  2ZZV A;  1EZP A;  3DLN A;  1MXV A;  3KJ7 A;  4U21 A;  1D9Q A;  2Q8M A;  3RT8 A;  4LN5 A;  4OAN A;  2Q8J A;  5I56 A;  2H4I A;  3N6T A;  4P1L A;  2NXO A; 
#chains in the Genus database with same CATH homology
 3UGW A;  5H8F B;  2Z23 A;  2O7U A;  1H45 A;  1LAX A;  2R71 A;  1B5H A;  1EU8 A;  5AA1 A;  4X48 A;  5EHS A;  1MS7 A;  4LAT A;  3MVY A;  4R73 A;  5AA4 A;  3DM0 A;  1Y1Z A;  5I58 B;  4QFO A;  1LCF A;  1OQG A;  4H6D A;  1Z7M E;  3MC2 A;  5DEX A;  3PUV E;  1PB8 A;  4O3A A;  1WDN A;  1B58 A;  4ZS9 A;  2PYY A;  2ANJ A;  2VP1 A;  3I3V A;  4Q5T A;  1QUL A;  2F6G A;  3RGY A;  4IO2 A;  3VE1 B;  4YU0 A;  4AQ4 A;  1B51 A;  3TOD A;  3ILT B;  5I59 A;  4R74 A;  1BKA A;  3IOR A;  2Y7R A;  4G68 B;  1S9T A;  1DPP A;  5L9M A;  1IIW A;  1ZLQ A;  2Y7P A;  2RCA A;  5H8H B;  3O97 A;  1MQJ A;  3TEP A;  3PPN A;  4EQ7 A;  1FTO A;  4YMA A;  4PFT A;  1BIY A;  4NF6 A;  4DE8 A;  3PUX E;  2AIX A;  1O63 A;  1MQI A;  2CMO A;  4ZZA A;  4LP2 B;  4KR5 A;  1B4H A;  3DP4 A;  3M3K A;  1F9B A;  4F1V A;  1JET A;  3MP6 A;  2DYX A;  3C35 A;  4QFL A;  1WOD A;  2RC9 A;  1FQC A;  5AE4 A;  3K00 A;  4G68 A;  5CM6 A;  3C4M A;  4IB2 A;  2IA4 A;  4OTE A;  4PE5 B;  3IO4 A;  1FTM A;  1EH3 A;  1ZKB A;  5H8H A;  3HN0 A;  3FXQ A;  1DTG A;  4ZZE A;  2HZL A;  3K01 A;  1JEV A;  3PPQ A;  1SW2 A;  4GL0 A;  2VD2 A;  1A8E A;  2W7Y A;  4ZDM A;  1GVC A;  1I69 A;  5KCJ B;  4EF1 A;  2P0S A;  1Y9U A;  3TEL A;  4ZEK A;  2DE2 A;  4NF8 B;  3LSW A;  2VHA A;  3K4U A;  4F18 A;  5CC2 A;  5A5X A;  3GBB A;  2NVU B;  1IXI A;  5FTH A;  1O7T A;  2XD2 A;  4EXL A;  3JYR A;  1P1Q A;  1B52 A;  3EPE A;  5DVJ A;  1B5I A;  5HPQ A;  1IEJ A;  4YB6 A;  4PET A;  1SW4 A;  1J1N A;  1B7Z A;  3V83 A;  3O29 A;  1B4Z A;  4N13 A;  5LOM A;  1QW0 A;  2A5T B;  4OVJ A;  5KCJ A;  3O2A A;  4HTG A;  2QMW A;  4OQO A;  2F7A A;  4FJP A;  1IXG A;  2OCU A;  1N84 A;  4NF8 A;  4U4S A;  4BDM A;  1Y4C A;  3TTN A;  3H6V A;  4TLL B;  3MJN A;  2RC7 A;  2XHD A;  1M5B A;  1USY H;  4NMY A;  1GR2 A;  3ILU B;  2F34 A;  1TFD A;  3E13 X;  1POT A;  3MZ9 A;  4IO6 A;  3UN6 A;  3MPL A;  4YIC A;  1RYO A;  3IO6 A;  4JB7 A;  2HEU A;  3PPO A;  1UQW A;  4NF5 B;  4X1D A;  3K0V A;  2A5T A;  2I6E A;  4IGR A;  1JW1 A;  5I84 A;  5H8S A;  1MQH A;  4R6H A;  4AB6 A;  4HW8 A;  1ELJ A;  2O1L A;  2XD3 A;  3Q27 A;  4GWO A;  3QSL A;  1EZ9 A;  2YJP A;  2Z22 A;  3KEI A;  2XX9 A;  4IO4 A;  4QSD A;  4LQ2 A;  1IUD A;  4JXI A;  2KLF A;  2RIN A;  3U94 A;  3E9X A;  4WEP A;  2X26 A;  2QL3 A;  3FJM A;  3GBA A;  5H8N A;  4IO5 A;  4OFJ A;  2UVH A;  3IX1 A;  3H3G A;  2D5W A;  1ZBM A;  5H8Q B;  3O6H A;  1LFH A;  1QUK A;  2H25 A;  2FYI A;  1SD3 A;  1R6Z A;  1Y1M A;  4BDO A;  1SYH A;  4EQB A;  4ESW A;  1MXU A;  3JV9 A;  2F8D A;  1XVX A;  4F3S A;  4XKN A;  3FZV A;  4OYV A;  3M3L A;  1JW5 A;  3H6W A;  3PD9 A;  4F3G A;  2XXX A;  4R9G A;  3SEV A;  1TT1 A;  1LAH E;  3HV1 A;  3VVF A;  4EF2 A;  4OFL A;  3PV0 E;  3G7W A;  4KI0 E;  1N3X A;  3IB1 A;  3S4U A;  5CMK A;  1A7L A;  2QSX A;  4JWX A;  4L17 A;  3TPA A;  1N7X A;  1I6B A;  4I9D A;  1B6H A;  3VDF A;  4HS7 A;  3CRB A;  1AOV A;  3HO7 A;  4KFQ A;  1FTK A;  1P1N A;  1Y20 A;  1MH3 A;  4MBP A;  1LFG A;  5CRY A;  3CFX A;  3VFJ A;  2UXA A;  3TYH A;  2PVU A;  4GLI A;  1NNF A;  3U1O A;  2XXT A;  3K6X A;  3HHG A;  3D4G A;  2H98 A;  5ICQ A;  1A99 A;  3HST A;  1II5 A;  2UVG A;  2DE3 A;  1DSN A;  1DMB A;  1UTB B;  4XKR A;  4WED A;  5KDT B;  1QJM A;  4F22 A;  1XC1 A;  5ELV A;  3C32 A;  1AH5 A;  3OEL A;  4KPT A;  3QK6 A;  4RYA A;  1AMF A;  3B6T A;  3MPK A;  3C34 A;  1MDQ A;  1A54 A;  2F97 A;  4AB5 A;  3LR1 A;  5JK4 A;  2HFB A;  5IKB A;  3H6T A;  3TTK A;  3ZS6 A;  1M5C A;  4THI A;  3CIJ A;  4ELP A;  3Q29 A;  3QIM A;  3IOV A;  4YKK A;  3O6G A;  5AA3 A;  1OLC A;  4POX A;  5DVF A;  2Q9T A;  4Z7E A;  4OER A;  4OWD A;  1UTB A;  4H67 A;  3B6Q A;  5KDT A;  3OSR A;  3U8Q A;  1MPB A;  3CSG A;  3MVW A;  4IO7 A;  4U1Z A;  1T0K A;  2V3U A;  3OSQ A;  1MDP 1;  1IIT A;  1P99 A;  3O9P A;  4QHQ A;  3G3I A;  3FGS A;  3KSJ A;  5CMM A;  2QMX A;  2D21 A;  1R1N A;  2OZZ A;  5DEX B;  4NTL A;  2OWT A;  2A5S A;  1Z7N E;  2Z8F A;  3OD7 A;  3TKD A;  4PFU A;  5I57 B;  2I48 A;  2V3T A;  1H44 A;  3UK4 A;  1FQE A;  3OEM A;  3LSX A;  4ELQ A;  3KBR A;  5K2X A;  5DT6 A;  4FE8 A;  3IOW A;  5I59 B;  4GL8 A;  1D3K A;  4P0G A;  2X7Q A;  1B1X A;  3KOS A;  4YMB A;  2ZNU A;  1A55 A;  1Y3P A;  3KOT A;  1RYX A;  3A3C A;  4KYE A;  1HSE A;  4NF6 B;  4BDR A;  2QJE A;  4EQ9 A;  2OLB A;  3TTR A;  4ESX A;  5I57 A;  2HAU A;  1VFE A;  3R6U A;  4QRZ A;  2B65 A;  5DYH A;  4LVQ A;  1M5D A;  1MY2 A;  3UIF A;  1ZTY A;  4TQU Q;  2G29 A;  3K1N A;  2Y84 A;  2Y7W A;  2RCB A;  1B3F A;  4I62 A;  4XTC Q;  3KJT A;  3U72 A;  1ZMG A;  4ZE8 A;  2I4C A;  3ECR A;  1VSO A;  1FTL A;  5ITO A;  4LUB A;  4GXS B;  2Q88 A;  4JBZ A;  4XKQ A;  3OEN A;  4P0I A;  3PUZ E;  1VFD A;  4G77 A;  1MRP A;  4R6Y A;  4H8J A;  2ONS A;  2LAO A;  2RF1 A;  2GFE A;  3FXU A;  3V5A A;  1PB9 A;  4G8M A;  3FVK A;  1LAF E;  1I6A A;  4LZ7 A;  3F11 A;  3BKI B;  3SDF A;  4FIM A;  2H5Y A;  5TPA B;  2PMS A;  5A5X B;  5CBS A;  4F31 B;  2XXW A;  3KN7 A;  4RPO A;  1B7U A;  3LBS A;  3T9V A;  2OJT A;  4R72 A;  2V84 A;  4P11 A;  4I1D A;  2F35 A;  3FIR A;  1PB7 A;  1MPD A;  4DXU A;  3QYT A;  2PT2 A;  1URS A;  4IO3 A;  3EQ1 A;  4KYS A;  1FQD A;  2Z8E A;  2GRV A;  1B46 A;  1OVB A;  5L9S A;  4M4G A;  1MQD A;  5TPA A;  3G3G A;  3V89 B;  2XXI A;  2O69 A;  3K1P A;  4R75 A;  3IB0 A;  5TP9 B;  2I0C A;  4HCW A;  3CG3 A;  3MW0 A;  5BWJ A;  1Q1K A;  4LA9 A;  5CMC A;  3OXN A;  3B7D A;  3MZB A;  3OOA A;  1JEU A;  3IK6 B;  3V8X B;  3T9H B;  3KSX A;  4POW A;  1VE4 A;  3Q26 A;  4YB7 A;  3LSF B;  1BLF A;  3KG2 A;  3TFL A;  1SW5 A;  2UVJ A;  4TOZ A;  4LON B;  1NFT A;  2DVC A;  3FJG A;  1SBP A;  4ZE9 A;  3T96 B;  3P7I A;  3I6V A;  5FTI A;  2RC8 A;  5CBR A;  4QFP A;  1URD A;  1DPE A;  4U22 A;  5TP9 A;  3RTW B;  1UIV A;  4U4X A;  1PBQ A;  3FAS A;  1RKM A;  2OWS A;  4I8C A;  1B5J A;  2XXU A;  4RY1 A;  2UYE A;  1QUI A;  2ZNT A;  4F19 A;  1FW0 A;  5H8N B;  5KZT A;  1VR5 A;  3GXA A;  3U92 A;  2V25 A;  4PFW A;  1SDX A;  2PT1 A;  1NNP A;  1TXF A;  4XIG Q;  1FQB A;  1MH4 A;  3MP1 A;  1DTZ A;  4NWD A;  4KQP A;  1A8F A;  2DS9 A;  1I6Q A;  3FVO A;  3QUF A;  4GVO A;  5DTB A;  4H5F A;  4KHZ E;  3RTF B;  3SEU A;  2P2A A;  4ZEC A;  1A40 A;  3RN8 A;  4XKP A;  1MY1 A;  3FUZ A;  3O66 A;  1H3D A;  2R6G E;  5L8D A;  3LSL A;  2ZMB A;  1OIB A;  4MFI A;  3VXB A;  3N26 A;  2I58 A;  1ANF A;  2F5X A;  3DP6 A;  3D4C A;  1MXW A;  2DSF A;  1MY0 A;  3E4R A;  3G3J A;  5FHN A;  2IEE A;  3S9L C;  5B7D A;  2DWA A;  1FCK A;  1MY3 A;  1KWH A;  4U23 A;  2ZYN A;  3HPI A;  1XT8 A;  2RKM A;  3MVZ A;  4OXV A;  3ZKL A;  3CG1 A;  3MUQ A;  2QS1 A;  4R2F A;  4ZEB A;  1B3L A;  1SQY A;  2FNC A;  2Q89 A;  2HQ0 A;  5DVI A;  2B3B A;  3TCF A;  5CMB A;  1JQF A;  2Q2A A;  1AIV A;  2ONK E;  3IOT A;  1TFA A;  4G8H A;  2ZXT A;  3G3H A;  4DZ1 A;  3K02 A;  3L6H A;  2YLN A;  4G8N A;  4G68 C;  4JSD A;  1YCJ A;  1D9Y A;  1BTJ A;  4EXK A;  2AL5 A;  4NE4 A;  1IXH A;  3JZJ A;  2XXV A;  4ELO A;  1US4 A;  4DIG A;  4M1V A;  1GGG A;  3KN8 A;  1FQF A;  2XXH A;  4YKJ A;  1L5T A;  4YKP A;  1M5F A;  1US5 A;  3PMV A;  1OVT A;  3Q28 A;  3MAM A;  3RUM A;  3H7M A;  2F7C A;  1MG1 A;  4R9F A;  1NNT A;  2E1S A;  3OO9 A;  4FEC A;  3CR9 A;  3T9U A;  2ZYO A;  1P1U A;  2F78 A;  2QPQ A;  3UP9 A;  5M2V A;  3RT6 B;  3PGF A;  3TZA A;  1YAE A;  3PMW A;  1NKX A;  1IZ1 A;  2NOO A;  1BP5 A;  3TMG A;  2NWJ A;  2V3Q A;  3L6G A;  3TQL A;  3BFU A;  3E3K A;  3PUY E;  3WAF A;  4H5G A;  4E0W A;  4F3B A;  5I2K B;  3KFM A;  1XOC A;  4F29 A;  1SI1 A;  4OZ9 A;  4RK2 A;  4C0R A;  4GFR A;  3FJ7 A;  3TAJ A;  2GH9 A;  3TQW A;  1JNF A;  1NNK A;  3VVE A;  3M8U A;  1ZJL A;  3MBP A;  4DCX A;  1OQH A;  3IAZ A;  5IAI A;  3U93 A;  2OK2 A;  2DWH A;  3RQT A;  3FVG A;  4NED A;  3C31 A;  1PBP A;  1Y3Q A;  4KCC A;  4F2O A;  5JEI A;  5I2K A;  4RXL A;  3EHS A;  3PMX A;  3MWB A;  1PEB A;  4LQ5 A;  5FHM A;  4BLA A;  4GIZ A;  5F7V A;  4WXJ A;  4H65 A;  1MXZ A;  3OMB A;  3K6W A;  3KN3 A;  4RNS A;  4GRK A;  4HCY A;  2CZL A;  4DXB A;  1HSJ A;  4XXU A;  3PPR A;  4FAJ A;  3EHT A;  4FED A;  1Q35 A;  2REG A;  4OFO A;  1LAG E;  3SEY A;  4ONY A;  3A09 A;  5F1Q A;  3W9V A;  3QXM A;  2DP8 A;  1LFI A;  3MQ9 A;  1B3G A;  5L9O A;  1Y4T A;  4ZEI A;  3VXC A;  1OLA A;  3H6U A;  4C1U A;  3RLF E;  5H8F A;  5BUU A;  5HBC A;  3SEX A;  2DOJ A;  1QVS A;  1FTJ A;  4UAC A;  3EN3 A;  4PP0 A;  3RNN A;  1M5E A;  1B40 A;  1P1W A;  4BDL A;  3RY3 A;  3OO8 A;  5I58 A;  4LZ5 A;  1TWY A;  2HAV A;  3IL1 B;  1NMU A;  3ONM A;  4KD5 A;  4YZZ A;  5B70 A;  4GQO A;  4QSE A;  3T66 A;  2FA7 A;  4N07 A;  1URG A;  4YKI A;  1SVX B;  4OEV A;  3USD A;  2HZK A;  1D9V A;  3TTL A;  2I3W A;  3N5L A;  3MVX A;  3UA8 A;  4F3P A;  1AL3 A;  4R2B A;  1B0L A;  2XXP A;  5ICT A;  1CB6 A;  4IY6 A;  1LST A;  3C36 A;  2VD3 A;  3CFL A;  4YB5 A;  2VOZ A;  4O3C A;  5CI5 A;  3VLV A;  3GZG A;  3EF7 A;  1B3H A;  4WKM A;  4GF8 A;  4MLQ A;  2NUV A;  3FV1 A;  1LGB C;  3S9N C;  3PU5 A;  3H4Z A;  3IB2 A;  2DVZ A;  1B32 A;  1D4N A;  3T93 B;  3S9E A;  2QS2 A;  3SES A;  3TCG A;  3CFZ A;  4QFK A;  2XXY A;  1H76 A;  4QFN A;  4F39 A;  1MM7 A;  3B6W A;  3OEK A;  3VV5 A;  3PPP A;  3KZG A;  2UVI A;  2ESN A;  3LUY A;  3UOR A;  4RPN A;  4YAH X;  3IR1 A;  4ND9 A;  3O6I A;  2D3I A;  1XVY A;  3ZSF A;  1POY 1;  1CE2 A;  1JVY A;  3C9H A;  4QSC A;  3FAT A;  4F1U A;  3Q25 A;  4NWC A;  4ZED A;  2GHB A;  3G3K A;  3N94 A;  1XS5 A;  2I0B A;  3QUJ A;  1O64 A;  4PQJ A;  3T22 A;  4KYD A;  1B7H A;  2G93 A;  3SEW A;  3DP8 A;  4H1X A;  1IXC A;  2ZYM A;  2HXW A;  2I4B A;  3TDJ A;  3S2V A;  4GD5 A;  3CVG A;  2X7P A;  4GXA A;  4RA1 A;  3T9X B;  5TU0 A;  5J1D A;  4Q0C A;  3VLU A;  3RPW A;  2DQV A;  1R9Q A;  1MPC A;  5AA2 D;  1H43 A;  3BFT A;  4BDN A;  3LC8 A;  4ISU A;  4F1Y A;  2BJJ X;  3PD8 A;  4JWO A;  3M3F A;  4N6P A;  5HM4 B;  5AA2 B;  1NH7 A;  1GTK A;  2P1S A;  2F7B A;  3QAX A;  3SKP A;  4GOT A;  4TLM B;  1USY E;  1NL5 A;  3A3U A;  2HCA A;  4Q30 B;  4MF3 A;  1JW4 A;  2DWI A;  1GV8 A;  2Y7I A;  4NF4 B;  1UIU A;  1ZU0 A;  4R6K A;  5I2N B;  1N76 A;  3MZ1 A;  1DOT A;  5ITP A;  4K3F A;  2DWJ A;  2QS4 A;  4E0X A;  3FXR A;  3FV2 A;  1MQG A;  2Q2C A;  5JTY B;  2E0S A;  1B2H A;  4JWY A;  2B3F A;  3H06 B;  3SER A;  2XXQ A;  1LLS A;  3C33 A;  4OHN A;  3THI A;  4OMB A;  4ZEF A;  5AA2 A;  2PX1 A;  2F6P A;  1LCT A;  3AXF A;  4NF5 A;  2XX8 A;  3TCH A;  4H8I A;  2ONR A;  3OO6 A;  4Z0I A;  4ELR A;  2Z8D A;  2F36 A;  3PUW E;  1EZO A;  2YPN A;  3O28 A;  4DCY A;  4NF4 A;  4IY5 A;  4O3B A;  1LBC A;  3FD3 A;  2QS3 A;  5FHO A;  5I2N A;  1MXX A;  3GLB A;  2AYS A;  3DEL B;  4FAT A;  4Q8R A;  1N04 A;  4H0W A;  4ECF A;  1JVX A;  1B05 A;  3S9M C;  2O51 A;  2H9B A;  5JTY A;  3R26 A;  3WAE A;  5EHM A;  2WKY A;  4G4P A;  3K6V A;  1S50 A;  3MP8 A;  2ABH A;  1S7Y A;  3BBR A;  1N7W A;  4U2R A;  1P1O A;  4UA8 A;  3VLW A;  1QUJ A;  2O6A A;  3TTM A;  3IJO B;  1ZIU A;  3FVN A;  3G3F A;  1B3E A;  2DE4 A;  2ZYK A;  3HHF A;  4FOR A;  4F2Q A;  1B1H A;  5H8Q A;  1R9L A;  4RK9 A;  4QF9 A;  1FQA A;  4LZ8 A;  1MM6 A;  1B9J A;  4RJZ A;  3HCQ A;  3IOU A;  2PBW A;  2AL4 A;  3W9W A;  5K2Y A;  4DDD A;  2VGQ A;  1IQ7 A;  1LB8 A;  3ZKK A;  3TUS A;  3H03 A;  1MY4 A;  1N3W A;  4C1T A;  2O7I A;  3K2D A;  1MXY A;  4JDF A;  1YTV A;  3EHU A;  4U1O A;  3CI8 A;  1UTH B;  2DXR A;  1LBB A;  1SI0 A;  4OEU A;  1QKA A;  4DLD A;  1SYI A;  4DXC A;  2ALU A;  2DXY A;  2O1M A;  4X1B A;  4OEN A;  2O68 A;  5ISU A;  2UYF A;  3K6U A;  3N6U A;  4OES A;  1XHY A;  1SW1 A;  2QRY A;  2I3V A;  3KGC A;  1B0H A;  4MLV A;  4EDP A;  3ODB A;  1PC3 A;  4X9T A;  3K1M A;  2XX7 A;  1HSL A;  3SET A;  2THI A;  1WVJ A;  2I49 A;  1ATG A;  1PDA A;  4EUO A;  3W15 C;  1N0T A;  4KCD A;  3R7X A;  2XXR A;  4G2Z A;  2O84 X;  5I56 B;  4OET A;  4JSO A;  2ZNS A;  1OMP A;  1UTH A;  1QKB A;  3VVD A;  2R9J A;  1NH8 A;  3IJX B;  5EYF A;  1Y3N A;  2H99 A;  1YPN A;  4IGT A;  3CSB A;  5AA4 B;  2REJ A;  2V93 A;  2Y7K A;  4MH5 A;  3OO7 A;  2OBG A;  2M8C A;  3I5O A;  4BDQ A;  1LB9 A;  4PFY A;  4FEB A;  2GHA A;  1EZP A;  3DLN A;  1MXV A;  3KJ7 A;  4U21 A;  3RT8 A;  2Q8J A;  5I56 A;  2H4I A;  3N6T A;  2NXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...