1EU8A

Structure of trehalose maltose binding protein from thermococcus litoralis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
407
structure length
407
Chain Sequence
IEEGKIVFAVGGAPNEIEYWKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIASGWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYSKPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKDGKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYAWGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYSVQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKYVNSALAGKISPQEALDKAQKEAEELVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords TREHALOSE/MALTOSE BINDING PROTEIN
publication title The crystal structure of a liganded trehalose/maltose-binding protein from the hyperthermophilic Archaeon Thermococcus litoralis at 1.85 A.
pubmed doi rcsb
source organism Thermococcus litoralis
total genus 144
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A01
4EF2A 3FZVA 3TYHA 2RF1A 1UIVA 2F6GA 1OMPA 5JK4A 4ELOA 3KN7A 3CFLA 5ICTA 1JNFA 2OZZA 1DPPA 4P11A 3TPAA 1LFIA 1UIUA 3C34A 1XS5A 1HSJA 4YKPA 3TCGA 5CM6A 4R74A 3SKPA 3TTRA 2DSFA 3IOUA 4FE8A 1B3FA 1MXVA 1XT8A 2I58A 5F1QA 1IEJA 3O66A 4X1DA 1Q1KA 2R71A 4F18A 3PUYE 2FYIA 3CI8A 4LONB 1NNPA 4WEPA 3IR1A 3AXFA 1P1WA 5ITPA 3OEMA 4IB2A 4XXUA 4L17A 1MM6A 3W9VA 3PPPA 4K3FA 1NNKA 1N3XA 2REJA 2OCUA 4OHNA 4JSDA 3DM0A 1FCKA 1I6AA 5EHSA 1EZOA 5CBRA 4LZ8A 2DP8A 1JW1A 2XXTA 4FEDA 2AL5A 5I2NB 4U21A 1LLSA 4NF8B 4OESA 4ZECA 2F5XA 4ZEKA 2UVGA 4ZDMA 3HCQA 4F1YA 2FA7A 3S2VA 4GLIA 4JWXA 4Q8RA 3TTMA 3TZAA 2NVUB 3T96B 3E9XA 4OQOA 1QUJA 4QFLA 3U8QA 5TP9A 3VLUA 3JZJA 3TCHA 3CRBA 1B5HA 2F97A 4JXIA 4BDQA 2DE3A 5KCJA 4PP0A 3P7IA 5KDTB 2O1LA 1UTBA 1P1NA 1IXGA 3D4CA 1MPCA 1MDQA 1QULA 3TTKA 4NF5B 4IO4A 3K6XA 1URSA 3M3KA 3N26A 1VR5A 4FATA 1Y1ZA 2F7AA 1B7ZA 5AA4B 4F19A 3MJNA 3O6GA 1FTOA 2H99A 2O68A 4NTLA 1O63A 2G93A 4H8IA 3K6WA 2I6EA 1B0LA 1FTJA 1FTMA 1SDXA 3EQ1A 3R7XA 1MXZA 1MXWA 4DXUA 1IQ7A 2WKYA 4NF4B 3H6UA 5I58A 4GD5A 4OETA 3A3UA 2O1MA 1ZJLA 4FORA 5FHMA 2H25A 4I9DA 4IO6A 1JEUA 5FTHA 4EUOA 4ESWA 2XXWA 2QJEA 3HO7A 3H3GA 1B4HA 5L9MA 1NH8A 3IB0A 5AA2A 2DS9A 4RA1A 3S4UA 3H4ZA 3ODBA 3PUVE 3K1PA 1DSNA 4QFKA 1B1HA 4JB7A 4C1UA 1A8EA 1B52A 1B2HA 2Z22A 4QHQA 1FQDA 3B7DA 2XXXA 4XTCQ 4ZE9A 4JDFA 2V3QA 4ZEFA 5H8QA 4OFLA 1N0TA 1ELJA 4GFRA 2VD2A 4LQ2A 4ZS9A 3R26A 3MWBA 4BDNA 3U1OA 3SEUA 2F6PA 1P1QA 4XKRA 2NXOA 3BKIB 1EZ9A 4IO7A 3V5AA 2DYXA 1Z7NE 5DEXA 4G8HA 3TDJA 4XIGQ 4ESXA 3H7MA 4HCYA 1H43A 5H8QB 5H8NB 3C31A 4E0WA 1M5FA 4GWOA 5J1DA 3C4MA 2O7IA 1ANFA 4KHZE 5JEIA 2X26A 3V89B 4F3BA 4C0RA 1DTGA 3PUZE 3VDFA 1BLFA 2R6GE 5F7VA 3KSXA 1JW4A 1B05A 3QUFA 2YJPA 3QK6A 1OQGA 1ZKBA 5CMBA 3M8UA 2DE4A 2XXPA 4Q0CA 4YKKA 2F35A 4KYDA 3U94A 1QUKA 3IAZA 1Y1MA 4U22A 5I56A 1PBPA 2F34A 2XXIA 4PETA 2V3UA 3L6GA 1ZLQA 4AQ4A 2O84X 3MAMA 1SI0A 4LQ5A 3S9NC 2THIA 1IZ1A 4YMBA 1D4NA 2VGQA 2I0BA 5K2YA 3FATA 4LVQA 4F2OA 5CC2A 4PFUA 1H45A 3KOTA 4F1UA 1FQAA 3T9XB 5AA3A 2A5SA 5B70A 1J1NA 4POXA 3K02A 4QSEA 1LFGA 2H5YA 2OWTA 1R9QA 1XOCA 1DPEA 1MY2A 2P0SA 3FJGA 4F3SA 4F3PA 5BUUA 4NWDA 3IOVA 1QJMA 4DXBA 3OOAA 2RC8A 5A5XB 1D9YA 2UVJA 4UACA 1FQBA 1SYHA 3VVEA 5H8FA 4YB6A 3CSBA 3KEIA 3USDA 4DLDA 2XHDA 3U72A 1B46A 1T0KA 1P1UA 3H6TA 3E4RA 4RNSA 3MVZA 2QMWA 3MC2A 3HPIA 4E0XA 3EHUA 2I3WA 1B3HA 2IEEA 4AB6A 4RPOA 1US4A 1Y9UA 3SESA 1N7WA 5DVJA 2KLFA 3QXMA 1N3WA 3ILTB 2DVZA 4I62A 3QIMA 2DWJA 2XX9A 3EN3A 3OSRA 3DP6A 4YB5A 4G4PA 3OELA 3ZSFA 2ZYOA 4R6HA 4NWCA 4EXLA 2DVCA 1Y3QA 4P0GA 4YKIA 3F11A 4DXCA 3Q25A 1YAEA 3KG2A 1JQFA 3TTLA 3TFLA 4G77A 4RJZA 3A3CA 4Z7EA 1UQWA 1LAHE 3EF7A 3FIRA 1PEBA 1L5TA 1WVJA 3OEKA 1H76A 1MPBA 1TXFA 3BBRA 3HHGA 3VXBA 1DMBA 3PD9A 3MP6A 5AA1A 4NF6A 2CMOA 3B6QA 1TFAA 3LC8A 3UIFA 1D3KA 2Q9TA 5I59A 5CMKA 1VSOA 4EXKA 4ZZAA 2HAVA 3MUQA 2ZNSA 1B1XA 1AL3A 1GR2A 2IA4A 4KYEA 3I6VA 5AE4A 1A99A 2W7YA 2DXRA 2PYYA 2NUVA 4QRZA 1OVTA 1RYXA 2CZLA 2HFBA 2DQVA 4H5FA 4GXAA 1B40A 2OLBA 4TQUQ 1S9TA 4H8JA 1USYH 4ZE8A 3RLFE 2LAOA 2ZXTA 4PFWA 3IOTA 4G8MA 1PBQA 3V8XB 3I5OA 2RINA 2ZMBA 2ZYMA 1YPNA 5I84A 4F29A 2QL3A 1AH5A 3SEXA 2Y7IA 1Y4TA 2A5TA 1LFHA 4HS7A 2H98A 1IXHA 3IK6B 3ONMA 2VD3A 1M5CA 1VFEA 3SERA 3FXUA 1HSLA 3RQTA 3K1NA 1Z7ME 4Q30B 5ISUA 3OO7A 4H6DA 5KZTA 1N84A 2UYFA 3KZGA 1WDNA 3LR1A 3FXRA 2NOOA 1MG1A 2QS3A 3UGWA 2H4IA 3TELA 1BKAA 4GVOA 4FECA 2QSXA 3VE1B 1Y3PA 1GVCA 5EYFA 4ZZEA 3RNNA 3C36A 4UA8A 4IO5A 1JVYA 1MQHA 3TKDA 4MF3A 1LBBA 1FW0A 4QFNA 4FEBA 3OO8A 2X7QA 2PVUA 4TLMB 2XX8A 3N94A 3QUJA 1SI1A 1VFDA 4BDRA 1B7UA 4FIMA 1POTA 4IO2A 4QFOA 3PPQA 4JWOA 1S50A 4IGRA 1AIVA 4POWA 2QMXA 3GZGA 5HPQA 4OMBA 5TP9B 3IB2A 3UN6A 2RC9A 1B4ZA 3O9PA 3H6VA 4OWDA 1NL5A 2B65A 5KCJB 2DOJA 4ISUA 4YKJA 1MY0A 3PMXA 4U4XA 4TLLB 4WXJA 1CB6A 1UTBB 3Q26A 4C1TA 4FJPA 4OTEA 2AL4A 2RC7A 3PPRA 2OJTA 4GL8A 5CRYA 1O64A 3VV5A 2OK2A 5HBCA 4QSDA 3VLWA 1YCJA 1ZMGA 1QW0A 4XKPA 4R9FA 2RKMA 2D21A 5HM4B 5M2VA 1N7XA 4H5GA 3K4UA 4DE8A 5I2KA 3UP9A 5I58B 5ICQA 1IIWA 3MBPA 3FVKA 2HQ0A 1LAFE 1NFTA 1R1NA 3DELB 2DXYA 1II5A 4GRKA 1US5A 2REGA 4NMYA 4F31B 5DT6A 4MLVA 4U1ZA 5AA2B 1MXUA 3T9HB 4YB7A 1MQJA 3K2DA 4M1VA 3KGCA 2XXQA 3KN8A 4KPTA 2QS1A 4QSCA 3S9MC 1UTHA 3TMGA 4EQBA 2OBGA 5ELVA 4LZ5A 4R2BA 1XVYA 2UYEA 3MZ1A 3LSXA 1LBCA 5JTYA 4THIA 3EHSA 3CVGA 3EHTA 4G68A 3IO6A 5CMCA 1SD3A 1IUDA 4HTGA 2HCAA 3RPWA 2XD2A 2X7PA 4ZEBA 4YICA 4YZZA 2F36A 3C33A 3MP1A 5H8HA 2HXWA 3HHFA 4OFOA 5DEXB 3CIJA 3T9VA 3ZKKA 4U2RA 4H67A 1PB8A 4ZEDA 4RPNA 5DVFA 4PE5B 2XX7A 2I4CA 4KQPA 1TFDA 2Q88A 4DDDA 1NKXA 1I6QA 3CFZA 3WAEA 5L9SA 4U4SA 3RTFB 1EH3A 3Q28A 1QKAA 4G2ZA 3BFTA 3IB1A 3LBSA 2D5WA 3KN3A 4Z0IA 3LSWA 1B7HA 4ZEIA 1FQEA 1B5JA 3U93A 5TPAA 1JEVA 4XKNA 2BJJX 4I1DA 2PMSA 1IITA 1IXIA 3FJ7A 4RK2A 4KFQA 1H3DA 5I56B 3B6WA 4JBZA 4KCDA 3IORA 3UA8A 3JYRA 2Z23A 1F9BA 3KOSA 4X1BA 2G29A 1P1OA 4N13A 1QVSA 4RXLA 4R75A 3VXCA 4GQOA 1SQYA 3PD8A 1JVXA 2Z8DA 2R9JA 1PC3A 5CBSA 2Q2CA 4O3AA 1XHYA 4YU0A 3TQLA 5L9OA 5K2XA 1A55A 1Q35A 4KD5A 4PFYA 4GF8A 4QFPA 1DOTA 2ONSA 4N6PA 3DLNA 4ELPA 1QUIA 2UVIA 2XD3A 4DCYA 2Z8FA 5H8FB 4ECFA 1FTKA 1SBPA 4F3GA 1QKBA 4IGTA 1EU8A 4MFIA 3DP8A 3GXAA 3MPLA 4DZ1A 1POY1 1LCTA 1S7YA 2E0SA 3W9WA 3H06B 1ZU0A 3MVWA 4MBPA 3PMVA 2Y7RA 4DCXA 2HEUA 3S9EA 2DE2A 3CG3A 1MPDA 2I49A 3CSGA 3K00A 2GHAA 3JV9A 1OIBA 4BDOA 3MW0A 1MS7A 3BFUA 4AB5A 4R73A 4NEDA 4OYVA 2Q2AA 1WODA 1FQFA 1SYIA 3C35A 1NMUA 1MXXA 2ANJA 1A8FA 3MZ9A 2PBWA 2XXYA 1LB9A 1Y4CA 3HSTA 4OEVA 3N6TA 4WKMA 4HCWA 4XKQA 1EZPA 2VOZA 2PX1A 2PT1A 1PB9A 1MY4A 1M5DA 3RGYA 4H0WA 3UK4A 3U92A 4NF6B 3TODA 2V25A 5IAIA 1XVXA 5I59B 3VVFA 4KI0E 2RCAA 3C9HA 4GL0A 5I2NA 4EQ9A 3IO4A 4NF8A 4IO3A 3DP4A 1OVBA 2XXVA 2I3VA 5FHOA 3GBBA 1KWHA 2ESNA 3KJ7A 2OWSA 3PUWE 1PB7A 1BTJA 4PQJA 3T66A 4IY6A 5I57A 1H44A 2B3FA 3ECRA 4LZ7A 5BWJA 4NE4A 1GV8A 3G3HA 2ZYNA 3L6HA 1TT1A 4JSOA 3MPKA 1GTKA 3I3VA 3FUZA 5TU0A 2Y7PA 4YAHX 3K1MA 3M3LA 1SW4A 3K0VA 1URGA 4F22A 5KDTA 3OENA 4H1XA 2A5TB 2PT2A 2ZNTA 1URDA 3C32A 4KYSA 3LSFB 5I57B 2ONRA 3T22A 2UVHA 4NF5A 2QPQA 5FHNA 2VHAA 2NWJA 3G3FA 1LGBC 4MH5A 2F7BA 2ALUA 4F1VA 3UORA 3QYTA 3KFMA 1B3LA 5CMMA 5AA4A 2O51A 1LSTA 4I8CA 1LCFA 2UXAA 1USYE 2QRYA 4O3CA 2QS4A 1AMFA 1B3EA 3PU5A 4Q5TA 4WEDA 3FV2A 3ZKLA 3FJMA 1B5IA 3IL1B 2VP1A 2FNCA 3VFJA 1NNFA 4NF4A 2GFEA 1B58A 2M8CA 3FXQA 2Y84A 2I4BA 5DYHA 3FGSA 1SVXB 1PDAA 1RKMA 4RK9A 1ZIUA 3VVDA 3SEYA 4OXVA 4LUBA 3OSQA 3FASA 5IKBA 1N04A 2V84A 3OO9A 3HN0A 4GIZA 4OVJA 3PGFA 4OZ9A 1B3GA 3GBAA 5EHMA 3LSLA 3SEVA 1ZTYA 3H03A 3OMBA 1GGGA 4IY5A 5H8SA 3GLBA 4EDPA 2E1SA 2V3TA 1Y20A 3O2AA 1MQIA 4ELQA 1B9JA 1JW5A 3SETA 3KJTA 3KBRA 2HZLA 5L8DA 2Z8EA 3PMWA 1B6HA 3W15C 2P1SA 4JWYA 4OENA 3PPOA 3CR9A 5ITOA 3N5LA 2DWAA 2F8DA 2P2AA 4GOTA 1MQDA 4BDMA 3QSLA 5DVIA 3RY3A 4BLAA 2GRVA 4M4GA 5H8NA 3OD7A 5I2KB 1OLCA 4HW8A 2GH9A 2F78A 4FAJA 1B32A 2YPNA 3RT8A 1NH7A 1MDP1 3K01A 1NNTA 3O97A 3K6UA 3QAXA 3O6IA 4BDLA 4KR5A 3TTNA 4N07A 4LATA 4O3BA 3H6WA 3RUMA 4MLQA 3FD3A 4F2QA 4X9TA 2RCBA 5B7DA 1UTHB 4OFJA 2Y7WA 5DTBA 2YLNA 1N76A 3TCFA 2Y7KA 1ATGA 1R9LA 1Y3NA 4U1OA 5JTYB 1MH3A 1BP5A 2H9BA 1FTLA 4G68B 1A40A 3PUXE 4EF1A 3ILUB 4G8NA 2ZNUA 3TUSA 2HAUA 2D3IA 1JETA 3MQ9A 4PFTA 4KCCA 3TAJA 3RTWB 3SDFA 5H8HB 4X48A 4OERA 1YTVA 3MVXA 1MQGA 3KSJA 3PPNA 2HZKA 2ONKE 1OLAA 3N6UA 2V93A 3MP8A 3PV0E 1SW2A 3ZS6A 1O7TA 3O29A 1MXYA 4ND9A 1SW1A 5CI5A 2AYSA 3G7WA 1R6ZA 2QS2A 3Q29A 1A54A 4LA9A 2ZYKA 2I0CA 3RT6B 2GHBA 4QF9A 2Q8JA 1CE2A 4GXSB 4F39A 5A5XA 5TPAB 1HSEA 3G3IA 3S9LC 4RYAA 2AIXA 3THIA 2ABHA 3VLVA 3RN8A 2O7UA 3IOWA 1M5EA 3G3JA 4DIGA 4R2FA 2O6AA 2F7CA 4RY1A 1DTZA 1M5BA 3O6HA 2DWIA 1ZBMA 2O69A 4ELRA 4R6YA 4H65A 2B3BA 3IX1A 4YMAA 4EQ7A 5LOMA 3SEWA 1A7LA 3E3KA 4OEUA 2XXRA 4TOZA 3G3GA 3IJXB 3OO6A 3D4GA 3T9UA 2XXHA 4ONYA 1RYOA 1LB8A 3T93B 4P0IA 3M3FA 1MY1A 1IXCA 3MVYA 3V83A 1XC1A 2I48A 3Q27A 3FV1A 3EPEA 3FVNA 3MZBA 1BIYA 4R72A 1I6BA 3OXNA 3IJOB 5AA2D 3WAFA 1B0HA 4R6KA 1AOVA 1MY3A 1I69A 2DWHA 1D9VA 3A09A 3O28A 3CG1A 3R6UA 1LAXA 1SW5A 3G3KA 3E13X 1FQCA 1B51A 1TWYA 3LUYA 5FTIA 1LAGE 2XXUA 3TQWA 1P99A 3TEPA 1VE4A 3HV1A 4G68C 1MH4A 3FVGA 1MRPA 4LP2B 2Q89A 4R9GA 1OQHA 3B6TA 3FVOA 4U23A 3K6VA 1MM7A 3CFXA
chains in the Genus database with same CATH superfamily
1IMEA 4EF2A 3FZVA 3TYHA 2RF1A 1UIVA 2F6GA 1OMPA 5JK4A 4NF0A 4ELOA 3KN7A 1NUXA 3CFLA 5ICTA 1JNFA 2OZZA 1DPPA 4P11A 3TPAA 1LFIA 1BK4A 1UIUA 3C34A 2Q8MA 1XS5A 1HSJA 4YKPA 3KC0A 3TCGA 2WBDA 5CM6A 4R74A 3SKPA 3TTRA 2DSFA 3IOUA 4FE8A 2XXKA 1B3FA 1MXVA 1XT8A 5IZ1A 2I58A 2KR0A 2L5VA 5F1QA 1IEJA 3O66A 4X1DA 1Q1KA 2R71A 4F18A 3PUYE 2FYIA 3CI8A 3MYUA 4LONB 1NNPA 4WEPA 3IR1A 3AXFA 1P1WA 4I40A 5ITPA 3OEMA 4IB2A 4XXUA 4L17A 1MM6A 3W9VA 3PPPA 4K3FA 1NNKA 1N3XA 2REJA 2OCUA 4NX1A 4OHNA 4MCOA 4JSDA 4GWYA 1RDXA 2Q74A 4QBAA 3DM0A 1FCKA 1I6AA 5EHSA 5FBPA 5CBRA 4LZ8A 2DP8A 1JW1A 5I5PA 1EZOA 2XXTA 4FEDA 2AL5A 5I2NB 5IZ3A 4U21A 3A29A 1LLSA 4NF8B 4OESA 4ZECA 2F5XA 4ZEKA 2UVGA 4ZDMA 3HCQA 4F1YA 5ET5A 2FA7A 4MAGA 3S2VA 4GLIA 4JWXA 4Q8RA 3TTMA 1AWBA 3MSTA 3TZAA 2NVUB 3T96B 3E9XA 4OQOA 1QUJA 4QFLA 3U8QA 5TP9A 3VLUA 3JZJA 3TCHA 3CRBA 1B5HA 2F97A 4JXIA 4BDQA 2DE3A 5KCJA 4PP0A 3P7IA 5KDTB 2O1LA 1UTBA 1FPJA 4PFBA 1P1NA 1IXGA 3D4CA 1MPCA 1MDQA 1QULA 3TTKA 4NF5B 4IO4A 3K6XA 1URSA 5IZZA 3M3KA 3N26A 1VR5A 4FATA 1Y1ZA 2F7AA 1B7ZA 5AA4B 1FPIA 2FHYA 4F19A 3MJNA 1EYKA 3O6GA 1FTOA 2H99A 2O68A 4NTLA 1O63A 2G93A 4H8IA 3K6WA 2I6EA 1B0LA 1FTJA 1FTMA 1SDXA 3EQ1A 3R7XA 1MXZA 1MXWA 4DXUA 1IQ7A 2WKYA 4NF4B 3H6UA 5I58A 4GD5A 3FXBA 4OETA 3A3UA 5EQAA 4PTKA 2O1MA 1ZJLA 4FORA 5FHMA 2H25A 4I9DA 4IO6A 2ZZXA 1JEUA 5FTHA 4EUOA 4ESWA 2XXWA 2QJEA 3HO7A 3H3GA 1B4HA 5L9MA 1NH8A 4G61A 3IB0A 3LUZA 2DS9A 5AA2A 4RA1A 3S4UA 3H4ZA 3ODBA 3PUVE 3K1PA 1DSNA 4QFKA 1B1HA 4JB7A 4C1UA 1A8EA 1Q9DA 4N8YA 1B52A 1B2HA 3KBZA 2Z22A 4QHQA 1FQDA 3B7DA 2XXXA 4XTCQ 4ZE9A 3IFAA 4JDFA 2V3QA 4ZEFA 5H8QA 4OFLA 1N0TA 5EYHA 1ELJA 4GFRA 3B50A 2VD2A 4LQ2A 4ZS9A 3R26A 3MWBA 4BDNA 3U1OA 3SEUA 2F6PA 1P1QA 4XKRA 2NXOA 5IM2A 4X8RA 3BKIB 1EZ9A 4IO7A 3V5AA 2DYXA 1Z7NE 2WBBA 5DEXA 4G8HA 3TDJA 4XIGQ 3BIHA 4ESXA 4NHBA 3H7MA 4HCYA 4MEVA 1H43A 1G0HA 5H8QB 5H8NB 3C31A 5LDZA 4E0WA 1M5FA 4GWOA 5J1DA 3C4MA 1DCUA 2O7IA 1ANFA 4KHZE 5JEIA 4PAFA 2X26A 3V89B 4F3BA 4C0RA 1DTGA 3PUZE 3VDFA 1BLFA 2R6GE 5F7VA 3KSXA 1JW4A 1B05A 3QUFA 2YJPA 3QK6A 1OQGA 1ZKBA 5CMBA 3M8UA 2DE4A 2XXPA 4Q0CA 4YKKA 2F35A 4KYDA 3U94A 1QUKA 3IAZA 5ESYA 2JJKA 4U22A 1Y1MA 5EQ7A 1PBPA 2F34A 2XXIA 5I56A 4HE0A 4PETA 2V3UA 3L6GA 1ZLQA 4AQ4A 2O84X 3MAMA 1SI0A 1EYIA 4GX4A 4LQ5A 4GBWA 3S9NC 2THIA 1IZ1A 4YMBA 1D4NA 4GWZA 2VGQA 2I0BA 5K2YA 3FATA 4PBHA 4LVQA 4F2OA 5CC2A 4PFUA 3CHGA 1NI9A 2XA5A 1H45A 2V4CA 1VDWA 3KOTA 4F1UA 1FQAA 3T9XB 5AA3A 2A5SA 5B70A 1J1NA 4MNCA 4POXA 3K02A 4QSEA 1LFGA 2H5YA 2OWTA 1R9QA 1DK4A 1XOCA 1DPEA 1MY2A 2P0SA 4MNIA 3FJGA 4PGNA 5ET7A 4F3SA 1CNQA 4F3PA 1IMDA 5BUUA 4NWDA 3IOVA 1QJMA 4DXBA 3OOAA 2RC8A 5A5XB 1D9YA 2UVJA 4UACA 1FQBA 1SYHA 3VVEA 2CEXA 5H8FA 4YB6A 3CSBA 3KEIA 3USDA 4DLDA 2XHDA 3U72A 4GBVA 1B46A 4PF8A 2QFLA 1T0KA 1P1UA 3H6TA 3E4RA 4RNSA 3MVZA 2QMWA 3MC2A 3HPIA 4E0XA 3EHUA 2I3WA 1B3HA 2IEEA 4AB6A 4RPOA 1US4A 1Y9UA 3SESA 1N7WA 5DVJA 2KLFA 3QXMA 1FBEA 1N3WA 3ILTB 2DVZA 4I62A 4HE1A 3QIMA 2DWJA 5ET8A 2XX9A 3EN3A 3OSRA 4PE3A 1FPGA 3DP6A 3KC1A 4YB5A 4O94A 4G4PA 3OELA 3ZSFA 2ZYOA 4R6HA 4NWCA 4EXLA 4HXVA 2DVCA 1Y3QA 4P0GA 4YKIA 3F11A 4DXCA 4JVDA 1FRPA 3Q25A 1FPBA 1YAEA 3KG2A 1JQFA 3TTLA 1K9YA 3TFLA 4G77A 4RJZA 3A3CA 5J16A 4N6KA 4Z7EA 1UQWA 1LAHE 3EF7A 3FIRA 1PEBA 1L5TA 1WVJA 3OEKA 1H76A 1MPBA 1TXFA 3BBRA 3HHGA 3VXBA 2HXRA 1DMBA 2OWZA 3PD9A 3MP6A 5AA1A 2PFYA 2CMOA 4N8GA 1LBZA 4NF6A 3B6QA 1TFAA 3LC8A 3UIFA 1D3KA 4I3YA 2Q9TA 4JVIA 5I59A 5CMKA 1VSOA 4EXKA 4ZZAA 2HAVA 4IR8A 4PGPA 3MUQA 2ZNSA 2B4MA 1B1XA 1AL3A 1GR2A 2IA4A 4KYEA 3I6VA 5AE4A 1A99A 2W7YA 2DXRA 2PYYA 2NUVA 4QRZA 1OVTA 1RYXA 2CZLA 2HFBA 2DQVA 4H5FA 4GXAA 1B40A 2OLBA 4TQUQ 1FPDA 1S9TA 4H8JA 1USYH 4ZE8A 3RLFE 2LAOA 2ZXTA 4PFWA 3IOTA 4G8MA 4LN5A 1PBQA 3V8XB 3I5OA 2RINA 2ZMBA 2ZYMA 4P47A 1YPNA 5I84A 4F29A 2QL3A 1AH5A 3SEXA 2Y7IA 1Y4TA 2A5TA 1LFHA 4HS7A 2H98A 1IXHA 3IK6B 4O8MA 3ONMA 2VD3A 1M5CA 1VFEA 3SERA 3FXUA 1HSLA 3RQTA 3K1NA 1Z7ME 4Q30B 5ISUA 3OO7A 4H6DA 5KZTA 1N84A 1K9ZA 2UYFA 3KZGA 4GX6A 1WDNA 3LR1A 3FXRA 2NOOA 1MG1A 2QS3A 3UGWA 2H4IA 3TELA 3EKIA 1BKAA 4PFIA 4GVOA 4FECA 2QSXA 3VE1B 1Y3PA 1GVCA 2F3DA 4P1EA 4P9KA 5EYFA 4ZZEA 4N91A 5IZ3B 3RNNA 1JP4A 3C36A 4UA8A 2Y5KA 4IO5A 1JVYA 1MQHA 3TKDA 4XFEA 4MF3A 1LBBA 1FW0A 4QFNA 1FTAA 4FEBA 3OO8A 2X7QA 2PVUA 4TLMB 2XX8A 3N94A 3RPLA 3QUJA 1SI1A 1VFDA 4BDRA 3E78A 1B7UA 4FIMA 1POTA 4IO2A 4QFOA 3PPQA 4JWOA 1S50A 4IGRA 1AIVA 4POWA 2QMXA 3GZGA 1RDYA 5HPQA 2FBPA 4OMBA 1NV3A 5TP9B 3IB2A 3UN6A 2RC9A 1B4ZA 2HPGA 3O9PA 3H6VA 4OWDA 1NL5A 2B65A 5KCJB 2DOJA 5EQ8A 4ISUA 4YKJA 1MY0A 3PMXA 4U4XA 4OANA 4TLLB 4WXJA 1CB6A 1UTBB 3Q26A 4C1TA 4FJPA 1QGXA 4P8BA 4OTEA 2AL4A 5EQ9A 2RC7A 3PPRA 1YYZA 2OJTA 4GL8A 5CRYA 1O64A 5IGAA 2B4LA 4P1LA 3VV5A 2OK2A 5HBCA 4QSDA 4KXPA 3VLWA 1YCJA 4NG7A 1ZMGA 1QW0A 4XKPA 4R9FA 2RKMA 2D21A 2XWIA 5HM4B 1IMAA 2P3NA 2XWOA 1NUYA 1FBCA 5M2VA 1N7XA 4H5GA 4PAKA 3K4UA 1IMBA 4DE8A 4I3EA 5I2KA 3UP9A 2CEYA 5I58B 4N17A 5ICQA 1NV2A 1IIWA 3MBPA 3FVKA 2HQ0A 1LAFE 1NFTA 1R1NA 3DELB 2WYPA 2DXYA 1II5A 4GRKA 1US5A 2REGA 4NMYA 4F31B 5DT6A 4MLVA 4U1ZA 5AA2B 1MXUA 5F24A 3T9HB 4YB7A 1MQJA 1FPFA 3K2DA 4M1VA 3KGCA 2XXQA 3KN8A 4KPTA 2QS1A 4QSCA 3S9MC 1UTHA 2OBGA 3TMGA 4EQBA 5ELVA 3LV0A 4LZ5A 4R2BA 1XVYA 2UYEA 3MZ1A 3LSXA 1LBCA 5JTYA 1IMCA 1NUZA 4THIA 3EHSA 3CVGA 3EHTA 4G68A 3IO6A 5CMCA 1SD3A 1IUDA 4O7MA 1EYJA 4HTGA 2HCAA 3RPWA 2XD2A 2P3VA 2X7PA 4ZEBA 4YICA 4YZZA 1LBXA 2F36A 3C33A 3MP1A 5H8HA 2HXWA 3HHFA 4OFOA 5DEXB 3CIJA 3T9VA 3ZKKA 4U2RA 2Y5LA 4H67A 1PB8A 4ZEDA 4RPNA 5DVFA 4NGUA 4PE5B 2XX7A 2I4CA 4KQPA 2R8TA 3NOHA 1TFDA 2Q88A 4DDDA 1NKXA 1I6QA 3CFZA 3WAEA 5L9SA 4U4SA 3RTFB 1EH3A 1NV4A 3Q28A 1QKAA 2PFZA 4G2ZA 3BFTA 3IB1A 3LBSA 2D5WA 3KN3A 4Z0IA 3LSWA 1B7HA 4ZEIA 1FQEA 1B5JA 3U93A 5TPAA 1JEVA 4XKNA 2BJJX 1FBFA 4H46A 4I1DA 2PMSA 1IITA 1IXIA 4OVPA 3FJ7A 4RK2A 4KFQA 1H3DA 5I56B 3B6WA 4JBZA 5T3JA 4KCDA 3IORA 3UA8A 3JYRA 2Z23A 1F9BA 3KOSA 4X1BA 2G29A 1P1OA 3SZPA 4N13A 1QVSA 4RXLA 4PDHA 4R75A 3VXCA 4GQOA 1SQYA 1D9QA 3PD8A 1JVXA 2Z8DA 2R9JA 1PC3A 5CBSA 4UABA 2Q2CA 1FSAA 1XHYA 4O3AA 4YU0A 3TQLA 5L9OA 5K2XA 1A55A 1Q35A 4KD5A 4PFYA 4GF8A 4QFPA 1DOTA 2HHMA 2ONSA 4N6PA 3DLNA 4ELPA 1QUIA 2UVIA 4NAPA 2XD3A 4GWXA 2F3BA 4HE2A 5A5LA 4DCYA 5I3SA 2Z8FA 5H8FB 4ECFA 2QVUA 1YXIA 1FTKA 1SBPA 4F3GA 1QKBA 4IGTA 1EU8A 4MFIA 3DP8A 3GXAA 3MPLA 4DZ1A 1G0IA 5DW8A 1POY1 1LCTA 1S7YA 2E0SA 3W9WA 3H06B 1ZU0A 3MVWA 4MBPA 3PMVA 2Y7RA 4DCXA 2HEUA 3S9EA 2DE2A 3CG3A 1MPDA 2I49A 3CSGA 3K00A 2DDKA 2GHAA 3JV9A 1OIBA 4BDOA 3MW0A 1MS7A 3BFUA 4AB5A 4R73A 4FBPA 4NEDA 4OYVA 2Q2AA 1WODA 1FQFA 1SYIA 3C35A 1NMUA 1MXXA 2ANJA 4XEQA 1A8FA 1FBGA 3MZ9A 2PBWA 2XXYA 1FPEA 1LB9A 1Y4CA 2KQZA 3HSTA 4OEVA 3N6TA 4MX6A 4WKMA 1RDZA 4HCWA 4XKQA 1YZ0A 1EZPA 4AS4A 2VOZA 2PX1A 2PT1A 1PB9A 1MY4A 1M5DA 3RGYA 2ZZWA 4H0WA 3UK4A 4X04A 5EYGA 3U92A 4NF6B 3TODA 2WYKA 3RYDA 2V25A 5IAIA 1XVXA 5I59B 3VVFA 4KI0E 2RCAA 3C9HA 4GL0A 5I2NA 4EQ9A 3IO4A 4NF8A 4IO3A 3DP4A 1OVBA 2XXVA 2I3VA 5FHOA 3GBBA 1KWHA 2ESNA 3KJ7A 2OWSA 2XWKA 3PUWE 1PB7A 1BTJA 4PQJA 3T66A 4IY6A 5I57A 1H44A 2B3FA 3ECRA 4LZ7A 5BWJA 4NE4A 4OVQA 1GV8A 3G3HA 2ZYNA 3L6HA 1TT1A 4JSOA 4PFRA 3MPKA 1GTKA 3I3VA 3FUZA 5TU0A 5LTCA 2Y7PA 4YAHX 3K1MA 1LBVA 3M3LA 2CZIA 4PDDA 2BJIA 1SW4A 3K0VA 1URGA 4F22A 5KDTA 3OENA 4H1XA 2A5TB 4DI4B 2PT2A 2ZNTA 1URDA 3C32A 4KYSA 3LSFB 2QVRA 5I57B 2ONRA 3T22A 2UVHA 4NF5A 2QPQA 5FHNA 2VHAA 4PCDA 2NWJA 3G3FA 1LGBC 4MH5A 2F7BA 2ALUA 4F1VA 3UORA 3QYTA 3HFUA 3KFMA 2ZZVA 1B3LA 1FJ9A 1NV5A 4NQ8A 5CMMA 5AA4A 2O51A 1LSTA 4I8CA 1FPLA 1LCFA 2UXAA 1USYE 2QRYA 4O3CA 3GYYA 2QS4A 1AMFA 1B3EA 4P56A 3PU5A 2FVZA 4Q5TA 4WEDA 3FV2A 3ZKLA 3FJMA 1B5IA 3IL1B 1SPIA 2VP1A 2FNCA 3VFJA 1NNFA 4NF4A 2GFEA 1B58A 2M8CA 1LEVA 1INPA 4OA4A 3FXQA 2Y84A 1FBPA 2I4BA 5DYHA 3FGSA 3T1BA 4MNPA 3RPLB 3D1RA 1SVXB 2PCRA 1PDAA 1RKMA 4QXDA 4RK9A 1ZIUA 3VVDA 3SEYA 4OXVA 4LUBA 4N15A 3OSQA 3FASA 5IKBA 1N04A 2V84A 3OO9A 3HN0A 4GIZA 4OVJA 2VPOA 3PGFA 4OZ9A 1B3GA 2VT5A 3GBAA 5EHMA 1NV7A 3LSLA 3SEVA 1ZTYA 3H03A 3OMBA 1GGGA 4IY5A 5H8SA 3GLBA 4EDPA 2WEFA 2E1SA 2V3TA 1Y20A 2XWVA 3O2AA 1MQIA 4ELQA 1B9JA 1JW5A 3SETA 3KJTA 3KBRA 4MIJA 2HZLA 5L8DA 2Z8EA 3PMWA 1B6HA 4GX3A 3W15C 2P1SA 4JWYA 4OENA 3PPOA 3CR9A 5ITOA 4OVTA 1KZ8A 3N5LA 2DWAA 2F8DA 2P2AA 4GOTA 1MQDA 4BDMA 4DI3D 3QSLA 5DVIA 3RY3A 4BLAA 2GRVA 3IFCA 4M4GA 5H8NA 3OD7A 3PTYA 5I2KB 1OLCA 1XI6A 4HW8A 2GH9A 2F78A 4PF6A 4FAJA 1B32A 2YPNA 3RT8A 3B8BA 1NH7A 1MDP1 3K01A 1NNTA 1FBHA 3O97A 3K6UA 3QAXA 3O6IA 4BDLA 4KR5A 3U65A 3TTNA 4N07A 4LATA 4NN3A 4O3BA 3H6WA 3RUMA 4MLQA 3FD3A 4F2QA 4X9TA 2RCBA 5B7DA 1UTHB 4OFJA 4GWWA 1LBYA 2Y7WA 5DTBA 2YLNA 3ROJA 1N76A 3TCFA 1FBDA 2Y7KA 1ATGA 1R9LA 4N81A 1Y3NA 4U1OA 5JTYB 1DBZA 1MH3A 1BP5A 2H9BA 1FTLA 4G68B 1A40A 3PUXE 4EF1A 3T0JA 4PBQA 4O7IA 3ILUB 4G8NA 2ZNUA 4OVRA 3TUSA 2HAUA 2D3IA 4P3LA 1JETA 3MQ9A 4PFTA 4KCCA 3TAJA 3RTWB 3SDFA 5H8HB 4X48A 4OERA 1LBWA 4N4UA 1YTVA 3BIGA 3MVXA 1MQGA 3KSJA 3PPNA 2FIXA 2HZKA 2OX3A 2ONKE 1OLAA 3N6UA 1KA0A 2GQ1A 2V93A 3MP8A 3PV0E 1SW2A 3ZS6A 1O7TA 3O29A 1MXYA 4ND9A 1SW1A 4PAIA 5CI5A 2AYSA 3G7WA 1NUWA 1R6ZA 2QS2A 3Q29A 1A54A 4LA9A 4N6DA 2ZYKA 2I0CA 3RT6B 2GHBA 4QF9A 4XF5A 2Q8JA 1CE2A 4GXSB 4F39A 4GWUA 3QMFA 5A5XA 2VPNA 1NV0A 2WX9A 5TPAB 1HSEA 3G3IA 3S9LC 4RYAA 4MHFA 2AIXA 3THIA 2ABHA 3VLVA 3RN8A 4MJOA 5I7IA 2O7UA 3IOWA 1M5EA 2FIEA 3G3JA 4DIGA 4R2FA 2O6AA 1KA1A 2F7CA 4H45A 4RY1A 1DTZA 1M5BA 3O6HA 2DWIA 1ZBMA 2O69A 4ELRA 4R6YA 4H65A 2B3BA 1IMFA 3IX1A 4YMAA 4JVCA 4EQ7A 5LOMA 3SEWA 4GWSA 1A7LA 3E3KA 4OEUA 4MMPA 2XXRA 2QVVA 4TOZA 3G3GA 3IJXB 3OO6A 3D4GA 3T9UA 2XXHA 4ONYA 1RYOA 1LB8A 3E79A 3T93B 4P0IA 3M3FA 1MY1A 1IXCA 1FPKA 3MVYA 4PC9A 3V83A 1XC1A 2I48A 3Q27A 3FV1A 3EPEA 2CZKA 3FVNA 3MZBA 1BIYA 4R72A 1I6BA 1FJ6A 3OXNA 3IJOB 4OVSA 5AA2D 2MKZA 3WAFA 1B0HA 4R6KA 1AOVA 1MY3A 1I69A 2DWHA 1D9VA 3A09A 3O28A 3CG1A 3R6UA 1LAXA 4AS5A 1SW5A 3G3KA 3E13X 1FQCA 1B51A 1TWYA 3LUYA 5FTIA 1LAGE 2CZHA 3FBPA 2XXUA 3TQWA 1P99A 3TEPA 1VE4A 3HV1A 4G68C 1MH4A 5ET6A 3FVGA 1MRPA 4LP2B 2Q89A 3ISPA 1NV6A 4R9GA 1OQHA 3B6TA 3FVOA 4U23A 3K6VA 1MM7A 3CFXA 1NV1A
chains in the Genus database with same CATH topology
4EF2A 3FZVA 3TYHA 2RF1A 1UIVA 2F6GA 1OMPA 5JK4A 4ELOA 3KN7A 3CFLA 5ICTA 1JNFA 2OZZA 1DPPA 4P11A 3TPAA 1LFIA 1UIUA 3C34A 1XS5A 1HSJA 4YKPA 3TCGA 5CM6A 4R74A 3SKPA 3TTRA 2DSFA 3IOUA 4FE8A 1B3FA 1MXVA 1XT8A 2I58A 5F1QA 1IEJA 3O66A 4X1DA 1Q1KA 2R71A 4F18A 3PUYE 2FYIA 3CI8A 4LONB 1NNPA 4WEPA 3IR1A 3AXFA 1P1WA 5ITPA 3OEMA 4IB2A 4XXUA 4L17A 1MM6A 3W9VA 3PPPA 4K3FA 1NNKA 1N3XA 2REJA 2OCUA 4OHNA 4JSDA 3DM0A 1FCKA 1I6AA 5EHSA 1EZOA 5CBRA 4LZ8A 2DP8A 1JW1A 2XXTA 4FEDA 2AL5A 5I2NB 4U21A 1LLSA 4NF8B 4OESA 4ZECA 2F5XA 4ZEKA 2UVGA 4ZDMA 3HCQA 4F1YA 2FA7A 3S2VA 4GLIA 4JWXA 4Q8RA 3TTMA 3TZAA 2NVUB 3T96B 3E9XA 4OQOA 1QUJA 4QFLA 3U8QA 5TP9A 3VLUA 3JZJA 3TCHA 3CRBA 1B5HA 2F97A 4JXIA 4BDQA 2DE3A 5KCJA 4PP0A 3P7IA 5KDTB 2O1LA 1UTBA 1P1NA 1IXGA 3D4CA 1MPCA 1MDQA 1QULA 3TTKA 4NF5B 4IO4A 3K6XA 1URSA 3M3KA 3N26A 1VR5A 4FATA 1Y1ZA 2F7AA 1B7ZA 5AA4B 4F19A 3MJNA 3O6GA 1FTOA 2H99A 2O68A 4NTLA 1O63A 2G93A 4H8IA 3K6WA 2I6EA 1B0LA 1FTJA 1FTMA 1SDXA 3EQ1A 3R7XA 1MXZA 1MXWA 4DXUA 1IQ7A 2WKYA 4NF4B 3H6UA 5I58A 4GD5A 4OETA 3A3UA 2O1MA 1ZJLA 4FORA 5FHMA 2H25A 4I9DA 4IO6A 1JEUA 5FTHA 4EUOA 4ESWA 2XXWA 2QJEA 3HO7A 3H3GA 1B4HA 5L9MA 1NH8A 3IB0A 5AA2A 2DS9A 4RA1A 3S4UA 3H4ZA 3ODBA 3PUVE 3K1PA 1DSNA 4QFKA 1B1HA 4JB7A 4C1UA 1A8EA 1B52A 1B2HA 2Z22A 4QHQA 1FQDA 3B7DA 2XXXA 4XTCQ 4ZE9A 4JDFA 2V3QA 4ZEFA 5H8QA 4OFLA 1N0TA 1ELJA 4GFRA 2VD2A 4LQ2A 4ZS9A 3R26A 3MWBA 4BDNA 3U1OA 3SEUA 2F6PA 1P1QA 4XKRA 2NXOA 3BKIB 1EZ9A 4IO7A 3V5AA 2DYXA 1Z7NE 5DEXA 4G8HA 3TDJA 4XIGQ 4ESXA 3H7MA 4HCYA 1H43A 5H8QB 5H8NB 3C31A 4E0WA 1M5FA 4GWOA 5J1DA 3C4MA 2O7IA 1ANFA 4KHZE 5JEIA 2X26A 3V89B 4F3BA 4C0RA 1DTGA 3PUZE 3VDFA 1BLFA 2R6GE 5F7VA 3KSXA 1JW4A 1B05A 3QUFA 2YJPA 3QK6A 1OQGA 1ZKBA 5CMBA 3M8UA 2DE4A 2XXPA 4Q0CA 4YKKA 2F35A 4KYDA 3U94A 1QUKA 3IAZA 1Y1MA 4U22A 5I56A 1PBPA 2F34A 2XXIA 4PETA 2V3UA 3L6GA 1ZLQA 4AQ4A 2O84X 3MAMA 1SI0A 4LQ5A 3S9NC 2THIA 1IZ1A 4YMBA 1D4NA 2VGQA 2I0BA 5K2YA 3FATA 4LVQA 4F2OA 5CC2A 4PFUA 1H45A 3KOTA 4F1UA 1FQAA 3T9XB 5AA3A 2A5SA 5B70A 1J1NA 4POXA 3K02A 4QSEA 1LFGA 2H5YA 2OWTA 1R9QA 1XOCA 1DPEA 1MY2A 2P0SA 3FJGA 4F3SA 4F3PA 5BUUA 4NWDA 3IOVA 1QJMA 4DXBA 3OOAA 2RC8A 5A5XB 1D9YA 2UVJA 4UACA 1FQBA 1SYHA 3VVEA 5H8FA 4YB6A 3CSBA 3KEIA 3USDA 4DLDA 2XHDA 3U72A 1B46A 1T0KA 1P1UA 3H6TA 3E4RA 4RNSA 3MVZA 2QMWA 3MC2A 3HPIA 4E0XA 3EHUA 2I3WA 1B3HA 2IEEA 4AB6A 4RPOA 1US4A 1Y9UA 3SESA 1N7WA 5DVJA 2KLFA 3QXMA 1N3WA 3ILTB 2DVZA 4I62A 3QIMA 2DWJA 2XX9A 3EN3A 3OSRA 3DP6A 4YB5A 4G4PA 3OELA 3ZSFA 2ZYOA 4R6HA 4NWCA 4EXLA 2DVCA 1Y3QA 4P0GA 4YKIA 3F11A 4DXCA 3Q25A 1YAEA 3KG2A 1JQFA 3TTLA 3TFLA 4G77A 4RJZA 3A3CA 4Z7EA 1UQWA 1LAHE 3EF7A 3FIRA 1PEBA 1L5TA 1WVJA 3OEKA 1H76A 1MPBA 1TXFA 3BBRA 3HHGA 3VXBA 1DMBA 3PD9A 3MP6A 5AA1A 4NF6A 2CMOA 3B6QA 1TFAA 3LC8A 3UIFA 1D3KA 2Q9TA 5I59A 5CMKA 1VSOA 4EXKA 4ZZAA 2HAVA 3MUQA 2ZNSA 1B1XA 1AL3A 1GR2A 2IA4A 4KYEA 3I6VA 5AE4A 1A99A 2W7YA 2DXRA 2PYYA 2NUVA 4QRZA 1OVTA 1RYXA 2CZLA 2HFBA 2DQVA 4H5FA 4GXAA 1B40A 2OLBA 4TQUQ 1S9TA 4H8JA 1USYH 4ZE8A 3RLFE 2LAOA 2ZXTA 4PFWA 3IOTA 4G8MA 1PBQA 3V8XB 3I5OA 2RINA 2ZMBA 2ZYMA 1YPNA 5I84A 4F29A 2QL3A 1AH5A 3SEXA 2Y7IA 1Y4TA 2A5TA 1LFHA 4HS7A 2H98A 1IXHA 3IK6B 3ONMA 2VD3A 1M5CA 1VFEA 3SERA 3FXUA 1HSLA 3RQTA 3K1NA 1Z7ME 4Q30B 5ISUA 3OO7A 4H6DA 5KZTA 1N84A 2UYFA 3KZGA 1WDNA 3LR1A 3FXRA 2NOOA 1MG1A 2QS3A 3UGWA 2H4IA 3TELA 1BKAA 4GVOA 4FECA 2QSXA 3VE1B 1Y3PA 1GVCA 5EYFA 4ZZEA 3RNNA 3C36A 4UA8A 4IO5A 1JVYA 1MQHA 3TKDA 4MF3A 1LBBA 1FW0A 4QFNA 4FEBA 3OO8A 2X7QA 2PVUA 4TLMB 2XX8A 3N94A 3QUJA 1SI1A 1VFDA 4BDRA 1B7UA 4FIMA 1POTA 4IO2A 4QFOA 3PPQA 4JWOA 1S50A 4IGRA 1AIVA 4POWA 2QMXA 3GZGA 5HPQA 4OMBA 5TP9B 3IB2A 3UN6A 2RC9A 1B4ZA 3O9PA 3H6VA 4OWDA 1NL5A 2B65A 5KCJB 2DOJA 4ISUA 4YKJA 1MY0A 3PMXA 4U4XA 4TLLB 4WXJA 1CB6A 1UTBB 3Q26A 4C1TA 4FJPA 4OTEA 2AL4A 2RC7A 3PPRA 2OJTA 4GL8A 5CRYA 1O64A 3VV5A 2OK2A 5HBCA 4QSDA 3VLWA 1YCJA 1ZMGA 1QW0A 4XKPA 4R9FA 2RKMA 2D21A 5HM4B 5M2VA 1N7XA 4H5GA 3K4UA 4DE8A 5I2KA 3UP9A 5I58B 5ICQA 1IIWA 3MBPA 3FVKA 2HQ0A 1LAFE 1NFTA 1R1NA 3DELB 2DXYA 1II5A 4GRKA 1US5A 2REGA 4NMYA 4F31B 5DT6A 4MLVA 4U1ZA 5AA2B 1MXUA 3T9HB 4YB7A 1MQJA 3K2DA 4M1VA 3KGCA 2XXQA 3KN8A 4KPTA 2QS1A 4QSCA 3S9MC 1UTHA 3TMGA 4EQBA 2OBGA 5ELVA 4LZ5A 4R2BA 1XVYA 2UYEA 3MZ1A 3LSXA 1LBCA 5JTYA 4THIA 3EHSA 3CVGA 3EHTA 4G68A 3IO6A 5CMCA 1SD3A 1IUDA 4HTGA 2HCAA 3RPWA 2XD2A 2X7PA 4ZEBA 4YICA 4YZZA 2F36A 3C33A 3MP1A 5H8HA 2HXWA 3HHFA 4OFOA 5DEXB 3CIJA 3T9VA 3ZKKA 4U2RA 4H67A 1PB8A 4ZEDA 4RPNA 5DVFA 4PE5B 2XX7A 2I4CA 4KQPA 1TFDA 2Q88A 4DDDA 1NKXA 1I6QA 3CFZA 3WAEA 5L9SA 4U4SA 3RTFB 1EH3A 3Q28A 1QKAA 4G2ZA 3BFTA 3IB1A 3LBSA 2D5WA 3KN3A 4Z0IA 3LSWA 1B7HA 4ZEIA 1FQEA 1B5JA 3U93A 5TPAA 1JEVA 4XKNA 2BJJX 4I1DA 2PMSA 1IITA 1IXIA 3FJ7A 4RK2A 4KFQA 1H3DA 5I56B 3B6WA 4JBZA 4KCDA 3IORA 3UA8A 3JYRA 2Z23A 1F9BA 3KOSA 4X1BA 2G29A 1P1OA 4N13A 1QVSA 4RXLA 4R75A 3VXCA 4GQOA 1SQYA 3PD8A 1JVXA 2Z8DA 2R9JA 1PC3A 5CBSA 2Q2CA 4O3AA 1XHYA 4YU0A 3TQLA 5L9OA 5K2XA 1A55A 1Q35A 4KD5A 4PFYA 4GF8A 4QFPA 1DOTA 2ONSA 4N6PA 3DLNA 4ELPA 1QUIA 2UVIA 2XD3A 4DCYA 2Z8FA 5H8FB 4ECFA 1FTKA 1SBPA 4F3GA 1QKBA 4IGTA 1EU8A 4MFIA 3DP8A 3GXAA 3MPLA 4DZ1A 1POY1 1LCTA 1S7YA 2E0SA 3W9WA 3H06B 1ZU0A 3MVWA 4MBPA 3PMVA 2Y7RA 4DCXA 2HEUA 3S9EA 2DE2A 3CG3A 1MPDA 2I49A 3CSGA 3K00A 2GHAA 3JV9A 1OIBA 4BDOA 3MW0A 1MS7A 3BFUA 4AB5A 4R73A 4NEDA 4OYVA 2Q2AA 1WODA 1FQFA 1SYIA 3C35A 1NMUA 1MXXA 2ANJA 1A8FA 3MZ9A 2PBWA 2XXYA 1LB9A 1Y4CA 3HSTA 4OEVA 3N6TA 4WKMA 4HCWA 4XKQA 1EZPA 2VOZA 2PX1A 2PT1A 1PB9A 1MY4A 1M5DA 3RGYA 4H0WA 3UK4A 3U92A 4NF6B 3TODA 2V25A 5IAIA 1XVXA 5I59B 3VVFA 4KI0E 2RCAA 3C9HA 4GL0A 5I2NA 4EQ9A 3IO4A 4NF8A 4IO3A 3DP4A 1OVBA 2XXVA 2I3VA 5FHOA 3GBBA 1KWHA 2ESNA 3KJ7A 2OWSA 3PUWE 1PB7A 1BTJA 4PQJA 3T66A 4IY6A 5I57A 1H44A 2B3FA 3ECRA 4LZ7A 5BWJA 4NE4A 1GV8A 3G3HA 2ZYNA 3L6HA 1TT1A 4JSOA 3MPKA 1GTKA 3I3VA 3FUZA 5TU0A 2Y7PA 4YAHX 3K1MA 3M3LA 1SW4A 3K0VA 1URGA 4F22A 5KDTA 3OENA 4H1XA 2A5TB 2PT2A 2ZNTA 1URDA 3C32A 4KYSA 3LSFB 5I57B 2ONRA 3T22A 2UVHA 4NF5A 2QPQA 5FHNA 2VHAA 2NWJA 3G3FA 1LGBC 4MH5A 2F7BA 2ALUA 4F1VA 3UORA 3QYTA 3KFMA 1B3LA 5CMMA 5AA4A 2O51A 1LSTA 4I8CA 1LCFA 2UXAA 1USYE 2QRYA 4O3CA 2QS4A 1AMFA 1B3EA 3PU5A 4Q5TA 4WEDA 3FV2A 3ZKLA 3FJMA 1B5IA 3IL1B 2VP1A 2FNCA 3VFJA 1NNFA 4NF4A 2GFEA 1B58A 2M8CA 3FXQA 2Y84A 2I4BA 5DYHA 3FGSA 1SVXB 1PDAA 1RKMA 4RK9A 1ZIUA 3VVDA 3SEYA 4OXVA 4LUBA 3OSQA 3FASA 5IKBA 1N04A 2V84A 3OO9A 3HN0A 4GIZA 4OVJA 3PGFA 4OZ9A 1B3GA 3GBAA 5EHMA 3LSLA 3SEVA 1ZTYA 3H03A 3OMBA 1GGGA 4IY5A 5H8SA 3GLBA 4EDPA 2E1SA 2V3TA 1Y20A 3O2AA 1MQIA 4ELQA 1B9JA 1JW5A 3SETA 3KJTA 3KBRA 2HZLA 5L8DA 2Z8EA 3PMWA 1B6HA 3W15C 2P1SA 4JWYA 4OENA 3PPOA 3CR9A 5ITOA 3N5LA 2DWAA 2F8DA 2P2AA 4GOTA 1MQDA 4BDMA 3QSLA 5DVIA 3RY3A 4BLAA 2GRVA 4M4GA 5H8NA 3OD7A 5I2KB 1OLCA 4HW8A 2GH9A 2F78A 4FAJA 1B32A 2YPNA 3RT8A 1NH7A 1MDP1 3K01A 1NNTA 3O97A 3K6UA 3QAXA 3O6IA 4BDLA 4KR5A 3TTNA 4N07A 4LATA 4O3BA 3H6WA 3RUMA 4MLQA 3FD3A 4F2QA 4X9TA 2RCBA 5B7DA 1UTHB 4OFJA 2Y7WA 5DTBA 2YLNA 1N76A 3TCFA 2Y7KA 1ATGA 1R9LA 1Y3NA 4U1OA 5JTYB 1MH3A 1BP5A 2H9BA 1FTLA 4G68B 1A40A 3PUXE 4EF1A 3ILUB 4G8NA 2ZNUA 3TUSA 2HAUA 2D3IA 1JETA 3MQ9A 4PFTA 4KCCA 3TAJA 3RTWB 3SDFA 5H8HB 4X48A 4OERA 1YTVA 3MVXA 1MQGA 3KSJA 3PPNA 2HZKA 2ONKE 1OLAA 3N6UA 2V93A 3MP8A 3PV0E 1SW2A 3ZS6A 1O7TA 3O29A 1MXYA 4ND9A 1SW1A 5CI5A 2AYSA 3G7WA 1R6ZA 2QS2A 3Q29A 1A54A 4LA9A 2ZYKA 2I0CA 3RT6B 2GHBA 4QF9A 2Q8JA 1CE2A 4GXSB 4F39A 5A5XA 5TPAB 1HSEA 3G3IA 3S9LC 4RYAA 2AIXA 3THIA 2ABHA 3VLVA 3RN8A 2O7UA 3IOWA 1M5EA 3G3JA 4DIGA 4R2FA 2O6AA 2F7CA 4RY1A 1DTZA 1M5BA 3O6HA 2DWIA 1ZBMA 2O69A 4ELRA 4R6YA 4H65A 2B3BA 3IX1A 4YMAA 4EQ7A 5LOMA 3SEWA 1A7LA 3E3KA 4OEUA 2XXRA 4TOZA 3G3GA 3IJXB 3OO6A 3D4GA 3T9UA 2XXHA 4ONYA 1RYOA 1LB8A 3T93B 4P0IA 3M3FA 1MY1A 1IXCA 3MVYA 3V83A 1XC1A 2I48A 3Q27A 3FV1A 3EPEA 3FVNA 3MZBA 1BIYA 4R72A 1I6BA 3OXNA 3IJOB 5AA2D 3WAFA 1B0HA 4R6KA 1AOVA 1MY3A 1I69A 2DWHA 1D9VA 3A09A 3O28A 3CG1A 3R6UA 1LAXA 1SW5A 3G3KA 3E13X 1FQCA 1B51A 1TWYA 3LUYA 5FTIA 1LAGE 2XXUA 3TQWA 1P99A 3TEPA 1VE4A 3HV1A 4G68C 1MH4A 3FVGA 1MRPA 4LP2B 2Q89A 4R9GA 1OQHA 3B6TA 3FVOA 4U23A 3K6VA 1MM7A 3CFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EF2 A;  3FZV A;  3TYH A;  2RF1 A;  1UIV A;  2F6G A;  1OMP A;  5JK4 A;  4ELO A;  3KN7 A;  3CFL A;  5ICT A;  1JNF A;  2OZZ A;  1DPP A;  4P11 A;  3TPA A;  1LFI A;  1UIU A;  3C34 A;  1XS5 A;  1HSJ A;  4YKP A;  3TCG A;  5CM6 A;  4R74 A;  3SKP A;  3TTR A;  2DSF A;  3IOU A;  4FE8 A;  1B3F A;  1MXV A;  1XT8 A;  2I58 A;  5F1Q A;  1IEJ A;  3O66 A;  4X1D A;  1Q1K A;  2R71 A;  4F18 A;  3PUY E;  2FYI A;  3CI8 A;  4LON B;  1NNP A;  4WEP A;  3IR1 A;  3AXF A;  1P1W A;  5ITP A;  3OEM A;  4IB2 A;  4XXU A;  4L17 A;  1MM6 A;  3W9V A;  3PPP A;  4K3F A;  1NNK A;  1N3X A;  2REJ A;  2OCU A;  4OHN A;  4JSD A;  3DM0 A;  1FCK A;  1I6A A;  5EHS A;  1EZO A;  5CBR A;  4LZ8 A;  2DP8 A;  1JW1 A;  2XXT A;  4FED A;  2AL5 A;  5I2N B;  4U21 A;  1LLS A;  4NF8 B;  4OES A;  4ZEC A;  2F5X A;  4ZEK A;  2UVG A;  4ZDM A;  3HCQ A;  4F1Y A;  2FA7 A;  3S2V A;  4GLI A;  4JWX A;  4Q8R A;  3TTM A;  3TZA A;  2NVU B;  3T96 B;  3E9X A;  4OQO A;  1QUJ A;  4QFL A;  3U8Q A;  5TP9 A;  3VLU A;  3JZJ A;  3TCH A;  3CRB A;  1B5H A;  2F97 A;  4JXI A;  4BDQ A;  2DE3 A;  5KCJ A;  4PP0 A;  3P7I A;  5KDT B;  2O1L A;  1UTB A;  1P1N A;  1IXG A;  3D4C A;  1MPC A;  1MDQ A;  1QUL A;  3TTK A;  4NF5 B;  4IO4 A;  3K6X A;  1URS A;  3M3K A;  3N26 A;  1VR5 A;  4FAT A;  1Y1Z A;  2F7A A;  1B7Z A;  5AA4 B;  4F19 A;  3MJN A;  3O6G A;  1FTO A;  2H99 A;  2O68 A;  4NTL A;  1O63 A;  2G93 A;  4H8I A;  3K6W A;  2I6E A;  1B0L A;  1FTJ A;  1FTM A;  1SDX A;  3EQ1 A;  3R7X A;  1MXZ A;  1MXW A;  4DXU A;  1IQ7 A;  2WKY A;  4NF4 B;  3H6U A;  5I58 A;  4GD5 A;  4OET A;  3A3U A;  2O1M A;  1ZJL A;  4FOR A;  5FHM A;  2H25 A;  4I9D A;  4IO6 A;  1JEU A;  5FTH A;  4EUO A;  4ESW A;  2XXW A;  2QJE A;  3HO7 A;  3H3G A;  1B4H A;  5L9M A;  1NH8 A;  3IB0 A;  5AA2 A;  2DS9 A;  4RA1 A;  3S4U A;  3H4Z A;  3ODB A;  3PUV E;  3K1P A;  1DSN A;  4QFK A;  1B1H A;  4JB7 A;  4C1U A;  1A8E A;  1B52 A;  1B2H A;  2Z22 A;  4QHQ A;  1FQD A;  3B7D A;  2XXX A;  4XTC Q;  4ZE9 A;  4JDF A;  2V3Q A;  4ZEF A;  5H8Q A;  4OFL A;  1N0T A;  1ELJ A;  4GFR A;  2VD2 A;  4LQ2 A;  4ZS9 A;  3R26 A;  3MWB A;  4BDN A;  3U1O A;  3SEU A;  2F6P A;  1P1Q A;  4XKR A;  2NXO A;  3BKI B;  1EZ9 A;  4IO7 A;  3V5A A;  2DYX A;  1Z7N E;  5DEX A;  4G8H A;  3TDJ A;  4XIG Q;  4ESX A;  3H7M A;  4HCY A;  1H43 A;  5H8Q B;  5H8N B;  3C31 A;  4E0W A;  1M5F A;  4GWO A;  5J1D A;  3C4M A;  2O7I A;  1ANF A;  4KHZ E;  5JEI A;  2X26 A;  3V89 B;  4F3B A;  4C0R A;  1DTG A;  3PUZ E;  3VDF A;  1BLF A;  2R6G E;  5F7V A;  3KSX A;  1JW4 A;  1B05 A;  3QUF A;  2YJP A;  3QK6 A;  1OQG A;  1ZKB A;  5CMB A;  3M8U A;  2DE4 A;  2XXP A;  4Q0C A;  4YKK A;  2F35 A;  4KYD A;  3U94 A;  1QUK A;  3IAZ A;  1Y1M A;  4U22 A;  5I56 A;  1PBP A;  2F34 A;  2XXI A;  4PET A;  2V3U A;  3L6G A;  1ZLQ A;  4AQ4 A;  2O84 X;  3MAM A;  1SI0 A;  4LQ5 A;  3S9N C;  2THI A;  1IZ1 A;  4YMB A;  1D4N A;  2VGQ A;  2I0B A;  5K2Y A;  3FAT A;  4LVQ A;  4F2O A;  5CC2 A;  4PFU A;  1H45 A;  3KOT A;  4F1U A;  1FQA A;  3T9X B;  5AA3 A;  2A5S A;  5B70 A;  1J1N A;  4POX A;  3K02 A;  4QSE A;  1LFG A;  2H5Y A;  2OWT A;  1R9Q A;  1XOC A;  1DPE A;  1MY2 A;  2P0S A;  3FJG A;  4F3S A;  4F3P A;  5BUU A;  4NWD A;  3IOV A;  1QJM A;  4DXB A;  3OOA A;  2RC8 A;  5A5X B;  1D9Y A;  2UVJ A;  4UAC A;  1FQB A;  1SYH A;  3VVE A;  5H8F A;  4YB6 A;  3CSB A;  3KEI A;  3USD A;  4DLD A;  2XHD A;  3U72 A;  1B46 A;  1T0K A;  1P1U A;  3H6T A;  3E4R A;  4RNS A;  3MVZ A;  2QMW A;  3MC2 A;  3HPI A;  4E0X A;  3EHU A;  2I3W A;  1B3H A;  2IEE A;  4AB6 A;  4RPO A;  1US4 A;  1Y9U A;  3SES A;  1N7W A;  5DVJ A;  2KLF A;  3QXM A;  1N3W A;  3ILT B;  2DVZ A;  4I62 A;  3QIM A;  2DWJ A;  2XX9 A;  3EN3 A;  3OSR A;  3DP6 A;  4YB5 A;  4G4P A;  3OEL A;  3ZSF A;  2ZYO A;  4R6H A;  4NWC A;  4EXL A;  2DVC A;  1Y3Q A;  4P0G A;  4YKI A;  3F11 A;  4DXC A;  3Q25 A;  1YAE A;  3KG2 A;  1JQF A;  3TTL A;  3TFL A;  4G77 A;  4RJZ A;  3A3C A;  4Z7E A;  1UQW A;  1LAH E;  3EF7 A;  3FIR A;  1PEB A;  1L5T A;  1WVJ A;  3OEK A;  1H76 A;  1MPB A;  1TXF A;  3BBR A;  3HHG A;  3VXB A;  1DMB A;  3PD9 A;  3MP6 A;  5AA1 A;  4NF6 A;  2CMO A;  3B6Q A;  1TFA A;  3LC8 A;  3UIF A;  1D3K A;  2Q9T A;  5I59 A;  5CMK A;  1VSO A;  4EXK A;  4ZZA A;  2HAV A;  3MUQ A;  2ZNS A;  1B1X A;  1AL3 A;  1GR2 A;  2IA4 A;  4KYE A;  3I6V A;  5AE4 A;  1A99 A;  2W7Y A;  2DXR A;  2PYY A;  2NUV A;  4QRZ A;  1OVT A;  1RYX A;  2CZL A;  2HFB A;  2DQV A;  4H5F A;  4GXA A;  1B40 A;  2OLB A;  4TQU Q;  1S9T A;  4H8J A;  1USY H;  4ZE8 A;  3RLF E;  2LAO A;  2ZXT A;  4PFW A;  3IOT A;  4G8M A;  1PBQ A;  3V8X B;  3I5O A;  2RIN A;  2ZMB A;  2ZYM A;  1YPN A;  5I84 A;  4F29 A;  2QL3 A;  1AH5 A;  3SEX A;  2Y7I A;  1Y4T A;  2A5T A;  1LFH A;  4HS7 A;  2H98 A;  1IXH A;  3IK6 B;  3ONM A;  2VD3 A;  1M5C A;  1VFE A;  3SER A;  3FXU A;  1HSL A;  3RQT A;  3K1N A;  1Z7M E;  4Q30 B;  5ISU A;  3OO7 A;  4H6D A;  5KZT A;  1N84 A;  2UYF A;  3KZG A;  1WDN A;  3LR1 A;  3FXR A;  2NOO A;  1MG1 A;  2QS3 A;  3UGW A;  2H4I A;  3TEL A;  1BKA A;  4GVO A;  4FEC A;  2QSX A;  3VE1 B;  1Y3P A;  1GVC A;  5EYF A;  4ZZE A;  3RNN A;  3C36 A;  4UA8 A;  4IO5 A;  1JVY A;  1MQH A;  3TKD A;  4MF3 A;  1LBB A;  1FW0 A;  4QFN A;  4FEB A;  3OO8 A;  2X7Q A;  2PVU A;  4TLM B;  2XX8 A;  3N94 A;  3QUJ A;  1SI1 A;  1VFD A;  4BDR A;  1B7U A;  4FIM A;  1POT A;  4IO2 A;  4QFO A;  3PPQ A;  4JWO A;  1S50 A;  4IGR A;  1AIV A;  4POW A;  2QMX A;  3GZG A;  5HPQ A;  4OMB A;  5TP9 B;  3IB2 A;  3UN6 A;  2RC9 A;  1B4Z A;  3O9P A;  3H6V A;  4OWD A;  1NL5 A;  2B65 A;  5KCJ B;  2DOJ A;  4ISU A;  4YKJ A;  1MY0 A;  3PMX A;  4U4X A;  4TLL B;  4WXJ A;  1CB6 A;  1UTB B;  3Q26 A;  4C1T A;  4FJP A;  4OTE A;  2AL4 A;  2RC7 A;  3PPR A;  2OJT A;  4GL8 A;  5CRY A;  1O64 A;  3VV5 A;  2OK2 A;  5HBC A;  4QSD A;  3VLW A;  1YCJ A;  1ZMG A;  1QW0 A;  4XKP A;  4R9F A;  2RKM A;  2D21 A;  5HM4 B;  5M2V A;  1N7X A;  4H5G A;  3K4U A;  4DE8 A;  5I2K A;  3UP9 A;  5I58 B;  5ICQ A;  1IIW A;  3MBP A;  3FVK A;  2HQ0 A;  1LAF E;  1NFT A;  1R1N A;  3DEL B;  2DXY A;  1II5 A;  4GRK A;  1US5 A;  2REG A;  4NMY A;  4F31 B;  5DT6 A;  4MLV A;  4U1Z A;  5AA2 B;  1MXU A;  3T9H B;  4YB7 A;  1MQJ A;  3K2D A;  4M1V A;  3KGC A;  2XXQ A;  3KN8 A;  4KPT A;  2QS1 A;  4QSC A;  3S9M C;  1UTH A;  3TMG A;  4EQB A;  2OBG A;  5ELV A;  4LZ5 A;  4R2B A;  1XVY A;  2UYE A;  3MZ1 A;  3LSX A;  1LBC A;  5JTY A;  4THI A;  3EHS A;  3CVG A;  3EHT A;  4G68 A;  3IO6 A;  5CMC A;  1SD3 A;  1IUD A;  4HTG A;  2HCA A;  3RPW A;  2XD2 A;  2X7P A;  4ZEB A;  4YIC A;  4YZZ A;  2F36 A;  3C33 A;  3MP1 A;  5H8H A;  2HXW A;  3HHF A;  4OFO A;  5DEX B;  3CIJ A;  3T9V A;  3ZKK A;  4U2R A;  4H67 A;  1PB8 A;  4ZED A;  4RPN A;  5DVF A;  4PE5 B;  2XX7 A;  2I4C A;  4KQP A;  1TFD A;  2Q88 A;  4DDD A;  1NKX A;  1I6Q A;  3CFZ A;  3WAE A;  5L9S A;  4U4S A;  3RTF B;  1EH3 A;  3Q28 A;  1QKA A;  4G2Z A;  3BFT A;  3IB1 A;  3LBS A;  2D5W A;  3KN3 A;  4Z0I A;  3LSW A;  1B7H A;  4ZEI A;  1FQE A;  1B5J A;  3U93 A;  5TPA A;  1JEV A;  4XKN A;  2BJJ X;  4I1D A;  2PMS A;  1IIT A;  1IXI A;  3FJ7 A;  4RK2 A;  4KFQ A;  1H3D A;  5I56 B;  3B6W A;  4JBZ A;  4KCD A;  3IOR A;  3UA8 A;  3JYR A;  2Z23 A;  1F9B A;  3KOS A;  4X1B A;  2G29 A;  1P1O A;  4N13 A;  1QVS A;  4RXL A;  4R75 A;  3VXC A;  4GQO A;  1SQY A;  3PD8 A;  1JVX A;  2Z8D A;  2R9J A;  1PC3 A;  5CBS A;  2Q2C A;  4O3A A;  1XHY A;  4YU0 A;  3TQL A;  5L9O A;  5K2X A;  1A55 A;  1Q35 A;  4KD5 A;  4PFY A;  4GF8 A;  4QFP A;  1DOT A;  2ONS A;  4N6P A;  3DLN A;  4ELP A;  1QUI A;  2UVI A;  2XD3 A;  4DCY A;  2Z8F A;  5H8F B;  4ECF A;  1FTK A;  1SBP A;  4F3G A;  1QKB A;  4IGT A;  1EU8 A;  4MFI A;  3DP8 A;  3GXA A;  3MPL A;  4DZ1 A;  1POY 1;  1LCT A;  1S7Y A;  2E0S A;  3W9W A;  3H06 B;  1ZU0 A;  3MVW A;  4MBP A;  3PMV A;  2Y7R A;  4DCX A;  2HEU A;  3S9E A;  2DE2 A;  3CG3 A;  1MPD A;  2I49 A;  3CSG A;  3K00 A;  2GHA A;  3JV9 A;  1OIB A;  4BDO A;  3MW0 A;  1MS7 A;  3BFU A;  4AB5 A;  4R73 A;  4NED A;  4OYV A;  2Q2A A;  1WOD A;  1FQF A;  1SYI A;  3C35 A;  1NMU A;  1MXX A;  2ANJ A;  1A8F A;  3MZ9 A;  2PBW A;  2XXY A;  1LB9 A;  1Y4C A;  3HST A;  4OEV A;  3N6T A;  4WKM A;  4HCW A;  4XKQ A;  1EZP A;  2VOZ A;  2PX1 A;  2PT1 A;  1PB9 A;  1MY4 A;  1M5D A;  3RGY A;  4H0W A;  3UK4 A;  3U92 A;  4NF6 B;  3TOD A;  2V25 A;  5IAI A;  1XVX A;  5I59 B;  3VVF A;  4KI0 E;  2RCA A;  3C9H A;  4GL0 A;  5I2N A;  4EQ9 A;  3IO4 A;  4NF8 A;  4IO3 A;  3DP4 A;  1OVB A;  2XXV A;  2I3V A;  5FHO A;  3GBB A;  1KWH A;  2ESN A;  3KJ7 A;  2OWS A;  3PUW E;  1PB7 A;  1BTJ A;  4PQJ A;  3T66 A;  4IY6 A;  5I57 A;  1H44 A;  2B3F A;  3ECR A;  4LZ7 A;  5BWJ A;  4NE4 A;  1GV8 A;  3G3H A;  2ZYN A;  3L6H A;  1TT1 A;  4JSO A;  3MPK A;  1GTK A;  3I3V A;  3FUZ A;  5TU0 A;  2Y7P A;  4YAH X;  3K1M A;  3M3L A;  1SW4 A;  3K0V A;  1URG A;  4F22 A;  5KDT A;  3OEN A;  4H1X A;  2A5T B;  2PT2 A;  2ZNT A;  1URD A;  3C32 A;  4KYS A;  3LSF B;  5I57 B;  2ONR A;  3T22 A;  2UVH A;  4NF5 A;  2QPQ A;  5FHN A;  2VHA A;  2NWJ A;  3G3F A;  1LGB C;  4MH5 A;  2F7B A;  2ALU A;  4F1V A;  3UOR A;  3QYT A;  3KFM A;  1B3L A;  5CMM A;  5AA4 A;  2O51 A;  1LST A;  4I8C A;  1LCF A;  2UXA A;  1USY E;  2QRY A;  4O3C A;  2QS4 A;  1AMF A;  1B3E A;  3PU5 A;  4Q5T A;  4WED A;  3FV2 A;  3ZKL A;  3FJM A;  1B5I A;  3IL1 B;  2VP1 A;  2FNC A;  3VFJ A;  1NNF A;  4NF4 A;  2GFE A;  1B58 A;  2M8C A;  3FXQ A;  2Y84 A;  2I4B A;  5DYH A;  3FGS A;  1SVX B;  1PDA A;  1RKM A;  4RK9 A;  1ZIU A;  3VVD A;  3SEY A;  4OXV A;  4LUB A;  3OSQ A;  3FAS A;  5IKB A;  1N04 A;  2V84 A;  3OO9 A;  3HN0 A;  4GIZ A;  4OVJ A;  3PGF A;  4OZ9 A;  1B3G A;  3GBA A;  5EHM A;  3LSL A;  3SEV A;  1ZTY A;  3H03 A;  3OMB A;  1GGG A;  4IY5 A;  5H8S A;  3GLB A;  4EDP A;  2E1S A;  2V3T A;  1Y20 A;  3O2A A;  1MQI A;  4ELQ A;  1B9J A;  1JW5 A;  3SET A;  3KJT A;  3KBR A;  2HZL A;  5L8D A;  2Z8E A;  3PMW A;  1B6H A;  3W15 C;  2P1S A;  4JWY A;  4OEN A;  3PPO A;  3CR9 A;  5ITO A;  3N5L A;  2DWA A;  2F8D A;  2P2A A;  4GOT A;  1MQD A;  4BDM A;  3QSL A;  5DVI A;  3RY3 A;  4BLA A;  2GRV A;  4M4G A;  5H8N A;  3OD7 A;  5I2K B;  1OLC A;  4HW8 A;  2GH9 A;  2F78 A;  4FAJ A;  1B32 A;  2YPN A;  3RT8 A;  1NH7 A;  1MDP 1;  3K01 A;  1NNT A;  3O97 A;  3K6U A;  3QAX A;  3O6I A;  4BDL A;  4KR5 A;  3TTN A;  4N07 A;  4LAT A;  4O3B A;  3H6W A;  3RUM A;  4MLQ A;  3FD3 A;  4F2Q A;  4X9T A;  2RCB A;  5B7D A;  1UTH B;  4OFJ A;  2Y7W A;  5DTB A;  2YLN A;  1N76 A;  3TCF A;  2Y7K A;  1ATG A;  1R9L A;  1Y3N A;  4U1O A;  5JTY B;  1MH3 A;  1BP5 A;  2H9B A;  1FTL A;  4G68 B;  1A40 A;  3PUX E;  4EF1 A;  3ILU B;  4G8N A;  2ZNU A;  3TUS A;  2HAU A;  2D3I A;  1JET A;  3MQ9 A;  4PFT A;  4KCC A;  3TAJ A;  3RTW B;  3SDF A;  5H8H B;  4X48 A;  4OER A;  1YTV A;  3MVX A;  1MQG A;  3KSJ A;  3PPN A;  2HZK A;  2ONK E;  1OLA A;  3N6U A;  2V93 A;  3MP8 A;  3PV0 E;  1SW2 A;  3ZS6 A;  1O7T A;  3O29 A;  1MXY A;  4ND9 A;  1SW1 A;  5CI5 A;  2AYS A;  3G7W A;  1R6Z A;  2QS2 A;  3Q29 A;  1A54 A;  4LA9 A;  2ZYK A;  2I0C A;  3RT6 B;  2GHB A;  4QF9 A;  2Q8J A;  1CE2 A;  4GXS B;  4F39 A;  5A5X A;  5TPA B;  1HSE A;  3G3I A;  3S9L C;  4RYA A;  2AIX A;  3THI A;  2ABH A;  3VLV A;  3RN8 A;  2O7U A;  3IOW A;  1M5E A;  3G3J A;  4DIG A;  4R2F A;  2O6A A;  2F7C A;  4RY1 A;  1DTZ A;  1M5B A;  3O6H A;  2DWI A;  1ZBM A;  2O69 A;  4ELR A;  4R6Y A;  4H65 A;  2B3B A;  3IX1 A;  4YMA A;  4EQ7 A;  5LOM A;  3SEW A;  1A7L A;  3E3K A;  4OEU A;  2XXR A;  4TOZ A;  3G3G A;  3IJX B;  3OO6 A;  3D4G A;  3T9U A;  2XXH A;  4ONY A;  1RYO A;  1LB8 A;  3T93 B;  4P0I A;  3M3F A;  1MY1 A;  1IXC A;  3MVY A;  3V83 A;  1XC1 A;  2I48 A;  3Q27 A;  3FV1 A;  3EPE A;  3FVN A;  3MZB A;  1BIY A;  4R72 A;  1I6B A;  3OXN A;  3IJO B;  5AA2 D;  3WAF A;  1B0H A;  4R6K A;  1AOV A;  1MY3 A;  1I69 A;  2DWH A;  1D9V A;  3A09 A;  3O28 A;  3CG1 A;  3R6U A;  1LAX A;  1SW5 A;  3G3K A;  3E13 X;  1FQC A;  1B51 A;  1TWY A;  3LUY A;  5FTI A;  1LAG E;  2XXU A;  3TQW A;  1P99 A;  3TEP A;  1VE4 A;  3HV1 A;  4G68 C;  1MH4 A;  3FVG A;  1MRP A;  4LP2 B;  2Q89 A;  4R9G A;  1OQH A;  3B6T A;  3FVO A;  4U23 A;  3K6V A;  1MM7 A;  3CFX A; 
#chains in the Genus database with same CATH topology
 1IME A;  4EF2 A;  3FZV A;  3TYH A;  2RF1 A;  1UIV A;  2F6G A;  1OMP A;  5JK4 A;  4NF0 A;  4ELO A;  3KN7 A;  1NUX A;  3CFL A;  5ICT A;  1JNF A;  2OZZ A;  1DPP A;  4P11 A;  3TPA A;  1LFI A;  1BK4 A;  1UIU A;  3C34 A;  2Q8M A;  1XS5 A;  1HSJ A;  4YKP A;  3KC0 A;  3TCG A;  2WBD A;  5CM6 A;  4R74 A;  3SKP A;  3TTR A;  2DSF A;  3IOU A;  4FE8 A;  2XXK A;  1B3F A;  1MXV A;  1XT8 A;  5IZ1 A;  2I58 A;  2KR0 A;  2L5V A;  5F1Q A;  1IEJ A;  3O66 A;  4X1D A;  1Q1K A;  2R71 A;  4F18 A;  3PUY E;  2FYI A;  3CI8 A;  3MYU A;  4LON B;  1NNP A;  4WEP A;  3IR1 A;  3AXF A;  1P1W A;  4I40 A;  5ITP A;  3OEM A;  4IB2 A;  4XXU A;  4L17 A;  1MM6 A;  3W9V A;  3PPP A;  4K3F A;  1NNK A;  1N3X A;  2REJ A;  2OCU A;  4NX1 A;  4OHN A;  4MCO A;  4JSD A;  4GWY A;  1RDX A;  2Q74 A;  4QBA A;  3DM0 A;  1FCK A;  1I6A A;  5EHS A;  5FBP A;  5CBR A;  4LZ8 A;  2DP8 A;  1JW1 A;  5I5P A;  1EZO A;  2XXT A;  4FED A;  2AL5 A;  5I2N B;  5IZ3 A;  4U21 A;  3A29 A;  1LLS A;  4NF8 B;  4OES A;  4ZEC A;  2F5X A;  4ZEK A;  2UVG A;  4ZDM A;  3HCQ A;  4F1Y A;  5ET5 A;  2FA7 A;  4MAG A;  3S2V A;  4GLI A;  4JWX A;  4Q8R A;  3TTM A;  1AWB A;  3MST A;  3TZA A;  2NVU B;  3T96 B;  3E9X A;  4OQO A;  1QUJ A;  4QFL A;  3U8Q A;  5TP9 A;  3VLU A;  3JZJ A;  3TCH A;  3CRB A;  1B5H A;  2F97 A;  4JXI A;  4BDQ A;  2DE3 A;  5KCJ A;  4PP0 A;  3P7I A;  5KDT B;  2O1L A;  1UTB A;  1FPJ A;  4PFB A;  1P1N A;  1IXG A;  3D4C A;  1MPC A;  1MDQ A;  1QUL A;  3TTK A;  4NF5 B;  4IO4 A;  3K6X A;  1URS A;  5IZZ A;  3M3K A;  3N26 A;  1VR5 A;  4FAT A;  1Y1Z A;  2F7A A;  1B7Z A;  5AA4 B;  1FPI A;  2FHY A;  4F19 A;  3MJN A;  1EYK A;  3O6G A;  1FTO A;  2H99 A;  2O68 A;  4NTL A;  1O63 A;  2G93 A;  4H8I A;  3K6W A;  2I6E A;  1B0L A;  1FTJ A;  1FTM A;  1SDX A;  3EQ1 A;  3R7X A;  1MXZ A;  1MXW A;  4DXU A;  1IQ7 A;  2WKY A;  4NF4 B;  3H6U A;  5I58 A;  4GD5 A;  3FXB A;  4OET A;  3A3U A;  5EQA A;  4PTK A;  2O1M A;  1ZJL A;  4FOR A;  5FHM A;  2H25 A;  4I9D A;  4IO6 A;  2ZZX A;  1JEU A;  5FTH A;  4EUO A;  4ESW A;  2XXW A;  2QJE A;  3HO7 A;  3H3G A;  1B4H A;  5L9M A;  1NH8 A;  4G61 A;  3IB0 A;  3LUZ A;  2DS9 A;  5AA2 A;  4RA1 A;  3S4U A;  3H4Z A;  3ODB A;  3PUV E;  3K1P A;  1DSN A;  4QFK A;  1B1H A;  4JB7 A;  4C1U A;  1A8E A;  1Q9D A;  4N8Y A;  1B52 A;  1B2H A;  3KBZ A;  2Z22 A;  4QHQ A;  1FQD A;  3B7D A;  2XXX A;  4XTC Q;  4ZE9 A;  3IFA A;  4JDF A;  2V3Q A;  4ZEF A;  5H8Q A;  4OFL A;  1N0T A;  5EYH A;  1ELJ A;  4GFR A;  3B50 A;  2VD2 A;  4LQ2 A;  4ZS9 A;  3R26 A;  3MWB A;  4BDN A;  3U1O A;  3SEU A;  2F6P A;  1P1Q A;  4XKR A;  2NXO A;  5IM2 A;  4X8R A;  3BKI B;  1EZ9 A;  4IO7 A;  3V5A A;  2DYX A;  1Z7N E;  2WBB A;  5DEX A;  4G8H A;  3TDJ A;  4XIG Q;  3BIH A;  4ESX A;  4NHB A;  3H7M A;  4HCY A;  4MEV A;  1H43 A;  1G0H A;  5H8Q B;  5H8N B;  3C31 A;  5LDZ A;  4E0W A;  1M5F A;  4GWO A;  5J1D A;  3C4M A;  1DCU A;  2O7I A;  1ANF A;  4KHZ E;  5JEI A;  4PAF A;  2X26 A;  3V89 B;  4F3B A;  4C0R A;  1DTG A;  3PUZ E;  3VDF A;  1BLF A;  2R6G E;  5F7V A;  3KSX A;  1JW4 A;  1B05 A;  3QUF A;  2YJP A;  3QK6 A;  1OQG A;  1ZKB A;  5CMB A;  3M8U A;  2DE4 A;  2XXP A;  4Q0C A;  4YKK A;  2F35 A;  4KYD A;  3U94 A;  1QUK A;  3IAZ A;  5ESY A;  2JJK A;  4U22 A;  1Y1M A;  5EQ7 A;  1PBP A;  2F34 A;  2XXI A;  5I56 A;  4HE0 A;  4PET A;  2V3U A;  3L6G A;  1ZLQ A;  4AQ4 A;  2O84 X;  3MAM A;  1SI0 A;  1EYI A;  4GX4 A;  4LQ5 A;  4GBW A;  3S9N C;  2THI A;  1IZ1 A;  4YMB A;  1D4N A;  4GWZ A;  2VGQ A;  2I0B A;  5K2Y A;  3FAT A;  4PBH A;  4LVQ A;  4F2O A;  5CC2 A;  4PFU A;  3CHG A;  1NI9 A;  2XA5 A;  1H45 A;  2V4C A;  1VDW A;  3KOT A;  4F1U A;  1FQA A;  3T9X B;  5AA3 A;  2A5S A;  5B70 A;  1J1N A;  4MNC A;  4POX A;  3K02 A;  4QSE A;  1LFG A;  2H5Y A;  2OWT A;  1R9Q A;  1DK4 A;  1XOC A;  1DPE A;  1MY2 A;  2P0S A;  4MNI A;  3FJG A;  4PGN A;  5ET7 A;  4F3S A;  1CNQ A;  4F3P A;  1IMD A;  5BUU A;  4NWD A;  3IOV A;  1QJM A;  4DXB A;  3OOA A;  2RC8 A;  5A5X B;  1D9Y A;  2UVJ A;  4UAC A;  1FQB A;  1SYH A;  3VVE A;  2CEX A;  5H8F A;  4YB6 A;  3CSB A;  3KEI A;  3USD A;  4DLD A;  2XHD A;  3U72 A;  4GBV A;  1B46 A;  4PF8 A;  2QFL A;  1T0K A;  1P1U A;  3H6T A;  3E4R A;  4RNS A;  3MVZ A;  2QMW A;  3MC2 A;  3HPI A;  4E0X A;  3EHU A;  2I3W A;  1B3H A;  2IEE A;  4AB6 A;  4RPO A;  1US4 A;  1Y9U A;  3SES A;  1N7W A;  5DVJ A;  2KLF A;  3QXM A;  1FBE A;  1N3W A;  3ILT B;  2DVZ A;  4I62 A;  4HE1 A;  3QIM A;  2DWJ A;  5ET8 A;  2XX9 A;  3EN3 A;  3OSR A;  4PE3 A;  1FPG A;  3DP6 A;  3KC1 A;  4YB5 A;  4O94 A;  4G4P A;  3OEL A;  3ZSF A;  2ZYO A;  4R6H A;  4NWC A;  4EXL A;  4HXV A;  2DVC A;  1Y3Q A;  4P0G A;  4YKI A;  3F11 A;  4DXC A;  4JVD A;  1FRP A;  3Q25 A;  1FPB A;  1YAE A;  3KG2 A;  1JQF A;  3TTL A;  1K9Y A;  3TFL A;  4G77 A;  4RJZ A;  3A3C A;  5J16 A;  4N6K A;  4Z7E A;  1UQW A;  1LAH E;  3EF7 A;  3FIR A;  1PEB A;  1L5T A;  1WVJ A;  3OEK A;  1H76 A;  1MPB A;  1TXF A;  3BBR A;  3HHG A;  3VXB A;  2HXR A;  1DMB A;  2OWZ A;  3PD9 A;  3MP6 A;  5AA1 A;  2PFY A;  2CMO A;  4N8G A;  1LBZ A;  4NF6 A;  3B6Q A;  1TFA A;  3LC8 A;  3UIF A;  1D3K A;  4I3Y A;  2Q9T A;  4JVI A;  5I59 A;  5CMK A;  1VSO A;  4EXK A;  4ZZA A;  2HAV A;  4IR8 A;  4PGP A;  3MUQ A;  2ZNS A;  2B4M A;  1B1X A;  1AL3 A;  1GR2 A;  2IA4 A;  4KYE A;  3I6V A;  5AE4 A;  1A99 A;  2W7Y A;  2DXR A;  2PYY A;  2NUV A;  4QRZ A;  1OVT A;  1RYX A;  2CZL A;  2HFB A;  2DQV A;  4H5F A;  4GXA A;  1B40 A;  2OLB A;  4TQU Q;  1FPD A;  1S9T A;  4H8J A;  1USY H;  4ZE8 A;  3RLF E;  2LAO A;  2ZXT A;  4PFW A;  3IOT A;  4G8M A;  4LN5 A;  1PBQ A;  3V8X B;  3I5O A;  2RIN A;  2ZMB A;  2ZYM A;  4P47 A;  1YPN A;  5I84 A;  4F29 A;  2QL3 A;  1AH5 A;  3SEX A;  2Y7I A;  1Y4T A;  2A5T A;  1LFH A;  4HS7 A;  2H98 A;  1IXH A;  3IK6 B;  4O8M A;  3ONM A;  2VD3 A;  1M5C A;  1VFE A;  3SER A;  3FXU A;  1HSL A;  3RQT A;  3K1N A;  1Z7M E;  4Q30 B;  5ISU A;  3OO7 A;  4H6D A;  5KZT A;  1N84 A;  1K9Z A;  2UYF A;  3KZG A;  4GX6 A;  1WDN A;  3LR1 A;  3FXR A;  2NOO A;  1MG1 A;  2QS3 A;  3UGW A;  2H4I A;  3TEL A;  3EKI A;  1BKA A;  4PFI A;  4GVO A;  4FEC A;  2QSX A;  3VE1 B;  1Y3P A;  1GVC A;  2F3D A;  4P1E A;  4P9K A;  5EYF A;  4ZZE A;  4N91 A;  5IZ3 B;  3RNN A;  1JP4 A;  3C36 A;  4UA8 A;  2Y5K A;  4IO5 A;  1JVY A;  1MQH A;  3TKD A;  4XFE A;  4MF3 A;  1LBB A;  1FW0 A;  4QFN A;  1FTA A;  4FEB A;  3OO8 A;  2X7Q A;  2PVU A;  4TLM B;  2XX8 A;  3N94 A;  3RPL A;  3QUJ A;  1SI1 A;  1VFD A;  4BDR A;  3E78 A;  1B7U A;  4FIM A;  1POT A;  4IO2 A;  4QFO A;  3PPQ A;  4JWO A;  1S50 A;  4IGR A;  1AIV A;  4POW A;  2QMX A;  3GZG A;  1RDY A;  5HPQ A;  2FBP A;  4OMB A;  1NV3 A;  5TP9 B;  3IB2 A;  3UN6 A;  2RC9 A;  1B4Z A;  2HPG A;  3O9P A;  3H6V A;  4OWD A;  1NL5 A;  2B65 A;  5KCJ B;  2DOJ A;  5EQ8 A;  4ISU A;  4YKJ A;  1MY0 A;  3PMX A;  4U4X A;  4OAN A;  4TLL B;  4WXJ A;  1CB6 A;  1UTB B;  3Q26 A;  4C1T A;  4FJP A;  1QGX A;  4P8B A;  4OTE A;  2AL4 A;  5EQ9 A;  2RC7 A;  3PPR A;  1YYZ A;  2OJT A;  4GL8 A;  5CRY A;  1O64 A;  5IGA A;  2B4L A;  4P1L A;  3VV5 A;  2OK2 A;  5HBC A;  4QSD A;  4KXP A;  3VLW A;  1YCJ A;  4NG7 A;  1ZMG A;  1QW0 A;  4XKP A;  4R9F A;  2RKM A;  2D21 A;  2XWI A;  5HM4 B;  1IMA A;  2P3N A;  2XWO A;  1NUY A;  1FBC A;  5M2V A;  1N7X A;  4H5G A;  4PAK A;  3K4U A;  1IMB A;  4DE8 A;  4I3E A;  5I2K A;  3UP9 A;  2CEY A;  5I58 B;  4N17 A;  5ICQ A;  1NV2 A;  1IIW A;  3MBP A;  3FVK A;  2HQ0 A;  1LAF E;  1NFT A;  1R1N A;  3DEL B;  2WYP A;  2DXY A;  1II5 A;  4GRK A;  1US5 A;  2REG A;  4NMY A;  4F31 B;  5DT6 A;  4MLV A;  4U1Z A;  5AA2 B;  1MXU A;  5F24 A;  3T9H B;  4YB7 A;  1MQJ A;  1FPF A;  3K2D A;  4M1V A;  3KGC A;  2XXQ A;  3KN8 A;  4KPT A;  2QS1 A;  4QSC A;  3S9M C;  1UTH A;  2OBG A;  3TMG A;  4EQB A;  5ELV A;  3LV0 A;  4LZ5 A;  4R2B A;  1XVY A;  2UYE A;  3MZ1 A;  3LSX A;  1LBC A;  5JTY A;  1IMC A;  1NUZ A;  4THI A;  3EHS A;  3CVG A;  3EHT A;  4G68 A;  3IO6 A;  5CMC A;  1SD3 A;  1IUD A;  4O7M A;  1EYJ A;  4HTG A;  2HCA A;  3RPW A;  2XD2 A;  2P3V A;  2X7P A;  4ZEB A;  4YIC A;  4YZZ A;  1LBX A;  2F36 A;  3C33 A;  3MP1 A;  5H8H A;  2HXW A;  3HHF A;  4OFO A;  5DEX B;  3CIJ A;  3T9V A;  3ZKK A;  4U2R A;  2Y5L A;  4H67 A;  1PB8 A;  4ZED A;  4RPN A;  5DVF A;  4NGU A;  4PE5 B;  2XX7 A;  2I4C A;  4KQP A;  2R8T A;  3NOH A;  1TFD A;  2Q88 A;  4DDD A;  1NKX A;  1I6Q A;  3CFZ A;  3WAE A;  5L9S A;  4U4S A;  3RTF B;  1EH3 A;  1NV4 A;  3Q28 A;  1QKA A;  2PFZ A;  4G2Z A;  3BFT A;  3IB1 A;  3LBS A;  2D5W A;  3KN3 A;  4Z0I A;  3LSW A;  1B7H A;  4ZEI A;  1FQE A;  1B5J A;  3U93 A;  5TPA A;  1JEV A;  4XKN A;  2BJJ X;  1FBF A;  4H46 A;  4I1D A;  2PMS A;  1IIT A;  1IXI A;  4OVP A;  3FJ7 A;  4RK2 A;  4KFQ A;  1H3D A;  5I56 B;  3B6W A;  4JBZ A;  5T3J A;  4KCD A;  3IOR A;  3UA8 A;  3JYR A;  2Z23 A;  1F9B A;  3KOS A;  4X1B A;  2G29 A;  1P1O A;  3SZP A;  4N13 A;  1QVS A;  4RXL A;  4PDH A;  4R75 A;  3VXC A;  4GQO A;  1SQY A;  1D9Q A;  3PD8 A;  1JVX A;  2Z8D A;  2R9J A;  1PC3 A;  5CBS A;  4UAB A;  2Q2C A;  1FSA A;  1XHY A;  4O3A A;  4YU0 A;  3TQL A;  5L9O A;  5K2X A;  1A55 A;  1Q35 A;  4KD5 A;  4PFY A;  4GF8 A;  4QFP A;  1DOT A;  2HHM A;  2ONS A;  4N6P A;  3DLN A;  4ELP A;  1QUI A;  2UVI A;  4NAP A;  2XD3 A;  4GWX A;  2F3B A;  4HE2 A;  5A5L A;  4DCY A;  5I3S A;  2Z8F A;  5H8F B;  4ECF A;  2QVU A;  1YXI A;  1FTK A;  1SBP A;  4F3G A;  1QKB A;  4IGT A;  1EU8 A;  4MFI A;  3DP8 A;  3GXA A;  3MPL A;  4DZ1 A;  1G0I A;  5DW8 A;  1POY 1;  1LCT A;  1S7Y A;  2E0S A;  3W9W A;  3H06 B;  1ZU0 A;  3MVW A;  4MBP A;  3PMV A;  2Y7R A;  4DCX A;  2HEU A;  3S9E A;  2DE2 A;  3CG3 A;  1MPD A;  2I49 A;  3CSG A;  3K00 A;  2DDK A;  2GHA A;  3JV9 A;  1OIB A;  4BDO A;  3MW0 A;  1MS7 A;  3BFU A;  4AB5 A;  4R73 A;  4FBP A;  4NED A;  4OYV A;  2Q2A A;  1WOD A;  1FQF A;  1SYI A;  3C35 A;  1NMU A;  1MXX A;  2ANJ A;  4XEQ A;  1A8F A;  1FBG A;  3MZ9 A;  2PBW A;  2XXY A;  1FPE A;  1LB9 A;  1Y4C A;  2KQZ A;  3HST A;  4OEV A;  3N6T A;  4MX6 A;  4WKM A;  1RDZ A;  4HCW A;  4XKQ A;  1YZ0 A;  1EZP A;  4AS4 A;  2VOZ A;  2PX1 A;  2PT1 A;  1PB9 A;  1MY4 A;  1M5D A;  3RGY A;  2ZZW A;  4H0W A;  3UK4 A;  4X04 A;  5EYG A;  3U92 A;  4NF6 B;  3TOD A;  2WYK A;  3RYD A;  2V25 A;  5IAI A;  1XVX A;  5I59 B;  3VVF A;  4KI0 E;  2RCA A;  3C9H A;  4GL0 A;  5I2N A;  4EQ9 A;  3IO4 A;  4NF8 A;  4IO3 A;  3DP4 A;  1OVB A;  2XXV A;  2I3V A;  5FHO A;  3GBB A;  1KWH A;  2ESN A;  3KJ7 A;  2OWS A;  2XWK A;  3PUW E;  1PB7 A;  1BTJ A;  4PQJ A;  3T66 A;  4IY6 A;  5I57 A;  1H44 A;  2B3F A;  3ECR A;  4LZ7 A;  5BWJ A;  4NE4 A;  4OVQ A;  1GV8 A;  3G3H A;  2ZYN A;  3L6H A;  1TT1 A;  4JSO A;  4PFR A;  3MPK A;  1GTK A;  3I3V A;  3FUZ A;  5TU0 A;  5LTC A;  2Y7P A;  4YAH X;  3K1M A;  1LBV A;  3M3L A;  2CZI A;  4PDD A;  2BJI A;  1SW4 A;  3K0V A;  1URG A;  4F22 A;  5KDT A;  3OEN A;  4H1X A;  2A5T B;  4DI4 B;  2PT2 A;  2ZNT A;  1URD A;  3C32 A;  4KYS A;  3LSF B;  2QVR A;  5I57 B;  2ONR A;  3T22 A;  2UVH A;  4NF5 A;  2QPQ A;  5FHN A;  2VHA A;  4PCD A;  2NWJ A;  3G3F A;  1LGB C;  4MH5 A;  2F7B A;  2ALU A;  4F1V A;  3UOR A;  3QYT A;  3HFU A;  3KFM A;  2ZZV A;  1B3L A;  1FJ9 A;  1NV5 A;  4NQ8 A;  5CMM A;  5AA4 A;  2O51 A;  1LST A;  4I8C A;  1FPL A;  1LCF A;  2UXA A;  1USY E;  2QRY A;  4O3C A;  3GYY A;  2QS4 A;  1AMF A;  1B3E A;  4P56 A;  3PU5 A;  2FVZ A;  4Q5T A;  4WED A;  3FV2 A;  3ZKL A;  3FJM A;  1B5I A;  3IL1 B;  1SPI A;  2VP1 A;  2FNC A;  3VFJ A;  1NNF A;  4NF4 A;  2GFE A;  1B58 A;  2M8C A;  1LEV A;  1INP A;  4OA4 A;  3FXQ A;  2Y84 A;  1FBP A;  2I4B A;  5DYH A;  3FGS A;  3T1B A;  4MNP A;  3RPL B;  3D1R A;  1SVX B;  2PCR A;  1PDA A;  1RKM A;  4QXD A;  4RK9 A;  1ZIU A;  3VVD A;  3SEY A;  4OXV A;  4LUB A;  4N15 A;  3OSQ A;  3FAS A;  5IKB A;  1N04 A;  2V84 A;  3OO9 A;  3HN0 A;  4GIZ A;  4OVJ A;  2VPO A;  3PGF A;  4OZ9 A;  1B3G A;  2VT5 A;  3GBA A;  5EHM A;  1NV7 A;  3LSL A;  3SEV A;  1ZTY A;  3H03 A;  3OMB A;  1GGG A;  4IY5 A;  5H8S A;  3GLB A;  4EDP A;  2WEF A;  2E1S A;  2V3T A;  1Y20 A;  2XWV A;  3O2A A;  1MQI A;  4ELQ A;  1B9J A;  1JW5 A;  3SET A;  3KJT A;  3KBR A;  4MIJ A;  2HZL A;  5L8D A;  2Z8E A;  3PMW A;  1B6H A;  4GX3 A;  3W15 C;  2P1S A;  4JWY A;  4OEN A;  3PPO A;  3CR9 A;  5ITO A;  4OVT A;  1KZ8 A;  3N5L A;  2DWA A;  2F8D A;  2P2A A;  4GOT A;  1MQD A;  4BDM A;  4DI3 D;  3QSL A;  5DVI A;  3RY3 A;  4BLA A;  2GRV A;  3IFC A;  4M4G A;  5H8N A;  3OD7 A;  3PTY A;  5I2K B;  1OLC A;  1XI6 A;  4HW8 A;  2GH9 A;  2F78 A;  4PF6 A;  4FAJ A;  1B32 A;  2YPN A;  3RT8 A;  3B8B A;  1NH7 A;  1MDP 1;  3K01 A;  1NNT A;  1FBH A;  3O97 A;  3K6U A;  3QAX A;  3O6I A;  4BDL A;  4KR5 A;  3U65 A;  3TTN A;  4N07 A;  4LAT A;  4NN3 A;  4O3B A;  3H6W A;  3RUM A;  4MLQ A;  3FD3 A;  4F2Q A;  4X9T A;  2RCB A;  5B7D A;  1UTH B;  4OFJ A;  4GWW A;  1LBY A;  2Y7W A;  5DTB A;  2YLN A;  3ROJ A;  1N76 A;  3TCF A;  1FBD A;  2Y7K A;  1ATG A;  1R9L A;  4N81 A;  1Y3N A;  4U1O A;  5JTY B;  1DBZ A;  1MH3 A;  1BP5 A;  2H9B A;  1FTL A;  4G68 B;  1A40 A;  3PUX E;  4EF1 A;  3T0J A;  4PBQ A;  4O7I A;  3ILU B;  4G8N A;  2ZNU A;  4OVR A;  3TUS A;  2HAU A;  2D3I A;  4P3L A;  1JET A;  3MQ9 A;  4PFT A;  4KCC A;  3TAJ A;  3RTW B;  3SDF A;  5H8H B;  4X48 A;  4OER A;  1LBW A;  4N4U A;  1YTV A;  3BIG A;  3MVX A;  1MQG A;  3KSJ A;  3PPN A;  2FIX A;  2HZK A;  2OX3 A;  2ONK E;  1OLA A;  3N6U A;  1KA0 A;  2GQ1 A;  2V93 A;  3MP8 A;  3PV0 E;  1SW2 A;  3ZS6 A;  1O7T A;  3O29 A;  1MXY A;  4ND9 A;  1SW1 A;  4PAI A;  5CI5 A;  2AYS A;  3G7W A;  1NUW A;  1R6Z A;  2QS2 A;  3Q29 A;  1A54 A;  4LA9 A;  4N6D A;  2ZYK A;  2I0C A;  3RT6 B;  2GHB A;  4QF9 A;  4XF5 A;  2Q8J A;  1CE2 A;  4GXS B;  4F39 A;  4GWU A;  3QMF A;  5A5X A;  2VPN A;  1NV0 A;  2WX9 A;  5TPA B;  1HSE A;  3G3I A;  3S9L C;  4RYA A;  4MHF A;  2AIX A;  3THI A;  2ABH A;  3VLV A;  3RN8 A;  4MJO A;  5I7I A;  2O7U A;  3IOW A;  1M5E A;  2FIE A;  3G3J A;  4DIG A;  4R2F A;  2O6A A;  1KA1 A;  2F7C A;  4H45 A;  4RY1 A;  1DTZ A;  1M5B A;  3O6H A;  2DWI A;  1ZBM A;  2O69 A;  4ELR A;  4R6Y A;  4H65 A;  2B3B A;  1IMF A;  3IX1 A;  4YMA A;  4JVC A;  4EQ7 A;  5LOM A;  3SEW A;  4GWS A;  1A7L A;  3E3K A;  4OEU A;  4MMP A;  2XXR A;  2QVV A;  4TOZ A;  3G3G A;  3IJX B;  3OO6 A;  3D4G A;  3T9U A;  2XXH A;  4ONY A;  1RYO A;  1LB8 A;  3E79 A;  3T93 B;  4P0I A;  3M3F A;  1MY1 A;  1IXC A;  1FPK A;  3MVY A;  4PC9 A;  3V83 A;  1XC1 A;  2I48 A;  3Q27 A;  3FV1 A;  3EPE A;  2CZK A;  3FVN A;  3MZB A;  1BIY A;  4R72 A;  1I6B A;  1FJ6 A;  3OXN A;  3IJO B;  4OVS A;  5AA2 D;  2MKZ A;  3WAF A;  1B0H A;  4R6K A;  1AOV A;  1MY3 A;  1I69 A;  2DWH A;  1D9V A;  3A09 A;  3O28 A;  3CG1 A;  3R6U A;  1LAX A;  4AS5 A;  1SW5 A;  3G3K A;  3E13 X;  1FQC A;  1B51 A;  1TWY A;  3LUY A;  5FTI A;  1LAG E;  2CZH A;  3FBP A;  2XXU A;  3TQW A;  1P99 A;  3TEP A;  1VE4 A;  3HV1 A;  4G68 C;  1MH4 A;  5ET6 A;  3FVG A;  1MRP A;  4LP2 B;  2Q89 A;  3ISP A;  1NV6 A;  4R9G A;  1OQH A;  3B6T A;  3FVO A;  4U23 A;  3K6V A;  1MM7 A;  3CFX A;  1NV1 A; 
#chains in the Genus database with same CATH homology
 4EF2 A;  3FZV A;  3TYH A;  2RF1 A;  1UIV A;  2F6G A;  1OMP A;  5JK4 A;  4ELO A;  3KN7 A;  3CFL A;  5ICT A;  1JNF A;  2OZZ A;  1DPP A;  4P11 A;  3TPA A;  1LFI A;  1UIU A;  3C34 A;  1XS5 A;  1HSJ A;  4YKP A;  3TCG A;  5CM6 A;  4R74 A;  3SKP A;  3TTR A;  2DSF A;  3IOU A;  4FE8 A;  1B3F A;  1MXV A;  1XT8 A;  2I58 A;  5F1Q A;  1IEJ A;  3O66 A;  4X1D A;  1Q1K A;  2R71 A;  4F18 A;  3PUY E;  2FYI A;  3CI8 A;  4LON B;  1NNP A;  4WEP A;  3IR1 A;  3AXF A;  1P1W A;  5ITP A;  3OEM A;  4IB2 A;  4XXU A;  4L17 A;  1MM6 A;  3W9V A;  3PPP A;  4K3F A;  1NNK A;  1N3X A;  2REJ A;  2OCU A;  4OHN A;  4JSD A;  3DM0 A;  1FCK A;  1I6A A;  5EHS A;  1EZO A;  5CBR A;  4LZ8 A;  2DP8 A;  1JW1 A;  2XXT A;  4FED A;  2AL5 A;  5I2N B;  4U21 A;  1LLS A;  4NF8 B;  4OES A;  4ZEC A;  2F5X A;  4ZEK A;  2UVG A;  4ZDM A;  3HCQ A;  4F1Y A;  2FA7 A;  3S2V A;  4GLI A;  4JWX A;  4Q8R A;  3TTM A;  3TZA A;  2NVU B;  3T96 B;  3E9X A;  4OQO A;  1QUJ A;  4QFL A;  3U8Q A;  5TP9 A;  3VLU A;  3JZJ A;  3TCH A;  3CRB A;  1B5H A;  2F97 A;  4JXI A;  4BDQ A;  2DE3 A;  5KCJ A;  4PP0 A;  3P7I A;  5KDT B;  2O1L A;  1UTB A;  1P1N A;  1IXG A;  3D4C A;  1MPC A;  1MDQ A;  1QUL A;  3TTK A;  4NF5 B;  4IO4 A;  3K6X A;  1URS A;  3M3K A;  3N26 A;  1VR5 A;  4FAT A;  1Y1Z A;  2F7A A;  1B7Z A;  5AA4 B;  4F19 A;  3MJN A;  3O6G A;  1FTO A;  2H99 A;  2O68 A;  4NTL A;  1O63 A;  2G93 A;  4H8I A;  3K6W A;  2I6E A;  1B0L A;  1FTJ A;  1FTM A;  1SDX A;  3EQ1 A;  3R7X A;  1MXZ A;  1MXW A;  4DXU A;  1IQ7 A;  2WKY A;  4NF4 B;  3H6U A;  5I58 A;  4GD5 A;  4OET A;  3A3U A;  2O1M A;  1ZJL A;  4FOR A;  5FHM A;  2H25 A;  4I9D A;  4IO6 A;  1JEU A;  5FTH A;  4EUO A;  4ESW A;  2XXW A;  2QJE A;  3HO7 A;  3H3G A;  1B4H A;  5L9M A;  1NH8 A;  3IB0 A;  5AA2 A;  2DS9 A;  4RA1 A;  3S4U A;  3H4Z A;  3ODB A;  3PUV E;  3K1P A;  1DSN A;  4QFK A;  1B1H A;  4JB7 A;  4C1U A;  1A8E A;  1B52 A;  1B2H A;  2Z22 A;  4QHQ A;  1FQD A;  3B7D A;  2XXX A;  4XTC Q;  4ZE9 A;  4JDF A;  2V3Q A;  4ZEF A;  5H8Q A;  4OFL A;  1N0T A;  1ELJ A;  4GFR A;  2VD2 A;  4LQ2 A;  4ZS9 A;  3R26 A;  3MWB A;  4BDN A;  3U1O A;  3SEU A;  2F6P A;  1P1Q A;  4XKR A;  2NXO A;  3BKI B;  1EZ9 A;  4IO7 A;  3V5A A;  2DYX A;  1Z7N E;  5DEX A;  4G8H A;  3TDJ A;  4XIG Q;  4ESX A;  3H7M A;  4HCY A;  1H43 A;  5H8Q B;  5H8N B;  3C31 A;  4E0W A;  1M5F A;  4GWO A;  5J1D A;  3C4M A;  2O7I A;  1ANF A;  4KHZ E;  5JEI A;  2X26 A;  3V89 B;  4F3B A;  4C0R A;  1DTG A;  3PUZ E;  3VDF A;  1BLF A;  2R6G E;  5F7V A;  3KSX A;  1JW4 A;  1B05 A;  3QUF A;  2YJP A;  3QK6 A;  1OQG A;  1ZKB A;  5CMB A;  3M8U A;  2DE4 A;  2XXP A;  4Q0C A;  4YKK A;  2F35 A;  4KYD A;  3U94 A;  1QUK A;  3IAZ A;  1Y1M A;  4U22 A;  5I56 A;  1PBP A;  2F34 A;  2XXI A;  4PET A;  2V3U A;  3L6G A;  1ZLQ A;  4AQ4 A;  2O84 X;  3MAM A;  1SI0 A;  4LQ5 A;  3S9N C;  2THI A;  1IZ1 A;  4YMB A;  1D4N A;  2VGQ A;  2I0B A;  5K2Y A;  3FAT A;  4LVQ A;  4F2O A;  5CC2 A;  4PFU A;  1H45 A;  3KOT A;  4F1U A;  1FQA A;  3T9X B;  5AA3 A;  2A5S A;  5B70 A;  1J1N A;  4POX A;  3K02 A;  4QSE A;  1LFG A;  2H5Y A;  2OWT A;  1R9Q A;  1XOC A;  1DPE A;  1MY2 A;  2P0S A;  3FJG A;  4F3S A;  4F3P A;  5BUU A;  4NWD A;  3IOV A;  1QJM A;  4DXB A;  3OOA A;  2RC8 A;  5A5X B;  1D9Y A;  2UVJ A;  4UAC A;  1FQB A;  1SYH A;  3VVE A;  5H8F A;  4YB6 A;  3CSB A;  3KEI A;  3USD A;  4DLD A;  2XHD A;  3U72 A;  1B46 A;  1T0K A;  1P1U A;  3H6T A;  3E4R A;  4RNS A;  3MVZ A;  2QMW A;  3MC2 A;  3HPI A;  4E0X A;  3EHU A;  2I3W A;  1B3H A;  2IEE A;  4AB6 A;  4RPO A;  1US4 A;  1Y9U A;  3SES A;  1N7W A;  5DVJ A;  2KLF A;  3QXM A;  1N3W A;  3ILT B;  2DVZ A;  4I62 A;  3QIM A;  2DWJ A;  2XX9 A;  3EN3 A;  3OSR A;  3DP6 A;  4YB5 A;  4G4P A;  3OEL A;  3ZSF A;  2ZYO A;  4R6H A;  4NWC A;  4EXL A;  2DVC A;  1Y3Q A;  4P0G A;  4YKI A;  3F11 A;  4DXC A;  3Q25 A;  1YAE A;  3KG2 A;  1JQF A;  3TTL A;  3TFL A;  4G77 A;  4RJZ A;  3A3C A;  4Z7E A;  1UQW A;  1LAH E;  3EF7 A;  3FIR A;  1PEB A;  1L5T A;  1WVJ A;  3OEK A;  1H76 A;  1MPB A;  1TXF A;  3BBR A;  3HHG A;  3VXB A;  1DMB A;  3PD9 A;  3MP6 A;  5AA1 A;  4NF6 A;  2CMO A;  3B6Q A;  1TFA A;  3LC8 A;  3UIF A;  1D3K A;  2Q9T A;  5I59 A;  5CMK A;  1VSO A;  4EXK A;  4ZZA A;  2HAV A;  3MUQ A;  2ZNS A;  1B1X A;  1AL3 A;  1GR2 A;  2IA4 A;  4KYE A;  3I6V A;  5AE4 A;  1A99 A;  2W7Y A;  2DXR A;  2PYY A;  2NUV A;  4QRZ A;  1OVT A;  1RYX A;  2CZL A;  2HFB A;  2DQV A;  4H5F A;  4GXA A;  1B40 A;  2OLB A;  4TQU Q;  1S9T A;  4H8J A;  1USY H;  4ZE8 A;  3RLF E;  2LAO A;  2ZXT A;  4PFW A;  3IOT A;  4G8M A;  1PBQ A;  3V8X B;  3I5O A;  2RIN A;  2ZMB A;  2ZYM A;  1YPN A;  5I84 A;  4F29 A;  2QL3 A;  1AH5 A;  3SEX A;  2Y7I A;  1Y4T A;  2A5T A;  1LFH A;  4HS7 A;  2H98 A;  1IXH A;  3IK6 B;  3ONM A;  2VD3 A;  1M5C A;  1VFE A;  3SER A;  3FXU A;  1HSL A;  3RQT A;  3K1N A;  1Z7M E;  4Q30 B;  5ISU A;  3OO7 A;  4H6D A;  5KZT A;  1N84 A;  2UYF A;  3KZG A;  1WDN A;  3LR1 A;  3FXR A;  2NOO A;  1MG1 A;  2QS3 A;  3UGW A;  2H4I A;  3TEL A;  1BKA A;  4GVO A;  4FEC A;  2QSX A;  3VE1 B;  1Y3P A;  1GVC A;  5EYF A;  4ZZE A;  3RNN A;  3C36 A;  4UA8 A;  4IO5 A;  1JVY A;  1MQH A;  3TKD A;  4MF3 A;  1LBB A;  1FW0 A;  4QFN A;  4FEB A;  3OO8 A;  2X7Q A;  2PVU A;  4TLM B;  2XX8 A;  3N94 A;  3QUJ A;  1SI1 A;  1VFD A;  4BDR A;  1B7U A;  4FIM A;  1POT A;  4IO2 A;  4QFO A;  3PPQ A;  4JWO A;  1S50 A;  4IGR A;  1AIV A;  4POW A;  2QMX A;  3GZG A;  5HPQ A;  4OMB A;  5TP9 B;  3IB2 A;  3UN6 A;  2RC9 A;  1B4Z A;  3O9P A;  3H6V A;  4OWD A;  1NL5 A;  2B65 A;  5KCJ B;  2DOJ A;  4ISU A;  4YKJ A;  1MY0 A;  3PMX A;  4U4X A;  4TLL B;  4WXJ A;  1CB6 A;  1UTB B;  3Q26 A;  4C1T A;  4FJP A;  4OTE A;  2AL4 A;  2RC7 A;  3PPR A;  2OJT A;  4GL8 A;  5CRY A;  1O64 A;  3VV5 A;  2OK2 A;  5HBC A;  4QSD A;  3VLW A;  1YCJ A;  1ZMG A;  1QW0 A;  4XKP A;  4R9F A;  2RKM A;  2D21 A;  5HM4 B;  5M2V A;  1N7X A;  4H5G A;  3K4U A;  4DE8 A;  5I2K A;  3UP9 A;  5I58 B;  5ICQ A;  1IIW A;  3MBP A;  3FVK A;  2HQ0 A;  1LAF E;  1NFT A;  1R1N A;  3DEL B;  2DXY A;  1II5 A;  4GRK A;  1US5 A;  2REG A;  4NMY A;  4F31 B;  5DT6 A;  4MLV A;  4U1Z A;  5AA2 B;  1MXU A;  3T9H B;  4YB7 A;  1MQJ A;  3K2D A;  4M1V A;  3KGC A;  2XXQ A;  3KN8 A;  4KPT A;  2QS1 A;  4QSC A;  3S9M C;  1UTH A;  3TMG A;  4EQB A;  2OBG A;  5ELV A;  4LZ5 A;  4R2B A;  1XVY A;  2UYE A;  3MZ1 A;  3LSX A;  1LBC A;  5JTY A;  4THI A;  3EHS A;  3CVG A;  3EHT A;  4G68 A;  3IO6 A;  5CMC A;  1SD3 A;  1IUD A;  4HTG A;  2HCA A;  3RPW A;  2XD2 A;  2X7P A;  4ZEB A;  4YIC A;  4YZZ A;  2F36 A;  3C33 A;  3MP1 A;  5H8H A;  2HXW A;  3HHF A;  4OFO A;  5DEX B;  3CIJ A;  3T9V A;  3ZKK A;  4U2R A;  4H67 A;  1PB8 A;  4ZED A;  4RPN A;  5DVF A;  4PE5 B;  2XX7 A;  2I4C A;  4KQP A;  1TFD A;  2Q88 A;  4DDD A;  1NKX A;  1I6Q A;  3CFZ A;  3WAE A;  5L9S A;  4U4S A;  3RTF B;  1EH3 A;  3Q28 A;  1QKA A;  4G2Z A;  3BFT A;  3IB1 A;  3LBS A;  2D5W A;  3KN3 A;  4Z0I A;  3LSW A;  1B7H A;  4ZEI A;  1FQE A;  1B5J A;  3U93 A;  5TPA A;  1JEV A;  4XKN A;  2BJJ X;  4I1D A;  2PMS A;  1IIT A;  1IXI A;  3FJ7 A;  4RK2 A;  4KFQ A;  1H3D A;  5I56 B;  3B6W A;  4JBZ A;  4KCD A;  3IOR A;  3UA8 A;  3JYR A;  2Z23 A;  1F9B A;  3KOS A;  4X1B A;  2G29 A;  1P1O A;  4N13 A;  1QVS A;  4RXL A;  4R75 A;  3VXC A;  4GQO A;  1SQY A;  3PD8 A;  1JVX A;  2Z8D A;  2R9J A;  1PC3 A;  5CBS A;  2Q2C A;  4O3A A;  1XHY A;  4YU0 A;  3TQL A;  5L9O A;  5K2X A;  1A55 A;  1Q35 A;  4KD5 A;  4PFY A;  4GF8 A;  4QFP A;  1DOT A;  2ONS A;  4N6P A;  3DLN A;  4ELP A;  1QUI A;  2UVI A;  2XD3 A;  4DCY A;  2Z8F A;  5H8F B;  4ECF A;  1FTK A;  1SBP A;  4F3G A;  1QKB A;  4IGT A;  1EU8 A;  4MFI A;  3DP8 A;  3GXA A;  3MPL A;  4DZ1 A;  1POY 1;  1LCT A;  1S7Y A;  2E0S A;  3W9W A;  3H06 B;  1ZU0 A;  3MVW A;  4MBP A;  3PMV A;  2Y7R A;  4DCX A;  2HEU A;  3S9E A;  2DE2 A;  3CG3 A;  1MPD A;  2I49 A;  3CSG A;  3K00 A;  2GHA A;  3JV9 A;  1OIB A;  4BDO A;  3MW0 A;  1MS7 A;  3BFU A;  4AB5 A;  4R73 A;  4NED A;  4OYV A;  2Q2A A;  1WOD A;  1FQF A;  1SYI A;  3C35 A;  1NMU A;  1MXX A;  2ANJ A;  1A8F A;  3MZ9 A;  2PBW A;  2XXY A;  1LB9 A;  1Y4C A;  3HST A;  4OEV A;  3N6T A;  4WKM A;  4HCW A;  4XKQ A;  1EZP A;  2VOZ A;  2PX1 A;  2PT1 A;  1PB9 A;  1MY4 A;  1M5D A;  3RGY A;  4H0W A;  3UK4 A;  3U92 A;  4NF6 B;  3TOD A;  2V25 A;  5IAI A;  1XVX A;  5I59 B;  3VVF A;  4KI0 E;  2RCA A;  3C9H A;  4GL0 A;  5I2N A;  4EQ9 A;  3IO4 A;  4NF8 A;  4IO3 A;  3DP4 A;  1OVB A;  2XXV A;  2I3V A;  5FHO A;  3GBB A;  1KWH A;  2ESN A;  3KJ7 A;  2OWS A;  3PUW E;  1PB7 A;  1BTJ A;  4PQJ A;  3T66 A;  4IY6 A;  5I57 A;  1H44 A;  2B3F A;  3ECR A;  4LZ7 A;  5BWJ A;  4NE4 A;  1GV8 A;  3G3H A;  2ZYN A;  3L6H A;  1TT1 A;  4JSO A;  3MPK A;  1GTK A;  3I3V A;  3FUZ A;  5TU0 A;  2Y7P A;  4YAH X;  3K1M A;  3M3L A;  1SW4 A;  3K0V A;  1URG A;  4F22 A;  5KDT A;  3OEN A;  4H1X A;  2A5T B;  2PT2 A;  2ZNT A;  1URD A;  3C32 A;  4KYS A;  3LSF B;  5I57 B;  2ONR A;  3T22 A;  2UVH A;  4NF5 A;  2QPQ A;  5FHN A;  2VHA A;  2NWJ A;  3G3F A;  1LGB C;  4MH5 A;  2F7B A;  2ALU A;  4F1V A;  3UOR A;  3QYT A;  3KFM A;  1B3L A;  5CMM A;  5AA4 A;  2O51 A;  1LST A;  4I8C A;  1LCF A;  2UXA A;  1USY E;  2QRY A;  4O3C A;  2QS4 A;  1AMF A;  1B3E A;  3PU5 A;  4Q5T A;  4WED A;  3FV2 A;  3ZKL A;  3FJM A;  1B5I A;  3IL1 B;  2VP1 A;  2FNC A;  3VFJ A;  1NNF A;  4NF4 A;  2GFE A;  1B58 A;  2M8C A;  3FXQ A;  2Y84 A;  2I4B A;  5DYH A;  3FGS A;  1SVX B;  1PDA A;  1RKM A;  4RK9 A;  1ZIU A;  3VVD A;  3SEY A;  4OXV A;  4LUB A;  3OSQ A;  3FAS A;  5IKB A;  1N04 A;  2V84 A;  3OO9 A;  3HN0 A;  4GIZ A;  4OVJ A;  3PGF A;  4OZ9 A;  1B3G A;  3GBA A;  5EHM A;  3LSL A;  3SEV A;  1ZTY A;  3H03 A;  3OMB A;  1GGG A;  4IY5 A;  5H8S A;  3GLB A;  4EDP A;  2E1S A;  2V3T A;  1Y20 A;  3O2A A;  1MQI A;  4ELQ A;  1B9J A;  1JW5 A;  3SET A;  3KJT A;  3KBR A;  2HZL A;  5L8D A;  2Z8E A;  3PMW A;  1B6H A;  3W15 C;  2P1S A;  4JWY A;  4OEN A;  3PPO A;  3CR9 A;  5ITO A;  3N5L A;  2DWA A;  2F8D A;  2P2A A;  4GOT A;  1MQD A;  4BDM A;  3QSL A;  5DVI A;  3RY3 A;  4BLA A;  2GRV A;  4M4G A;  5H8N A;  3OD7 A;  5I2K B;  1OLC A;  4HW8 A;  2GH9 A;  2F78 A;  4FAJ A;  1B32 A;  2YPN A;  3RT8 A;  1NH7 A;  1MDP 1;  3K01 A;  1NNT A;  3O97 A;  3K6U A;  3QAX A;  3O6I A;  4BDL A;  4KR5 A;  3TTN A;  4N07 A;  4LAT A;  4O3B A;  3H6W A;  3RUM A;  4MLQ A;  3FD3 A;  4F2Q A;  4X9T A;  2RCB A;  5B7D A;  1UTH B;  4OFJ A;  2Y7W A;  5DTB A;  2YLN A;  1N76 A;  3TCF A;  2Y7K A;  1ATG A;  1R9L A;  1Y3N A;  4U1O A;  5JTY B;  1MH3 A;  1BP5 A;  2H9B A;  1FTL A;  4G68 B;  1A40 A;  3PUX E;  4EF1 A;  3ILU B;  4G8N A;  2ZNU A;  3TUS A;  2HAU A;  2D3I A;  1JET A;  3MQ9 A;  4PFT A;  4KCC A;  3TAJ A;  3RTW B;  3SDF A;  5H8H B;  4X48 A;  4OER A;  1YTV A;  3MVX A;  1MQG A;  3KSJ A;  3PPN A;  2HZK A;  2ONK E;  1OLA A;  3N6U A;  2V93 A;  3MP8 A;  3PV0 E;  1SW2 A;  3ZS6 A;  1O7T A;  3O29 A;  1MXY A;  4ND9 A;  1SW1 A;  5CI5 A;  2AYS A;  3G7W A;  1R6Z A;  2QS2 A;  3Q29 A;  1A54 A;  4LA9 A;  2ZYK A;  2I0C A;  3RT6 B;  2GHB A;  4QF9 A;  2Q8J A;  1CE2 A;  4GXS B;  4F39 A;  5A5X A;  5TPA B;  1HSE A;  3G3I A;  3S9L C;  4RYA A;  2AIX A;  3THI A;  2ABH A;  3VLV A;  3RN8 A;  2O7U A;  3IOW A;  1M5E A;  3G3J A;  4DIG A;  4R2F A;  2O6A A;  2F7C A;  4RY1 A;  1DTZ A;  1M5B A;  3O6H A;  2DWI A;  1ZBM A;  2O69 A;  4ELR A;  4R6Y A;  4H65 A;  2B3B A;  3IX1 A;  4YMA A;  4EQ7 A;  5LOM A;  3SEW A;  1A7L A;  3E3K A;  4OEU A;  2XXR A;  4TOZ A;  3G3G A;  3IJX B;  3OO6 A;  3D4G A;  3T9U A;  2XXH A;  4ONY A;  1RYO A;  1LB8 A;  3T93 B;  4P0I A;  3M3F A;  1MY1 A;  1IXC A;  3MVY A;  3V83 A;  1XC1 A;  2I48 A;  3Q27 A;  3FV1 A;  3EPE A;  3FVN A;  3MZB A;  1BIY A;  4R72 A;  1I6B A;  3OXN A;  3IJO B;  5AA2 D;  3WAF A;  1B0H A;  4R6K A;  1AOV A;  1MY3 A;  1I69 A;  2DWH A;  1D9V A;  3A09 A;  3O28 A;  3CG1 A;  3R6U A;  1LAX A;  1SW5 A;  3G3K A;  3E13 X;  1FQC A;  1B51 A;  1TWY A;  3LUY A;  5FTI A;  1LAG E;  2XXU A;  3TQW A;  1P99 A;  3TEP A;  1VE4 A;  3HV1 A;  4G68 C;  1MH4 A;  3FVG A;  1MRP A;  4LP2 B;  2Q89 A;  4R9G A;  1OQH A;  3B6T A;  3FVO A;  4U23 A;  3K6V A;  1MM7 A;  3CFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...