1EU8A

Structure of trehalose maltose binding protein from thermococcus litoralis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
407
structure length
407
Chain Sequence
IEEGKIVFAVGGAPNEIEYWKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIASGWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYSKPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKDGKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYAWGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYSVQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKYVNSALAGKISPQEALDKAQKEAEELVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a liganded trehalose/maltose-binding protein from the hyperthermophilic Archaeon Thermococcus litoralis at 1.85 A.
pubmed doi rcsb
source organism Thermococcus litoralis
molecule tags Sugar binding protein
molecule keywords TREHALOSE/MALTOSE BINDING PROTEIN
total genus 144
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A01
2DXRA 3DP6A 3PMXA 2UVIA 1IITA 3DP8A 5H8NA 1ZU0A 2OK2A 4OFLA 1BP5A 3E13X 3IJOB 5TP9B 4GXSB 1A99A 3VDFA 3HSTA 2RINA 1S7YA 2B65A 1ZKBA 4Q5TA 1Y3NA 5HBCA 3T93B 4AQ4A 2DVCA 3FV1A 1HSEA 3IR1A 2HQ0A 3CVGA 3FV2A 1H44A 4KYDA 3DP4A 3LBSA 4MH5A 2V84A 1Z7ME 4ZS9A 3SEWA 2F35A 3WAFA 2QS2A 1US5A 2THIA 1BIYA 1LAXA 2F5XA 1NFTA 3HHFA 1URSA 4G4PA 4RPOA 1FTOA 4FATA 4YKJA 1LFHA 2DVZA 1A54A 5JEIA 2O69A 3IB0A 2OBGA 4JB7A 4G68B 4DE8A 1Y4TA 2Y7PA 4PP0A 2QS4A 3U92A 4OESA 2Z8EA 2RC7A 2DWHA 1D9YA 5AA3A 5A5XA 2PT2A 2M8CA 4JDFA 2REJA 2X7QA 1MH3A 1NMUA 3EPEA 2NUVA 3OMBA 4OEUA 3LC8A 2XD2A 4RPNA 3H6TA 4ZDMA 3MW0A 4O3CA 4OZ9A 2H4IA 2GHBA 2KLFA 3AXFA 3N94A 4L17A 4LQ5A 1BTJA 5ELVA 1JETA 2ZYKA 3LSLA 3SETA 3W15C 1MS7A 4MF3A 3PD8A 4R74A 2XXYA 1M5FA 1NNKA 4RNSA 5M2VA 1O7TA 3U8QA 5I2KB 1B3HA 3IB2A 1FQCA 5CMCA 1A40A 1QW0A 2F7CA 3VVFA 3PPQA 2OWTA 1QUJA 3EN3A 3FASA 3K4UA 3R26A 4U21A 5H8HA 1A8EA 3T9UA 4F1UA 3QXMA 1SW5A 3KG2A 4IGTA 3PUYE 5FHMA 3TTNA 4NF5A 3FJGA 3C32A 5CMMA 4X1DA 5AA1A 2YJPA 2W7YA 3C35A 5TPAA 1NNPA 2OLBA 3VLVA 5JTYA 1N3WA 2Z22A 5DYHA 3IORA 5F7VA 4POWA 3VFJA 1A55A 3HCQA 4GLIA 3SKPA 4F2QA 2XXWA 3G7WA 1NNTA 3OO7A 4QSDA 1H3DA 1Y9UA 2B3FA 1EU8A 1QVSA 3S9NC 3T22A 2XXUA 1N7WA 3H4ZA 3ZSFA 4Z7EA 1XC1A 4N13A 5I2NB 3FJ7A 5JK4A 1FTKA 3Q27A 4MLVA 2HAVA 1J1NA 4YKKA 3C34A 4TLMB 3Q26A 3I5OA 3H6VA 3CFLA 3K01A 3TZAA 4DXUA 4FEDA 3FJMA 3GZGA 3QAXA 1MY4A 1DPPA 2PT1A 1SI0A 2CMOA 3O66A 3OEMA 4RXLA 4XTCQ 3OD7A 5AA2A 3VXCA 2I48A 2Y7RA 2XX8A 2UVJA 2Y7WA 3KOTA 1B7HA 1JEUA 5K2XA 2D21A 1IUDA 1P1QA 1PB7A 3K6VA 1ZLQA 5EHSA 4EF2A 2CZLA 5I2KA 1VFEA 4U4XA 3ECRA 4KI0E 5DEXB 1HSJA 4E0XA 1LB9A 2QL3A 1MH4A 2R9JA 3QYTA 1UQWA 4PFUA 1DSNA 1LAHE 3D4CA 4H6DA 3T9XB 3ODBA 2F7BA 5H8FA 3PUZE 1EH3A 3QUJA 4Q8RA 1VFDA 5TP9A 1Y1MA 2G29A 2XXRA 5IAIA 3KFMA 2Q88A 1R1NA 4DCXA 3EHTA 3S2VA 4XKRA 2QMWA 5KDTA 1JVYA 1WVJA 1O63A 4RK2A 4C0RA 2ZNSA 5ICQA 1N04A 4H0WA 2O51A 4RJZA 3RTFB 4NF6A 4DXCA 2FA7A 3B6WA 3GXAA 4P0IA 3O6HA 4ND9A 4QF9A 2O1LA 1URGA 3U1OA 2PX1A 4C1UA 4G8NA 3LSXA 4OQOA 4QFLA 2ZMBA 5H8SA 2Q8JA 1N7XA 1R6ZA 2H25A 4R72A 2HCAA 4K3FA 1HSLA 4OFJA 3RT6B 1JNFA 3SESA 5AA4A 1UTHA 3MVWA 5B70A 3A3CA 4IY6A 4KHZE 2X26A 2G93A 4H5FA 2ZNTA 1MY2A 1USYE 4NMYA 1SDXA 2I3VA 1TWYA 1B4HA 1MPCA 3K1NA 3PD9A 4YKPA 2H5YA 4IO3A 3OO9A 4R2FA 3FD3A 5TPAB 5DEXA 3TTRA 4LQ2A 3RGYA 2HZLA 3MQ9A 3TKDA 2FNCA 3A3UA 3OELA 2GH9A 2NXOA 1MXZA 2XXPA 2GHAA 4YAHX 1SW1A 1Y3PA 3RUMA 1SI1A 2QS1A 4PE5B 4Q0CA 4BDRA 2DWIA 1DOTA 2ZYNA 3L6GA 3C9HA 4LP2B 3MZ9A 2AYSA 5HPQA 2ANJA 4YICA 1B40A 1UIVA 3HO7A 3BFTA 3V89B 1DMBA 3O97A 1FQBA 3M3FA 1ZJLA 4GQOA 3IX1A 3TYHA 1FQFA 4F19A 4ZE9A 1LGBC 1I6QA 3S9EA 5ITPA 1H76A 4R9GA 4H5GA 4R75A 1LLSA 3C31A 2I49A 3MUQA 2AL5A 3O28A 4XKQA 3RPWA 1XVXA 2DE3A 3TDJA 3RTWB 2V3QA 5I58B 1MPBA 1LCTA 3IL1B 2QPQA 4OYVA 5EHMA 1B05A 1N3XA 3PPOA 4PFWA 3TQLA 3TCFA 1S50A 3M8UA 4NF8A 3CIJA 1JQFA 1NKXA 1AH5A 2XXIA 4GWOA 4JWOA 1IEJA 1XOCA 4QFKA 3VVDA 3ZKKA 1IXHA 3R7XA 3E9XA 4GL0A 4OWDA 4XKNA 1LFGA 4GL8A 1MXXA 5H8FB 2UVHA 1Y3QA 4ELOA 4FIMA 4JSDA 2VHAA 3K6WA 1UTBA 3TPAA 4I62A 1BKAA 2PYYA 4IB2A 4NF8B 4ELPA 2GFEA 4IO4A 4R73A 1MM6A 5KDTB 1YTVA 3N26A 4THIA 5I56A 3KZGA 1OQHA 3MBPA 2DE4A 3CI8A 1B6HA 2XXXA 2F36A 3PPNA 4H67A 4ZZAA 1MQDA 5FHNA 4RY1A 3QUFA 2ZNUA 3VLUA 4DZ1A 2I58A 1OQGA 4ESWA 3U93A 4EQ9A 3JV9A 4OHNA 2IA4A 4ZZEA 1XT8A 2HZKA 5CMKA 1AIVA 4KYSA 1B9JA 5H8QA 4NE4A 1XS5A 3UP9A 2E1SA 1NL5A 5L8DA 1VR5A 1MDP1 3FVGA 4IGRA 4NF6B 1B58A 1GV8A 2NWJA 4EQ7A 4YZZA 1EZOA 3K1MA 1I69A 2ONKE 5AE4A 1B5IA 5I59B 3SEXA 4N6PA 4AB6A 1Q1KA 1MQGA 3K0VA 4RYAA 3RT8A 1B2HA 3E3KA 3LSWA 4PFYA 3T96B 1RKMA 2F97A 1B5JA 3DM0A 2XXVA 3OSQA 3H6WA 4R9FA 2OZZA 2QS3A 3JZJA 4NWDA 5EYFA 2VD2A 5L9OA 4IO2A 5L9MA 3TTKA 4YB6A 3PUWE 2PVUA 3WAEA 4JWXA 4OENA 4EQBA 4EXLA 1ZTYA 2E0SA 3KEIA 3FVNA 4UA8A 2DQVA 2F34A 2Q2AA 2ZYMA 5DVJA 1I6BA 3I6VA 4G8MA 3PUXE 2I4BA 3FATA 3ZS6A 1PEBA 2XXHA 1SYHA 3PGFA 3TCHA 4HS7A 2P1SA 3KJTA 3O29A 4RA1A 2I3WA 5CI5A 4HW8A 1MPDA 5BUUA 5L9SA 1N76A 3PMWA 2RF1A 3B6TA 3S9LC 3QIMA 2Q9TA 1UTHB 2VOZA 4ZEDA 3K00A 1B0HA 2VP1A 3IOUA 3MPKA 4IY5A 3TODA 4DCYA 3B7DA 3MP6A 3O6GA 1OLCA 3SDFA 2QRYA 2PMSA 5KCJB 1F9BA 1TT1A 4NTLA 3MPLA 4PETA 4POXA 4R6HA 3IK6B 3G3HA 1QKAA 3OEKA 3VXBA 3KJ7A 1NH7A 3H6UA 3UGWA 5AA2B 2QSXA 1Y1ZA 1FQDA 1UIUA 2HEUA 1OLAA 3LSFB 5DVIA 5I57B 3CFZA 2ESNA 1OVBA 2ZXTA 4EF1A 3A09A 1LCFA 3MJNA 1OVTA 1SVXB 4O3BA 4PQJA 3IO4A 4XIGQ 4ZEBA 5HM4B 1B1XA 1PB9A 5B7DA 1MXUA 1US4A 5AA2D 2UXAA 4R6KA 3TFLA 1IXIA 1B3FA 1MY3A 2FYIA 1LAGE 4DXBA 3GBBA 2H98A 2P2AA 4ISUA 1B7UA 4JBZA 3RN8A 2Y7KA 3TAJA 4ESXA 2R71A 1B3LA 1QUKA 3Q29A 2ABHA 2DP8A 4QRZA 2LAOA 1JW1A 2ZYOA 2RCBA 2XX7A 4F1YA 2I0CA 2DXYA 2VD3A 4F3SA 5H8NB 1IXCA 1JW5A 5I58A 4QFOA 5J1DA 5I57A 3KSXA 4JWYA 4X48A 3MAMA 1D9VA 5FTHA 1USYH 4U23A 3TQWA 3FZVA 2F78A 2WKYA 3N6TA 1OMPA 4LUBA 5DT6A 3CSBA 3I3VA 2H99A 4R6YA 4WEDA 1DTZA 1WDNA 2Z8DA 3KN8A 2ALUA 3M3KA 4MFIA 1UTBB 5ISUA 2DS9A 4F18A 1AMFA 1MXVA 4FORA 1FCKA 4IO6A 4LA9A 3F11A 4JXIA 4MLQA 4WEPA 2V3UA 3OO6A 5DTBA 3UN6A 2A5TB 1PDAA 2O68A 3OENA 3Q28A 1DPEA 4LONB 1OIBA 2NOOA 2XX9A 2XXQA 4G77A 4GF8A 4JSOA 1S9TA 1RYXA 2RKMA 1MQIA 5F1QA 2OWSA 4BDOA 3OO8A 2R6GE 3H7MA 1P1NA 4QSEA 3CFXA 1LFIA 4LZ5A 4OTEA 4X9TA 3CSGA 4XKPA 4E0WA 5I59A 2HXWA 5ICTA 2QMXA 1B52A 5I84A 1TFAA 3GLBA 1JVXA 2XXTA 4ELQA 3UK4A 3VE1B 1EZPA 3FUZA 3KSJA 5BWJA 2B3BA 1QJMA 4IO7A 1QKBA 3IJXB 2Y7IA 4QHQA 4Z0IA 3CRBA 1LAFE 3G3IA 2BJJX 3G3GA 4ONYA 3EHSA 3ILTB 1MDQA 1A8FA 1N0TA 1YAEA 2O7IA 4U1OA 4LZ8A 4ELRA 1POY1 5CC2A 1FTJA 1CB6A 1LBBA 2GRVA 3FVKA 5H8HB 1LB8A 4P11A 3JYRA 4F22A 1PBQA 3MP8A 2ONRA 3DLNA 4QSCA 4DIGA 2A5SA 2HFBA 3O6IA 3O9PA 4FJPA 5KCJA 3G3FA 3UA8A 1R9QA 1Y4CA 2VGQA 3IO6A 3MVZA 4OXVA 1EZ9A 1ZIUA 2O1MA 3FVOA 4QFNA 3HV1A 3K6UA 3TELA 4EDPA 1DTGA 4YB7A 4OEVA 4GRKA 1TFDA 1SW2A 4LZ7A 1B7ZA 1CE2A 3C4MA 4NF4A 2DYXA 2RC8A 1ANFA 4I8CA 2UVGA 4ZECA 3V8XB 2AIXA 3G3KA 3RLFE 1Q35A 2O7UA 3QK6A 2IEEA 2UYFA 1B51A 1A7LA 3O2AA 2DWAA 3MVYA 4G68A 4G8HA 1FW0A 4GIZA 4GVOA 4UACA 4X1BA 1GGGA 2YLNA 4ZEIA 1MG1A 4TLLB 1B1HA 3RY3A 4NEDA 4XXUA 1SW4A 4GFRA 4O3AA 1B46A 3KOSA 3BKIB 3TTLA 4P0GA 1WODA 3G3JA 3MVXA 4NF4B 1IZ1A 3CG1A 3CG3A 3V5AA 3IOTA 4I9DA 4KCDA 4KYEA 4U2RA 2NVUB 4AB5A 5CRYA 4H8JA 3ONMA 3U94A 3T66A 5LOMA 3LR1A 3TUSA 2I0BA 1B5HA 3H3GA 3TMGA 4U1ZA 3KN7A 1ATGA 5JTYB 3PPPA 5K2YA 4BLAA 4DDDA 4Q30B 4U22A 3MZ1A 2A5TA 5ITOA 1SQYA 3HN0A 4H8IA 3BFUA 1Z7NE 2H9BA 1R9LA 5AA4B 4OERA 1N84A 4IO5A 3FXUA 2REGA 3OOAA 2Q89A 4ZEFA 3IB1A 2DE2A 3EQ1A 3EHUA 3MC2A 4FECA 3VLWA 1FTLA 3M3LA 1B0LA 2D5WA 2I4CA 3L6HA 1QUIA 3USDA 4F29A 4NF5B 2D3IA 3THIA 1M5CA 2V93A 2V25A 3MWBA 1P1OA 1Y20A 4MBPA 2XD3A 4FE8A 2Z8FA 3KGCA 4KFQA 3H03A 4WKMA 1TXFA 3D4GA 4BDLA 5CM6A 1MM7A 3FXQA 2RCAA 3T9HB 5I56B 1KWHA 4I1DA 4YB5A 1URDA 3QSLA 3CR9A 4F3PA 4F3BA 2DSFA 1B3GA 2PBWA 2OCUA 2X7PA 3C33A 3E4RA 3IOVA 3Q25A 1H45A 4H65A 4HCYA 4EUOA 1IIWA 3K2DA 4GD5A 4F39A 3FGSA 1NH8A 3LUYA 3PMVA 4N07A 2P0SA 3H06B 4G68C 4F3GA 2XHDA 1LSTA 1II5A 3EF7A 4FEBA 4YKIA 2DOJA 2UYEA 4FAJA 4G2ZA 4YMAA 5KZTA 1D4NA 4KQPA 4OFOA 1GVCA 1IXGA 5IKBA 1YPNA 2DWJA 4HCWA 4KCCA 1MY1A 3PUVE 3T9VA 4RK9A 4BDNA 3PU5A 1ELJA 2I6EA 2ONSA 2Y84A 1SD3A 1GTKA 3OSRA 3SEYA 3VV5A 1FQAA 1SBPA 3W9WA 1D3KA 3TCGA 4YMBA 4C1TA 1POTA 1P1WA 4M4GA 1FTMA 3GBAA 3S4UA 3OXNA 1PC3A 1VE4A 1H43A 3KN3A 3UORA 1ZBMA 1NNFA 1O64A 3FXRA 4BDQA 1P99A 1L5TA 1XHYA 3DELB 1MQJA 5TU0A 3VVEA 1AOVA 3S9MC 1GR2A 1PBPA 3ZKLA 5FHOA 2YPNA 3FIRA 4GXAA 2RC9A 1RYOA 3P7IA 4TOZA 4U4SA 4WXJA 3RNNA 4ECFA 5CBRA 1M5BA 1ZMGA 2QJEA 2V3TA 4KD5A 2F7AA 4HTGA 1M5EA 5DVFA 3U72A 1YCJA 1SYIA 3SERA 3K02A 1MXWA 1MXYA 1BLFA 3K6XA 4YU0A 1B4ZA 4ZE8A 3RQTA 2HAUA 2AL4A 3SEVA 1I6AA 1P1UA 2O84X 3K1PA 3R6UA 4TQUQ 4KPTA 3KBRA 1JEVA 1XVYA 4NWCA 4OVJA 1QULA 4ZEKA 3TEPA 4F31B 1MQHA 3HHGA 3N5LA 1FQEA 4OMBA 1LBCA 1MRPA 1VSOA 5CBSA 4QFPA 3V83A 3MZBA 1AL3A 1MY0A 3HPIA 4LATA 1B3EA 2OJTA 2Z23A 3IAZA 1T0KA 3UIFA 4F1VA 2O6AA 1B32A 1M5DA 4H1XA 5FTIA 3SEUA 5A5XB 3PPRA 5I2NA 4OETA 4M1VA 4GOTA 4EXKA 3PV0E 1JW4A 5H8QB 4F2OA 2F8DA 5CMBA 3C36A 3ILUB 3IOWA 2Q2CA 4KR5A 3B6QA 4LVQA 3W9VA 4PFTA 3N6UA 3MP1A 3TTMA 4DLDA 1IQ7A 2F6PA 3BBRA 4BDMA 4R2BA 1PB8A 2F6GA
chains in the Genus database with same CATH superfamily
1FJ9A 2DXRA 5H8NA 1ZU0A 2OK2A 1EYJA 1S7YA 3T93B 3CHGA 1Y3NA 2DVCA 3FV1A 1HSEA 4XEQA 4MH5A 3LBSA 3WAFA 2THIA 4MIJA 1URSA 1FTOA 2DVZA 1A54A 1FTAA 5JEIA 2O69A 1DCUA 4G68B 4DE8A 1LBWA 4MAGA 3U92A 2PT2A 2X7QA 4OEUA 3H6TA 4OZ9A 2KLFA 1FBGA 3SETA 4N8YA 1NNKA 5M2VA 5I2KB 1FQCA 4U21A 5IZ3B 1FPIA 3KG2A 4IGTA 3PUYE 5FHMA 4NF5A 4DI3D 2ZZXA 3FJGA 5CMMA 2W7YA 3VLVA 2OLBA 5JTYA 5DYHA 5F7VA 4GLIA 3OO7A 1Y9UA 3S9NC 1N7WA 1FTKA 4PC9A 4TLMB 3TZAA 4FEDA 3QAXA 1DPPA 2I48A 2Y7RA 2XX8A 3KOTA 5K2XA 2D21A 1IUDA 5EHSA 1HSJA 1LB9A 2R9JA 1UQWA 3ODBA 5IAIA 1Y1MA 3S2VA 4RJZA 3RTFB 3GXAA 4P0IA 4ND9A 4G8NA 4OQOA 1LBXA 4QFLA 1BK4A 5H8SA 1N7XA 1R6ZA 4R72A 4K3FA 4OFJA 1UTHA 3MVWA 4H5FA 1SDXA 1TWYA 4IO3A 4R2FA 5TPAB 3MQ9A 3OELA 2NXOA 3RUMA 2GHAA 2DWIA 2ZYNA 3L6GA 3C9HA 4NAPA 2AYSA 2DDKA 2ANJA 1CNQA 4ZE9A 3IX1A 4PGPA 4H5GA 3RPWA 4MNPA 1LCTA 5EHMA 3PPOA 4PFWA 3TQLA 3TCFA 4F3PA 3CIJA 2XXIA 1K9ZA 3ZKKA 4OWDA 1FPEA 2ZZVA 2VHAA 3QMFA 4IB2A 4NF8B 1NV4A 3N26A 3KZGA 3MBPA 1B6HA 4H67A 2I58A 4OA4A 4EQ9A 4N6DA 2IA4A 5H8QA 4GBWA 1IMDA 1XS5A 3ROJA 4MEVA 5L8DA 2NWJA 1EZOA 1FBCA 3LSWA 4MJOA 1B5JA 3H6WA 4R9FA 4PF6A 4O94A 5L9MA 4YB6A 1ZTYA 2E0SA 1FBPA 4UA8A 4HS7A 5L9SA 3O29A 5BUUA 4XFEA 1N76A 3B6TA 3S9LC 2VOZA 1XI6A 3IOUA 4DCYA 2QRYA 2FIXA 5KCJB 5EQ7A 4R6HA 3IK6B 1FPKA 2QSXA 1FQDA 3LSFB 4GWWA 4O7IA 4XIGQ 4PQJA 5B7DA 1D9QA 4GWYA 2UXAA 1MY3A 2FYIA 1LAGE 2H98A 4ISUA 2Y7KA 2LAOA 2RCBA 2XX7A 2I0CA 4F3SA 5I58A 4QFOA 3KSXA 4U23A 2F78A 4OVQA 4IR8A 3CSBA 4MMPA 5ISUA 1MXVA 4MLQA 4LA9A 3ISPA 1OIBA 2NOOA 4JSOA 4GF8A 2RKMA 3H7MA 3CFXA 4HE1A 4LZ5A 4OTEA 3CSGA 4XKPA 2HXWA 5ICTA 5I84A 2P3VA 2QVUA 3UK4A 4IO7A 1RDZA 2CEYA 3CRBA 2BJJX 1N0TA 1YAEA 4U1OA 1FTJA 1CB6A 2GRVA 3JYRA 3MP8A 4QSCA 5ET7A 3IO6A 4OXVA 4GWXA 3FVOA 3HV1A 3TELA 4OEVA 4LZ7A 1B7ZA 3C4MA 1KA0A 1ANFA 3HFUA 3RLFE 1Q35A 3QK6A 1B51A 4G8HA 4GIZA 4MBPA 4JVCA 3TQWA 1QGXA 4ZEIA 3RY3A 4XXUA 4GFRA 1WODA 1Q9DA 3G3JA 3CG3A 3V5AA 4G61A 4PE3A 5LOMA 3TUSA 1B5HA 2F3DA 1NV5A 4NX1A 4OVRA 1N84A 4FECA 1FTLA 3M3LA 1B0LA 2I4CA 4MCOA 3USDA 3THIA 1M5CA 3MWBA 2V25A 1Y20A 4WKMA 3D4GA 3CR9A 4F3BA 2DSFA 1B3GA 2PBWA 3E4RA 4PBHA 3FGSA 2XHDA 1LSTA 3EF7A 4FEBA 4G2ZA 4YMAA 4KQPA 3T9VA 4BDNA 3SEYA 2Y84A 3W9WA 1FQAA 1FTMA 1FPFA 1XHYA 1AOVA 1MQJA 3S9MC 2RC9A 4WXJA 1ZMGA 4GX4A 1FPJA 4YU0A 1BLFA 4ZE8A 3RQTA 4KPTA 3TEPA 1JEVA 4F31B 1FQEA 1NV2A 4NQ8A 3MZBA 2OJTA 2Z23A 4UABA 2O6AA 1M5DA 5FTIA 3T0JA 4OETA 1KZ8A 3C36A 3IOWA 4LVQA 1IQ7A 2F6GA 5F24A 4OFLA 4GXSB 3VDFA 4Q5TA 2Q8MA 1KA1A 3IR1A 3SZPA 3FV2A 1H44A 4KYDA 2V84A 1Z7ME 2WYKA 2QS2A 1US5A 3HHFA 1BIYA 1NFTA 1LFHA 3IB0A 2OBGA 3RYDA 2Y7PA 4OESA 3NOHA 5AA3A 2M8CA 1NMUA 4ZDMA 2Y5KA 2GHBA 3AXFA 4LQ5A 1BTJA 2ZYKA 4RNSA 3EN3A 1A8EA 3C32A 5AA1A 2YJPA 1NNPA 3IORA 4POWA 3G7WA 1EU8A 3H4ZA 3ZSFA 5I2NB 3Q26A 4DXUA 2B4MA 1MY4A 2PT1A 4RXLA 2CMOA 2KQZA 1B7HA 1JEUA 1PB7A 5I2KA 2QVVA 4U4XA 3T9XB 5H8FA 1EH3A 3QUJA 1VFDA 3KFMA 4XKRA 1O63A 4RK2A 4H0WA 2O51A 3B6WA 4QF9A 2PX1A 4C1UA 3LUZA 4N17A 2ZMBA 1NUWA 2X26A 3LV0A 5I3SA 1USYE 4NMYA 2I3VA 1MPCA 1NV7A 3RGYA 3A3UA 3RPLB 1SW1A 2QS1A 4LP2B 1UIVA 3HO7A 3BFTA 3V89B 4GQOA 3TYHA 1LGBC 4R9GA 4R75A 3O28A 4XKQA 5I58B 3IL1B 1FJ6A 1N3XA 1S50A 4GWOA 4JWOA 1IEJA 1XOCA 3KC1A 3FBPA 3R7XA 3E9XA 4GL0A 4OVPA 1MXXA 5H8FB 2JJKA 4JSDA 4H45A 3TPAA 4I62A 1BKAA 4ELPA 4QBAA 4IO4A 3CI8A 3PPNA 1MQDA 5FHNA 3VLUA 4DZ1A 4X04A 4ESWA 4KYSA 2E1SA 4NF6B 1MDP1 4YZZA 2CZHA 5AE4A 5EYGA 1Q1KA 1EYIA 2F3BA 3RT8A 1B2HA 4PFIA 5ET6A 1LBYA 3JZJA 4NWDA 4GX3A 5L9OA 3PUWE 4EQBA 1YYZA 5TU0A 3FVNA 1K9YA 3I6VA 2I4BA 3FATA 3ZS6A 1PEBA 1SYHA 3TCHA 4RA1A 3QIMA 4ZEDA 3K00A 2VP1A 3TODA 3B7DA 3SDFA 1F9BA 4POXA 3MYUA 1QKAA 3KJ7A 4NF0A 5DVIA 1OLAA 5I57B 2ESNA 1OVBA 1SPIA 2ZXTA 3A09A 3MJNA 1OVTA 1MXUA 5AA2D 4R6KA 4P8BA 3GBBA 1B7UA 4JBZA 1B3LA 3Q29A 2DP8A 5EQ8A 2ZYOA 2VD3A 1IXCA 1JW5A 4X48A 1USYH 3N6TA 5DT6A 4WEDA 1WDNA 4MFIA 4NG7A 1AMFA 4FORA 1FCKA 4JXIA 3VV5A 2A5TB 2O68A 3OENA 2XX9A 4BDOA 3OO8A 4QSEA 1LFIA 1NUZA 1TFAA 1JVXA 2XXTA 5BWJA 2B3BA 1QJMA 4PTKA 3G3IA 4HE0A 4N81A 2WBBA 4PAFA 4P47A 4ELRA 2O7IA 3MSTA 1POY1 1LBBA 2ONRA 3DLNA 2VGQA 1Y4CA 2XWVA 5LDZA 2WBDA 4EDPA 1RDXA 1TFDA 1SW2A 1CE2A 2PCRA 4NF4A 3V8XB 1IMFA 3O2AA 4G68A 4UACA 2VPNA 1GGGA 1MG1A 2FIEA 4NEDA 4P0GA 1IZ1A 3IOTA 4U2RA 3U94A 2Y5LA 4PAKA 3TMGA 1ATGA 5K2YA 4BLAA 4U22A 1SQYA 4IO5A 2REGA 3EQ1A 2XD3A 4BDLA 1TXFA 2XWKA 5I56B 4I1DA 2X7PA 2OCUA 4GD5A 4MNIA 1IMCA 3PMVA 4N07A 2P0SA 3H06B 4G68C 2DOJA 4FAJA 5KZTA 4GWUA 1GVCA 1YPNA 2DWJA 3OSRA 2ONSA 1SBPA 1D3KA 2WX9A 3TCGA 4YMBA 1POTA 3OXNA 1PC3A 3KN3A 3UORA 1NNFA 3FXRA 2MKZA 3DELB 1PBPA 4GWZA 1DK4A 2QJEA 2F7AA 3U72A 1YCJA 1MXYA 3SEVA 1I6AA 3KBRA 1QULA 3N5LA 4OMBA 5CBSA 3GYYA 3V83A 1AL3A 1MY0A 4LATA 3IAZA 4H1XA 5I2NA 4EXKA 5H8QB 4KR5A 3B6QA 3IFAA 3W9VA 4PFTA 3N6UA 3TTMA 3U65A 4BDMA 1PB8A 1AWBA 3DP8A 3IJOB 5A5LA 1A99A 3HSTA 2RINA 2B65A 5HBCA 2Q74A 2HQ0A 4ZS9A 4O8MA 1LAXA 2F5XA 4YKJA 3KC0A 3IFCA 4PP0A 2QS4A 2Z8EA 2RC7A 2DWHA 1D9YA 5A5XA 2REJA 3OMBA 2NUVA 3LC8A 3MW0A 4N8GA 4P3LA 1JETA 3LSLA 3W15C 1MS7A 4MF3A 2XXYA 1B3HA 1A40A 2OWTA 3K4UA 5H8HA 3QXMA 1SW5A 3TTNA 4MNCA 2XWOA 4OVSA 3C35A 1N3WA 3HCQA 1H3DA 2B3FA 1QVSA 2XXUA 2GQ1A 1XC1A 1G0IA 4N13A 3FJ7A 5JK4A 3I5OA 3H6VA 4LN5A 3K01A 3FJMA 3GZGA 4XTCQ 3O66A 3OEMA 5AA2A 3OD7A 3VXCA 1P1QA 3K6VA 1ZLQA 3BIGA 2CZLA 4KI0E 5DEXB 4AS5A 1MH4A 1DSNA 3D4CA 4H6DA 1NUYA 4PCDA 2Q88A 1R1NA 4DCXA 5KDTA 2QMWA 1WVJA 4C0RA 2ZNSA 4AS4A 4NF6A 2FA7A 3RPLA 2O1LA 1URGA 3LSXA 2H25A 2HCAA 3SESA 1HSLA 1JNFA 5FBPA 3A3CA 4KHZE 2G93A 2ZNTA 1MY2A 4P56A 3PD9A 4YKPA 2H5YA 3OO9A 3FD3A 3TTRA 1NV6A 2HZLA 2FNCA 2GH9A 1MXZA 1DOTA 3MZ9A 4YICA 1B40A 1FQBA 1ZJLA 4GBVA 1I6QA 3S9EA 5ITPA 1H76A 1RDYA 3MUQA 2AL5A 5IZ3A 1XVXA 3RTWB 2L5VA 4OYVA 1B05A 3M8UA 1NKXA 5ICQA 1AH5A 4QFKA 2FHYA 3VVDA 1LFGA 4GL8A 2UVHA 2PYYA 2GFEA 1YTVA 4THIA 5I56A 2DE4A 2XXXA 2F36A 3EKIA 1OQGA 4PF8A 3U93A 3JV9A 4OHNA 2HZKA 1AIVA 4NE4A 1NL5A 1VR5A 3FVGA 3A29A 1B58A 1FPLA 1I69A 2ONKE 1B5IA 4I40A 3SEXA 4N6PA 1MQGA 2HXRA 4RYAA 3E3KA 3T96B 1RKMA 2OZZA 1FPBA 5EYFA 2VD2A 3TTKA 3WAEA 4OENA 1VDWA 2DQVA 2F34A 2Q2AA 2ZYMA 5DVJA 1I6BA 3PTYA 5T3JA 3PUXE 3UA8A 1FBHA 5I5PA 2XXHA 3PGFA 3B8BA 4HW8A 1MPDA 3PMWA 2RF1A 4KXPA 1UTHB 5ET5A 4NGUA 1B0HA 2QFLA 4DI4B 3FXBA 2PMSA 2R8TA 2CZIA 3MPLA 3OEKA 4GX6A 3VXBA 5AA2B 1NH7A 3UGWA 4N15A 1Y1ZA 1LCFA 4O3BA 5HM4B 1PB9A 3TFLA 1FPGA 4DXBA 3TAJA 2R71A 1QUKA 2ABHA 5IZ1A 4F1YA 5H8NB 3MAMA 5FTHA 4LUBA 5EQAA 3M3KA 1NI9A 1UTBB 2WEFA 4F18A 4O7MA 3F11A 2HHMA 2V3UA 1PDAA 3Q28A 4LONB 2XXQA 4F29A 4G77A 1RYXA 2R6GE 1P1NA 2PFYA 4ELQA 3VE1B 1EZPA 3FUZA 3KSJA 3IJXB 2Y7IA 4QHQA 4Z0IA 1LAFE 4ONYA 3FVKA 5I7IA 4P11A 4F22A 1PBQA 4DIGA 1JP4A 3O9PA 1R9QA 1EZ9A 1ZIUA 4QFNA 4GRKA 2DYXA 2RC8A 4ZECA 2AIXA 2O7UA 1FPDA 4GVOA 1FW0A 2YLNA 1IMEA 1SW4A 4O3AA 1B46A 3KOSA 5IM2A 4AB5A 2I0BA 3KBZA 4U1ZA 5IZZA 3MZ1A 4P1EA 1G0HA 3HN0A 4HE2A 4H8IA 3BFUA 1Z7NE 1R9LA 4N4UA 1EYKA 3MC2A 3VLWA 2D5WA 4NF5B 1P1OA 3D1RA 4FE8A 2RCAA 4YB5A 1URDA 2HPGA 3QSLA 4H65A 4HCYA 1H45A 4EUOA 3K2DA 4F39A 4F3GA 4YKIA 4I3YA 2UYEA 5DW8A 1D4NA 4OFOA 1IXGA 4N91A 4HCWA 5IKBA 4KCCA 1MY1A 2B4LA 1GTKA 4C1TA 3S4UA 1P1WA 2CEXA 4M4GA 1O64A 1L5TA 1GR2A 3FIRA 3RNNA 4GXAA 3P7IA 5CBRA 1M5BA 4KD5A 4HTGA 5DVFA 3SERA 3K02A 1MXWA 2AL4A 1P1UA 2O84X 4ZEKA 4OVJA 1MQHA 1MRPA 1NV1A 4PDDA 3BIHA 3UIFA 1B32A 3SEUA 4M1VA 4GOTA 3PV0E 1JW4A 2ZZWA 4F2OA 2F8DA 5CMBA 1IMAA 3ILUB 3MP1A 4PAIA 3BBRA 4R2BA 3DP6A 3PMXA 2UVIA 1IITA 1BP5A 3E13X 5TP9B 4AQ4A 1ZKBA 4P9KA 3CVGA 3DP4A 3SEWA 4MX6A 2F35A 4G4PA 4FATA 4RPOA 4JB7A 4FBPA 1Y4TA 4JDFA 1MH3A 2XXKA 3EPEA 4RPNA 2XD2A 4O3CA 2VPOA 2H4IA 3N94A 4L17A 4MHFA 5ELVA 4R74A 3PD8A 1M5FA 3U8QA 1O7TA 3IB2A 5CMCA 3E78A 1QW0A 2F7CA 3VVFA 3PPQA 1QUJA 3FASA 3R26A 3T9UA 4F1UA 4X1DA 5TPAA 3VFJA 2Z22A 1A55A 1FBEA 3SKPA 4F2QA 2XXWA 4QSDA 1NNTA 3T1BA 3T22A 4Z7EA 3Q27A 4MLVA 2HAVA 1J1NA 4YKKA 3C34A 1IMBA 3CFLA 1SI0A 2UVJA 2Y7WA 4EF2A 1VFEA 4E0XA 1YXIA 3ECRA 2QL3A 3QYTA 4PFUA 1LAHE 2V4CA 2F7BA 3PUZE 4Q8RA 5LTCA 5EQ9A 5TP9A 2G29A 2XXRA 3EHTA 4PDHA 4N6KA 1JVYA 4P1LA 4PFBA 1N04A 2P3NA 4DXCA 3O6HA 3U1OA 2Q8JA 5AA4A 3RT6B 5B70A 4IY6A 1B4HA 3K1NA 5DEXA 2VT5A 4LQ2A 3TKDA 2XXPA 1Y3PA 1SI1A 4PE5B 4Q0CA 4BDRA 5HPQA 1DMBA 3O97A 3M3FA 1FSAA 1FQFA 4F19A 1LLSA 3C31A 2I49A 2DE3A 3TDJA 2V3QA 1MPBA 2QPQA 4NF8A 1JQFA 1IXHA 4XKNA 1Y3QA 4FIMA 3K6WA 1UTBA 4R73A 1MM6A 5KDTB 2WYPA 1OQHA 4ZZAA 4RY1A 3QUFA 2ZNUA 1LBVA 4ZZEA 1XT8A 5CMKA 1B9JA 5ESYA 3UP9A 4EXLA 4IGRA 4XF5A 4EQ7A 5EYHA 3K1MA 5I59B 4AB6A 3K0VA 4OANA 4PFYA 2F97A 3DM0A 2XXVA 3OSQA 2QS3A 4IO2A 2PVUA 1NUXA 4JWXA 3KEIA 4G8MA 2P1SA 3KJTA 5CI5A 2I3WA 2Q9TA 4IY5A 3MPKA 1YZ0A 3MP6A 3O6GA 1OLCA 1TT1A 4NTLA 4PETA 4PGNA 3G3HA 4H46A 4NN3A 3H6UA 2HEUA 1UIUA 4X8RA 3CFZA 4EF1A 1GV8A 1SVXB 3IO4A 4ZEBA 1B1XA 2XA5A 1US4A 1IXIA 1B3FA 4OVTA 2P2AA 3RN8A 2OWZA 4QXDA 4QRZA 1JW1A 5J1DA 2DXYA 5I57A 4JWYA 1D9VA 1INPA 3FZVA 2BJIA 2WKYA 1OMPA 3I3VA 4R6YA 2H99A 1DTZA 2Z8DA 3KN8A 2ALUA 2DS9A 4PFRA 4WEPA 5DTBA 4IO6A 3UN6A 4ESXA 3OO6A 3E79A 1DPEA 5F1QA 1S9TA 4DLDA 2QVRA 1MQIA 2OWSA 4X9TA 4E0WA 5I59A 2QMXA 1B52A 3GLBA 2FVZA 1FBDA 1QKBA 3G3GA 3EHSA 3ILTB 1MDQA 1A8FA 4LZ8A 5CC2A 5IGAA 5H8HB 1LB8A 2CZKA 2A5SA 2HFBA 3O6IA 4FJPA 5KCJA 3G3FA 3MVZA 2O1MA 3K6UA 1DTGA 4YB7A 1FBFA 1NV3A 2PFZA 4JVIA 4I8CA 2UVGA 3G3KA 1LBZA 2IEEA 2UYFA 4YAHX 1A7LA 2DWAA 3MVYA 4X1BA 4TLLB 1B1HA 3BKIB 3TTLA 3MVXA 4NF4B 3CG1A 4I9DA 4KCDA 4KYEA 2NVUB 5CRYA 4H8JA 3ONMA 3T66A 4JVDA 3LR1A 3H3GA 3KN7A 5JTYB 3PPPA 4DDDA 4Q30B 2A5TA 5ITOA 2H9BA 5AA4B 4OERA 3FXUA 4ZEFA 3OOAA 2Q89A 3IB1A 2DE2A 4NHBA 3EHUA 3L6HA 1QUIA 2D3IA 2V93A 2Z8FA 3KGCA 4KFQA 3H03A 5CM6A 3B50A 1MM7A 3FXQA 2FBPA 3T9HB 4PBQA 1KWHA 3C33A 3Q25A 3IOVA 1IIWA 1NH8A 3LUYA 4HXVA 1NV0A 4GWSA 1FRPA 1II5A 2OX3A 4ELOA 3PUVE 4RK9A 3PU5A 1ELJA 2I6EA 1SD3A 4I3EA 3GBAA 1VE4A 1H43A 1ZBMA 4BDQA 1P99A 1LEVA 3VVEA 3ZKLA 5FHOA 2YPNA 4TOZA 4U4SA 1RYOA 4ECFA 2V3TA 5J16A 1M5EA 1SYIA 2KR0A 3K6XA 1B4ZA 2HAUA 3R6UA 4TQUQ 3K1PA 1XVYA 4NWCA 3HHGA 1DBZA 1LBCA 1VSOA 4QFPA 3HPIA 1B3EA 1T0KA 4F1VA 5ET8A 5A5XB 3PPRA 2Q2CA 2F6PA 2XWIA
chains in the Genus database with same CATH topology
2DXRA 3DP6A 3PMXA 2UVIA 1IITA 3DP8A 5H8NA 1ZU0A 2OK2A 4OFLA 1BP5A 3E13X 3IJOB 5TP9B 4GXSB 1A99A 3VDFA 3HSTA 2RINA 1S7YA 2B65A 1ZKBA 4Q5TA 1Y3NA 5HBCA 3T93B 4AQ4A 2DVCA 3FV1A 1HSEA 3IR1A 2HQ0A 3CVGA 3FV2A 1H44A 4KYDA 3DP4A 3LBSA 4MH5A 2V84A 1Z7ME 4ZS9A 3SEWA 2F35A 3WAFA 2QS2A 1US5A 2THIA 1BIYA 1LAXA 2F5XA 1NFTA 3HHFA 1URSA 4G4PA 4RPOA 1FTOA 4FATA 4YKJA 1LFHA 2DVZA 1A54A 5JEIA 2O69A 3IB0A 2OBGA 4JB7A 4G68B 4DE8A 1Y4TA 2Y7PA 4PP0A 2QS4A 3U92A 4OESA 2Z8EA 2RC7A 2DWHA 1D9YA 5AA3A 5A5XA 2PT2A 2M8CA 4JDFA 2REJA 2X7QA 1MH3A 1NMUA 3EPEA 2NUVA 3OMBA 4OEUA 3LC8A 2XD2A 4RPNA 3H6TA 4ZDMA 3MW0A 4O3CA 4OZ9A 2H4IA 2GHBA 2KLFA 3AXFA 3N94A 4L17A 4LQ5A 1BTJA 5ELVA 1JETA 2ZYKA 3LSLA 3SETA 3W15C 1MS7A 4MF3A 3PD8A 4R74A 2XXYA 1M5FA 1NNKA 4RNSA 5M2VA 1O7TA 3U8QA 5I2KB 1B3HA 3IB2A 1FQCA 5CMCA 1A40A 1QW0A 2F7CA 3VVFA 3PPQA 2OWTA 1QUJA 3EN3A 3FASA 3K4UA 3R26A 4U21A 5H8HA 1A8EA 3T9UA 4F1UA 3QXMA 1SW5A 3KG2A 4IGTA 3PUYE 5FHMA 3TTNA 4NF5A 3FJGA 3C32A 5CMMA 4X1DA 5AA1A 2YJPA 2W7YA 3C35A 5TPAA 1NNPA 2OLBA 3VLVA 5JTYA 1N3WA 2Z22A 5DYHA 3IORA 5F7VA 4POWA 3VFJA 1A55A 3HCQA 4GLIA 3SKPA 4F2QA 2XXWA 3G7WA 1NNTA 3OO7A 4QSDA 1H3DA 1Y9UA 2B3FA 1EU8A 1QVSA 3S9NC 3T22A 2XXUA 1N7WA 3H4ZA 3ZSFA 4Z7EA 1XC1A 4N13A 5I2NB 3FJ7A 5JK4A 1FTKA 3Q27A 4MLVA 2HAVA 1J1NA 4YKKA 3C34A 4TLMB 3Q26A 3I5OA 3H6VA 3CFLA 3K01A 3TZAA 4DXUA 4FEDA 3FJMA 3GZGA 3QAXA 1MY4A 1DPPA 2PT1A 1SI0A 2CMOA 3O66A 3OEMA 4RXLA 4XTCQ 3OD7A 5AA2A 3VXCA 2I48A 2Y7RA 2XX8A 2UVJA 2Y7WA 3KOTA 1B7HA 1JEUA 5K2XA 2D21A 1IUDA 1P1QA 1PB7A 3K6VA 1ZLQA 5EHSA 4EF2A 2CZLA 5I2KA 1VFEA 4U4XA 3ECRA 4KI0E 5DEXB 1HSJA 4E0XA 1LB9A 2QL3A 1MH4A 2R9JA 3QYTA 1UQWA 4PFUA 1DSNA 1LAHE 3D4CA 4H6DA 3T9XB 3ODBA 2F7BA 5H8FA 3PUZE 1EH3A 3QUJA 4Q8RA 1VFDA 5TP9A 1Y1MA 2G29A 2XXRA 5IAIA 3KFMA 2Q88A 1R1NA 4DCXA 3EHTA 3S2VA 4XKRA 2QMWA 5KDTA 1JVYA 1WVJA 1O63A 4RK2A 4C0RA 2ZNSA 5ICQA 1N04A 4H0WA 2O51A 4RJZA 3RTFB 4NF6A 4DXCA 2FA7A 3B6WA 3GXAA 4P0IA 3O6HA 4ND9A 4QF9A 2O1LA 1URGA 3U1OA 2PX1A 4C1UA 4G8NA 3LSXA 4OQOA 4QFLA 2ZMBA 5H8SA 2Q8JA 1N7XA 1R6ZA 2H25A 4R72A 2HCAA 4K3FA 1HSLA 4OFJA 3RT6B 1JNFA 3SESA 5AA4A 1UTHA 3MVWA 5B70A 3A3CA 4IY6A 4KHZE 2X26A 2G93A 4H5FA 2ZNTA 1MY2A 1USYE 4NMYA 1SDXA 2I3VA 1TWYA 1B4HA 1MPCA 3K1NA 3PD9A 4YKPA 2H5YA 4IO3A 3OO9A 4R2FA 3FD3A 5TPAB 5DEXA 3TTRA 4LQ2A 3RGYA 2HZLA 3MQ9A 3TKDA 2FNCA 3A3UA 3OELA 2GH9A 2NXOA 1MXZA 2XXPA 2GHAA 4YAHX 1SW1A 1Y3PA 3RUMA 1SI1A 2QS1A 4PE5B 4Q0CA 4BDRA 2DWIA 1DOTA 2ZYNA 3L6GA 3C9HA 4LP2B 3MZ9A 2AYSA 5HPQA 2ANJA 4YICA 1B40A 1UIVA 3HO7A 3BFTA 3V89B 1DMBA 3O97A 1FQBA 3M3FA 1ZJLA 4GQOA 3IX1A 3TYHA 1FQFA 4F19A 4ZE9A 1LGBC 1I6QA 3S9EA 5ITPA 1H76A 4R9GA 4H5GA 4R75A 1LLSA 3C31A 2I49A 3MUQA 2AL5A 3O28A 4XKQA 3RPWA 1XVXA 2DE3A 3TDJA 3RTWB 2V3QA 5I58B 1MPBA 1LCTA 3IL1B 2QPQA 4OYVA 5EHMA 1B05A 1N3XA 3PPOA 4PFWA 3TQLA 3TCFA 1S50A 3M8UA 4NF8A 3CIJA 1JQFA 1NKXA 1AH5A 2XXIA 4GWOA 4JWOA 1IEJA 1XOCA 4QFKA 3VVDA 3ZKKA 1IXHA 3R7XA 3E9XA 4GL0A 4OWDA 4XKNA 1LFGA 4GL8A 1MXXA 5H8FB 2UVHA 1Y3QA 4ELOA 4FIMA 4JSDA 2VHAA 3K6WA 1UTBA 3TPAA 4I62A 1BKAA 2PYYA 4IB2A 4NF8B 4ELPA 2GFEA 4IO4A 4R73A 1MM6A 5KDTB 1YTVA 3N26A 4THIA 5I56A 3KZGA 1OQHA 3MBPA 2DE4A 3CI8A 1B6HA 2XXXA 2F36A 3PPNA 4H67A 4ZZAA 1MQDA 5FHNA 4RY1A 3QUFA 2ZNUA 3VLUA 4DZ1A 2I58A 1OQGA 4ESWA 3U93A 4EQ9A 3JV9A 4OHNA 2IA4A 4ZZEA 1XT8A 2HZKA 5CMKA 1AIVA 4KYSA 1B9JA 5H8QA 4NE4A 1XS5A 3UP9A 2E1SA 1NL5A 5L8DA 1VR5A 1MDP1 3FVGA 4IGRA 4NF6B 1B58A 1GV8A 2NWJA 4EQ7A 4YZZA 1EZOA 3K1MA 1I69A 2ONKE 5AE4A 1B5IA 5I59B 3SEXA 4N6PA 4AB6A 1Q1KA 1MQGA 3K0VA 4RYAA 3RT8A 1B2HA 3E3KA 3LSWA 4PFYA 3T96B 1RKMA 2F97A 1B5JA 3DM0A 2XXVA 3OSQA 3H6WA 4R9FA 2OZZA 2QS3A 3JZJA 4NWDA 5EYFA 2VD2A 5L9OA 4IO2A 5L9MA 3TTKA 4YB6A 3PUWE 2PVUA 3WAEA 4JWXA 4OENA 4EQBA 4EXLA 1ZTYA 2E0SA 3KEIA 3FVNA 4UA8A 2DQVA 2F34A 2Q2AA 2ZYMA 5DVJA 1I6BA 3I6VA 4G8MA 3PUXE 2I4BA 3FATA 3ZS6A 1PEBA 2XXHA 1SYHA 3PGFA 3TCHA 4HS7A 2P1SA 3KJTA 3O29A 4RA1A 2I3WA 5CI5A 4HW8A 1MPDA 5BUUA 5L9SA 1N76A 3PMWA 2RF1A 3B6TA 3S9LC 3QIMA 2Q9TA 1UTHB 2VOZA 4ZEDA 3K00A 1B0HA 2VP1A 3IOUA 3MPKA 4IY5A 3TODA 4DCYA 3B7DA 3MP6A 3O6GA 1OLCA 3SDFA 2QRYA 2PMSA 5KCJB 1F9BA 1TT1A 4NTLA 3MPLA 4PETA 4POXA 4R6HA 3IK6B 3G3HA 1QKAA 3OEKA 3VXBA 3KJ7A 1NH7A 3H6UA 3UGWA 5AA2B 2QSXA 1Y1ZA 1FQDA 1UIUA 2HEUA 1OLAA 3LSFB 5DVIA 5I57B 3CFZA 2ESNA 1OVBA 2ZXTA 4EF1A 3A09A 1LCFA 3MJNA 1OVTA 1SVXB 4O3BA 4PQJA 3IO4A 4XIGQ 4ZEBA 5HM4B 1B1XA 1PB9A 5B7DA 1MXUA 1US4A 5AA2D 2UXAA 4R6KA 3TFLA 1IXIA 1B3FA 1MY3A 2FYIA 1LAGE 4DXBA 3GBBA 2H98A 2P2AA 4ISUA 1B7UA 4JBZA 3RN8A 2Y7KA 3TAJA 4ESXA 2R71A 1B3LA 1QUKA 3Q29A 2ABHA 2DP8A 4QRZA 2LAOA 1JW1A 2ZYOA 2RCBA 2XX7A 4F1YA 2I0CA 2DXYA 2VD3A 4F3SA 5H8NB 1IXCA 1JW5A 5I58A 4QFOA 5J1DA 5I57A 3KSXA 4JWYA 4X48A 3MAMA 1D9VA 5FTHA 1USYH 4U23A 3TQWA 3FZVA 2F78A 2WKYA 3N6TA 1OMPA 4LUBA 5DT6A 3CSBA 3I3VA 2H99A 4R6YA 4WEDA 1DTZA 1WDNA 2Z8DA 3KN8A 2ALUA 3M3KA 4MFIA 1UTBB 5ISUA 2DS9A 4F18A 1AMFA 1MXVA 4FORA 1FCKA 4IO6A 4LA9A 3F11A 4JXIA 4MLQA 4WEPA 2V3UA 3OO6A 5DTBA 3UN6A 2A5TB 1PDAA 2O68A 3OENA 3Q28A 1DPEA 4LONB 1OIBA 2NOOA 2XX9A 2XXQA 4G77A 4GF8A 4JSOA 1S9TA 1RYXA 2RKMA 1MQIA 5F1QA 2OWSA 4BDOA 3OO8A 2R6GE 3H7MA 1P1NA 4QSEA 3CFXA 1LFIA 4LZ5A 4OTEA 4X9TA 3CSGA 4XKPA 4E0WA 5I59A 2HXWA 5ICTA 2QMXA 1B52A 5I84A 1TFAA 3GLBA 1JVXA 2XXTA 4ELQA 3UK4A 3VE1B 1EZPA 3FUZA 3KSJA 5BWJA 2B3BA 1QJMA 4IO7A 1QKBA 3IJXB 2Y7IA 4QHQA 4Z0IA 3CRBA 1LAFE 3G3IA 2BJJX 3G3GA 4ONYA 3EHSA 3ILTB 1MDQA 1A8FA 1N0TA 1YAEA 2O7IA 4U1OA 4LZ8A 4ELRA 1POY1 5CC2A 1FTJA 1CB6A 1LBBA 2GRVA 3FVKA 5H8HB 1LB8A 4P11A 3JYRA 4F22A 1PBQA 3MP8A 2ONRA 3DLNA 4QSCA 4DIGA 2A5SA 2HFBA 3O6IA 3O9PA 4FJPA 5KCJA 3G3FA 3UA8A 1R9QA 1Y4CA 2VGQA 3IO6A 3MVZA 4OXVA 1EZ9A 1ZIUA 2O1MA 3FVOA 4QFNA 3HV1A 3K6UA 3TELA 4EDPA 1DTGA 4YB7A 4OEVA 4GRKA 1TFDA 1SW2A 4LZ7A 1B7ZA 1CE2A 3C4MA 4NF4A 2DYXA 2RC8A 1ANFA 4I8CA 2UVGA 4ZECA 3V8XB 2AIXA 3G3KA 3RLFE 1Q35A 2O7UA 3QK6A 2IEEA 2UYFA 1B51A 1A7LA 3O2AA 2DWAA 3MVYA 4G68A 4G8HA 1FW0A 4GIZA 4GVOA 4UACA 4X1BA 1GGGA 2YLNA 4ZEIA 1MG1A 4TLLB 1B1HA 3RY3A 4NEDA 4XXUA 1SW4A 4GFRA 4O3AA 1B46A 3KOSA 3BKIB 3TTLA 4P0GA 1WODA 3G3JA 3MVXA 4NF4B 1IZ1A 3CG1A 3CG3A 3V5AA 3IOTA 4I9DA 4KCDA 4KYEA 4U2RA 2NVUB 4AB5A 5CRYA 4H8JA 3ONMA 3U94A 3T66A 5LOMA 3LR1A 3TUSA 2I0BA 1B5HA 3H3GA 3TMGA 4U1ZA 3KN7A 1ATGA 5JTYB 3PPPA 5K2YA 4BLAA 4DDDA 4Q30B 4U22A 3MZ1A 2A5TA 5ITOA 1SQYA 3HN0A 4H8IA 3BFUA 1Z7NE 2H9BA 1R9LA 5AA4B 4OERA 1N84A 4IO5A 3FXUA 2REGA 3OOAA 2Q89A 4ZEFA 3IB1A 2DE2A 3EQ1A 3EHUA 3MC2A 4FECA 3VLWA 1FTLA 3M3LA 1B0LA 2D5WA 2I4CA 3L6HA 1QUIA 3USDA 4F29A 4NF5B 2D3IA 3THIA 1M5CA 2V93A 2V25A 3MWBA 1P1OA 1Y20A 4MBPA 2XD3A 4FE8A 2Z8FA 3KGCA 4KFQA 3H03A 4WKMA 1TXFA 3D4GA 4BDLA 5CM6A 1MM7A 3FXQA 2RCAA 3T9HB 5I56B 1KWHA 4I1DA 4YB5A 1URDA 3QSLA 3CR9A 4F3PA 4F3BA 2DSFA 1B3GA 2PBWA 2OCUA 2X7PA 3C33A 3E4RA 3IOVA 3Q25A 1H45A 4H65A 4HCYA 4EUOA 1IIWA 3K2DA 4GD5A 4F39A 3FGSA 1NH8A 3LUYA 3PMVA 4N07A 2P0SA 3H06B 4G68C 4F3GA 2XHDA 1LSTA 1II5A 3EF7A 4FEBA 4YKIA 2DOJA 2UYEA 4FAJA 4G2ZA 4YMAA 5KZTA 1D4NA 4KQPA 4OFOA 1GVCA 1IXGA 5IKBA 1YPNA 2DWJA 4HCWA 4KCCA 1MY1A 3PUVE 3T9VA 4RK9A 4BDNA 3PU5A 1ELJA 2I6EA 2ONSA 2Y84A 1SD3A 1GTKA 3OSRA 3SEYA 3VV5A 1FQAA 1SBPA 3W9WA 1D3KA 3TCGA 4YMBA 4C1TA 1POTA 1P1WA 4M4GA 1FTMA 3GBAA 3S4UA 3OXNA 1PC3A 1VE4A 1H43A 3KN3A 3UORA 1ZBMA 1NNFA 1O64A 3FXRA 4BDQA 1P99A 1L5TA 1XHYA 3DELB 1MQJA 5TU0A 3VVEA 1AOVA 3S9MC 1GR2A 1PBPA 3ZKLA 5FHOA 2YPNA 3FIRA 4GXAA 2RC9A 1RYOA 3P7IA 4TOZA 4U4SA 4WXJA 3RNNA 4ECFA 5CBRA 1M5BA 1ZMGA 2QJEA 2V3TA 4KD5A 2F7AA 4HTGA 1M5EA 5DVFA 3U72A 1YCJA 1SYIA 3SERA 3K02A 1MXWA 1MXYA 1BLFA 3K6XA 4YU0A 1B4ZA 4ZE8A 3RQTA 2HAUA 2AL4A 3SEVA 1I6AA 1P1UA 2O84X 3K1PA 3R6UA 4TQUQ 4KPTA 3KBRA 1JEVA 1XVYA 4NWCA 4OVJA 1QULA 4ZEKA 3TEPA 4F31B 1MQHA 3HHGA 3N5LA 1FQEA 4OMBA 1LBCA 1MRPA 1VSOA 5CBSA 4QFPA 3V83A 3MZBA 1AL3A 1MY0A 3HPIA 4LATA 1B3EA 2OJTA 2Z23A 3IAZA 1T0KA 3UIFA 4F1VA 2O6AA 1B32A 1M5DA 4H1XA 5FTIA 3SEUA 5A5XB 3PPRA 5I2NA 4OETA 4M1VA 4GOTA 4EXKA 3PV0E 1JW4A 5H8QB 4F2OA 2F8DA 5CMBA 3C36A 3ILUB 3IOWA 2Q2CA 4KR5A 3B6QA 4LVQA 3W9VA 4PFTA 3N6UA 3MP1A 3TTMA 4DLDA 1IQ7A 2F6PA 3BBRA 4BDMA 4R2BA 1PB8A 2F6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXR A;  3DP6 A;  3PMX A;  2UVI A;  1IIT A;  3DP8 A;  5H8N A;  1ZU0 A;  2OK2 A;  4OFL A;  1BP5 A;  3E13 X;  3IJO B;  5TP9 B;  4GXS B;  1A99 A;  3VDF A;  3HST A;  2RIN A;  1S7Y A;  2B65 A;  1ZKB A;  4Q5T A;  1Y3N A;  5HBC A;  3T93 B;  4AQ4 A;  2DVC A;  3FV1 A;  1HSE A;  3IR1 A;  2HQ0 A;  3CVG A;  3FV2 A;  1H44 A;  4KYD A;  3DP4 A;  3LBS A;  4MH5 A;  2V84 A;  1Z7M E;  4ZS9 A;  3SEW A;  2F35 A;  3WAF A;  2QS2 A;  1US5 A;  2THI A;  1BIY A;  1LAX A;  2F5X A;  1NFT A;  3HHF A;  1URS A;  4G4P A;  4RPO A;  1FTO A;  4FAT A;  4YKJ A;  1LFH A;  2DVZ A;  1A54 A;  5JEI A;  2O69 A;  3IB0 A;  2OBG A;  4JB7 A;  4G68 B;  4DE8 A;  1Y4T A;  2Y7P A;  4PP0 A;  2QS4 A;  3U92 A;  4OES A;  2Z8E A;  2RC7 A;  2DWH A;  1D9Y A;  5AA3 A;  5A5X A;  2PT2 A;  2M8C A;  4JDF A;  2REJ A;  2X7Q A;  1MH3 A;  1NMU A;  3EPE A;  2NUV A;  3OMB A;  4OEU A;  3LC8 A;  2XD2 A;  4RPN A;  3H6T A;  4ZDM A;  3MW0 A;  4O3C A;  4OZ9 A;  2H4I A;  2GHB A;  2KLF A;  3AXF A;  3N94 A;  4L17 A;  4LQ5 A;  1BTJ A;  5ELV A;  1JET A;  2ZYK A;  3LSL A;  3SET A;  3W15 C;  1MS7 A;  4MF3 A;  3PD8 A;  4R74 A;  2XXY A;  1M5F A;  1NNK A;  4RNS A;  5M2V A;  1O7T A;  3U8Q A;  5I2K B;  1B3H A;  3IB2 A;  1FQC A;  5CMC A;  1A40 A;  1QW0 A;  2F7C A;  3VVF A;  3PPQ A;  2OWT A;  1QUJ A;  3EN3 A;  3FAS A;  3K4U A;  3R26 A;  4U21 A;  5H8H A;  1A8E A;  3T9U A;  4F1U A;  3QXM A;  1SW5 A;  3KG2 A;  4IGT A;  3PUY E;  5FHM A;  3TTN A;  4NF5 A;  3FJG A;  3C32 A;  5CMM A;  4X1D A;  5AA1 A;  2YJP A;  2W7Y A;  3C35 A;  5TPA A;  1NNP A;  2OLB A;  3VLV A;  5JTY A;  1N3W A;  2Z22 A;  5DYH A;  3IOR A;  5F7V A;  4POW A;  3VFJ A;  1A55 A;  3HCQ A;  4GLI A;  3SKP A;  4F2Q A;  2XXW A;  3G7W A;  1NNT A;  3OO7 A;  4QSD A;  1H3D A;  1Y9U A;  2B3F A;  1EU8 A;  1QVS A;  3S9N C;  3T22 A;  2XXU A;  1N7W A;  3H4Z A;  3ZSF A;  4Z7E A;  1XC1 A;  4N13 A;  5I2N B;  3FJ7 A;  5JK4 A;  1FTK A;  3Q27 A;  4MLV A;  2HAV A;  1J1N A;  4YKK A;  3C34 A;  4TLM B;  3Q26 A;  3I5O A;  3H6V A;  3CFL A;  3K01 A;  3TZA A;  4DXU A;  4FED A;  3FJM A;  3GZG A;  3QAX A;  1MY4 A;  1DPP A;  2PT1 A;  1SI0 A;  2CMO A;  3O66 A;  3OEM A;  4RXL A;  4XTC Q;  3OD7 A;  5AA2 A;  3VXC A;  2I48 A;  2Y7R A;  2XX8 A;  2UVJ A;  2Y7W A;  3KOT A;  1B7H A;  1JEU A;  5K2X A;  2D21 A;  1IUD A;  1P1Q A;  1PB7 A;  3K6V A;  1ZLQ A;  5EHS A;  4EF2 A;  2CZL A;  5I2K A;  1VFE A;  4U4X A;  3ECR A;  4KI0 E;  5DEX B;  1HSJ A;  4E0X A;  1LB9 A;  2QL3 A;  1MH4 A;  2R9J A;  3QYT A;  1UQW A;  4PFU A;  1DSN A;  1LAH E;  3D4C A;  4H6D A;  3T9X B;  3ODB A;  2F7B A;  5H8F A;  3PUZ E;  1EH3 A;  3QUJ A;  4Q8R A;  1VFD A;  5TP9 A;  1Y1M A;  2G29 A;  2XXR A;  5IAI A;  3KFM A;  2Q88 A;  1R1N A;  4DCX A;  3EHT A;  3S2V A;  4XKR A;  2QMW A;  5KDT A;  1JVY A;  1WVJ A;  1O63 A;  4RK2 A;  4C0R A;  2ZNS A;  5ICQ A;  1N04 A;  4H0W A;  2O51 A;  4RJZ A;  3RTF B;  4NF6 A;  4DXC A;  2FA7 A;  3B6W A;  3GXA A;  4P0I A;  3O6H A;  4ND9 A;  4QF9 A;  2O1L A;  1URG A;  3U1O A;  2PX1 A;  4C1U A;  4G8N A;  3LSX A;  4OQO A;  4QFL A;  2ZMB A;  5H8S A;  2Q8J A;  1N7X A;  1R6Z A;  2H25 A;  4R72 A;  2HCA A;  4K3F A;  1HSL A;  4OFJ A;  3RT6 B;  1JNF A;  3SES A;  5AA4 A;  1UTH A;  3MVW A;  5B70 A;  3A3C A;  4IY6 A;  4KHZ E;  2X26 A;  2G93 A;  4H5F A;  2ZNT A;  1MY2 A;  1USY E;  4NMY A;  1SDX A;  2I3V A;  1TWY A;  1B4H A;  1MPC A;  3K1N A;  3PD9 A;  4YKP A;  2H5Y A;  4IO3 A;  3OO9 A;  4R2F A;  3FD3 A;  5TPA B;  5DEX A;  3TTR A;  4LQ2 A;  3RGY A;  2HZL A;  3MQ9 A;  3TKD A;  2FNC A;  3A3U A;  3OEL A;  2GH9 A;  2NXO A;  1MXZ A;  2XXP A;  2GHA A;  4YAH X;  1SW1 A;  1Y3P A;  3RUM A;  1SI1 A;  2QS1 A;  4PE5 B;  4Q0C A;  4BDR A;  2DWI A;  1DOT A;  2ZYN A;  3L6G A;  3C9H A;  4LP2 B;  3MZ9 A;  2AYS A;  5HPQ A;  2ANJ A;  4YIC A;  1B40 A;  1UIV A;  3HO7 A;  3BFT A;  3V89 B;  1DMB A;  3O97 A;  1FQB A;  3M3F A;  1ZJL A;  4GQO A;  3IX1 A;  3TYH A;  1FQF A;  4F19 A;  4ZE9 A;  1LGB C;  1I6Q A;  3S9E A;  5ITP A;  1H76 A;  4R9G A;  4H5G A;  4R75 A;  1LLS A;  3C31 A;  2I49 A;  3MUQ A;  2AL5 A;  3O28 A;  4XKQ A;  3RPW A;  1XVX A;  2DE3 A;  3TDJ A;  3RTW B;  2V3Q A;  5I58 B;  1MPB A;  1LCT A;  3IL1 B;  2QPQ A;  4OYV A;  5EHM A;  1B05 A;  1N3X A;  3PPO A;  4PFW A;  3TQL A;  3TCF A;  1S50 A;  3M8U A;  4NF8 A;  3CIJ A;  1JQF A;  1NKX A;  1AH5 A;  2XXI A;  4GWO A;  4JWO A;  1IEJ A;  1XOC A;  4QFK A;  3VVD A;  3ZKK A;  1IXH A;  3R7X A;  3E9X A;  4GL0 A;  4OWD A;  4XKN A;  1LFG A;  4GL8 A;  1MXX A;  5H8F B;  2UVH A;  1Y3Q A;  4ELO A;  4FIM A;  4JSD A;  2VHA A;  3K6W A;  1UTB A;  3TPA A;  4I62 A;  1BKA A;  2PYY A;  4IB2 A;  4NF8 B;  4ELP A;  2GFE A;  4IO4 A;  4R73 A;  1MM6 A;  5KDT B;  1YTV A;  3N26 A;  4THI A;  5I56 A;  3KZG A;  1OQH A;  3MBP A;  2DE4 A;  3CI8 A;  1B6H A;  2XXX A;  2F36 A;  3PPN A;  4H67 A;  4ZZA A;  1MQD A;  5FHN A;  4RY1 A;  3QUF A;  2ZNU A;  3VLU A;  4DZ1 A;  2I58 A;  1OQG A;  4ESW A;  3U93 A;  4EQ9 A;  3JV9 A;  4OHN A;  2IA4 A;  4ZZE A;  1XT8 A;  2HZK A;  5CMK A;  1AIV A;  4KYS A;  1B9J A;  5H8Q A;  4NE4 A;  1XS5 A;  3UP9 A;  2E1S A;  1NL5 A;  5L8D A;  1VR5 A;  1MDP 1;  3FVG A;  4IGR A;  4NF6 B;  1B58 A;  1GV8 A;  2NWJ A;  4EQ7 A;  4YZZ A;  1EZO A;  3K1M A;  1I69 A;  2ONK E;  5AE4 A;  1B5I A;  5I59 B;  3SEX A;  4N6P A;  4AB6 A;  1Q1K A;  1MQG A;  3K0V A;  4RYA A;  3RT8 A;  1B2H A;  3E3K A;  3LSW A;  4PFY A;  3T96 B;  1RKM A;  2F97 A;  1B5J A;  3DM0 A;  2XXV A;  3OSQ A;  3H6W A;  4R9F A;  2OZZ A;  2QS3 A;  3JZJ A;  4NWD A;  5EYF A;  2VD2 A;  5L9O A;  4IO2 A;  5L9M A;  3TTK A;  4YB6 A;  3PUW E;  2PVU A;  3WAE A;  4JWX A;  4OEN A;  4EQB A;  4EXL A;  1ZTY A;  2E0S A;  3KEI A;  3FVN A;  4UA8 A;  2DQV A;  2F34 A;  2Q2A A;  2ZYM A;  5DVJ A;  1I6B A;  3I6V A;  4G8M A;  3PUX E;  2I4B A;  3FAT A;  3ZS6 A;  1PEB A;  2XXH A;  1SYH A;  3PGF A;  3TCH A;  4HS7 A;  2P1S A;  3KJT A;  3O29 A;  4RA1 A;  2I3W A;  5CI5 A;  4HW8 A;  1MPD A;  5BUU A;  5L9S A;  1N76 A;  3PMW A;  2RF1 A;  3B6T A;  3S9L C;  3QIM A;  2Q9T A;  1UTH B;  2VOZ A;  4ZED A;  3K00 A;  1B0H A;  2VP1 A;  3IOU A;  3MPK A;  4IY5 A;  3TOD A;  4DCY A;  3B7D A;  3MP6 A;  3O6G A;  1OLC A;  3SDF A;  2QRY A;  2PMS A;  5KCJ B;  1F9B A;  1TT1 A;  4NTL A;  3MPL A;  4PET A;  4POX A;  4R6H A;  3IK6 B;  3G3H A;  1QKA A;  3OEK A;  3VXB A;  3KJ7 A;  1NH7 A;  3H6U A;  3UGW A;  5AA2 B;  2QSX A;  1Y1Z A;  1FQD A;  1UIU A;  2HEU A;  1OLA A;  3LSF B;  5DVI A;  5I57 B;  3CFZ A;  2ESN A;  1OVB A;  2ZXT A;  4EF1 A;  3A09 A;  1LCF A;  3MJN A;  1OVT A;  1SVX B;  4O3B A;  4PQJ A;  3IO4 A;  4XIG Q;  4ZEB A;  5HM4 B;  1B1X A;  1PB9 A;  5B7D A;  1MXU A;  1US4 A;  5AA2 D;  2UXA A;  4R6K A;  3TFL A;  1IXI A;  1B3F A;  1MY3 A;  2FYI A;  1LAG E;  4DXB A;  3GBB A;  2H98 A;  2P2A A;  4ISU A;  1B7U A;  4JBZ A;  3RN8 A;  2Y7K A;  3TAJ A;  4ESX A;  2R71 A;  1B3L A;  1QUK A;  3Q29 A;  2ABH A;  2DP8 A;  4QRZ A;  2LAO A;  1JW1 A;  2ZYO A;  2RCB A;  2XX7 A;  4F1Y A;  2I0C A;  2DXY A;  2VD3 A;  4F3S A;  5H8N B;  1IXC A;  1JW5 A;  5I58 A;  4QFO A;  5J1D A;  5I57 A;  3KSX A;  4JWY A;  4X48 A;  3MAM A;  1D9V A;  5FTH A;  1USY H;  4U23 A;  3TQW A;  3FZV A;  2F78 A;  2WKY A;  3N6T A;  1OMP A;  4LUB A;  5DT6 A;  3CSB A;  3I3V A;  2H99 A;  4R6Y A;  4WED A;  1DTZ A;  1WDN A;  2Z8D A;  3KN8 A;  2ALU A;  3M3K A;  4MFI A;  1UTB B;  5ISU A;  2DS9 A;  4F18 A;  1AMF A;  1MXV A;  4FOR A;  1FCK A;  4IO6 A;  4LA9 A;  3F11 A;  4JXI A;  4MLQ A;  4WEP A;  2V3U A;  3OO6 A;  5DTB A;  3UN6 A;  2A5T B;  1PDA A;  2O68 A;  3OEN A;  3Q28 A;  1DPE A;  4LON B;  1OIB A;  2NOO A;  2XX9 A;  2XXQ A;  4G77 A;  4GF8 A;  4JSO A;  1S9T A;  1RYX A;  2RKM A;  1MQI A;  5F1Q A;  2OWS A;  4BDO A;  3OO8 A;  2R6G E;  3H7M A;  1P1N A;  4QSE A;  3CFX A;  1LFI A;  4LZ5 A;  4OTE A;  4X9T A;  3CSG A;  4XKP A;  4E0W A;  5I59 A;  2HXW A;  5ICT A;  2QMX A;  1B52 A;  5I84 A;  1TFA A;  3GLB A;  1JVX A;  2XXT A;  4ELQ A;  3UK4 A;  3VE1 B;  1EZP A;  3FUZ A;  3KSJ A;  5BWJ A;  2B3B A;  1QJM A;  4IO7 A;  1QKB A;  3IJX B;  2Y7I A;  4QHQ A;  4Z0I A;  3CRB A;  1LAF E;  3G3I A;  2BJJ X;  3G3G A;  4ONY A;  3EHS A;  3ILT B;  1MDQ A;  1A8F A;  1N0T A;  1YAE A;  2O7I A;  4U1O A;  4LZ8 A;  4ELR A;  1POY 1;  5CC2 A;  1FTJ A;  1CB6 A;  1LBB A;  2GRV A;  3FVK A;  5H8H B;  1LB8 A;  4P11 A;  3JYR A;  4F22 A;  1PBQ A;  3MP8 A;  2ONR A;  3DLN A;  4QSC A;  4DIG A;  2A5S A;  2HFB A;  3O6I A;  3O9P A;  4FJP A;  5KCJ A;  3G3F A;  3UA8 A;  1R9Q A;  1Y4C A;  2VGQ A;  3IO6 A;  3MVZ A;  4OXV A;  1EZ9 A;  1ZIU A;  2O1M A;  3FVO A;  4QFN A;  3HV1 A;  3K6U A;  3TEL A;  4EDP A;  1DTG A;  4YB7 A;  4OEV A;  4GRK A;  1TFD A;  1SW2 A;  4LZ7 A;  1B7Z A;  1CE2 A;  3C4M A;  4NF4 A;  2DYX A;  2RC8 A;  1ANF A;  4I8C A;  2UVG A;  4ZEC A;  3V8X B;  2AIX A;  3G3K A;  3RLF E;  1Q35 A;  2O7U A;  3QK6 A;  2IEE A;  2UYF A;  1B51 A;  1A7L A;  3O2A A;  2DWA A;  3MVY A;  4G68 A;  4G8H A;  1FW0 A;  4GIZ A;  4GVO A;  4UAC A;  4X1B A;  1GGG A;  2YLN A;  4ZEI A;  1MG1 A;  4TLL B;  1B1H A;  3RY3 A;  4NED A;  4XXU A;  1SW4 A;  4GFR A;  4O3A A;  1B46 A;  3KOS A;  3BKI B;  3TTL A;  4P0G A;  1WOD A;  3G3J A;  3MVX A;  4NF4 B;  1IZ1 A;  3CG1 A;  3CG3 A;  3V5A A;  3IOT A;  4I9D A;  4KCD A;  4KYE A;  4U2R A;  2NVU B;  4AB5 A;  5CRY A;  4H8J A;  3ONM A;  3U94 A;  3T66 A;  5LOM A;  3LR1 A;  3TUS A;  2I0B A;  1B5H A;  3H3G A;  3TMG A;  4U1Z A;  3KN7 A;  1ATG A;  5JTY B;  3PPP A;  5K2Y A;  4BLA A;  4DDD A;  4Q30 B;  4U22 A;  3MZ1 A;  2A5T A;  5ITO A;  1SQY A;  3HN0 A;  4H8I A;  3BFU A;  1Z7N E;  2H9B A;  1R9L A;  5AA4 B;  4OER A;  1N84 A;  4IO5 A;  3FXU A;  2REG A;  3OOA A;  2Q89 A;  4ZEF A;  3IB1 A;  2DE2 A;  3EQ1 A;  3EHU A;  3MC2 A;  4FEC A;  3VLW A;  1FTL A;  3M3L A;  1B0L A;  2D5W A;  2I4C A;  3L6H A;  1QUI A;  3USD A;  4F29 A;  4NF5 B;  2D3I A;  3THI A;  1M5C A;  2V93 A;  2V25 A;  3MWB A;  1P1O A;  1Y20 A;  4MBP A;  2XD3 A;  4FE8 A;  2Z8F A;  3KGC A;  4KFQ A;  3H03 A;  4WKM A;  1TXF A;  3D4G A;  4BDL A;  5CM6 A;  1MM7 A;  3FXQ A;  2RCA A;  3T9H B;  5I56 B;  1KWH A;  4I1D A;  4YB5 A;  1URD A;  3QSL A;  3CR9 A;  4F3P A;  4F3B A;  2DSF A;  1B3G A;  2PBW A;  2OCU A;  2X7P A;  3C33 A;  3E4R A;  3IOV A;  3Q25 A;  1H45 A;  4H65 A;  4HCY A;  4EUO A;  1IIW A;  3K2D A;  4GD5 A;  4F39 A;  3FGS A;  1NH8 A;  3LUY A;  3PMV A;  4N07 A;  2P0S A;  3H06 B;  4G68 C;  4F3G A;  2XHD A;  1LST A;  1II5 A;  3EF7 A;  4FEB A;  4YKI A;  2DOJ A;  2UYE A;  4FAJ A;  4G2Z A;  4YMA A;  5KZT A;  1D4N A;  4KQP A;  4OFO A;  1GVC A;  1IXG A;  5IKB A;  1YPN A;  2DWJ A;  4HCW A;  4KCC A;  1MY1 A;  3PUV E;  3T9V A;  4RK9 A;  4BDN A;  3PU5 A;  1ELJ A;  2I6E A;  2ONS A;  2Y84 A;  1SD3 A;  1GTK A;  3OSR A;  3SEY A;  3VV5 A;  1FQA A;  1SBP A;  3W9W A;  1D3K A;  3TCG A;  4YMB A;  4C1T A;  1POT A;  1P1W A;  4M4G A;  1FTM A;  3GBA A;  3S4U A;  3OXN A;  1PC3 A;  1VE4 A;  1H43 A;  3KN3 A;  3UOR A;  1ZBM A;  1NNF A;  1O64 A;  3FXR A;  4BDQ A;  1P99 A;  1L5T A;  1XHY A;  3DEL B;  1MQJ A;  5TU0 A;  3VVE A;  1AOV A;  3S9M C;  1GR2 A;  1PBP A;  3ZKL A;  5FHO A;  2YPN A;  3FIR A;  4GXA A;  2RC9 A;  1RYO A;  3P7I A;  4TOZ A;  4U4S A;  4WXJ A;  3RNN A;  4ECF A;  5CBR A;  1M5B A;  1ZMG A;  2QJE A;  2V3T A;  4KD5 A;  2F7A A;  4HTG A;  1M5E A;  5DVF A;  3U72 A;  1YCJ A;  1SYI A;  3SER A;  3K02 A;  1MXW A;  1MXY A;  1BLF A;  3K6X A;  4YU0 A;  1B4Z A;  4ZE8 A;  3RQT A;  2HAU A;  2AL4 A;  3SEV A;  1I6A A;  1P1U A;  2O84 X;  3K1P A;  3R6U A;  4TQU Q;  4KPT A;  3KBR A;  1JEV A;  1XVY A;  4NWC A;  4OVJ A;  1QUL A;  4ZEK A;  3TEP A;  4F31 B;  1MQH A;  3HHG A;  3N5L A;  1FQE A;  4OMB A;  1LBC A;  1MRP A;  1VSO A;  5CBS A;  4QFP A;  3V83 A;  3MZB A;  1AL3 A;  1MY0 A;  3HPI A;  4LAT A;  1B3E A;  2OJT A;  2Z23 A;  3IAZ A;  1T0K A;  3UIF A;  4F1V A;  2O6A A;  1B32 A;  1M5D A;  4H1X A;  5FTI A;  3SEU A;  5A5X B;  3PPR A;  5I2N A;  4OET A;  4M1V A;  4GOT A;  4EXK A;  3PV0 E;  1JW4 A;  5H8Q B;  4F2O A;  2F8D A;  5CMB A;  3C36 A;  3ILU B;  3IOW A;  2Q2C A;  4KR5 A;  3B6Q A;  4LVQ A;  3W9V A;  4PFT A;  3N6U A;  3MP1 A;  3TTM A;  4DLD A;  1IQ7 A;  2F6P A;  3BBR A;  4BDM A;  4R2B A;  1PB8 A;  2F6G A; 
#chains in the Genus database with same CATH topology
 1FJ9 A;  2DXR A;  5H8N A;  1ZU0 A;  2OK2 A;  1EYJ A;  1S7Y A;  3T93 B;  3CHG A;  1Y3N A;  2DVC A;  3FV1 A;  1HSE A;  4XEQ A;  4MH5 A;  3LBS A;  3WAF A;  2THI A;  4MIJ A;  1URS A;  1FTO A;  2DVZ A;  1A54 A;  1FTA A;  5JEI A;  2O69 A;  1DCU A;  4G68 B;  4DE8 A;  1LBW A;  4MAG A;  3U92 A;  2PT2 A;  2X7Q A;  4OEU A;  3H6T A;  4OZ9 A;  2KLF A;  1FBG A;  3SET A;  4N8Y A;  1NNK A;  5M2V A;  5I2K B;  1FQC A;  4U21 A;  5IZ3 B;  1FPI A;  3KG2 A;  4IGT A;  3PUY E;  5FHM A;  4NF5 A;  4DI3 D;  2ZZX A;  3FJG A;  5CMM A;  2W7Y A;  3VLV A;  2OLB A;  5JTY A;  5DYH A;  5F7V A;  4GLI A;  3OO7 A;  1Y9U A;  3S9N C;  1N7W A;  1FTK A;  4PC9 A;  4TLM B;  3TZA A;  4FED A;  3QAX A;  1DPP A;  2I48 A;  2Y7R A;  2XX8 A;  3KOT A;  5K2X A;  2D21 A;  1IUD A;  5EHS A;  1HSJ A;  1LB9 A;  2R9J A;  1UQW A;  3ODB A;  5IAI A;  1Y1M A;  3S2V A;  4RJZ A;  3RTF B;  3GXA A;  4P0I A;  4ND9 A;  4G8N A;  4OQO A;  1LBX A;  4QFL A;  1BK4 A;  5H8S A;  1N7X A;  1R6Z A;  4R72 A;  4K3F A;  4OFJ A;  1UTH A;  3MVW A;  4H5F A;  1SDX A;  1TWY A;  4IO3 A;  4R2F A;  5TPA B;  3MQ9 A;  3OEL A;  2NXO A;  3RUM A;  2GHA A;  2DWI A;  2ZYN A;  3L6G A;  3C9H A;  4NAP A;  2AYS A;  2DDK A;  2ANJ A;  1CNQ A;  4ZE9 A;  3IX1 A;  4PGP A;  4H5G A;  3RPW A;  4MNP A;  1LCT A;  5EHM A;  3PPO A;  4PFW A;  3TQL A;  3TCF A;  4F3P A;  3CIJ A;  2XXI A;  1K9Z A;  3ZKK A;  4OWD A;  1FPE A;  2ZZV A;  2VHA A;  3QMF A;  4IB2 A;  4NF8 B;  1NV4 A;  3N26 A;  3KZG A;  3MBP A;  1B6H A;  4H67 A;  2I58 A;  4OA4 A;  4EQ9 A;  4N6D A;  2IA4 A;  5H8Q A;  4GBW A;  1IMD A;  1XS5 A;  3ROJ A;  4MEV A;  5L8D A;  2NWJ A;  1EZO A;  1FBC A;  3LSW A;  4MJO A;  1B5J A;  3H6W A;  4R9F A;  4PF6 A;  4O94 A;  5L9M A;  4YB6 A;  1ZTY A;  2E0S A;  1FBP A;  4UA8 A;  4HS7 A;  5L9S A;  3O29 A;  5BUU A;  4XFE A;  1N76 A;  3B6T A;  3S9L C;  2VOZ A;  1XI6 A;  3IOU A;  4DCY A;  2QRY A;  2FIX A;  5KCJ B;  5EQ7 A;  4R6H A;  3IK6 B;  1FPK A;  2QSX A;  1FQD A;  3LSF B;  4GWW A;  4O7I A;  4XIG Q;  4PQJ A;  5B7D A;  1D9Q A;  4GWY A;  2UXA A;  1MY3 A;  2FYI A;  1LAG E;  2H98 A;  4ISU A;  2Y7K A;  2LAO A;  2RCB A;  2XX7 A;  2I0C A;  4F3S A;  5I58 A;  4QFO A;  3KSX A;  4U23 A;  2F78 A;  4OVQ A;  4IR8 A;  3CSB A;  4MMP A;  5ISU A;  1MXV A;  4MLQ A;  4LA9 A;  3ISP A;  1OIB A;  2NOO A;  4JSO A;  4GF8 A;  2RKM A;  3H7M A;  3CFX A;  4HE1 A;  4LZ5 A;  4OTE A;  3CSG A;  4XKP A;  2HXW A;  5ICT A;  5I84 A;  2P3V A;  2QVU A;  3UK4 A;  4IO7 A;  1RDZ A;  2CEY A;  3CRB A;  2BJJ X;  1N0T A;  1YAE A;  4U1O A;  1FTJ A;  1CB6 A;  2GRV A;  3JYR A;  3MP8 A;  4QSC A;  5ET7 A;  3IO6 A;  4OXV A;  4GWX A;  3FVO A;  3HV1 A;  3TEL A;  4OEV A;  4LZ7 A;  1B7Z A;  3C4M A;  1KA0 A;  1ANF A;  3HFU A;  3RLF E;  1Q35 A;  3QK6 A;  1B51 A;  4G8H A;  4GIZ A;  4MBP A;  4JVC A;  3TQW A;  1QGX A;  4ZEI A;  3RY3 A;  4XXU A;  4GFR A;  1WOD A;  1Q9D A;  3G3J A;  3CG3 A;  3V5A A;  4G61 A;  4PE3 A;  5LOM A;  3TUS A;  1B5H A;  2F3D A;  1NV5 A;  4NX1 A;  4OVR A;  1N84 A;  4FEC A;  1FTL A;  3M3L A;  1B0L A;  2I4C A;  4MCO A;  3USD A;  3THI A;  1M5C A;  3MWB A;  2V25 A;  1Y20 A;  4WKM A;  3D4G A;  3CR9 A;  4F3B A;  2DSF A;  1B3G A;  2PBW A;  3E4R A;  4PBH A;  3FGS A;  2XHD A;  1LST A;  3EF7 A;  4FEB A;  4G2Z A;  4YMA A;  4KQP A;  3T9V A;  4BDN A;  3SEY A;  2Y84 A;  3W9W A;  1FQA A;  1FTM A;  1FPF A;  1XHY A;  1AOV A;  1MQJ A;  3S9M C;  2RC9 A;  4WXJ A;  1ZMG A;  4GX4 A;  1FPJ A;  4YU0 A;  1BLF A;  4ZE8 A;  3RQT A;  4KPT A;  3TEP A;  1JEV A;  4F31 B;  1FQE A;  1NV2 A;  4NQ8 A;  3MZB A;  2OJT A;  2Z23 A;  4UAB A;  2O6A A;  1M5D A;  5FTI A;  3T0J A;  4OET A;  1KZ8 A;  3C36 A;  3IOW A;  4LVQ A;  1IQ7 A;  2F6G A;  5F24 A;  4OFL A;  4GXS B;  3VDF A;  4Q5T A;  2Q8M A;  1KA1 A;  3IR1 A;  3SZP A;  3FV2 A;  1H44 A;  4KYD A;  2V84 A;  1Z7M E;  2WYK A;  2QS2 A;  1US5 A;  3HHF A;  1BIY A;  1NFT A;  1LFH A;  3IB0 A;  2OBG A;  3RYD A;  2Y7P A;  4OES A;  3NOH A;  5AA3 A;  2M8C A;  1NMU A;  4ZDM A;  2Y5K A;  2GHB A;  3AXF A;  4LQ5 A;  1BTJ A;  2ZYK A;  4RNS A;  3EN3 A;  1A8E A;  3C32 A;  5AA1 A;  2YJP A;  1NNP A;  3IOR A;  4POW A;  3G7W A;  1EU8 A;  3H4Z A;  3ZSF A;  5I2N B;  3Q26 A;  4DXU A;  2B4M A;  1MY4 A;  2PT1 A;  4RXL A;  2CMO A;  2KQZ A;  1B7H A;  1JEU A;  1PB7 A;  5I2K A;  2QVV A;  4U4X A;  3T9X B;  5H8F A;  1EH3 A;  3QUJ A;  1VFD A;  3KFM A;  4XKR A;  1O63 A;  4RK2 A;  4H0W A;  2O51 A;  3B6W A;  4QF9 A;  2PX1 A;  4C1U A;  3LUZ A;  4N17 A;  2ZMB A;  1NUW A;  2X26 A;  3LV0 A;  5I3S A;  1USY E;  4NMY A;  2I3V A;  1MPC A;  1NV7 A;  3RGY A;  3A3U A;  3RPL B;  1SW1 A;  2QS1 A;  4LP2 B;  1UIV A;  3HO7 A;  3BFT A;  3V89 B;  4GQO A;  3TYH A;  1LGB C;  4R9G A;  4R75 A;  3O28 A;  4XKQ A;  5I58 B;  3IL1 B;  1FJ6 A;  1N3X A;  1S50 A;  4GWO A;  4JWO A;  1IEJ A;  1XOC A;  3KC1 A;  3FBP A;  3R7X A;  3E9X A;  4GL0 A;  4OVP A;  1MXX A;  5H8F B;  2JJK A;  4JSD A;  4H45 A;  3TPA A;  4I62 A;  1BKA A;  4ELP A;  4QBA A;  4IO4 A;  3CI8 A;  3PPN A;  1MQD A;  5FHN A;  3VLU A;  4DZ1 A;  4X04 A;  4ESW A;  4KYS A;  2E1S A;  4NF6 B;  1MDP 1;  4YZZ A;  2CZH A;  5AE4 A;  5EYG A;  1Q1K A;  1EYI A;  2F3B A;  3RT8 A;  1B2H A;  4PFI A;  5ET6 A;  1LBY A;  3JZJ A;  4NWD A;  4GX3 A;  5L9O A;  3PUW E;  4EQB A;  1YYZ A;  5TU0 A;  3FVN A;  1K9Y A;  3I6V A;  2I4B A;  3FAT A;  3ZS6 A;  1PEB A;  1SYH A;  3TCH A;  4RA1 A;  3QIM A;  4ZED A;  3K00 A;  2VP1 A;  3TOD A;  3B7D A;  3SDF A;  1F9B A;  4POX A;  3MYU A;  1QKA A;  3KJ7 A;  4NF0 A;  5DVI A;  1OLA A;  5I57 B;  2ESN A;  1OVB A;  1SPI A;  2ZXT A;  3A09 A;  3MJN A;  1OVT A;  1MXU A;  5AA2 D;  4R6K A;  4P8B A;  3GBB A;  1B7U A;  4JBZ A;  1B3L A;  3Q29 A;  2DP8 A;  5EQ8 A;  2ZYO A;  2VD3 A;  1IXC A;  1JW5 A;  4X48 A;  1USY H;  3N6T A;  5DT6 A;  4WED A;  1WDN A;  4MFI A;  4NG7 A;  1AMF A;  4FOR A;  1FCK A;  4JXI A;  3VV5 A;  2A5T B;  2O68 A;  3OEN A;  2XX9 A;  4BDO A;  3OO8 A;  4QSE A;  1LFI A;  1NUZ A;  1TFA A;  1JVX A;  2XXT A;  5BWJ A;  2B3B A;  1QJM A;  4PTK A;  3G3I A;  4HE0 A;  4N81 A;  2WBB A;  4PAF A;  4P47 A;  4ELR A;  2O7I A;  3MST A;  1POY 1;  1LBB A;  2ONR A;  3DLN A;  2VGQ A;  1Y4C A;  2XWV A;  5LDZ A;  2WBD A;  4EDP A;  1RDX A;  1TFD A;  1SW2 A;  1CE2 A;  2PCR A;  4NF4 A;  3V8X B;  1IMF A;  3O2A A;  4G68 A;  4UAC A;  2VPN A;  1GGG A;  1MG1 A;  2FIE A;  4NED A;  4P0G A;  1IZ1 A;  3IOT A;  4U2R A;  3U94 A;  2Y5L A;  4PAK A;  3TMG A;  1ATG A;  5K2Y A;  4BLA A;  4U22 A;  1SQY A;  4IO5 A;  2REG A;  3EQ1 A;  2XD3 A;  4BDL A;  1TXF A;  2XWK A;  5I56 B;  4I1D A;  2X7P A;  2OCU A;  4GD5 A;  4MNI A;  1IMC A;  3PMV A;  4N07 A;  2P0S A;  3H06 B;  4G68 C;  2DOJ A;  4FAJ A;  5KZT A;  4GWU A;  1GVC A;  1YPN A;  2DWJ A;  3OSR A;  2ONS A;  1SBP A;  1D3K A;  2WX9 A;  3TCG A;  4YMB A;  1POT A;  3OXN A;  1PC3 A;  3KN3 A;  3UOR A;  1NNF A;  3FXR A;  2MKZ A;  3DEL B;  1PBP A;  4GWZ A;  1DK4 A;  2QJE A;  2F7A A;  3U72 A;  1YCJ A;  1MXY A;  3SEV A;  1I6A A;  3KBR A;  1QUL A;  3N5L A;  4OMB A;  5CBS A;  3GYY A;  3V83 A;  1AL3 A;  1MY0 A;  4LAT A;  3IAZ A;  4H1X A;  5I2N A;  4EXK A;  5H8Q B;  4KR5 A;  3B6Q A;  3IFA A;  3W9V A;  4PFT A;  3N6U A;  3TTM A;  3U65 A;  4BDM A;  1PB8 A;  1AWB A;  3DP8 A;  3IJO B;  5A5L A;  1A99 A;  3HST A;  2RIN A;  2B65 A;  5HBC A;  2Q74 A;  2HQ0 A;  4ZS9 A;  4O8M A;  1LAX A;  2F5X A;  4YKJ A;  3KC0 A;  3IFC A;  4PP0 A;  2QS4 A;  2Z8E A;  2RC7 A;  2DWH A;  1D9Y A;  5A5X A;  2REJ A;  3OMB A;  2NUV A;  3LC8 A;  3MW0 A;  4N8G A;  4P3L A;  1JET A;  3LSL A;  3W15 C;  1MS7 A;  4MF3 A;  2XXY A;  1B3H A;  1A40 A;  2OWT A;  3K4U A;  5H8H A;  3QXM A;  1SW5 A;  3TTN A;  4MNC A;  2XWO A;  4OVS A;  3C35 A;  1N3W A;  3HCQ A;  1H3D A;  2B3F A;  1QVS A;  2XXU A;  2GQ1 A;  1XC1 A;  1G0I A;  4N13 A;  3FJ7 A;  5JK4 A;  3I5O A;  3H6V A;  4LN5 A;  3K01 A;  3FJM A;  3GZG A;  4XTC Q;  3O66 A;  3OEM A;  5AA2 A;  3OD7 A;  3VXC A;  1P1Q A;  3K6V A;  1ZLQ A;  3BIG A;  2CZL A;  4KI0 E;  5DEX B;  4AS5 A;  1MH4 A;  1DSN A;  3D4C A;  4H6D A;  1NUY A;  4PCD A;  2Q88 A;  1R1N A;  4DCX A;  5KDT A;  2QMW A;  1WVJ A;  4C0R A;  2ZNS A;  4AS4 A;  4NF6 A;  2FA7 A;  3RPL A;  2O1L A;  1URG A;  3LSX A;  2H25 A;  2HCA A;  3SES A;  1HSL A;  1JNF A;  5FBP A;  3A3C A;  4KHZ E;  2G93 A;  2ZNT A;  1MY2 A;  4P56 A;  3PD9 A;  4YKP A;  2H5Y A;  3OO9 A;  3FD3 A;  3TTR A;  1NV6 A;  2HZL A;  2FNC A;  2GH9 A;  1MXZ A;  1DOT A;  3MZ9 A;  4YIC A;  1B40 A;  1FQB A;  1ZJL A;  4GBV A;  1I6Q A;  3S9E A;  5ITP A;  1H76 A;  1RDY A;  3MUQ A;  2AL5 A;  5IZ3 A;  1XVX A;  3RTW B;  2L5V A;  4OYV A;  1B05 A;  3M8U A;  1NKX A;  5ICQ A;  1AH5 A;  4QFK A;  2FHY A;  3VVD A;  1LFG A;  4GL8 A;  2UVH A;  2PYY A;  2GFE A;  1YTV A;  4THI A;  5I56 A;  2DE4 A;  2XXX A;  2F36 A;  3EKI A;  1OQG A;  4PF8 A;  3U93 A;  3JV9 A;  4OHN A;  2HZK A;  1AIV A;  4NE4 A;  1NL5 A;  1VR5 A;  3FVG A;  3A29 A;  1B58 A;  1FPL A;  1I69 A;  2ONK E;  1B5I A;  4I40 A;  3SEX A;  4N6P A;  1MQG A;  2HXR A;  4RYA A;  3E3K A;  3T96 B;  1RKM A;  2OZZ A;  1FPB A;  5EYF A;  2VD2 A;  3TTK A;  3WAE A;  4OEN A;  1VDW A;  2DQV A;  2F34 A;  2Q2A A;  2ZYM A;  5DVJ A;  1I6B A;  3PTY A;  5T3J A;  3PUX E;  3UA8 A;  1FBH A;  5I5P A;  2XXH A;  3PGF A;  3B8B A;  4HW8 A;  1MPD A;  3PMW A;  2RF1 A;  4KXP A;  1UTH B;  5ET5 A;  4NGU A;  1B0H A;  2QFL A;  4DI4 B;  3FXB A;  2PMS A;  2R8T A;  2CZI A;  3MPL A;  3OEK A;  4GX6 A;  3VXB A;  5AA2 B;  1NH7 A;  3UGW A;  4N15 A;  1Y1Z A;  1LCF A;  4O3B A;  5HM4 B;  1PB9 A;  3TFL A;  1FPG A;  4DXB A;  3TAJ A;  2R71 A;  1QUK A;  2ABH A;  5IZ1 A;  4F1Y A;  5H8N B;  3MAM A;  5FTH A;  4LUB A;  5EQA A;  3M3K A;  1NI9 A;  1UTB B;  2WEF A;  4F18 A;  4O7M A;  3F11 A;  2HHM A;  2V3U A;  1PDA A;  3Q28 A;  4LON B;  2XXQ A;  4F29 A;  4G77 A;  1RYX A;  2R6G E;  1P1N A;  2PFY A;  4ELQ A;  3VE1 B;  1EZP A;  3FUZ A;  3KSJ A;  3IJX B;  2Y7I A;  4QHQ A;  4Z0I A;  1LAF E;  4ONY A;  3FVK A;  5I7I A;  4P11 A;  4F22 A;  1PBQ A;  4DIG A;  1JP4 A;  3O9P A;  1R9Q A;  1EZ9 A;  1ZIU A;  4QFN A;  4GRK A;  2DYX A;  2RC8 A;  4ZEC A;  2AIX A;  2O7U A;  1FPD A;  4GVO A;  1FW0 A;  2YLN A;  1IME A;  1SW4 A;  4O3A A;  1B46 A;  3KOS A;  5IM2 A;  4AB5 A;  2I0B A;  3KBZ A;  4U1Z A;  5IZZ A;  3MZ1 A;  4P1E A;  1G0H A;  3HN0 A;  4HE2 A;  4H8I A;  3BFU A;  1Z7N E;  1R9L A;  4N4U A;  1EYK A;  3MC2 A;  3VLW A;  2D5W A;  4NF5 B;  1P1O A;  3D1R A;  4FE8 A;  2RCA A;  4YB5 A;  1URD A;  2HPG A;  3QSL A;  4H65 A;  4HCY A;  1H45 A;  4EUO A;  3K2D A;  4F39 A;  4F3G A;  4YKI A;  4I3Y A;  2UYE A;  5DW8 A;  1D4N A;  4OFO A;  1IXG A;  4N91 A;  4HCW A;  5IKB A;  4KCC A;  1MY1 A;  2B4L A;  1GTK A;  4C1T A;  3S4U A;  1P1W A;  2CEX A;  4M4G A;  1O64 A;  1L5T A;  1GR2 A;  3FIR A;  3RNN A;  4GXA A;  3P7I A;  5CBR A;  1M5B A;  4KD5 A;  4HTG A;  5DVF A;  3SER A;  3K02 A;  1MXW A;  2AL4 A;  1P1U A;  2O84 X;  4ZEK A;  4OVJ A;  1MQH A;  1MRP A;  1NV1 A;  4PDD A;  3BIH A;  3UIF A;  1B32 A;  3SEU A;  4M1V A;  4GOT A;  3PV0 E;  1JW4 A;  2ZZW A;  4F2O A;  2F8D A;  5CMB A;  1IMA A;  3ILU B;  3MP1 A;  4PAI A;  3BBR A;  4R2B A;  3DP6 A;  3PMX A;  2UVI A;  1IIT A;  1BP5 A;  3E13 X;  5TP9 B;  4AQ4 A;  1ZKB A;  4P9K A;  3CVG A;  3DP4 A;  3SEW A;  4MX6 A;  2F35 A;  4G4P A;  4FAT A;  4RPO A;  4JB7 A;  4FBP A;  1Y4T A;  4JDF A;  1MH3 A;  2XXK A;  3EPE A;  4RPN A;  2XD2 A;  4O3C A;  2VPO A;  2H4I A;  3N94 A;  4L17 A;  4MHF A;  5ELV A;  4R74 A;  3PD8 A;  1M5F A;  3U8Q A;  1O7T A;  3IB2 A;  5CMC A;  3E78 A;  1QW0 A;  2F7C A;  3VVF A;  3PPQ A;  1QUJ A;  3FAS A;  3R26 A;  3T9U A;  4F1U A;  4X1D A;  5TPA A;  3VFJ A;  2Z22 A;  1A55 A;  1FBE A;  3SKP A;  4F2Q A;  2XXW A;  4QSD A;  1NNT A;  3T1B A;  3T22 A;  4Z7E A;  3Q27 A;  4MLV A;  2HAV A;  1J1N A;  4YKK A;  3C34 A;  1IMB A;  3CFL A;  1SI0 A;  2UVJ A;  2Y7W A;  4EF2 A;  1VFE A;  4E0X A;  1YXI A;  3ECR A;  2QL3 A;  3QYT A;  4PFU A;  1LAH E;  2V4C A;  2F7B A;  3PUZ E;  4Q8R A;  5LTC A;  5EQ9 A;  5TP9 A;  2G29 A;  2XXR A;  3EHT A;  4PDH A;  4N6K A;  1JVY A;  4P1L A;  4PFB A;  1N04 A;  2P3N A;  4DXC A;  3O6H A;  3U1O A;  2Q8J A;  5AA4 A;  3RT6 B;  5B70 A;  4IY6 A;  1B4H A;  3K1N A;  5DEX A;  2VT5 A;  4LQ2 A;  3TKD A;  2XXP A;  1Y3P A;  1SI1 A;  4PE5 B;  4Q0C A;  4BDR A;  5HPQ A;  1DMB A;  3O97 A;  3M3F A;  1FSA A;  1FQF A;  4F19 A;  1LLS A;  3C31 A;  2I49 A;  2DE3 A;  3TDJ A;  2V3Q A;  1MPB A;  2QPQ A;  4NF8 A;  1JQF A;  1IXH A;  4XKN A;  1Y3Q A;  4FIM A;  3K6W A;  1UTB A;  4R73 A;  1MM6 A;  5KDT B;  2WYP A;  1OQH A;  4ZZA A;  4RY1 A;  3QUF A;  2ZNU A;  1LBV A;  4ZZE A;  1XT8 A;  5CMK A;  1B9J A;  5ESY A;  3UP9 A;  4EXL A;  4IGR A;  4XF5 A;  4EQ7 A;  5EYH A;  3K1M A;  5I59 B;  4AB6 A;  3K0V A;  4OAN A;  4PFY A;  2F97 A;  3DM0 A;  2XXV A;  3OSQ A;  2QS3 A;  4IO2 A;  2PVU A;  1NUX A;  4JWX A;  3KEI A;  4G8M A;  2P1S A;  3KJT A;  5CI5 A;  2I3W A;  2Q9T A;  4IY5 A;  3MPK A;  1YZ0 A;  3MP6 A;  3O6G A;  1OLC A;  1TT1 A;  4NTL A;  4PET A;  4PGN A;  3G3H A;  4H46 A;  4NN3 A;  3H6U A;  2HEU A;  1UIU A;  4X8R A;  3CFZ A;  4EF1 A;  1GV8 A;  1SVX B;  3IO4 A;  4ZEB A;  1B1X A;  2XA5 A;  1US4 A;  1IXI A;  1B3F A;  4OVT A;  2P2A A;  3RN8 A;  2OWZ A;  4QXD A;  4QRZ A;  1JW1 A;  5J1D A;  2DXY A;  5I57 A;  4JWY A;  1D9V A;  1INP A;  3FZV A;  2BJI A;  2WKY A;  1OMP A;  3I3V A;  4R6Y A;  2H99 A;  1DTZ A;  2Z8D A;  3KN8 A;  2ALU A;  2DS9 A;  4PFR A;  4WEP A;  5DTB A;  4IO6 A;  3UN6 A;  4ESX A;  3OO6 A;  3E79 A;  1DPE A;  5F1Q A;  1S9T A;  4DLD A;  2QVR A;  1MQI A;  2OWS A;  4X9T A;  4E0W A;  5I59 A;  2QMX A;  1B52 A;  3GLB A;  2FVZ A;  1FBD A;  1QKB A;  3G3G A;  3EHS A;  3ILT B;  1MDQ A;  1A8F A;  4LZ8 A;  5CC2 A;  5IGA A;  5H8H B;  1LB8 A;  2CZK A;  2A5S A;  2HFB A;  3O6I A;  4FJP A;  5KCJ A;  3G3F A;  3MVZ A;  2O1M A;  3K6U A;  1DTG A;  4YB7 A;  1FBF A;  1NV3 A;  2PFZ A;  4JVI A;  4I8C A;  2UVG A;  3G3K A;  1LBZ A;  2IEE A;  2UYF A;  4YAH X;  1A7L A;  2DWA A;  3MVY A;  4X1B A;  4TLL B;  1B1H A;  3BKI B;  3TTL A;  3MVX A;  4NF4 B;  3CG1 A;  4I9D A;  4KCD A;  4KYE A;  2NVU B;  5CRY A;  4H8J A;  3ONM A;  3T66 A;  4JVD A;  3LR1 A;  3H3G A;  3KN7 A;  5JTY B;  3PPP A;  4DDD A;  4Q30 B;  2A5T A;  5ITO A;  2H9B A;  5AA4 B;  4OER A;  3FXU A;  4ZEF A;  3OOA A;  2Q89 A;  3IB1 A;  2DE2 A;  4NHB A;  3EHU A;  3L6H A;  1QUI A;  2D3I A;  2V93 A;  2Z8F A;  3KGC A;  4KFQ A;  3H03 A;  5CM6 A;  3B50 A;  1MM7 A;  3FXQ A;  2FBP A;  3T9H B;  4PBQ A;  1KWH A;  3C33 A;  3Q25 A;  3IOV A;  1IIW A;  1NH8 A;  3LUY A;  4HXV A;  1NV0 A;  4GWS A;  1FRP A;  1II5 A;  2OX3 A;  4ELO A;  3PUV E;  4RK9 A;  3PU5 A;  1ELJ A;  2I6E A;  1SD3 A;  4I3E A;  3GBA A;  1VE4 A;  1H43 A;  1ZBM A;  4BDQ A;  1P99 A;  1LEV A;  3VVE A;  3ZKL A;  5FHO A;  2YPN A;  4TOZ A;  4U4S A;  1RYO A;  4ECF A;  2V3T A;  5J16 A;  1M5E A;  1SYI A;  2KR0 A;  3K6X A;  1B4Z A;  2HAU A;  3R6U A;  4TQU Q;  3K1P A;  1XVY A;  4NWC A;  3HHG A;  1DBZ A;  1LBC A;  1VSO A;  4QFP A;  3HPI A;  1B3E A;  1T0K A;  4F1V A;  5ET8 A;  5A5X B;  3PPR A;  2Q2C A;  2F6P A;  2XWI A; 
#chains in the Genus database with same CATH homology
 2DXR A;  3DP6 A;  3PMX A;  2UVI A;  1IIT A;  3DP8 A;  5H8N A;  1ZU0 A;  2OK2 A;  4OFL A;  1BP5 A;  3E13 X;  3IJO B;  5TP9 B;  4GXS B;  1A99 A;  3VDF A;  3HST A;  2RIN A;  1S7Y A;  2B65 A;  1ZKB A;  4Q5T A;  1Y3N A;  5HBC A;  3T93 B;  4AQ4 A;  2DVC A;  3FV1 A;  1HSE A;  3IR1 A;  2HQ0 A;  3CVG A;  3FV2 A;  1H44 A;  4KYD A;  3DP4 A;  3LBS A;  4MH5 A;  2V84 A;  1Z7M E;  4ZS9 A;  3SEW A;  2F35 A;  3WAF A;  2QS2 A;  1US5 A;  2THI A;  1BIY A;  1LAX A;  2F5X A;  1NFT A;  3HHF A;  1URS A;  4G4P A;  4RPO A;  1FTO A;  4FAT A;  4YKJ A;  1LFH A;  2DVZ A;  1A54 A;  5JEI A;  2O69 A;  3IB0 A;  2OBG A;  4JB7 A;  4G68 B;  4DE8 A;  1Y4T A;  2Y7P A;  4PP0 A;  2QS4 A;  3U92 A;  4OES A;  2Z8E A;  2RC7 A;  2DWH A;  1D9Y A;  5AA3 A;  5A5X A;  2PT2 A;  2M8C A;  4JDF A;  2REJ A;  2X7Q A;  1MH3 A;  1NMU A;  3EPE A;  2NUV A;  3OMB A;  4OEU A;  3LC8 A;  2XD2 A;  4RPN A;  3H6T A;  4ZDM A;  3MW0 A;  4O3C A;  4OZ9 A;  2H4I A;  2GHB A;  2KLF A;  3AXF A;  3N94 A;  4L17 A;  4LQ5 A;  1BTJ A;  5ELV A;  1JET A;  2ZYK A;  3LSL A;  3SET A;  3W15 C;  1MS7 A;  4MF3 A;  3PD8 A;  4R74 A;  2XXY A;  1M5F A;  1NNK A;  4RNS A;  5M2V A;  1O7T A;  3U8Q A;  5I2K B;  1B3H A;  3IB2 A;  1FQC A;  5CMC A;  1A40 A;  1QW0 A;  2F7C A;  3VVF A;  3PPQ A;  2OWT A;  1QUJ A;  3EN3 A;  3FAS A;  3K4U A;  3R26 A;  4U21 A;  5H8H A;  1A8E A;  3T9U A;  4F1U A;  3QXM A;  1SW5 A;  3KG2 A;  4IGT A;  3PUY E;  5FHM A;  3TTN A;  4NF5 A;  3FJG A;  3C32 A;  5CMM A;  4X1D A;  5AA1 A;  2YJP A;  2W7Y A;  3C35 A;  5TPA A;  1NNP A;  2OLB A;  3VLV A;  5JTY A;  1N3W A;  2Z22 A;  5DYH A;  3IOR A;  5F7V A;  4POW A;  3VFJ A;  1A55 A;  3HCQ A;  4GLI A;  3SKP A;  4F2Q A;  2XXW A;  3G7W A;  1NNT A;  3OO7 A;  4QSD A;  1H3D A;  1Y9U A;  2B3F A;  1EU8 A;  1QVS A;  3S9N C;  3T22 A;  2XXU A;  1N7W A;  3H4Z A;  3ZSF A;  4Z7E A;  1XC1 A;  4N13 A;  5I2N B;  3FJ7 A;  5JK4 A;  1FTK A;  3Q27 A;  4MLV A;  2HAV A;  1J1N A;  4YKK A;  3C34 A;  4TLM B;  3Q26 A;  3I5O A;  3H6V A;  3CFL A;  3K01 A;  3TZA A;  4DXU A;  4FED A;  3FJM A;  3GZG A;  3QAX A;  1MY4 A;  1DPP A;  2PT1 A;  1SI0 A;  2CMO A;  3O66 A;  3OEM A;  4RXL A;  4XTC Q;  3OD7 A;  5AA2 A;  3VXC A;  2I48 A;  2Y7R A;  2XX8 A;  2UVJ A;  2Y7W A;  3KOT A;  1B7H A;  1JEU A;  5K2X A;  2D21 A;  1IUD A;  1P1Q A;  1PB7 A;  3K6V A;  1ZLQ A;  5EHS A;  4EF2 A;  2CZL A;  5I2K A;  1VFE A;  4U4X A;  3ECR A;  4KI0 E;  5DEX B;  1HSJ A;  4E0X A;  1LB9 A;  2QL3 A;  1MH4 A;  2R9J A;  3QYT A;  1UQW A;  4PFU A;  1DSN A;  1LAH E;  3D4C A;  4H6D A;  3T9X B;  3ODB A;  2F7B A;  5H8F A;  3PUZ E;  1EH3 A;  3QUJ A;  4Q8R A;  1VFD A;  5TP9 A;  1Y1M A;  2G29 A;  2XXR A;  5IAI A;  3KFM A;  2Q88 A;  1R1N A;  4DCX A;  3EHT A;  3S2V A;  4XKR A;  2QMW A;  5KDT A;  1JVY A;  1WVJ A;  1O63 A;  4RK2 A;  4C0R A;  2ZNS A;  5ICQ A;  1N04 A;  4H0W A;  2O51 A;  4RJZ A;  3RTF B;  4NF6 A;  4DXC A;  2FA7 A;  3B6W A;  3GXA A;  4P0I A;  3O6H A;  4ND9 A;  4QF9 A;  2O1L A;  1URG A;  3U1O A;  2PX1 A;  4C1U A;  4G8N A;  3LSX A;  4OQO A;  4QFL A;  2ZMB A;  5H8S A;  2Q8J A;  1N7X A;  1R6Z A;  2H25 A;  4R72 A;  2HCA A;  4K3F A;  1HSL A;  4OFJ A;  3RT6 B;  1JNF A;  3SES A;  5AA4 A;  1UTH A;  3MVW A;  5B70 A;  3A3C A;  4IY6 A;  4KHZ E;  2X26 A;  2G93 A;  4H5F A;  2ZNT A;  1MY2 A;  1USY E;  4NMY A;  1SDX A;  2I3V A;  1TWY A;  1B4H A;  1MPC A;  3K1N A;  3PD9 A;  4YKP A;  2H5Y A;  4IO3 A;  3OO9 A;  4R2F A;  3FD3 A;  5TPA B;  5DEX A;  3TTR A;  4LQ2 A;  3RGY A;  2HZL A;  3MQ9 A;  3TKD A;  2FNC A;  3A3U A;  3OEL A;  2GH9 A;  2NXO A;  1MXZ A;  2XXP A;  2GHA A;  4YAH X;  1SW1 A;  1Y3P A;  3RUM A;  1SI1 A;  2QS1 A;  4PE5 B;  4Q0C A;  4BDR A;  2DWI A;  1DOT A;  2ZYN A;  3L6G A;  3C9H A;  4LP2 B;  3MZ9 A;  2AYS A;  5HPQ A;  2ANJ A;  4YIC A;  1B40 A;  1UIV A;  3HO7 A;  3BFT A;  3V89 B;  1DMB A;  3O97 A;  1FQB A;  3M3F A;  1ZJL A;  4GQO A;  3IX1 A;  3TYH A;  1FQF A;  4F19 A;  4ZE9 A;  1LGB C;  1I6Q A;  3S9E A;  5ITP A;  1H76 A;  4R9G A;  4H5G A;  4R75 A;  1LLS A;  3C31 A;  2I49 A;  3MUQ A;  2AL5 A;  3O28 A;  4XKQ A;  3RPW A;  1XVX A;  2DE3 A;  3TDJ A;  3RTW B;  2V3Q A;  5I58 B;  1MPB A;  1LCT A;  3IL1 B;  2QPQ A;  4OYV A;  5EHM A;  1B05 A;  1N3X A;  3PPO A;  4PFW A;  3TQL A;  3TCF A;  1S50 A;  3M8U A;  4NF8 A;  3CIJ A;  1JQF A;  1NKX A;  1AH5 A;  2XXI A;  4GWO A;  4JWO A;  1IEJ A;  1XOC A;  4QFK A;  3VVD A;  3ZKK A;  1IXH A;  3R7X A;  3E9X A;  4GL0 A;  4OWD A;  4XKN A;  1LFG A;  4GL8 A;  1MXX A;  5H8F B;  2UVH A;  1Y3Q A;  4ELO A;  4FIM A;  4JSD A;  2VHA A;  3K6W A;  1UTB A;  3TPA A;  4I62 A;  1BKA A;  2PYY A;  4IB2 A;  4NF8 B;  4ELP A;  2GFE A;  4IO4 A;  4R73 A;  1MM6 A;  5KDT B;  1YTV A;  3N26 A;  4THI A;  5I56 A;  3KZG A;  1OQH A;  3MBP A;  2DE4 A;  3CI8 A;  1B6H A;  2XXX A;  2F36 A;  3PPN A;  4H67 A;  4ZZA A;  1MQD A;  5FHN A;  4RY1 A;  3QUF A;  2ZNU A;  3VLU A;  4DZ1 A;  2I58 A;  1OQG A;  4ESW A;  3U93 A;  4EQ9 A;  3JV9 A;  4OHN A;  2IA4 A;  4ZZE A;  1XT8 A;  2HZK A;  5CMK A;  1AIV A;  4KYS A;  1B9J A;  5H8Q A;  4NE4 A;  1XS5 A;  3UP9 A;  2E1S A;  1NL5 A;  5L8D A;  1VR5 A;  1MDP 1;  3FVG A;  4IGR A;  4NF6 B;  1B58 A;  1GV8 A;  2NWJ A;  4EQ7 A;  4YZZ A;  1EZO A;  3K1M A;  1I69 A;  2ONK E;  5AE4 A;  1B5I A;  5I59 B;  3SEX A;  4N6P A;  4AB6 A;  1Q1K A;  1MQG A;  3K0V A;  4RYA A;  3RT8 A;  1B2H A;  3E3K A;  3LSW A;  4PFY A;  3T96 B;  1RKM A;  2F97 A;  1B5J A;  3DM0 A;  2XXV A;  3OSQ A;  3H6W A;  4R9F A;  2OZZ A;  2QS3 A;  3JZJ A;  4NWD A;  5EYF A;  2VD2 A;  5L9O A;  4IO2 A;  5L9M A;  3TTK A;  4YB6 A;  3PUW E;  2PVU A;  3WAE A;  4JWX A;  4OEN A;  4EQB A;  4EXL A;  1ZTY A;  2E0S A;  3KEI A;  3FVN A;  4UA8 A;  2DQV A;  2F34 A;  2Q2A A;  2ZYM A;  5DVJ A;  1I6B A;  3I6V A;  4G8M A;  3PUX E;  2I4B A;  3FAT A;  3ZS6 A;  1PEB A;  2XXH A;  1SYH A;  3PGF A;  3TCH A;  4HS7 A;  2P1S A;  3KJT A;  3O29 A;  4RA1 A;  2I3W A;  5CI5 A;  4HW8 A;  1MPD A;  5BUU A;  5L9S A;  1N76 A;  3PMW A;  2RF1 A;  3B6T A;  3S9L C;  3QIM A;  2Q9T A;  1UTH B;  2VOZ A;  4ZED A;  3K00 A;  1B0H A;  2VP1 A;  3IOU A;  3MPK A;  4IY5 A;  3TOD A;  4DCY A;  3B7D A;  3MP6 A;  3O6G A;  1OLC A;  3SDF A;  2QRY A;  2PMS A;  5KCJ B;  1F9B A;  1TT1 A;  4NTL A;  3MPL A;  4PET A;  4POX A;  4R6H A;  3IK6 B;  3G3H A;  1QKA A;  3OEK A;  3VXB A;  3KJ7 A;  1NH7 A;  3H6U A;  3UGW A;  5AA2 B;  2QSX A;  1Y1Z A;  1FQD A;  1UIU A;  2HEU A;  1OLA A;  3LSF B;  5DVI A;  5I57 B;  3CFZ A;  2ESN A;  1OVB A;  2ZXT A;  4EF1 A;  3A09 A;  1LCF A;  3MJN A;  1OVT A;  1SVX B;  4O3B A;  4PQJ A;  3IO4 A;  4XIG Q;  4ZEB A;  5HM4 B;  1B1X A;  1PB9 A;  5B7D A;  1MXU A;  1US4 A;  5AA2 D;  2UXA A;  4R6K A;  3TFL A;  1IXI A;  1B3F A;  1MY3 A;  2FYI A;  1LAG E;  4DXB A;  3GBB A;  2H98 A;  2P2A A;  4ISU A;  1B7U A;  4JBZ A;  3RN8 A;  2Y7K A;  3TAJ A;  4ESX A;  2R71 A;  1B3L A;  1QUK A;  3Q29 A;  2ABH A;  2DP8 A;  4QRZ A;  2LAO A;  1JW1 A;  2ZYO A;  2RCB A;  2XX7 A;  4F1Y A;  2I0C A;  2DXY A;  2VD3 A;  4F3S A;  5H8N B;  1IXC A;  1JW5 A;  5I58 A;  4QFO A;  5J1D A;  5I57 A;  3KSX A;  4JWY A;  4X48 A;  3MAM A;  1D9V A;  5FTH A;  1USY H;  4U23 A;  3TQW A;  3FZV A;  2F78 A;  2WKY A;  3N6T A;  1OMP A;  4LUB A;  5DT6 A;  3CSB A;  3I3V A;  2H99 A;  4R6Y A;  4WED A;  1DTZ A;  1WDN A;  2Z8D A;  3KN8 A;  2ALU A;  3M3K A;  4MFI A;  1UTB B;  5ISU A;  2DS9 A;  4F18 A;  1AMF A;  1MXV A;  4FOR A;  1FCK A;  4IO6 A;  4LA9 A;  3F11 A;  4JXI A;  4MLQ A;  4WEP A;  2V3U A;  3OO6 A;  5DTB A;  3UN6 A;  2A5T B;  1PDA A;  2O68 A;  3OEN A;  3Q28 A;  1DPE A;  4LON B;  1OIB A;  2NOO A;  2XX9 A;  2XXQ A;  4G77 A;  4GF8 A;  4JSO A;  1S9T A;  1RYX A;  2RKM A;  1MQI A;  5F1Q A;  2OWS A;  4BDO A;  3OO8 A;  2R6G E;  3H7M A;  1P1N A;  4QSE A;  3CFX A;  1LFI A;  4LZ5 A;  4OTE A;  4X9T A;  3CSG A;  4XKP A;  4E0W A;  5I59 A;  2HXW A;  5ICT A;  2QMX A;  1B52 A;  5I84 A;  1TFA A;  3GLB A;  1JVX A;  2XXT A;  4ELQ A;  3UK4 A;  3VE1 B;  1EZP A;  3FUZ A;  3KSJ A;  5BWJ A;  2B3B A;  1QJM A;  4IO7 A;  1QKB A;  3IJX B;  2Y7I A;  4QHQ A;  4Z0I A;  3CRB A;  1LAF E;  3G3I A;  2BJJ X;  3G3G A;  4ONY A;  3EHS A;  3ILT B;  1MDQ A;  1A8F A;  1N0T A;  1YAE A;  2O7I A;  4U1O A;  4LZ8 A;  4ELR A;  1POY 1;  5CC2 A;  1FTJ A;  1CB6 A;  1LBB A;  2GRV A;  3FVK A;  5H8H B;  1LB8 A;  4P11 A;  3JYR A;  4F22 A;  1PBQ A;  3MP8 A;  2ONR A;  3DLN A;  4QSC A;  4DIG A;  2A5S A;  2HFB A;  3O6I A;  3O9P A;  4FJP A;  5KCJ A;  3G3F A;  3UA8 A;  1R9Q A;  1Y4C A;  2VGQ A;  3IO6 A;  3MVZ A;  4OXV A;  1EZ9 A;  1ZIU A;  2O1M A;  3FVO A;  4QFN A;  3HV1 A;  3K6U A;  3TEL A;  4EDP A;  1DTG A;  4YB7 A;  4OEV A;  4GRK A;  1TFD A;  1SW2 A;  4LZ7 A;  1B7Z A;  1CE2 A;  3C4M A;  4NF4 A;  2DYX A;  2RC8 A;  1ANF A;  4I8C A;  2UVG A;  4ZEC A;  3V8X B;  2AIX A;  3G3K A;  3RLF E;  1Q35 A;  2O7U A;  3QK6 A;  2IEE A;  2UYF A;  1B51 A;  1A7L A;  3O2A A;  2DWA A;  3MVY A;  4G68 A;  4G8H A;  1FW0 A;  4GIZ A;  4GVO A;  4UAC A;  4X1B A;  1GGG A;  2YLN A;  4ZEI A;  1MG1 A;  4TLL B;  1B1H A;  3RY3 A;  4NED A;  4XXU A;  1SW4 A;  4GFR A;  4O3A A;  1B46 A;  3KOS A;  3BKI B;  3TTL A;  4P0G A;  1WOD A;  3G3J A;  3MVX A;  4NF4 B;  1IZ1 A;  3CG1 A;  3CG3 A;  3V5A A;  3IOT A;  4I9D A;  4KCD A;  4KYE A;  4U2R A;  2NVU B;  4AB5 A;  5CRY A;  4H8J A;  3ONM A;  3U94 A;  3T66 A;  5LOM A;  3LR1 A;  3TUS A;  2I0B A;  1B5H A;  3H3G A;  3TMG A;  4U1Z A;  3KN7 A;  1ATG A;  5JTY B;  3PPP A;  5K2Y A;  4BLA A;  4DDD A;  4Q30 B;  4U22 A;  3MZ1 A;  2A5T A;  5ITO A;  1SQY A;  3HN0 A;  4H8I A;  3BFU A;  1Z7N E;  2H9B A;  1R9L A;  5AA4 B;  4OER A;  1N84 A;  4IO5 A;  3FXU A;  2REG A;  3OOA A;  2Q89 A;  4ZEF A;  3IB1 A;  2DE2 A;  3EQ1 A;  3EHU A;  3MC2 A;  4FEC A;  3VLW A;  1FTL A;  3M3L A;  1B0L A;  2D5W A;  2I4C A;  3L6H A;  1QUI A;  3USD A;  4F29 A;  4NF5 B;  2D3I A;  3THI A;  1M5C A;  2V93 A;  2V25 A;  3MWB A;  1P1O A;  1Y20 A;  4MBP A;  2XD3 A;  4FE8 A;  2Z8F A;  3KGC A;  4KFQ A;  3H03 A;  4WKM A;  1TXF A;  3D4G A;  4BDL A;  5CM6 A;  1MM7 A;  3FXQ A;  2RCA A;  3T9H B;  5I56 B;  1KWH A;  4I1D A;  4YB5 A;  1URD A;  3QSL A;  3CR9 A;  4F3P A;  4F3B A;  2DSF A;  1B3G A;  2PBW A;  2OCU A;  2X7P A;  3C33 A;  3E4R A;  3IOV A;  3Q25 A;  1H45 A;  4H65 A;  4HCY A;  4EUO A;  1IIW A;  3K2D A;  4GD5 A;  4F39 A;  3FGS A;  1NH8 A;  3LUY A;  3PMV A;  4N07 A;  2P0S A;  3H06 B;  4G68 C;  4F3G A;  2XHD A;  1LST A;  1II5 A;  3EF7 A;  4FEB A;  4YKI A;  2DOJ A;  2UYE A;  4FAJ A;  4G2Z A;  4YMA A;  5KZT A;  1D4N A;  4KQP A;  4OFO A;  1GVC A;  1IXG A;  5IKB A;  1YPN A;  2DWJ A;  4HCW A;  4KCC A;  1MY1 A;  3PUV E;  3T9V A;  4RK9 A;  4BDN A;  3PU5 A;  1ELJ A;  2I6E A;  2ONS A;  2Y84 A;  1SD3 A;  1GTK A;  3OSR A;  3SEY A;  3VV5 A;  1FQA A;  1SBP A;  3W9W A;  1D3K A;  3TCG A;  4YMB A;  4C1T A;  1POT A;  1P1W A;  4M4G A;  1FTM A;  3GBA A;  3S4U A;  3OXN A;  1PC3 A;  1VE4 A;  1H43 A;  3KN3 A;  3UOR A;  1ZBM A;  1NNF A;  1O64 A;  3FXR A;  4BDQ A;  1P99 A;  1L5T A;  1XHY A;  3DEL B;  1MQJ A;  5TU0 A;  3VVE A;  1AOV A;  3S9M C;  1GR2 A;  1PBP A;  3ZKL A;  5FHO A;  2YPN A;  3FIR A;  4GXA A;  2RC9 A;  1RYO A;  3P7I A;  4TOZ A;  4U4S A;  4WXJ A;  3RNN A;  4ECF A;  5CBR A;  1M5B A;  1ZMG A;  2QJE A;  2V3T A;  4KD5 A;  2F7A A;  4HTG A;  1M5E A;  5DVF A;  3U72 A;  1YCJ A;  1SYI A;  3SER A;  3K02 A;  1MXW A;  1MXY A;  1BLF A;  3K6X A;  4YU0 A;  1B4Z A;  4ZE8 A;  3RQT A;  2HAU A;  2AL4 A;  3SEV A;  1I6A A;  1P1U A;  2O84 X;  3K1P A;  3R6U A;  4TQU Q;  4KPT A;  3KBR A;  1JEV A;  1XVY A;  4NWC A;  4OVJ A;  1QUL A;  4ZEK A;  3TEP A;  4F31 B;  1MQH A;  3HHG A;  3N5L A;  1FQE A;  4OMB A;  1LBC A;  1MRP A;  1VSO A;  5CBS A;  4QFP A;  3V83 A;  3MZB A;  1AL3 A;  1MY0 A;  3HPI A;  4LAT A;  1B3E A;  2OJT A;  2Z23 A;  3IAZ A;  1T0K A;  3UIF A;  4F1V A;  2O6A A;  1B32 A;  1M5D A;  4H1X A;  5FTI A;  3SEU A;  5A5X B;  3PPR A;  5I2N A;  4OET A;  4M1V A;  4GOT A;  4EXK A;  3PV0 E;  1JW4 A;  5H8Q B;  4F2O A;  2F8D A;  5CMB A;  3C36 A;  3ILU B;  3IOW A;  2Q2C A;  4KR5 A;  3B6Q A;  4LVQ A;  3W9V A;  4PFT A;  3N6U A;  3MP1 A;  3TTM A;  4DLD A;  1IQ7 A;  2F6P A;  3BBR A;  4BDM A;  4R2B A;  1PB8 A;  2F6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...