1EU8A

Structure of trehalose maltose binding protein from thermococcus litoralis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
407
structure length
407
Chain Sequence
IEEGKIVFAVGGAPNEIEYWKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIASGWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYSKPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKDGKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYAWGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYSVQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKYVNSALAGKISPQEALDKAQKEAEELVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a liganded trehalose/maltose-binding protein from the hyperthermophilic Archaeon Thermococcus litoralis at 1.85 A.
pubmed doi rcsb
source organism Thermococcus litoralis
molecule tags Sugar binding protein
molecule keywords TREHALOSE/MALTOSE BINDING PROTEIN
total genus 144
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A01
1N84A 2OLBA 3FVOA 3IOTA 3PPQA 4P11A 3TODA 2NXOA 2ZMBA 3QIMA 1MY2A 4C1TA 3SEUA 4YMAA 1S50A 2OZZA 1I6QA 2XXRA 3H6WA 1B5JA 3IX1A 3MZBA 4YU0A 3T9UA 3P7IA 1JVYA 4HW8A 2BJJX 1A8EA 2ABHA 1LLSA 4G4PA 2Z22A 3N6TA 3B6WA 4FAJA 5CBRA 5TP9B 1B05A 3VVEA 5CM6A 5H8NB 2KLFA 4NEDA 2ONSA 4PFYA 2NUVA 3GLBA 4FIMA 3MZ1A 1EU8A 1NNFA 4ELQA 1IEJA 3RNNA 1TFDA 3TQWA 3IOWA 4U21A 2UVIA 1Y1MA 3OOAA 3QUFA 4H67A 1SW4A 5CMBA 1POY1 5AA4A 2V3QA 3OENA 1LB9A 3K02A 4MLVA 3H3GA 1POTA 4U4SA 1NKXA 1FTJA 1US5A 1CE2A 1UTBA 1VFEA 4R73A 3O29A 1SVXB 1GVCA 3TZAA 1GGGA 2HZKA 1NH7A 4EXKA 2YJPA 1EH3A 1OVTA 3FXRA 1HSJA 5I2NA 4F1VA 2HQ0A 3A3CA 2DQVA 3CI8A 3K6UA 4GRKA 4RA1A 5FTIA 3T96B 4F3GA 2UYFA 3TTKA 3IJXB 2P2AA 2Y7KA 2H9BA 2F36A 4U23A 1A55A 1XVYA 4ZEBA 4ESWA 4F19A 2ZYMA 4H65A 4H1XA 1B9JA 3KN7A 3K01A 1UQWA 1B4ZA 3FJGA 3OMBA 3IB1A 1Z7ME 1QKAA 2IA4A 3FATA 3GXAA 5TPAB 3V83A 4OVJA 3DP8A 1II5A 3QXMA 2QL3A 1NNKA 3FGSA 1MH3A 2ANJA 2PX1A 3ZS6A 2I3WA 2Y7RA 1B7ZA 4ZDMA 4LZ8A 5AA1A 3VE1B 1MG1A 4H5FA 3VLVA 4EUOA 4F3BA 3MP8A 1H76A 4NF4A 2CZLA 4JSOA 2O1MA 3RT6B 4UA8A 1DOTA 4X9TA 5FHOA 3DM0A 3M3LA 1S7YA 4LQ2A 4QHQA 4R75A 2ZNUA 5K2YA 1XC1A 4I1DA 3PGFA 1Y3QA 4ZS9A 4WEDA 4XKNA 1M5BA 4ZECA 1MQHA 2B3BA 3W9WA 5B70A 1MDP1 1AMFA 1NL5A 4NWCA 2RKMA 3PUVE 3W9VA 5AA2B 1BKAA 1GR2A 1USYH 2XXTA 3K4UA 4KYDA 3SEWA 4DE8A 3PPNA 1USYE 5L9OA 3R26A 2HCAA 4HCYA 2DSFA 5KCJB 2H99A 2DWJA 2AL4A 1Q1KA 3K1PA 3E3KA 2XXIA 3TEPA 2DE4A 4F1UA 5I59B 2VP1A 1QULA 2NOOA 3DP6A 2Q2CA 3SEYA 3KSXA 5A5XA 2ESNA 1JETA 4BDQA 4DIGA 3GBBA 4I9DA 4ISUA 3KBRA 1Q35A 4NF5B 2O51A 3VXBA 4C0RA 5DVFA 5KDTA 1UTHA 4ZZEA 5KZTA 3PUWE 4YICA 2F7CA 1I6AA 5L9SA 4NF4B 4N07A 1BIYA 2HEUA 4ZEIA 3E4RA 2XD2A 2D21A 4I62A 1NMUA 1XHYA 4PFWA 1T0KA 2M8CA 4QFKA 1LBCA 4OHNA 2CMOA 3H6VA 4E0WA 4THIA 3RGYA 1A7LA 2Q89A 3PD8A 4TLMB 5F1QA 1MY3A 1PBPA 1QVSA 3JZJA 3FZVA 1LAGE 1N7XA 2XXHA 3EHSA 4LQ5A 3CFLA 3THIA 3C36A 3FVGA 2R9JA 1IQ7A 3OO9A 4R2BA 3V89B 1ZJLA 2XXWA 3OO8A 3C9HA 2DVCA 3MVWA 1A54A 5JK4A 2DYXA 2DE3A 4BDNA 3HHGA 4F3SA 2YLNA 1LFHA 4NF8A 4UACA 1FQDA 3FV2A 4IO7A 1L5TA 3FV1A 5H8FB 2GFEA 1BTJA 4XTCQ 2ZYNA 4FORA 4KI0E 4RK9A 5DTBA 3S9EA 2ZXTA 1HSLA 2DXRA 5I57A 2A5SA 2THIA 2F78A 3KZGA 4LUBA 3TCGA 4F22A 3U94A 2R6GE 1I69A 3LSFB 4U22A 1D4NA 4DCYA 5I84A 3K2DA 3T9XB 4PE5B 4ELRA 5AA4B 5I2KB 1ATGA 1B7HA 2H5YA 4QFLA 2P0SA 3O2AA 1DSNA 3U93A 1MQGA 5FHNA 1IXIA 2Y7IA 2F97A 1JEVA 3UGWA 2QPQA 4ZE9A 5AE4A 2ZYOA 4IB2A 1B1XA 3PUYE 5H8NA 3CG3A 2D3IA 5TP9A 3ONMA 1MXVA 3CVGA 3FASA 3FVKA 4HS7A 4Q5TA 4QFPA 4C1UA 3G3JA 3SESA 3EHTA 3TMGA 4POXA 3RLFE 3UORA 4ZZAA 5DEXB 4NTLA 4U1OA 1AOVA 3TKDA 1SW2A 2D5WA 3Q27A 1WODA 3PD9A 1QUJA 2F34A 3T9HB 3LSXA 1VSOA 2X26A 3VVFA 1FQEA 1AH5A 2F6PA 4KR5A 2Q2AA 1B52A 1MY1A 2DWHA 3OSRA 4KYSA 4R9GA 3PPRA 3V8XB 4FECA 4EDPA 4O3AA 3SEXA 4H6DA 1EZOA 4OXVA 4R2FA 1DTGA 1DPPA 4F2OA 3HCQA 1Z7NE 2Z8EA 4X1BA 5BWJA 1B3LA 1B3FA 1MM6A 3K6XA 2RINA 5CMKA 1AIVA 1IXGA 5H8HB 3H4ZA 2I6EA 5L9MA 3BBRA 2RC9A 3IO4A 3W15C 3B7DA 4DZ1A 1FTMA 3N94A 1SI0A 1B3EA 2YPNA 2DE2A 1PC3A 5B7DA 4OTEA 1IXCA 5EHSA 1OMPA 2OCUA 4WKMA 2Q8JA 2VGQA 3KJ7A 1M5FA 1QUIA 3LR1A 4YAHX 5HPQA 1SYIA 1M5CA 1UIUA 3MUQA 2F6GA 4NF6B 2RCBA 3IOVA 1MM7A 2ZNSA 2G29A 3IOUA 3MVXA 2AL5A 3TTRA 3DLNA 3PMVA 4U2RA 3M3FA 3Q25A 2V84A 2DWAA 2F7BA 2H98A 2RC7A 2VOZA 4RXLA 2X7QA 5KCJA 4GIZA 1B7UA 1ZLQA 1B6HA 1RYOA 3EF7A 5M2VA 5I58B 1SI1A 4R6HA 2V93A 4YKIA 3FIRA 5HM4B 5ICTA 4ELOA 5JEIA 1Y4TA 3U72A 1R1NA 2GH9A 2OWSA 1NNTA 3CRBA 3CSGA 3S9NC 4AB5A 4O3CA 3FD3A 3HN0A 1P1UA 3FXUA 4O3BA 1B4HA 4GD5A 1LCTA 1ZTYA 2ALUA 4R6YA 4ZEKA 1ZIUA 1D9YA 1PB9A 4LZ5A 4LATA 3L6GA 2DXYA 2O1LA 3ECRA 5JTYB 1QKBA 1FQFA 3R6UA 3TCFA 2WKYA 4G8HA 3KN3A 4RNSA 1LAHE 1URGA 1EZ9A 1Y1ZA 3O28A 1P1WA 2QJEA 3N6UA 3QUJA 4KYEA 4OMBA 1Y9UA 3VDFA 4U1ZA 1P1OA 1IITA 3WAEA 1M5DA 5DEXA 1DPEA 4OEUA 4G68A 4H0WA 1FTKA 5AA2D 5CMMA 3ZSFA 3DP4A 4BDRA 1MPCA 1H45A 1NFTA 2XX9A 3KOTA 1QJMA 3PMWA 4HCWA 4FEDA 1RYXA 3TTNA 1FTOA 4ECFA 4Q8RA 3E13X 3QYTA 4XKPA 5EYFA 1MXZA 4PQJA 2XD3A 4LONB 4IO6A 4QFOA 1FQCA 1B5HA 4JWXA 2UVJA 3K00A 3IL1B 1H44A 4DDDA 4OFOA 3C4MA 3MAMA 3BFUA 2HAUA 4ZE8A 4GXSB 3K0VA 1MXUA 4IGRA 4QFNA 3USDA 3EPEA 4LP2B 1A99A 3FVNA 1JW4A 1UTBB 1PBQA 3PMXA 4JB7A 1VE4A 2QS4A 3OXNA 4H8JA 1WDNA 3O9PA 4OENA 4I8CA 3H06B 4NF8B 4TQUQ 4GWOA 1B2HA 1D9VA 3OO6A 3V5AA 4E0XA 1SBPA 1OQGA 4G8NA 2I4CA 1SQYA 2PMSA 2OWTA 4GXAA 3QAXA 4R9FA 3FXQA 1R9LA 3KJTA 2QMXA 1URSA 4PP0A 1ZBMA 1R9QA 3UN6A 3IAZA 2ZNTA 1B3GA 2UYEA 2O84X 4GFRA 4MLQA 1GV8A 5DT6A 3SKPA 4PFUA 2G93A 3SERA 3IO6A 4G68B 1GTKA 5TU0A 4OFLA 3CR9A 1R6ZA 4F31B 2XXYA 1ZU0A 4G8MA 4LVQA 4BDOA 4K3FA 4RPOA 4FATA 5H8QB 3CFZA 5K2XA 1P99A 3KN8A 4TLLB 1SD3A 4H8IA 1O63A 2XXQA 3LSLA 3CIJA 3KEIA 1TWYA 1OIBA 4NF5A 5KDTB 2XXXA 3S2VA 4F18A 2A5TB 1JW1A 1LFIA 2GHAA 5A5XB 4DXCA 1O64A 2O7UA 2I48A 1FQAA 4ONYA 3T93B 4GVOA 2DOJA 4BDLA 2O68A 5I59A 3C34A 4EF1A 4TOZA 1VR5A 3FJMA 1M5EA 3H6UA 3C32A 2F5XA 3LBSA 3SEVA 1OQHA 3BFTA 3K6WA 3VV5A 2DWIA 5DYHA 4IO2A 4DCXA 5IAIA 2QS2A 2ZYKA 1AL3A 1FCKA 1N7WA 2PYYA 1BLFA 3LSWA 1DMBA 5AA2A 4ESXA 4RPNA 4JBZA 3N26A 3K1MA 3IB2A 4JDFA 3TUSA 1HSEA 1JEUA 1ZKBA 3N5LA 3JYRA 3K6VA 1URDA 4OFJA 3T66A 1A8FA 3MPKA 5L8DA 3VFJA 1LAXA 3VLWA 1P1NA 3EQ1A 4NMYA 4F1YA 4OWDA 3PUXE 3RY3A 2E1SA 2P1SA 4IY6A 2Y7WA 3OEMA 4LA9A 2O7IA 1MQJA 4XKQA 3KOSA 3TELA 1SW5A 2I0BA 5I56B 1A40A 3RPWA 4BDMA 1OLAA 3RUMA 3IORA 2FA7A 3KSJA 2DP8A 2QS3A 1YTVA 4OQOA 3CSBA 3HPIA 4DLDA 5I56A 1I6BA 2H4IA 3EHUA 1XVXA 4JXIA 5TPAA 4F2QA 1JW5A 5FTHA 2GHBA 2QRYA 2B3FA 1H43A 1N0TA 2QSXA 5FHMA 2PBWA 4YMBA 3VLUA 1B40A 1CB6A 1QW0A 3CFXA 4OETA 2W7YA 3TCHA 3MBPA 4OYVA 4G77A 3S4UA 2XHDA 3LC8A 4OERA 4M1VA 5ITPA 2AIXA 3QK6A 4N13A 3K1NA 4IGTA 4MF3A 4AB6A 4Z7EA 1P1QA 4ZEDA 3QSLA 4YKPA 4GOTA 4KCCA 2XXVA 4RK2A 1SDXA 3WAFA 4MFIA 4L17A 1US4A 4YB6A 3KG2A 1N3WA 2Y84A 1LCFA 3G7WA 4LZ7A 3S9MC 1ANFA 1N3XA 5CC2A 3AXFA 1PEBA 4M4GA 1MS7A 2VD3A 3L6HA 3LUYA 4QSEA 4G68C 4RY1A 4F3PA 1QUKA 2B65A 1LGBC 2HXWA 3I3VA 3Q26A 1B46A 1SYHA 3TFLA 3OEKA 1WVJA 1XT8A 3O97A 2Y7PA 4NE4A 4BLAA 5I2KA 3FJ7A 3H03A 2RF1A 4DXBA 2UVGA 3TAJA 2ONRA 2QMWA 3UK4A 4DXUA 4EQBA 1MXYA 1MXWA 2FNCA 3ILTB 4IY5A 3HSTA 3Q28A 1JQFA 3U8QA 5I57B 1N04A 4GQOA 3RT8A 1O7TA 3RTWB 2HAVA 4KQPA 4X1DA 1J1NA 1OVBA 4GL0A 4Q30B 3UIFA 3VXCA 1EZPA 3D4CA 4P0IA 4KFQA 5F7VA 3M8UA 3RTFB 1MQDA 5H8FA 3PPOA 4H5GA 1PDAA 2ONKE 1Y3PA 4QF9A 5CMCA 1TXFA 5LOMA 1YPNA 3JV9A 4KHZE 3O66A 3MVZA 3IJOB 4F29A 1DTZA 1PB7A 4OESA 4XIGQ 3RN8A 1MPDA 3R7XA 4EF2A 3TDJA 5CRYA 5ISUA 3IK6B 5EHMA 4POWA 4EXLA 2F8DA 1B58A 4GL8A 2I3VA 1B1HA 4JWOA 2Z8FA 4XXUA 4OZ9A 3MQ9A 1IZ1A 3H7MA 4EQ7A 2Q9TA 1BP5A 2REGA 3E9XA 4U4XA 2O6AA 3H6TA 4GF8A 4R72A 2DS9A 1ZMGA 4YB7A 3IB0A 3FUZA 1UTHB 2GRVA 2I58A 3B6QA 1XS5A 3O6HA 4FJPA 4WXJA 3I5OA 3U92A 3ZKKA 4EQ9A 1LAFE 2XX8A 3M3KA 2PT1A 4F39A 1FTLA 4XKRA 4YKJA 3TTMA 3UP9A 1XOCA 1YCJA 2PT2A 3G3KA 2IEEA 3I6VA 1TT1A 4HTGA 4N6PA 3TPAA 1FQBA 5CBSA 1TFAA 1NNPA 2VHAA 1H3DA 4KPTA 3C33A 3GBAA 3MWBA 3GZGA 1SW1A 3OD7A 4IO5A 2OBGA 3KFMA 4X48A 3SETA 1KWHA 1MY4A 1S9TA 2RCAA 2FYIA 2RC8A 3RQTA 4KD5A 1LBBA 4RYAA 3TTLA 3TYHA 3HHFA 4NWDA 2I4BA 2UVHA 2XXUA 1NH8A 2OK2A 3MJNA 2NWJA 5IKBA 4PETA 2OJTA 5JTYA 1JVXA 1N76A 2AYSA 3ZKLA 4ND9A 1MQIA 3KGCA 3CG1A 3G3IA 2LAOA 4R6KA 2H25A 1IXHA 3OSQA 1UIVA 2XXPA 2X7PA 2PVUA 3MPLA 3OO7A 5AA3A 1D3KA 1JNFA 1B0LA 1Y3NA 3MC2A 3G3FA 1LSTA 4KCDA 4MH5A 3G3HA 1VFDA 4FEBA 3DELB 4GLIA 2Z23A 1IUDA 3MZ9A 4R74A 5ITOA 5I58A 4AQ4A 1Y20A 3HV1A 3O6GA 3PV0E 4JWYA 4PFTA 4QSDA 1Y4CA 1MH4A 1B0HA 2R71A 1MXXA 3HO7A 2I0CA 3PUZE 2UXAA 2F7AA 4FE8A 2HZLA 2XX7A 4Z0IA 2NVUB 1PB8A 3MP6A 4NF6A 5ELVA 1MPBA 3U1OA 2I49A 4YB5A 5DVJA 1B3HA 4IO4A 3D4GA 4ZEFA 2E0SA 3A09A 5HBCA 3VVDA 3MW0A 1YAEA 3OELA 3PU5A 4JSDA 2Q88A 1LB8A 2V3TA 4RJZA 2F35A 2HFBA 3C31A 4G2ZA 4WEPA 5CI5A 4YKKA 3ILUB 5I2NB 3TQLA 5J1DA 1ELJA 3SDFA 1B32A 1MY0A 3S9LC 2V25A 3T22A 1FW0A 3C35A 4IO3A 5H8HA 5DVIA 4YZZA 1RKMA 4MBPA 1MRPA 4QRZA 2V3UA 3BKIB 1B51A 3T9VA 3F11A 3UA8A 4ELPA 3Q29A 5ICQA 1MDQA 3EN3A 2A5TA 1OLCA 2QS1A 2REJA 3B6TA 3IR1A 4Q0CA 2DVZA 3MP1A 3ODBA 4P0GA 1IIWA 1B5IA 2VD2A 1LFGA 1F9BA 3G3GA 3O6IA 3A3UA 3MVYA 5H8SA 5BUUA 4OEVA 2Z8DA 3PPPA 4QSCA 5H8QA 2O69A
chains in the Genus database with same CATH superfamily
1N84A 2OLBA 4P11A 3TODA 2ZMBA 3QIMA 4C1TA 1IMFA 2XXRA 3H6WA 4YU0A 3P7IA 1JVYA 5TP9B 3VVEA 2KLFA 2ONSA 4PFYA 2UVIA 1POY1 2V3QA 3H3GA 5ET8A 3TZAA 2CZKA 2YJPA 1EH3A 2DQVA 5FTIA 2H9BA 1NV3A 3KN7A 3PTYA 4DI3D 4I3YA 1II5A 3BIGA 5FHOA 4LQ2A 1S7YA 5K2YA 4R75A 4ZS9A 5B70A 4NWCA 2RKMA 5LTCA 1USYH 2WEFA 2CEYA 1USYE 3R26A 2HCAA 3E3KA 1LBVA 4F1UA 1QULA 3KSXA 4BDQA 3ROJA 3GBBA 4I9DA 5DVFA 2F7CA 5L9SA 2HEUA 2XD2A 5DW8A 4QFKA 2CMOA 3H6VA 4THIA 3JZJA 1N7XA 3C36A 4R2BA 1ZJLA 3C9HA 3MVWA 2B4MA 1L5TA 2GFEA 4FORA 4RK9A 2F78A 3KZGA 2R6GE 3LSFB 1D4NA 4PE5B 1ATGA 1B7HA 4MEVA 2P0SA 3O2AA 1DSNA 3U93A 4XF5A 5FHNA 2Y7IA 5AE4A 1B1XA 5TP9A 3FVKA 4C1UA 3TMGA 3RLFE 4ZZAA 5F24A 3TKDA 2HPGA 1FPEA 2F6PA 4KR5A 2Q2AA 3OSRA 3V8XB 4FECA 4O3AA 3SEXA 1DPPA 3HCQA 1Z7NE 2Z8EA 5BWJA 3H4ZA 2I6EA 3W15C 4DZ1A 2YPNA 2DE2A 5B7DA 4OTEA 3E78A 2VGQA 4GWWA 1SYIA 3QMFA 3MUQA 2ZNSA 2ZZXA 2G29A 2QFLA 2F7BA 1ZLQA 4R6HA 3FIRA 5HM4B 2GH9A 2OWSA 1XI6A 1LCTA 3RPLB 4PF8A 2FIEA 1FQFA 1Y1ZA 1M5DA 5DEXA 5AA2D 4BDRA 5EYHA 1MPCA 1H45A 3GYYA 2HHMA 4Q8RA 1FTOA 4XKPA 5EYFA 1MXZA 4PQJA 1FBCA 4MIJA 2XD3A 4QFOA 4NG7A 3EPEA 4LP2B 4GWXA 3VVFA 4H8JA 3OXNA 1WDNA 2Q8MA 3H06B 3ISPA 4E0XA 2I4CA 4R9FA 3FXQA 3KJTA 1URSA 1ZBMA 3IAZA 1RDZA 2UYEA 1GV8A 3SKPA 3SERA 1EYKA 1R6ZA 2XXYA 1ZU0A 4BDOA 2BJIA 4K3FA 5EYGA 5H8QB 3CFZA 4PFIA 1SD3A 3LSLA 5KDTB 4DI4B 2Q74A 1LFIA 2O7UA 2I48A 4ONYA 2DOJA 4EF1A 4MJOA 1VR5A 2F5XA 4DCXA 3VV5A 1AL3A 1FCKA 1N7WA 1DK4A 4JBZA 4JDFA 3N5LA 3JYRA 5FBPA 1A8FA 3VLWA 3VFJA 1LAXA 4F1YA 4OWDA 4LA9A 3TELA 2Y7WA 2FVZA 2I0BA 1A40A 3IORA 2FA7A 4DLDA 5I56A 1AWBA 1I6BA 1NV6A 4MAGA 5FTHA 2GHBA 1RDYA 4NF0A 5FHMA 4YMBA 3VLUA 3MBPA 4OYVA 4OERA 4IR8A 1QGXA 5ITPA 3QK6A 2XXVA 3WAFA 4L17A 4YB6A 3G7WA 3S9MC 1ANFA 5CC2A 4AS4A 5ET6A 4GBVA 4OVTA 3H03A 2UVGA 3ILTB 3HSTA 4GQOA 4GL0A 3UIFA 3RTFB 1NI9A 3M8UA 1KA1A 1YPNA 4OESA 1IMEA 1MPDA 5ISUA 4POWA 4EXLA 2F8DA 4GL8A 4N81A 3H6TA 4R72A 3I5OA 4EQ9A 3M3KA 2PT1A 4F39A 1LBZA 1YCJA 3I6VA 4N6PA 5T3JA 1TT1A 1NNPA 4IO5A 2OBGA 1KWHA 5EQAA 4RYAA 3TYHA 2XXUA 3MJNA 4PETA 2WYPA 3B50A 2H25A 5I5PA 2X7PA 1VFDA 2Z23A 3E79A 5IZZA 1FPIA 2XXKA 4JWYA 1MH4A 2OWZA 3HO7A 2UXAA 2F7AA 2XX7A 3MP6A 4NF6A 5ELVA 5DVJA 3A09A 4H46A 1YAEA 1IMCA 3PU5A 4WEPA 4JSDA 2Q88A 1SPIA 4G2ZA 3ILUB 1ELJA 3SDFA 3S9LC 5H8HA 1RKMA 4ELPA 1K9YA 3EN3A 2A5TA 2QS1A 2DVZA 1IIWA 1B5IA 2VD2A 5H8SA 1CNQA 2Z8DA 3PPPA 4GX4A 2O69A 2NXOA 4MNPA 2OZZA 3IX1A 1B5JA 2BJJX 2ABHA 2L5VA 3U65A 1LLSA 4G4PA 3N6TA 4FAJA 5CBRA 5CM6A 5H8NB 4NEDA 4ELQA 1IEJA 1Y1MA 3QUFA 5CMBA 1LB9A 4R73A 1US5A 1UTBA 4I40A 3O29A 1GVCA 5ICTA 1KA0A 1OVTA 4F1VA 4GRKA 4O7MA 4RA1A 2UYFA 3TTKA 2ZYMA 3K01A 1B4ZA 3IB1A 2IA4A 1QKAA 3FATA 3DP8A 2QL3A 3FGSA 1MH3A 3VLVA 4F3BA 2PFZA 4DDDA 1H76A 4JSOA 4N15A 3M3LA 5EQ9A 4I1DA 4PGNA 1M5BA 4ZECA 4PAFA 3W9WA 1MDP1 1GR2A 2XXTA 3K4UA 4PFRA 5L9OA 4HCYA 2DSFA 5KCJB 1FJ9A 2AL4A 4PDHA 5I59B 2VP1A 3DP6A 4NAPA 1JETA 4DIGA 5KDTA 1Q35A 3VXBA 3PUWE 4YICA 4NF4B 4ZEIA 2D21A 4I62A 1FBDA 1T0KA 4OHNA 4N17A 4E0WA 1QVSA 1PBPA 1LAGE 3EHSA 3FVGA 2R9JA 1IQ7A 3OO9A 3OO8A 4MHFA 1A54A 4UABA 2DE3A 4BDNA 1LFHA 4UACA 3FV2A 3FV1A 4XTCQ 2ZYNA 4KI0E 3S9EA 1YXIA 2A5SA 4U22A 4DCYA 4ELRA 5AA4B 2H5YA 2FHYA 1MQGA 2MKZA 4IB2A 3PUYE 4Q5TA 3FASA 4QFPA 1FSAA 4POXA 5DEXB 4NTLA 4U1OA 1AOVA 1SW2A 2D5WA 1WODA 2VPNA 2F34A 3LSXA 1VSOA 4GWUA 2WBDA 1MY1A 2DWHA 4KYSA 4H6DA 4OXVA 2R8TA 1B3LA 5CMKA 4GX6A 2RC9A 2XWVA 3B7DA 1B3EA 1IXCA 5EHSA 1QUIA 1FBHA 4MX6A 2F6GA 3DLNA 1NV2A 2VOZA 2X7QA 5KCJA 1B7UA 5I58B 1RYOA 5M2VA 4YKIA 2V93A 3U72A 4OA4A 1NV5A 3S9NC 4O3CA 3HN0A 1P1UA 4ZEKA 1ZIUA 1D9YA 4LZ5A 5JTYB 1QKBA 3R6UA 2WKYA 4RNSA 4KYEA 2QJEA 3QUJA 3WAEA 1Y9UA 1IITA 1FTKA 4LN5A 3ZSFA 3PMWA 2XX9A 5AA3A 3IFCA 4HCWA 4FEDA 4NGUA 4JVIA 4LONB 1B5HA 4JWXA 3IL1B 3C4MA 3BFUA 2HAUA 3K0VA 1MXUA 4P1LA 3FVNA 5EQ7A 1JW4A 4JB7A 1FPLA 4GWOA 3OO6A 1SBPA 2PMSA 1SQYA 2OWTA 1R9LA 4PP0A 1R9QA 4JVDA 4PCDA 4XFEA 4MLQA 1GTKA 5TU0A 4OFLA 4F31B 4G8MA 4LVQA 4OVQA 4FATA 2XXQA 1TWYA 1OIBA 2XXXA 2A5TB 2GHAA 3T93B 1G0IA 5I59A 3C34A 3H6UA 1FPGA 3SEVA 3K6WA 2DWIA 1BLFA 1DMBA 4RPNA 3IB2A 1JEUA 1DCUA 5L8DA 3EQ1A 4PTKA 2XWIA 3RY3A 4IY6A 1MQJA 3KSJA 2QS3A 1YTVA 4OQOA 3HPIA 1XVXA 3CFXA 3TCHA 2W7YA 4MNCA 4G77A 2XHDA 3LC8A 4M1VA 4N13A 4ZEDA 4MF3A 4GOTA 3AXFA 1PEBA 4RY1A 1MS7A 1QUKA 2CZIA 4HE0A 1B46A 1SYHA 4HXVA 3OEKA 1LEVA 3O97A 4DXBA 4DXUA 4EQBA 3U8QA 1N04A 1O7TA 2HAVA 4X1DA 1OVBA 1EZPA 3VXCA 4H5GA 1PDAA 2ONKE 3MVZA 4XIGQ 3RN8A 3R7XA 4EF2A 3NOHA 4XEQA 1G0HA 3IK6B 5EHMA 1B58A 1B1HA 3H7MA 2REGA 3E9XA 2DS9A 1UTHB 2GRVA 1VDWA 4FJPA 5I3SA 1LAFE 2PT2A 3FBPA 2IEEA 1FQBA 1TFAA 3GBAA 3GZGA 1SW1A 2WBBA 3HHFA 2UVHA 2NWJA 5IKBA 2F3BA 1JVXA 4HE1A 1NV7A 3CG1A 3G3IA 2LAOA 3OSQA 3MPLA 3OO7A 1D3KA 4KCDA 1B0LA 1Y3NA 3MC2A 3MZ9A 5ITOA 5IM2A 5I58A 1YZ0A 4QSDA 1B0HA 2R71A 3PUZE 2WYKA 2NVUB 1MPBA 1B3HA 5HBCA 3VVDA 3OELA 1LB8A 2V3TA 4EXKA 3C31A 1B32A 2QVVA 2V25A 3T22A 3C35A 4IO3A 1FBEA 4YZZA 3UA8A 2V3UA 3T9VA 3F11A 1OLCA 3IR1A 4PFBA 1LFGA 3MVYA 2Y5LA 3FVOA 3IOTA 3PPQA 1MY2A 5IGAA 1S50A 3MZBA 1I6QA 4HW8A 4NN3A 1A8EA 2WX9A 2Z22A 3B6WA 4FIMA 1EU8A 4QBAA 3TQWA 4U21A 5AA4A 3K02A 1POTA 4U4SA 1FTJA 1CE2A 1SVXB 2HZKA 1NH7A 4N6DA 5I2NA 2HQ0A 3A3CA 3T96B 4KXPA 3IJXB 2P2AA 2Y7KA 4ZEBA 4ESWA 1XVYA 4H65A 4H1XA 1B9JA 3FJGA 1EYJA 1Z7ME 4OVJA 3QXMA 1NNKA 1IMBA 2ANJA 5ET7A 4LZ8A 4ZDMA 3VE1B 4H5FA 3MP8A 4NF4A 2O1MA 1XC1A 3PGFA 1Y3QA 4OVPA 4WEDA 4XKNA 1AMFA 1NL5A 3W9VA 1INPA 4KYDA 3PPNA 4GX3A 2DWJA 1Q1KA 3K1PA 2XXIA 2Q2CA 2ESNA 3KBRA 4C0RA 2O51A 4ZZEA 5KZTA 1I6AA 2HXRA 4N07A 3RGYA 4NX1A 3PD8A 4TLMB 5F1QA 3FZVA 4LQ5A 2XXWA 4OANA 4X8RA 4MMPA 2DYXA 4F3SA 3LV0A 2ZZWA 5H8FB 4O94A 5DTBA 2ZXTA 1HSLA 5I57A 4LUBA 2CZHA 3TCGA 3U94A 3K2DA 5I2KB 4QFLA 2F97A 1JEVA 2QPQA 1NV1A 2ZYOA 5H8NA 2D3IA 3ONMA 1MXVA 4HS7A 1FPFA 3SESA 3EHTA 3T9HB 2JJKA 2X26A 1FQEA 3VDFA 1B52A 3PPRA 1EZOA 4R2FA 1DTGA 1B3FA 1MM6A 2RINA 1IXGA 2QVRA 3BBRA 5L9MA 3IO4A 1OMPA 2OCUA 4WKMA 1LBWA 3KJ7A 3LR1A 4YAHX 5HPQA 1NUWA 1UIUA 3IOUA 3D1RA 3MVXA 3PMVA 4U2RA 2V84A 2DWAA 4N91A 4RXLA 4GIZA 1B6HA 1SI1A 1NV0A 4ELOA 3MYUA 1Y4TA 1R1NA 3CRBA 3CSGA 1NNTA 3FD3A 1B4HA 1PB9A 3L6GA 2DXYA 3ECRA 1JP4A 3TCFA 5J16A 4G61A 4G8HA 3KN3A 1LAHE 3O28A 3N6UA 4OMBA 1NUYA 4U1ZA 1DPEA 4G68A 4H0WA 4MCOA 5CMMA 3DP4A 1NFTA 3TTNA 1RYXA 4ECFA 1FQCA 3K00A 1H44A 3SZPA 4OFOA 3MAMA 2FIXA 4ZE8A 4IGRA 1FPKA 1UTBB 1PBQA 3PMXA 3T66A 2QS4A 4OENA 1B2HA 4GXAA 1OQGA 3QAXA 2ZNTA 2O84X 4PAIA 4RPOA 3CIJA 3KEIA 4NF5A 1NUXA 1FPDA 1JW1A 5A5XB 1FQAA 2O68A 4TOZA 1FBPA 3FJMA 1M5EA 3C32A 5DYHA 5IAIA 3LSWA 2PYYA 4N8GA 4ESXA 3N26A 3K1MA 3TUSA 3K6VA 1URDA 4NMYA 3KC1A 2E1SA 2P1SA 2P3VA 3KOSA 1OLAA 2DP8A 3CSBA 4JXIA 5TPAA 4N4UA 4F2QA 1JW5A 2B3FA 1N0TA 2QSXA 1CB6A 3S4UA 4IGTA 4Z7EA 1P1QA 3QSLA 4KCCA 4RK2A 1SDXA 4MFIA 1US4A 2VPOA 3KG2A 1FJ6A 1LCFA 3L6HA 4G68C 2B65A 4NHBA 2HXWA 3I3VA 3Q26A 3TFLA 1XT8A 2Y7PA 3FJ7A 3TAJA 3UK4A 1JQFA 5I57B 3RT8A 4P0IA 5F7VA 1Y3PA 4QF9A 5CMCA 3JV9A 5LDZA 4O7IA 1PB7A 3KC0A 5CRYA 2I3VA 2Z8FA 4OZ9A 3MQ9A 1IZ1A 4EQ7A 1BP5A 4GF8A 3FUZA 3B6QA 2I58A 3U92A 3ZKKA 5ET5A 4XKRA 4YKJA 3TTMA 3UP9A 1XOCA 4HTGA 2VHAA 1H3DA 3C33A 3MWBA 3OD7A 3KFMA 1MY4A 2RC8A 2RCAA 4HE2A 3RQTA 4KD5A 1LBBA 4NWDA 2I4BA 2OJTA 5JTYA 2KQZA 1N76A 2AYSA 3ZKLA 4ND9A 1MQIA 4PE3A 2PVUA 1JNFA 3G3FA 3G3HA 4FEBA 4GLIA 4R74A 1IUDA 2XWKA 1Y20A 3HV1A 3PV0E 4PFTA 2I0CA 2HZLA 1PB8A 3U1OA 2I49A 4YB5A 3D4GA 3A29A 2HFBA 4YKKA 5CI5A 3TQLA 5J1DA 1MY0A 4PF6A 5DVIA 4QRZA 1MRPA 3BKIB 1B51A 3KBZA 5ICQA 2OX3A 4Q0CA 3MP1A 3ODBA 4P0GA 3O6IA 3G3GA 3A3UA 3T1BA 4OEVA 5H8QA 4P9KA 3SEUA 4YMAA 5IZ3A 3T9UA 4H45A 1FPJA 1B05A 2NUVA 3GLBA 3MZ1A 1NNFA 1K9ZA 3RNNA 1TFDA 3IOWA 4H67A 3OOAA 1SW4A 3OENA 4MLVA 1NKXA 1VFEA 1GGGA 2PCRA 3FXRA 1HSJA 4OVRA 3CI8A 3K6UA 4F3GA 2VT5A 2F3DA 2F36A 1A55A 4U23A 4F19A 1UQWA 3OMBA 3GXAA 4P47A 5TPAB 3V83A 1D9QA 5I7IA 2PX1A 3ZS6A 2I3WA 2Y7RA 1B7ZA 4PBHA 5AA1A 4EUOA 5JEIA 1MG1A 2XWOA 1FRPA 2CZLA 4UA8A 1DOTA 4X9TA 3DM0A 4QHQA 2ZNUA 5ESYA 1MQHA 2B3BA 1LBXA 3PUVE 5AA2B 1BKAA 4P3LA 3SEWA 4DE8A 1FTAA 2H99A 3EKIA 3TEPA 2DE4A 2NOOA 3SEYA 5A5XA 4P8BA 4ISUA 4NF5B 3BIHA 4PDDA 1UTHA 1BIYA 3E4RA 1NMUA 1XHYA 4PFWA 2M8CA 1LBCA 1A7LA 2Q89A 1MY3A 2XXHA 3CFLA 3V89B 2DVCA 5JK4A 3HHGA 4P1EA 2YLNA 4NF8A 1FQDA 4IO7A 1BTJA 2DXRA 2THIA 4GBWA 4F22A 1FBFA 1I69A 5I84A 3T9XB 4JVCA 1NUZA 3T0JA 1IXIA 3UGWA 4ZE9A 4PBQA 1FBGA 3CG3A 3CVGA 3G3JA 5EQ8A 3UORA 3Q27A 3PD9A 1QUJA 4GWSA 1AH5A 4R9GA 1DBZA 4EDPA 2V4CA 4F2OA 4X1BA 1FPBA 3K6XA 1AIVA 5H8HB 1FTMA 3N94A 1SI0A 1PC3A 2Q8JA 1M5FA 1M5CA 2FBPA 4NF6B 2RCBA 3IOVA 1MM7A 3TTRA 2AL5A 3M3FA 3Q25A 2H98A 2RC7A 2PFYA 2QVUA 4PGPA 3EF7A 4AS5A 2Y5KA 4AB5A 3FXUA 4O3BA 4GD5A 1ZTYA 2ALUA 4R6YA 5A5LA 4LATA 2O1LA 4I3EA 1URGA 1EZ9A 1P1WA 1P1OA 4OEUA 3KOTA 1QJMA 3E13X 3QYTA 4IO6A 2UVJA 4GXSB 3CHGA 4QFNA 3USDA 3RYDA 1A99A 4FBPA 3HFUA 1VE4A 3O9PA 4I8CA 4NF8B 4TQUQ 1D9VA 3V5AA 4G8NA 4PAKA 2QMXA 3UN6A 1YYZA 1B3GA 4GFRA 5DT6A 4PFUA 2G93A 3IO6A 4G68B 5IZ3B 3CR9A 1KZ8A 5K2XA 1P99A 3KN8A 4TLLB 1BK4A 4H8IA 1O63A 3S2VA 4F18A 1Q9DA 4DXCA 1O64A 4GVOA 4BDLA 3LBSA 1OQHA 3BFTA 4MNIA 4IO2A 2GQ1A 2QS2A 2ZYKA 4GWZA 5AA2A 3B8BA 1HSEA 1ZKBA 4OFJA 3FXBA 3MPKA 1P1NA 3PUXE 3THIA 3OEMA 4XKQA 2O7IA 1SW5A 5I56B 3RPWA 4BDMA 3RUMA 1RDXA 2H4IA 3EHUA 2QRYA 1H43A 2PBWA 1B40A 1QW0A 4OETA 4X04A 1IMDA 2AIXA 3K1NA 4AB6A 4YKPA 1IMAA 4N6KA 4O8MA 1N3WA 2Y84A 3MSTA 4LZ7A 1N3XA 4M4GA 2VD3A 4QSEA 3LUYA 4F3PA 1LGBC 1WVJA 4NE4A 4BLAA 5I2KA 2RF1A 2ONRA 2QMWA 1MXYA 1MXWA 2FNCA 4IY5A 3Q28A 3RTWB 4KQPA 1J1NA 4Q30B 3D4CA 4KFQA 5H8FA 1MQDA 3PPOA 1TXFA 5LOMA 4KHZE 3O66A 3IJOB 4F29A 1DTZA 3TDJA 4PC9A 4JWOA 4XXUA 2Q9TA 2B4LA 2KR0A 4U4XA 2DDKA 2O6AA 1ZMGA 4QXDA 4YB7A 3IB0A 3O6HA 1XS5A 4WXJA 1LBYA 2XX8A 1FTLA 3LUZA 4N8YA 3G3KA 5CBSA 3TPAA 4KPTA 4P56A 2P3NA 4OVSA 4X48A 5IZ1A 3SETA 1S9TA 2FYIA 3TTLA 1NH8A 2OK2A 3IFAA 3KGCA 4R6KA 3RPLA 1IXHA 1UIVA 2XXPA 4MH5A 1LSTA 3DELB 2XA5A 4AQ4A 3O6GA 1Y4CA 2ZZVA 1MXXA 4GWYA 4FE8A 4Z0IA 4ZEFA 4IO4A 2E0SA 3MW0A 3RT6B 4RJZA 2F35A 5I2NB 1FW0A 2CEXA 4MBPA 1NV4A 3Q29A 1MDQA 3B6TA 2REJA 1EYIA 4NQ8A 1F9BA 5BUUA 4QSCA
chains in the Genus database with same CATH topology
1N84A 2OLBA 3FVOA 3IOTA 3PPQA 4P11A 3TODA 2NXOA 2ZMBA 3QIMA 1MY2A 4C1TA 3SEUA 4YMAA 1S50A 2OZZA 1I6QA 2XXRA 3H6WA 1B5JA 3IX1A 3MZBA 4YU0A 3T9UA 3P7IA 1JVYA 4HW8A 2BJJX 1A8EA 2ABHA 1LLSA 4G4PA 2Z22A 3N6TA 3B6WA 4FAJA 5CBRA 5TP9B 1B05A 3VVEA 5CM6A 5H8NB 2KLFA 4NEDA 2ONSA 4PFYA 2NUVA 3GLBA 4FIMA 3MZ1A 1EU8A 1NNFA 4ELQA 1IEJA 3RNNA 1TFDA 3TQWA 3IOWA 4U21A 2UVIA 1Y1MA 3OOAA 3QUFA 4H67A 1SW4A 5CMBA 1POY1 5AA4A 2V3QA 3OENA 1LB9A 3K02A 4MLVA 3H3GA 1POTA 4U4SA 1NKXA 1FTJA 1US5A 1CE2A 1UTBA 1VFEA 4R73A 3O29A 1SVXB 1GVCA 3TZAA 1GGGA 2HZKA 1NH7A 4EXKA 2YJPA 1EH3A 1OVTA 3FXRA 1HSJA 5I2NA 4F1VA 2HQ0A 3A3CA 2DQVA 3CI8A 3K6UA 4GRKA 4RA1A 5FTIA 3T96B 4F3GA 2UYFA 3TTKA 3IJXB 2P2AA 2Y7KA 2H9BA 2F36A 4U23A 1A55A 1XVYA 4ZEBA 4ESWA 4F19A 2ZYMA 4H65A 4H1XA 1B9JA 3KN7A 3K01A 1UQWA 1B4ZA 3FJGA 3OMBA 3IB1A 1Z7ME 1QKAA 2IA4A 3FATA 3GXAA 5TPAB 3V83A 4OVJA 3DP8A 1II5A 3QXMA 2QL3A 1NNKA 3FGSA 1MH3A 2ANJA 2PX1A 3ZS6A 2I3WA 2Y7RA 1B7ZA 4ZDMA 4LZ8A 5AA1A 3VE1B 1MG1A 4H5FA 3VLVA 4EUOA 4F3BA 3MP8A 1H76A 4NF4A 2CZLA 4JSOA 2O1MA 3RT6B 4UA8A 1DOTA 4X9TA 5FHOA 3DM0A 3M3LA 1S7YA 4LQ2A 4QHQA 4R75A 2ZNUA 5K2YA 1XC1A 4I1DA 3PGFA 1Y3QA 4ZS9A 4WEDA 4XKNA 1M5BA 4ZECA 1MQHA 2B3BA 3W9WA 5B70A 1MDP1 1AMFA 1NL5A 4NWCA 2RKMA 3PUVE 3W9VA 5AA2B 1BKAA 1GR2A 1USYH 2XXTA 3K4UA 4KYDA 3SEWA 4DE8A 3PPNA 1USYE 5L9OA 3R26A 2HCAA 4HCYA 2DSFA 5KCJB 2H99A 2DWJA 2AL4A 1Q1KA 3K1PA 3E3KA 2XXIA 3TEPA 2DE4A 4F1UA 5I59B 2VP1A 1QULA 2NOOA 3DP6A 2Q2CA 3SEYA 3KSXA 5A5XA 2ESNA 1JETA 4BDQA 4DIGA 3GBBA 4I9DA 4ISUA 3KBRA 1Q35A 4NF5B 2O51A 3VXBA 4C0RA 5DVFA 5KDTA 1UTHA 4ZZEA 5KZTA 3PUWE 4YICA 2F7CA 1I6AA 5L9SA 4NF4B 4N07A 1BIYA 2HEUA 4ZEIA 3E4RA 2XD2A 2D21A 4I62A 1NMUA 1XHYA 4PFWA 1T0KA 2M8CA 4QFKA 1LBCA 4OHNA 2CMOA 3H6VA 4E0WA 4THIA 3RGYA 1A7LA 2Q89A 3PD8A 4TLMB 5F1QA 1MY3A 1PBPA 1QVSA 3JZJA 3FZVA 1LAGE 1N7XA 2XXHA 3EHSA 4LQ5A 3CFLA 3THIA 3C36A 3FVGA 2R9JA 1IQ7A 3OO9A 4R2BA 3V89B 1ZJLA 2XXWA 3OO8A 3C9HA 2DVCA 3MVWA 1A54A 5JK4A 2DYXA 2DE3A 4BDNA 3HHGA 4F3SA 2YLNA 1LFHA 4NF8A 4UACA 1FQDA 3FV2A 4IO7A 1L5TA 3FV1A 5H8FB 2GFEA 1BTJA 4XTCQ 2ZYNA 4FORA 4KI0E 4RK9A 5DTBA 3S9EA 2ZXTA 1HSLA 2DXRA 5I57A 2A5SA 2THIA 2F78A 3KZGA 4LUBA 3TCGA 4F22A 3U94A 2R6GE 1I69A 3LSFB 4U22A 1D4NA 4DCYA 5I84A 3K2DA 3T9XB 4PE5B 4ELRA 5AA4B 5I2KB 1ATGA 1B7HA 2H5YA 4QFLA 2P0SA 3O2AA 1DSNA 3U93A 1MQGA 5FHNA 1IXIA 2Y7IA 2F97A 1JEVA 3UGWA 2QPQA 4ZE9A 5AE4A 2ZYOA 4IB2A 1B1XA 3PUYE 5H8NA 3CG3A 2D3IA 5TP9A 3ONMA 1MXVA 3CVGA 3FASA 3FVKA 4HS7A 4Q5TA 4QFPA 4C1UA 3G3JA 3SESA 3EHTA 3TMGA 4POXA 3RLFE 3UORA 4ZZAA 5DEXB 4NTLA 4U1OA 1AOVA 3TKDA 1SW2A 2D5WA 3Q27A 1WODA 3PD9A 1QUJA 2F34A 3T9HB 3LSXA 1VSOA 2X26A 3VVFA 1FQEA 1AH5A 2F6PA 4KR5A 2Q2AA 1B52A 1MY1A 2DWHA 3OSRA 4KYSA 4R9GA 3PPRA 3V8XB 4FECA 4EDPA 4O3AA 3SEXA 4H6DA 1EZOA 4OXVA 4R2FA 1DTGA 1DPPA 4F2OA 3HCQA 1Z7NE 2Z8EA 4X1BA 5BWJA 1B3LA 1B3FA 1MM6A 3K6XA 2RINA 5CMKA 1AIVA 1IXGA 5H8HB 3H4ZA 2I6EA 5L9MA 3BBRA 2RC9A 3IO4A 3W15C 3B7DA 4DZ1A 1FTMA 3N94A 1SI0A 1B3EA 2YPNA 2DE2A 1PC3A 5B7DA 4OTEA 1IXCA 5EHSA 1OMPA 2OCUA 4WKMA 2Q8JA 2VGQA 3KJ7A 1M5FA 1QUIA 3LR1A 4YAHX 5HPQA 1SYIA 1M5CA 1UIUA 3MUQA 2F6GA 4NF6B 2RCBA 3IOVA 1MM7A 2ZNSA 2G29A 3IOUA 3MVXA 2AL5A 3TTRA 3DLNA 3PMVA 4U2RA 3M3FA 3Q25A 2V84A 2DWAA 2F7BA 2H98A 2RC7A 2VOZA 4RXLA 2X7QA 5KCJA 4GIZA 1B7UA 1ZLQA 1B6HA 1RYOA 3EF7A 5M2VA 5I58B 1SI1A 4R6HA 2V93A 4YKIA 3FIRA 5HM4B 5ICTA 4ELOA 5JEIA 1Y4TA 3U72A 1R1NA 2GH9A 2OWSA 1NNTA 3CRBA 3CSGA 3S9NC 4AB5A 4O3CA 3FD3A 3HN0A 1P1UA 3FXUA 4O3BA 1B4HA 4GD5A 1LCTA 1ZTYA 2ALUA 4R6YA 4ZEKA 1ZIUA 1D9YA 1PB9A 4LZ5A 4LATA 3L6GA 2DXYA 2O1LA 3ECRA 5JTYB 1QKBA 1FQFA 3R6UA 3TCFA 2WKYA 4G8HA 3KN3A 4RNSA 1LAHE 1URGA 1EZ9A 1Y1ZA 3O28A 1P1WA 2QJEA 3N6UA 3QUJA 4KYEA 4OMBA 1Y9UA 3VDFA 4U1ZA 1P1OA 1IITA 3WAEA 1M5DA 5DEXA 1DPEA 4OEUA 4G68A 4H0WA 1FTKA 5AA2D 5CMMA 3ZSFA 3DP4A 4BDRA 1MPCA 1H45A 1NFTA 2XX9A 3KOTA 1QJMA 3PMWA 4HCWA 4FEDA 1RYXA 3TTNA 1FTOA 4ECFA 4Q8RA 3E13X 3QYTA 4XKPA 5EYFA 1MXZA 4PQJA 2XD3A 4LONB 4IO6A 4QFOA 1FQCA 1B5HA 4JWXA 2UVJA 3K00A 3IL1B 1H44A 4DDDA 4OFOA 3C4MA 3MAMA 3BFUA 2HAUA 4ZE8A 4GXSB 3K0VA 1MXUA 4IGRA 4QFNA 3USDA 3EPEA 4LP2B 1A99A 3FVNA 1JW4A 1UTBB 1PBQA 3PMXA 4JB7A 1VE4A 2QS4A 3OXNA 4H8JA 1WDNA 3O9PA 4OENA 4I8CA 3H06B 4NF8B 4TQUQ 4GWOA 1B2HA 1D9VA 3OO6A 3V5AA 4E0XA 1SBPA 1OQGA 4G8NA 2I4CA 1SQYA 2PMSA 2OWTA 4GXAA 3QAXA 4R9FA 3FXQA 1R9LA 3KJTA 2QMXA 1URSA 4PP0A 1ZBMA 1R9QA 3UN6A 3IAZA 2ZNTA 1B3GA 2UYEA 2O84X 4GFRA 4MLQA 1GV8A 5DT6A 3SKPA 4PFUA 2G93A 3SERA 3IO6A 4G68B 1GTKA 5TU0A 4OFLA 3CR9A 1R6ZA 4F31B 2XXYA 1ZU0A 4G8MA 4LVQA 4BDOA 4K3FA 4RPOA 4FATA 5H8QB 3CFZA 5K2XA 1P99A 3KN8A 4TLLB 1SD3A 4H8IA 1O63A 2XXQA 3LSLA 3CIJA 3KEIA 1TWYA 1OIBA 4NF5A 5KDTB 2XXXA 3S2VA 4F18A 2A5TB 1JW1A 1LFIA 2GHAA 5A5XB 4DXCA 1O64A 2O7UA 2I48A 1FQAA 4ONYA 3T93B 4GVOA 2DOJA 4BDLA 2O68A 5I59A 3C34A 4EF1A 4TOZA 1VR5A 3FJMA 1M5EA 3H6UA 3C32A 2F5XA 3LBSA 3SEVA 1OQHA 3BFTA 3K6WA 3VV5A 2DWIA 5DYHA 4IO2A 4DCXA 5IAIA 2QS2A 2ZYKA 1AL3A 1FCKA 1N7WA 2PYYA 1BLFA 3LSWA 1DMBA 5AA2A 4ESXA 4RPNA 4JBZA 3N26A 3K1MA 3IB2A 4JDFA 3TUSA 1HSEA 1JEUA 1ZKBA 3N5LA 3JYRA 3K6VA 1URDA 4OFJA 3T66A 1A8FA 3MPKA 5L8DA 3VFJA 1LAXA 3VLWA 1P1NA 3EQ1A 4NMYA 4F1YA 4OWDA 3PUXE 3RY3A 2E1SA 2P1SA 4IY6A 2Y7WA 3OEMA 4LA9A 2O7IA 1MQJA 4XKQA 3KOSA 3TELA 1SW5A 2I0BA 5I56B 1A40A 3RPWA 4BDMA 1OLAA 3RUMA 3IORA 2FA7A 3KSJA 2DP8A 2QS3A 1YTVA 4OQOA 3CSBA 3HPIA 4DLDA 5I56A 1I6BA 2H4IA 3EHUA 1XVXA 4JXIA 5TPAA 4F2QA 1JW5A 5FTHA 2GHBA 2QRYA 2B3FA 1H43A 1N0TA 2QSXA 5FHMA 2PBWA 4YMBA 3VLUA 1B40A 1CB6A 1QW0A 3CFXA 4OETA 2W7YA 3TCHA 3MBPA 4OYVA 4G77A 3S4UA 2XHDA 3LC8A 4OERA 4M1VA 5ITPA 2AIXA 3QK6A 4N13A 3K1NA 4IGTA 4MF3A 4AB6A 4Z7EA 1P1QA 4ZEDA 3QSLA 4YKPA 4GOTA 4KCCA 2XXVA 4RK2A 1SDXA 3WAFA 4MFIA 4L17A 1US4A 4YB6A 3KG2A 1N3WA 2Y84A 1LCFA 3G7WA 4LZ7A 3S9MC 1ANFA 1N3XA 5CC2A 3AXFA 1PEBA 4M4GA 1MS7A 2VD3A 3L6HA 3LUYA 4QSEA 4G68C 4RY1A 4F3PA 1QUKA 2B65A 1LGBC 2HXWA 3I3VA 3Q26A 1B46A 1SYHA 3TFLA 3OEKA 1WVJA 1XT8A 3O97A 2Y7PA 4NE4A 4BLAA 5I2KA 3FJ7A 3H03A 2RF1A 4DXBA 2UVGA 3TAJA 2ONRA 2QMWA 3UK4A 4DXUA 4EQBA 1MXYA 1MXWA 2FNCA 3ILTB 4IY5A 3HSTA 3Q28A 1JQFA 3U8QA 5I57B 1N04A 4GQOA 3RT8A 1O7TA 3RTWB 2HAVA 4KQPA 4X1DA 1J1NA 1OVBA 4GL0A 4Q30B 3UIFA 3VXCA 1EZPA 3D4CA 4P0IA 4KFQA 5F7VA 3M8UA 3RTFB 1MQDA 5H8FA 3PPOA 4H5GA 1PDAA 2ONKE 1Y3PA 4QF9A 5CMCA 1TXFA 5LOMA 1YPNA 3JV9A 4KHZE 3O66A 3MVZA 3IJOB 4F29A 1DTZA 1PB7A 4OESA 4XIGQ 3RN8A 1MPDA 3R7XA 4EF2A 3TDJA 5CRYA 5ISUA 3IK6B 5EHMA 4POWA 4EXLA 2F8DA 1B58A 4GL8A 2I3VA 1B1HA 4JWOA 2Z8FA 4XXUA 4OZ9A 3MQ9A 1IZ1A 3H7MA 4EQ7A 2Q9TA 1BP5A 2REGA 3E9XA 4U4XA 2O6AA 3H6TA 4GF8A 4R72A 2DS9A 1ZMGA 4YB7A 3IB0A 3FUZA 1UTHB 2GRVA 2I58A 3B6QA 1XS5A 3O6HA 4FJPA 4WXJA 3I5OA 3U92A 3ZKKA 4EQ9A 1LAFE 2XX8A 3M3KA 2PT1A 4F39A 1FTLA 4XKRA 4YKJA 3TTMA 3UP9A 1XOCA 1YCJA 2PT2A 3G3KA 2IEEA 3I6VA 1TT1A 4HTGA 4N6PA 3TPAA 1FQBA 5CBSA 1TFAA 1NNPA 2VHAA 1H3DA 4KPTA 3C33A 3GBAA 3MWBA 3GZGA 1SW1A 3OD7A 4IO5A 2OBGA 3KFMA 4X48A 3SETA 1KWHA 1MY4A 1S9TA 2RCAA 2FYIA 2RC8A 3RQTA 4KD5A 1LBBA 4RYAA 3TTLA 3TYHA 3HHFA 4NWDA 2I4BA 2UVHA 2XXUA 1NH8A 2OK2A 3MJNA 2NWJA 5IKBA 4PETA 2OJTA 5JTYA 1JVXA 1N76A 2AYSA 3ZKLA 4ND9A 1MQIA 3KGCA 3CG1A 3G3IA 2LAOA 4R6KA 2H25A 1IXHA 3OSQA 1UIVA 2XXPA 2X7PA 2PVUA 3MPLA 3OO7A 5AA3A 1D3KA 1JNFA 1B0LA 1Y3NA 3MC2A 3G3FA 1LSTA 4KCDA 4MH5A 3G3HA 1VFDA 4FEBA 3DELB 4GLIA 2Z23A 1IUDA 3MZ9A 4R74A 5ITOA 5I58A 4AQ4A 1Y20A 3HV1A 3O6GA 3PV0E 4JWYA 4PFTA 4QSDA 1Y4CA 1MH4A 1B0HA 2R71A 1MXXA 3HO7A 2I0CA 3PUZE 2UXAA 2F7AA 4FE8A 2HZLA 2XX7A 4Z0IA 2NVUB 1PB8A 3MP6A 4NF6A 5ELVA 1MPBA 3U1OA 2I49A 4YB5A 5DVJA 1B3HA 4IO4A 3D4GA 4ZEFA 2E0SA 3A09A 5HBCA 3VVDA 3MW0A 1YAEA 3OELA 3PU5A 4JSDA 2Q88A 1LB8A 2V3TA 4RJZA 2F35A 2HFBA 3C31A 4G2ZA 4WEPA 5CI5A 4YKKA 3ILUB 5I2NB 3TQLA 5J1DA 1ELJA 3SDFA 1B32A 1MY0A 3S9LC 2V25A 3T22A 1FW0A 3C35A 4IO3A 5H8HA 5DVIA 4YZZA 1RKMA 4MBPA 1MRPA 4QRZA 2V3UA 3BKIB 1B51A 3T9VA 3F11A 3UA8A 4ELPA 3Q29A 5ICQA 1MDQA 3EN3A 2A5TA 1OLCA 2QS1A 2REJA 3B6TA 3IR1A 4Q0CA 2DVZA 3MP1A 3ODBA 4P0GA 1IIWA 1B5IA 2VD2A 1LFGA 1F9BA 3G3GA 3O6IA 3A3UA 3MVYA 5H8SA 5BUUA 4OEVA 2Z8DA 3PPPA 4QSCA 5H8QA 2O69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N84 A;  2OLB A;  3FVO A;  3IOT A;  3PPQ A;  4P11 A;  3TOD A;  2NXO A;  2ZMB A;  3QIM A;  1MY2 A;  4C1T A;  3SEU A;  4YMA A;  1S50 A;  2OZZ A;  1I6Q A;  2XXR A;  3H6W A;  1B5J A;  3IX1 A;  3MZB A;  4YU0 A;  3T9U A;  3P7I A;  1JVY A;  4HW8 A;  2BJJ X;  1A8E A;  2ABH A;  1LLS A;  4G4P A;  2Z22 A;  3N6T A;  3B6W A;  4FAJ A;  5CBR A;  5TP9 B;  1B05 A;  3VVE A;  5CM6 A;  5H8N B;  2KLF A;  4NED A;  2ONS A;  4PFY A;  2NUV A;  3GLB A;  4FIM A;  3MZ1 A;  1EU8 A;  1NNF A;  4ELQ A;  1IEJ A;  3RNN A;  1TFD A;  3TQW A;  3IOW A;  4U21 A;  2UVI A;  1Y1M A;  3OOA A;  3QUF A;  4H67 A;  1SW4 A;  5CMB A;  1POY 1;  5AA4 A;  2V3Q A;  3OEN A;  1LB9 A;  3K02 A;  4MLV A;  3H3G A;  1POT A;  4U4S A;  1NKX A;  1FTJ A;  1US5 A;  1CE2 A;  1UTB A;  1VFE A;  4R73 A;  3O29 A;  1SVX B;  1GVC A;  3TZA A;  1GGG A;  2HZK A;  1NH7 A;  4EXK A;  2YJP A;  1EH3 A;  1OVT A;  3FXR A;  1HSJ A;  5I2N A;  4F1V A;  2HQ0 A;  3A3C A;  2DQV A;  3CI8 A;  3K6U A;  4GRK A;  4RA1 A;  5FTI A;  3T96 B;  4F3G A;  2UYF A;  3TTK A;  3IJX B;  2P2A A;  2Y7K A;  2H9B A;  2F36 A;  4U23 A;  1A55 A;  1XVY A;  4ZEB A;  4ESW A;  4F19 A;  2ZYM A;  4H65 A;  4H1X A;  1B9J A;  3KN7 A;  3K01 A;  1UQW A;  1B4Z A;  3FJG A;  3OMB A;  3IB1 A;  1Z7M E;  1QKA A;  2IA4 A;  3FAT A;  3GXA A;  5TPA B;  3V83 A;  4OVJ A;  3DP8 A;  1II5 A;  3QXM A;  2QL3 A;  1NNK A;  3FGS A;  1MH3 A;  2ANJ A;  2PX1 A;  3ZS6 A;  2I3W A;  2Y7R A;  1B7Z A;  4ZDM A;  4LZ8 A;  5AA1 A;  3VE1 B;  1MG1 A;  4H5F A;  3VLV A;  4EUO A;  4F3B A;  3MP8 A;  1H76 A;  4NF4 A;  2CZL A;  4JSO A;  2O1M A;  3RT6 B;  4UA8 A;  1DOT A;  4X9T A;  5FHO A;  3DM0 A;  3M3L A;  1S7Y A;  4LQ2 A;  4QHQ A;  4R75 A;  2ZNU A;  5K2Y A;  1XC1 A;  4I1D A;  3PGF A;  1Y3Q A;  4ZS9 A;  4WED A;  4XKN A;  1M5B A;  4ZEC A;  1MQH A;  2B3B A;  3W9W A;  5B70 A;  1MDP 1;  1AMF A;  1NL5 A;  4NWC A;  2RKM A;  3PUV E;  3W9V A;  5AA2 B;  1BKA A;  1GR2 A;  1USY H;  2XXT A;  3K4U A;  4KYD A;  3SEW A;  4DE8 A;  3PPN A;  1USY E;  5L9O A;  3R26 A;  2HCA A;  4HCY A;  2DSF A;  5KCJ B;  2H99 A;  2DWJ A;  2AL4 A;  1Q1K A;  3K1P A;  3E3K A;  2XXI A;  3TEP A;  2DE4 A;  4F1U A;  5I59 B;  2VP1 A;  1QUL A;  2NOO A;  3DP6 A;  2Q2C A;  3SEY A;  3KSX A;  5A5X A;  2ESN A;  1JET A;  4BDQ A;  4DIG A;  3GBB A;  4I9D A;  4ISU A;  3KBR A;  1Q35 A;  4NF5 B;  2O51 A;  3VXB A;  4C0R A;  5DVF A;  5KDT A;  1UTH A;  4ZZE A;  5KZT A;  3PUW E;  4YIC A;  2F7C A;  1I6A A;  5L9S A;  4NF4 B;  4N07 A;  1BIY A;  2HEU A;  4ZEI A;  3E4R A;  2XD2 A;  2D21 A;  4I62 A;  1NMU A;  1XHY A;  4PFW A;  1T0K A;  2M8C A;  4QFK A;  1LBC A;  4OHN A;  2CMO A;  3H6V A;  4E0W A;  4THI A;  3RGY A;  1A7L A;  2Q89 A;  3PD8 A;  4TLM B;  5F1Q A;  1MY3 A;  1PBP A;  1QVS A;  3JZJ A;  3FZV A;  1LAG E;  1N7X A;  2XXH A;  3EHS A;  4LQ5 A;  3CFL A;  3THI A;  3C36 A;  3FVG A;  2R9J A;  1IQ7 A;  3OO9 A;  4R2B A;  3V89 B;  1ZJL A;  2XXW A;  3OO8 A;  3C9H A;  2DVC A;  3MVW A;  1A54 A;  5JK4 A;  2DYX A;  2DE3 A;  4BDN A;  3HHG A;  4F3S A;  2YLN A;  1LFH A;  4NF8 A;  4UAC A;  1FQD A;  3FV2 A;  4IO7 A;  1L5T A;  3FV1 A;  5H8F B;  2GFE A;  1BTJ A;  4XTC Q;  2ZYN A;  4FOR A;  4KI0 E;  4RK9 A;  5DTB A;  3S9E A;  2ZXT A;  1HSL A;  2DXR A;  5I57 A;  2A5S A;  2THI A;  2F78 A;  3KZG A;  4LUB A;  3TCG A;  4F22 A;  3U94 A;  2R6G E;  1I69 A;  3LSF B;  4U22 A;  1D4N A;  4DCY A;  5I84 A;  3K2D A;  3T9X B;  4PE5 B;  4ELR A;  5AA4 B;  5I2K B;  1ATG A;  1B7H A;  2H5Y A;  4QFL A;  2P0S A;  3O2A A;  1DSN A;  3U93 A;  1MQG A;  5FHN A;  1IXI A;  2Y7I A;  2F97 A;  1JEV A;  3UGW A;  2QPQ A;  4ZE9 A;  5AE4 A;  2ZYO A;  4IB2 A;  1B1X A;  3PUY E;  5H8N A;  3CG3 A;  2D3I A;  5TP9 A;  3ONM A;  1MXV A;  3CVG A;  3FAS A;  3FVK A;  4HS7 A;  4Q5T A;  4QFP A;  4C1U A;  3G3J A;  3SES A;  3EHT A;  3TMG A;  4POX A;  3RLF E;  3UOR A;  4ZZA A;  5DEX B;  4NTL A;  4U1O A;  1AOV A;  3TKD A;  1SW2 A;  2D5W A;  3Q27 A;  1WOD A;  3PD9 A;  1QUJ A;  2F34 A;  3T9H B;  3LSX A;  1VSO A;  2X26 A;  3VVF A;  1FQE A;  1AH5 A;  2F6P A;  4KR5 A;  2Q2A A;  1B52 A;  1MY1 A;  2DWH A;  3OSR A;  4KYS A;  4R9G A;  3PPR A;  3V8X B;  4FEC A;  4EDP A;  4O3A A;  3SEX A;  4H6D A;  1EZO A;  4OXV A;  4R2F A;  1DTG A;  1DPP A;  4F2O A;  3HCQ A;  1Z7N E;  2Z8E A;  4X1B A;  5BWJ A;  1B3L A;  1B3F A;  1MM6 A;  3K6X A;  2RIN A;  5CMK A;  1AIV A;  1IXG A;  5H8H B;  3H4Z A;  2I6E A;  5L9M A;  3BBR A;  2RC9 A;  3IO4 A;  3W15 C;  3B7D A;  4DZ1 A;  1FTM A;  3N94 A;  1SI0 A;  1B3E A;  2YPN A;  2DE2 A;  1PC3 A;  5B7D A;  4OTE A;  1IXC A;  5EHS A;  1OMP A;  2OCU A;  4WKM A;  2Q8J A;  2VGQ A;  3KJ7 A;  1M5F A;  1QUI A;  3LR1 A;  4YAH X;  5HPQ A;  1SYI A;  1M5C A;  1UIU A;  3MUQ A;  2F6G A;  4NF6 B;  2RCB A;  3IOV A;  1MM7 A;  2ZNS A;  2G29 A;  3IOU A;  3MVX A;  2AL5 A;  3TTR A;  3DLN A;  3PMV A;  4U2R A;  3M3F A;  3Q25 A;  2V84 A;  2DWA A;  2F7B A;  2H98 A;  2RC7 A;  2VOZ A;  4RXL A;  2X7Q A;  5KCJ A;  4GIZ A;  1B7U A;  1ZLQ A;  1B6H A;  1RYO A;  3EF7 A;  5M2V A;  5I58 B;  1SI1 A;  4R6H A;  2V93 A;  4YKI A;  3FIR A;  5HM4 B;  5ICT A;  4ELO A;  5JEI A;  1Y4T A;  3U72 A;  1R1N A;  2GH9 A;  2OWS A;  1NNT A;  3CRB A;  3CSG A;  3S9N C;  4AB5 A;  4O3C A;  3FD3 A;  3HN0 A;  1P1U A;  3FXU A;  4O3B A;  1B4H A;  4GD5 A;  1LCT A;  1ZTY A;  2ALU A;  4R6Y A;  4ZEK A;  1ZIU A;  1D9Y A;  1PB9 A;  4LZ5 A;  4LAT A;  3L6G A;  2DXY A;  2O1L A;  3ECR A;  5JTY B;  1QKB A;  1FQF A;  3R6U A;  3TCF A;  2WKY A;  4G8H A;  3KN3 A;  4RNS A;  1LAH E;  1URG A;  1EZ9 A;  1Y1Z A;  3O28 A;  1P1W A;  2QJE A;  3N6U A;  3QUJ A;  4KYE A;  4OMB A;  1Y9U A;  3VDF A;  4U1Z A;  1P1O A;  1IIT A;  3WAE A;  1M5D A;  5DEX A;  1DPE A;  4OEU A;  4G68 A;  4H0W A;  1FTK A;  5AA2 D;  5CMM A;  3ZSF A;  3DP4 A;  4BDR A;  1MPC A;  1H45 A;  1NFT A;  2XX9 A;  3KOT A;  1QJM A;  3PMW A;  4HCW A;  4FED A;  1RYX A;  3TTN A;  1FTO A;  4ECF A;  4Q8R A;  3E13 X;  3QYT A;  4XKP A;  5EYF A;  1MXZ A;  4PQJ A;  2XD3 A;  4LON B;  4IO6 A;  4QFO A;  1FQC A;  1B5H A;  4JWX A;  2UVJ A;  3K00 A;  3IL1 B;  1H44 A;  4DDD A;  4OFO A;  3C4M A;  3MAM A;  3BFU A;  2HAU A;  4ZE8 A;  4GXS B;  3K0V A;  1MXU A;  4IGR A;  4QFN A;  3USD A;  3EPE A;  4LP2 B;  1A99 A;  3FVN A;  1JW4 A;  1UTB B;  1PBQ A;  3PMX A;  4JB7 A;  1VE4 A;  2QS4 A;  3OXN A;  4H8J A;  1WDN A;  3O9P A;  4OEN A;  4I8C A;  3H06 B;  4NF8 B;  4TQU Q;  4GWO A;  1B2H A;  1D9V A;  3OO6 A;  3V5A A;  4E0X A;  1SBP A;  1OQG A;  4G8N A;  2I4C A;  1SQY A;  2PMS A;  2OWT A;  4GXA A;  3QAX A;  4R9F A;  3FXQ A;  1R9L A;  3KJT A;  2QMX A;  1URS A;  4PP0 A;  1ZBM A;  1R9Q A;  3UN6 A;  3IAZ A;  2ZNT A;  1B3G A;  2UYE A;  2O84 X;  4GFR A;  4MLQ A;  1GV8 A;  5DT6 A;  3SKP A;  4PFU A;  2G93 A;  3SER A;  3IO6 A;  4G68 B;  1GTK A;  5TU0 A;  4OFL A;  3CR9 A;  1R6Z A;  4F31 B;  2XXY A;  1ZU0 A;  4G8M A;  4LVQ A;  4BDO A;  4K3F A;  4RPO A;  4FAT A;  5H8Q B;  3CFZ A;  5K2X A;  1P99 A;  3KN8 A;  4TLL B;  1SD3 A;  4H8I A;  1O63 A;  2XXQ A;  3LSL A;  3CIJ A;  3KEI A;  1TWY A;  1OIB A;  4NF5 A;  5KDT B;  2XXX A;  3S2V A;  4F18 A;  2A5T B;  1JW1 A;  1LFI A;  2GHA A;  5A5X B;  4DXC A;  1O64 A;  2O7U A;  2I48 A;  1FQA A;  4ONY A;  3T93 B;  4GVO A;  2DOJ A;  4BDL A;  2O68 A;  5I59 A;  3C34 A;  4EF1 A;  4TOZ A;  1VR5 A;  3FJM A;  1M5E A;  3H6U A;  3C32 A;  2F5X A;  3LBS A;  3SEV A;  1OQH A;  3BFT A;  3K6W A;  3VV5 A;  2DWI A;  5DYH A;  4IO2 A;  4DCX A;  5IAI A;  2QS2 A;  2ZYK A;  1AL3 A;  1FCK A;  1N7W A;  2PYY A;  1BLF A;  3LSW A;  1DMB A;  5AA2 A;  4ESX A;  4RPN A;  4JBZ A;  3N26 A;  3K1M A;  3IB2 A;  4JDF A;  3TUS A;  1HSE A;  1JEU A;  1ZKB A;  3N5L A;  3JYR A;  3K6V A;  1URD A;  4OFJ A;  3T66 A;  1A8F A;  3MPK A;  5L8D A;  3VFJ A;  1LAX A;  3VLW A;  1P1N A;  3EQ1 A;  4NMY A;  4F1Y A;  4OWD A;  3PUX E;  3RY3 A;  2E1S A;  2P1S A;  4IY6 A;  2Y7W A;  3OEM A;  4LA9 A;  2O7I A;  1MQJ A;  4XKQ A;  3KOS A;  3TEL A;  1SW5 A;  2I0B A;  5I56 B;  1A40 A;  3RPW A;  4BDM A;  1OLA A;  3RUM A;  3IOR A;  2FA7 A;  3KSJ A;  2DP8 A;  2QS3 A;  1YTV A;  4OQO A;  3CSB A;  3HPI A;  4DLD A;  5I56 A;  1I6B A;  2H4I A;  3EHU A;  1XVX A;  4JXI A;  5TPA A;  4F2Q A;  1JW5 A;  5FTH A;  2GHB A;  2QRY A;  2B3F A;  1H43 A;  1N0T A;  2QSX A;  5FHM A;  2PBW A;  4YMB A;  3VLU A;  1B40 A;  1CB6 A;  1QW0 A;  3CFX A;  4OET A;  2W7Y A;  3TCH A;  3MBP A;  4OYV A;  4G77 A;  3S4U A;  2XHD A;  3LC8 A;  4OER A;  4M1V A;  5ITP A;  2AIX A;  3QK6 A;  4N13 A;  3K1N A;  4IGT A;  4MF3 A;  4AB6 A;  4Z7E A;  1P1Q A;  4ZED A;  3QSL A;  4YKP A;  4GOT A;  4KCC A;  2XXV A;  4RK2 A;  1SDX A;  3WAF A;  4MFI A;  4L17 A;  1US4 A;  4YB6 A;  3KG2 A;  1N3W A;  2Y84 A;  1LCF A;  3G7W A;  4LZ7 A;  3S9M C;  1ANF A;  1N3X A;  5CC2 A;  3AXF A;  1PEB A;  4M4G A;  1MS7 A;  2VD3 A;  3L6H A;  3LUY A;  4QSE A;  4G68 C;  4RY1 A;  4F3P A;  1QUK A;  2B65 A;  1LGB C;  2HXW A;  3I3V A;  3Q26 A;  1B46 A;  1SYH A;  3TFL A;  3OEK A;  1WVJ A;  1XT8 A;  3O97 A;  2Y7P A;  4NE4 A;  4BLA A;  5I2K A;  3FJ7 A;  3H03 A;  2RF1 A;  4DXB A;  2UVG A;  3TAJ A;  2ONR A;  2QMW A;  3UK4 A;  4DXU A;  4EQB A;  1MXY A;  1MXW A;  2FNC A;  3ILT B;  4IY5 A;  3HST A;  3Q28 A;  1JQF A;  3U8Q A;  5I57 B;  1N04 A;  4GQO A;  3RT8 A;  1O7T A;  3RTW B;  2HAV A;  4KQP A;  4X1D A;  1J1N A;  1OVB A;  4GL0 A;  4Q30 B;  3UIF A;  3VXC A;  1EZP A;  3D4C A;  4P0I A;  4KFQ A;  5F7V A;  3M8U A;  3RTF B;  1MQD A;  5H8F A;  3PPO A;  4H5G A;  1PDA A;  2ONK E;  1Y3P A;  4QF9 A;  5CMC A;  1TXF A;  5LOM A;  1YPN A;  3JV9 A;  4KHZ E;  3O66 A;  3MVZ A;  3IJO B;  4F29 A;  1DTZ A;  1PB7 A;  4OES A;  4XIG Q;  3RN8 A;  1MPD A;  3R7X A;  4EF2 A;  3TDJ A;  5CRY A;  5ISU A;  3IK6 B;  5EHM A;  4POW A;  4EXL A;  2F8D A;  1B58 A;  4GL8 A;  2I3V A;  1B1H A;  4JWO A;  2Z8F A;  4XXU A;  4OZ9 A;  3MQ9 A;  1IZ1 A;  3H7M A;  4EQ7 A;  2Q9T A;  1BP5 A;  2REG A;  3E9X A;  4U4X A;  2O6A A;  3H6T A;  4GF8 A;  4R72 A;  2DS9 A;  1ZMG A;  4YB7 A;  3IB0 A;  3FUZ A;  1UTH B;  2GRV A;  2I58 A;  3B6Q A;  1XS5 A;  3O6H A;  4FJP A;  4WXJ A;  3I5O A;  3U92 A;  3ZKK A;  4EQ9 A;  1LAF E;  2XX8 A;  3M3K A;  2PT1 A;  4F39 A;  1FTL A;  4XKR A;  4YKJ A;  3TTM A;  3UP9 A;  1XOC A;  1YCJ A;  2PT2 A;  3G3K A;  2IEE A;  3I6V A;  1TT1 A;  4HTG A;  4N6P A;  3TPA A;  1FQB A;  5CBS A;  1TFA A;  1NNP A;  2VHA A;  1H3D A;  4KPT A;  3C33 A;  3GBA A;  3MWB A;  3GZG A;  1SW1 A;  3OD7 A;  4IO5 A;  2OBG A;  3KFM A;  4X48 A;  3SET A;  1KWH A;  1MY4 A;  1S9T A;  2RCA A;  2FYI A;  2RC8 A;  3RQT A;  4KD5 A;  1LBB A;  4RYA A;  3TTL A;  3TYH A;  3HHF A;  4NWD A;  2I4B A;  2UVH A;  2XXU A;  1NH8 A;  2OK2 A;  3MJN A;  2NWJ A;  5IKB A;  4PET A;  2OJT A;  5JTY A;  1JVX A;  1N76 A;  2AYS A;  3ZKL A;  4ND9 A;  1MQI A;  3KGC A;  3CG1 A;  3G3I A;  2LAO A;  4R6K A;  2H25 A;  1IXH A;  3OSQ A;  1UIV A;  2XXP A;  2X7P A;  2PVU A;  3MPL A;  3OO7 A;  5AA3 A;  1D3K A;  1JNF A;  1B0L A;  1Y3N A;  3MC2 A;  3G3F A;  1LST A;  4KCD A;  4MH5 A;  3G3H A;  1VFD A;  4FEB A;  3DEL B;  4GLI A;  2Z23 A;  1IUD A;  3MZ9 A;  4R74 A;  5ITO A;  5I58 A;  4AQ4 A;  1Y20 A;  3HV1 A;  3O6G A;  3PV0 E;  4JWY A;  4PFT A;  4QSD A;  1Y4C A;  1MH4 A;  1B0H A;  2R71 A;  1MXX A;  3HO7 A;  2I0C A;  3PUZ E;  2UXA A;  2F7A A;  4FE8 A;  2HZL A;  2XX7 A;  4Z0I A;  2NVU B;  1PB8 A;  3MP6 A;  4NF6 A;  5ELV A;  1MPB A;  3U1O A;  2I49 A;  4YB5 A;  5DVJ A;  1B3H A;  4IO4 A;  3D4G A;  4ZEF A;  2E0S A;  3A09 A;  5HBC A;  3VVD A;  3MW0 A;  1YAE A;  3OEL A;  3PU5 A;  4JSD A;  2Q88 A;  1LB8 A;  2V3T A;  4RJZ A;  2F35 A;  2HFB A;  3C31 A;  4G2Z A;  4WEP A;  5CI5 A;  4YKK A;  3ILU B;  5I2N B;  3TQL A;  5J1D A;  1ELJ A;  3SDF A;  1B32 A;  1MY0 A;  3S9L C;  2V25 A;  3T22 A;  1FW0 A;  3C35 A;  4IO3 A;  5H8H A;  5DVI A;  4YZZ A;  1RKM A;  4MBP A;  1MRP A;  4QRZ A;  2V3U A;  3BKI B;  1B51 A;  3T9V A;  3F11 A;  3UA8 A;  4ELP A;  3Q29 A;  5ICQ A;  1MDQ A;  3EN3 A;  2A5T A;  1OLC A;  2QS1 A;  2REJ A;  3B6T A;  3IR1 A;  4Q0C A;  2DVZ A;  3MP1 A;  3ODB A;  4P0G A;  1IIW A;  1B5I A;  2VD2 A;  1LFG A;  1F9B A;  3G3G A;  3O6I A;  3A3U A;  3MVY A;  5H8S A;  5BUU A;  4OEV A;  2Z8D A;  3PPP A;  4QSC A;  5H8Q A;  2O69 A; 
#chains in the Genus database with same CATH topology
 1N84 A;  2OLB A;  4P11 A;  3TOD A;  2ZMB A;  3QIM A;  4C1T A;  1IMF A;  2XXR A;  3H6W A;  4YU0 A;  3P7I A;  1JVY A;  5TP9 B;  3VVE A;  2KLF A;  2ONS A;  4PFY A;  2UVI A;  1POY 1;  2V3Q A;  3H3G A;  5ET8 A;  3TZA A;  2CZK A;  2YJP A;  1EH3 A;  2DQV A;  5FTI A;  2H9B A;  1NV3 A;  3KN7 A;  3PTY A;  4DI3 D;  4I3Y A;  1II5 A;  3BIG A;  5FHO A;  4LQ2 A;  1S7Y A;  5K2Y A;  4R75 A;  4ZS9 A;  5B70 A;  4NWC A;  2RKM A;  5LTC A;  1USY H;  2WEF A;  2CEY A;  1USY E;  3R26 A;  2HCA A;  3E3K A;  1LBV A;  4F1U A;  1QUL A;  3KSX A;  4BDQ A;  3ROJ A;  3GBB A;  4I9D A;  5DVF A;  2F7C A;  5L9S A;  2HEU A;  2XD2 A;  5DW8 A;  4QFK A;  2CMO A;  3H6V A;  4THI A;  3JZJ A;  1N7X A;  3C36 A;  4R2B A;  1ZJL A;  3C9H A;  3MVW A;  2B4M A;  1L5T A;  2GFE A;  4FOR A;  4RK9 A;  2F78 A;  3KZG A;  2R6G E;  3LSF B;  1D4N A;  4PE5 B;  1ATG A;  1B7H A;  4MEV A;  2P0S A;  3O2A A;  1DSN A;  3U93 A;  4XF5 A;  5FHN A;  2Y7I A;  5AE4 A;  1B1X A;  5TP9 A;  3FVK A;  4C1U A;  3TMG A;  3RLF E;  4ZZA A;  5F24 A;  3TKD A;  2HPG A;  1FPE A;  2F6P A;  4KR5 A;  2Q2A A;  3OSR A;  3V8X B;  4FEC A;  4O3A A;  3SEX A;  1DPP A;  3HCQ A;  1Z7N E;  2Z8E A;  5BWJ A;  3H4Z A;  2I6E A;  3W15 C;  4DZ1 A;  2YPN A;  2DE2 A;  5B7D A;  4OTE A;  3E78 A;  2VGQ A;  4GWW A;  1SYI A;  3QMF A;  3MUQ A;  2ZNS A;  2ZZX A;  2G29 A;  2QFL A;  2F7B A;  1ZLQ A;  4R6H A;  3FIR A;  5HM4 B;  2GH9 A;  2OWS A;  1XI6 A;  1LCT A;  3RPL B;  4PF8 A;  2FIE A;  1FQF A;  1Y1Z A;  1M5D A;  5DEX A;  5AA2 D;  4BDR A;  5EYH A;  1MPC A;  1H45 A;  3GYY A;  2HHM A;  4Q8R A;  1FTO A;  4XKP A;  5EYF A;  1MXZ A;  4PQJ A;  1FBC A;  4MIJ A;  2XD3 A;  4QFO A;  4NG7 A;  3EPE A;  4LP2 B;  4GWX A;  3VVF A;  4H8J A;  3OXN A;  1WDN A;  2Q8M A;  3H06 B;  3ISP A;  4E0X A;  2I4C A;  4R9F A;  3FXQ A;  3KJT A;  1URS A;  1ZBM A;  3IAZ A;  1RDZ A;  2UYE A;  1GV8 A;  3SKP A;  3SER A;  1EYK A;  1R6Z A;  2XXY A;  1ZU0 A;  4BDO A;  2BJI A;  4K3F A;  5EYG A;  5H8Q B;  3CFZ A;  4PFI A;  1SD3 A;  3LSL A;  5KDT B;  4DI4 B;  2Q74 A;  1LFI A;  2O7U A;  2I48 A;  4ONY A;  2DOJ A;  4EF1 A;  4MJO A;  1VR5 A;  2F5X A;  4DCX A;  3VV5 A;  1AL3 A;  1FCK A;  1N7W A;  1DK4 A;  4JBZ A;  4JDF A;  3N5L A;  3JYR A;  5FBP A;  1A8F A;  3VLW A;  3VFJ A;  1LAX A;  4F1Y A;  4OWD A;  4LA9 A;  3TEL A;  2Y7W A;  2FVZ A;  2I0B A;  1A40 A;  3IOR A;  2FA7 A;  4DLD A;  5I56 A;  1AWB A;  1I6B A;  1NV6 A;  4MAG A;  5FTH A;  2GHB A;  1RDY A;  4NF0 A;  5FHM A;  4YMB A;  3VLU A;  3MBP A;  4OYV A;  4OER A;  4IR8 A;  1QGX A;  5ITP A;  3QK6 A;  2XXV A;  3WAF A;  4L17 A;  4YB6 A;  3G7W A;  3S9M C;  1ANF A;  5CC2 A;  4AS4 A;  5ET6 A;  4GBV A;  4OVT A;  3H03 A;  2UVG A;  3ILT B;  3HST A;  4GQO A;  4GL0 A;  3UIF A;  3RTF B;  1NI9 A;  3M8U A;  1KA1 A;  1YPN A;  4OES A;  1IME A;  1MPD A;  5ISU A;  4POW A;  4EXL A;  2F8D A;  4GL8 A;  4N81 A;  3H6T A;  4R72 A;  3I5O A;  4EQ9 A;  3M3K A;  2PT1 A;  4F39 A;  1LBZ A;  1YCJ A;  3I6V A;  4N6P A;  5T3J A;  1TT1 A;  1NNP A;  4IO5 A;  2OBG A;  1KWH A;  5EQA A;  4RYA A;  3TYH A;  2XXU A;  3MJN A;  4PET A;  2WYP A;  3B50 A;  2H25 A;  5I5P A;  2X7P A;  1VFD A;  2Z23 A;  3E79 A;  5IZZ A;  1FPI A;  2XXK A;  4JWY A;  1MH4 A;  2OWZ A;  3HO7 A;  2UXA A;  2F7A A;  2XX7 A;  3MP6 A;  4NF6 A;  5ELV A;  5DVJ A;  3A09 A;  4H46 A;  1YAE A;  1IMC A;  3PU5 A;  4WEP A;  4JSD A;  2Q88 A;  1SPI A;  4G2Z A;  3ILU B;  1ELJ A;  3SDF A;  3S9L C;  5H8H A;  1RKM A;  4ELP A;  1K9Y A;  3EN3 A;  2A5T A;  2QS1 A;  2DVZ A;  1IIW A;  1B5I A;  2VD2 A;  5H8S A;  1CNQ A;  2Z8D A;  3PPP A;  4GX4 A;  2O69 A;  2NXO A;  4MNP A;  2OZZ A;  3IX1 A;  1B5J A;  2BJJ X;  2ABH A;  2L5V A;  3U65 A;  1LLS A;  4G4P A;  3N6T A;  4FAJ A;  5CBR A;  5CM6 A;  5H8N B;  4NED A;  4ELQ A;  1IEJ A;  1Y1M A;  3QUF A;  5CMB A;  1LB9 A;  4R73 A;  1US5 A;  1UTB A;  4I40 A;  3O29 A;  1GVC A;  5ICT A;  1KA0 A;  1OVT A;  4F1V A;  4GRK A;  4O7M A;  4RA1 A;  2UYF A;  3TTK A;  2ZYM A;  3K01 A;  1B4Z A;  3IB1 A;  2IA4 A;  1QKA A;  3FAT A;  3DP8 A;  2QL3 A;  3FGS A;  1MH3 A;  3VLV A;  4F3B A;  2PFZ A;  4DDD A;  1H76 A;  4JSO A;  4N15 A;  3M3L A;  5EQ9 A;  4I1D A;  4PGN A;  1M5B A;  4ZEC A;  4PAF A;  3W9W A;  1MDP 1;  1GR2 A;  2XXT A;  3K4U A;  4PFR A;  5L9O A;  4HCY A;  2DSF A;  5KCJ B;  1FJ9 A;  2AL4 A;  4PDH A;  5I59 B;  2VP1 A;  3DP6 A;  4NAP A;  1JET A;  4DIG A;  5KDT A;  1Q35 A;  3VXB A;  3PUW E;  4YIC A;  4NF4 B;  4ZEI A;  2D21 A;  4I62 A;  1FBD A;  1T0K A;  4OHN A;  4N17 A;  4E0W A;  1QVS A;  1PBP A;  1LAG E;  3EHS A;  3FVG A;  2R9J A;  1IQ7 A;  3OO9 A;  3OO8 A;  4MHF A;  1A54 A;  4UAB A;  2DE3 A;  4BDN A;  1LFH A;  4UAC A;  3FV2 A;  3FV1 A;  4XTC Q;  2ZYN A;  4KI0 E;  3S9E A;  1YXI A;  2A5S A;  4U22 A;  4DCY A;  4ELR A;  5AA4 B;  2H5Y A;  2FHY A;  1MQG A;  2MKZ A;  4IB2 A;  3PUY E;  4Q5T A;  3FAS A;  4QFP A;  1FSA A;  4POX A;  5DEX B;  4NTL A;  4U1O A;  1AOV A;  1SW2 A;  2D5W A;  1WOD A;  2VPN A;  2F34 A;  3LSX A;  1VSO A;  4GWU A;  2WBD A;  1MY1 A;  2DWH A;  4KYS A;  4H6D A;  4OXV A;  2R8T A;  1B3L A;  5CMK A;  4GX6 A;  2RC9 A;  2XWV A;  3B7D A;  1B3E A;  1IXC A;  5EHS A;  1QUI A;  1FBH A;  4MX6 A;  2F6G A;  3DLN A;  1NV2 A;  2VOZ A;  2X7Q A;  5KCJ A;  1B7U A;  5I58 B;  1RYO A;  5M2V A;  4YKI A;  2V93 A;  3U72 A;  4OA4 A;  1NV5 A;  3S9N C;  4O3C A;  3HN0 A;  1P1U A;  4ZEK A;  1ZIU A;  1D9Y A;  4LZ5 A;  5JTY B;  1QKB A;  3R6U A;  2WKY A;  4RNS A;  4KYE A;  2QJE A;  3QUJ A;  3WAE A;  1Y9U A;  1IIT A;  1FTK A;  4LN5 A;  3ZSF A;  3PMW A;  2XX9 A;  5AA3 A;  3IFC A;  4HCW A;  4FED A;  4NGU A;  4JVI A;  4LON B;  1B5H A;  4JWX A;  3IL1 B;  3C4M A;  3BFU A;  2HAU A;  3K0V A;  1MXU A;  4P1L A;  3FVN A;  5EQ7 A;  1JW4 A;  4JB7 A;  1FPL A;  4GWO A;  3OO6 A;  1SBP A;  2PMS A;  1SQY A;  2OWT A;  1R9L A;  4PP0 A;  1R9Q A;  4JVD A;  4PCD A;  4XFE A;  4MLQ A;  1GTK A;  5TU0 A;  4OFL A;  4F31 B;  4G8M A;  4LVQ A;  4OVQ A;  4FAT A;  2XXQ A;  1TWY A;  1OIB A;  2XXX A;  2A5T B;  2GHA A;  3T93 B;  1G0I A;  5I59 A;  3C34 A;  3H6U A;  1FPG A;  3SEV A;  3K6W A;  2DWI A;  1BLF A;  1DMB A;  4RPN A;  3IB2 A;  1JEU A;  1DCU A;  5L8D A;  3EQ1 A;  4PTK A;  2XWI A;  3RY3 A;  4IY6 A;  1MQJ A;  3KSJ A;  2QS3 A;  1YTV A;  4OQO A;  3HPI A;  1XVX A;  3CFX A;  3TCH A;  2W7Y A;  4MNC A;  4G77 A;  2XHD A;  3LC8 A;  4M1V A;  4N13 A;  4ZED A;  4MF3 A;  4GOT A;  3AXF A;  1PEB A;  4RY1 A;  1MS7 A;  1QUK A;  2CZI A;  4HE0 A;  1B46 A;  1SYH A;  4HXV A;  3OEK A;  1LEV A;  3O97 A;  4DXB A;  4DXU A;  4EQB A;  3U8Q A;  1N04 A;  1O7T A;  2HAV A;  4X1D A;  1OVB A;  1EZP A;  3VXC A;  4H5G A;  1PDA A;  2ONK E;  3MVZ A;  4XIG Q;  3RN8 A;  3R7X A;  4EF2 A;  3NOH A;  4XEQ A;  1G0H A;  3IK6 B;  5EHM A;  1B58 A;  1B1H A;  3H7M A;  2REG A;  3E9X A;  2DS9 A;  1UTH B;  2GRV A;  1VDW A;  4FJP A;  5I3S A;  1LAF E;  2PT2 A;  3FBP A;  2IEE A;  1FQB A;  1TFA A;  3GBA A;  3GZG A;  1SW1 A;  2WBB A;  3HHF A;  2UVH A;  2NWJ A;  5IKB A;  2F3B A;  1JVX A;  4HE1 A;  1NV7 A;  3CG1 A;  3G3I A;  2LAO A;  3OSQ A;  3MPL A;  3OO7 A;  1D3K A;  4KCD A;  1B0L A;  1Y3N A;  3MC2 A;  3MZ9 A;  5ITO A;  5IM2 A;  5I58 A;  1YZ0 A;  4QSD A;  1B0H A;  2R71 A;  3PUZ E;  2WYK A;  2NVU B;  1MPB A;  1B3H A;  5HBC A;  3VVD A;  3OEL A;  1LB8 A;  2V3T A;  4EXK A;  3C31 A;  1B32 A;  2QVV A;  2V25 A;  3T22 A;  3C35 A;  4IO3 A;  1FBE A;  4YZZ A;  3UA8 A;  2V3U A;  3T9V A;  3F11 A;  1OLC A;  3IR1 A;  4PFB A;  1LFG A;  3MVY A;  2Y5L A;  3FVO A;  3IOT A;  3PPQ A;  1MY2 A;  5IGA A;  1S50 A;  3MZB A;  1I6Q A;  4HW8 A;  4NN3 A;  1A8E A;  2WX9 A;  2Z22 A;  3B6W A;  4FIM A;  1EU8 A;  4QBA A;  3TQW A;  4U21 A;  5AA4 A;  3K02 A;  1POT A;  4U4S A;  1FTJ A;  1CE2 A;  1SVX B;  2HZK A;  1NH7 A;  4N6D A;  5I2N A;  2HQ0 A;  3A3C A;  3T96 B;  4KXP A;  3IJX B;  2P2A A;  2Y7K A;  4ZEB A;  4ESW A;  1XVY A;  4H65 A;  4H1X A;  1B9J A;  3FJG A;  1EYJ A;  1Z7M E;  4OVJ A;  3QXM A;  1NNK A;  1IMB A;  2ANJ A;  5ET7 A;  4LZ8 A;  4ZDM A;  3VE1 B;  4H5F A;  3MP8 A;  4NF4 A;  2O1M A;  1XC1 A;  3PGF A;  1Y3Q A;  4OVP A;  4WED A;  4XKN A;  1AMF A;  1NL5 A;  3W9V A;  1INP A;  4KYD A;  3PPN A;  4GX3 A;  2DWJ A;  1Q1K A;  3K1P A;  2XXI A;  2Q2C A;  2ESN A;  3KBR A;  4C0R A;  2O51 A;  4ZZE A;  5KZT A;  1I6A A;  2HXR A;  4N07 A;  3RGY A;  4NX1 A;  3PD8 A;  4TLM B;  5F1Q A;  3FZV A;  4LQ5 A;  2XXW A;  4OAN A;  4X8R A;  4MMP A;  2DYX A;  4F3S A;  3LV0 A;  2ZZW A;  5H8F B;  4O94 A;  5DTB A;  2ZXT A;  1HSL A;  5I57 A;  4LUB A;  2CZH A;  3TCG A;  3U94 A;  3K2D A;  5I2K B;  4QFL A;  2F97 A;  1JEV A;  2QPQ A;  1NV1 A;  2ZYO A;  5H8N A;  2D3I A;  3ONM A;  1MXV A;  4HS7 A;  1FPF A;  3SES A;  3EHT A;  3T9H B;  2JJK A;  2X26 A;  1FQE A;  3VDF A;  1B52 A;  3PPR A;  1EZO A;  4R2F A;  1DTG A;  1B3F A;  1MM6 A;  2RIN A;  1IXG A;  2QVR A;  3BBR A;  5L9M A;  3IO4 A;  1OMP A;  2OCU A;  4WKM A;  1LBW A;  3KJ7 A;  3LR1 A;  4YAH X;  5HPQ A;  1NUW A;  1UIU A;  3IOU A;  3D1R A;  3MVX A;  3PMV A;  4U2R A;  2V84 A;  2DWA A;  4N91 A;  4RXL A;  4GIZ A;  1B6H A;  1SI1 A;  1NV0 A;  4ELO A;  3MYU A;  1Y4T A;  1R1N A;  3CRB A;  3CSG A;  1NNT A;  3FD3 A;  1B4H A;  1PB9 A;  3L6G A;  2DXY A;  3ECR A;  1JP4 A;  3TCF A;  5J16 A;  4G61 A;  4G8H A;  3KN3 A;  1LAH E;  3O28 A;  3N6U A;  4OMB A;  1NUY A;  4U1Z A;  1DPE A;  4G68 A;  4H0W A;  4MCO A;  5CMM A;  3DP4 A;  1NFT A;  3TTN A;  1RYX A;  4ECF A;  1FQC A;  3K00 A;  1H44 A;  3SZP A;  4OFO A;  3MAM A;  2FIX A;  4ZE8 A;  4IGR A;  1FPK A;  1UTB B;  1PBQ A;  3PMX A;  3T66 A;  2QS4 A;  4OEN A;  1B2H A;  4GXA A;  1OQG A;  3QAX A;  2ZNT A;  2O84 X;  4PAI A;  4RPO A;  3CIJ A;  3KEI A;  4NF5 A;  1NUX A;  1FPD A;  1JW1 A;  5A5X B;  1FQA A;  2O68 A;  4TOZ A;  1FBP A;  3FJM A;  1M5E A;  3C32 A;  5DYH A;  5IAI A;  3LSW A;  2PYY A;  4N8G A;  4ESX A;  3N26 A;  3K1M A;  3TUS A;  3K6V A;  1URD A;  4NMY A;  3KC1 A;  2E1S A;  2P1S A;  2P3V A;  3KOS A;  1OLA A;  2DP8 A;  3CSB A;  4JXI A;  5TPA A;  4N4U A;  4F2Q A;  1JW5 A;  2B3F A;  1N0T A;  2QSX A;  1CB6 A;  3S4U A;  4IGT A;  4Z7E A;  1P1Q A;  3QSL A;  4KCC A;  4RK2 A;  1SDX A;  4MFI A;  1US4 A;  2VPO A;  3KG2 A;  1FJ6 A;  1LCF A;  3L6H A;  4G68 C;  2B65 A;  4NHB A;  2HXW A;  3I3V A;  3Q26 A;  3TFL A;  1XT8 A;  2Y7P A;  3FJ7 A;  3TAJ A;  3UK4 A;  1JQF A;  5I57 B;  3RT8 A;  4P0I A;  5F7V A;  1Y3P A;  4QF9 A;  5CMC A;  3JV9 A;  5LDZ A;  4O7I A;  1PB7 A;  3KC0 A;  5CRY A;  2I3V A;  2Z8F A;  4OZ9 A;  3MQ9 A;  1IZ1 A;  4EQ7 A;  1BP5 A;  4GF8 A;  3FUZ A;  3B6Q A;  2I58 A;  3U92 A;  3ZKK A;  5ET5 A;  4XKR A;  4YKJ A;  3TTM A;  3UP9 A;  1XOC A;  4HTG A;  2VHA A;  1H3D A;  3C33 A;  3MWB A;  3OD7 A;  3KFM A;  1MY4 A;  2RC8 A;  2RCA A;  4HE2 A;  3RQT A;  4KD5 A;  1LBB A;  4NWD A;  2I4B A;  2OJT A;  5JTY A;  2KQZ A;  1N76 A;  2AYS A;  3ZKL A;  4ND9 A;  1MQI A;  4PE3 A;  2PVU A;  1JNF A;  3G3F A;  3G3H A;  4FEB A;  4GLI A;  4R74 A;  1IUD A;  2XWK A;  1Y20 A;  3HV1 A;  3PV0 E;  4PFT A;  2I0C A;  2HZL A;  1PB8 A;  3U1O A;  2I49 A;  4YB5 A;  3D4G A;  3A29 A;  2HFB A;  4YKK A;  5CI5 A;  3TQL A;  5J1D A;  1MY0 A;  4PF6 A;  5DVI A;  4QRZ A;  1MRP A;  3BKI B;  1B51 A;  3KBZ A;  5ICQ A;  2OX3 A;  4Q0C A;  3MP1 A;  3ODB A;  4P0G A;  3O6I A;  3G3G A;  3A3U A;  3T1B A;  4OEV A;  5H8Q A;  4P9K A;  3SEU A;  4YMA A;  5IZ3 A;  3T9U A;  4H45 A;  1FPJ A;  1B05 A;  2NUV A;  3GLB A;  3MZ1 A;  1NNF A;  1K9Z A;  3RNN A;  1TFD A;  3IOW A;  4H67 A;  3OOA A;  1SW4 A;  3OEN A;  4MLV A;  1NKX A;  1VFE A;  1GGG A;  2PCR A;  3FXR A;  1HSJ A;  4OVR A;  3CI8 A;  3K6U A;  4F3G A;  2VT5 A;  2F3D A;  2F36 A;  1A55 A;  4U23 A;  4F19 A;  1UQW A;  3OMB A;  3GXA A;  4P47 A;  5TPA B;  3V83 A;  1D9Q A;  5I7I A;  2PX1 A;  3ZS6 A;  2I3W A;  2Y7R A;  1B7Z A;  4PBH A;  5AA1 A;  4EUO A;  5JEI A;  1MG1 A;  2XWO A;  1FRP A;  2CZL A;  4UA8 A;  1DOT A;  4X9T A;  3DM0 A;  4QHQ A;  2ZNU A;  5ESY A;  1MQH A;  2B3B A;  1LBX A;  3PUV E;  5AA2 B;  1BKA A;  4P3L A;  3SEW A;  4DE8 A;  1FTA A;  2H99 A;  3EKI A;  3TEP A;  2DE4 A;  2NOO A;  3SEY A;  5A5X A;  4P8B A;  4ISU A;  4NF5 B;  3BIH A;  4PDD A;  1UTH A;  1BIY A;  3E4R A;  1NMU A;  1XHY A;  4PFW A;  2M8C A;  1LBC A;  1A7L A;  2Q89 A;  1MY3 A;  2XXH A;  3CFL A;  3V89 B;  2DVC A;  5JK4 A;  3HHG A;  4P1E A;  2YLN A;  4NF8 A;  1FQD A;  4IO7 A;  1BTJ A;  2DXR A;  2THI A;  4GBW A;  4F22 A;  1FBF A;  1I69 A;  5I84 A;  3T9X B;  4JVC A;  1NUZ A;  3T0J A;  1IXI A;  3UGW A;  4ZE9 A;  4PBQ A;  1FBG A;  3CG3 A;  3CVG A;  3G3J A;  5EQ8 A;  3UOR A;  3Q27 A;  3PD9 A;  1QUJ A;  4GWS A;  1AH5 A;  4R9G A;  1DBZ A;  4EDP A;  2V4C A;  4F2O A;  4X1B A;  1FPB A;  3K6X A;  1AIV A;  5H8H B;  1FTM A;  3N94 A;  1SI0 A;  1PC3 A;  2Q8J A;  1M5F A;  1M5C A;  2FBP A;  4NF6 B;  2RCB A;  3IOV A;  1MM7 A;  3TTR A;  2AL5 A;  3M3F A;  3Q25 A;  2H98 A;  2RC7 A;  2PFY A;  2QVU A;  4PGP A;  3EF7 A;  4AS5 A;  2Y5K A;  4AB5 A;  3FXU A;  4O3B A;  4GD5 A;  1ZTY A;  2ALU A;  4R6Y A;  5A5L A;  4LAT A;  2O1L A;  4I3E A;  1URG A;  1EZ9 A;  1P1W A;  1P1O A;  4OEU A;  3KOT A;  1QJM A;  3E13 X;  3QYT A;  4IO6 A;  2UVJ A;  4GXS B;  3CHG A;  4QFN A;  3USD A;  3RYD A;  1A99 A;  4FBP A;  3HFU A;  1VE4 A;  3O9P A;  4I8C A;  4NF8 B;  4TQU Q;  1D9V A;  3V5A A;  4G8N A;  4PAK A;  2QMX A;  3UN6 A;  1YYZ A;  1B3G A;  4GFR A;  5DT6 A;  4PFU A;  2G93 A;  3IO6 A;  4G68 B;  5IZ3 B;  3CR9 A;  1KZ8 A;  5K2X A;  1P99 A;  3KN8 A;  4TLL B;  1BK4 A;  4H8I A;  1O63 A;  3S2V A;  4F18 A;  1Q9D A;  4DXC A;  1O64 A;  4GVO A;  4BDL A;  3LBS A;  1OQH A;  3BFT A;  4MNI A;  4IO2 A;  2GQ1 A;  2QS2 A;  2ZYK A;  4GWZ A;  5AA2 A;  3B8B A;  1HSE A;  1ZKB A;  4OFJ A;  3FXB A;  3MPK A;  1P1N A;  3PUX E;  3THI A;  3OEM A;  4XKQ A;  2O7I A;  1SW5 A;  5I56 B;  3RPW A;  4BDM A;  3RUM A;  1RDX A;  2H4I A;  3EHU A;  2QRY A;  1H43 A;  2PBW A;  1B40 A;  1QW0 A;  4OET A;  4X04 A;  1IMD A;  2AIX A;  3K1N A;  4AB6 A;  4YKP A;  1IMA A;  4N6K A;  4O8M A;  1N3W A;  2Y84 A;  3MST A;  4LZ7 A;  1N3X A;  4M4G A;  2VD3 A;  4QSE A;  3LUY A;  4F3P A;  1LGB C;  1WVJ A;  4NE4 A;  4BLA A;  5I2K A;  2RF1 A;  2ONR A;  2QMW A;  1MXY A;  1MXW A;  2FNC A;  4IY5 A;  3Q28 A;  3RTW B;  4KQP A;  1J1N A;  4Q30 B;  3D4C A;  4KFQ A;  5H8F A;  1MQD A;  3PPO A;  1TXF A;  5LOM A;  4KHZ E;  3O66 A;  3IJO B;  4F29 A;  1DTZ A;  3TDJ A;  4PC9 A;  4JWO A;  4XXU A;  2Q9T A;  2B4L A;  2KR0 A;  4U4X A;  2DDK A;  2O6A A;  1ZMG A;  4QXD A;  4YB7 A;  3IB0 A;  3O6H A;  1XS5 A;  4WXJ A;  1LBY A;  2XX8 A;  1FTL A;  3LUZ A;  4N8Y A;  3G3K A;  5CBS A;  3TPA A;  4KPT A;  4P56 A;  2P3N A;  4OVS A;  4X48 A;  5IZ1 A;  3SET A;  1S9T A;  2FYI A;  3TTL A;  1NH8 A;  2OK2 A;  3IFA A;  3KGC A;  4R6K A;  3RPL A;  1IXH A;  1UIV A;  2XXP A;  4MH5 A;  1LST A;  3DEL B;  2XA5 A;  4AQ4 A;  3O6G A;  1Y4C A;  2ZZV A;  1MXX A;  4GWY A;  4FE8 A;  4Z0I A;  4ZEF A;  4IO4 A;  2E0S A;  3MW0 A;  3RT6 B;  4RJZ A;  2F35 A;  5I2N B;  1FW0 A;  2CEX A;  4MBP A;  1NV4 A;  3Q29 A;  1MDQ A;  3B6T A;  2REJ A;  1EYI A;  4NQ8 A;  1F9B A;  5BUU A;  4QSC A; 
#chains in the Genus database with same CATH homology
 1N84 A;  2OLB A;  3FVO A;  3IOT A;  3PPQ A;  4P11 A;  3TOD A;  2NXO A;  2ZMB A;  3QIM A;  1MY2 A;  4C1T A;  3SEU A;  4YMA A;  1S50 A;  2OZZ A;  1I6Q A;  2XXR A;  3H6W A;  1B5J A;  3IX1 A;  3MZB A;  4YU0 A;  3T9U A;  3P7I A;  1JVY A;  4HW8 A;  2BJJ X;  1A8E A;  2ABH A;  1LLS A;  4G4P A;  2Z22 A;  3N6T A;  3B6W A;  4FAJ A;  5CBR A;  5TP9 B;  1B05 A;  3VVE A;  5CM6 A;  5H8N B;  2KLF A;  4NED A;  2ONS A;  4PFY A;  2NUV A;  3GLB A;  4FIM A;  3MZ1 A;  1EU8 A;  1NNF A;  4ELQ A;  1IEJ A;  3RNN A;  1TFD A;  3TQW A;  3IOW A;  4U21 A;  2UVI A;  1Y1M A;  3OOA A;  3QUF A;  4H67 A;  1SW4 A;  5CMB A;  1POY 1;  5AA4 A;  2V3Q A;  3OEN A;  1LB9 A;  3K02 A;  4MLV A;  3H3G A;  1POT A;  4U4S A;  1NKX A;  1FTJ A;  1US5 A;  1CE2 A;  1UTB A;  1VFE A;  4R73 A;  3O29 A;  1SVX B;  1GVC A;  3TZA A;  1GGG A;  2HZK A;  1NH7 A;  4EXK A;  2YJP A;  1EH3 A;  1OVT A;  3FXR A;  1HSJ A;  5I2N A;  4F1V A;  2HQ0 A;  3A3C A;  2DQV A;  3CI8 A;  3K6U A;  4GRK A;  4RA1 A;  5FTI A;  3T96 B;  4F3G A;  2UYF A;  3TTK A;  3IJX B;  2P2A A;  2Y7K A;  2H9B A;  2F36 A;  4U23 A;  1A55 A;  1XVY A;  4ZEB A;  4ESW A;  4F19 A;  2ZYM A;  4H65 A;  4H1X A;  1B9J A;  3KN7 A;  3K01 A;  1UQW A;  1B4Z A;  3FJG A;  3OMB A;  3IB1 A;  1Z7M E;  1QKA A;  2IA4 A;  3FAT A;  3GXA A;  5TPA B;  3V83 A;  4OVJ A;  3DP8 A;  1II5 A;  3QXM A;  2QL3 A;  1NNK A;  3FGS A;  1MH3 A;  2ANJ A;  2PX1 A;  3ZS6 A;  2I3W A;  2Y7R A;  1B7Z A;  4ZDM A;  4LZ8 A;  5AA1 A;  3VE1 B;  1MG1 A;  4H5F A;  3VLV A;  4EUO A;  4F3B A;  3MP8 A;  1H76 A;  4NF4 A;  2CZL A;  4JSO A;  2O1M A;  3RT6 B;  4UA8 A;  1DOT A;  4X9T A;  5FHO A;  3DM0 A;  3M3L A;  1S7Y A;  4LQ2 A;  4QHQ A;  4R75 A;  2ZNU A;  5K2Y A;  1XC1 A;  4I1D A;  3PGF A;  1Y3Q A;  4ZS9 A;  4WED A;  4XKN A;  1M5B A;  4ZEC A;  1MQH A;  2B3B A;  3W9W A;  5B70 A;  1MDP 1;  1AMF A;  1NL5 A;  4NWC A;  2RKM A;  3PUV E;  3W9V A;  5AA2 B;  1BKA A;  1GR2 A;  1USY H;  2XXT A;  3K4U A;  4KYD A;  3SEW A;  4DE8 A;  3PPN A;  1USY E;  5L9O A;  3R26 A;  2HCA A;  4HCY A;  2DSF A;  5KCJ B;  2H99 A;  2DWJ A;  2AL4 A;  1Q1K A;  3K1P A;  3E3K A;  2XXI A;  3TEP A;  2DE4 A;  4F1U A;  5I59 B;  2VP1 A;  1QUL A;  2NOO A;  3DP6 A;  2Q2C A;  3SEY A;  3KSX A;  5A5X A;  2ESN A;  1JET A;  4BDQ A;  4DIG A;  3GBB A;  4I9D A;  4ISU A;  3KBR A;  1Q35 A;  4NF5 B;  2O51 A;  3VXB A;  4C0R A;  5DVF A;  5KDT A;  1UTH A;  4ZZE A;  5KZT A;  3PUW E;  4YIC A;  2F7C A;  1I6A A;  5L9S A;  4NF4 B;  4N07 A;  1BIY A;  2HEU A;  4ZEI A;  3E4R A;  2XD2 A;  2D21 A;  4I62 A;  1NMU A;  1XHY A;  4PFW A;  1T0K A;  2M8C A;  4QFK A;  1LBC A;  4OHN A;  2CMO A;  3H6V A;  4E0W A;  4THI A;  3RGY A;  1A7L A;  2Q89 A;  3PD8 A;  4TLM B;  5F1Q A;  1MY3 A;  1PBP A;  1QVS A;  3JZJ A;  3FZV A;  1LAG E;  1N7X A;  2XXH A;  3EHS A;  4LQ5 A;  3CFL A;  3THI A;  3C36 A;  3FVG A;  2R9J A;  1IQ7 A;  3OO9 A;  4R2B A;  3V89 B;  1ZJL A;  2XXW A;  3OO8 A;  3C9H A;  2DVC A;  3MVW A;  1A54 A;  5JK4 A;  2DYX A;  2DE3 A;  4BDN A;  3HHG A;  4F3S A;  2YLN A;  1LFH A;  4NF8 A;  4UAC A;  1FQD A;  3FV2 A;  4IO7 A;  1L5T A;  3FV1 A;  5H8F B;  2GFE A;  1BTJ A;  4XTC Q;  2ZYN A;  4FOR A;  4KI0 E;  4RK9 A;  5DTB A;  3S9E A;  2ZXT A;  1HSL A;  2DXR A;  5I57 A;  2A5S A;  2THI A;  2F78 A;  3KZG A;  4LUB A;  3TCG A;  4F22 A;  3U94 A;  2R6G E;  1I69 A;  3LSF B;  4U22 A;  1D4N A;  4DCY A;  5I84 A;  3K2D A;  3T9X B;  4PE5 B;  4ELR A;  5AA4 B;  5I2K B;  1ATG A;  1B7H A;  2H5Y A;  4QFL A;  2P0S A;  3O2A A;  1DSN A;  3U93 A;  1MQG A;  5FHN A;  1IXI A;  2Y7I A;  2F97 A;  1JEV A;  3UGW A;  2QPQ A;  4ZE9 A;  5AE4 A;  2ZYO A;  4IB2 A;  1B1X A;  3PUY E;  5H8N A;  3CG3 A;  2D3I A;  5TP9 A;  3ONM A;  1MXV A;  3CVG A;  3FAS A;  3FVK A;  4HS7 A;  4Q5T A;  4QFP A;  4C1U A;  3G3J A;  3SES A;  3EHT A;  3TMG A;  4POX A;  3RLF E;  3UOR A;  4ZZA A;  5DEX B;  4NTL A;  4U1O A;  1AOV A;  3TKD A;  1SW2 A;  2D5W A;  3Q27 A;  1WOD A;  3PD9 A;  1QUJ A;  2F34 A;  3T9H B;  3LSX A;  1VSO A;  2X26 A;  3VVF A;  1FQE A;  1AH5 A;  2F6P A;  4KR5 A;  2Q2A A;  1B52 A;  1MY1 A;  2DWH A;  3OSR A;  4KYS A;  4R9G A;  3PPR A;  3V8X B;  4FEC A;  4EDP A;  4O3A A;  3SEX A;  4H6D A;  1EZO A;  4OXV A;  4R2F A;  1DTG A;  1DPP A;  4F2O A;  3HCQ A;  1Z7N E;  2Z8E A;  4X1B A;  5BWJ A;  1B3L A;  1B3F A;  1MM6 A;  3K6X A;  2RIN A;  5CMK A;  1AIV A;  1IXG A;  5H8H B;  3H4Z A;  2I6E A;  5L9M A;  3BBR A;  2RC9 A;  3IO4 A;  3W15 C;  3B7D A;  4DZ1 A;  1FTM A;  3N94 A;  1SI0 A;  1B3E A;  2YPN A;  2DE2 A;  1PC3 A;  5B7D A;  4OTE A;  1IXC A;  5EHS A;  1OMP A;  2OCU A;  4WKM A;  2Q8J A;  2VGQ A;  3KJ7 A;  1M5F A;  1QUI A;  3LR1 A;  4YAH X;  5HPQ A;  1SYI A;  1M5C A;  1UIU A;  3MUQ A;  2F6G A;  4NF6 B;  2RCB A;  3IOV A;  1MM7 A;  2ZNS A;  2G29 A;  3IOU A;  3MVX A;  2AL5 A;  3TTR A;  3DLN A;  3PMV A;  4U2R A;  3M3F A;  3Q25 A;  2V84 A;  2DWA A;  2F7B A;  2H98 A;  2RC7 A;  2VOZ A;  4RXL A;  2X7Q A;  5KCJ A;  4GIZ A;  1B7U A;  1ZLQ A;  1B6H A;  1RYO A;  3EF7 A;  5M2V A;  5I58 B;  1SI1 A;  4R6H A;  2V93 A;  4YKI A;  3FIR A;  5HM4 B;  5ICT A;  4ELO A;  5JEI A;  1Y4T A;  3U72 A;  1R1N A;  2GH9 A;  2OWS A;  1NNT A;  3CRB A;  3CSG A;  3S9N C;  4AB5 A;  4O3C A;  3FD3 A;  3HN0 A;  1P1U A;  3FXU A;  4O3B A;  1B4H A;  4GD5 A;  1LCT A;  1ZTY A;  2ALU A;  4R6Y A;  4ZEK A;  1ZIU A;  1D9Y A;  1PB9 A;  4LZ5 A;  4LAT A;  3L6G A;  2DXY A;  2O1L A;  3ECR A;  5JTY B;  1QKB A;  1FQF A;  3R6U A;  3TCF A;  2WKY A;  4G8H A;  3KN3 A;  4RNS A;  1LAH E;  1URG A;  1EZ9 A;  1Y1Z A;  3O28 A;  1P1W A;  2QJE A;  3N6U A;  3QUJ A;  4KYE A;  4OMB A;  1Y9U A;  3VDF A;  4U1Z A;  1P1O A;  1IIT A;  3WAE A;  1M5D A;  5DEX A;  1DPE A;  4OEU A;  4G68 A;  4H0W A;  1FTK A;  5AA2 D;  5CMM A;  3ZSF A;  3DP4 A;  4BDR A;  1MPC A;  1H45 A;  1NFT A;  2XX9 A;  3KOT A;  1QJM A;  3PMW A;  4HCW A;  4FED A;  1RYX A;  3TTN A;  1FTO A;  4ECF A;  4Q8R A;  3E13 X;  3QYT A;  4XKP A;  5EYF A;  1MXZ A;  4PQJ A;  2XD3 A;  4LON B;  4IO6 A;  4QFO A;  1FQC A;  1B5H A;  4JWX A;  2UVJ A;  3K00 A;  3IL1 B;  1H44 A;  4DDD A;  4OFO A;  3C4M A;  3MAM A;  3BFU A;  2HAU A;  4ZE8 A;  4GXS B;  3K0V A;  1MXU A;  4IGR A;  4QFN A;  3USD A;  3EPE A;  4LP2 B;  1A99 A;  3FVN A;  1JW4 A;  1UTB B;  1PBQ A;  3PMX A;  4JB7 A;  1VE4 A;  2QS4 A;  3OXN A;  4H8J A;  1WDN A;  3O9P A;  4OEN A;  4I8C A;  3H06 B;  4NF8 B;  4TQU Q;  4GWO A;  1B2H A;  1D9V A;  3OO6 A;  3V5A A;  4E0X A;  1SBP A;  1OQG A;  4G8N A;  2I4C A;  1SQY A;  2PMS A;  2OWT A;  4GXA A;  3QAX A;  4R9F A;  3FXQ A;  1R9L A;  3KJT A;  2QMX A;  1URS A;  4PP0 A;  1ZBM A;  1R9Q A;  3UN6 A;  3IAZ A;  2ZNT A;  1B3G A;  2UYE A;  2O84 X;  4GFR A;  4MLQ A;  1GV8 A;  5DT6 A;  3SKP A;  4PFU A;  2G93 A;  3SER A;  3IO6 A;  4G68 B;  1GTK A;  5TU0 A;  4OFL A;  3CR9 A;  1R6Z A;  4F31 B;  2XXY A;  1ZU0 A;  4G8M A;  4LVQ A;  4BDO A;  4K3F A;  4RPO A;  4FAT A;  5H8Q B;  3CFZ A;  5K2X A;  1P99 A;  3KN8 A;  4TLL B;  1SD3 A;  4H8I A;  1O63 A;  2XXQ A;  3LSL A;  3CIJ A;  3KEI A;  1TWY A;  1OIB A;  4NF5 A;  5KDT B;  2XXX A;  3S2V A;  4F18 A;  2A5T B;  1JW1 A;  1LFI A;  2GHA A;  5A5X B;  4DXC A;  1O64 A;  2O7U A;  2I48 A;  1FQA A;  4ONY A;  3T93 B;  4GVO A;  2DOJ A;  4BDL A;  2O68 A;  5I59 A;  3C34 A;  4EF1 A;  4TOZ A;  1VR5 A;  3FJM A;  1M5E A;  3H6U A;  3C32 A;  2F5X A;  3LBS A;  3SEV A;  1OQH A;  3BFT A;  3K6W A;  3VV5 A;  2DWI A;  5DYH A;  4IO2 A;  4DCX A;  5IAI A;  2QS2 A;  2ZYK A;  1AL3 A;  1FCK A;  1N7W A;  2PYY A;  1BLF A;  3LSW A;  1DMB A;  5AA2 A;  4ESX A;  4RPN A;  4JBZ A;  3N26 A;  3K1M A;  3IB2 A;  4JDF A;  3TUS A;  1HSE A;  1JEU A;  1ZKB A;  3N5L A;  3JYR A;  3K6V A;  1URD A;  4OFJ A;  3T66 A;  1A8F A;  3MPK A;  5L8D A;  3VFJ A;  1LAX A;  3VLW A;  1P1N A;  3EQ1 A;  4NMY A;  4F1Y A;  4OWD A;  3PUX E;  3RY3 A;  2E1S A;  2P1S A;  4IY6 A;  2Y7W A;  3OEM A;  4LA9 A;  2O7I A;  1MQJ A;  4XKQ A;  3KOS A;  3TEL A;  1SW5 A;  2I0B A;  5I56 B;  1A40 A;  3RPW A;  4BDM A;  1OLA A;  3RUM A;  3IOR A;  2FA7 A;  3KSJ A;  2DP8 A;  2QS3 A;  1YTV A;  4OQO A;  3CSB A;  3HPI A;  4DLD A;  5I56 A;  1I6B A;  2H4I A;  3EHU A;  1XVX A;  4JXI A;  5TPA A;  4F2Q A;  1JW5 A;  5FTH A;  2GHB A;  2QRY A;  2B3F A;  1H43 A;  1N0T A;  2QSX A;  5FHM A;  2PBW A;  4YMB A;  3VLU A;  1B40 A;  1CB6 A;  1QW0 A;  3CFX A;  4OET A;  2W7Y A;  3TCH A;  3MBP A;  4OYV A;  4G77 A;  3S4U A;  2XHD A;  3LC8 A;  4OER A;  4M1V A;  5ITP A;  2AIX A;  3QK6 A;  4N13 A;  3K1N A;  4IGT A;  4MF3 A;  4AB6 A;  4Z7E A;  1P1Q A;  4ZED A;  3QSL A;  4YKP A;  4GOT A;  4KCC A;  2XXV A;  4RK2 A;  1SDX A;  3WAF A;  4MFI A;  4L17 A;  1US4 A;  4YB6 A;  3KG2 A;  1N3W A;  2Y84 A;  1LCF A;  3G7W A;  4LZ7 A;  3S9M C;  1ANF A;  1N3X A;  5CC2 A;  3AXF A;  1PEB A;  4M4G A;  1MS7 A;  2VD3 A;  3L6H A;  3LUY A;  4QSE A;  4G68 C;  4RY1 A;  4F3P A;  1QUK A;  2B65 A;  1LGB C;  2HXW A;  3I3V A;  3Q26 A;  1B46 A;  1SYH A;  3TFL A;  3OEK A;  1WVJ A;  1XT8 A;  3O97 A;  2Y7P A;  4NE4 A;  4BLA A;  5I2K A;  3FJ7 A;  3H03 A;  2RF1 A;  4DXB A;  2UVG A;  3TAJ A;  2ONR A;  2QMW A;  3UK4 A;  4DXU A;  4EQB A;  1MXY A;  1MXW A;  2FNC A;  3ILT B;  4IY5 A;  3HST A;  3Q28 A;  1JQF A;  3U8Q A;  5I57 B;  1N04 A;  4GQO A;  3RT8 A;  1O7T A;  3RTW B;  2HAV A;  4KQP A;  4X1D A;  1J1N A;  1OVB A;  4GL0 A;  4Q30 B;  3UIF A;  3VXC A;  1EZP A;  3D4C A;  4P0I A;  4KFQ A;  5F7V A;  3M8U A;  3RTF B;  1MQD A;  5H8F A;  3PPO A;  4H5G A;  1PDA A;  2ONK E;  1Y3P A;  4QF9 A;  5CMC A;  1TXF A;  5LOM A;  1YPN A;  3JV9 A;  4KHZ E;  3O66 A;  3MVZ A;  3IJO B;  4F29 A;  1DTZ A;  1PB7 A;  4OES A;  4XIG Q;  3RN8 A;  1MPD A;  3R7X A;  4EF2 A;  3TDJ A;  5CRY A;  5ISU A;  3IK6 B;  5EHM A;  4POW A;  4EXL A;  2F8D A;  1B58 A;  4GL8 A;  2I3V A;  1B1H A;  4JWO A;  2Z8F A;  4XXU A;  4OZ9 A;  3MQ9 A;  1IZ1 A;  3H7M A;  4EQ7 A;  2Q9T A;  1BP5 A;  2REG A;  3E9X A;  4U4X A;  2O6A A;  3H6T A;  4GF8 A;  4R72 A;  2DS9 A;  1ZMG A;  4YB7 A;  3IB0 A;  3FUZ A;  1UTH B;  2GRV A;  2I58 A;  3B6Q A;  1XS5 A;  3O6H A;  4FJP A;  4WXJ A;  3I5O A;  3U92 A;  3ZKK A;  4EQ9 A;  1LAF E;  2XX8 A;  3M3K A;  2PT1 A;  4F39 A;  1FTL A;  4XKR A;  4YKJ A;  3TTM A;  3UP9 A;  1XOC A;  1YCJ A;  2PT2 A;  3G3K A;  2IEE A;  3I6V A;  1TT1 A;  4HTG A;  4N6P A;  3TPA A;  1FQB A;  5CBS A;  1TFA A;  1NNP A;  2VHA A;  1H3D A;  4KPT A;  3C33 A;  3GBA A;  3MWB A;  3GZG A;  1SW1 A;  3OD7 A;  4IO5 A;  2OBG A;  3KFM A;  4X48 A;  3SET A;  1KWH A;  1MY4 A;  1S9T A;  2RCA A;  2FYI A;  2RC8 A;  3RQT A;  4KD5 A;  1LBB A;  4RYA A;  3TTL A;  3TYH A;  3HHF A;  4NWD A;  2I4B A;  2UVH A;  2XXU A;  1NH8 A;  2OK2 A;  3MJN A;  2NWJ A;  5IKB A;  4PET A;  2OJT A;  5JTY A;  1JVX A;  1N76 A;  2AYS A;  3ZKL A;  4ND9 A;  1MQI A;  3KGC A;  3CG1 A;  3G3I A;  2LAO A;  4R6K A;  2H25 A;  1IXH A;  3OSQ A;  1UIV A;  2XXP A;  2X7P A;  2PVU A;  3MPL A;  3OO7 A;  5AA3 A;  1D3K A;  1JNF A;  1B0L A;  1Y3N A;  3MC2 A;  3G3F A;  1LST A;  4KCD A;  4MH5 A;  3G3H A;  1VFD A;  4FEB A;  3DEL B;  4GLI A;  2Z23 A;  1IUD A;  3MZ9 A;  4R74 A;  5ITO A;  5I58 A;  4AQ4 A;  1Y20 A;  3HV1 A;  3O6G A;  3PV0 E;  4JWY A;  4PFT A;  4QSD A;  1Y4C A;  1MH4 A;  1B0H A;  2R71 A;  1MXX A;  3HO7 A;  2I0C A;  3PUZ E;  2UXA A;  2F7A A;  4FE8 A;  2HZL A;  2XX7 A;  4Z0I A;  2NVU B;  1PB8 A;  3MP6 A;  4NF6 A;  5ELV A;  1MPB A;  3U1O A;  2I49 A;  4YB5 A;  5DVJ A;  1B3H A;  4IO4 A;  3D4G A;  4ZEF A;  2E0S A;  3A09 A;  5HBC A;  3VVD A;  3MW0 A;  1YAE A;  3OEL A;  3PU5 A;  4JSD A;  2Q88 A;  1LB8 A;  2V3T A;  4RJZ A;  2F35 A;  2HFB A;  3C31 A;  4G2Z A;  4WEP A;  5CI5 A;  4YKK A;  3ILU B;  5I2N B;  3TQL A;  5J1D A;  1ELJ A;  3SDF A;  1B32 A;  1MY0 A;  3S9L C;  2V25 A;  3T22 A;  1FW0 A;  3C35 A;  4IO3 A;  5H8H A;  5DVI A;  4YZZ A;  1RKM A;  4MBP A;  1MRP A;  4QRZ A;  2V3U A;  3BKI B;  1B51 A;  3T9V A;  3F11 A;  3UA8 A;  4ELP A;  3Q29 A;  5ICQ A;  1MDQ A;  3EN3 A;  2A5T A;  1OLC A;  2QS1 A;  2REJ A;  3B6T A;  3IR1 A;  4Q0C A;  2DVZ A;  3MP1 A;  3ODB A;  4P0G A;  1IIW A;  1B5I A;  2VD2 A;  1LFG A;  1F9B A;  3G3G A;  3O6I A;  3A3U A;  3MVY A;  5H8S A;  5BUU A;  4OEV A;  2Z8D A;  3PPP A;  4QSC A;  5H8Q A;  2O69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...