1EU8A

Structure of trehalose maltose binding protein from thermococcus litoralis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
407
structure length
407
Chain Sequence
b'IEEGKIVFAVGGAPNEIEYWKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIASGWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYSKPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKDGKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYAWGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYSVQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKYVNSALAGKISPQEALDKAQKEAEELVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TREHALOSE/MALTOSE BINDING PROTEIN
publication title The crystal structure of a liganded trehalose/maltose-binding protein from the hyperthermophilic Archaeon Thermococcus litoralis at 1.85 A.
pubmed doi rcsb
source organism Thermococcus litoralis
molecule tags Sugar binding protein
total genus 144
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1eu8A01
1DPPA 1O64A 1CB6A 2AL5A 1NL5A 3O29A 1VR5A 1PC3A 3H3GA 1B3GA 4IO3A 3SEVA 3PUXE 4TOZA 1DOTA 4YKJA 2O7IA 3ZKLA 2I48A 3TUSA 4KYSA 4EQ9A 1B5HA 5DVIA 4G2ZA 2Y7WA 3PUYE 3G3FA 3HCQA 3M3FA 1POY1 1H43A 4PQJA 1ZLQA 4KFQA 1XVXA 2XXRA 3EHTA 2QS3A 4LP2B 3S9LC 2NWJA 4QFLA 3Q29A 3CG3A 3QAXA 4XKRA 3L6GA 3FGSA 4C0RA 4JBZA 2ZNUA 4NMYA 3OXNA 3OO7A 4MBPA 1Q35A 5I2KA 4Z0IA 5K2XA 1LGBC 3TMGA 1FQBA 3OO9A 3RT8A 1PB9A 1IXGA 1HSLA 1WVJA 2F35A 1FTJA 3QK6A 1B40A 1VSOA 1NMUA 3IB0A 1XT8A 5F1QA 3K6UA 2FNCA 2RCBA 4RJZA 1JW4A 1MG1A 3VXBA 5I84A 3C34A 3MP1A 4LQ2A 5I2NB 2A5SA 3RT6B 3UP9A 1YTVA 1PBQA 2XXIA 2UYFA 1B3LA 4FE8A 4OFJA 4GLIA 3PMWA 1GGGA 3CFXA 3SERA 4OHNA 1B58A 3CR9A 4XXUA 5FHMA 1SQYA 1N0TA 3FJGA 4I1DA 1S7YA 3A3UA 5HM4B 1AMFA 3TYHA 1FW0A 4DZ1A 2V3TA 4R6YA 2UXAA 4NF6B 2Y84A 2HZLA 5I56B 1FTLA 4G8HA 3Q27A 2F36A 1SW5A 3MP8A 3EQ1A 3KSJA 2PMSA 3C36A 3E13X 2PT1A 3IOVA 3IOTA 2OWTA 4BDLA 3H6UA 1OQGA 1ZKBA 3H06B 4NE4A 2QS2A 4U4SA 4RK2A 2XXWA 2XXUA 2ZYMA 1CE2A 3T93B 2ONRA 3BBRA 1XHYA 2HAVA 3MPKA 2XXXA 1A8EA 4ESXA 2IEEA 5H8QA 4P0IA 1MDP1 1YAEA 2PBWA 1H76A 4DIGA 1SW1A 3SEUA 3TAJA 5CBRA 2IA4A 4R75A 3K6VA 3LC8A 2Z8FA 4ZE9A 1GTKA 2Z23A 3MVWA 4FJPA 4ONYA 1LFIA 4YZZA 1H3DA 4PFUA 1QUJA 3S9MC 1USYE 2OZZA 4AB5A 3KOSA 3WAFA 4F1YA 1B9JA 4FATA 1LCTA 3MUQA 4MLVA 5I2KB 3O97A 1PBPA 3Q28A 4FAJA 4ZS9A 4ESWA 1A99A 5CC2A 3IL1B 4GL0A 1TWYA 3H6VA 3ILTB 3SEXA 3TTLA 3FV1A 3FD3A 2G93A 2DXYA 4F2OA 3DP6A 3UK4A 3DELB 1AOVA 1QVSA 1Y3NA 4ELOA 4OEVA 2NUVA 3U8QA 2PT2A 2Y7PA 2DE2A 1MXWA 3TTKA 3D4CA 2ZMBA 4R6HA 5KCJA 3OO8A 4UACA 1HSJA 2XD3A 4MH5A 5BWJA 1D9VA 1MQDA 3EPEA 5I59A 2Q89A 5A5XA 3KN3A 4PE5B 3ZSFA 4EUOA 4PFWA 3N26A 3U1OA 1SD3A 4KI0E 1Y20A 1I6QA 2HXWA 4GFRA 1B0HA 1B7HA 1DSNA 5CI5A 1RYXA 2W7YA 3QSLA 3H03A 4YMAA 3FJ7A 1B7ZA 1YPNA 2QSXA 2DOJA 1QKAA 2AYSA 4F19A 3MJNA 3LSFB 1II5A 4H67A 4HCWA 3FXRA 4O3AA 4WEDA 5L9SA 1LAFE 4X1DA 1MQGA 4EDPA 2V25A 2DXRA 3TELA 5H8QB 2I0CA 3FJMA 2Z22A 2DSFA 3RN8A 1P1WA 3GBAA 1M5EA 3T9HB 5TU0A 3SESA 1LAXA 3A09A 1H44A 2P1SA 3KG2A 3CFZA 1O63A 4DCYA 4R73A 4RK9A 4XKPA 1N3XA 4YKPA 3M3LA 3RTFB 2CZLA 3DLNA 2RKMA 3FXUA 3PUVE 1MH3A 3PV0E 3K4UA 2H98A 2HCAA 4U23A 2E0SA 4M1VA 1US4A 3IB2A 1Y1MA 4JDFA 4Z7EA 4JB7A 4FORA 5CBSA 1B5IA 4LUBA 4OFOA 1NNPA 1Y9UA 2B3BA 4OXVA 4DLDA 3R26A 2X7QA 3Q25A 3FVOA 3T9XB 3HV1A 4BDNA 1QKBA 2XXVA 2UYEA 4OERA 2Y7KA 5CMKA 4JWOA 4ELQA 4PETA 2HAUA 1MXZA 2VOZA 3PD8A 1BLFA 3QXMA 2ZNTA 2GFEA 4KCCA 5KCJB 2QPQA 4I9DA 1LSTA 5IKBA 1FCKA 4OFLA 2DYXA 5ITPA 1NFTA 2OLBA 3MPLA 3K0VA 1YCJA 5A5XB 1PB8A 1MY2A 4RA1A 1MM6A 2V3QA 4R2BA 3JZJA 4NF5A 2HZKA 4OTEA 3U94A 4H0WA 4ISUA 2Q2AA 3CI8A 3RQTA 4BDMA 4PFTA 1OVTA 4BLAA 4K3FA 4OYVA 3BKIB 3MZ1A 5AE4A 3IOUA 2AL4A 1MDQA 1N7XA 4H1XA 2OK2A 4F3GA 1IUDA 3E4RA 3AXFA 2XXQA 4TLMB 2ABHA 1B1HA 4RXLA 1VE4A 2H4IA 3IX1A 1B4HA 3B6WA 2GH9A 4H5GA 1L5TA 3OMBA 4QFOA 3MVXA 1RKMA 3K02A 3VFJA 3QUFA 3S9EA 1MXVA 3VVFA 5HPQA 4GOTA 3VXCA 4X9TA 2GRVA 3KJTA 1IXIA 1A40A 3CRBA 1URGA 3PUWE 3EHUA 3PPOA 1M5CA 4EXKA 1SW2A 3K01A 1R9LA 4IB2A 1QJMA 2QS4A 1UTBA 1R1NA 4BDRA 4QFPA 3LBSA 3PU5A 1MXXA 3CSGA 3BFUA 4R9FA 3O2AA 4HS7A 1IXHA 4YU0A 4F3BA 3FXQA 4NF8A 3VLWA 3OEKA 3TFLA 3B6QA 3OOAA 2RF1A 3N5LA 4YMBA 4DXCA 1A7LA 1OQHA 5ICQA 4GWOA 1XVYA 1SI1A 5FTIA 3ECRA 1XOCA 3FV2A 3G7WA 4BDOA 3IO6A 4POXA 3KEIA 2XXYA 2RINA 2OWSA 5H8HA 1JVYA 3FATA 4F18A 3USDA 1GVCA 3TZAA 1POTA 4F1VA 4MFIA 3TEPA 4F39A 4MLQA 1QULA 3IOWA 3MBPA 4NF5B 1MH4A 1MY0A 3E9XA 1MRPA 4IO6A 3PD9A 2Q2CA 3O6IA 2XXTA 4E0WA 3F11A 3VVDA 1B05A 3EHSA 1B2HA 3RY3A 4ND9A 1NH7A 4LVQA 4NF4A 3OEMA 5BUUA 2WKYA 1SI0A 1MXUA 2R9JA 1US5A 3C4MA 2ZYNA 5L8DA 2I4CA 5ISUA 2F78A 1B5JA 1B3HA 4G68A 2PYYA 1Y3QA 2ESNA 3H7MA 5AA1A 2I0BA 1AL3A 2VP1A 3SETA 4OESA 1LCFA 3H6WA 1JNFA 3MC2A 2O84X 3ILUB 4PFYA 1SBPA 3SEYA 4G4PA 1NKXA 2OBGA 4N6PA 4UA8A 1UTBB 5EHSA 2HQ0A 3VDFA 2QMWA 2ZNSA 4EF2A 3UIFA 4JWXA 2Y7RA 1TFDA 3IB1A 4JSDA 4Q5TA 1BIYA 2D21A 4GXAA 1B3FA 4YKKA 4NF8B 1M5DA 4OZ9A 3IAZA 2UVJA 3M8UA 3MWBA 3DM0A 3SKPA 1UQWA 3H6TA 1SVXB 1B4ZA 1IITA 4KCDA 2LAOA 1B0LA 3PPQA 4LZ8A 3MVZA 3VV5A 4F2QA 5AA2D 1M5BA 4OENA 4C1TA 4N07A 3U93A 3GLBA 4ELRA 4QF9A 5H8HB 4KR5A 2NOOA 3MZBA 1EZ9A 1I6AA 3MZ9A 4QSEA 4OWDA 3LUYA 4GVOA 4IGRA 3PUZE 3B7DA 3CG1A 1B52A 4LA9A 3FIRA 3C9HA 1N76A 3DP8A 3B6TA 1FTMA 1NNTA 3KJ7A 2F6GA 1R6ZA 3PPPA 4L17A 3C31A 1P99A 2RC8A 4G68C 3HO7A 4RPOA 4ZEFA 2BJJX 3JYRA 3T22A 4OQOA 3PGFA 4EQBA 1B46A 1MY3A 1EZPA 1J1NA 4NF4B 1A55A 1H45A 4KQPA 5DEXA 4DXBA 3QYTA 4Q30B 4IO2A 4ZEDA 4OETA 1EZOA 2I6EA 3D4GA 4DE8A 1MPCA 3MW0A 3QUJA 4DDDA 4WXJA 3KN8A 4G68B 4WEPA 1IEJA 2VGQA 2DWAA 5AA4A 2Q88A 3W15C 4F22A 1HSEA 3TCHA 4NWCA 3RTWB 5F7VA 1SYHA 1GV8A 1ZIUA 3KFMA 4U1ZA 4PP0A 1MQIA 2UVIA 3V8XB 2F6PA 3RNNA 1Y3PA 1SDXA 3MP6A 3S9NC 1BTJA 2H99A 1LLSA 3FZVA 3Q26A 2FA7A 4QHQA 4JWYA 4IY5A 3K1MA 3TKDA 5DVJA 2DE4A 2UVGA 1RYOA 2ZYOA 5I58A 2F97A 3EF7A 2V3UA 3HSTA 1UIUA 2Q9TA 3PPNA 4H6DA 4EXLA 5B70A 4YKIA 1P1NA 4QSCA 3U92A 4F3SA 4P0GA 2Q8JA 3ZS6A 4O3BA 1N7WA 1QUIA 2I49A 2RC7A 4G8NA 2P2AA 1LBCA 2XD2A 5FHOA 3OELA 3LR1A 4YICA 3KGCA 4FECA 1OLAA 5B7DA 5JTYA 2R6GE 2REJA 1PB7A 5I59B 4TQUQ 1VFEA 4QFNA 4H65A 4I62A 4F31B 5EHMA 5CM6A 2PVUA 1D9YA 3K00A 3R7XA 2RC9A 3KSXA 1PDAA 3OENA 2D5WA 3SEWA 3K1PA 2REGA 1B7UA 4Q0CA 1LB8A 3TODA 1IXCA 4FEBA 2XX8A 1B3EA 3G3GA 3N94A 4AQ4A 5FTHA 2DS9A 4POWA 3TTMA 3RUMA 2DE3A 2A5TA 3OSRA 5DEXB 2VHAA 2HEUA 3K1NA 1DTZA 3TPAA 5AA2A 2I3VA 1P1UA 3T66A 2AIXA 5AA3A 1B6HA 4GF8A 1WODA 5AA4B 1LB9A 3IK6B 2O6AA 3OD7A 3JV9A 2G29A 1PEBA 2DWJA 4XKNA 1Q1KA 2F34A 2YJPA 1ZMGA 4U21A 3MVYA 4N13A 4R6KA 4KYEA 1USYH 3G3HA 3MQ9A 2XX9A 1TT1A 2I4BA 1DPEA 2XXPA 3GBBA 4WKMA 2NXOA 3CFLA 4DXUA 2ONKE 3UA8A 1EU8A 2O68A 1ATGA 2OCUA 5TP9A 3O66A 2H25A 5I58B 1MY4A 3HPIA 2F7BA 2R71A 1QUKA 1Z7ME 4YB6A 3I3VA 5JK4A 4IO7A 2DVCA 5H8NA 4YAHX 5L9MA 3SDFA 1ZTYA 2QRYA 1A8FA 3L6HA 5J1DA 2Z8EA 2XXHA 2ZXTA 5TPAA 1MPBA 2I58A 1URSA 4GQOA 1M5FA 1I6BA 4H5FA 3T9VA 4RNSA 4R74A 3C35A 1TXFA 2O1LA 4LATA 1Y4CA 3HN0A 5JTYB 2QJEA 1MY1A 3RLFE 4GIZA 4KPTA 1URDA 3TCGA 4MF3A 3KZGA 2XX7A 3TDJA 1MS7A 4U22A 2H5YA 4LONB 1N3WA 2X7PA 4OEUA 4GL8A 2PX1A 1UTHA 1LAHE 4FIMA 4IO5A 5H8SA 4DCXA 3U72A 4AB6A 5KZTA 3IJOB 3G3IA 4QRZA 1NNKA 1OIBA 4RY1A 3O28A 2Z8DA 3C33A 4ZEBA 1ZJLA 4M4GA 4X48A 3RGYA 2A5TB 3A3CA 1WDNA 1B51A 3P7IA 5H8FA 1D4NA 1AIVA 4JSOA 4ZEKA 4E0XA 5AA2B 1KWHA 1BKAA 1EH3A 2QS1A 3E3KA 5IAIA 1S50A 3DP4A 3IORA 3T9UA 4U2RA 4ZECA 3FVGA 3O6HA 1D3KA 2THIA 4BDQA 1OMPA 2YPNA 3I6VA 4R2FA 3FVKA 3O6GA 3S4UA 3BFTA 1ZBMA 3PMXA 3GZGA 3THIA 1ANFA 4ZZEA 4XIGQ 3W9WA 3LSXA 1N84A 1R9QA 1LFHA 4R72A 2QMXA 2UVHA 3H4ZA 5I57A 4IGTA 3WAEA 1Z7NE 5L9OA 5ITOA 1MPDA 1ELJA 2YLNA 3KN7A 1GR2A 5KDTA 3K6WA 4O3CA 4OVJA 5TP9B 1JVXA 3IJXB 4I8CA 4YB7A 1T0KA 2F7CA 4NEDA 4F3PA 3V5AA 1MQJA 4XKQA 4LZ7A 3UN6A 3OSQA 1IZ1A 5H8NB 4F1UA 5K2YA 2V93A 1NH8A 2VD2A 3UGWA 1JETA 3N6UA 3ZKKA 2DWHA 1F9BA 3GXAA 5TPAB 1P1QA 3CSBA 4F29A 3VLUA 4IO4A 2GHBA 3M3KA 1N04A 2DQVA 2E1SA 3RPWA 3K2DA 3TTNA 4OMBA 3EN3A 2DVZA 5CMMA 1SYIA 4H8JA 1LFGA 4ZEIA 2FYIA 1JW5A 5ELVA 2O1MA 4NWDA 2VD3A 1AH5A 1UTHB 3MAMA 4IY6A 4P11A 1O7TA 3PMVA 4H8IA 3IO4A 4THIA 3LSLA 5CRYA 4R9GA 1MM7A 2O7UA 2X26A 1I69A 1IQ7A 3S2VA 5ICTA 3VVEA 2H9BA 1B1XA 4GRKA 5H8FB 4LZ5A 2XHDA 5CMCA 3VLVA 2ANJA 1XS5A 3ONMA 2ALUA 2I3WA 3TTRA 3LSWA 3N6TA 2ZYKA 3HHGA 2OJTA 3FVNA 1FQDA 2F7AA 4KHZE 3I5OA 2HFBA 4EQ7A 1FTOA 1QW0A 3VE1B 2Y7IA 4KD5A 4YB5A 4TLLB 2M8CA 3FASA 3QIMA 3KBRA 4ZDMA 3W9VA 4ECFA 4HW8A 1UIVA 1JEVA 4QFKA 5I57B 1Y4TA 5M2VA 1JQFA 1FQFA 4ZZAA 1JEUA 5DTBA 5KDTB 4KYDA 3TCFA 3OO6A 4GXSB 4GD5A 2DWIA 2P0SA 4HTGA 2F5XA 5FHNA 4XTCQ 1SW4A 1FTKA 1A54A 1Y1ZA 4QSDA 1NNFA 1LAGE 1XC1A 4FEDA 2KLFA 1DTGA 4Q8RA 1IIWA 2F8DA 1FQAA 3FUZA 3R6UA 3KOTA 2RCAA 3IR1A 1BP5A 1JW1A 4ELPA 1MXYA 3V89B 1OVBA 1TFAA 2NVUB 4U4XA 5I2NA 3CVGA 2O51A 1P1OA 2DP8A 3ODBA 2CMOA 5EYFA 4ZE8A 4X1BA 1OLCA 5DVFA 5HBCA 3CIJA 4U1OA 4LQ5A 5JEIA 5DYHA 2O69A 2ONSA 1FQEA 2B65A 2V84A 5CMBA 5DT6A 4NTLA 3TQLA 4EF1A 2QL3A 3C32A 3T96B 2D3IA 3UORA 1ZU0A 4HCYA 3HHFA 4NF6A 3PPRA 1FQCA 3K6XA 5I56A 4G77A 4C1UA 1VFDA 1LBBA 4RYAA 1DMBA 5LOMA 1MQHA 3O9PA 4RPNA 1S9TA 3V83A 2GHAA 4JXIA 3G3JA 3TQWA 2B3FA 3G3KA 1B32A 4G8MA
chains in the Genus database with same CATH superfamily
1DPPA 1O64A 1CB6A 2Y5KA 2AL5A 2GQ1A 1NL5A 3O29A 1VR5A 1PC3A 3H3GA 1B3GA 4IO3A 3SEVA 3PUXE 4TOZA 5F24A 3KC1A 1DOTA 4YKJA 4NN3A 2O7IA 3D1RA 3ZKLA 2I48A 3TUSA 1FRPA 1FPDA 5I7IA 4KYSA 5IM2A 4EQ9A 1B5HA 5DVIA 4G2ZA 2Y7WA 3PUYE 4HE2A 3G3FA 3HCQA 3M3FA 1POY1 1H43A 4PQJA 1ZLQA 4OVQA 4KFQA 1XVXA 2XXRA 3EHTA 2QS3A 4LP2B 2Q8MA 3S9LC 2NWJA 4QFLA 3Q29A 3CG3A 3QAXA 4XKRA 3L6GA 3FGSA 4C0RA 4JBZA 2ZNUA 4NMYA 3OXNA 3OO7A 4MBPA 1Q35A 5I2KA 4Z0IA 5K2XA 1LGBC 3TMGA 1FQBA 3OO9A 3RT8A 1PB9A 1IXGA 1HSLA 4QBAA 1WVJA 2F35A 2VT5A 1FTJA 3QK6A 5ET8A 1B40A 1VSOA 1NMUA 3IB0A 1FPEA 1XT8A 5F1QA 3K6UA 2FNCA 2RCBA 3LUZA 4RJZA 1JW4A 1MG1A 3VXBA 1EYIA 5I84A 3C34A 3MP1A 4LQ2A 5I2NB 2A5SA 3RT6B 3UP9A 1YTVA 1PBQA 2XXIA 2UYFA 1LBZA 4DI3D 1B3LA 4FE8A 4OFJA 1FJ6A 1EYKA 4GLIA 3PMWA 1GGGA 3CFXA 3SERA 4OHNA 1B58A 3CR9A 4XXUA 5FHMA 1SQYA 1N0TA 3FJGA 2WYKA 4I1DA 1S7YA 4PFRA 2CEYA 3A3UA 5HM4B 1AMFA 3TYHA 4MNCA 1FW0A 4DZ1A 2V3TA 4R6YA 2UXAA 4NF6B 2Y84A 2HZLA 5I56B 1FTLA 4G8HA 3Q27A 2F36A 1SW5A 3MP8A 3EQ1A 3KSJA 2PMSA 5DW8A 3C36A 3E13X 2PT1A 3IOVA 4MIJA 3IOTA 4NF0A 1K9ZA 4PAIA 2OWTA 4GWYA 4BDLA 3H6UA 1OQGA 1ZKBA 4QXDA 3H06B 2PCRA 3MYUA 4NE4A 2QS2A 4U4SA 4RK2A 2XXWA 2XXUA 2ZYMA 1CE2A 3T93B 2ONRA 3BBRA 1XHYA 2HAVA 3MPKA 2XXXA 1A8EA 4ESXA 2IEEA 4X04A 5H8QA 1KZ8A 4P0IA 1MDP1 1YAEA 2F3DA 2CEXA 2PBWA 1H76A 4DIGA 1SW1A 1DCUA 3SEUA 1FPGA 3TAJA 5CBRA 2IA4A 3E79A 4R75A 3K6VA 3CHGA 3LC8A 2Z8FA 4ZE9A 1GTKA 2Z23A 3MVWA 4FJPA 4ONYA 1LFIA 4YZZA 1H3DA 1LEVA 4PFUA 4H46A 1QUJA 3S9MC 1IMDA 1USYE 2OZZA 4AB5A 3KOSA 3WAFA 4F1YA 2V4CA 1B9JA 4FATA 1LCTA 3MUQA 4MLVA 5I2KB 3O97A 1PBPA 3Q28A 4FAJA 4HE0A 4ZS9A 4ESWA 1A99A 1AWBA 5CC2A 3IL1B 3MSTA 4GL0A 1TWYA 3H6VA 3ILTB 3SEXA 3TTLA 3FV1A 3FD3A 2G93A 2DXYA 4F2OA 3DP6A 3UK4A 3DELB 4I3YA 1AOVA 1QVSA 1Y3NA 3IFAA 2FVZA 1FBHA 4ELOA 4OEVA 2NUVA 1FBCA 3FBPA 3U8QA 2PT2A 2Y7PA 2DE2A 1MXWA 3TTKA 3D4CA 2ZMBA 4R6HA 4I40A 5J16A 5KCJA 4PDDA 3OO8A 4UACA 1HSJA 2XD3A 4MH5A 5BWJA 1D9VA 2QFLA 1MQDA 3EPEA 5I59A 2Q89A 5A5XA 3KN3A 1IMEA 4PE5B 3ZSFA 5FBPA 4EUOA 4PFWA 3N26A 3U1OA 1SD3A 4N6KA 4MAGA 4KI0E 1Y20A 1I6QA 2HXWA 4GFRA 1B0HA 1B7HA 1RDXA 1DSNA 4GBWA 5CI5A 1FJ9A 2HPGA 1RYXA 2W7YA 4MX6A 3QSLA 3U65A 3T1BA 3H03A 4YMAA 3FJ7A 1B7ZA 1YPNA 2QSXA 2DOJA 1LBXA 1QKAA 2AYSA 4F19A 1VDWA 3MJNA 3LSFB 1II5A 4H67A 4HCWA 3FXRA 4O3AA 4WEDA 5L9SA 1LAFE 4X1DA 1MQGA 4EDPA 2V25A 2DXRA 3TELA 5H8QB 2I0CA 3FJMA 2Z22A 1IMBA 2DSFA 3RN8A 1P1WA 3GBAA 1M5EA 3T9HB 1FPJA 5TU0A 3SESA 1LAXA 3A09A 4PFIA 1H44A 2P1SA 3KG2A 3CFZA 4NG7A 5LDZA 1O63A 4DCYA 4R73A 4RK9A 4XKPA 1N3XA 4YKPA 3M3LA 3RTFB 2CZLA 4N8YA 3DLNA 2RKMA 4PBHA 3FXUA 3PUVE 1MH3A 3PV0E 3K4UA 2H98A 2HCAA 4PFBA 4U23A 2E0SA 4M1VA 1US4A 2P3NA 3IB2A 4PGPA 1Y1MA 4JDFA 4Z7EA 4JB7A 4FORA 5CBSA 1B5IA 4LUBA 4OFOA 1NNPA 1Y9UA 2B3BA 4OXVA 4DLDA 3R26A 2X7QA 3Q25A 3FVOA 3T9XB 3HV1A 4BDNA 1QKBA 2XXVA 2UYEA 4OERA 4N91A 2Y7KA 4GWWA 5CMKA 2KR0A 4JWOA 4ELQA 4PETA 2HAUA 1MXZA 2XXKA 2VOZA 3PD8A 1BLFA 3QXMA 2ZNTA 2GFEA 1FPLA 4KCCA 5KCJB 2QPQA 4I9DA 1LSTA 4OA4A 5IKBA 1FCKA 2ZZWA 4OFLA 2DYXA 5ITPA 1NFTA 2OLBA 3MPLA 3K0VA 1YCJA 5A5XB 1PB8A 1MY2A 4X8RA 4RA1A 1MM6A 2V3QA 4R2BA 4PF6A 3JZJA 4NF5A 2HZKA 4P8BA 4OTEA 3U94A 4H0WA 4ISUA 2Q2AA 3CI8A 1FTAA 3RQTA 4BDMA 4PFTA 1OVTA 4BLAA 4K3FA 4OYVA 3BKIB 3MZ1A 5AE4A 3IOUA 3EKIA 2AL4A 1MDQA 1N7XA 1FPIA 4H1XA 2OK2A 4F3GA 1IUDA 3E4RA 3AXFA 2XXQA 4TLMB 4MJOA 2ABHA 1B1HA 4NAPA 4RXLA 1VE4A 2VPNA 2H4IA 3IX1A 1B4HA 1YYZA 3B6WA 2GH9A 4H5GA 1L5TA 3OMBA 4NX1A 4QFOA 3MVXA 1RKMA 3K02A 4N6DA 3VFJA 3QUFA 3S9EA 1MXVA 3VVFA 5HPQA 4GOTA 3VXCA 4X9TA 4AS4A 2GRVA 3KJTA 1IXIA 1A40A 3CRBA 3E78A 1URGA 1DK4A 3PUWE 3EHUA 3PPOA 1M5CA 4EXKA 1SW2A 3K01A 1R9LA 4IB2A 1QJMA 2QS4A 4PTKA 1UTBA 1R1NA 4BDRA 4QFPA 3LBSA 3NOHA 3PU5A 1MXXA 3CSGA 4MHFA 3BFUA 4P56A 4R9FA 1NUXA 3O2AA 4HS7A 4GWXA 2FIEA 2OWZA 1IXHA 4YU0A 4F3BA 3FXQA 4N81A 4NF8A 3VLWA 4KXPA 2B4LA 3OEKA 3TFLA 3B6QA 3OOAA 2RF1A 3N5LA 4YMBA 1NV5A 4DXCA 1A7LA 2CZHA 1OQHA 5ICQA 4GWOA 1SI1A 1XVYA 2Y5LA 5FTIA 3ECRA 1XOCA 2OX3A 3FV2A 3G7WA 2BJIA 2WEFA 4BDOA 4POXA 3IO6A 3KEIA 2XXYA 2RINA 2OWSA 5H8HA 4OVRA 1JVYA 1DBZA 3FATA 4F18A 3USDA 1GVCA 3TZAA 4XEQA 1POTA 4F1VA 4MFIA 3TEPA 3B8BA 4F39A 4LN5A 4MLQA 1QULA 3IOWA 2FBPA 3MBPA 4NF5B 4NQ8A 1NV2A 1MH4A 1MY0A 3E9XA 1MRPA 5I3SA 4IO6A 3PD9A 4P1EA 2Q2CA 3O6IA 4XF5A 2XXTA 4E0WA 3F11A 1FBDA 4O94A 3VVDA 1B05A 3EHSA 1B2HA 3RY3A 4ND9A 1NH7A 4NF4A 4LVQA 4HE1A 4G61A 3OEMA 4PF8A 1FPKA 5BUUA 2WKYA 1SI0A 1MXUA 2R9JA 1US5A 3C4MA 2ZYNA 1IMFA 5L8DA 2I4CA 5ISUA 2F78A 1B5JA 1B3HA 4G68A 3RYDA 2PYYA 4PBQA 1Y3QA 1D9QA 2ESNA 3H7MA 5AA1A 2I0BA 1AL3A 2VP1A 3SETA 4OESA 1LCFA 3H6WA 1JNFA 2Q74A 3MC2A 2O84X 3ILUB 3IFCA 4PFYA 1SBPA 3SEYA 4G4PA 1NKXA 2OBGA 4AS5A 4N6PA 4UA8A 1UTBB 5EHSA 2HQ0A 3VDFA 2QMWA 3QMFA 2ZNSA 4EF2A 3UIFA 4JWXA 2Y7RA 1TFDA 3IB1A 4JSDA 1FSAA 4Q5TA 1BIYA 1EYJA 2D21A 4GXAA 1B3FA 4JVDA 4YKKA 4NF8B 1M5DA 4OZ9A 3IAZA 2UVJA 3M8UA 3MWBA 3DM0A 3SKPA 1UQWA 3H6TA 1SVXB 1B4ZA 1IITA 4KCDA 2LAOA 1B0LA 4UABA 3PPQA 4FBPA 4LZ8A 3A29A 3MVZA 3VV5A 2R8TA 4F2QA 4GWUA 5AA2D 1M5BA 4OENA 4C1TA 4N07A 3U93A 2P3VA 3GLBA 4ELRA 4QF9A 4O8MA 5H8HB 4KR5A 2NOOA 3MZBA 4P1LA 1EZ9A 1I6AA 3MZ9A 4QSEA 4OWDA 3LUYA 4GVOA 4IGRA 3PUZE 4MNIA 3B7DA 3CG1A 1B52A 4LA9A 3FIRA 3C9HA 1N76A 3DP8A 3B6TA 1FTMA 1NNTA 3KJ7A 2F6GA 1R6ZA 1XI6A 3PTYA 3PPPA 4L17A 3C31A 1P99A 2RC8A 4G68C 3HO7A 4RPOA 4ZEFA 2BJJX 3JYRA 3T22A 4OQOA 3PGFA 4EQBA 1B46A 1MY3A 1EZPA 4JVIA 1J1NA 4NF4B 1A55A 1H45A 4KQPA 5DEXA 4DXBA 3QYTA 4Q30B 4IO2A 4ZEDA 4OETA 4NGUA 1EZOA 2I6EA 2WBDA 3D4GA 3RPLA 2ZZXA 1MPCA 3MW0A 3QUJA 4DE8A 4DDDA 4WXJA 3KN8A 4OVSA 4G68B 4WEPA 5EQ9A 1IEJA 2VGQA 2DWAA 5AA4A 2Q88A 2QVVA 3W15C 4F22A 1HSEA 3TCHA 4NWCA 3RTWB 5F7VA 1SYHA 1GV8A 1ZIUA 3KFMA 4U1ZA 1NV4A 4PP0A 1MQIA 2UVIA 2HHMA 1SPIA 3V8XB 2F6PA 4P47A 5ESYA 3RNNA 1Y3PA 1SDXA 4DI4B 3MP6A 3S9NC 1BTJA 1JP4A 2H99A 1LLSA 3FZVA 3Q26A 1LBWA 5IZ1A 5EQ7A 2FA7A 4QHQA 4JWYA 4IY5A 3K1MA 3TKDA 2JJKA 5DVJA 1NV3A 2DE4A 2UVGA 1RYOA 2ZYOA 5I58A 2F97A 3EF7A 2V3UA 3HSTA 1UIUA 2Q9TA 3PPNA 2WX9A 4H6DA 1NV1A 4EXLA 5B70A 4YKIA 1P1NA 4GBVA 4QSCA 3U92A 3HFUA 4F3SA 4P0GA 2Q8JA 3ZS6A 4O3BA 3GYYA 1N7WA 1QUIA 4HXVA 2I49A 2RC7A 4G8NA 2P2AA 1LBCA 1FBGA 2XD2A 2QVUA 5FHOA 3OELA 3LR1A 4YICA 3KGCA 4FECA 1OLAA 5B7DA 5JTYA 2R6GE 2REJA 5ET6A 1FPBA 1PB7A 1IMCA 4TQUQ 5I59B 1VFEA 4QFNA 5A5LA 4H65A 4I62A 4F31B 5EHMA 5CM6A 2WYPA 2PVUA 1D9YA 4I3EA 3K00A 3R7XA 4GWSA 2RC9A 3KSXA 1PDAA 3OENA 1KA0A 2D5WA 2FIXA 3SEWA 3K1PA 2REGA 2DDKA 1KA1A 1B7UA 1G0HA 4Q0CA 1LB8A 3TODA 4N4UA 1IXCA 4FEBA 2XX8A 1NV0A 2B4MA 5IGAA 1B3EA 3G3GA 2WBBA 3N94A 4AQ4A 5FTHA 2DS9A 3KBZA 4POWA 3TTMA 3RUMA 2DE3A 1NUWA 2A5TA 3OSRA 5DEXB 2VHAA 5IZ3A 5IZZA 2HEUA 3K1NA 1DTZA 3TPAA 3RPLB 5AA2A 4OVTA 2I3VA 1P1UA 3T66A 2AIXA 5AA3A 1B6HA 4GF8A 1WODA 5AA4B 1LB9A 3IK6B 3FXBA 2O6AA 3OD7A 3JV9A 2G29A 1PEBA 2DWJA 2XWOA 4XKNA 1Q1KA 2F34A 2YJPA 1NV6A 1ZMGA 4U21A 3KC0A 4PCDA 4JVCA 3MVYA 4N13A 4R6KA 4KYEA 1USYH 4MNPA 3G3HA 1NUZA 3MQ9A 5EQ8A 2XX9A 1TT1A 4GX6A 2I4BA 1DPEA 2XXPA 4O7IA 3GBBA 4WKMA 2NXOA 3ROJA 3CFLA 4DXUA 2ONKE 3UA8A 1EU8A 2O68A 1ATGA 2OCUA 5TP9A 4PGNA 1K9YA 3O66A 2H25A 5I58B 1YXIA 2PFYA 1MY4A 3HPIA 2F7BA 2R71A 1QUKA 1Z7ME 4YB6A 3BIHA 3I3VA 5JK4A 4IO7A 2DVCA 5H8NA 4YAHX 5L9MA 3SDFA 1ZTYA 2QRYA 1A8FA 3L6HA 5J1DA 2Z8EA 2XXHA 2ZXTA 1MPBA 5TPAA 2I58A 1URSA 4GQOA 3T0JA 1M5FA 1I6BA 4H5FA 3T9VA 1LBVA 4RNSA 4R74A 3C35A 1TXFA 2O1LA 4LATA 1Y4CA 3HN0A 5JTYB 3LV0A 2QJEA 1MY1A 3RLFE 4GIZA 4KPTA 1URDA 3TCGA 4MF3A 3KZGA 2KQZA 4N17A 2XX7A 3TDJA 1MS7A 4U22A 2H5YA 4LONB 1N3WA 2X7PA 4OEUA 4GL8A 2PX1A 1UTHA 1LAHE 4FIMA 4IO5A 2QVRA 5H8SA 3U72A 4AB6A 4DCXA 5KZTA 2VPOA 3IJOB 3G3IA 5T3JA 4QRZA 1NNKA 1OIBA 4RY1A 1YZ0A 3O28A 2Z8DA 3C33A 4ZEBA 1ZJLA 4M4GA 4X48A 3RGYA 2A5TB 3BIGA 3A3CA 1WDNA 1B51A 3P7IA 5H8FA 5IZ3B 1D4NA 1AIVA 4JSOA 4ZEKA 4E0XA 5AA2B 1KWHA 1BKAA 1EH3A 2QS1A 4MCOA 3ISPA 3E3KA 5IAIA 4P3LA 1S50A 3DP4A 3B50A 3IORA 4U2RA 3T9UA 4ZECA 3FVGA 3O6HA 1D3KA 2THIA 4BDQA 1OMPA 2YPNA 3I6VA 4R2FA 3FVKA 3O6GA 3S4UA 3BFTA 1ZBMA 3PMXA 3GZGA 3THIA 1ANFA 4ZZEA 4XIGQ 3W9WA 3LSXA 1N84A 1R9QA 1LFHA 4R72A 2QMXA 2UVHA 2XWKA 3H4ZA 5I57A 4IGTA 4GX3A 3WAEA 1Z7NE 5L9OA 5ITOA 1MPDA 4P9KA 1NI9A 1ELJA 2YLNA 3KN7A 1GR2A 5KDTA 3K6WA 4H45A 4O3CA 4OVJA 5TP9B 1JVXA 3IJXB 4GWZA 4I8CA 4YB7A 1T0KA 2F7CA 4NEDA 4F3PA 4PAKA 2F3BA 3V5AA 1MQJA 4XKQA 4LZ7A 3UN6A 3OSQA 1IZ1A 5ET5A 5H8NB 4F1UA 5K2YA 2V93A 2FHYA 1NH8A 2VD2A 3UGWA 1JETA 3N6UA 2XA5A 3ZKKA 2DWHA 1F9BA 3GXAA 2XWIA 5TPAB 1P1QA 3CSBA 1RDZA 4F29A 3VLUA 4IO4A 2GHBA 4IR8A 1CNQA 3M3KA 1N04A 1FBFA 2DQVA 1INPA 2E1SA 3RPWA 3K2DA 3TTNA 4OMBA 3EN3A 2DVZA 5CMMA 1SYIA 4H8JA 1LFGA 4ZEIA 1FBEA 1QGXA 2FYIA 4GX4A 1JW5A 5ELVA 2O1MA 4NWDA 4PC9A 2VD3A 4PAFA 1AH5A 1UTHB 3MAMA 4IY6A 4P11A 1O7TA 3PMVA 4H8IA 3IO4A 4THIA 3LSLA 5CRYA 4R9GA 1RDYA 1MM7A 2O7UA 2X26A 1I69A 1IQ7A 4O7MA 3S2VA 5ICTA 3VVEA 2H9BA 1B1XA 4GRKA 3SZPA 1NUYA 5H8FB 4LZ5A 2XHDA 5CMCA 3VLVA 4OANA 2ANJA 1XS5A 2HXRA 3ONMA 2PFZA 2ALUA 2I3WA 1FBPA 3TTRA 3LSWA 3N6TA 2ZYKA 3HHGA 5LTCA 2OJTA 3FVNA 1FQDA 2F7AA 4KHZE 3I5OA 2HFBA 4EQ7A 1FPFA 1FTOA 4OVPA 1QW0A 3VE1B 2Y7IA 4KD5A 4YB5A 4TLLB 2M8CA 3FASA 3QIMA 3KBRA 5EQAA 4ZDMA 1IMAA 3W9VA 4ECFA 4HW8A 1UIVA 1JEVA 5ET7A 4QFKA 5I57B 1Y4TA 5M2VA 1JQFA 1FQFA 2L5VA 4ZZAA 1JEUA 4N8GA 5DTBA 5KDTB 4KYDA 3TCFA 4MMPA 3OO6A 4GXSB 4GD5A 2DWIA 2P0SA 2MKZA 4HTGA 2F5XA 5FHNA 4XTCQ 1SW4A 1FTKA 1A54A 4QSDA 1Y1ZA 1NNFA 1LAGE 5I5PA 1XC1A 4FEDA 2KLFA 4MEVA 1LBYA 1DTGA 4Q8RA 1IIWA 2F8DA 1FQAA 1Q9DA 3FUZA 3R6UA 5EYGA 3KOTA 1NV7A 2RCAA 3IR1A 1BP5A 1JW1A 2ZZVA 4ELPA 1MXYA 3V89B 1OVBA 1BK4A 1TFAA 2NVUB 4U4XA 5I2NA 3CVGA 2O51A 1P1OA 2DP8A 3ODBA 2CMOA 5EYFA 4ZE8A 4X1BA 1OLCA 4PDHA 5DVFA 5HBCA 3CIJA 4U1OA 4LQ5A 5JEIA 5DYHA 2O69A 2ONSA 1FQEA 2B65A 2V84A 4N15A 5CMBA 5DT6A 4NTLA 3TQLA 4EF1A 2QL3A 3C32A 3T96B 2D3IA 3UORA 1ZU0A 4HCYA 2CZKA 3HHFA 4NF6A 3PPRA 1FQCA 3K6XA 1G0IA 5I56A 4G77A 4C1UA 1VFDA 2XWVA 1LBBA 4RYAA 1DMBA 5LOMA 1MQHA 3O9PA 4RPNA 1S9TA 3V83A 2GHAA 4JXIA 4PE3A 4XFEA 2CZIA 4NHBA 3G3JA 3TQWA 2B3FA 5EYHA 3G3KA 1B32A 4G8MA
chains in the Genus database with same CATH topology
1DPPA 1O64A 1CB6A 2AL5A 1NL5A 3O29A 1VR5A 1PC3A 3H3GA 1B3GA 4IO3A 3SEVA 3PUXE 4TOZA 1DOTA 4YKJA 2O7IA 3ZKLA 2I48A 3TUSA 4KYSA 4EQ9A 1B5HA 5DVIA 4G2ZA 2Y7WA 3PUYE 3G3FA 3HCQA 3M3FA 1POY1 1H43A 4PQJA 1ZLQA 4KFQA 1XVXA 2XXRA 3EHTA 2QS3A 4LP2B 3S9LC 2NWJA 4QFLA 3Q29A 3CG3A 3QAXA 4XKRA 3L6GA 3FGSA 4C0RA 4JBZA 2ZNUA 4NMYA 3OXNA 3OO7A 4MBPA 1Q35A 5I2KA 4Z0IA 5K2XA 1LGBC 3TMGA 1FQBA 3OO9A 3RT8A 1PB9A 1IXGA 1HSLA 1WVJA 2F35A 1FTJA 3QK6A 1B40A 1VSOA 1NMUA 3IB0A 1XT8A 5F1QA 3K6UA 2FNCA 2RCBA 4RJZA 1JW4A 1MG1A 3VXBA 5I84A 3C34A 3MP1A 4LQ2A 5I2NB 2A5SA 3RT6B 3UP9A 1YTVA 1PBQA 2XXIA 2UYFA 1B3LA 4FE8A 4OFJA 4GLIA 3PMWA 1GGGA 3CFXA 3SERA 4OHNA 1B58A 3CR9A 4XXUA 5FHMA 1SQYA 1N0TA 3FJGA 4I1DA 1S7YA 3A3UA 5HM4B 1AMFA 3TYHA 1FW0A 4DZ1A 2V3TA 4R6YA 2UXAA 4NF6B 2Y84A 2HZLA 5I56B 1FTLA 4G8HA 3Q27A 2F36A 1SW5A 3MP8A 3EQ1A 3KSJA 2PMSA 3C36A 3E13X 2PT1A 3IOVA 3IOTA 2OWTA 4BDLA 3H6UA 1OQGA 1ZKBA 3H06B 4NE4A 2QS2A 4U4SA 4RK2A 2XXWA 2XXUA 2ZYMA 1CE2A 3T93B 2ONRA 3BBRA 1XHYA 2HAVA 3MPKA 2XXXA 1A8EA 4ESXA 2IEEA 5H8QA 4P0IA 1MDP1 1YAEA 2PBWA 1H76A 4DIGA 1SW1A 3SEUA 3TAJA 5CBRA 2IA4A 4R75A 3K6VA 3LC8A 2Z8FA 4ZE9A 1GTKA 2Z23A 3MVWA 4FJPA 4ONYA 1LFIA 4YZZA 1H3DA 4PFUA 1QUJA 3S9MC 1USYE 2OZZA 4AB5A 3KOSA 3WAFA 4F1YA 1B9JA 4FATA 1LCTA 3MUQA 4MLVA 5I2KB 3O97A 1PBPA 3Q28A 4FAJA 4ZS9A 4ESWA 1A99A 5CC2A 3IL1B 4GL0A 1TWYA 3H6VA 3ILTB 3SEXA 3TTLA 3FV1A 3FD3A 2G93A 2DXYA 4F2OA 3DP6A 3UK4A 3DELB 1AOVA 1QVSA 1Y3NA 4ELOA 4OEVA 2NUVA 3U8QA 2PT2A 2Y7PA 2DE2A 1MXWA 3TTKA 3D4CA 2ZMBA 4R6HA 5KCJA 3OO8A 4UACA 1HSJA 2XD3A 4MH5A 5BWJA 1D9VA 1MQDA 3EPEA 5I59A 2Q89A 5A5XA 3KN3A 4PE5B 3ZSFA 4EUOA 4PFWA 3N26A 3U1OA 1SD3A 4KI0E 1Y20A 1I6QA 2HXWA 4GFRA 1B0HA 1B7HA 1DSNA 5CI5A 1RYXA 2W7YA 3QSLA 3H03A 4YMAA 3FJ7A 1B7ZA 1YPNA 2QSXA 2DOJA 1QKAA 2AYSA 4F19A 3MJNA 3LSFB 1II5A 4H67A 4HCWA 3FXRA 4O3AA 4WEDA 5L9SA 1LAFE 4X1DA 1MQGA 4EDPA 2V25A 2DXRA 3TELA 5H8QB 2I0CA 3FJMA 2Z22A 2DSFA 3RN8A 1P1WA 3GBAA 1M5EA 3T9HB 5TU0A 3SESA 1LAXA 3A09A 1H44A 2P1SA 3KG2A 3CFZA 1O63A 4DCYA 4R73A 4RK9A 4XKPA 1N3XA 4YKPA 3M3LA 3RTFB 2CZLA 3DLNA 2RKMA 3FXUA 3PUVE 1MH3A 3PV0E 3K4UA 2H98A 2HCAA 4U23A 2E0SA 4M1VA 1US4A 3IB2A 1Y1MA 4JDFA 4Z7EA 4JB7A 4FORA 5CBSA 1B5IA 4LUBA 4OFOA 1NNPA 1Y9UA 2B3BA 4OXVA 4DLDA 3R26A 2X7QA 3Q25A 3FVOA 3T9XB 3HV1A 4BDNA 1QKBA 2XXVA 2UYEA 4OERA 2Y7KA 5CMKA 4JWOA 4ELQA 4PETA 2HAUA 1MXZA 2VOZA 3PD8A 1BLFA 3QXMA 2ZNTA 2GFEA 4KCCA 5KCJB 2QPQA 4I9DA 1LSTA 5IKBA 1FCKA 4OFLA 2DYXA 5ITPA 1NFTA 2OLBA 3MPLA 3K0VA 1YCJA 5A5XB 1PB8A 1MY2A 4RA1A 1MM6A 2V3QA 4R2BA 3JZJA 4NF5A 2HZKA 4OTEA 3U94A 4H0WA 4ISUA 2Q2AA 3CI8A 3RQTA 4BDMA 4PFTA 1OVTA 4BLAA 4K3FA 4OYVA 3BKIB 3MZ1A 5AE4A 3IOUA 2AL4A 1MDQA 1N7XA 4H1XA 2OK2A 4F3GA 1IUDA 3E4RA 3AXFA 2XXQA 4TLMB 2ABHA 1B1HA 4RXLA 1VE4A 2H4IA 3IX1A 1B4HA 3B6WA 2GH9A 4H5GA 1L5TA 3OMBA 4QFOA 3MVXA 1RKMA 3K02A 3VFJA 3QUFA 3S9EA 1MXVA 3VVFA 5HPQA 4GOTA 3VXCA 4X9TA 2GRVA 3KJTA 1IXIA 1A40A 3CRBA 1URGA 3PUWE 3EHUA 3PPOA 1M5CA 4EXKA 1SW2A 3K01A 1R9LA 4IB2A 1QJMA 2QS4A 1UTBA 1R1NA 4BDRA 4QFPA 3LBSA 3PU5A 1MXXA 3CSGA 3BFUA 4R9FA 3O2AA 4HS7A 1IXHA 4YU0A 4F3BA 3FXQA 4NF8A 3VLWA 3OEKA 3TFLA 3B6QA 3OOAA 2RF1A 3N5LA 4YMBA 4DXCA 1A7LA 1OQHA 5ICQA 4GWOA 1XVYA 1SI1A 5FTIA 3ECRA 1XOCA 3FV2A 3G7WA 4BDOA 3IO6A 4POXA 3KEIA 2XXYA 2RINA 2OWSA 5H8HA 1JVYA 3FATA 4F18A 3USDA 1GVCA 3TZAA 1POTA 4F1VA 4MFIA 3TEPA 4F39A 4MLQA 1QULA 3IOWA 3MBPA 4NF5B 1MH4A 1MY0A 3E9XA 1MRPA 4IO6A 3PD9A 2Q2CA 3O6IA 2XXTA 4E0WA 3F11A 3VVDA 1B05A 3EHSA 1B2HA 3RY3A 4ND9A 1NH7A 4LVQA 4NF4A 3OEMA 5BUUA 2WKYA 1SI0A 1MXUA 2R9JA 1US5A 3C4MA 2ZYNA 5L8DA 2I4CA 5ISUA 2F78A 1B5JA 1B3HA 4G68A 2PYYA 1Y3QA 2ESNA 3H7MA 5AA1A 2I0BA 1AL3A 2VP1A 3SETA 4OESA 1LCFA 3H6WA 1JNFA 3MC2A 2O84X 3ILUB 4PFYA 1SBPA 3SEYA 4G4PA 1NKXA 2OBGA 4N6PA 4UA8A 1UTBB 5EHSA 2HQ0A 3VDFA 2QMWA 2ZNSA 4EF2A 3UIFA 4JWXA 2Y7RA 1TFDA 3IB1A 4JSDA 4Q5TA 1BIYA 2D21A 4GXAA 1B3FA 4YKKA 4NF8B 1M5DA 4OZ9A 3IAZA 2UVJA 3M8UA 3MWBA 3DM0A 3SKPA 1UQWA 3H6TA 1SVXB 1B4ZA 1IITA 4KCDA 2LAOA 1B0LA 3PPQA 4LZ8A 3MVZA 3VV5A 4F2QA 5AA2D 1M5BA 4OENA 4C1TA 4N07A 3U93A 3GLBA 4ELRA 4QF9A 5H8HB 4KR5A 2NOOA 3MZBA 1EZ9A 1I6AA 3MZ9A 4QSEA 4OWDA 3LUYA 4GVOA 4IGRA 3PUZE 3B7DA 3CG1A 1B52A 4LA9A 3FIRA 3C9HA 1N76A 3DP8A 3B6TA 1FTMA 1NNTA 3KJ7A 2F6GA 1R6ZA 3PPPA 4L17A 3C31A 1P99A 2RC8A 4G68C 3HO7A 4RPOA 4ZEFA 2BJJX 3JYRA 3T22A 4OQOA 3PGFA 4EQBA 1B46A 1MY3A 1EZPA 1J1NA 4NF4B 1A55A 1H45A 4KQPA 5DEXA 4DXBA 3QYTA 4Q30B 4IO2A 4ZEDA 4OETA 1EZOA 2I6EA 3D4GA 4DE8A 1MPCA 3MW0A 3QUJA 4DDDA 4WXJA 3KN8A 4G68B 4WEPA 1IEJA 2VGQA 2DWAA 5AA4A 2Q88A 3W15C 4F22A 1HSEA 3TCHA 4NWCA 3RTWB 5F7VA 1SYHA 1GV8A 1ZIUA 3KFMA 4U1ZA 4PP0A 1MQIA 2UVIA 3V8XB 2F6PA 3RNNA 1Y3PA 1SDXA 3MP6A 3S9NC 1BTJA 2H99A 1LLSA 3FZVA 3Q26A 2FA7A 4QHQA 4JWYA 4IY5A 3K1MA 3TKDA 5DVJA 2DE4A 2UVGA 1RYOA 2ZYOA 5I58A 2F97A 3EF7A 2V3UA 3HSTA 1UIUA 2Q9TA 3PPNA 4H6DA 4EXLA 5B70A 4YKIA 1P1NA 4QSCA 3U92A 4F3SA 4P0GA 2Q8JA 3ZS6A 4O3BA 1N7WA 1QUIA 2I49A 2RC7A 4G8NA 2P2AA 1LBCA 2XD2A 5FHOA 3OELA 3LR1A 4YICA 3KGCA 4FECA 1OLAA 5B7DA 5JTYA 2R6GE 2REJA 1PB7A 5I59B 4TQUQ 1VFEA 4QFNA 4H65A 4I62A 4F31B 5EHMA 5CM6A 2PVUA 1D9YA 3K00A 3R7XA 2RC9A 3KSXA 1PDAA 3OENA 2D5WA 3SEWA 3K1PA 2REGA 1B7UA 4Q0CA 1LB8A 3TODA 1IXCA 4FEBA 2XX8A 1B3EA 3G3GA 3N94A 4AQ4A 5FTHA 2DS9A 4POWA 3TTMA 3RUMA 2DE3A 2A5TA 3OSRA 5DEXB 2VHAA 2HEUA 3K1NA 1DTZA 3TPAA 5AA2A 2I3VA 1P1UA 3T66A 2AIXA 5AA3A 1B6HA 4GF8A 1WODA 5AA4B 1LB9A 3IK6B 2O6AA 3OD7A 3JV9A 2G29A 1PEBA 2DWJA 4XKNA 1Q1KA 2F34A 2YJPA 1ZMGA 4U21A 3MVYA 4N13A 4R6KA 4KYEA 1USYH 3G3HA 3MQ9A 2XX9A 1TT1A 2I4BA 1DPEA 2XXPA 3GBBA 4WKMA 2NXOA 3CFLA 4DXUA 2ONKE 3UA8A 1EU8A 2O68A 1ATGA 2OCUA 5TP9A 3O66A 2H25A 5I58B 1MY4A 3HPIA 2F7BA 2R71A 1QUKA 1Z7ME 4YB6A 3I3VA 5JK4A 4IO7A 2DVCA 5H8NA 4YAHX 5L9MA 3SDFA 1ZTYA 2QRYA 1A8FA 3L6HA 5J1DA 2Z8EA 2XXHA 2ZXTA 5TPAA 1MPBA 2I58A 1URSA 4GQOA 1M5FA 1I6BA 4H5FA 3T9VA 4RNSA 4R74A 3C35A 1TXFA 2O1LA 4LATA 1Y4CA 3HN0A 5JTYB 2QJEA 1MY1A 3RLFE 4GIZA 4KPTA 1URDA 3TCGA 4MF3A 3KZGA 2XX7A 3TDJA 1MS7A 4U22A 2H5YA 4LONB 1N3WA 2X7PA 4OEUA 4GL8A 2PX1A 1UTHA 1LAHE 4FIMA 4IO5A 5H8SA 4DCXA 3U72A 4AB6A 5KZTA 3IJOB 3G3IA 4QRZA 1NNKA 1OIBA 4RY1A 3O28A 2Z8DA 3C33A 4ZEBA 1ZJLA 4M4GA 4X48A 3RGYA 2A5TB 3A3CA 1WDNA 1B51A 3P7IA 5H8FA 1D4NA 1AIVA 4JSOA 4ZEKA 4E0XA 5AA2B 1KWHA 1BKAA 1EH3A 2QS1A 3E3KA 5IAIA 1S50A 3DP4A 3IORA 3T9UA 4U2RA 4ZECA 3FVGA 3O6HA 1D3KA 2THIA 4BDQA 1OMPA 2YPNA 3I6VA 4R2FA 3FVKA 3O6GA 3S4UA 3BFTA 1ZBMA 3PMXA 3GZGA 3THIA 1ANFA 4ZZEA 4XIGQ 3W9WA 3LSXA 1N84A 1R9QA 1LFHA 4R72A 2QMXA 2UVHA 3H4ZA 5I57A 4IGTA 3WAEA 1Z7NE 5L9OA 5ITOA 1MPDA 1ELJA 2YLNA 3KN7A 1GR2A 5KDTA 3K6WA 4O3CA 4OVJA 5TP9B 1JVXA 3IJXB 4I8CA 4YB7A 1T0KA 2F7CA 4NEDA 4F3PA 3V5AA 1MQJA 4XKQA 4LZ7A 3UN6A 3OSQA 1IZ1A 5H8NB 4F1UA 5K2YA 2V93A 1NH8A 2VD2A 3UGWA 1JETA 3N6UA 3ZKKA 2DWHA 1F9BA 3GXAA 5TPAB 1P1QA 3CSBA 4F29A 3VLUA 4IO4A 2GHBA 3M3KA 1N04A 2DQVA 2E1SA 3RPWA 3K2DA 3TTNA 4OMBA 3EN3A 2DVZA 5CMMA 1SYIA 4H8JA 1LFGA 4ZEIA 2FYIA 1JW5A 5ELVA 2O1MA 4NWDA 2VD3A 1AH5A 1UTHB 3MAMA 4IY6A 4P11A 1O7TA 3PMVA 4H8IA 3IO4A 4THIA 3LSLA 5CRYA 4R9GA 1MM7A 2O7UA 2X26A 1I69A 1IQ7A 3S2VA 5ICTA 3VVEA 2H9BA 1B1XA 4GRKA 5H8FB 4LZ5A 2XHDA 5CMCA 3VLVA 2ANJA 1XS5A 3ONMA 2ALUA 2I3WA 3TTRA 3LSWA 3N6TA 2ZYKA 3HHGA 2OJTA 3FVNA 1FQDA 2F7AA 4KHZE 3I5OA 2HFBA 4EQ7A 1FTOA 1QW0A 3VE1B 2Y7IA 4KD5A 4YB5A 4TLLB 2M8CA 3FASA 3QIMA 3KBRA 4ZDMA 3W9VA 4ECFA 4HW8A 1UIVA 1JEVA 4QFKA 5I57B 1Y4TA 5M2VA 1JQFA 1FQFA 4ZZAA 1JEUA 5DTBA 5KDTB 4KYDA 3TCFA 3OO6A 4GXSB 4GD5A 2DWIA 2P0SA 4HTGA 2F5XA 5FHNA 4XTCQ 1SW4A 1FTKA 1A54A 1Y1ZA 4QSDA 1NNFA 1LAGE 1XC1A 4FEDA 2KLFA 1DTGA 4Q8RA 1IIWA 2F8DA 1FQAA 3FUZA 3R6UA 3KOTA 2RCAA 3IR1A 1BP5A 1JW1A 4ELPA 1MXYA 3V89B 1OVBA 1TFAA 2NVUB 4U4XA 5I2NA 3CVGA 2O51A 1P1OA 2DP8A 3ODBA 2CMOA 5EYFA 4ZE8A 4X1BA 1OLCA 5DVFA 5HBCA 3CIJA 4U1OA 4LQ5A 5JEIA 5DYHA 2O69A 2ONSA 1FQEA 2B65A 2V84A 5CMBA 5DT6A 4NTLA 3TQLA 4EF1A 2QL3A 3C32A 3T96B 2D3IA 3UORA 1ZU0A 4HCYA 3HHFA 4NF6A 3PPRA 1FQCA 3K6XA 5I56A 4G77A 4C1UA 1VFDA 1LBBA 4RYAA 1DMBA 5LOMA 1MQHA 3O9PA 4RPNA 1S9TA 3V83A 2GHAA 4JXIA 3G3JA 3TQWA 2B3FA 3G3KA 1B32A 4G8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DPP A;  1O64 A;  1CB6 A;  2AL5 A;  1NL5 A;  3O29 A;  1VR5 A;  1PC3 A;  3H3G A;  1B3G A;  4IO3 A;  3SEV A;  3PUX E;  4TOZ A;  1DOT A;  4YKJ A;  2O7I A;  3ZKL A;  2I48 A;  3TUS A;  4KYS A;  4EQ9 A;  1B5H A;  5DVI A;  4G2Z A;  2Y7W A;  3PUY E;  3G3F A;  3HCQ A;  3M3F A;  1POY 1;  1H43 A;  4PQJ A;  1ZLQ A;  4KFQ A;  1XVX A;  2XXR A;  3EHT A;  2QS3 A;  4LP2 B;  3S9L C;  2NWJ A;  4QFL A;  3Q29 A;  3CG3 A;  3QAX A;  4XKR A;  3L6G A;  3FGS A;  4C0R A;  4JBZ A;  2ZNU A;  4NMY A;  3OXN A;  3OO7 A;  4MBP A;  1Q35 A;  5I2K A;  4Z0I A;  5K2X A;  1LGB C;  3TMG A;  1FQB A;  3OO9 A;  3RT8 A;  1PB9 A;  1IXG A;  1HSL A;  1WVJ A;  2F35 A;  1FTJ A;  3QK6 A;  1B40 A;  1VSO A;  1NMU A;  3IB0 A;  1XT8 A;  5F1Q A;  3K6U A;  2FNC A;  2RCB A;  4RJZ A;  1JW4 A;  1MG1 A;  3VXB A;  5I84 A;  3C34 A;  3MP1 A;  4LQ2 A;  5I2N B;  2A5S A;  3RT6 B;  3UP9 A;  1YTV A;  1PBQ A;  2XXI A;  2UYF A;  1B3L A;  4FE8 A;  4OFJ A;  4GLI A;  3PMW A;  1GGG A;  3CFX A;  3SER A;  4OHN A;  1B58 A;  3CR9 A;  4XXU A;  5FHM A;  1SQY A;  1N0T A;  3FJG A;  4I1D A;  1S7Y A;  3A3U A;  5HM4 B;  1AMF A;  3TYH A;  1FW0 A;  4DZ1 A;  2V3T A;  4R6Y A;  2UXA A;  4NF6 B;  2Y84 A;  2HZL A;  5I56 B;  1FTL A;  4G8H A;  3Q27 A;  2F36 A;  1SW5 A;  3MP8 A;  3EQ1 A;  3KSJ A;  2PMS A;  3C36 A;  3E13 X;  2PT1 A;  3IOV A;  3IOT A;  2OWT A;  4BDL A;  3H6U A;  1OQG A;  1ZKB A;  3H06 B;  4NE4 A;  2QS2 A;  4U4S A;  4RK2 A;  2XXW A;  2XXU A;  2ZYM A;  1CE2 A;  3T93 B;  2ONR A;  3BBR A;  1XHY A;  2HAV A;  3MPK A;  2XXX A;  1A8E A;  4ESX A;  2IEE A;  5H8Q A;  4P0I A;  1MDP 1;  1YAE A;  2PBW A;  1H76 A;  4DIG A;  1SW1 A;  3SEU A;  3TAJ A;  5CBR A;  2IA4 A;  4R75 A;  3K6V A;  3LC8 A;  2Z8F A;  4ZE9 A;  1GTK A;  2Z23 A;  3MVW A;  4FJP A;  4ONY A;  1LFI A;  4YZZ A;  1H3D A;  4PFU A;  1QUJ A;  3S9M C;  1USY E;  2OZZ A;  4AB5 A;  3KOS A;  3WAF A;  4F1Y A;  1B9J A;  4FAT A;  1LCT A;  3MUQ A;  4MLV A;  5I2K B;  3O97 A;  1PBP A;  3Q28 A;  4FAJ A;  4ZS9 A;  4ESW A;  1A99 A;  5CC2 A;  3IL1 B;  4GL0 A;  1TWY A;  3H6V A;  3ILT B;  3SEX A;  3TTL A;  3FV1 A;  3FD3 A;  2G93 A;  2DXY A;  4F2O A;  3DP6 A;  3UK4 A;  3DEL B;  1AOV A;  1QVS A;  1Y3N A;  4ELO A;  4OEV A;  2NUV A;  3U8Q A;  2PT2 A;  2Y7P A;  2DE2 A;  1MXW A;  3TTK A;  3D4C A;  2ZMB A;  4R6H A;  5KCJ A;  3OO8 A;  4UAC A;  1HSJ A;  2XD3 A;  4MH5 A;  5BWJ A;  1D9V A;  1MQD A;  3EPE A;  5I59 A;  2Q89 A;  5A5X A;  3KN3 A;  4PE5 B;  3ZSF A;  4EUO A;  4PFW A;  3N26 A;  3U1O A;  1SD3 A;  4KI0 E;  1Y20 A;  1I6Q A;  2HXW A;  4GFR A;  1B0H A;  1B7H A;  1DSN A;  5CI5 A;  1RYX A;  2W7Y A;  3QSL A;  3H03 A;  4YMA A;  3FJ7 A;  1B7Z A;  1YPN A;  2QSX A;  2DOJ A;  1QKA A;  2AYS A;  4F19 A;  3MJN A;  3LSF B;  1II5 A;  4H67 A;  4HCW A;  3FXR A;  4O3A A;  4WED A;  5L9S A;  1LAF E;  4X1D A;  1MQG A;  4EDP A;  2V25 A;  2DXR A;  3TEL A;  5H8Q B;  2I0C A;  3FJM A;  2Z22 A;  2DSF A;  3RN8 A;  1P1W A;  3GBA A;  1M5E A;  3T9H B;  5TU0 A;  3SES A;  1LAX A;  3A09 A;  1H44 A;  2P1S A;  3KG2 A;  3CFZ A;  1O63 A;  4DCY A;  4R73 A;  4RK9 A;  4XKP A;  1N3X A;  4YKP A;  3M3L A;  3RTF B;  2CZL A;  3DLN A;  2RKM A;  3FXU A;  3PUV E;  1MH3 A;  3PV0 E;  3K4U A;  2H98 A;  2HCA A;  4U23 A;  2E0S A;  4M1V A;  1US4 A;  3IB2 A;  1Y1M A;  4JDF A;  4Z7E A;  4JB7 A;  4FOR A;  5CBS A;  1B5I A;  4LUB A;  4OFO A;  1NNP A;  1Y9U A;  2B3B A;  4OXV A;  4DLD A;  3R26 A;  2X7Q A;  3Q25 A;  3FVO A;  3T9X B;  3HV1 A;  4BDN A;  1QKB A;  2XXV A;  2UYE A;  4OER A;  2Y7K A;  5CMK A;  4JWO A;  4ELQ A;  4PET A;  2HAU A;  1MXZ A;  2VOZ A;  3PD8 A;  1BLF A;  3QXM A;  2ZNT A;  2GFE A;  4KCC A;  5KCJ B;  2QPQ A;  4I9D A;  1LST A;  5IKB A;  1FCK A;  4OFL A;  2DYX A;  5ITP A;  1NFT A;  2OLB A;  3MPL A;  3K0V A;  1YCJ A;  5A5X B;  1PB8 A;  1MY2 A;  4RA1 A;  1MM6 A;  2V3Q A;  4R2B A;  3JZJ A;  4NF5 A;  2HZK A;  4OTE A;  3U94 A;  4H0W A;  4ISU A;  2Q2A A;  3CI8 A;  3RQT A;  4BDM A;  4PFT A;  1OVT A;  4BLA A;  4K3F A;  4OYV A;  3BKI B;  3MZ1 A;  5AE4 A;  3IOU A;  2AL4 A;  1MDQ A;  1N7X A;  4H1X A;  2OK2 A;  4F3G A;  1IUD A;  3E4R A;  3AXF A;  2XXQ A;  4TLM B;  2ABH A;  1B1H A;  4RXL A;  1VE4 A;  2H4I A;  3IX1 A;  1B4H A;  3B6W A;  2GH9 A;  4H5G A;  1L5T A;  3OMB A;  4QFO A;  3MVX A;  1RKM A;  3K02 A;  3VFJ A;  3QUF A;  3S9E A;  1MXV A;  3VVF A;  5HPQ A;  4GOT A;  3VXC A;  4X9T A;  2GRV A;  3KJT A;  1IXI A;  1A40 A;  3CRB A;  1URG A;  3PUW E;  3EHU A;  3PPO A;  1M5C A;  4EXK A;  1SW2 A;  3K01 A;  1R9L A;  4IB2 A;  1QJM A;  2QS4 A;  1UTB A;  1R1N A;  4BDR A;  4QFP A;  3LBS A;  3PU5 A;  1MXX A;  3CSG A;  3BFU A;  4R9F A;  3O2A A;  4HS7 A;  1IXH A;  4YU0 A;  4F3B A;  3FXQ A;  4NF8 A;  3VLW A;  3OEK A;  3TFL A;  3B6Q A;  3OOA A;  2RF1 A;  3N5L A;  4YMB A;  4DXC A;  1A7L A;  1OQH A;  5ICQ A;  4GWO A;  1XVY A;  1SI1 A;  5FTI A;  3ECR A;  1XOC A;  3FV2 A;  3G7W A;  4BDO A;  3IO6 A;  4POX A;  3KEI A;  2XXY A;  2RIN A;  2OWS A;  5H8H A;  1JVY A;  3FAT A;  4F18 A;  3USD A;  1GVC A;  3TZA A;  1POT A;  4F1V A;  4MFI A;  3TEP A;  4F39 A;  4MLQ A;  1QUL A;  3IOW A;  3MBP A;  4NF5 B;  1MH4 A;  1MY0 A;  3E9X A;  1MRP A;  4IO6 A;  3PD9 A;  2Q2C A;  3O6I A;  2XXT A;  4E0W A;  3F11 A;  3VVD A;  1B05 A;  3EHS A;  1B2H A;  3RY3 A;  4ND9 A;  1NH7 A;  4LVQ A;  4NF4 A;  3OEM A;  5BUU A;  2WKY A;  1SI0 A;  1MXU A;  2R9J A;  1US5 A;  3C4M A;  2ZYN A;  5L8D A;  2I4C A;  5ISU A;  2F78 A;  1B5J A;  1B3H A;  4G68 A;  2PYY A;  1Y3Q A;  2ESN A;  3H7M A;  5AA1 A;  2I0B A;  1AL3 A;  2VP1 A;  3SET A;  4OES A;  1LCF A;  3H6W A;  1JNF A;  3MC2 A;  2O84 X;  3ILU B;  4PFY A;  1SBP A;  3SEY A;  4G4P A;  1NKX A;  2OBG A;  4N6P A;  4UA8 A;  1UTB B;  5EHS A;  2HQ0 A;  3VDF A;  2QMW A;  2ZNS A;  4EF2 A;  3UIF A;  4JWX A;  2Y7R A;  1TFD A;  3IB1 A;  4JSD A;  4Q5T A;  1BIY A;  2D21 A;  4GXA A;  1B3F A;  4YKK A;  4NF8 B;  1M5D A;  4OZ9 A;  3IAZ A;  2UVJ A;  3M8U A;  3MWB A;  3DM0 A;  3SKP A;  1UQW A;  3H6T A;  1SVX B;  1B4Z A;  1IIT A;  4KCD A;  2LAO A;  1B0L A;  3PPQ A;  4LZ8 A;  3MVZ A;  3VV5 A;  4F2Q A;  5AA2 D;  1M5B A;  4OEN A;  4C1T A;  4N07 A;  3U93 A;  3GLB A;  4ELR A;  4QF9 A;  5H8H B;  4KR5 A;  2NOO A;  3MZB A;  1EZ9 A;  1I6A A;  3MZ9 A;  4QSE A;  4OWD A;  3LUY A;  4GVO A;  4IGR A;  3PUZ E;  3B7D A;  3CG1 A;  1B52 A;  4LA9 A;  3FIR A;  3C9H A;  1N76 A;  3DP8 A;  3B6T A;  1FTM A;  1NNT A;  3KJ7 A;  2F6G A;  1R6Z A;  3PPP A;  4L17 A;  3C31 A;  1P99 A;  2RC8 A;  4G68 C;  3HO7 A;  4RPO A;  4ZEF A;  2BJJ X;  3JYR A;  3T22 A;  4OQO A;  3PGF A;  4EQB A;  1B46 A;  1MY3 A;  1EZP A;  1J1N A;  4NF4 B;  1A55 A;  1H45 A;  4KQP A;  5DEX A;  4DXB A;  3QYT A;  4Q30 B;  4IO2 A;  4ZED A;  4OET A;  1EZO A;  2I6E A;  3D4G A;  4DE8 A;  1MPC A;  3MW0 A;  3QUJ A;  4DDD A;  4WXJ A;  3KN8 A;  4G68 B;  4WEP A;  1IEJ A;  2VGQ A;  2DWA A;  5AA4 A;  2Q88 A;  3W15 C;  4F22 A;  1HSE A;  3TCH A;  4NWC A;  3RTW B;  5F7V A;  1SYH A;  1GV8 A;  1ZIU A;  3KFM A;  4U1Z A;  4PP0 A;  1MQI A;  2UVI A;  3V8X B;  2F6P A;  3RNN A;  1Y3P A;  1SDX A;  3MP6 A;  3S9N C;  1BTJ A;  2H99 A;  1LLS A;  3FZV A;  3Q26 A;  2FA7 A;  4QHQ A;  4JWY A;  4IY5 A;  3K1M A;  3TKD A;  5DVJ A;  2DE4 A;  2UVG A;  1RYO A;  2ZYO A;  5I58 A;  2F97 A;  3EF7 A;  2V3U A;  3HST A;  1UIU A;  2Q9T A;  3PPN A;  4H6D A;  4EXL A;  5B70 A;  4YKI A;  1P1N A;  4QSC A;  3U92 A;  4F3S A;  4P0G A;  2Q8J A;  3ZS6 A;  4O3B A;  1N7W A;  1QUI A;  2I49 A;  2RC7 A;  4G8N A;  2P2A A;  1LBC A;  2XD2 A;  5FHO A;  3OEL A;  3LR1 A;  4YIC A;  3KGC A;  4FEC A;  1OLA A;  5B7D A;  5JTY A;  2R6G E;  2REJ A;  1PB7 A;  5I59 B;  4TQU Q;  1VFE A;  4QFN A;  4H65 A;  4I62 A;  4F31 B;  5EHM A;  5CM6 A;  2PVU A;  1D9Y A;  3K00 A;  3R7X A;  2RC9 A;  3KSX A;  1PDA A;  3OEN A;  2D5W A;  3SEW A;  3K1P A;  2REG A;  1B7U A;  4Q0C A;  1LB8 A;  3TOD A;  1IXC A;  4FEB A;  2XX8 A;  1B3E A;  3G3G A;  3N94 A;  4AQ4 A;  5FTH A;  2DS9 A;  4POW A;  3TTM A;  3RUM A;  2DE3 A;  2A5T A;  3OSR A;  5DEX B;  2VHA A;  2HEU A;  3K1N A;  1DTZ A;  3TPA A;  5AA2 A;  2I3V A;  1P1U A;  3T66 A;  2AIX A;  5AA3 A;  1B6H A;  4GF8 A;  1WOD A;  5AA4 B;  1LB9 A;  3IK6 B;  2O6A A;  3OD7 A;  3JV9 A;  2G29 A;  1PEB A;  2DWJ A;  4XKN A;  1Q1K A;  2F34 A;  2YJP A;  1ZMG A;  4U21 A;  3MVY A;  4N13 A;  4R6K A;  4KYE A;  1USY H;  3G3H A;  3MQ9 A;  2XX9 A;  1TT1 A;  2I4B A;  1DPE A;  2XXP A;  3GBB A;  4WKM A;  2NXO A;  3CFL A;  4DXU A;  2ONK E;  3UA8 A;  1EU8 A;  2O68 A;  1ATG A;  2OCU A;  5TP9 A;  3O66 A;  2H25 A;  5I58 B;  1MY4 A;  3HPI A;  2F7B A;  2R71 A;  1QUK A;  1Z7M E;  4YB6 A;  3I3V A;  5JK4 A;  4IO7 A;  2DVC A;  5H8N A;  4YAH X;  5L9M A;  3SDF A;  1ZTY A;  2QRY A;  1A8F A;  3L6H A;  5J1D A;  2Z8E A;  2XXH A;  2ZXT A;  5TPA A;  1MPB A;  2I58 A;  1URS A;  4GQO A;  1M5F A;  1I6B A;  4H5F A;  3T9V A;  4RNS A;  4R74 A;  3C35 A;  1TXF A;  2O1L A;  4LAT A;  1Y4C A;  3HN0 A;  5JTY B;  2QJE A;  1MY1 A;  3RLF E;  4GIZ A;  4KPT A;  1URD A;  3TCG A;  4MF3 A;  3KZG A;  2XX7 A;  3TDJ A;  1MS7 A;  4U22 A;  2H5Y A;  4LON B;  1N3W A;  2X7P A;  4OEU A;  4GL8 A;  2PX1 A;  1UTH A;  1LAH E;  4FIM A;  4IO5 A;  5H8S A;  4DCX A;  3U72 A;  4AB6 A;  5KZT A;  3IJO B;  3G3I A;  4QRZ A;  1NNK A;  1OIB A;  4RY1 A;  3O28 A;  2Z8D A;  3C33 A;  4ZEB A;  1ZJL A;  4M4G A;  4X48 A;  3RGY A;  2A5T B;  3A3C A;  1WDN A;  1B51 A;  3P7I A;  5H8F A;  1D4N A;  1AIV A;  4JSO A;  4ZEK A;  4E0X A;  5AA2 B;  1KWH A;  1BKA A;  1EH3 A;  2QS1 A;  3E3K A;  5IAI A;  1S50 A;  3DP4 A;  3IOR A;  3T9U A;  4U2R A;  4ZEC A;  3FVG A;  3O6H A;  1D3K A;  2THI A;  4BDQ A;  1OMP A;  2YPN A;  3I6V A;  4R2F A;  3FVK A;  3O6G A;  3S4U A;  3BFT A;  1ZBM A;  3PMX A;  3GZG A;  3THI A;  1ANF A;  4ZZE A;  4XIG Q;  3W9W A;  3LSX A;  1N84 A;  1R9Q A;  1LFH A;  4R72 A;  2QMX A;  2UVH A;  3H4Z A;  5I57 A;  4IGT A;  3WAE A;  1Z7N E;  5L9O A;  5ITO A;  1MPD A;  1ELJ A;  2YLN A;  3KN7 A;  1GR2 A;  5KDT A;  3K6W A;  4O3C A;  4OVJ A;  5TP9 B;  1JVX A;  3IJX B;  4I8C A;  4YB7 A;  1T0K A;  2F7C A;  4NED A;  4F3P A;  3V5A A;  1MQJ A;  4XKQ A;  4LZ7 A;  3UN6 A;  3OSQ A;  1IZ1 A;  5H8N B;  4F1U A;  5K2Y A;  2V93 A;  1NH8 A;  2VD2 A;  3UGW A;  1JET A;  3N6U A;  3ZKK A;  2DWH A;  1F9B A;  3GXA A;  5TPA B;  1P1Q A;  3CSB A;  4F29 A;  3VLU A;  4IO4 A;  2GHB A;  3M3K A;  1N04 A;  2DQV A;  2E1S A;  3RPW A;  3K2D A;  3TTN A;  4OMB A;  3EN3 A;  2DVZ A;  5CMM A;  1SYI A;  4H8J A;  1LFG A;  4ZEI A;  2FYI A;  1JW5 A;  5ELV A;  2O1M A;  4NWD A;  2VD3 A;  1AH5 A;  1UTH B;  3MAM A;  4IY6 A;  4P11 A;  1O7T A;  3PMV A;  4H8I A;  3IO4 A;  4THI A;  3LSL A;  5CRY A;  4R9G A;  1MM7 A;  2O7U A;  2X26 A;  1I69 A;  1IQ7 A;  3S2V A;  5ICT A;  3VVE A;  2H9B A;  1B1X A;  4GRK A;  5H8F B;  4LZ5 A;  2XHD A;  5CMC A;  3VLV A;  2ANJ A;  1XS5 A;  3ONM A;  2ALU A;  2I3W A;  3TTR A;  3LSW A;  3N6T A;  2ZYK A;  3HHG A;  2OJT A;  3FVN A;  1FQD A;  2F7A A;  4KHZ E;  3I5O A;  2HFB A;  4EQ7 A;  1FTO A;  1QW0 A;  3VE1 B;  2Y7I A;  4KD5 A;  4YB5 A;  4TLL B;  2M8C A;  3FAS A;  3QIM A;  3KBR A;  4ZDM A;  3W9V A;  4ECF A;  4HW8 A;  1UIV A;  1JEV A;  4QFK A;  5I57 B;  1Y4T A;  5M2V A;  1JQF A;  1FQF A;  4ZZA A;  1JEU A;  5DTB A;  5KDT B;  4KYD A;  3TCF A;  3OO6 A;  4GXS B;  4GD5 A;  2DWI A;  2P0S A;  4HTG A;  2F5X A;  5FHN A;  4XTC Q;  1SW4 A;  1FTK A;  1A54 A;  1Y1Z A;  4QSD A;  1NNF A;  1LAG E;  1XC1 A;  4FED A;  2KLF A;  1DTG A;  4Q8R A;  1IIW A;  2F8D A;  1FQA A;  3FUZ A;  3R6U A;  3KOT A;  2RCA A;  3IR1 A;  1BP5 A;  1JW1 A;  4ELP A;  1MXY A;  3V89 B;  1OVB A;  1TFA A;  2NVU B;  4U4X A;  5I2N A;  3CVG A;  2O51 A;  1P1O A;  2DP8 A;  3ODB A;  2CMO A;  5EYF A;  4ZE8 A;  4X1B A;  1OLC A;  5DVF A;  5HBC A;  3CIJ A;  4U1O A;  4LQ5 A;  5JEI A;  5DYH A;  2O69 A;  2ONS A;  1FQE A;  2B65 A;  2V84 A;  5CMB A;  5DT6 A;  4NTL A;  3TQL A;  4EF1 A;  2QL3 A;  3C32 A;  3T96 B;  2D3I A;  3UOR A;  1ZU0 A;  4HCY A;  3HHF A;  4NF6 A;  3PPR A;  1FQC A;  3K6X A;  5I56 A;  4G77 A;  4C1U A;  1VFD A;  1LBB A;  4RYA A;  1DMB A;  5LOM A;  1MQH A;  3O9P A;  4RPN A;  1S9T A;  3V83 A;  2GHA A;  4JXI A;  3G3J A;  3TQW A;  2B3F A;  3G3K A;  1B32 A;  4G8M A; 
#chains in the Genus database with same CATH topology
 1DPP A;  1O64 A;  1CB6 A;  2Y5K A;  2AL5 A;  2GQ1 A;  1NL5 A;  3O29 A;  1VR5 A;  1PC3 A;  3H3G A;  1B3G A;  4IO3 A;  3SEV A;  3PUX E;  4TOZ A;  5F24 A;  3KC1 A;  1DOT A;  4YKJ A;  4NN3 A;  2O7I A;  3D1R A;  3ZKL A;  2I48 A;  3TUS A;  1FRP A;  1FPD A;  5I7I A;  4KYS A;  5IM2 A;  4EQ9 A;  1B5H A;  5DVI A;  4G2Z A;  2Y7W A;  3PUY E;  4HE2 A;  3G3F A;  3HCQ A;  3M3F A;  1POY 1;  1H43 A;  4PQJ A;  1ZLQ A;  4OVQ A;  4KFQ A;  1XVX A;  2XXR A;  3EHT A;  2QS3 A;  4LP2 B;  2Q8M A;  3S9L C;  2NWJ A;  4QFL A;  3Q29 A;  3CG3 A;  3QAX A;  4XKR A;  3L6G A;  3FGS A;  4C0R A;  4JBZ A;  2ZNU A;  4NMY A;  3OXN A;  3OO7 A;  4MBP A;  1Q35 A;  5I2K A;  4Z0I A;  5K2X A;  1LGB C;  3TMG A;  1FQB A;  3OO9 A;  3RT8 A;  1PB9 A;  1IXG A;  1HSL A;  4QBA A;  1WVJ A;  2F35 A;  2VT5 A;  1FTJ A;  3QK6 A;  5ET8 A;  1B40 A;  1VSO A;  1NMU A;  3IB0 A;  1FPE A;  1XT8 A;  5F1Q A;  3K6U A;  2FNC A;  2RCB A;  3LUZ A;  4RJZ A;  1JW4 A;  1MG1 A;  3VXB A;  1EYI A;  5I84 A;  3C34 A;  3MP1 A;  4LQ2 A;  5I2N B;  2A5S A;  3RT6 B;  3UP9 A;  1YTV A;  1PBQ A;  2XXI A;  2UYF A;  1LBZ A;  4DI3 D;  1B3L A;  4FE8 A;  4OFJ A;  1FJ6 A;  1EYK A;  4GLI A;  3PMW A;  1GGG A;  3CFX A;  3SER A;  4OHN A;  1B58 A;  3CR9 A;  4XXU A;  5FHM A;  1SQY A;  1N0T A;  3FJG A;  2WYK A;  4I1D A;  1S7Y A;  4PFR A;  2CEY A;  3A3U A;  5HM4 B;  1AMF A;  3TYH A;  4MNC A;  1FW0 A;  4DZ1 A;  2V3T A;  4R6Y A;  2UXA A;  4NF6 B;  2Y84 A;  2HZL A;  5I56 B;  1FTL A;  4G8H A;  3Q27 A;  2F36 A;  1SW5 A;  3MP8 A;  3EQ1 A;  3KSJ A;  2PMS A;  5DW8 A;  3C36 A;  3E13 X;  2PT1 A;  3IOV A;  4MIJ A;  3IOT A;  4NF0 A;  1K9Z A;  4PAI A;  2OWT A;  4GWY A;  4BDL A;  3H6U A;  1OQG A;  1ZKB A;  4QXD A;  3H06 B;  2PCR A;  3MYU A;  4NE4 A;  2QS2 A;  4U4S A;  4RK2 A;  2XXW A;  2XXU A;  2ZYM A;  1CE2 A;  3T93 B;  2ONR A;  3BBR A;  1XHY A;  2HAV A;  3MPK A;  2XXX A;  1A8E A;  4ESX A;  2IEE A;  4X04 A;  5H8Q A;  1KZ8 A;  4P0I A;  1MDP 1;  1YAE A;  2F3D A;  2CEX A;  2PBW A;  1H76 A;  4DIG A;  1SW1 A;  1DCU A;  3SEU A;  1FPG A;  3TAJ A;  5CBR A;  2IA4 A;  3E79 A;  4R75 A;  3K6V A;  3CHG A;  3LC8 A;  2Z8F A;  4ZE9 A;  1GTK A;  2Z23 A;  3MVW A;  4FJP A;  4ONY A;  1LFI A;  4YZZ A;  1H3D A;  1LEV A;  4PFU A;  4H46 A;  1QUJ A;  3S9M C;  1IMD A;  1USY E;  2OZZ A;  4AB5 A;  3KOS A;  3WAF A;  4F1Y A;  2V4C A;  1B9J A;  4FAT A;  1LCT A;  3MUQ A;  4MLV A;  5I2K B;  3O97 A;  1PBP A;  3Q28 A;  4FAJ A;  4HE0 A;  4ZS9 A;  4ESW A;  1A99 A;  1AWB A;  5CC2 A;  3IL1 B;  3MST A;  4GL0 A;  1TWY A;  3H6V A;  3ILT B;  3SEX A;  3TTL A;  3FV1 A;  3FD3 A;  2G93 A;  2DXY A;  4F2O A;  3DP6 A;  3UK4 A;  3DEL B;  4I3Y A;  1AOV A;  1QVS A;  1Y3N A;  3IFA A;  2FVZ A;  1FBH A;  4ELO A;  4OEV A;  2NUV A;  1FBC A;  3FBP A;  3U8Q A;  2PT2 A;  2Y7P A;  2DE2 A;  1MXW A;  3TTK A;  3D4C A;  2ZMB A;  4R6H A;  4I40 A;  5J16 A;  5KCJ A;  4PDD A;  3OO8 A;  4UAC A;  1HSJ A;  2XD3 A;  4MH5 A;  5BWJ A;  1D9V A;  2QFL A;  1MQD A;  3EPE A;  5I59 A;  2Q89 A;  5A5X A;  3KN3 A;  1IME A;  4PE5 B;  3ZSF A;  5FBP A;  4EUO A;  4PFW A;  3N26 A;  3U1O A;  1SD3 A;  4N6K A;  4MAG A;  4KI0 E;  1Y20 A;  1I6Q A;  2HXW A;  4GFR A;  1B0H A;  1B7H A;  1RDX A;  1DSN A;  4GBW A;  5CI5 A;  1FJ9 A;  2HPG A;  1RYX A;  2W7Y A;  4MX6 A;  3QSL A;  3U65 A;  3T1B A;  3H03 A;  4YMA A;  3FJ7 A;  1B7Z A;  1YPN A;  2QSX A;  2DOJ A;  1LBX A;  1QKA A;  2AYS A;  4F19 A;  1VDW A;  3MJN A;  3LSF B;  1II5 A;  4H67 A;  4HCW A;  3FXR A;  4O3A A;  4WED A;  5L9S A;  1LAF E;  4X1D A;  1MQG A;  4EDP A;  2V25 A;  2DXR A;  3TEL A;  5H8Q B;  2I0C A;  3FJM A;  2Z22 A;  1IMB A;  2DSF A;  3RN8 A;  1P1W A;  3GBA A;  1M5E A;  3T9H B;  1FPJ A;  5TU0 A;  3SES A;  1LAX A;  3A09 A;  4PFI A;  1H44 A;  2P1S A;  3KG2 A;  3CFZ A;  4NG7 A;  5LDZ A;  1O63 A;  4DCY A;  4R73 A;  4RK9 A;  4XKP A;  1N3X A;  4YKP A;  3M3L A;  3RTF B;  2CZL A;  4N8Y A;  3DLN A;  2RKM A;  4PBH A;  3FXU A;  3PUV E;  1MH3 A;  3PV0 E;  3K4U A;  2H98 A;  2HCA A;  4PFB A;  4U23 A;  2E0S A;  4M1V A;  1US4 A;  2P3N A;  3IB2 A;  4PGP A;  1Y1M A;  4JDF A;  4Z7E A;  4JB7 A;  4FOR A;  5CBS A;  1B5I A;  4LUB A;  4OFO A;  1NNP A;  1Y9U A;  2B3B A;  4OXV A;  4DLD A;  3R26 A;  2X7Q A;  3Q25 A;  3FVO A;  3T9X B;  3HV1 A;  4BDN A;  1QKB A;  2XXV A;  2UYE A;  4OER A;  4N91 A;  2Y7K A;  4GWW A;  5CMK A;  2KR0 A;  4JWO A;  4ELQ A;  4PET A;  2HAU A;  1MXZ A;  2XXK A;  2VOZ A;  3PD8 A;  1BLF A;  3QXM A;  2ZNT A;  2GFE A;  1FPL A;  4KCC A;  5KCJ B;  2QPQ A;  4I9D A;  1LST A;  4OA4 A;  5IKB A;  1FCK A;  2ZZW A;  4OFL A;  2DYX A;  5ITP A;  1NFT A;  2OLB A;  3MPL A;  3K0V A;  1YCJ A;  5A5X B;  1PB8 A;  1MY2 A;  4X8R A;  4RA1 A;  1MM6 A;  2V3Q A;  4R2B A;  4PF6 A;  3JZJ A;  4NF5 A;  2HZK A;  4P8B A;  4OTE A;  3U94 A;  4H0W A;  4ISU A;  2Q2A A;  3CI8 A;  1FTA A;  3RQT A;  4BDM A;  4PFT A;  1OVT A;  4BLA A;  4K3F A;  4OYV A;  3BKI B;  3MZ1 A;  5AE4 A;  3IOU A;  3EKI A;  2AL4 A;  1MDQ A;  1N7X A;  1FPI A;  4H1X A;  2OK2 A;  4F3G A;  1IUD A;  3E4R A;  3AXF A;  2XXQ A;  4TLM B;  4MJO A;  2ABH A;  1B1H A;  4NAP A;  4RXL A;  1VE4 A;  2VPN A;  2H4I A;  3IX1 A;  1B4H A;  1YYZ A;  3B6W A;  2GH9 A;  4H5G A;  1L5T A;  3OMB A;  4NX1 A;  4QFO A;  3MVX A;  1RKM A;  3K02 A;  4N6D A;  3VFJ A;  3QUF A;  3S9E A;  1MXV A;  3VVF A;  5HPQ A;  4GOT A;  3VXC A;  4X9T A;  4AS4 A;  2GRV A;  3KJT A;  1IXI A;  1A40 A;  3CRB A;  3E78 A;  1URG A;  1DK4 A;  3PUW E;  3EHU A;  3PPO A;  1M5C A;  4EXK A;  1SW2 A;  3K01 A;  1R9L A;  4IB2 A;  1QJM A;  2QS4 A;  4PTK A;  1UTB A;  1R1N A;  4BDR A;  4QFP A;  3LBS A;  3NOH A;  3PU5 A;  1MXX A;  3CSG A;  4MHF A;  3BFU A;  4P56 A;  4R9F A;  1NUX A;  3O2A A;  4HS7 A;  4GWX A;  2FIE A;  2OWZ A;  1IXH A;  4YU0 A;  4F3B A;  3FXQ A;  4N81 A;  4NF8 A;  3VLW A;  4KXP A;  2B4L A;  3OEK A;  3TFL A;  3B6Q A;  3OOA A;  2RF1 A;  3N5L A;  4YMB A;  1NV5 A;  4DXC A;  1A7L A;  2CZH A;  1OQH A;  5ICQ A;  4GWO A;  1SI1 A;  1XVY A;  2Y5L A;  5FTI A;  3ECR A;  1XOC A;  2OX3 A;  3FV2 A;  3G7W A;  2BJI A;  2WEF A;  4BDO A;  4POX A;  3IO6 A;  3KEI A;  2XXY A;  2RIN A;  2OWS A;  5H8H A;  4OVR A;  1JVY A;  1DBZ A;  3FAT A;  4F18 A;  3USD A;  1GVC A;  3TZA A;  4XEQ A;  1POT A;  4F1V A;  4MFI A;  3TEP A;  3B8B A;  4F39 A;  4LN5 A;  4MLQ A;  1QUL A;  3IOW A;  2FBP A;  3MBP A;  4NF5 B;  4NQ8 A;  1NV2 A;  1MH4 A;  1MY0 A;  3E9X A;  1MRP A;  5I3S A;  4IO6 A;  3PD9 A;  4P1E A;  2Q2C A;  3O6I A;  4XF5 A;  2XXT A;  4E0W A;  3F11 A;  1FBD A;  4O94 A;  3VVD A;  1B05 A;  3EHS A;  1B2H A;  3RY3 A;  4ND9 A;  1NH7 A;  4NF4 A;  4LVQ A;  4HE1 A;  4G61 A;  3OEM A;  4PF8 A;  1FPK A;  5BUU A;  2WKY A;  1SI0 A;  1MXU A;  2R9J A;  1US5 A;  3C4M A;  2ZYN A;  1IMF A;  5L8D A;  2I4C A;  5ISU A;  2F78 A;  1B5J A;  1B3H A;  4G68 A;  3RYD A;  2PYY A;  4PBQ A;  1Y3Q A;  1D9Q A;  2ESN A;  3H7M A;  5AA1 A;  2I0B A;  1AL3 A;  2VP1 A;  3SET A;  4OES A;  1LCF A;  3H6W A;  1JNF A;  2Q74 A;  3MC2 A;  2O84 X;  3ILU B;  3IFC A;  4PFY A;  1SBP A;  3SEY A;  4G4P A;  1NKX A;  2OBG A;  4AS5 A;  4N6P A;  4UA8 A;  1UTB B;  5EHS A;  2HQ0 A;  3VDF A;  2QMW A;  3QMF A;  2ZNS A;  4EF2 A;  3UIF A;  4JWX A;  2Y7R A;  1TFD A;  3IB1 A;  4JSD A;  1FSA A;  4Q5T A;  1BIY A;  1EYJ A;  2D21 A;  4GXA A;  1B3F A;  4JVD A;  4YKK A;  4NF8 B;  1M5D A;  4OZ9 A;  3IAZ A;  2UVJ A;  3M8U A;  3MWB A;  3DM0 A;  3SKP A;  1UQW A;  3H6T A;  1SVX B;  1B4Z A;  1IIT A;  4KCD A;  2LAO A;  1B0L A;  4UAB A;  3PPQ A;  4FBP A;  4LZ8 A;  3A29 A;  3MVZ A;  3VV5 A;  2R8T A;  4F2Q A;  4GWU A;  5AA2 D;  1M5B A;  4OEN A;  4C1T A;  4N07 A;  3U93 A;  2P3V A;  3GLB A;  4ELR A;  4QF9 A;  4O8M A;  5H8H B;  4KR5 A;  2NOO A;  3MZB A;  4P1L A;  1EZ9 A;  1I6A A;  3MZ9 A;  4QSE A;  4OWD A;  3LUY A;  4GVO A;  4IGR A;  3PUZ E;  4MNI A;  3B7D A;  3CG1 A;  1B52 A;  4LA9 A;  3FIR A;  3C9H A;  1N76 A;  3DP8 A;  3B6T A;  1FTM A;  1NNT A;  3KJ7 A;  2F6G A;  1R6Z A;  1XI6 A;  3PTY A;  3PPP A;  4L17 A;  3C31 A;  1P99 A;  2RC8 A;  4G68 C;  3HO7 A;  4RPO A;  4ZEF A;  2BJJ X;  3JYR A;  3T22 A;  4OQO A;  3PGF A;  4EQB A;  1B46 A;  1MY3 A;  1EZP A;  4JVI A;  1J1N A;  4NF4 B;  1A55 A;  1H45 A;  4KQP A;  5DEX A;  4DXB A;  3QYT A;  4Q30 B;  4IO2 A;  4ZED A;  4OET A;  4NGU A;  1EZO A;  2I6E A;  2WBD A;  3D4G A;  3RPL A;  2ZZX A;  1MPC A;  3MW0 A;  3QUJ A;  4DE8 A;  4DDD A;  4WXJ A;  3KN8 A;  4OVS A;  4G68 B;  4WEP A;  5EQ9 A;  1IEJ A;  2VGQ A;  2DWA A;  5AA4 A;  2Q88 A;  2QVV A;  3W15 C;  4F22 A;  1HSE A;  3TCH A;  4NWC A;  3RTW B;  5F7V A;  1SYH A;  1GV8 A;  1ZIU A;  3KFM A;  4U1Z A;  1NV4 A;  4PP0 A;  1MQI A;  2UVI A;  2HHM A;  1SPI A;  3V8X B;  2F6P A;  4P47 A;  5ESY A;  3RNN A;  1Y3P A;  1SDX A;  4DI4 B;  3MP6 A;  3S9N C;  1BTJ A;  1JP4 A;  2H99 A;  1LLS A;  3FZV A;  3Q26 A;  1LBW A;  5IZ1 A;  5EQ7 A;  2FA7 A;  4QHQ A;  4JWY A;  4IY5 A;  3K1M A;  3TKD A;  2JJK A;  5DVJ A;  1NV3 A;  2DE4 A;  2UVG A;  1RYO A;  2ZYO A;  5I58 A;  2F97 A;  3EF7 A;  2V3U A;  3HST A;  1UIU A;  2Q9T A;  3PPN A;  2WX9 A;  4H6D A;  1NV1 A;  4EXL A;  5B70 A;  4YKI A;  1P1N A;  4GBV A;  4QSC A;  3U92 A;  3HFU A;  4F3S A;  4P0G A;  2Q8J A;  3ZS6 A;  4O3B A;  3GYY A;  1N7W A;  1QUI A;  4HXV A;  2I49 A;  2RC7 A;  4G8N A;  2P2A A;  1LBC A;  1FBG A;  2XD2 A;  2QVU A;  5FHO A;  3OEL A;  3LR1 A;  4YIC A;  3KGC A;  4FEC A;  1OLA A;  5B7D A;  5JTY A;  2R6G E;  2REJ A;  5ET6 A;  1FPB A;  1PB7 A;  1IMC A;  4TQU Q;  5I59 B;  1VFE A;  4QFN A;  5A5L A;  4H65 A;  4I62 A;  4F31 B;  5EHM A;  5CM6 A;  2WYP A;  2PVU A;  1D9Y A;  4I3E A;  3K00 A;  3R7X A;  4GWS A;  2RC9 A;  3KSX A;  1PDA A;  3OEN A;  1KA0 A;  2D5W A;  2FIX A;  3SEW A;  3K1P A;  2REG A;  2DDK A;  1KA1 A;  1B7U A;  1G0H A;  4Q0C A;  1LB8 A;  3TOD A;  4N4U A;  1IXC A;  4FEB A;  2XX8 A;  1NV0 A;  2B4M A;  5IGA A;  1B3E A;  3G3G A;  2WBB A;  3N94 A;  4AQ4 A;  5FTH A;  2DS9 A;  3KBZ A;  4POW A;  3TTM A;  3RUM A;  2DE3 A;  1NUW A;  2A5T A;  3OSR A;  5DEX B;  2VHA A;  5IZ3 A;  5IZZ A;  2HEU A;  3K1N A;  1DTZ A;  3TPA A;  3RPL B;  5AA2 A;  4OVT A;  2I3V A;  1P1U A;  3T66 A;  2AIX A;  5AA3 A;  1B6H A;  4GF8 A;  1WOD A;  5AA4 B;  1LB9 A;  3IK6 B;  3FXB A;  2O6A A;  3OD7 A;  3JV9 A;  2G29 A;  1PEB A;  2DWJ A;  2XWO A;  4XKN A;  1Q1K A;  2F34 A;  2YJP A;  1NV6 A;  1ZMG A;  4U21 A;  3KC0 A;  4PCD A;  4JVC A;  3MVY A;  4N13 A;  4R6K A;  4KYE A;  1USY H;  4MNP A;  3G3H A;  1NUZ A;  3MQ9 A;  5EQ8 A;  2XX9 A;  1TT1 A;  4GX6 A;  2I4B A;  1DPE A;  2XXP A;  4O7I A;  3GBB A;  4WKM A;  2NXO A;  3ROJ A;  3CFL A;  4DXU A;  2ONK E;  3UA8 A;  1EU8 A;  2O68 A;  1ATG A;  2OCU A;  5TP9 A;  4PGN A;  1K9Y A;  3O66 A;  2H25 A;  5I58 B;  1YXI A;  2PFY A;  1MY4 A;  3HPI A;  2F7B A;  2R71 A;  1QUK A;  1Z7M E;  4YB6 A;  3BIH A;  3I3V A;  5JK4 A;  4IO7 A;  2DVC A;  5H8N A;  4YAH X;  5L9M A;  3SDF A;  1ZTY A;  2QRY A;  1A8F A;  3L6H A;  5J1D A;  2Z8E A;  2XXH A;  2ZXT A;  1MPB A;  5TPA A;  2I58 A;  1URS A;  4GQO A;  3T0J A;  1M5F A;  1I6B A;  4H5F A;  3T9V A;  1LBV A;  4RNS A;  4R74 A;  3C35 A;  1TXF A;  2O1L A;  4LAT A;  1Y4C A;  3HN0 A;  5JTY B;  3LV0 A;  2QJE A;  1MY1 A;  3RLF E;  4GIZ A;  4KPT A;  1URD A;  3TCG A;  4MF3 A;  3KZG A;  2KQZ A;  4N17 A;  2XX7 A;  3TDJ A;  1MS7 A;  4U22 A;  2H5Y A;  4LON B;  1N3W A;  2X7P A;  4OEU A;  4GL8 A;  2PX1 A;  1UTH A;  1LAH E;  4FIM A;  4IO5 A;  2QVR A;  5H8S A;  3U72 A;  4AB6 A;  4DCX A;  5KZT A;  2VPO A;  3IJO B;  3G3I A;  5T3J A;  4QRZ A;  1NNK A;  1OIB A;  4RY1 A;  1YZ0 A;  3O28 A;  2Z8D A;  3C33 A;  4ZEB A;  1ZJL A;  4M4G A;  4X48 A;  3RGY A;  2A5T B;  3BIG A;  3A3C A;  1WDN A;  1B51 A;  3P7I A;  5H8F A;  5IZ3 B;  1D4N A;  1AIV A;  4JSO A;  4ZEK A;  4E0X A;  5AA2 B;  1KWH A;  1BKA A;  1EH3 A;  2QS1 A;  4MCO A;  3ISP A;  3E3K A;  5IAI A;  4P3L A;  1S50 A;  3DP4 A;  3B50 A;  3IOR A;  4U2R A;  3T9U A;  4ZEC A;  3FVG A;  3O6H A;  1D3K A;  2THI A;  4BDQ A;  1OMP A;  2YPN A;  3I6V A;  4R2F A;  3FVK A;  3O6G A;  3S4U A;  3BFT A;  1ZBM A;  3PMX A;  3GZG A;  3THI A;  1ANF A;  4ZZE A;  4XIG Q;  3W9W A;  3LSX A;  1N84 A;  1R9Q A;  1LFH A;  4R72 A;  2QMX A;  2UVH A;  2XWK A;  3H4Z A;  5I57 A;  4IGT A;  4GX3 A;  3WAE A;  1Z7N E;  5L9O A;  5ITO A;  1MPD A;  4P9K A;  1NI9 A;  1ELJ A;  2YLN A;  3KN7 A;  1GR2 A;  5KDT A;  3K6W A;  4H45 A;  4O3C A;  4OVJ A;  5TP9 B;  1JVX A;  3IJX B;  4GWZ A;  4I8C A;  4YB7 A;  1T0K A;  2F7C A;  4NED A;  4F3P A;  4PAK A;  2F3B A;  3V5A A;  1MQJ A;  4XKQ A;  4LZ7 A;  3UN6 A;  3OSQ A;  1IZ1 A;  5ET5 A;  5H8N B;  4F1U A;  5K2Y A;  2V93 A;  2FHY A;  1NH8 A;  2VD2 A;  3UGW A;  1JET A;  3N6U A;  2XA5 A;  3ZKK A;  2DWH A;  1F9B A;  3GXA A;  2XWI A;  5TPA B;  1P1Q A;  3CSB A;  1RDZ A;  4F29 A;  3VLU A;  4IO4 A;  2GHB A;  4IR8 A;  1CNQ A;  3M3K A;  1N04 A;  1FBF A;  2DQV A;  1INP A;  2E1S A;  3RPW A;  3K2D A;  3TTN A;  4OMB A;  3EN3 A;  2DVZ A;  5CMM A;  1SYI A;  4H8J A;  1LFG A;  4ZEI A;  1FBE A;  1QGX A;  2FYI A;  4GX4 A;  1JW5 A;  5ELV A;  2O1M A;  4NWD A;  4PC9 A;  2VD3 A;  4PAF A;  1AH5 A;  1UTH B;  3MAM A;  4IY6 A;  4P11 A;  1O7T A;  3PMV A;  4H8I A;  3IO4 A;  4THI A;  3LSL A;  5CRY A;  4R9G A;  1RDY A;  1MM7 A;  2O7U A;  2X26 A;  1I69 A;  1IQ7 A;  4O7M A;  3S2V A;  5ICT A;  3VVE A;  2H9B A;  1B1X A;  4GRK A;  3SZP A;  1NUY A;  5H8F B;  4LZ5 A;  2XHD A;  5CMC A;  3VLV A;  4OAN A;  2ANJ A;  1XS5 A;  2HXR A;  3ONM A;  2PFZ A;  2ALU A;  2I3W A;  1FBP A;  3TTR A;  3LSW A;  3N6T A;  2ZYK A;  3HHG A;  5LTC A;  2OJT A;  3FVN A;  1FQD A;  2F7A A;  4KHZ E;  3I5O A;  2HFB A;  4EQ7 A;  1FPF A;  1FTO A;  4OVP A;  1QW0 A;  3VE1 B;  2Y7I A;  4KD5 A;  4YB5 A;  4TLL B;  2M8C A;  3FAS A;  3QIM A;  3KBR A;  5EQA A;  4ZDM A;  1IMA A;  3W9V A;  4ECF A;  4HW8 A;  1UIV A;  1JEV A;  5ET7 A;  4QFK A;  5I57 B;  1Y4T A;  5M2V A;  1JQF A;  1FQF A;  2L5V A;  4ZZA A;  1JEU A;  4N8G A;  5DTB A;  5KDT B;  4KYD A;  3TCF A;  4MMP A;  3OO6 A;  4GXS B;  4GD5 A;  2DWI A;  2P0S A;  2MKZ A;  4HTG A;  2F5X A;  5FHN A;  4XTC Q;  1SW4 A;  1FTK A;  1A54 A;  4QSD A;  1Y1Z A;  1NNF A;  1LAG E;  5I5P A;  1XC1 A;  4FED A;  2KLF A;  4MEV A;  1LBY A;  1DTG A;  4Q8R A;  1IIW A;  2F8D A;  1FQA A;  1Q9D A;  3FUZ A;  3R6U A;  5EYG A;  3KOT A;  1NV7 A;  2RCA A;  3IR1 A;  1BP5 A;  1JW1 A;  2ZZV A;  4ELP A;  1MXY A;  3V89 B;  1OVB A;  1BK4 A;  1TFA A;  2NVU B;  4U4X A;  5I2N A;  3CVG A;  2O51 A;  1P1O A;  2DP8 A;  3ODB A;  2CMO A;  5EYF A;  4ZE8 A;  4X1B A;  1OLC A;  4PDH A;  5DVF A;  5HBC A;  3CIJ A;  4U1O A;  4LQ5 A;  5JEI A;  5DYH A;  2O69 A;  2ONS A;  1FQE A;  2B65 A;  2V84 A;  4N15 A;  5CMB A;  5DT6 A;  4NTL A;  3TQL A;  4EF1 A;  2QL3 A;  3C32 A;  3T96 B;  2D3I A;  3UOR A;  1ZU0 A;  4HCY A;  2CZK A;  3HHF A;  4NF6 A;  3PPR A;  1FQC A;  3K6X A;  1G0I A;  5I56 A;  4G77 A;  4C1U A;  1VFD A;  2XWV A;  1LBB A;  4RYA A;  1DMB A;  5LOM A;  1MQH A;  3O9P A;  4RPN A;  1S9T A;  3V83 A;  2GHA A;  4JXI A;  4PE3 A;  4XFE A;  2CZI A;  4NHB A;  3G3J A;  3TQW A;  2B3F A;  5EYH A;  3G3K A;  1B32 A;  4G8M A; 
#chains in the Genus database with same CATH homology
 1DPP A;  1O64 A;  1CB6 A;  2AL5 A;  1NL5 A;  3O29 A;  1VR5 A;  1PC3 A;  3H3G A;  1B3G A;  4IO3 A;  3SEV A;  3PUX E;  4TOZ A;  1DOT A;  4YKJ A;  2O7I A;  3ZKL A;  2I48 A;  3TUS A;  4KYS A;  4EQ9 A;  1B5H A;  5DVI A;  4G2Z A;  2Y7W A;  3PUY E;  3G3F A;  3HCQ A;  3M3F A;  1POY 1;  1H43 A;  4PQJ A;  1ZLQ A;  4KFQ A;  1XVX A;  2XXR A;  3EHT A;  2QS3 A;  4LP2 B;  3S9L C;  2NWJ A;  4QFL A;  3Q29 A;  3CG3 A;  3QAX A;  4XKR A;  3L6G A;  3FGS A;  4C0R A;  4JBZ A;  2ZNU A;  4NMY A;  3OXN A;  3OO7 A;  4MBP A;  1Q35 A;  5I2K A;  4Z0I A;  5K2X A;  1LGB C;  3TMG A;  1FQB A;  3OO9 A;  3RT8 A;  1PB9 A;  1IXG A;  1HSL A;  1WVJ A;  2F35 A;  1FTJ A;  3QK6 A;  1B40 A;  1VSO A;  1NMU A;  3IB0 A;  1XT8 A;  5F1Q A;  3K6U A;  2FNC A;  2RCB A;  4RJZ A;  1JW4 A;  1MG1 A;  3VXB A;  5I84 A;  3C34 A;  3MP1 A;  4LQ2 A;  5I2N B;  2A5S A;  3RT6 B;  3UP9 A;  1YTV A;  1PBQ A;  2XXI A;  2UYF A;  1B3L A;  4FE8 A;  4OFJ A;  4GLI A;  3PMW A;  1GGG A;  3CFX A;  3SER A;  4OHN A;  1B58 A;  3CR9 A;  4XXU A;  5FHM A;  1SQY A;  1N0T A;  3FJG A;  4I1D A;  1S7Y A;  3A3U A;  5HM4 B;  1AMF A;  3TYH A;  1FW0 A;  4DZ1 A;  2V3T A;  4R6Y A;  2UXA A;  4NF6 B;  2Y84 A;  2HZL A;  5I56 B;  1FTL A;  4G8H A;  3Q27 A;  2F36 A;  1SW5 A;  3MP8 A;  3EQ1 A;  3KSJ A;  2PMS A;  3C36 A;  3E13 X;  2PT1 A;  3IOV A;  3IOT A;  2OWT A;  4BDL A;  3H6U A;  1OQG A;  1ZKB A;  3H06 B;  4NE4 A;  2QS2 A;  4U4S A;  4RK2 A;  2XXW A;  2XXU A;  2ZYM A;  1CE2 A;  3T93 B;  2ONR A;  3BBR A;  1XHY A;  2HAV A;  3MPK A;  2XXX A;  1A8E A;  4ESX A;  2IEE A;  5H8Q A;  4P0I A;  1MDP 1;  1YAE A;  2PBW A;  1H76 A;  4DIG A;  1SW1 A;  3SEU A;  3TAJ A;  5CBR A;  2IA4 A;  4R75 A;  3K6V A;  3LC8 A;  2Z8F A;  4ZE9 A;  1GTK A;  2Z23 A;  3MVW A;  4FJP A;  4ONY A;  1LFI A;  4YZZ A;  1H3D A;  4PFU A;  1QUJ A;  3S9M C;  1USY E;  2OZZ A;  4AB5 A;  3KOS A;  3WAF A;  4F1Y A;  1B9J A;  4FAT A;  1LCT A;  3MUQ A;  4MLV A;  5I2K B;  3O97 A;  1PBP A;  3Q28 A;  4FAJ A;  4ZS9 A;  4ESW A;  1A99 A;  5CC2 A;  3IL1 B;  4GL0 A;  1TWY A;  3H6V A;  3ILT B;  3SEX A;  3TTL A;  3FV1 A;  3FD3 A;  2G93 A;  2DXY A;  4F2O A;  3DP6 A;  3UK4 A;  3DEL B;  1AOV A;  1QVS A;  1Y3N A;  4ELO A;  4OEV A;  2NUV A;  3U8Q A;  2PT2 A;  2Y7P A;  2DE2 A;  1MXW A;  3TTK A;  3D4C A;  2ZMB A;  4R6H A;  5KCJ A;  3OO8 A;  4UAC A;  1HSJ A;  2XD3 A;  4MH5 A;  5BWJ A;  1D9V A;  1MQD A;  3EPE A;  5I59 A;  2Q89 A;  5A5X A;  3KN3 A;  4PE5 B;  3ZSF A;  4EUO A;  4PFW A;  3N26 A;  3U1O A;  1SD3 A;  4KI0 E;  1Y20 A;  1I6Q A;  2HXW A;  4GFR A;  1B0H A;  1B7H A;  1DSN A;  5CI5 A;  1RYX A;  2W7Y A;  3QSL A;  3H03 A;  4YMA A;  3FJ7 A;  1B7Z A;  1YPN A;  2QSX A;  2DOJ A;  1QKA A;  2AYS A;  4F19 A;  3MJN A;  3LSF B;  1II5 A;  4H67 A;  4HCW A;  3FXR A;  4O3A A;  4WED A;  5L9S A;  1LAF E;  4X1D A;  1MQG A;  4EDP A;  2V25 A;  2DXR A;  3TEL A;  5H8Q B;  2I0C A;  3FJM A;  2Z22 A;  2DSF A;  3RN8 A;  1P1W A;  3GBA A;  1M5E A;  3T9H B;  5TU0 A;  3SES A;  1LAX A;  3A09 A;  1H44 A;  2P1S A;  3KG2 A;  3CFZ A;  1O63 A;  4DCY A;  4R73 A;  4RK9 A;  4XKP A;  1N3X A;  4YKP A;  3M3L A;  3RTF B;  2CZL A;  3DLN A;  2RKM A;  3FXU A;  3PUV E;  1MH3 A;  3PV0 E;  3K4U A;  2H98 A;  2HCA A;  4U23 A;  2E0S A;  4M1V A;  1US4 A;  3IB2 A;  1Y1M A;  4JDF A;  4Z7E A;  4JB7 A;  4FOR A;  5CBS A;  1B5I A;  4LUB A;  4OFO A;  1NNP A;  1Y9U A;  2B3B A;  4OXV A;  4DLD A;  3R26 A;  2X7Q A;  3Q25 A;  3FVO A;  3T9X B;  3HV1 A;  4BDN A;  1QKB A;  2XXV A;  2UYE A;  4OER A;  2Y7K A;  5CMK A;  4JWO A;  4ELQ A;  4PET A;  2HAU A;  1MXZ A;  2VOZ A;  3PD8 A;  1BLF A;  3QXM A;  2ZNT A;  2GFE A;  4KCC A;  5KCJ B;  2QPQ A;  4I9D A;  1LST A;  5IKB A;  1FCK A;  4OFL A;  2DYX A;  5ITP A;  1NFT A;  2OLB A;  3MPL A;  3K0V A;  1YCJ A;  5A5X B;  1PB8 A;  1MY2 A;  4RA1 A;  1MM6 A;  2V3Q A;  4R2B A;  3JZJ A;  4NF5 A;  2HZK A;  4OTE A;  3U94 A;  4H0W A;  4ISU A;  2Q2A A;  3CI8 A;  3RQT A;  4BDM A;  4PFT A;  1OVT A;  4BLA A;  4K3F A;  4OYV A;  3BKI B;  3MZ1 A;  5AE4 A;  3IOU A;  2AL4 A;  1MDQ A;  1N7X A;  4H1X A;  2OK2 A;  4F3G A;  1IUD A;  3E4R A;  3AXF A;  2XXQ A;  4TLM B;  2ABH A;  1B1H A;  4RXL A;  1VE4 A;  2H4I A;  3IX1 A;  1B4H A;  3B6W A;  2GH9 A;  4H5G A;  1L5T A;  3OMB A;  4QFO A;  3MVX A;  1RKM A;  3K02 A;  3VFJ A;  3QUF A;  3S9E A;  1MXV A;  3VVF A;  5HPQ A;  4GOT A;  3VXC A;  4X9T A;  2GRV A;  3KJT A;  1IXI A;  1A40 A;  3CRB A;  1URG A;  3PUW E;  3EHU A;  3PPO A;  1M5C A;  4EXK A;  1SW2 A;  3K01 A;  1R9L A;  4IB2 A;  1QJM A;  2QS4 A;  1UTB A;  1R1N A;  4BDR A;  4QFP A;  3LBS A;  3PU5 A;  1MXX A;  3CSG A;  3BFU A;  4R9F A;  3O2A A;  4HS7 A;  1IXH A;  4YU0 A;  4F3B A;  3FXQ A;  4NF8 A;  3VLW A;  3OEK A;  3TFL A;  3B6Q A;  3OOA A;  2RF1 A;  3N5L A;  4YMB A;  4DXC A;  1A7L A;  1OQH A;  5ICQ A;  4GWO A;  1XVY A;  1SI1 A;  5FTI A;  3ECR A;  1XOC A;  3FV2 A;  3G7W A;  4BDO A;  3IO6 A;  4POX A;  3KEI A;  2XXY A;  2RIN A;  2OWS A;  5H8H A;  1JVY A;  3FAT A;  4F18 A;  3USD A;  1GVC A;  3TZA A;  1POT A;  4F1V A;  4MFI A;  3TEP A;  4F39 A;  4MLQ A;  1QUL A;  3IOW A;  3MBP A;  4NF5 B;  1MH4 A;  1MY0 A;  3E9X A;  1MRP A;  4IO6 A;  3PD9 A;  2Q2C A;  3O6I A;  2XXT A;  4E0W A;  3F11 A;  3VVD A;  1B05 A;  3EHS A;  1B2H A;  3RY3 A;  4ND9 A;  1NH7 A;  4LVQ A;  4NF4 A;  3OEM A;  5BUU A;  2WKY A;  1SI0 A;  1MXU A;  2R9J A;  1US5 A;  3C4M A;  2ZYN A;  5L8D A;  2I4C A;  5ISU A;  2F78 A;  1B5J A;  1B3H A;  4G68 A;  2PYY A;  1Y3Q A;  2ESN A;  3H7M A;  5AA1 A;  2I0B A;  1AL3 A;  2VP1 A;  3SET A;  4OES A;  1LCF A;  3H6W A;  1JNF A;  3MC2 A;  2O84 X;  3ILU B;  4PFY A;  1SBP A;  3SEY A;  4G4P A;  1NKX A;  2OBG A;  4N6P A;  4UA8 A;  1UTB B;  5EHS A;  2HQ0 A;  3VDF A;  2QMW A;  2ZNS A;  4EF2 A;  3UIF A;  4JWX A;  2Y7R A;  1TFD A;  3IB1 A;  4JSD A;  4Q5T A;  1BIY A;  2D21 A;  4GXA A;  1B3F A;  4YKK A;  4NF8 B;  1M5D A;  4OZ9 A;  3IAZ A;  2UVJ A;  3M8U A;  3MWB A;  3DM0 A;  3SKP A;  1UQW A;  3H6T A;  1SVX B;  1B4Z A;  1IIT A;  4KCD A;  2LAO A;  1B0L A;  3PPQ A;  4LZ8 A;  3MVZ A;  3VV5 A;  4F2Q A;  5AA2 D;  1M5B A;  4OEN A;  4C1T A;  4N07 A;  3U93 A;  3GLB A;  4ELR A;  4QF9 A;  5H8H B;  4KR5 A;  2NOO A;  3MZB A;  1EZ9 A;  1I6A A;  3MZ9 A;  4QSE A;  4OWD A;  3LUY A;  4GVO A;  4IGR A;  3PUZ E;  3B7D A;  3CG1 A;  1B52 A;  4LA9 A;  3FIR A;  3C9H A;  1N76 A;  3DP8 A;  3B6T A;  1FTM A;  1NNT A;  3KJ7 A;  2F6G A;  1R6Z A;  3PPP A;  4L17 A;  3C31 A;  1P99 A;  2RC8 A;  4G68 C;  3HO7 A;  4RPO A;  4ZEF A;  2BJJ X;  3JYR A;  3T22 A;  4OQO A;  3PGF A;  4EQB A;  1B46 A;  1MY3 A;  1EZP A;  1J1N A;  4NF4 B;  1A55 A;  1H45 A;  4KQP A;  5DEX A;  4DXB A;  3QYT A;  4Q30 B;  4IO2 A;  4ZED A;  4OET A;  1EZO A;  2I6E A;  3D4G A;  4DE8 A;  1MPC A;  3MW0 A;  3QUJ A;  4DDD A;  4WXJ A;  3KN8 A;  4G68 B;  4WEP A;  1IEJ A;  2VGQ A;  2DWA A;  5AA4 A;  2Q88 A;  3W15 C;  4F22 A;  1HSE A;  3TCH A;  4NWC A;  3RTW B;  5F7V A;  1SYH A;  1GV8 A;  1ZIU A;  3KFM A;  4U1Z A;  4PP0 A;  1MQI A;  2UVI A;  3V8X B;  2F6P A;  3RNN A;  1Y3P A;  1SDX A;  3MP6 A;  3S9N C;  1BTJ A;  2H99 A;  1LLS A;  3FZV A;  3Q26 A;  2FA7 A;  4QHQ A;  4JWY A;  4IY5 A;  3K1M A;  3TKD A;  5DVJ A;  2DE4 A;  2UVG A;  1RYO A;  2ZYO A;  5I58 A;  2F97 A;  3EF7 A;  2V3U A;  3HST A;  1UIU A;  2Q9T A;  3PPN A;  4H6D A;  4EXL A;  5B70 A;  4YKI A;  1P1N A;  4QSC A;  3U92 A;  4F3S A;  4P0G A;  2Q8J A;  3ZS6 A;  4O3B A;  1N7W A;  1QUI A;  2I49 A;  2RC7 A;  4G8N A;  2P2A A;  1LBC A;  2XD2 A;  5FHO A;  3OEL A;  3LR1 A;  4YIC A;  3KGC A;  4FEC A;  1OLA A;  5B7D A;  5JTY A;  2R6G E;  2REJ A;  1PB7 A;  5I59 B;  4TQU Q;  1VFE A;  4QFN A;  4H65 A;  4I62 A;  4F31 B;  5EHM A;  5CM6 A;  2PVU A;  1D9Y A;  3K00 A;  3R7X A;  2RC9 A;  3KSX A;  1PDA A;  3OEN A;  2D5W A;  3SEW A;  3K1P A;  2REG A;  1B7U A;  4Q0C A;  1LB8 A;  3TOD A;  1IXC A;  4FEB A;  2XX8 A;  1B3E A;  3G3G A;  3N94 A;  4AQ4 A;  5FTH A;  2DS9 A;  4POW A;  3TTM A;  3RUM A;  2DE3 A;  2A5T A;  3OSR A;  5DEX B;  2VHA A;  2HEU A;  3K1N A;  1DTZ A;  3TPA A;  5AA2 A;  2I3V A;  1P1U A;  3T66 A;  2AIX A;  5AA3 A;  1B6H A;  4GF8 A;  1WOD A;  5AA4 B;  1LB9 A;  3IK6 B;  2O6A A;  3OD7 A;  3JV9 A;  2G29 A;  1PEB A;  2DWJ A;  4XKN A;  1Q1K A;  2F34 A;  2YJP A;  1ZMG A;  4U21 A;  3MVY A;  4N13 A;  4R6K A;  4KYE A;  1USY H;  3G3H A;  3MQ9 A;  2XX9 A;  1TT1 A;  2I4B A;  1DPE A;  2XXP A;  3GBB A;  4WKM A;  2NXO A;  3CFL A;  4DXU A;  2ONK E;  3UA8 A;  1EU8 A;  2O68 A;  1ATG A;  2OCU A;  5TP9 A;  3O66 A;  2H25 A;  5I58 B;  1MY4 A;  3HPI A;  2F7B A;  2R71 A;  1QUK A;  1Z7M E;  4YB6 A;  3I3V A;  5JK4 A;  4IO7 A;  2DVC A;  5H8N A;  4YAH X;  5L9M A;  3SDF A;  1ZTY A;  2QRY A;  1A8F A;  3L6H A;  5J1D A;  2Z8E A;  2XXH A;  2ZXT A;  5TPA A;  1MPB A;  2I58 A;  1URS A;  4GQO A;  1M5F A;  1I6B A;  4H5F A;  3T9V A;  4RNS A;  4R74 A;  3C35 A;  1TXF A;  2O1L A;  4LAT A;  1Y4C A;  3HN0 A;  5JTY B;  2QJE A;  1MY1 A;  3RLF E;  4GIZ A;  4KPT A;  1URD A;  3TCG A;  4MF3 A;  3KZG A;  2XX7 A;  3TDJ A;  1MS7 A;  4U22 A;  2H5Y A;  4LON B;  1N3W A;  2X7P A;  4OEU A;  4GL8 A;  2PX1 A;  1UTH A;  1LAH E;  4FIM A;  4IO5 A;  5H8S A;  4DCX A;  3U72 A;  4AB6 A;  5KZT A;  3IJO B;  3G3I A;  4QRZ A;  1NNK A;  1OIB A;  4RY1 A;  3O28 A;  2Z8D A;  3C33 A;  4ZEB A;  1ZJL A;  4M4G A;  4X48 A;  3RGY A;  2A5T B;  3A3C A;  1WDN A;  1B51 A;  3P7I A;  5H8F A;  1D4N A;  1AIV A;  4JSO A;  4ZEK A;  4E0X A;  5AA2 B;  1KWH A;  1BKA A;  1EH3 A;  2QS1 A;  3E3K A;  5IAI A;  1S50 A;  3DP4 A;  3IOR A;  3T9U A;  4U2R A;  4ZEC A;  3FVG A;  3O6H A;  1D3K A;  2THI A;  4BDQ A;  1OMP A;  2YPN A;  3I6V A;  4R2F A;  3FVK A;  3O6G A;  3S4U A;  3BFT A;  1ZBM A;  3PMX A;  3GZG A;  3THI A;  1ANF A;  4ZZE A;  4XIG Q;  3W9W A;  3LSX A;  1N84 A;  1R9Q A;  1LFH A;  4R72 A;  2QMX A;  2UVH A;  3H4Z A;  5I57 A;  4IGT A;  3WAE A;  1Z7N E;  5L9O A;  5ITO A;  1MPD A;  1ELJ A;  2YLN A;  3KN7 A;  1GR2 A;  5KDT A;  3K6W A;  4O3C A;  4OVJ A;  5TP9 B;  1JVX A;  3IJX B;  4I8C A;  4YB7 A;  1T0K A;  2F7C A;  4NED A;  4F3P A;  3V5A A;  1MQJ A;  4XKQ A;  4LZ7 A;  3UN6 A;  3OSQ A;  1IZ1 A;  5H8N B;  4F1U A;  5K2Y A;  2V93 A;  1NH8 A;  2VD2 A;  3UGW A;  1JET A;  3N6U A;  3ZKK A;  2DWH A;  1F9B A;  3GXA A;  5TPA B;  1P1Q A;  3CSB A;  4F29 A;  3VLU A;  4IO4 A;  2GHB A;  3M3K A;  1N04 A;  2DQV A;  2E1S A;  3RPW A;  3K2D A;  3TTN A;  4OMB A;  3EN3 A;  2DVZ A;  5CMM A;  1SYI A;  4H8J A;  1LFG A;  4ZEI A;  2FYI A;  1JW5 A;  5ELV A;  2O1M A;  4NWD A;  2VD3 A;  1AH5 A;  1UTH B;  3MAM A;  4IY6 A;  4P11 A;  1O7T A;  3PMV A;  4H8I A;  3IO4 A;  4THI A;  3LSL A;  5CRY A;  4R9G A;  1MM7 A;  2O7U A;  2X26 A;  1I69 A;  1IQ7 A;  3S2V A;  5ICT A;  3VVE A;  2H9B A;  1B1X A;  4GRK A;  5H8F B;  4LZ5 A;  2XHD A;  5CMC A;  3VLV A;  2ANJ A;  1XS5 A;  3ONM A;  2ALU A;  2I3W A;  3TTR A;  3LSW A;  3N6T A;  2ZYK A;  3HHG A;  2OJT A;  3FVN A;  1FQD A;  2F7A A;  4KHZ E;  3I5O A;  2HFB A;  4EQ7 A;  1FTO A;  1QW0 A;  3VE1 B;  2Y7I A;  4KD5 A;  4YB5 A;  4TLL B;  2M8C A;  3FAS A;  3QIM A;  3KBR A;  4ZDM A;  3W9V A;  4ECF A;  4HW8 A;  1UIV A;  1JEV A;  4QFK A;  5I57 B;  1Y4T A;  5M2V A;  1JQF A;  1FQF A;  4ZZA A;  1JEU A;  5DTB A;  5KDT B;  4KYD A;  3TCF A;  3OO6 A;  4GXS B;  4GD5 A;  2DWI A;  2P0S A;  4HTG A;  2F5X A;  5FHN A;  4XTC Q;  1SW4 A;  1FTK A;  1A54 A;  1Y1Z A;  4QSD A;  1NNF A;  1LAG E;  1XC1 A;  4FED A;  2KLF A;  1DTG A;  4Q8R A;  1IIW A;  2F8D A;  1FQA A;  3FUZ A;  3R6U A;  3KOT A;  2RCA A;  3IR1 A;  1BP5 A;  1JW1 A;  4ELP A;  1MXY A;  3V89 B;  1OVB A;  1TFA A;  2NVU B;  4U4X A;  5I2N A;  3CVG A;  2O51 A;  1P1O A;  2DP8 A;  3ODB A;  2CMO A;  5EYF A;  4ZE8 A;  4X1B A;  1OLC A;  5DVF A;  5HBC A;  3CIJ A;  4U1O A;  4LQ5 A;  5JEI A;  5DYH A;  2O69 A;  2ONS A;  1FQE A;  2B65 A;  2V84 A;  5CMB A;  5DT6 A;  4NTL A;  3TQL A;  4EF1 A;  2QL3 A;  3C32 A;  3T96 B;  2D3I A;  3UOR A;  1ZU0 A;  4HCY A;  3HHF A;  4NF6 A;  3PPR A;  1FQC A;  3K6X A;  5I56 A;  4G77 A;  4C1U A;  1VFD A;  1LBB A;  4RYA A;  1DMB A;  5LOM A;  1MQH A;  3O9P A;  4RPN A;  1S9T A;  3V83 A;  2GHA A;  4JXI A;  3G3J A;  3TQW A;  2B3F A;  3G3K A;  1B32 A;  4G8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...