3G3KA

Crystal structure of the glur6 ligand binding domain dimer i442h k494e k665r i749l q753k e757q mutant with glutamate and nacl at 1.24 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
253
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTHLGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKRSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITLAILKLQEQGLHMMKEKWWRGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 88
structure length 253
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3kA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3kA02
4PP0A 2R6GE 3G3FA 2ZYOA 1Y3NA 3GXAA 5JTYA 4MFIA 2I48A 2DWIA 3O9PA 1MM6A 3S9LC 4ZEIA 3G3KA 1T0KA 3TZAA 4RJZA 3TQWA 2E1SA 3H6VA 3IOWA 4G4PA 4KHZE 3BKIB 4U4XA 3CVGA 2Z8FA 3KGCA 1LAGE 2HZKA 2O51A 2OK2A 3DP8A 2Q8JA 3KG2A 2ONRA 4R9GA 3USDA 2F6GA 4KR5A 1F9BA 3TCFA 3O6GA 5H8FA 2ZNSA 3FVOA 4GWOA 5H8HA 1B1XA 1R6ZA 4OQOA 2UVHA 2DSFA 2KLFA 3TPAA 5A5XA 3K00A 3TCGA 1H45A 1S9TA 3IJXB 3CRBA 2ALUA 1Y4TA 3FJGA 3FXUA 5LOMA 5I2NB 1ZTYA 2UYFA 4NF5A 5JK4A 3VVEA 1DOTA 1NKXA 4PQJA 4C1TA 3KN3A 3H6WA 1Y4CA 2GRVA 3SEXA 5I58B 3A3UA 5TPAA 2UVGA 4H5GA 4OETA 5H8HB 1FQEA 2Y7RA 4PFYA 2Q2AA 3TUSA 1XVYA 4WXJA 1HSLA 4JDFA 1B4HA 2G93A 4Q30B 4QSEA 3PUYE 3FVNA 2PT1A 3U92A 4LZ7A 2DWAA 3I3VA 4AQ4A 3D4GA 1B52A 3HN0A 4YB5A 2O84X 5I59B 4EQBA 2RINA 2XX7A 4IO5A 4ZEKA 5H8QA 1O7TA 3UN6A 2H5YA 5DVJA 2F35A 2DE4A 1LAXA 3MZBA 3QXMA 1LFGA 2Q88A 1XHYA 1A99A 1R9QA 3PUWE 2IA4A 4N13A 5TP9B 4U2RA 3P7IA 1P99A 3ZKKA 1Y1ZA 2F36A 1UQWA 1NL5A 2Y7PA 1BP5A 3M8UA 3Q27A 3MP6A 1B0HA 3T93B 4BLAA 1A7LA 1PDAA 3SETA 3DM0A 4LATA 5F7VA 1GR2A 3MPLA 4F3GA 1OQHA 4LQ5A 3IOVA 3T9VA 1PEBA 1DTGA 2V3QA 5HBCA 5I84A 4R2BA 2D21A 3CI8A 4OVJA 2XX8A 5AA2A 4MLQA 3TMGA 4ZZAA 3C4MA 1UTBA 2Q89A 1O63A 1VFEA 1RYXA 1US5A 2HFBA 3K4UA 1TXFA 4H8JA 1JVXA 4G8NA 1II5A 3OEMA 1DSNA 2XXHA 3M3FA 4GOTA 3K1NA 3VLWA 1M5BA 5KDTB 1WDNA 4RYAA 4G68C 1EU8A 1UTBB 5AA3A 2H9BA 4LP2B 2CMOA 4ONYA 3O2AA 1USYE 3SESA 1QUKA 1MY1A 3OXNA 3MJNA 3OSRA 1ZIUA 4YZZA 3B7DA 3MBPA 1TFDA 3HHGA 4EQ9A 5FHMA 5CBSA 2ABHA 2XXYA 1MG1A 2ONKE 2VGQA 1GTKA 1QUIA 1BLFA 4POXA 1JW4A 1B58A 4M1VA 5DEXA 1H43A 4K3FA 5I2KA 3C35A 1A40A 4H8IA 1SW4A 2XXRA 3VXBA 4UACA 3OENA 3SEUA 3MVWA 2DWHA 3I6VA 3KN7A 4P11A 3UGWA 4HCYA 3TTLA 3B6QA 4F22A 3H6TA 5I57A 4LUBA 2I4CA 4NF4B 3FV1A 5ICQA 4YB6A 5KZTA 1P1NA 3C33A 5DEXB 4GL0A 4F31B 3A09A 2PVUA 3E9XA 2CZLA 2A5SA 3O97A 1TWYA 2QMWA 3ILUB 3O6HA 4I9DA 4HCWA 4Q8RA 2DS9A 1A54A 1M5DA 1LB9A 2QS2A 1US4A 4KI0E 1FTKA 4WEPA 4DXUA 1I6AA 2F7BA 2QS1A 1IQ7A 3T9XB 1B3FA 4ZEFA 2XX9A 3KJ7A 3O66A 3S9EA 5IKBA 1JQFA 4BDRA 3MAMA 4KQPA 3O28A 1QVSA 2OLBA 1B46A 1SI0A 2Q9TA 5J1DA 4IO2A 1MQIA 2QRYA 4BDQA 3ZS6A 4ND9A 1RKMA 2NXOA 2B65A 4F39A 2AL4A 2DQVA 1FCKA 2I4BA 4FEDA 4R6KA 3OELA 1UTHB 4MH5A 2XXWA 3TAJA 4XIGQ 4NWCA 3KZGA 4RK2A 1MS7A 3KOTA 3W9WA 2UXAA 1LCFA 4G77A 2UVIA 2F34A 2I49A 3VVDA 5F1QA 1YPNA 4F2QA 1NNFA 3LSWA 2ZNTA 3Q28A 1IIWA 2O6AA 2REGA 1MQHA 2Y7IA 3DP4A 4ZE8A 3K02A 4F3BA 1SD3A 3HSTA 1OLAA 3RT8A 1B51A 3IB0A 2I6EA 4YICA 4XXUA 4O3BA 4PETA 2F7CA 3FJ7A 3MQ9A 2DE2A 2QPQA 4FE8A 3T66A 4BDOA 3EHUA 4PFUA 1PBPA 3E4RA 4IY6A 1NMUA 4OFOA 4PFWA 4F3SA 4U23A 4OZ9A 2HAUA 2PT2A 3K1MA 4DDDA 3K1PA 2DOJA 3IX1A 3SDFA 2UVJA 2XXUA 1N3XA 5FTHA 4H67A 4LVQA 2XD3A 4PFTA 2FA7A 4RPNA 4I8CA 4JWXA 2FYIA 3OO6A 2Y7KA 1FTJA 1SW2A 5L9MA 3C9HA 3MUQA 4Z7EA 3PPNA 4EF1A 1IEJA 3FXQA 4NMYA 4RK9A 4LZ8A 1Z7ME 4YAHX 5I2NA 4IGRA 3Q26A 3K2DA 4KYDA 4BDNA 3FXRA 1IZ1A 3V5AA 1Y3QA 1TT1A 2H4IA 2E0SA 2GHBA 1XVXA 2O1LA 4GQOA 2HZLA 5I58A 1ANFA 3MZ1A 1Q1KA 3QUJA 2XXTA 3QUFA 3RTFB 5EHMA 2V84A 2XXPA 2ZYMA 4XKPA 2YJPA 2OWSA 3H6UA 3LR1A 3QAXA 4LZ5A 4QFLA 3OO8A 3MW0A 1AIVA 1Z7NE 1MY0A 2Y7WA 1MQJA 2V3TA 1GGGA 4OHNA 3TEPA 3BFTA 1FW0A 1N7XA 3ECRA 1EZ9A 2RC9A 4G2ZA 1LCTA 5JEIA 4LA9A 3FGSA 5I59A 4FIMA 2P0SA 3SEVA 4DCYA 3KSJA 4Z0IA 3PMWA 1N7WA 4QHQA 1HSJA 1ELJA 4OXVA 1XOCA 1YAEA 1AL3A 4O3AA 1JEUA 3CG1A 3MZ9A 4Q0CA 3N94A 3SKPA 5TP9A 3LSFB 2XXIA 1FQFA 4NTLA 3CSGA 4H1XA 2DWJA 3S2VA 5DYHA 4IO3A 3G3HA 3GBBA 4MBPA 2PX1A 2A5TB 4JWOA 3BFUA 3FVGA 1SYHA 3O29A 2OCUA 1QJMA 2R71A 4KCCA 2Y84A 1EZPA 2I0CA 3MP1A 3IL1B 3U72A 3OO9A 5AE4A 2F97A 1Y9UA 3IO4A 1ZLQA 3K6VA 3CFLA 3VLVA 4E0XA 1N3WA 1FQAA 2XXVA 3KN8A 3KFMA 3T96B 4ELRA 1VSOA 3UIFA 4R74A 2GHAA 4ELPA 5KDTA 1QULA 3EQ1A 1PB7A 5DVIA 1NFTA 5CC2A 1MY3A 3RPWA 4NF6A 5CI5A 1USYH 2OBGA 3HO7A 3OMBA 1Y20A 3FVKA 4HS7A 1I6QA 5DTBA 1OMPA 3R26A 1B3HA 2I3VA 3RNNA 4F19A 1MQDA 3IB1A 3G7WA 3U1OA 3K0VA 3LSXA 4ZZEA 5IAIA 4NF6B 2VHAA 1OIBA 5FHOA 2FNCA 4ELOA 1B9JA 1M5FA 1B7UA 1PB8A 1N84A 4U21A 1URGA 1Y3PA 3MWBA 1FQCA 4NF4A 3VE1B 5H8SA 2YLNA 4ZE9A 5CMKA 4IO6A 2QS4A 3K6XA 3S4UA 4QFNA 4HW8A 1AH5A 3C32A 1TFAA 2HXWA 1LBCA 4GXSB 4N6PA 2XXXA 2AIXA 3FUZA 3LC8A 2H98A 2ZMBA 4F3PA 1SW5A 4DLDA 2X7PA 3S9MC 4PE5B 1B1HA 1NH8A 3KSXA 3ZSFA 1FQBA 1A8FA 3T9HB 1J1NA 3ZKLA 1P1UA 5FTIA 3TTRA 4JSOA 5H8NB 3JYRA 2F7AA 3IB2A 3PPRA 1MPBA 5ITOA 3Q29A 3JZJA 1B5HA 1H44A 4RA1A 1B3LA 1B3GA 3HPIA 1XS5A 4XKQA 4X48A 1IITA 4I62A 3IOTA 2Z8DA 1P1QA 3TTNA 3ONMA 1D9VA 1NNTA 4ZEDA 4JXIA 3L6HA 3L6GA 3U94A 2GH9A 4YKIA 2OJTA 4ESWA 1PB9A 3R7XA 3D4CA 2AL5A 1MXXA 4H5FA 1UTHA 1P1WA 3C31A 3RUMA 4YMBA 2DVCA 2X7QA 3PD8A 1B5IA 4TQUQ 2IEEA 4DXBA 4QSDA 2DXYA 4JWYA 1HSEA 3WAEA 3QIMA 1UIUA 4IO7A 2H25A 3U8QA 4F18A 4IGTA 4KFQA 3E13X 3EHTA 3CR9A 4G68B 4GF8A 5K2YA 3O6IA 1S50A 4GXAA 4TLMB 3EN3A 3TDJA 3FIRA 4GRKA 2ZYNA 3G3JA 1MH4A 1PBQA 3K6WA 1B32A 3UORA 5KCJA 1MXVA 1OQGA 1DPPA 4KYSA 5DT6A 2QSXA 1MM7A 4U22A 1ATGA 3MVXA 2QMXA 1B05A 3IK6B 4IB2A 3PPQA 1MRPA 4H65A 4LQ2A 3VFJA 3TYHA 2I0BA 4O3CA 1YTVA 1JW1A 3V89B 3VXCA 3K01A 5ELVA 1DTZA 4IO4A 5KCJB 4KCDA 2HAVA 2B3FA 1Y1MA 4FECA 2VD3A 1IXGA 2DP8A 2O7IA 4EXKA 3TQLA 5B70A 1AOVA 3KJTA 3THIA 1UIVA 4JB7A 1QKAA 3PGFA 5ISUA 1D3KA 4RNSA 4KPTA 2NWJA 2UYEA 3RY3A 1MXUA 1FTMA 1LSTA 3TFLA 1LAFE 3TTMA 3IJOB 4AB5A 2ESNA 3TCHA 4QFPA 4F1UA 3HV1A 2NVUB 3CFXA 1YCJA 3KOSA 4C0RA 5K2XA 2XD2A 4DE8A 4QFOA 2HQ0A 4E0WA 3VDFA 4G8MA 3QSLA 3CFZA 1POY1 3SERA 3T9UA 4IY5A 2M8CA 4C1UA 4OFJA 1N76A 4YB7A 2PYYA 3EPEA 3FJMA 2DVZA 2QS3A 4FORA 3UP9A 3I5OA 3N26A 3F11A 4DZ1A 2ZXTA 1R1NA 5TU0A 2PMSA 4BDLA 3U93A 1MDP1 1QW0A 4RPOA 5CMMA 3G3GA 2Z22A 1SI1A 1WVJA 1D4NA 4FATA 1JETA 1SBPA 5JTYB 1LLSA 1XC1A 2RKMA 4QF9A 5EHSA 1MY4A 3E3KA 4HTGA 1B5JA 3PD9A 2DE3A 3V83A 4XKNA 4QRZA 4P0GA 4ZS9A 4EXLA 2WKYA 4GVOA 1AMFA 2D5WA 5FHNA 1A8EA 2RCBA 4H0WA 2A5TA 3R6UA 4ZDMA 1MXWA 1MPCA 1Q35A 4NF8A 1MDQA 5H8FB 2HCAA 3HHFA 1BKAA 3OEKA 4NWDA 3B6TA 1XT8A 4AB6A 3N5LA 2X26A 4QSCA 4L17A 2RC7A 5A5XB 4POWA 1JEVA 1ZU0A 4Q5TA 4FEBA 2BJJX 4GLIA 1EZOA 4NF5B 4OTEA 2OZZA 2XHDA 2O1MA 3SEYA 3RGYA 1FTLA 1PC3A 3FZVA 1DPEA 3RT6B 2THIA 3H7MA 4NF8B 5TPAB 4EQ7A 4YU0A 1LBBA 4I1DA 4XKRA 3TKDA 4R72A 1ZMGA 3H06B 1JVYA 2ANJA 1N0TA 3CSBA 1A55A 2V93A 5ICTA 4KD5A 1FTOA 3M3KA 1SW1A 2XXQA 4FAJA 3PV0E 1M5CA 2W7YA 3IAZA 4NE4A 3W15C 1OLCA 1MH3A 1MXZA 3PMXA 4H6DA 1BTJA 1NNKA 4OEUA 3UA8A 1SQYA 5H8QB 3TTKA 1OVBA 3B6WA 3EF7A 4NEDA 2DXRA 2REJA 2O69A 3CIJA 1SVXB 4R73A 4YMAA 1EH3A 4X1DA 1MQGA 3TODA 3OO7A 1O64A 3PPOA 4OWDA 5L9OA 4U1ZA 4R2FA 5I56A 1D9YA 1ZBMA 4TLLB 2F6PA 1GVCA 3ILTB 2HEUA 2V25A 3WAFA 1KWHA 5L9SA 5HPQA 3PMVA 1B40A 1IXCA 4XTCQ 3LUYA 3T22A 1ZKBA 1LFHA 3TELA 2D3IA 5AA2B 3PPPA 5CBRA 3N6UA 5CM6A 4RY1A 3IOUA 5AA1A 5AA4A 5I56B 4ZEBA 1CB6A 1OVTA 4F1VA 3RLFE 2P1SA 3LSLA 1P1OA 2F5XA 1M5EA 2B3BA 3FATA 1LB8A 3IO6A 4JBZA 1MPDA 1B2HA 4GFRA 5H8NA 3V8XB 4ISUA 3H03A 1LGBC 3RTWB 3OD7A 1LFIA 4WEDA 3PUZE 2NOOA 4F1YA 3MVYA 3H4ZA 4BDMA 5DVFA 4GIZA 5AA4B 3C34A 1JNFA 3S9NC 4ESXA 3DLNA 5EYFA 2I3WA 3EHSA 3W9VA 1H76A 4GL8A 2O7UA 3IR1A 4OEVA 1NNPA 5B7DA 2F8DA 2P2AA 4EUOA 3MVZA 4YKKA 4N07A 2QL3A 4KYEA 2OWTA 5L8DA 5HM4B 1B4ZA 4MLVA 4JSDA 3MC2A 5I2KB 3RQTA 4U1OA 2QJEA 3M3LA 4F2OA 4U4SA 3HCQA 4R6YA 1VFDA 5BUUA 3IORA 1I6BA 3AXFA 2DYXA 1IXHA 4WKMA 3PU5A 5I57B 3LBSA 2VD2A 3KBRA 4EF2A 1B7HA 1VR5A 4G68A 3C36A 4F29A 4UA8A 4RXLA 3GZGA 1BIYA 4DIGA 2RCAA 3OOAA 3QK6A 5CRYA 3BBRA 4OESA 1URSA 2ZNUA 1L5TA 2O68A 2NUVA 3SEWA 3N6TA 4LONB 3PUXE 2PBWA 1H3DA 4FJPA 2VP1A 2Z23A 2GFEA 4MF3A 3VVFA 3OSQA 4QFKA 1B0LA 2V3UA 3K6UA 3UK4A 1B7ZA 2RF1A 1QUJA 4R75A 4P0IA 4M4GA 2H99A 1GV8A 1URDA 3CG3A 2Z8EA 1LAHE 2I58A 1S7YA 3DP6A 1JW5A 4OYVA 1DMBA 4ECFA 3H3GA 4ZECA 1N04A 2YPNA 4EDPA 4THIA 4DCXA 1MXYA 4OFLA 1IUDA 1IXIA 4X9TA 3VLUA 1B3EA 2LAOA 5ITPA 4GD5A 2F78A 1WODA 1NH7A 3G3IA 2R9JA 2VOZA 1SDXA 3ODBA 4TOZA 1I69A 3FASA 1VE4A 4R9FA 2ZYKA 2RC8A 1ZJLA 3PUVE 2AYSA 4ELQA 2G29A 1CE2A 1SYIA 1POTA 4X1BA 1QKBA 4YKPA 2ONSA 5BWJA 4YKJA 3JV9A 1MY2A 4G8HA 3GBAA 3Q25A 1FQDA 3KEIA 3FV2A 3QYTA 3MP8A 5AA2D 1RYOA 4DXCA 1R9LA 3VV5A 3RN8A 4OENA 1B6HA 3DELB 3GLBA 3MPKA 5CMCA 4OMBA 5CMBA 5M2VA 3FD3A 4R6HA 4OERA 3A3CA 2Q2CA
chains in the Genus database with same CATH superfamily
4PP0A 2R6GE 3G3FA 4P1LA 2ZYOA 1Y3NA 1FBEA 3GXAA 5JTYA 4MFIA 2I48A 2DWIA 4NF0A 3O9PA 1MM6A 3S9LC 4ZEIA 5A5LA 3G3KA 1T0KA 3T1BA 3TZAA 4RJZA 3TQWA 2E1SA 3H6VA 3IOWA 4G4PA 4KHZE 3BKIB 4U4XA 3CVGA 2Z8FA 3KGCA 1LAGE 2HZKA 2O51A 2OK2A 3DP8A 2Q8JA 3KG2A 2ONRA 4R9GA 3USDA 5LTCA 2F6GA 2WYPA 4KR5A 1F9BA 3TCFA 3O6GA 5H8FA 4MEVA 2ZNSA 3FVOA 4GWOA 5H8HA 1B1XA 1R6ZA 4OQOA 4N15A 2UVHA 1IMEA 2DSFA 2KLFA 3TPAA 5A5XA 3K00A 3TCGA 1H45A 1S9TA 4GWWA 3IJXB 3CRBA 2ALUA 1Y4TA 4X04A 3FJGA 3FXUA 5LOMA 5I2NB 1ZTYA 2UYFA 4NF5A 5JK4A 3VVEA 5EQ9A 1DOTA 1NKXA 4PQJA 1NV3A 4C1TA 3KN3A 3H6WA 1Y4CA 2GRVA 3SEXA 5I58B 2ZZVA 3A3UA 5TPAA 2UVGA 4H5GA 4OETA 5H8HB 1FQEA 2Y7RA 4PFYA 2Q2AA 3TUSA 3LV0A 1XVYA 4WXJA 1HSLA 4P9KA 4JDFA 1B4HA 2G93A 4Q30B 4QSEA 3PUYE 3FVNA 2PT1A 4GX4A 3U92A 4LZ7A 2DWAA 3I3VA 4AQ4A 3D4GA 4MIJA 1B52A 3HN0A 4YB5A 2O84X 5I59B 4EQBA 2RINA 3BIHA 2XX7A 4IO5A 4ZEKA 5J16A 5H8QA 1O7TA 3UN6A 2H5YA 5DVJA 3BIGA 4PGNA 4GWYA 4I3EA 2F35A 2DE4A 1LAXA 3MZBA 3QXMA 1LFGA 2Q88A 1A99A 1XHYA 1R9QA 3PUWE 2IA4A 4N13A 5TP9B 4U2RA 3P7IA 1P99A 3ZKKA 2OX3A 1Y1ZA 2F36A 1UQWA 1NL5A 2Y7PA 1BP5A 3M8UA 3Q27A 3MP6A 1B0HA 3T93B 4BLAA 1A7LA 2F3DA 1PDAA 3SETA 3DM0A 3MSTA 4LATA 2FVZA 5F7VA 1GR2A 3MPLA 4F3GA 1OQHA 4LQ5A 3IOVA 1FJ9A 3T9VA 1PEBA 1DTGA 2V3QA 5HBCA 5I84A 4R2BA 2D21A 3CI8A 4OVJA 2XX8A 5AA2A 4MLQA 3TMGA 3HFUA 4ZZAA 3C4MA 1LBZA 1UTBA 4JVDA 4HXVA 2Q89A 1O63A 1VFEA 1RYXA 1US5A 2HFBA 3K4UA 1TXFA 4H8JA 2HHMA 1JVXA 4G8NA 1II5A 3OEMA 1DSNA 2XXHA 3M3FA 4GOTA 3K1NA 3VLWA 3U65A 1M5BA 5KDTB 1WDNA 4RYAA 2F3BA 4G68C 1EU8A 1UTBB 5AA3A 2H9BA 5F24A 4LP2B 2HPGA 2CMOA 4ONYA 3O2AA 1USYE 4OVRA 3SESA 1QUKA 1MY1A 3OXNA 3MJNA 3OSRA 1ZIUA 4YZZA 3B7DA 3MBPA 1TFDA 3EKIA 3HHGA 4EQ9A 5FHMA 5CBSA 5ESYA 2ABHA 2XXYA 1MG1A 2ONKE 2VGQA 1GTKA 1QUIA 1BLFA 4POXA 1JW4A 1B58A 4H46A 4M1VA 5DEXA 1H43A 4K3FA 5I2KA 3C35A 1A40A 4H8IA 1SW4A 2XXRA 4P1EA 3VXBA 4UACA 2XWOA 3OENA 3SEUA 4X8RA 3MVWA 2DWHA 3I6VA 3KN7A 4P11A 3UGWA 4HCYA 3TTLA 1RDYA 3B6QA 4F22A 3H6TA 5I57A 4LUBA 2I4CA 4NF4B 3FV1A 4OVPA 5ICQA 4N4UA 4YB6A 5KZTA 1P1NA 3C33A 5DEXB 4GL0A 1EYJA 4NHBA 4F31B 3A09A 2PVUA 3E9XA 2CZLA 2A5SA 3O97A 1TWYA 2QMWA 3ILUB 3O6HA 4I9DA 1EYIA 4HCWA 4PC9A 4Q8RA 2DS9A 2CEYA 1A54A 1M5DA 1LB9A 2QS2A 1US4A 4KI0E 1FTKA 4WEPA 4DXUA 1I6AA 2F7BA 2QS1A 1IQ7A 1FJ6A 3T9XB 2WEFA 1B3FA 4ZEFA 2XX9A 3KJ7A 3O66A 3S9EA 5IKBA 2JJKA 1JQFA 2B4LA 4BDRA 3MAMA 4KQPA 3O28A 1QVSA 2KQZA 2OLBA 1B46A 1SI0A 2Q9TA 5J1DA 4IO2A 1MQIA 2QRYA 4BDQA 2VPNA 4PFIA 3ZS6A 2ZZWA 4ND9A 1RKMA 2NXOA 2B65A 4F39A 2AL4A 2DQVA 1FCKA 4XFEA 2I4BA 4FEDA 4R6KA 3OELA 1RDXA 1UTHB 4MH5A 2XXWA 3TAJA 4XIGQ 4NWCA 3KZGA 4RK2A 1MS7A 3KOTA 3W9WA 2UXAA 1LCFA 5I5PA 4G77A 1FPFA 2UVIA 2F34A 2I49A 3VVDA 5F1QA 1YPNA 4F2QA 1NNFA 3LSWA 3B50A 2ZNTA 4MCOA 3Q28A 1YXIA 1IIWA 2O6AA 2REGA 1MQHA 2Y7IA 3DP4A 4ZE8A 3K02A 4F3BA 1SD3A 2Q74A 3HSTA 1OLAA 1FPKA 1B51A 3RT8A 3IB0A 2I6EA 4YICA 4XXUA 2FIEA 4O3BA 4PETA 1XI6A 2F7CA 3FJ7A 3MQ9A 2DE2A 2QPQA 4FE8A 5IGAA 4O94A 3T66A 4MX6A 4BDOA 2CZIA 2P3VA 2CZHA 3EHUA 3MYUA 4PCDA 4PFUA 1PBPA 3E4RA 4IY6A 3KC1A 1NMUA 5DW8A 4OFOA 4PFWA 4F3SA 4U23A 4OZ9A 2HAUA 4PBHA 1IMFA 2PT2A 2PFZA 3K1MA 4DDDA 3K1PA 2DOJA 3IX1A 3SDFA 2UVJA 1JP4A 2XXUA 1N3XA 5FTHA 4H67A 4O7MA 4LVQA 5IZZA 2XD3A 4PFTA 2FA7A 4RPNA 4I8CA 4JWXA 2FYIA 3OO6A 2Y7KA 1FTJA 1SW2A 5L9MA 3C9HA 3MUQA 4Z7EA 3PPNA 4EF1A 1IEJA 3FXQA 4NMYA 4RK9A 4JVCA 1LBYA 4LZ8A 1Z7ME 4YAHX 5I2NA 1FPDA 4IGRA 3Q26A 3K2DA 4KYDA 4PAKA 4BDNA 3FXRA 1IZ1A 3V5AA 4N17A 1Y3QA 4N91A 1TT1A 2H4IA 2E0SA 2GHBA 1XVXA 2O1LA 4GQOA 2HZLA 5I58A 1ANFA 3MZ1A 1Q1KA 3QUJA 2XXTA 3QUFA 3RTFB 5EHMA 2V84A 1DCUA 5IZ3A 2XXPA 2ZYMA 5LDZA 4XKPA 2YJPA 2OWSA 3H6UA 3LR1A 5EQAA 5ET7A 3QAXA 2R8TA 4LZ5A 4QFLA 3OO8A 5T3JA 1NI9A 3MW0A 1LBWA 1AIVA 1Z7NE 1FBFA 1MY0A 2Y7WA 1MQJA 2V3TA 1GGGA 4OHNA 3TEPA 3BFTA 4P3LA 1FW0A 1N7XA 3ECRA 1EZ9A 4P47A 2RC9A 4G2ZA 1LCTA 5JEIA 4LA9A 5IZ3B 3FGSA 5I59A 4FIMA 2P0SA 3SEVA 4DCYA 3KSJA 4Z0IA 1IMAA 1N7WA 3PMWA 4QHQA 1HSJA 1ELJA 4OXVA 1XOCA 1YAEA 1AL3A 4O3AA 1JEUA 3CG1A 2WBBA 5ET8A 3MZ9A 4Q0CA 3N94A 3SKPA 2Q8MA 5TP9A 3LSFB 2XXIA 1NV6A 1CNQA 1FQFA 4NTLA 3CSGA 4H1XA 2DWJA 3S2VA 5DYHA 4IO3A 3G3HA 3GBBA 4MBPA 2PX1A 2A5TB 2QVUA 4JWOA 1FBDA 3BFUA 3FVGA 1SYHA 3O29A 2OCUA 1QJMA 1NV4A 2R71A 4KCCA 2Y84A 1EZPA 2I0CA 3MP1A 1NV7A 3IL1B 1FPBA 3U72A 3NOHA 3OO9A 4AS4A 5AE4A 4DI4B 2F97A 1Y9UA 2DDKA 1ZLQA 4MAGA 3CFLA 3IO4A 3K6VA 1N3WA 1FQAA 3KN8A 2XXVA 3VLVA 4E0XA 3KFMA 3T96B 4ELRA 2QFLA 1VSOA 3UIFA 3E78A 4R74A 1LBVA 2GHAA 4ELPA 5I3SA 5KDTA 1QULA 1AWBA 3EQ1A 1PB7A 3PTYA 5DVIA 1NFTA 5CC2A 1MY3A 4NQ8A 4QBAA 1DK4A 1QGXA 3RPWA 4NF6A 5CI5A 1USYH 5EQ8A 2OBGA 3HO7A 1NV0A 3OMBA 1Y20A 3FVKA 4HS7A 1I6QA 5DTBA 5EQ7A 1OMPA 3R26A 1B3HA 2I3VA 3RNNA 4F19A 1MQDA 3IB1A 3G7WA 3U1OA 2ZZXA 3K0VA 4GWZA 3LSXA 4ZZEA 5IAIA 4DI3D 4NF6B 2VHAA 4PGPA 1OIBA 5FHOA 2FNCA 4ELOA 1B9JA 1M5FA 1B7UA 1PB8A 1N84A 4U21A 1URGA 1Y3PA 4HE0A 3MWBA 3RPLB 1FQCA 4NF4A 3VE1B 5H8SA 2YLNA 4ZE9A 1NV5A 5CMKA 4IO6A 2QS4A 1IMDA 3K6XA 3S4UA 4QFNA 4HW8A 1AH5A 3C32A 1TFAA 2HXWA 1LBCA 4GXSB 1Q9DA 4N6PA 4NGUA 2XXXA 2AIXA 3FUZA 3LC8A 2H98A 2KR0A 2ZMBA 4N6DA 1SW5A 4F3PA 4DLDA 2X7PA 3S9MC 4PE5B 1B1HA 1NH8A 3KSXA 3ZSFA 1FQBA 4O8MA 1A8FA 3T9HB 1J1NA 3ZKLA 1P1UA 5FTIA 4N8YA 3TTRA 4JSOA 5H8NB 3JYRA 2F7AA 3IB2A 3PPRA 1MPBA 5ITOA 3Q29A 3JZJA 1B5HA 1H44A 4RA1A 1B3LA 1NUYA 1B3GA 3HPIA 3KBZA 1XS5A 4XKQA 1FTAA 4X48A 1IITA 4I62A 3IOTA 2Z8DA 1IMCA 1P1QA 3TTNA 5EYGA 3ONMA 1D9VA 1NNTA 1IMBA 4ZEDA 4FBPA 4JXIA 3L6HA 3L6GA 3U94A 2GH9A 4YKIA 2OJTA 4ESWA 1K9ZA 1PB9A 3R7XA 3D4CA 2AL5A 1MXXA 4H5FA 1UTHA 1P1WA 4NN3A 3C31A 3RUMA 4YMBA 2DVCA 2X7QA 3PD8A 1B5IA 4TQUQ 2IEEA 4DXBA 4QSDA 2DXYA 2L5VA 4HE1A 4JWYA 1HSEA 1FPGA 4PDDA 4G61A 3WAEA 3QIMA 1UIUA 4IO7A 2H25A 3RYDA 3U8QA 4F18A 4IGTA 4KFQA 2OWZA 3E13X 3EHTA 3CR9A 4G68B 1FBCA 4GF8A 5K2YA 3O6IA 1S50A 4GXAA 4TLMB 3EN3A 1G0HA 1NUZA 1D9QA 3TDJA 3FIRA 4GRKA 2Y5KA 2ZYNA 3G3JA 1MH4A 1PBQA 3K6WA 1B32A 3UORA 5KCJA 1MXVA 1OQGA 2VPOA 4HE2A 1DPPA 2QVRA 4KYSA 5DT6A 2QSXA 1MM7A 3LUZA 1ATGA 4U22A 3MVXA 2QMXA 1B05A 4MNPA 2V4CA 3IK6B 4IB2A 1FPEA 3PPQA 1MRPA 1FBPA 3KC0A 4H65A 4LQ2A 3VFJA 1FBHA 3TYHA 2I0BA 1NUWA 3SZPA 4O3CA 1YTVA 1JW1A 3V89B 3VXCA 3K01A 4KXPA 5ELVA 4PFBA 1DTZA 3CHGA 4IO4A 5KCJB 4KCDA 2HAVA 2B3FA 1Y1MA 4FECA 2VD3A 1IXGA 2DP8A 2O7IA 4EXKA 3TQLA 4N6KA 5B70A 1AOVA 3KJTA 3THIA 1UIVA 4JB7A 1QKAA 3PGFA 5ISUA 1D3KA 4RNSA 4KPTA 2NWJA 2UYEA 3RY3A 1FPJA 1MXUA 1FTMA 1LSTA 3TFLA 1LAFE 3TTMA 1DBZA 3IJOB 4AB5A 2ESNA 1LBXA 3TCHA 4QFPA 4F1UA 3HV1A 4PDHA 2NVUB 3CFXA 4JVIA 3ISPA 1YCJA 3KOSA 4C0RA 5K2XA 2XD2A 4XF5A 4DE8A 4QFOA 2HQ0A 4E0WA 3VDFA 4G8MA 3QMFA 3QSLA 3CFZA 4N81A 4PBQA 4I40A 1POY1 3SERA 3T9UA 4PTKA 4IY5A 2M8CA 4C1UA 4OFJA 1N76A 1YZ0A 4N8GA 4YB7A 2PYYA 3EPEA 4UABA 4I3YA 3FJMA 4GX6A 2DVZA 4O7IA 2QS3A 4FORA 4NG7A 3UP9A 3I5OA 3N26A 3F11A 4DZ1A 2ZXTA 1R1NA 5TU0A 2PMSA 1FPLA 4BDLA 3U93A 1MDP1 1QW0A 4RPOA 5CMMA 1NV1A 1K9YA 1BK4A 3G3GA 2Z22A 1SI1A 1WVJA 1D4NA 4FATA 4MNCA 1JETA 1SBPA 1KA1A 4AS5A 5JTYB 1LLSA 1NV2A 1XC1A 2RKMA 1INPA 4QF9A 5EHSA 1MY4A 3E3KA 4HTGA 1B5JA 3PD9A 2DE3A 3V83A 4XKNA 4QRZA 4P0GA 4ZS9A 4EXLA 2WKYA 4GVOA 1AMFA 2D5WA 4H45A 5FHNA 1A8EA 2RCBA 4GWSA 4H0WA 2A5TA 3R6UA 4ZDMA 5FBPA 1MXWA 1MPCA 4LN5A 1Q35A 4NF8A 1MDQA 5H8FB 2HCAA 3HHFA 1BKAA 3OEKA 4NWDA 3B6TA 1XT8A 4AB6A 2FHYA 3N5LA 2X26A 4QSCA 4L17A 4MJOA 2RC7A 4GX3A 2FBPA 5A5XB 4POWA 1JEVA 1ZU0A 4Q5TA 4FEBA 2BJJX 4GLIA 1EZOA 4NF5B 4OTEA 2OZZA 2XHDA 2B4MA 2O1MA 3SEYA 3RGYA 1FTLA 4GBVA 1PC3A 3FZVA 1DPEA 3RT6B 2THIA 3H7MA 4NF8B 1LEVA 5TPAB 4EQ7A 4YU0A 1LBBA 4I1DA 4XKRA 3TKDA 2XA5A 2XWVA 3A29A 4R72A 1ZMGA 3H06B 1JVYA 2PFYA 2ANJA 1N0TA 3CSBA 1A55A 2V93A 5ICTA 4KD5A 1FTOA 3M3KA 1SW1A 2XXQA 1KZ8A 4FAJA 3PV0E 3ROJA 1M5CA 2W7YA 3IAZA 4NE4A 3W15C 1YYZA 1OLCA 1MH3A 1MXZA 5I7IA 3PMXA 4H6DA 1BTJA 4MNIA 1NNKA 4OEUA 3UA8A 1SQYA 5H8QB 3TTKA 1OVBA 3B6WA 3EF7A 1FRPA 4GWUA 4NEDA 2DXRA 3GYYA 2REJA 2O69A 3CIJA 1SVXB 4R73A 1FBGA 4YMAA 1EH3A 4X1DA 1MQGA 3TODA 3OO7A 5IM2A 3IFAA 1O64A 4IR8A 5ET5A 3PPOA 4OWDA 5L9OA 4U1ZA 4R2FA 5I56A 1D9YA 1ZBMA 3RPLA 4TLLB 2F6PA 1GVCA 3ILTB 4PF8A 2HEUA 2V25A 5EYHA 3WAFA 1KWHA 5L9SA 5HPQA 3PMVA 1B40A 1IXCA 4XTCQ 3LUYA 3T22A 1ZKBA 1LFHA 3TELA 1EYKA 2D3IA 5AA2B 3PPPA 2CEXA 5CBRA 3N6UA 5CM6A 4OVQA 4RY1A 2CZKA 3IOUA 5AA1A 5AA4A 5I56B 4ZEBA 1CB6A 1OVTA 4QXDA 4F1VA 3RLFE 2P1SA 3LSLA 1P1OA 2F5XA 1M5EA 3FBPA 2B3BA 3FATA 1LB8A 3IO6A 4JBZA 4P56A 1MPDA 1B2HA 4GFRA 2FIXA 5H8NA 3V8XB 4ISUA 3H03A 1LGBC 3RTWB 3OD7A 1LFIA 4WEDA 3PUZE 4PF6A 2NOOA 4F1YA 3MVYA 3H4ZA 4BDMA 5DVFA 4NX1A 4GIZA 4PFRA 5AA4B 3C34A 1JNFA 3S9NC 4P8BA 4ESXA 4OA4A 3DLNA 5EYFA 2I3WA 3EHSA 3W9VA 1H76A 3B8BA 4GL8A 2O7UA 3IR1A 4OEVA 2HXRA 1NNPA 5B7DA 2F8DA 2P2AA 3FXBA 4EUOA 3MVZA 4YKKA 4N07A 2QL3A 2WYKA 4KYEA 2OWTA 5L8DA 5HM4B 1B4ZA 4MLVA 4JSDA 3MC2A 5I2KB 3RQTA 4U1OA 2QJEA 2XWIA 3M3LA 4F2OA 4U4SA 3HCQA 1VDWA 4R6YA 1VFDA 4OVTA 5BUUA 2WBDA 3IORA 1I6BA 3AXFA 2DYXA 2VT5A 4GBWA 1IXHA 4WKMA 3PU5A 5I57B 3LBSA 2VD2A 3KBRA 4EF2A 4XEQA 4MHFA 1B7HA 1VR5A 4G68A 3C36A 2XWKA 4UA8A 4F29A 4RXLA 3GZGA 1BIYA 4DIGA 3E79A 2RCAA 3OOAA 1KA0A 3QK6A 5CRYA 1SPIA 3BBRA 4OESA 1URSA 2ZNUA 1L5TA 2O68A 2NUVA 3D1RA 4OANA 3SEWA 4PAFA 3N6TA 4LONB 3PUXE 2PBWA 1H3DA 4FJPA 2VP1A 2Z23A 2GFEA 2GQ1A 4MF3A 3VVFA 3OSQA 1FSAA 4QFKA 1B0LA 2V3UA 3K6UA 3UK4A 2PCRA 1B7ZA 1NUXA 2RF1A 1QUJA 4R75A 4P0IA 4M4GA 2H99A 3T0JA 1GV8A 1URDA 3CG3A 2Z8EA 1LAHE 2I58A 1S7YA 3DP6A 1JW5A 4OYVA 1DMBA 4ECFA 4NAPA 3H3GA 4ZECA 1N04A 2YPNA 4EDPA 4THIA 4DCXA 1MXYA 1RDZA 4OFLA 1IUDA 1IXIA 3IFCA 2QVVA 4X9TA 3VLUA 1B3EA 2LAOA 5ITPA 4GD5A 2F78A 1G0IA 1WODA 1NH7A 3G3IA 2R9JA 2VOZA 1SDXA 3ODBA 4OVSA 4TOZA 2XXKA 1I69A 2WX9A 3FASA 1VE4A 4R9FA 2ZYKA 2RC8A 1ZJLA 3PUVE 5ET6A 2AYSA 5IZ1A 4ELQA 2G29A 1CE2A 1SYIA 1POTA 2BJIA 4GWXA 4MMPA 4X1BA 1QKBA 4YKPA 2ONSA 5BWJA 4YKJA 3JV9A 1MY2A 4G8HA 3GBAA 3Q25A 1FQDA 3KEIA 3FV2A 3QYTA 2P3NA 3MP8A 5AA2D 1RYOA 2Y5LA 4DXCA 1FPIA 1R9LA 3VV5A 3RN8A 4OENA 1B6HA 3DELB 4PE3A 3GLBA 3MPKA 5CMCA 4PAIA 2MKZA 4OMBA 5CMBA 5M2VA 3FD3A 4R6HA 4OERA 3A3CA 2Q2CA
chains in the Genus database with same CATH topology
4PP0A 2R6GE 3G3FA 2ZYOA 1Y3NA 3GXAA 5JTYA 4MFIA 2I48A 2DWIA 3O9PA 1MM6A 3S9LC 4ZEIA 3G3KA 1T0KA 3TZAA 4RJZA 3TQWA 2E1SA 3H6VA 3IOWA 4G4PA 4KHZE 3BKIB 4U4XA 3CVGA 2Z8FA 3KGCA 1LAGE 2HZKA 2O51A 2OK2A 3DP8A 2Q8JA 3KG2A 2ONRA 4R9GA 3USDA 2F6GA 4KR5A 1F9BA 3TCFA 3O6GA 5H8FA 2ZNSA 3FVOA 4GWOA 5H8HA 1B1XA 1R6ZA 4OQOA 2UVHA 2DSFA 2KLFA 3TPAA 5A5XA 3K00A 3TCGA 1H45A 1S9TA 3IJXB 3CRBA 2ALUA 1Y4TA 3FJGA 3FXUA 5LOMA 5I2NB 1ZTYA 2UYFA 4NF5A 5JK4A 3VVEA 1DOTA 1NKXA 4PQJA 4C1TA 3KN3A 3H6WA 1Y4CA 2GRVA 3SEXA 5I58B 3A3UA 5TPAA 2UVGA 4H5GA 4OETA 5H8HB 1FQEA 2Y7RA 4PFYA 2Q2AA 3TUSA 1XVYA 4WXJA 1HSLA 4JDFA 1B4HA 2G93A 4Q30B 4QSEA 3PUYE 3FVNA 2PT1A 3U92A 4LZ7A 2DWAA 3I3VA 4AQ4A 3D4GA 1B52A 3HN0A 4YB5A 2O84X 5I59B 4EQBA 2RINA 2XX7A 4IO5A 4ZEKA 5H8QA 1O7TA 3UN6A 2H5YA 5DVJA 2F35A 2DE4A 1LAXA 3MZBA 3QXMA 1LFGA 2Q88A 1XHYA 1A99A 1R9QA 3PUWE 2IA4A 4N13A 5TP9B 4U2RA 3P7IA 1P99A 3ZKKA 1Y1ZA 2F36A 1UQWA 1NL5A 2Y7PA 1BP5A 3M8UA 3Q27A 3MP6A 1B0HA 3T93B 4BLAA 1A7LA 1PDAA 3SETA 3DM0A 4LATA 5F7VA 1GR2A 3MPLA 4F3GA 1OQHA 4LQ5A 3IOVA 3T9VA 1PEBA 1DTGA 2V3QA 5HBCA 5I84A 4R2BA 2D21A 3CI8A 4OVJA 2XX8A 5AA2A 4MLQA 3TMGA 4ZZAA 3C4MA 1UTBA 2Q89A 1O63A 1VFEA 1RYXA 1US5A 2HFBA 3K4UA 1TXFA 4H8JA 1JVXA 4G8NA 1II5A 3OEMA 1DSNA 2XXHA 3M3FA 4GOTA 3K1NA 3VLWA 1M5BA 5KDTB 1WDNA 4RYAA 4G68C 1EU8A 1UTBB 5AA3A 2H9BA 4LP2B 2CMOA 4ONYA 3O2AA 1USYE 3SESA 1QUKA 1MY1A 3OXNA 3MJNA 3OSRA 1ZIUA 4YZZA 3B7DA 3MBPA 1TFDA 3HHGA 4EQ9A 5FHMA 5CBSA 2ABHA 2XXYA 1MG1A 2ONKE 2VGQA 1GTKA 1QUIA 1BLFA 4POXA 1JW4A 1B58A 4M1VA 5DEXA 1H43A 4K3FA 5I2KA 3C35A 1A40A 4H8IA 1SW4A 2XXRA 3VXBA 4UACA 3OENA 3SEUA 3MVWA 2DWHA 3I6VA 3KN7A 4P11A 3UGWA 4HCYA 3TTLA 3B6QA 4F22A 3H6TA 5I57A 4LUBA 2I4CA 4NF4B 3FV1A 5ICQA 4YB6A 5KZTA 1P1NA 3C33A 5DEXB 4GL0A 4F31B 3A09A 2PVUA 3E9XA 2CZLA 2A5SA 3O97A 1TWYA 2QMWA 3ILUB 3O6HA 4I9DA 4HCWA 4Q8RA 2DS9A 1A54A 1M5DA 1LB9A 2QS2A 1US4A 4KI0E 1FTKA 4WEPA 4DXUA 1I6AA 2F7BA 2QS1A 1IQ7A 3T9XB 1B3FA 4ZEFA 2XX9A 3KJ7A 3O66A 3S9EA 5IKBA 1JQFA 4BDRA 3MAMA 4KQPA 3O28A 1QVSA 2OLBA 1B46A 1SI0A 2Q9TA 5J1DA 4IO2A 1MQIA 2QRYA 4BDQA 3ZS6A 4ND9A 1RKMA 2NXOA 2B65A 4F39A 2AL4A 2DQVA 1FCKA 2I4BA 4FEDA 4R6KA 3OELA 1UTHB 4MH5A 2XXWA 3TAJA 4XIGQ 4NWCA 3KZGA 4RK2A 1MS7A 3KOTA 3W9WA 2UXAA 1LCFA 4G77A 2UVIA 2F34A 2I49A 3VVDA 5F1QA 1YPNA 4F2QA 1NNFA 3LSWA 2ZNTA 3Q28A 1IIWA 2O6AA 2REGA 1MQHA 2Y7IA 3DP4A 4ZE8A 3K02A 4F3BA 1SD3A 3HSTA 1OLAA 3RT8A 1B51A 3IB0A 2I6EA 4YICA 4XXUA 4O3BA 4PETA 2F7CA 3FJ7A 3MQ9A 2DE2A 2QPQA 4FE8A 3T66A 4BDOA 3EHUA 4PFUA 1PBPA 3E4RA 4IY6A 1NMUA 4OFOA 4PFWA 4F3SA 4U23A 4OZ9A 2HAUA 2PT2A 3K1MA 4DDDA 3K1PA 2DOJA 3IX1A 3SDFA 2UVJA 2XXUA 1N3XA 5FTHA 4H67A 4LVQA 2XD3A 4PFTA 2FA7A 4RPNA 4I8CA 4JWXA 2FYIA 3OO6A 2Y7KA 1FTJA 1SW2A 5L9MA 3C9HA 3MUQA 4Z7EA 3PPNA 4EF1A 1IEJA 3FXQA 4NMYA 4RK9A 4LZ8A 1Z7ME 4YAHX 5I2NA 4IGRA 3Q26A 3K2DA 4KYDA 4BDNA 3FXRA 1IZ1A 3V5AA 1Y3QA 1TT1A 2H4IA 2E0SA 2GHBA 1XVXA 2O1LA 4GQOA 2HZLA 5I58A 1ANFA 3MZ1A 1Q1KA 3QUJA 2XXTA 3QUFA 3RTFB 5EHMA 2V84A 2XXPA 2ZYMA 4XKPA 2YJPA 2OWSA 3H6UA 3LR1A 3QAXA 4LZ5A 4QFLA 3OO8A 3MW0A 1AIVA 1Z7NE 1MY0A 2Y7WA 1MQJA 2V3TA 1GGGA 4OHNA 3TEPA 3BFTA 1FW0A 1N7XA 3ECRA 1EZ9A 2RC9A 4G2ZA 1LCTA 5JEIA 4LA9A 3FGSA 5I59A 4FIMA 2P0SA 3SEVA 4DCYA 3KSJA 4Z0IA 3PMWA 1N7WA 4QHQA 1HSJA 1ELJA 4OXVA 1XOCA 1YAEA 1AL3A 4O3AA 1JEUA 3CG1A 3MZ9A 4Q0CA 3N94A 3SKPA 5TP9A 3LSFB 2XXIA 1FQFA 4NTLA 3CSGA 4H1XA 2DWJA 3S2VA 5DYHA 4IO3A 3G3HA 3GBBA 4MBPA 2PX1A 2A5TB 4JWOA 3BFUA 3FVGA 1SYHA 3O29A 2OCUA 1QJMA 2R71A 4KCCA 2Y84A 1EZPA 2I0CA 3MP1A 3IL1B 3U72A 3OO9A 5AE4A 2F97A 1Y9UA 3IO4A 1ZLQA 3K6VA 3CFLA 3VLVA 4E0XA 1N3WA 1FQAA 2XXVA 3KN8A 3KFMA 3T96B 4ELRA 1VSOA 3UIFA 4R74A 2GHAA 4ELPA 5KDTA 1QULA 3EQ1A 1PB7A 5DVIA 1NFTA 5CC2A 1MY3A 3RPWA 4NF6A 5CI5A 1USYH 2OBGA 3HO7A 3OMBA 1Y20A 3FVKA 4HS7A 1I6QA 5DTBA 1OMPA 3R26A 1B3HA 2I3VA 3RNNA 4F19A 1MQDA 3IB1A 3G7WA 3U1OA 3K0VA 3LSXA 4ZZEA 5IAIA 4NF6B 2VHAA 1OIBA 5FHOA 2FNCA 4ELOA 1B9JA 1M5FA 1B7UA 1PB8A 1N84A 4U21A 1URGA 1Y3PA 3MWBA 1FQCA 4NF4A 3VE1B 5H8SA 2YLNA 4ZE9A 5CMKA 4IO6A 2QS4A 3K6XA 3S4UA 4QFNA 4HW8A 1AH5A 3C32A 1TFAA 2HXWA 1LBCA 4GXSB 4N6PA 2XXXA 2AIXA 3FUZA 3LC8A 2H98A 2ZMBA 4F3PA 1SW5A 4DLDA 2X7PA 3S9MC 4PE5B 1B1HA 1NH8A 3KSXA 3ZSFA 1FQBA 1A8FA 3T9HB 1J1NA 3ZKLA 1P1UA 5FTIA 3TTRA 4JSOA 5H8NB 3JYRA 2F7AA 3IB2A 3PPRA 1MPBA 5ITOA 3Q29A 3JZJA 1B5HA 1H44A 4RA1A 1B3LA 1B3GA 3HPIA 1XS5A 4XKQA 4X48A 1IITA 4I62A 3IOTA 2Z8DA 1P1QA 3TTNA 3ONMA 1D9VA 1NNTA 4ZEDA 4JXIA 3L6HA 3L6GA 3U94A 2GH9A 4YKIA 2OJTA 4ESWA 1PB9A 3R7XA 3D4CA 2AL5A 1MXXA 4H5FA 1UTHA 1P1WA 3C31A 3RUMA 4YMBA 2DVCA 2X7QA 3PD8A 1B5IA 4TQUQ 2IEEA 4DXBA 4QSDA 2DXYA 4JWYA 1HSEA 3WAEA 3QIMA 1UIUA 4IO7A 2H25A 3U8QA 4F18A 4IGTA 4KFQA 3E13X 3EHTA 3CR9A 4G68B 4GF8A 5K2YA 3O6IA 1S50A 4GXAA 4TLMB 3EN3A 3TDJA 3FIRA 4GRKA 2ZYNA 3G3JA 1MH4A 1PBQA 3K6WA 1B32A 3UORA 5KCJA 1MXVA 1OQGA 1DPPA 4KYSA 5DT6A 2QSXA 1MM7A 4U22A 1ATGA 3MVXA 2QMXA 1B05A 3IK6B 4IB2A 3PPQA 1MRPA 4H65A 4LQ2A 3VFJA 3TYHA 2I0BA 4O3CA 1YTVA 1JW1A 3V89B 3VXCA 3K01A 5ELVA 1DTZA 4IO4A 5KCJB 4KCDA 2HAVA 2B3FA 1Y1MA 4FECA 2VD3A 1IXGA 2DP8A 2O7IA 4EXKA 3TQLA 5B70A 1AOVA 3KJTA 3THIA 1UIVA 4JB7A 1QKAA 3PGFA 5ISUA 1D3KA 4RNSA 4KPTA 2NWJA 2UYEA 3RY3A 1MXUA 1FTMA 1LSTA 3TFLA 1LAFE 3TTMA 3IJOB 4AB5A 2ESNA 3TCHA 4QFPA 4F1UA 3HV1A 2NVUB 3CFXA 1YCJA 3KOSA 4C0RA 5K2XA 2XD2A 4DE8A 4QFOA 2HQ0A 4E0WA 3VDFA 4G8MA 3QSLA 3CFZA 1POY1 3SERA 3T9UA 4IY5A 2M8CA 4C1UA 4OFJA 1N76A 4YB7A 2PYYA 3EPEA 3FJMA 2DVZA 2QS3A 4FORA 3UP9A 3I5OA 3N26A 3F11A 4DZ1A 2ZXTA 1R1NA 5TU0A 2PMSA 4BDLA 3U93A 1MDP1 1QW0A 4RPOA 5CMMA 3G3GA 2Z22A 1SI1A 1WVJA 1D4NA 4FATA 1JETA 1SBPA 5JTYB 1LLSA 1XC1A 2RKMA 4QF9A 5EHSA 1MY4A 3E3KA 4HTGA 1B5JA 3PD9A 2DE3A 3V83A 4XKNA 4QRZA 4P0GA 4ZS9A 4EXLA 2WKYA 4GVOA 1AMFA 2D5WA 5FHNA 1A8EA 2RCBA 4H0WA 2A5TA 3R6UA 4ZDMA 1MXWA 1MPCA 1Q35A 4NF8A 1MDQA 5H8FB 2HCAA 3HHFA 1BKAA 3OEKA 4NWDA 3B6TA 1XT8A 4AB6A 3N5LA 2X26A 4QSCA 4L17A 2RC7A 5A5XB 4POWA 1JEVA 1ZU0A 4Q5TA 4FEBA 2BJJX 4GLIA 1EZOA 4NF5B 4OTEA 2OZZA 2XHDA 2O1MA 3SEYA 3RGYA 1FTLA 1PC3A 3FZVA 1DPEA 3RT6B 2THIA 3H7MA 4NF8B 5TPAB 4EQ7A 4YU0A 1LBBA 4I1DA 4XKRA 3TKDA 4R72A 1ZMGA 3H06B 1JVYA 2ANJA 1N0TA 3CSBA 1A55A 2V93A 5ICTA 4KD5A 1FTOA 3M3KA 1SW1A 2XXQA 4FAJA 3PV0E 1M5CA 2W7YA 3IAZA 4NE4A 3W15C 1OLCA 1MH3A 1MXZA 3PMXA 4H6DA 1BTJA 1NNKA 4OEUA 3UA8A 1SQYA 5H8QB 3TTKA 1OVBA 3B6WA 3EF7A 4NEDA 2DXRA 2REJA 2O69A 3CIJA 1SVXB 4R73A 4YMAA 1EH3A 4X1DA 1MQGA 3TODA 3OO7A 1O64A 3PPOA 4OWDA 5L9OA 4U1ZA 4R2FA 5I56A 1D9YA 1ZBMA 4TLLB 2F6PA 1GVCA 3ILTB 2HEUA 2V25A 3WAFA 1KWHA 5L9SA 5HPQA 3PMVA 1B40A 1IXCA 4XTCQ 3LUYA 3T22A 1ZKBA 1LFHA 3TELA 2D3IA 5AA2B 3PPPA 5CBRA 3N6UA 5CM6A 4RY1A 3IOUA 5AA1A 5AA4A 5I56B 4ZEBA 1CB6A 1OVTA 4F1VA 3RLFE 2P1SA 3LSLA 1P1OA 2F5XA 1M5EA 2B3BA 3FATA 1LB8A 3IO6A 4JBZA 1MPDA 1B2HA 4GFRA 5H8NA 3V8XB 4ISUA 3H03A 1LGBC 3RTWB 3OD7A 1LFIA 4WEDA 3PUZE 2NOOA 4F1YA 3MVYA 3H4ZA 4BDMA 5DVFA 4GIZA 5AA4B 3C34A 1JNFA 3S9NC 4ESXA 3DLNA 5EYFA 2I3WA 3EHSA 3W9VA 1H76A 4GL8A 2O7UA 3IR1A 4OEVA 1NNPA 5B7DA 2F8DA 2P2AA 4EUOA 3MVZA 4YKKA 4N07A 2QL3A 4KYEA 2OWTA 5L8DA 5HM4B 1B4ZA 4MLVA 4JSDA 3MC2A 5I2KB 3RQTA 4U1OA 2QJEA 3M3LA 4F2OA 4U4SA 3HCQA 4R6YA 1VFDA 5BUUA 3IORA 1I6BA 3AXFA 2DYXA 1IXHA 4WKMA 3PU5A 5I57B 3LBSA 2VD2A 3KBRA 4EF2A 1B7HA 1VR5A 4G68A 3C36A 4F29A 4UA8A 4RXLA 3GZGA 1BIYA 4DIGA 2RCAA 3OOAA 3QK6A 5CRYA 3BBRA 4OESA 1URSA 2ZNUA 1L5TA 2O68A 2NUVA 3SEWA 3N6TA 4LONB 3PUXE 2PBWA 1H3DA 4FJPA 2VP1A 2Z23A 2GFEA 4MF3A 3VVFA 3OSQA 4QFKA 1B0LA 2V3UA 3K6UA 3UK4A 1B7ZA 2RF1A 1QUJA 4R75A 4P0IA 4M4GA 2H99A 1GV8A 1URDA 3CG3A 2Z8EA 1LAHE 2I58A 1S7YA 3DP6A 1JW5A 4OYVA 1DMBA 4ECFA 3H3GA 4ZECA 1N04A 2YPNA 4EDPA 4THIA 4DCXA 1MXYA 4OFLA 1IUDA 1IXIA 4X9TA 3VLUA 1B3EA 2LAOA 5ITPA 4GD5A 2F78A 1WODA 1NH7A 3G3IA 2R9JA 2VOZA 1SDXA 3ODBA 4TOZA 1I69A 3FASA 1VE4A 4R9FA 2ZYKA 2RC8A 1ZJLA 3PUVE 2AYSA 4ELQA 2G29A 1CE2A 1SYIA 1POTA 4X1BA 1QKBA 4YKPA 2ONSA 5BWJA 4YKJA 3JV9A 1MY2A 4G8HA 3GBAA 3Q25A 1FQDA 3KEIA 3FV2A 3QYTA 3MP8A 5AA2D 1RYOA 4DXCA 1R9LA 3VV5A 3RN8A 4OENA 1B6HA 3DELB 3GLBA 3MPKA 5CMCA 4OMBA 5CMBA 5M2VA 3FD3A 4R6HA 4OERA 3A3CA 2Q2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PP0 A;  2R6G E;  3G3F A;  2ZYO A;  1Y3N A;  3GXA A;  5JTY A;  4MFI A;  2I48 A;  2DWI A;  3O9P A;  1MM6 A;  3S9L C;  4ZEI A;  3G3K A;  1T0K A;  3TZA A;  4RJZ A;  3TQW A;  2E1S A;  3H6V A;  3IOW A;  4G4P A;  4KHZ E;  3BKI B;  4U4X A;  3CVG A;  2Z8F A;  3KGC A;  1LAG E;  2HZK A;  2O51 A;  2OK2 A;  3DP8 A;  2Q8J A;  3KG2 A;  2ONR A;  4R9G A;  3USD A;  2F6G A;  4KR5 A;  1F9B A;  3TCF A;  3O6G A;  5H8F A;  2ZNS A;  3FVO A;  4GWO A;  5H8H A;  1B1X A;  1R6Z A;  4OQO A;  2UVH A;  2DSF A;  2KLF A;  3TPA A;  5A5X A;  3K00 A;  3TCG A;  1H45 A;  1S9T A;  3IJX B;  3CRB A;  2ALU A;  1Y4T A;  3FJG A;  3FXU A;  5LOM A;  5I2N B;  1ZTY A;  2UYF A;  4NF5 A;  5JK4 A;  3VVE A;  1DOT A;  1NKX A;  4PQJ A;  4C1T A;  3KN3 A;  3H6W A;  1Y4C A;  2GRV A;  3SEX A;  5I58 B;  3A3U A;  5TPA A;  2UVG A;  4H5G A;  4OET A;  5H8H B;  1FQE A;  2Y7R A;  4PFY A;  2Q2A A;  3TUS A;  1XVY A;  4WXJ A;  1HSL A;  4JDF A;  1B4H A;  2G93 A;  4Q30 B;  4QSE A;  3PUY E;  3FVN A;  2PT1 A;  3U92 A;  4LZ7 A;  2DWA A;  3I3V A;  4AQ4 A;  3D4G A;  1B52 A;  3HN0 A;  4YB5 A;  2O84 X;  5I59 B;  4EQB A;  2RIN A;  2XX7 A;  4IO5 A;  4ZEK A;  5H8Q A;  1O7T A;  3UN6 A;  2H5Y A;  5DVJ A;  2F35 A;  2DE4 A;  1LAX A;  3MZB A;  3QXM A;  1LFG A;  2Q88 A;  1XHY A;  1A99 A;  1R9Q A;  3PUW E;  2IA4 A;  4N13 A;  5TP9 B;  4U2R A;  3P7I A;  1P99 A;  3ZKK A;  1Y1Z A;  2F36 A;  1UQW A;  1NL5 A;  2Y7P A;  1BP5 A;  3M8U A;  3Q27 A;  3MP6 A;  1B0H A;  3T93 B;  4BLA A;  1A7L A;  1PDA A;  3SET A;  3DM0 A;  4LAT A;  5F7V A;  1GR2 A;  3MPL A;  4F3G A;  1OQH A;  4LQ5 A;  3IOV A;  3T9V A;  1PEB A;  1DTG A;  2V3Q A;  5HBC A;  5I84 A;  4R2B A;  2D21 A;  3CI8 A;  4OVJ A;  2XX8 A;  5AA2 A;  4MLQ A;  3TMG A;  4ZZA A;  3C4M A;  1UTB A;  2Q89 A;  1O63 A;  1VFE A;  1RYX A;  1US5 A;  2HFB A;  3K4U A;  1TXF A;  4H8J A;  1JVX A;  4G8N A;  1II5 A;  3OEM A;  1DSN A;  2XXH A;  3M3F A;  4GOT A;  3K1N A;  3VLW A;  1M5B A;  5KDT B;  1WDN A;  4RYA A;  4G68 C;  1EU8 A;  1UTB B;  5AA3 A;  2H9B A;  4LP2 B;  2CMO A;  4ONY A;  3O2A A;  1USY E;  3SES A;  1QUK A;  1MY1 A;  3OXN A;  3MJN A;  3OSR A;  1ZIU A;  4YZZ A;  3B7D A;  3MBP A;  1TFD A;  3HHG A;  4EQ9 A;  5FHM A;  5CBS A;  2ABH A;  2XXY A;  1MG1 A;  2ONK E;  2VGQ A;  1GTK A;  1QUI A;  1BLF A;  4POX A;  1JW4 A;  1B58 A;  4M1V A;  5DEX A;  1H43 A;  4K3F A;  5I2K A;  3C35 A;  1A40 A;  4H8I A;  1SW4 A;  2XXR A;  3VXB A;  4UAC A;  3OEN A;  3SEU A;  3MVW A;  2DWH A;  3I6V A;  3KN7 A;  4P11 A;  3UGW A;  4HCY A;  3TTL A;  3B6Q A;  4F22 A;  3H6T A;  5I57 A;  4LUB A;  2I4C A;  4NF4 B;  3FV1 A;  5ICQ A;  4YB6 A;  5KZT A;  1P1N A;  3C33 A;  5DEX B;  4GL0 A;  4F31 B;  3A09 A;  2PVU A;  3E9X A;  2CZL A;  2A5S A;  3O97 A;  1TWY A;  2QMW A;  3ILU B;  3O6H A;  4I9D A;  4HCW A;  4Q8R A;  2DS9 A;  1A54 A;  1M5D A;  1LB9 A;  2QS2 A;  1US4 A;  4KI0 E;  1FTK A;  4WEP A;  4DXU A;  1I6A A;  2F7B A;  2QS1 A;  1IQ7 A;  3T9X B;  1B3F A;  4ZEF A;  2XX9 A;  3KJ7 A;  3O66 A;  3S9E A;  5IKB A;  1JQF A;  4BDR A;  3MAM A;  4KQP A;  3O28 A;  1QVS A;  2OLB A;  1B46 A;  1SI0 A;  2Q9T A;  5J1D A;  4IO2 A;  1MQI A;  2QRY A;  4BDQ A;  3ZS6 A;  4ND9 A;  1RKM A;  2NXO A;  2B65 A;  4F39 A;  2AL4 A;  2DQV A;  1FCK A;  2I4B A;  4FED A;  4R6K A;  3OEL A;  1UTH B;  4MH5 A;  2XXW A;  3TAJ A;  4XIG Q;  4NWC A;  3KZG A;  4RK2 A;  1MS7 A;  3KOT A;  3W9W A;  2UXA A;  1LCF A;  4G77 A;  2UVI A;  2F34 A;  2I49 A;  3VVD A;  5F1Q A;  1YPN A;  4F2Q A;  1NNF A;  3LSW A;  2ZNT A;  3Q28 A;  1IIW A;  2O6A A;  2REG A;  1MQH A;  2Y7I A;  3DP4 A;  4ZE8 A;  3K02 A;  4F3B A;  1SD3 A;  3HST A;  1OLA A;  3RT8 A;  1B51 A;  3IB0 A;  2I6E A;  4YIC A;  4XXU A;  4O3B A;  4PET A;  2F7C A;  3FJ7 A;  3MQ9 A;  2DE2 A;  2QPQ A;  4FE8 A;  3T66 A;  4BDO A;  3EHU A;  4PFU A;  1PBP A;  3E4R A;  4IY6 A;  1NMU A;  4OFO A;  4PFW A;  4F3S A;  4U23 A;  4OZ9 A;  2HAU A;  2PT2 A;  3K1M A;  4DDD A;  3K1P A;  2DOJ A;  3IX1 A;  3SDF A;  2UVJ A;  2XXU A;  1N3X A;  5FTH A;  4H67 A;  4LVQ A;  2XD3 A;  4PFT A;  2FA7 A;  4RPN A;  4I8C A;  4JWX A;  2FYI A;  3OO6 A;  2Y7K A;  1FTJ A;  1SW2 A;  5L9M A;  3C9H A;  3MUQ A;  4Z7E A;  3PPN A;  4EF1 A;  1IEJ A;  3FXQ A;  4NMY A;  4RK9 A;  4LZ8 A;  1Z7M E;  4YAH X;  5I2N A;  4IGR A;  3Q26 A;  3K2D A;  4KYD A;  4BDN A;  3FXR A;  1IZ1 A;  3V5A A;  1Y3Q A;  1TT1 A;  2H4I A;  2E0S A;  2GHB A;  1XVX A;  2O1L A;  4GQO A;  2HZL A;  5I58 A;  1ANF A;  3MZ1 A;  1Q1K A;  3QUJ A;  2XXT A;  3QUF A;  3RTF B;  5EHM A;  2V84 A;  2XXP A;  2ZYM A;  4XKP A;  2YJP A;  2OWS A;  3H6U A;  3LR1 A;  3QAX A;  4LZ5 A;  4QFL A;  3OO8 A;  3MW0 A;  1AIV A;  1Z7N E;  1MY0 A;  2Y7W A;  1MQJ A;  2V3T A;  1GGG A;  4OHN A;  3TEP A;  3BFT A;  1FW0 A;  1N7X A;  3ECR A;  1EZ9 A;  2RC9 A;  4G2Z A;  1LCT A;  5JEI A;  4LA9 A;  3FGS A;  5I59 A;  4FIM A;  2P0S A;  3SEV A;  4DCY A;  3KSJ A;  4Z0I A;  3PMW A;  1N7W A;  4QHQ A;  1HSJ A;  1ELJ A;  4OXV A;  1XOC A;  1YAE A;  1AL3 A;  4O3A A;  1JEU A;  3CG1 A;  3MZ9 A;  4Q0C A;  3N94 A;  3SKP A;  5TP9 A;  3LSF B;  2XXI A;  1FQF A;  4NTL A;  3CSG A;  4H1X A;  2DWJ A;  3S2V A;  5DYH A;  4IO3 A;  3G3H A;  3GBB A;  4MBP A;  2PX1 A;  2A5T B;  4JWO A;  3BFU A;  3FVG A;  1SYH A;  3O29 A;  2OCU A;  1QJM A;  2R71 A;  4KCC A;  2Y84 A;  1EZP A;  2I0C A;  3MP1 A;  3IL1 B;  3U72 A;  3OO9 A;  5AE4 A;  2F97 A;  1Y9U A;  3IO4 A;  1ZLQ A;  3K6V A;  3CFL A;  3VLV A;  4E0X A;  1N3W A;  1FQA A;  2XXV A;  3KN8 A;  3KFM A;  3T96 B;  4ELR A;  1VSO A;  3UIF A;  4R74 A;  2GHA A;  4ELP A;  5KDT A;  1QUL A;  3EQ1 A;  1PB7 A;  5DVI A;  1NFT A;  5CC2 A;  1MY3 A;  3RPW A;  4NF6 A;  5CI5 A;  1USY H;  2OBG A;  3HO7 A;  3OMB A;  1Y20 A;  3FVK A;  4HS7 A;  1I6Q A;  5DTB A;  1OMP A;  3R26 A;  1B3H A;  2I3V A;  3RNN A;  4F19 A;  1MQD A;  3IB1 A;  3G7W A;  3U1O A;  3K0V A;  3LSX A;  4ZZE A;  5IAI A;  4NF6 B;  2VHA A;  1OIB A;  5FHO A;  2FNC A;  4ELO A;  1B9J A;  1M5F A;  1B7U A;  1PB8 A;  1N84 A;  4U21 A;  1URG A;  1Y3P A;  3MWB A;  1FQC A;  4NF4 A;  3VE1 B;  5H8S A;  2YLN A;  4ZE9 A;  5CMK A;  4IO6 A;  2QS4 A;  3K6X A;  3S4U A;  4QFN A;  4HW8 A;  1AH5 A;  3C32 A;  1TFA A;  2HXW A;  1LBC A;  4GXS B;  4N6P A;  2XXX A;  2AIX A;  3FUZ A;  3LC8 A;  2H98 A;  2ZMB A;  4F3P A;  1SW5 A;  4DLD A;  2X7P A;  3S9M C;  4PE5 B;  1B1H A;  1NH8 A;  3KSX A;  3ZSF A;  1FQB A;  1A8F A;  3T9H B;  1J1N A;  3ZKL A;  1P1U A;  5FTI A;  3TTR A;  4JSO A;  5H8N B;  3JYR A;  2F7A A;  3IB2 A;  3PPR A;  1MPB A;  5ITO A;  3Q29 A;  3JZJ A;  1B5H A;  1H44 A;  4RA1 A;  1B3L A;  1B3G A;  3HPI A;  1XS5 A;  4XKQ A;  4X48 A;  1IIT A;  4I62 A;  3IOT A;  2Z8D A;  1P1Q A;  3TTN A;  3ONM A;  1D9V A;  1NNT A;  4ZED A;  4JXI A;  3L6H A;  3L6G A;  3U94 A;  2GH9 A;  4YKI A;  2OJT A;  4ESW A;  1PB9 A;  3R7X A;  3D4C A;  2AL5 A;  1MXX A;  4H5F A;  1UTH A;  1P1W A;  3C31 A;  3RUM A;  4YMB A;  2DVC A;  2X7Q A;  3PD8 A;  1B5I A;  4TQU Q;  2IEE A;  4DXB A;  4QSD A;  2DXY A;  4JWY A;  1HSE A;  3WAE A;  3QIM A;  1UIU A;  4IO7 A;  2H25 A;  3U8Q A;  4F18 A;  4IGT A;  4KFQ A;  3E13 X;  3EHT A;  3CR9 A;  4G68 B;  4GF8 A;  5K2Y A;  3O6I A;  1S50 A;  4GXA A;  4TLM B;  3EN3 A;  3TDJ A;  3FIR A;  4GRK A;  2ZYN A;  3G3J A;  1MH4 A;  1PBQ A;  3K6W A;  1B32 A;  3UOR A;  5KCJ A;  1MXV A;  1OQG A;  1DPP A;  4KYS A;  5DT6 A;  2QSX A;  1MM7 A;  4U22 A;  1ATG A;  3MVX A;  2QMX A;  1B05 A;  3IK6 B;  4IB2 A;  3PPQ A;  1MRP A;  4H65 A;  4LQ2 A;  3VFJ A;  3TYH A;  2I0B A;  4O3C A;  1YTV A;  1JW1 A;  3V89 B;  3VXC A;  3K01 A;  5ELV A;  1DTZ A;  4IO4 A;  5KCJ B;  4KCD A;  2HAV A;  2B3F A;  1Y1M A;  4FEC A;  2VD3 A;  1IXG A;  2DP8 A;  2O7I A;  4EXK A;  3TQL A;  5B70 A;  1AOV A;  3KJT A;  3THI A;  1UIV A;  4JB7 A;  1QKA A;  3PGF A;  5ISU A;  1D3K A;  4RNS A;  4KPT A;  2NWJ A;  2UYE A;  3RY3 A;  1MXU A;  1FTM A;  1LST A;  3TFL A;  1LAF E;  3TTM A;  3IJO B;  4AB5 A;  2ESN A;  3TCH A;  4QFP A;  4F1U A;  3HV1 A;  2NVU B;  3CFX A;  1YCJ A;  3KOS A;  4C0R A;  5K2X A;  2XD2 A;  4DE8 A;  4QFO A;  2HQ0 A;  4E0W A;  3VDF A;  4G8M A;  3QSL A;  3CFZ A;  1POY 1;  3SER A;  3T9U A;  4IY5 A;  2M8C A;  4C1U A;  4OFJ A;  1N76 A;  4YB7 A;  2PYY A;  3EPE A;  3FJM A;  2DVZ A;  2QS3 A;  4FOR A;  3UP9 A;  3I5O A;  3N26 A;  3F11 A;  4DZ1 A;  2ZXT A;  1R1N A;  5TU0 A;  2PMS A;  4BDL A;  3U93 A;  1MDP 1;  1QW0 A;  4RPO A;  5CMM A;  3G3G A;  2Z22 A;  1SI1 A;  1WVJ A;  1D4N A;  4FAT A;  1JET A;  1SBP A;  5JTY B;  1LLS A;  1XC1 A;  2RKM A;  4QF9 A;  5EHS A;  1MY4 A;  3E3K A;  4HTG A;  1B5J A;  3PD9 A;  2DE3 A;  3V83 A;  4XKN A;  4QRZ A;  4P0G A;  4ZS9 A;  4EXL A;  2WKY A;  4GVO A;  1AMF A;  2D5W A;  5FHN A;  1A8E A;  2RCB A;  4H0W A;  2A5T A;  3R6U A;  4ZDM A;  1MXW A;  1MPC A;  1Q35 A;  4NF8 A;  1MDQ A;  5H8F B;  2HCA A;  3HHF A;  1BKA A;  3OEK A;  4NWD A;  3B6T A;  1XT8 A;  4AB6 A;  3N5L A;  2X26 A;  4QSC A;  4L17 A;  2RC7 A;  5A5X B;  4POW A;  1JEV A;  1ZU0 A;  4Q5T A;  4FEB A;  2BJJ X;  4GLI A;  1EZO A;  4NF5 B;  4OTE A;  2OZZ A;  2XHD A;  2O1M A;  3SEY A;  3RGY A;  1FTL A;  1PC3 A;  3FZV A;  1DPE A;  3RT6 B;  2THI A;  3H7M A;  4NF8 B;  5TPA B;  4EQ7 A;  4YU0 A;  1LBB A;  4I1D A;  4XKR A;  3TKD A;  4R72 A;  1ZMG A;  3H06 B;  1JVY A;  2ANJ A;  1N0T A;  3CSB A;  1A55 A;  2V93 A;  5ICT A;  4KD5 A;  1FTO A;  3M3K A;  1SW1 A;  2XXQ A;  4FAJ A;  3PV0 E;  1M5C A;  2W7Y A;  3IAZ A;  4NE4 A;  3W15 C;  1OLC A;  1MH3 A;  1MXZ A;  3PMX A;  4H6D A;  1BTJ A;  1NNK A;  4OEU A;  3UA8 A;  1SQY A;  5H8Q B;  3TTK A;  1OVB A;  3B6W A;  3EF7 A;  4NED A;  2DXR A;  2REJ A;  2O69 A;  3CIJ A;  1SVX B;  4R73 A;  4YMA A;  1EH3 A;  4X1D A;  1MQG A;  3TOD A;  3OO7 A;  1O64 A;  3PPO A;  4OWD A;  5L9O A;  4U1Z A;  4R2F A;  5I56 A;  1D9Y A;  1ZBM A;  4TLL B;  2F6P A;  1GVC A;  3ILT B;  2HEU A;  2V25 A;  3WAF A;  1KWH A;  5L9S A;  5HPQ A;  3PMV A;  1B40 A;  1IXC A;  4XTC Q;  3LUY A;  3T22 A;  1ZKB A;  1LFH A;  3TEL A;  2D3I A;  5AA2 B;  3PPP A;  5CBR A;  3N6U A;  5CM6 A;  4RY1 A;  3IOU A;  5AA1 A;  5AA4 A;  5I56 B;  4ZEB A;  1CB6 A;  1OVT A;  4F1V A;  3RLF E;  2P1S A;  3LSL A;  1P1O A;  2F5X A;  1M5E A;  2B3B A;  3FAT A;  1LB8 A;  3IO6 A;  4JBZ A;  1MPD A;  1B2H A;  4GFR A;  5H8N A;  3V8X B;  4ISU A;  3H03 A;  1LGB C;  3RTW B;  3OD7 A;  1LFI A;  4WED A;  3PUZ E;  2NOO A;  4F1Y A;  3MVY A;  3H4Z A;  4BDM A;  5DVF A;  4GIZ A;  5AA4 B;  3C34 A;  1JNF A;  3S9N C;  4ESX A;  3DLN A;  5EYF A;  2I3W A;  3EHS A;  3W9V A;  1H76 A;  4GL8 A;  2O7U A;  3IR1 A;  4OEV A;  1NNP A;  5B7D A;  2F8D A;  2P2A A;  4EUO A;  3MVZ A;  4YKK A;  4N07 A;  2QL3 A;  4KYE A;  2OWT A;  5L8D A;  5HM4 B;  1B4Z A;  4MLV A;  4JSD A;  3MC2 A;  5I2K B;  3RQT A;  4U1O A;  2QJE A;  3M3L A;  4F2O A;  4U4S A;  3HCQ A;  4R6Y A;  1VFD A;  5BUU A;  3IOR A;  1I6B A;  3AXF A;  2DYX A;  1IXH A;  4WKM A;  3PU5 A;  5I57 B;  3LBS A;  2VD2 A;  3KBR A;  4EF2 A;  1B7H A;  1VR5 A;  4G68 A;  3C36 A;  4F29 A;  4UA8 A;  4RXL A;  3GZG A;  1BIY A;  4DIG A;  2RCA A;  3OOA A;  3QK6 A;  5CRY A;  3BBR A;  4OES A;  1URS A;  2ZNU A;  1L5T A;  2O68 A;  2NUV A;  3SEW A;  3N6T A;  4LON B;  3PUX E;  2PBW A;  1H3D A;  4FJP A;  2VP1 A;  2Z23 A;  2GFE A;  4MF3 A;  3VVF A;  3OSQ A;  4QFK A;  1B0L A;  2V3U A;  3K6U A;  3UK4 A;  1B7Z A;  2RF1 A;  1QUJ A;  4R75 A;  4P0I A;  4M4G A;  2H99 A;  1GV8 A;  1URD A;  3CG3 A;  2Z8E A;  1LAH E;  2I58 A;  1S7Y A;  3DP6 A;  1JW5 A;  4OYV A;  1DMB A;  4ECF A;  3H3G A;  4ZEC A;  1N04 A;  2YPN A;  4EDP A;  4THI A;  4DCX A;  1MXY A;  4OFL A;  1IUD A;  1IXI A;  4X9T A;  3VLU A;  1B3E A;  2LAO A;  5ITP A;  4GD5 A;  2F78 A;  1WOD A;  1NH7 A;  3G3I A;  2R9J A;  2VOZ A;  1SDX A;  3ODB A;  4TOZ A;  1I69 A;  3FAS A;  1VE4 A;  4R9F A;  2ZYK A;  2RC8 A;  1ZJL A;  3PUV E;  2AYS A;  4ELQ A;  2G29 A;  1CE2 A;  1SYI A;  1POT A;  4X1B A;  1QKB A;  4YKP A;  2ONS A;  5BWJ A;  4YKJ A;  3JV9 A;  1MY2 A;  4G8H A;  3GBA A;  3Q25 A;  1FQD A;  3KEI A;  3FV2 A;  3QYT A;  3MP8 A;  5AA2 D;  1RYO A;  4DXC A;  1R9L A;  3VV5 A;  3RN8 A;  4OEN A;  1B6H A;  3DEL B;  3GLB A;  3MPK A;  5CMC A;  4OMB A;  5CMB A;  5M2V A;  3FD3 A;  4R6H A;  4OER A;  3A3C A;  2Q2C A; 
#chains in the Genus database with same CATH topology
 4PP0 A;  2R6G E;  3G3F A;  4P1L A;  2ZYO A;  1Y3N A;  1FBE A;  3GXA A;  5JTY A;  4MFI A;  2I48 A;  2DWI A;  4NF0 A;  3O9P A;  1MM6 A;  3S9L C;  4ZEI A;  5A5L A;  3G3K A;  1T0K A;  3T1B A;  3TZA A;  4RJZ A;  3TQW A;  2E1S A;  3H6V A;  3IOW A;  4G4P A;  4KHZ E;  3BKI B;  4U4X A;  3CVG A;  2Z8F A;  3KGC A;  1LAG E;  2HZK A;  2O51 A;  2OK2 A;  3DP8 A;  2Q8J A;  3KG2 A;  2ONR A;  4R9G A;  3USD A;  5LTC A;  2F6G A;  2WYP A;  4KR5 A;  1F9B A;  3TCF A;  3O6G A;  5H8F A;  4MEV A;  2ZNS A;  3FVO A;  4GWO A;  5H8H A;  1B1X A;  1R6Z A;  4OQO A;  4N15 A;  2UVH A;  1IME A;  2DSF A;  2KLF A;  3TPA A;  5A5X A;  3K00 A;  3TCG A;  1H45 A;  1S9T A;  4GWW A;  3IJX B;  3CRB A;  2ALU A;  1Y4T A;  4X04 A;  3FJG A;  3FXU A;  5LOM A;  5I2N B;  1ZTY A;  2UYF A;  4NF5 A;  5JK4 A;  3VVE A;  5EQ9 A;  1DOT A;  1NKX A;  4PQJ A;  1NV3 A;  4C1T A;  3KN3 A;  3H6W A;  1Y4C A;  2GRV A;  3SEX A;  5I58 B;  2ZZV A;  3A3U A;  5TPA A;  2UVG A;  4H5G A;  4OET A;  5H8H B;  1FQE A;  2Y7R A;  4PFY A;  2Q2A A;  3TUS A;  3LV0 A;  1XVY A;  4WXJ A;  1HSL A;  4P9K A;  4JDF A;  1B4H A;  2G93 A;  4Q30 B;  4QSE A;  3PUY E;  3FVN A;  2PT1 A;  4GX4 A;  3U92 A;  4LZ7 A;  2DWA A;  3I3V A;  4AQ4 A;  3D4G A;  4MIJ A;  1B52 A;  3HN0 A;  4YB5 A;  2O84 X;  5I59 B;  4EQB A;  2RIN A;  3BIH A;  2XX7 A;  4IO5 A;  4ZEK A;  5J16 A;  5H8Q A;  1O7T A;  3UN6 A;  2H5Y A;  5DVJ A;  3BIG A;  4PGN A;  4GWY A;  4I3E A;  2F35 A;  2DE4 A;  1LAX A;  3MZB A;  3QXM A;  1LFG A;  2Q88 A;  1A99 A;  1XHY A;  1R9Q A;  3PUW E;  2IA4 A;  4N13 A;  5TP9 B;  4U2R A;  3P7I A;  1P99 A;  3ZKK A;  2OX3 A;  1Y1Z A;  2F36 A;  1UQW A;  1NL5 A;  2Y7P A;  1BP5 A;  3M8U A;  3Q27 A;  3MP6 A;  1B0H A;  3T93 B;  4BLA A;  1A7L A;  2F3D A;  1PDA A;  3SET A;  3DM0 A;  3MST A;  4LAT A;  2FVZ A;  5F7V A;  1GR2 A;  3MPL A;  4F3G A;  1OQH A;  4LQ5 A;  3IOV A;  1FJ9 A;  3T9V A;  1PEB A;  1DTG A;  2V3Q A;  5HBC A;  5I84 A;  4R2B A;  2D21 A;  3CI8 A;  4OVJ A;  2XX8 A;  5AA2 A;  4MLQ A;  3TMG A;  3HFU A;  4ZZA A;  3C4M A;  1LBZ A;  1UTB A;  4JVD A;  4HXV A;  2Q89 A;  1O63 A;  1VFE A;  1RYX A;  1US5 A;  2HFB A;  3K4U A;  1TXF A;  4H8J A;  2HHM A;  1JVX A;  4G8N A;  1II5 A;  3OEM A;  1DSN A;  2XXH A;  3M3F A;  4GOT A;  3K1N A;  3VLW A;  3U65 A;  1M5B A;  5KDT B;  1WDN A;  4RYA A;  2F3B A;  4G68 C;  1EU8 A;  1UTB B;  5AA3 A;  2H9B A;  5F24 A;  4LP2 B;  2HPG A;  2CMO A;  4ONY A;  3O2A A;  1USY E;  4OVR A;  3SES A;  1QUK A;  1MY1 A;  3OXN A;  3MJN A;  3OSR A;  1ZIU A;  4YZZ A;  3B7D A;  3MBP A;  1TFD A;  3EKI A;  3HHG A;  4EQ9 A;  5FHM A;  5CBS A;  5ESY A;  2ABH A;  2XXY A;  1MG1 A;  2ONK E;  2VGQ A;  1GTK A;  1QUI A;  1BLF A;  4POX A;  1JW4 A;  1B58 A;  4H46 A;  4M1V A;  5DEX A;  1H43 A;  4K3F A;  5I2K A;  3C35 A;  1A40 A;  4H8I A;  1SW4 A;  2XXR A;  4P1E A;  3VXB A;  4UAC A;  2XWO A;  3OEN A;  3SEU A;  4X8R A;  3MVW A;  2DWH A;  3I6V A;  3KN7 A;  4P11 A;  3UGW A;  4HCY A;  3TTL A;  1RDY A;  3B6Q A;  4F22 A;  3H6T A;  5I57 A;  4LUB A;  2I4C A;  4NF4 B;  3FV1 A;  4OVP A;  5ICQ A;  4N4U A;  4YB6 A;  5KZT A;  1P1N A;  3C33 A;  5DEX B;  4GL0 A;  1EYJ A;  4NHB A;  4F31 B;  3A09 A;  2PVU A;  3E9X A;  2CZL A;  2A5S A;  3O97 A;  1TWY A;  2QMW A;  3ILU B;  3O6H A;  4I9D A;  1EYI A;  4HCW A;  4PC9 A;  4Q8R A;  2DS9 A;  2CEY A;  1A54 A;  1M5D A;  1LB9 A;  2QS2 A;  1US4 A;  4KI0 E;  1FTK A;  4WEP A;  4DXU A;  1I6A A;  2F7B A;  2QS1 A;  1IQ7 A;  1FJ6 A;  3T9X B;  2WEF A;  1B3F A;  4ZEF A;  2XX9 A;  3KJ7 A;  3O66 A;  3S9E A;  5IKB A;  2JJK A;  1JQF A;  2B4L A;  4BDR A;  3MAM A;  4KQP A;  3O28 A;  1QVS A;  2KQZ A;  2OLB A;  1B46 A;  1SI0 A;  2Q9T A;  5J1D A;  4IO2 A;  1MQI A;  2QRY A;  4BDQ A;  2VPN A;  4PFI A;  3ZS6 A;  2ZZW A;  4ND9 A;  1RKM A;  2NXO A;  2B65 A;  4F39 A;  2AL4 A;  2DQV A;  1FCK A;  4XFE A;  2I4B A;  4FED A;  4R6K A;  3OEL A;  1RDX A;  1UTH B;  4MH5 A;  2XXW A;  3TAJ A;  4XIG Q;  4NWC A;  3KZG A;  4RK2 A;  1MS7 A;  3KOT A;  3W9W A;  2UXA A;  1LCF A;  5I5P A;  4G77 A;  1FPF A;  2UVI A;  2F34 A;  2I49 A;  3VVD A;  5F1Q A;  1YPN A;  4F2Q A;  1NNF A;  3LSW A;  3B50 A;  2ZNT A;  4MCO A;  3Q28 A;  1YXI A;  1IIW A;  2O6A A;  2REG A;  1MQH A;  2Y7I A;  3DP4 A;  4ZE8 A;  3K02 A;  4F3B A;  1SD3 A;  2Q74 A;  3HST A;  1OLA A;  1FPK A;  1B51 A;  3RT8 A;  3IB0 A;  2I6E A;  4YIC A;  4XXU A;  2FIE A;  4O3B A;  4PET A;  1XI6 A;  2F7C A;  3FJ7 A;  3MQ9 A;  2DE2 A;  2QPQ A;  4FE8 A;  5IGA A;  4O94 A;  3T66 A;  4MX6 A;  4BDO A;  2CZI A;  2P3V A;  2CZH A;  3EHU A;  3MYU A;  4PCD A;  4PFU A;  1PBP A;  3E4R A;  4IY6 A;  3KC1 A;  1NMU A;  5DW8 A;  4OFO A;  4PFW A;  4F3S A;  4U23 A;  4OZ9 A;  2HAU A;  4PBH A;  1IMF A;  2PT2 A;  2PFZ A;  3K1M A;  4DDD A;  3K1P A;  2DOJ A;  3IX1 A;  3SDF A;  2UVJ A;  1JP4 A;  2XXU A;  1N3X A;  5FTH A;  4H67 A;  4O7M A;  4LVQ A;  5IZZ A;  2XD3 A;  4PFT A;  2FA7 A;  4RPN A;  4I8C A;  4JWX A;  2FYI A;  3OO6 A;  2Y7K A;  1FTJ A;  1SW2 A;  5L9M A;  3C9H A;  3MUQ A;  4Z7E A;  3PPN A;  4EF1 A;  1IEJ A;  3FXQ A;  4NMY A;  4RK9 A;  4JVC A;  1LBY A;  4LZ8 A;  1Z7M E;  4YAH X;  5I2N A;  1FPD A;  4IGR A;  3Q26 A;  3K2D A;  4KYD A;  4PAK A;  4BDN A;  3FXR A;  1IZ1 A;  3V5A A;  4N17 A;  1Y3Q A;  4N91 A;  1TT1 A;  2H4I A;  2E0S A;  2GHB A;  1XVX A;  2O1L A;  4GQO A;  2HZL A;  5I58 A;  1ANF A;  3MZ1 A;  1Q1K A;  3QUJ A;  2XXT A;  3QUF A;  3RTF B;  5EHM A;  2V84 A;  1DCU A;  5IZ3 A;  2XXP A;  2ZYM A;  5LDZ A;  4XKP A;  2YJP A;  2OWS A;  3H6U A;  3LR1 A;  5EQA A;  5ET7 A;  3QAX A;  2R8T A;  4LZ5 A;  4QFL A;  3OO8 A;  5T3J A;  1NI9 A;  3MW0 A;  1LBW A;  1AIV A;  1Z7N E;  1FBF A;  1MY0 A;  2Y7W A;  1MQJ A;  2V3T A;  1GGG A;  4OHN A;  3TEP A;  3BFT A;  4P3L A;  1FW0 A;  1N7X A;  3ECR A;  1EZ9 A;  4P47 A;  2RC9 A;  4G2Z A;  1LCT A;  5JEI A;  4LA9 A;  5IZ3 B;  3FGS A;  5I59 A;  4FIM A;  2P0S A;  3SEV A;  4DCY A;  3KSJ A;  4Z0I A;  1IMA A;  1N7W A;  3PMW A;  4QHQ A;  1HSJ A;  1ELJ A;  4OXV A;  1XOC A;  1YAE A;  1AL3 A;  4O3A A;  1JEU A;  3CG1 A;  2WBB A;  5ET8 A;  3MZ9 A;  4Q0C A;  3N94 A;  3SKP A;  2Q8M A;  5TP9 A;  3LSF B;  2XXI A;  1NV6 A;  1CNQ A;  1FQF A;  4NTL A;  3CSG A;  4H1X A;  2DWJ A;  3S2V A;  5DYH A;  4IO3 A;  3G3H A;  3GBB A;  4MBP A;  2PX1 A;  2A5T B;  2QVU A;  4JWO A;  1FBD A;  3BFU A;  3FVG A;  1SYH A;  3O29 A;  2OCU A;  1QJM A;  1NV4 A;  2R71 A;  4KCC A;  2Y84 A;  1EZP A;  2I0C A;  3MP1 A;  1NV7 A;  3IL1 B;  1FPB A;  3U72 A;  3NOH A;  3OO9 A;  4AS4 A;  5AE4 A;  4DI4 B;  2F97 A;  1Y9U A;  2DDK A;  1ZLQ A;  4MAG A;  3CFL A;  3IO4 A;  3K6V A;  1N3W A;  1FQA A;  3KN8 A;  2XXV A;  3VLV A;  4E0X A;  3KFM A;  3T96 B;  4ELR A;  2QFL A;  1VSO A;  3UIF A;  3E78 A;  4R74 A;  1LBV A;  2GHA A;  4ELP A;  5I3S A;  5KDT A;  1QUL A;  1AWB A;  3EQ1 A;  1PB7 A;  3PTY A;  5DVI A;  1NFT A;  5CC2 A;  1MY3 A;  4NQ8 A;  4QBA A;  1DK4 A;  1QGX A;  3RPW A;  4NF6 A;  5CI5 A;  1USY H;  5EQ8 A;  2OBG A;  3HO7 A;  1NV0 A;  3OMB A;  1Y20 A;  3FVK A;  4HS7 A;  1I6Q A;  5DTB A;  5EQ7 A;  1OMP A;  3R26 A;  1B3H A;  2I3V A;  3RNN A;  4F19 A;  1MQD A;  3IB1 A;  3G7W A;  3U1O A;  2ZZX A;  3K0V A;  4GWZ A;  3LSX A;  4ZZE A;  5IAI A;  4DI3 D;  4NF6 B;  2VHA A;  4PGP A;  1OIB A;  5FHO A;  2FNC A;  4ELO A;  1B9J A;  1M5F A;  1B7U A;  1PB8 A;  1N84 A;  4U21 A;  1URG A;  1Y3P A;  4HE0 A;  3MWB A;  3RPL B;  1FQC A;  4NF4 A;  3VE1 B;  5H8S A;  2YLN A;  4ZE9 A;  1NV5 A;  5CMK A;  4IO6 A;  2QS4 A;  1IMD A;  3K6X A;  3S4U A;  4QFN A;  4HW8 A;  1AH5 A;  3C32 A;  1TFA A;  2HXW A;  1LBC A;  4GXS B;  1Q9D A;  4N6P A;  4NGU A;  2XXX A;  2AIX A;  3FUZ A;  3LC8 A;  2H98 A;  2KR0 A;  2ZMB A;  4N6D A;  1SW5 A;  4F3P A;  4DLD A;  2X7P A;  3S9M C;  4PE5 B;  1B1H A;  1NH8 A;  3KSX A;  3ZSF A;  1FQB A;  4O8M A;  1A8F A;  3T9H B;  1J1N A;  3ZKL A;  1P1U A;  5FTI A;  4N8Y A;  3TTR A;  4JSO A;  5H8N B;  3JYR A;  2F7A A;  3IB2 A;  3PPR A;  1MPB A;  5ITO A;  3Q29 A;  3JZJ A;  1B5H A;  1H44 A;  4RA1 A;  1B3L A;  1NUY A;  1B3G A;  3HPI A;  3KBZ A;  1XS5 A;  4XKQ A;  1FTA A;  4X48 A;  1IIT A;  4I62 A;  3IOT A;  2Z8D A;  1IMC A;  1P1Q A;  3TTN A;  5EYG A;  3ONM A;  1D9V A;  1NNT A;  1IMB A;  4ZED A;  4FBP A;  4JXI A;  3L6H A;  3L6G A;  3U94 A;  2GH9 A;  4YKI A;  2OJT A;  4ESW A;  1K9Z A;  1PB9 A;  3R7X A;  3D4C A;  2AL5 A;  1MXX A;  4H5F A;  1UTH A;  1P1W A;  4NN3 A;  3C31 A;  3RUM A;  4YMB A;  2DVC A;  2X7Q A;  3PD8 A;  1B5I A;  4TQU Q;  2IEE A;  4DXB A;  4QSD A;  2DXY A;  2L5V A;  4HE1 A;  4JWY A;  1HSE A;  1FPG A;  4PDD A;  4G61 A;  3WAE A;  3QIM A;  1UIU A;  4IO7 A;  2H25 A;  3RYD A;  3U8Q A;  4F18 A;  4IGT A;  4KFQ A;  2OWZ A;  3E13 X;  3EHT A;  3CR9 A;  4G68 B;  1FBC A;  4GF8 A;  5K2Y A;  3O6I A;  1S50 A;  4GXA A;  4TLM B;  3EN3 A;  1G0H A;  1NUZ A;  1D9Q A;  3TDJ A;  3FIR A;  4GRK A;  2Y5K A;  2ZYN A;  3G3J A;  1MH4 A;  1PBQ A;  3K6W A;  1B32 A;  3UOR A;  5KCJ A;  1MXV A;  1OQG A;  2VPO A;  4HE2 A;  1DPP A;  2QVR A;  4KYS A;  5DT6 A;  2QSX A;  1MM7 A;  3LUZ A;  1ATG A;  4U22 A;  3MVX A;  2QMX A;  1B05 A;  4MNP A;  2V4C A;  3IK6 B;  4IB2 A;  1FPE A;  3PPQ A;  1MRP A;  1FBP A;  3KC0 A;  4H65 A;  4LQ2 A;  3VFJ A;  1FBH A;  3TYH A;  2I0B A;  1NUW A;  3SZP A;  4O3C A;  1YTV A;  1JW1 A;  3V89 B;  3VXC A;  3K01 A;  4KXP A;  5ELV A;  4PFB A;  1DTZ A;  3CHG A;  4IO4 A;  5KCJ B;  4KCD A;  2HAV A;  2B3F A;  1Y1M A;  4FEC A;  2VD3 A;  1IXG A;  2DP8 A;  2O7I A;  4EXK A;  3TQL A;  4N6K A;  5B70 A;  1AOV A;  3KJT A;  3THI A;  1UIV A;  4JB7 A;  1QKA A;  3PGF A;  5ISU A;  1D3K A;  4RNS A;  4KPT A;  2NWJ A;  2UYE A;  3RY3 A;  1FPJ A;  1MXU A;  1FTM A;  1LST A;  3TFL A;  1LAF E;  3TTM A;  1DBZ A;  3IJO B;  4AB5 A;  2ESN A;  1LBX A;  3TCH A;  4QFP A;  4F1U A;  3HV1 A;  4PDH A;  2NVU B;  3CFX A;  4JVI A;  3ISP A;  1YCJ A;  3KOS A;  4C0R A;  5K2X A;  2XD2 A;  4XF5 A;  4DE8 A;  4QFO A;  2HQ0 A;  4E0W A;  3VDF A;  4G8M A;  3QMF A;  3QSL A;  3CFZ A;  4N81 A;  4PBQ A;  4I40 A;  1POY 1;  3SER A;  3T9U A;  4PTK A;  4IY5 A;  2M8C A;  4C1U A;  4OFJ A;  1N76 A;  1YZ0 A;  4N8G A;  4YB7 A;  2PYY A;  3EPE A;  4UAB A;  4I3Y A;  3FJM A;  4GX6 A;  2DVZ A;  4O7I A;  2QS3 A;  4FOR A;  4NG7 A;  3UP9 A;  3I5O A;  3N26 A;  3F11 A;  4DZ1 A;  2ZXT A;  1R1N A;  5TU0 A;  2PMS A;  1FPL A;  4BDL A;  3U93 A;  1MDP 1;  1QW0 A;  4RPO A;  5CMM A;  1NV1 A;  1K9Y A;  1BK4 A;  3G3G A;  2Z22 A;  1SI1 A;  1WVJ A;  1D4N A;  4FAT A;  4MNC A;  1JET A;  1SBP A;  1KA1 A;  4AS5 A;  5JTY B;  1LLS A;  1NV2 A;  1XC1 A;  2RKM A;  1INP A;  4QF9 A;  5EHS A;  1MY4 A;  3E3K A;  4HTG A;  1B5J A;  3PD9 A;  2DE3 A;  3V83 A;  4XKN A;  4QRZ A;  4P0G A;  4ZS9 A;  4EXL A;  2WKY A;  4GVO A;  1AMF A;  2D5W A;  4H45 A;  5FHN A;  1A8E A;  2RCB A;  4GWS A;  4H0W A;  2A5T A;  3R6U A;  4ZDM A;  5FBP A;  1MXW A;  1MPC A;  4LN5 A;  1Q35 A;  4NF8 A;  1MDQ A;  5H8F B;  2HCA A;  3HHF A;  1BKA A;  3OEK A;  4NWD A;  3B6T A;  1XT8 A;  4AB6 A;  2FHY A;  3N5L A;  2X26 A;  4QSC A;  4L17 A;  4MJO A;  2RC7 A;  4GX3 A;  2FBP A;  5A5X B;  4POW A;  1JEV A;  1ZU0 A;  4Q5T A;  4FEB A;  2BJJ X;  4GLI A;  1EZO A;  4NF5 B;  4OTE A;  2OZZ A;  2XHD A;  2B4M A;  2O1M A;  3SEY A;  3RGY A;  1FTL A;  4GBV A;  1PC3 A;  3FZV A;  1DPE A;  3RT6 B;  2THI A;  3H7M A;  4NF8 B;  1LEV A;  5TPA B;  4EQ7 A;  4YU0 A;  1LBB A;  4I1D A;  4XKR A;  3TKD A;  2XA5 A;  2XWV A;  3A29 A;  4R72 A;  1ZMG A;  3H06 B;  1JVY A;  2PFY A;  2ANJ A;  1N0T A;  3CSB A;  1A55 A;  2V93 A;  5ICT A;  4KD5 A;  1FTO A;  3M3K A;  1SW1 A;  2XXQ A;  1KZ8 A;  4FAJ A;  3PV0 E;  3ROJ A;  1M5C A;  2W7Y A;  3IAZ A;  4NE4 A;  3W15 C;  1YYZ A;  1OLC A;  1MH3 A;  1MXZ A;  5I7I A;  3PMX A;  4H6D A;  1BTJ A;  4MNI A;  1NNK A;  4OEU A;  3UA8 A;  1SQY A;  5H8Q B;  3TTK A;  1OVB A;  3B6W A;  3EF7 A;  1FRP A;  4GWU A;  4NED A;  2DXR A;  3GYY A;  2REJ A;  2O69 A;  3CIJ A;  1SVX B;  4R73 A;  1FBG A;  4YMA A;  1EH3 A;  4X1D A;  1MQG A;  3TOD A;  3OO7 A;  5IM2 A;  3IFA A;  1O64 A;  4IR8 A;  5ET5 A;  3PPO A;  4OWD A;  5L9O A;  4U1Z A;  4R2F A;  5I56 A;  1D9Y A;  1ZBM A;  3RPL A;  4TLL B;  2F6P A;  1GVC A;  3ILT B;  4PF8 A;  2HEU A;  2V25 A;  5EYH A;  3WAF A;  1KWH A;  5L9S A;  5HPQ A;  3PMV A;  1B40 A;  1IXC A;  4XTC Q;  3LUY A;  3T22 A;  1ZKB A;  1LFH A;  3TEL A;  1EYK A;  2D3I A;  5AA2 B;  3PPP A;  2CEX A;  5CBR A;  3N6U A;  5CM6 A;  4OVQ A;  4RY1 A;  2CZK A;  3IOU A;  5AA1 A;  5AA4 A;  5I56 B;  4ZEB A;  1CB6 A;  1OVT A;  4QXD A;  4F1V A;  3RLF E;  2P1S A;  3LSL A;  1P1O A;  2F5X A;  1M5E A;  3FBP A;  2B3B A;  3FAT A;  1LB8 A;  3IO6 A;  4JBZ A;  4P56 A;  1MPD A;  1B2H A;  4GFR A;  2FIX A;  5H8N A;  3V8X B;  4ISU A;  3H03 A;  1LGB C;  3RTW B;  3OD7 A;  1LFI A;  4WED A;  3PUZ E;  4PF6 A;  2NOO A;  4F1Y A;  3MVY A;  3H4Z A;  4BDM A;  5DVF A;  4NX1 A;  4GIZ A;  4PFR A;  5AA4 B;  3C34 A;  1JNF A;  3S9N C;  4P8B A;  4ESX A;  4OA4 A;  3DLN A;  5EYF A;  2I3W A;  3EHS A;  3W9V A;  1H76 A;  3B8B A;  4GL8 A;  2O7U A;  3IR1 A;  4OEV A;  2HXR A;  1NNP A;  5B7D A;  2F8D A;  2P2A A;  3FXB A;  4EUO A;  3MVZ A;  4YKK A;  4N07 A;  2QL3 A;  2WYK A;  4KYE A;  2OWT A;  5L8D A;  5HM4 B;  1B4Z A;  4MLV A;  4JSD A;  3MC2 A;  5I2K B;  3RQT A;  4U1O A;  2QJE A;  2XWI A;  3M3L A;  4F2O A;  4U4S A;  3HCQ A;  1VDW A;  4R6Y A;  1VFD A;  4OVT A;  5BUU A;  2WBD A;  3IOR A;  1I6B A;  3AXF A;  2DYX A;  2VT5 A;  4GBW A;  1IXH A;  4WKM A;  3PU5 A;  5I57 B;  3LBS A;  2VD2 A;  3KBR A;  4EF2 A;  4XEQ A;  4MHF A;  1B7H A;  1VR5 A;  4G68 A;  3C36 A;  2XWK A;  4UA8 A;  4F29 A;  4RXL A;  3GZG A;  1BIY A;  4DIG A;  3E79 A;  2RCA A;  3OOA A;  1KA0 A;  3QK6 A;  5CRY A;  1SPI A;  3BBR A;  4OES A;  1URS A;  2ZNU A;  1L5T A;  2O68 A;  2NUV A;  3D1R A;  4OAN A;  3SEW A;  4PAF A;  3N6T A;  4LON B;  3PUX E;  2PBW A;  1H3D A;  4FJP A;  2VP1 A;  2Z23 A;  2GFE A;  2GQ1 A;  4MF3 A;  3VVF A;  3OSQ A;  1FSA A;  4QFK A;  1B0L A;  2V3U A;  3K6U A;  3UK4 A;  2PCR A;  1B7Z A;  1NUX A;  2RF1 A;  1QUJ A;  4R75 A;  4P0I A;  4M4G A;  2H99 A;  3T0J A;  1GV8 A;  1URD A;  3CG3 A;  2Z8E A;  1LAH E;  2I58 A;  1S7Y A;  3DP6 A;  1JW5 A;  4OYV A;  1DMB A;  4ECF A;  4NAP A;  3H3G A;  4ZEC A;  1N04 A;  2YPN A;  4EDP A;  4THI A;  4DCX A;  1MXY A;  1RDZ A;  4OFL A;  1IUD A;  1IXI A;  3IFC A;  2QVV A;  4X9T A;  3VLU A;  1B3E A;  2LAO A;  5ITP A;  4GD5 A;  2F78 A;  1G0I A;  1WOD A;  1NH7 A;  3G3I A;  2R9J A;  2VOZ A;  1SDX A;  3ODB A;  4OVS A;  4TOZ A;  2XXK A;  1I69 A;  2WX9 A;  3FAS A;  1VE4 A;  4R9F A;  2ZYK A;  2RC8 A;  1ZJL A;  3PUV E;  5ET6 A;  2AYS A;  5IZ1 A;  4ELQ A;  2G29 A;  1CE2 A;  1SYI A;  1POT A;  2BJI A;  4GWX A;  4MMP A;  4X1B A;  1QKB A;  4YKP A;  2ONS A;  5BWJ A;  4YKJ A;  3JV9 A;  1MY2 A;  4G8H A;  3GBA A;  3Q25 A;  1FQD A;  3KEI A;  3FV2 A;  3QYT A;  2P3N A;  3MP8 A;  5AA2 D;  1RYO A;  2Y5L A;  4DXC A;  1FPI A;  1R9L A;  3VV5 A;  3RN8 A;  4OEN A;  1B6H A;  3DEL B;  4PE3 A;  3GLB A;  3MPK A;  5CMC A;  4PAI A;  2MKZ A;  4OMB A;  5CMB A;  5M2V A;  3FD3 A;  4R6H A;  4OER A;  3A3C A;  2Q2C A; 
#chains in the Genus database with same CATH homology
 4PP0 A;  2R6G E;  3G3F A;  2ZYO A;  1Y3N A;  3GXA A;  5JTY A;  4MFI A;  2I48 A;  2DWI A;  3O9P A;  1MM6 A;  3S9L C;  4ZEI A;  3G3K A;  1T0K A;  3TZA A;  4RJZ A;  3TQW A;  2E1S A;  3H6V A;  3IOW A;  4G4P A;  4KHZ E;  3BKI B;  4U4X A;  3CVG A;  2Z8F A;  3KGC A;  1LAG E;  2HZK A;  2O51 A;  2OK2 A;  3DP8 A;  2Q8J A;  3KG2 A;  2ONR A;  4R9G A;  3USD A;  2F6G A;  4KR5 A;  1F9B A;  3TCF A;  3O6G A;  5H8F A;  2ZNS A;  3FVO A;  4GWO A;  5H8H A;  1B1X A;  1R6Z A;  4OQO A;  2UVH A;  2DSF A;  2KLF A;  3TPA A;  5A5X A;  3K00 A;  3TCG A;  1H45 A;  1S9T A;  3IJX B;  3CRB A;  2ALU A;  1Y4T A;  3FJG A;  3FXU A;  5LOM A;  5I2N B;  1ZTY A;  2UYF A;  4NF5 A;  5JK4 A;  3VVE A;  1DOT A;  1NKX A;  4PQJ A;  4C1T A;  3KN3 A;  3H6W A;  1Y4C A;  2GRV A;  3SEX A;  5I58 B;  3A3U A;  5TPA A;  2UVG A;  4H5G A;  4OET A;  5H8H B;  1FQE A;  2Y7R A;  4PFY A;  2Q2A A;  3TUS A;  1XVY A;  4WXJ A;  1HSL A;  4JDF A;  1B4H A;  2G93 A;  4Q30 B;  4QSE A;  3PUY E;  3FVN A;  2PT1 A;  3U92 A;  4LZ7 A;  2DWA A;  3I3V A;  4AQ4 A;  3D4G A;  1B52 A;  3HN0 A;  4YB5 A;  2O84 X;  5I59 B;  4EQB A;  2RIN A;  2XX7 A;  4IO5 A;  4ZEK A;  5H8Q A;  1O7T A;  3UN6 A;  2H5Y A;  5DVJ A;  2F35 A;  2DE4 A;  1LAX A;  3MZB A;  3QXM A;  1LFG A;  2Q88 A;  1XHY A;  1A99 A;  1R9Q A;  3PUW E;  2IA4 A;  4N13 A;  5TP9 B;  4U2R A;  3P7I A;  1P99 A;  3ZKK A;  1Y1Z A;  2F36 A;  1UQW A;  1NL5 A;  2Y7P A;  1BP5 A;  3M8U A;  3Q27 A;  3MP6 A;  1B0H A;  3T93 B;  4BLA A;  1A7L A;  1PDA A;  3SET A;  3DM0 A;  4LAT A;  5F7V A;  1GR2 A;  3MPL A;  4F3G A;  1OQH A;  4LQ5 A;  3IOV A;  3T9V A;  1PEB A;  1DTG A;  2V3Q A;  5HBC A;  5I84 A;  4R2B A;  2D21 A;  3CI8 A;  4OVJ A;  2XX8 A;  5AA2 A;  4MLQ A;  3TMG A;  4ZZA A;  3C4M A;  1UTB A;  2Q89 A;  1O63 A;  1VFE A;  1RYX A;  1US5 A;  2HFB A;  3K4U A;  1TXF A;  4H8J A;  1JVX A;  4G8N A;  1II5 A;  3OEM A;  1DSN A;  2XXH A;  3M3F A;  4GOT A;  3K1N A;  3VLW A;  1M5B A;  5KDT B;  1WDN A;  4RYA A;  4G68 C;  1EU8 A;  1UTB B;  5AA3 A;  2H9B A;  4LP2 B;  2CMO A;  4ONY A;  3O2A A;  1USY E;  3SES A;  1QUK A;  1MY1 A;  3OXN A;  3MJN A;  3OSR A;  1ZIU A;  4YZZ A;  3B7D A;  3MBP A;  1TFD A;  3HHG A;  4EQ9 A;  5FHM A;  5CBS A;  2ABH A;  2XXY A;  1MG1 A;  2ONK E;  2VGQ A;  1GTK A;  1QUI A;  1BLF A;  4POX A;  1JW4 A;  1B58 A;  4M1V A;  5DEX A;  1H43 A;  4K3F A;  5I2K A;  3C35 A;  1A40 A;  4H8I A;  1SW4 A;  2XXR A;  3VXB A;  4UAC A;  3OEN A;  3SEU A;  3MVW A;  2DWH A;  3I6V A;  3KN7 A;  4P11 A;  3UGW A;  4HCY A;  3TTL A;  3B6Q A;  4F22 A;  3H6T A;  5I57 A;  4LUB A;  2I4C A;  4NF4 B;  3FV1 A;  5ICQ A;  4YB6 A;  5KZT A;  1P1N A;  3C33 A;  5DEX B;  4GL0 A;  4F31 B;  3A09 A;  2PVU A;  3E9X A;  2CZL A;  2A5S A;  3O97 A;  1TWY A;  2QMW A;  3ILU B;  3O6H A;  4I9D A;  4HCW A;  4Q8R A;  2DS9 A;  1A54 A;  1M5D A;  1LB9 A;  2QS2 A;  1US4 A;  4KI0 E;  1FTK A;  4WEP A;  4DXU A;  1I6A A;  2F7B A;  2QS1 A;  1IQ7 A;  3T9X B;  1B3F A;  4ZEF A;  2XX9 A;  3KJ7 A;  3O66 A;  3S9E A;  5IKB A;  1JQF A;  4BDR A;  3MAM A;  4KQP A;  3O28 A;  1QVS A;  2OLB A;  1B46 A;  1SI0 A;  2Q9T A;  5J1D A;  4IO2 A;  1MQI A;  2QRY A;  4BDQ A;  3ZS6 A;  4ND9 A;  1RKM A;  2NXO A;  2B65 A;  4F39 A;  2AL4 A;  2DQV A;  1FCK A;  2I4B A;  4FED A;  4R6K A;  3OEL A;  1UTH B;  4MH5 A;  2XXW A;  3TAJ A;  4XIG Q;  4NWC A;  3KZG A;  4RK2 A;  1MS7 A;  3KOT A;  3W9W A;  2UXA A;  1LCF A;  4G77 A;  2UVI A;  2F34 A;  2I49 A;  3VVD A;  5F1Q A;  1YPN A;  4F2Q A;  1NNF A;  3LSW A;  2ZNT A;  3Q28 A;  1IIW A;  2O6A A;  2REG A;  1MQH A;  2Y7I A;  3DP4 A;  4ZE8 A;  3K02 A;  4F3B A;  1SD3 A;  3HST A;  1OLA A;  3RT8 A;  1B51 A;  3IB0 A;  2I6E A;  4YIC A;  4XXU A;  4O3B A;  4PET A;  2F7C A;  3FJ7 A;  3MQ9 A;  2DE2 A;  2QPQ A;  4FE8 A;  3T66 A;  4BDO A;  3EHU A;  4PFU A;  1PBP A;  3E4R A;  4IY6 A;  1NMU A;  4OFO A;  4PFW A;  4F3S A;  4U23 A;  4OZ9 A;  2HAU A;  2PT2 A;  3K1M A;  4DDD A;  3K1P A;  2DOJ A;  3IX1 A;  3SDF A;  2UVJ A;  2XXU A;  1N3X A;  5FTH A;  4H67 A;  4LVQ A;  2XD3 A;  4PFT A;  2FA7 A;  4RPN A;  4I8C A;  4JWX A;  2FYI A;  3OO6 A;  2Y7K A;  1FTJ A;  1SW2 A;  5L9M A;  3C9H A;  3MUQ A;  4Z7E A;  3PPN A;  4EF1 A;  1IEJ A;  3FXQ A;  4NMY A;  4RK9 A;  4LZ8 A;  1Z7M E;  4YAH X;  5I2N A;  4IGR A;  3Q26 A;  3K2D A;  4KYD A;  4BDN A;  3FXR A;  1IZ1 A;  3V5A A;  1Y3Q A;  1TT1 A;  2H4I A;  2E0S A;  2GHB A;  1XVX A;  2O1L A;  4GQO A;  2HZL A;  5I58 A;  1ANF A;  3MZ1 A;  1Q1K A;  3QUJ A;  2XXT A;  3QUF A;  3RTF B;  5EHM A;  2V84 A;  2XXP A;  2ZYM A;  4XKP A;  2YJP A;  2OWS A;  3H6U A;  3LR1 A;  3QAX A;  4LZ5 A;  4QFL A;  3OO8 A;  3MW0 A;  1AIV A;  1Z7N E;  1MY0 A;  2Y7W A;  1MQJ A;  2V3T A;  1GGG A;  4OHN A;  3TEP A;  3BFT A;  1FW0 A;  1N7X A;  3ECR A;  1EZ9 A;  2RC9 A;  4G2Z A;  1LCT A;  5JEI A;  4LA9 A;  3FGS A;  5I59 A;  4FIM A;  2P0S A;  3SEV A;  4DCY A;  3KSJ A;  4Z0I A;  3PMW A;  1N7W A;  4QHQ A;  1HSJ A;  1ELJ A;  4OXV A;  1XOC A;  1YAE A;  1AL3 A;  4O3A A;  1JEU A;  3CG1 A;  3MZ9 A;  4Q0C A;  3N94 A;  3SKP A;  5TP9 A;  3LSF B;  2XXI A;  1FQF A;  4NTL A;  3CSG A;  4H1X A;  2DWJ A;  3S2V A;  5DYH A;  4IO3 A;  3G3H A;  3GBB A;  4MBP A;  2PX1 A;  2A5T B;  4JWO A;  3BFU A;  3FVG A;  1SYH A;  3O29 A;  2OCU A;  1QJM A;  2R71 A;  4KCC A;  2Y84 A;  1EZP A;  2I0C A;  3MP1 A;  3IL1 B;  3U72 A;  3OO9 A;  5AE4 A;  2F97 A;  1Y9U A;  3IO4 A;  1ZLQ A;  3K6V A;  3CFL A;  3VLV A;  4E0X A;  1N3W A;  1FQA A;  2XXV A;  3KN8 A;  3KFM A;  3T96 B;  4ELR A;  1VSO A;  3UIF A;  4R74 A;  2GHA A;  4ELP A;  5KDT A;  1QUL A;  3EQ1 A;  1PB7 A;  5DVI A;  1NFT A;  5CC2 A;  1MY3 A;  3RPW A;  4NF6 A;  5CI5 A;  1USY H;  2OBG A;  3HO7 A;  3OMB A;  1Y20 A;  3FVK A;  4HS7 A;  1I6Q A;  5DTB A;  1OMP A;  3R26 A;  1B3H A;  2I3V A;  3RNN A;  4F19 A;  1MQD A;  3IB1 A;  3G7W A;  3U1O A;  3K0V A;  3LSX A;  4ZZE A;  5IAI A;  4NF6 B;  2VHA A;  1OIB A;  5FHO A;  2FNC A;  4ELO A;  1B9J A;  1M5F A;  1B7U A;  1PB8 A;  1N84 A;  4U21 A;  1URG A;  1Y3P A;  3MWB A;  1FQC A;  4NF4 A;  3VE1 B;  5H8S A;  2YLN A;  4ZE9 A;  5CMK A;  4IO6 A;  2QS4 A;  3K6X A;  3S4U A;  4QFN A;  4HW8 A;  1AH5 A;  3C32 A;  1TFA A;  2HXW A;  1LBC A;  4GXS B;  4N6P A;  2XXX A;  2AIX A;  3FUZ A;  3LC8 A;  2H98 A;  2ZMB A;  4F3P A;  1SW5 A;  4DLD A;  2X7P A;  3S9M C;  4PE5 B;  1B1H A;  1NH8 A;  3KSX A;  3ZSF A;  1FQB A;  1A8F A;  3T9H B;  1J1N A;  3ZKL A;  1P1U A;  5FTI A;  3TTR A;  4JSO A;  5H8N B;  3JYR A;  2F7A A;  3IB2 A;  3PPR A;  1MPB A;  5ITO A;  3Q29 A;  3JZJ A;  1B5H A;  1H44 A;  4RA1 A;  1B3L A;  1B3G A;  3HPI A;  1XS5 A;  4XKQ A;  4X48 A;  1IIT A;  4I62 A;  3IOT A;  2Z8D A;  1P1Q A;  3TTN A;  3ONM A;  1D9V A;  1NNT A;  4ZED A;  4JXI A;  3L6H A;  3L6G A;  3U94 A;  2GH9 A;  4YKI A;  2OJT A;  4ESW A;  1PB9 A;  3R7X A;  3D4C A;  2AL5 A;  1MXX A;  4H5F A;  1UTH A;  1P1W A;  3C31 A;  3RUM A;  4YMB A;  2DVC A;  2X7Q A;  3PD8 A;  1B5I A;  4TQU Q;  2IEE A;  4DXB A;  4QSD A;  2DXY A;  4JWY A;  1HSE A;  3WAE A;  3QIM A;  1UIU A;  4IO7 A;  2H25 A;  3U8Q A;  4F18 A;  4IGT A;  4KFQ A;  3E13 X;  3EHT A;  3CR9 A;  4G68 B;  4GF8 A;  5K2Y A;  3O6I A;  1S50 A;  4GXA A;  4TLM B;  3EN3 A;  3TDJ A;  3FIR A;  4GRK A;  2ZYN A;  3G3J A;  1MH4 A;  1PBQ A;  3K6W A;  1B32 A;  3UOR A;  5KCJ A;  1MXV A;  1OQG A;  1DPP A;  4KYS A;  5DT6 A;  2QSX A;  1MM7 A;  4U22 A;  1ATG A;  3MVX A;  2QMX A;  1B05 A;  3IK6 B;  4IB2 A;  3PPQ A;  1MRP A;  4H65 A;  4LQ2 A;  3VFJ A;  3TYH A;  2I0B A;  4O3C A;  1YTV A;  1JW1 A;  3V89 B;  3VXC A;  3K01 A;  5ELV A;  1DTZ A;  4IO4 A;  5KCJ B;  4KCD A;  2HAV A;  2B3F A;  1Y1M A;  4FEC A;  2VD3 A;  1IXG A;  2DP8 A;  2O7I A;  4EXK A;  3TQL A;  5B70 A;  1AOV A;  3KJT A;  3THI A;  1UIV A;  4JB7 A;  1QKA A;  3PGF A;  5ISU A;  1D3K A;  4RNS A;  4KPT A;  2NWJ A;  2UYE A;  3RY3 A;  1MXU A;  1FTM A;  1LST A;  3TFL A;  1LAF E;  3TTM A;  3IJO B;  4AB5 A;  2ESN A;  3TCH A;  4QFP A;  4F1U A;  3HV1 A;  2NVU B;  3CFX A;  1YCJ A;  3KOS A;  4C0R A;  5K2X A;  2XD2 A;  4DE8 A;  4QFO A;  2HQ0 A;  4E0W A;  3VDF A;  4G8M A;  3QSL A;  3CFZ A;  1POY 1;  3SER A;  3T9U A;  4IY5 A;  2M8C A;  4C1U A;  4OFJ A;  1N76 A;  4YB7 A;  2PYY A;  3EPE A;  3FJM A;  2DVZ A;  2QS3 A;  4FOR A;  3UP9 A;  3I5O A;  3N26 A;  3F11 A;  4DZ1 A;  2ZXT A;  1R1N A;  5TU0 A;  2PMS A;  4BDL A;  3U93 A;  1MDP 1;  1QW0 A;  4RPO A;  5CMM A;  3G3G A;  2Z22 A;  1SI1 A;  1WVJ A;  1D4N A;  4FAT A;  1JET A;  1SBP A;  5JTY B;  1LLS A;  1XC1 A;  2RKM A;  4QF9 A;  5EHS A;  1MY4 A;  3E3K A;  4HTG A;  1B5J A;  3PD9 A;  2DE3 A;  3V83 A;  4XKN A;  4QRZ A;  4P0G A;  4ZS9 A;  4EXL A;  2WKY A;  4GVO A;  1AMF A;  2D5W A;  5FHN A;  1A8E A;  2RCB A;  4H0W A;  2A5T A;  3R6U A;  4ZDM A;  1MXW A;  1MPC A;  1Q35 A;  4NF8 A;  1MDQ A;  5H8F B;  2HCA A;  3HHF A;  1BKA A;  3OEK A;  4NWD A;  3B6T A;  1XT8 A;  4AB6 A;  3N5L A;  2X26 A;  4QSC A;  4L17 A;  2RC7 A;  5A5X B;  4POW A;  1JEV A;  1ZU0 A;  4Q5T A;  4FEB A;  2BJJ X;  4GLI A;  1EZO A;  4NF5 B;  4OTE A;  2OZZ A;  2XHD A;  2O1M A;  3SEY A;  3RGY A;  1FTL A;  1PC3 A;  3FZV A;  1DPE A;  3RT6 B;  2THI A;  3H7M A;  4NF8 B;  5TPA B;  4EQ7 A;  4YU0 A;  1LBB A;  4I1D A;  4XKR A;  3TKD A;  4R72 A;  1ZMG A;  3H06 B;  1JVY A;  2ANJ A;  1N0T A;  3CSB A;  1A55 A;  2V93 A;  5ICT A;  4KD5 A;  1FTO A;  3M3K A;  1SW1 A;  2XXQ A;  4FAJ A;  3PV0 E;  1M5C A;  2W7Y A;  3IAZ A;  4NE4 A;  3W15 C;  1OLC A;  1MH3 A;  1MXZ A;  3PMX A;  4H6D A;  1BTJ A;  1NNK A;  4OEU A;  3UA8 A;  1SQY A;  5H8Q B;  3TTK A;  1OVB A;  3B6W A;  3EF7 A;  4NED A;  2DXR A;  2REJ A;  2O69 A;  3CIJ A;  1SVX B;  4R73 A;  4YMA A;  1EH3 A;  4X1D A;  1MQG A;  3TOD A;  3OO7 A;  1O64 A;  3PPO A;  4OWD A;  5L9O A;  4U1Z A;  4R2F A;  5I56 A;  1D9Y A;  1ZBM A;  4TLL B;  2F6P A;  1GVC A;  3ILT B;  2HEU A;  2V25 A;  3WAF A;  1KWH A;  5L9S A;  5HPQ A;  3PMV A;  1B40 A;  1IXC A;  4XTC Q;  3LUY A;  3T22 A;  1ZKB A;  1LFH A;  3TEL A;  2D3I A;  5AA2 B;  3PPP A;  5CBR A;  3N6U A;  5CM6 A;  4RY1 A;  3IOU A;  5AA1 A;  5AA4 A;  5I56 B;  4ZEB A;  1CB6 A;  1OVT A;  4F1V A;  3RLF E;  2P1S A;  3LSL A;  1P1O A;  2F5X A;  1M5E A;  2B3B A;  3FAT A;  1LB8 A;  3IO6 A;  4JBZ A;  1MPD A;  1B2H A;  4GFR A;  5H8N A;  3V8X B;  4ISU A;  3H03 A;  1LGB C;  3RTW B;  3OD7 A;  1LFI A;  4WED A;  3PUZ E;  2NOO A;  4F1Y A;  3MVY A;  3H4Z A;  4BDM A;  5DVF A;  4GIZ A;  5AA4 B;  3C34 A;  1JNF A;  3S9N C;  4ESX A;  3DLN A;  5EYF A;  2I3W A;  3EHS A;  3W9V A;  1H76 A;  4GL8 A;  2O7U A;  3IR1 A;  4OEV A;  1NNP A;  5B7D A;  2F8D A;  2P2A A;  4EUO A;  3MVZ A;  4YKK A;  4N07 A;  2QL3 A;  4KYE A;  2OWT A;  5L8D A;  5HM4 B;  1B4Z A;  4MLV A;  4JSD A;  3MC2 A;  5I2K B;  3RQT A;  4U1O A;  2QJE A;  3M3L A;  4F2O A;  4U4S A;  3HCQ A;  4R6Y A;  1VFD A;  5BUU A;  3IOR A;  1I6B A;  3AXF A;  2DYX A;  1IXH A;  4WKM A;  3PU5 A;  5I57 B;  3LBS A;  2VD2 A;  3KBR A;  4EF2 A;  1B7H A;  1VR5 A;  4G68 A;  3C36 A;  4F29 A;  4UA8 A;  4RXL A;  3GZG A;  1BIY A;  4DIG A;  2RCA A;  3OOA A;  3QK6 A;  5CRY A;  3BBR A;  4OES A;  1URS A;  2ZNU A;  1L5T A;  2O68 A;  2NUV A;  3SEW A;  3N6T A;  4LON B;  3PUX E;  2PBW A;  1H3D A;  4FJP A;  2VP1 A;  2Z23 A;  2GFE A;  4MF3 A;  3VVF A;  3OSQ A;  4QFK A;  1B0L A;  2V3U A;  3K6U A;  3UK4 A;  1B7Z A;  2RF1 A;  1QUJ A;  4R75 A;  4P0I A;  4M4G A;  2H99 A;  1GV8 A;  1URD A;  3CG3 A;  2Z8E A;  1LAH E;  2I58 A;  1S7Y A;  3DP6 A;  1JW5 A;  4OYV A;  1DMB A;  4ECF A;  3H3G A;  4ZEC A;  1N04 A;  2YPN A;  4EDP A;  4THI A;  4DCX A;  1MXY A;  4OFL A;  1IUD A;  1IXI A;  4X9T A;  3VLU A;  1B3E A;  2LAO A;  5ITP A;  4GD5 A;  2F78 A;  1WOD A;  1NH7 A;  3G3I A;  2R9J A;  2VOZ A;  1SDX A;  3ODB A;  4TOZ A;  1I69 A;  3FAS A;  1VE4 A;  4R9F A;  2ZYK A;  2RC8 A;  1ZJL A;  3PUV E;  2AYS A;  4ELQ A;  2G29 A;  1CE2 A;  1SYI A;  1POT A;  4X1B A;  1QKB A;  4YKP A;  2ONS A;  5BWJ A;  4YKJ A;  3JV9 A;  1MY2 A;  4G8H A;  3GBA A;  3Q25 A;  1FQD A;  3KEI A;  3FV2 A;  3QYT A;  3MP8 A;  5AA2 D;  1RYO A;  4DXC A;  1R9L A;  3VV5 A;  3RN8 A;  4OEN A;  1B6H A;  3DEL B;  3GLB A;  3MPK A;  5CMC A;  4OMB A;  5CMB A;  5M2V A;  3FD3 A;  4R6H A;  4OER A;  3A3C A;  2Q2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...