3G3KA

Crystal structure of the glur6 ligand binding domain dimer i442h k494e k665r i749l q753k e757q mutant with glutamate and nacl at 1.24 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
253
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTHLGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKRSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITLAILKLQEQGLHMMKEKWWRGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 88
structure length 253
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3kA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3kA02
1JQFA 5B70A 2QRYA 3MVYA 4RA1A 2DXRA 1AH5A 1SW1A 5I59A 4GL8A 3C32A 4P0IA 4LZ5A 2AIXA 3G3KA 3HHFA 2ONRA 4R9GA 3IB0A 2REGA 2Y7KA 1SI1A 5AA2B 1Y1MA 3S4UA 4ZECA 3FVGA 5CMMA 4GL0A 5IKBA 3MVWA 5ICQA 3OMBA 3ECRA 5I2NA 5JTYA 4HTGA 2OLBA 2B65A 1MXWA 1SDXA 3OXNA 1IQ7A 2D3IA 2OJTA 2GFEA 4E0XA 2DWAA 4FAJA 1B5IA 4M4GA 2XX8A 3S2VA 4GXSB 3UP9A 1AIVA 4GXAA 1HSLA 4RNSA 4F2OA 3CSGA 3S9MC 1MDQA 1MY1A 3H3GA 4XIGQ 2THIA 3EHUA 4ZS9A 4OFOA 3HN0A 1ZKBA 3TTRA 3O97A 1Y4TA 2OBGA 1OLCA 4NWCA 3CI8A 2ZYKA 1FQAA 2IA4A 1TT1A 1EZ9A 3QUJA 1UTHB 1PEBA 1MM7A 3QXMA 1YAEA 4U21A 4IO2A 2R71A 1MXZA 1D3KA 4ZEKA 1SD3A 3OENA 1UIUA 2D5WA 1MPBA 2H9BA 4U1ZA 2HAVA 3LUYA 4KCCA 3T9VA 4DXCA 3RPWA 4OMBA 4FJPA 3UGWA 2X26A 3HO7A 4MH5A 3FGSA 3MQ9A 2DWJA 2I0CA 1Z7NE 4LONB 1MQJA 4ZE9A 2VHAA 4G8NA 3M3LA 3FXUA 2F6PA 4ELPA 2Q9TA 3KOSA 4Q5TA 1B05A 4AB5A 4KYEA 4ZZAA 1OMPA 4NF8A 3BFUA 1QUJA 2UVJA 3MUQA 3KN7A 4YKKA 2CZLA 2XXVA 1S50A 2GHBA 3DP8A 4IO5A 1DPPA 1LAHE 4BDQA 3IB1A 1KWHA 3VFJA 3IL1B 3SEYA 2HCAA 2O6AA 3KJTA 2ALUA 1FTKA 4Z0IA 2QL3A 2VP1A 3T93B 1BIYA 3B6TA 3UN6A 1OIBA 3O28A 1N3XA 2HZKA 1FQBA 2OWSA 1PBQA 1NL5A 2Q2CA 3G3JA 2ONKE 1XHYA 2DWIA 4EQBA 3OO8A 4KI0E 4R2FA 5K2YA 3RUMA 4R6YA 4XKRA 4U22A 4PFWA 1NMUA 2PT1A 2AL4A 2V25A 5TU0A 2V3UA 4YKPA 1RYOA 4MBPA 1LBCA 2RCAA 3I3VA 1MH4A 3V8XB 4DZ1A 1LBBA 4WKMA 2Y7WA 4KD5A 3C33A 2DVCA 3MZ1A 3G3HA 4U2RA 4F1VA 1BTJA 1IIWA 3UA8A 1SBPA 1N04A 1TWYA 1B1XA 3H4ZA 2AL5A 2XXXA 4E0WA 3FUZA 4WXJA 1P1UA 1US5A 4JDFA 2I49A 1PB9A 3C9HA 2HZLA 1ELJA 3PV0E 4OVJA 3MBPA 3C34A 3TTLA 4R73A 4TLLB 3ZS6A 3VV5A 2KLFA 1IUDA 3E3KA 3N94A 2V93A 4PE5B 5I2KB 4QFLA 1IXGA 4G8HA 4OTEA 1USYH 3GXAA 3ODBA 4NF6B 3LSWA 3IJXB 2QPQA 5A5XA 4GWOA 3TCGA 1OVBA 3LBSA 1P99A 2VGQA 5HM4B 2NUVA 2O1LA 3K4UA 3MP6A 2VD3A 4IO7A 4IO6A 4IB2A 1Y1ZA 4IGRA 3B7DA 4G4PA 3AXFA 1FQFA 3U92A 5EYFA 4H0WA 5H8FA 3CIJA 3Q27A 2ZXTA 4YKJA 1N76A 4H5GA 3HCQA 3PMXA 4R6KA 3OD7A 3T9HB 4U4SA 4BDMA 1D9VA 3K6UA 4OYVA 1M5EA 5B7DA 2DYXA 5H8SA 3QYTA 2DE3A 1MY2A 5DTBA 2I3VA 3Q29A 1JNFA 2PX1A 5L8DA 3RTWB 3MVZA 4YKIA 1PB7A 3RLFE 2RKMA 3HV1A 1EZOA 3E4RA 3TKDA 3N5LA 1LAGE 3I6VA 4OEUA 3VVEA 1MPCA 1B0LA 1FTLA 4G77A 4X9TA 3W9WA 2IEEA 4OWDA 1JW1A 4JWOA 4EF2A 2BJJX 1B52A 1R6ZA 4O3CA 4JWYA 3RN8A 1B5HA 3K01A 1B3GA 3TZAA 3O6IA 3HHGA 1Q35A 3OO9A 3VE1B 3CG3A 2YJPA 1I6AA 3IOVA 1OLAA 3MPKA 1DMBA 2PBWA 1QKBA 3EN3A 4JWXA 1DPEA 5H8QB 2PYYA 2QS1A 1A7LA 1MXVA 1ZLQA 4ELQA 3MC2A 1JETA 4IO3A 4NMYA 4BDRA 3SESA 1POTA 4DXUA 2B3FA 4OXVA 5CBSA 3LSXA 4M1VA 3U8QA 1XT8A 1O63A 4LZ8A 3PUXE 3MWBA 3JZJA 3OO6A 5AA2D 1O64A 1UIVA 3VVFA 5L9OA 4EQ9A 3IOWA 3DP6A 3H06B 5CRYA 3TQWA 3MZBA 2ZMBA 4LP2B 3N6UA 3FD3A 3BFTA 1MY4A 1NNPA 1H43A 2HQ0A 4H65A 1NH7A 1BLFA 2O7IA 1URDA 3TDJA 3EPEA 3JV9A 2HAUA 3P7IA 1LB9A 5I57A 1I6BA 2XXUA 1R1NA 3G3IA 2H98A 4Q30B 2P1SA 3IORA 2F78A 3Q28A 1OVTA 5DT6A 1LFHA 2I58A 2DSFA 4GLIA 1Y4CA 3MPLA 4OETA 1GV8A 4YZZA 4TLMB 2DP8A 1DTZA 3WAEA 2E1SA 4DIGA 4DCXA 1DSNA 1GGGA 2NOOA 2DWHA 1MM6A 5I56B 3ZSFA 2PT2A 3TODA 1QULA 2X7PA 5K2XA 3TTNA 2XXTA 4R9FA 2H4IA 1A54A 3KEIA 1M5FA 4F31B 1LCFA 1A99A 4RPNA 3RQTA 4EXLA 3CR9A 1B2HA 3K02A 3KSXA 1PDAA 1US4A 3PUVE 1HSEA 1MDP1 4RYAA 2NVUB 4F1YA 1B51A 5KZTA 4NE4A 5CI5A 3U93A 1I6QA 4N07A 4U23A 1FCKA 5EHSA 4IO4A 3PPPA 3FVOA 4DXBA 2XXYA 1R9QA 2R9JA 4DLDA 2VD2A 1VFDA 4O3AA 4FORA 2F5XA 4QSEA 3T9UA 4YB5A 1MY0A 3UIFA 2DE4A 1LB8A 4LQ5A 1UTBA 2HFBA 3SEXA 4NEDA 2DXYA 1H44A 3S9NC 2ZNTA 2REJA 4I8CA 1ZBMA 1NFTA 1POY1 4X1BA 2UVHA 1L5TA 2UYFA 1H3DA 2H25A 2ZNUA 4OHNA 1M5DA 1AL3A 1LSTA 1LGBC 3QAXA 4FECA 1CB6A 3O66A 3EQ1A 3B6WA 2RCBA 5KDTB 3PD9A 4GFRA 4OFJA 3W15C 1JVXA 5CBRA 1IXIA 5CMCA 1SYIA 4POWA 1B7HA 5AA4B 2Y7RA 1XOCA 1BKAA 4OERA 5IAIA 1LFGA 3FV2A 3W9VA 2V3QA 2A5SA 5AA2A 4XXUA 3TTKA 1II5A 1MXUA 4ZEDA 4C0RA 2OCUA 3ONMA 1N7XA 4F19A 3MJNA 2B3BA 1XVXA 4NF5B 1ANFA 1HSJA 3O6HA 3SERA 1LFIA 2Y84A 1SW5A 3K2DA 4LQ2A 3M3KA 1B7ZA 4KQPA 1FW0A 2XHDA 4LATA 4U4XA 1USYE 3MP8A 2G93A 5I84A 2QS4A 4JSDA 1Y3NA 3IR1A 4H5FA 3CG1A 3ILUB 4H8IA 4R2BA 3CVGA 2I6EA 4H1XA 5I56A 4R6HA 3EF7A 1GTKA 3SEUA 3QUFA 1PC3A 4F18A 2Z23A 4ONYA 4RK9A 4F1UA 3K6WA 5BUUA 4F3SA 4UA8A 5J1DA 1B46A 3KBRA 2XD3A 2Q8JA 5H8NB 1YCJA 2GH9A 1IZ1A 3G3GA 4PQJA 2QS2A 1B3EA 1MY3A 1M5CA 4H8JA 1UTHA 3OEKA 3GBBA 2F8DA 3R7XA 4HS7A 2Q2AA 3Q26A 3EHTA 4I9DA 4HCWA 4BLAA 1B3LA 3KJ7A 2H5YA 1J1NA 1ATGA 2ZYNA 4OENA 4GD5A 3L6GA 1H45A 3IO6A 1Y3PA 1WDNA 2FYIA 4Z7EA 5FHNA 3RT6B 3HPIA 1CE2A 1O7TA 1S9TA 1N7WA 1JEVA 2Z8EA 1Y3QA 1SW2A 4MLQA 5ELVA 3TQLA 1QJMA 2YLNA 3O29A 5AA3A 2F7BA 4GOTA 3H6VA 1D9YA 5ISUA 1SQYA 3S9LC 3KOTA 1B3FA 3L6HA 5AA1A 3ZKLA 4I1DA 4XTCQ 3C35A 3CFLA 1B32A 5CMKA 1Y9UA 1BP5A 3EHSA 5I59B 3RTFB 3KFMA 4IY6A 4EQ7A 1MH3A 3H6TA 4PFUA 5CM6A 3BBRA 3U72A 1JEUA 3O9PA 3KN3A 3PUYE 4POXA 1TFDA 4EF1A 3G3FA 3M8UA 4YU0A 2NXOA 1D4NA 1UQWA 4BDOA 4F3GA 2UVIA 4LZ7A 4R75A 1A8EA 1ZU0A 2I3WA 3PPRA 2ESNA 5I2NB 5JTYB 2O1MA 3USDA 3U94A 5JEIA 3K1MA 5H8HB 2F7AA 1TFAA 4ZEIA 3KZGA 1XC1A 3N6TA 5HPQA 3IOTA 4DE8A 1Q1KA 5ITOA 4FATA 3RNNA 1NNFA 2ONSA 4X1DA 2ABHA 2F34A 5L9MA 3RGYA 4QSDA 3PD8A 4H6DA 5FTIA 3DELB 4L17A 3FZVA 2O7UA 3T66A 3V89B 4YMBA 3LC8A 2XXIA 3PU5A 4BDNA 4RY1A 3TELA 3DP4A 4ESWA 4GQOA 3FVKA 2X7QA 5EHMA 4P11A 2OK2A 3KGCA 1QKAA 4RPOA 3V83A 5FTHA 3OSQA 4ZE8A 2DOJA 3LR1A 1P1WA 1GVCA 3RT8A 2A5TB 3TYHA 4PFYA 4XKPA 3D4GA 5CMBA 1B7UA 4N13A 4X48A 3VLUA 3C36A 5LOMA 1MQDA 3THIA 2DQVA 1VE4A 3MVXA 3CFZA 4XKQA 1S7YA 1IEJA 2FA7A 1YPNA 5I2KA 1IITA 3MAMA 2FNCA 4QRZA 4ZZEA 2O68A 1WODA 2XXPA 4ECFA 2W7YA 4NF6A 4ISUA 5DVFA 1SYHA 4FEBA 3H03A 1VR5A 3DM0A 3PUWE 4NF8B 4F2QA 1B4ZA 2I0BA 2RC9A 4F22A 1FQDA 1LCTA 4I62A 4ZEFA 2QJEA 3GLBA 3OELA 2XXWA 1XVYA 4DDDA 5FHMA 4MLVA 3K1PA 5KCJB 3E9XA 4OESA 3OEMA 1LLSA 4KFQA 4KPTA 3ILTB 3T9XB 3SEVA 1DTGA 2XX7A 3FIRA 3LSFB 3PPOA 3VXBA 4C1UA 5DYHA 1EU8A 5H8HA 4NF4B 4OFLA 1B9JA 4QFPA 4O3BA 4GVOA 4QF9A 1N3WA 2WKYA 2NWJA 4EUOA 1DOTA 2I48A 4U1OA 4K3FA 4NWDA 3HSTA 3UORA 2XX9A 1NNKA 1ZTYA 1QUIA 1OQGA 1B3HA 1QVSA 1IXHA 2QMXA 5FHOA 3H6UA 5AE4A 2V3TA 1QUKA 3IK6B 2H99A 1SVXB 2OWTA 5DEXB 5TPAB 3MW0A 1N0TA 3UK4A 3FXRA 2GHAA 1Z7ME 3KSJA 4NTLA 2AYSA 5TP9B 4G68B 3R26A 3O2AA 2Z8FA 3M3FA 4Q8RA 4QFOA 4IY5A 2DS9A 3S9EA 1RYXA 2QSXA 3A3UA 4TQUQ 2A5TA 3IJOB 5H8QA 2PVUA 1NKXA 3OO7A 4AQ4A 4MF3A 1JVYA 4KYDA 2ZYOA 1MRPA 3TFLA 2F36A 3LSLA 3FJGA 1FTOA 4F3PA 1A8FA 4THIA 1B4HA 4GF8A 4YMAA 4F39A 1AMFA 4R72A 2VOZA 1MPDA 3G7WA 1OQHA 1R9LA 4ZEBA 3KG2A 1URSA 2Y7PA 2LAOA 3TMGA 4KR5A 4UACA 5I58B 3QSLA 1VFEA 5A5XB 2HEUA 2DE2A 2OZZA 3E13X 2XXHA 3VDFA 3CRBA 2RINA 4F29A 4G8MA 5KCJA 3PMWA 4XKNA 4QHQA 3PUZE 2Y7IA 5ICTA 3TTMA 5H8FB 3PMVA 1B58A 3PPNA 1EH3A 3PGFA 4QFNA 3FV1A 3ZKKA 4NF4A 2RF1A 3GZGA 3T22A 3N26A 3SKPA 3QIMA 3OSRA 1A40A 4C1TA 1LAFE 4JB7A 3DLNA 4JSOA 4LVQA 4OQOA 3BKIB 2QMWA 4YICA 4YAHX 4JXIA 5ITPA 3V5AA 3I5OA 3A3CA 4QFKA 2I4CA 4OEVA 1SW4A 3MZ9A 2HXWA 1A55A 5DEXA 3A09A 5TPAA 2ANJA 3SEWA 2XXRA 3TEPA 4WEPA 3Q25A 3JYRA 1YTVA 4RK2A 4FIMA 1B6HA 3K00A 5TP9A 4G68A 1VSOA 3TUSA 4ND9A 2F35A 3IB2A 2ZNSA 3WAFA 3QK6A 2F97A 3C4MA 3O6GA 1NH8A 3TCFA 5F7VA 4HW8A 4H67A 3H7MA 2Q89A 5CC2A 1QW0A 4KHZE 4LUBA 1JW5A 3T96B 3OOAA 4ESXA 4DCYA 2YPNA 4TOZA 1SI0A 4R74A 3VXCA 2P2AA 2Z22A 4EXKA 4KCDA 2Q88A 5KDTA 1B40A 3TCHA 1MQIA 1FTJA 1MQHA 2E0SA 1FTMA 2O51A 2I4BA 2DVZA 3TPAA 2ZYMA 5AA4A 2XXQA 3CFXA 4WEDA 4P0GA 2R6GE 3R6UA 2G29A 4KYSA 1P1NA 1ZMGA 5I58A 4PETA 1H76A 1PB8A 1Y20A 1F9BA 2CMOA 4YB7A 4NF5A 4GRKA 5DVJA 1MG1A 2RC7A 1T0KA 4G2ZA 3K6XA 5HBCA 1FQEA 1XS5A 2UYEA 4AB6A 3KN8A 3IAZA 3RY3A 5I57B 3K1NA 1MQGA 3B6QA 2XD2A 1MXXA 3F11A 2P0SA 1WVJA 4ELOA 2M8CA 1FQCA 3IX1A 2O84X 3K6VA 2UXAA 4RXLA 5M2VA 1URGA 3GBAA 4PP0A 4JBZA 3FJMA 5F1QA 3CSBA 3FVNA 3VLVA 3IO4A 1EZPA 3FATA 4FEDA 1MXYA 5L9SA 3FJ7A 2D21A 3VLWA 5JK4A 1M5BA 5H8NA 2F7CA 4OZ9A 1P1OA 4QSCA 2F6GA 1TXFA 1NNTA 3FXQA 1B0HA 4BDLA 4PFTA 4EDPA 5BWJA 4F3BA 1B1HA 3TAJA 3H6WA 4N6PA 4RJZA 4ZDMA 1GR2A 2UVGA 3K0VA 1IXCA 4Q0CA 4IGTA 1AOVA 1ZJLA 1PBPA 2RC8A 1ZIUA 4G68C 3D4CA 1N84A 3SETA 4MFIA 1I69A 2GRVA 3FASA 3SDFA 3PPQA 1UTBB 2Z8DA 1MS7A 1JW4A 4HCYA 4YB6A 3U1OA 1RKMA 4ELRA 3IOUA 1LAXA 4LA9A 2QS3A 2O69A 1P1QA 2PMSA 5DVIA 4FE8A 4GIZA 3C31A 3MP1A 1B5JA 3VVDA 2V84A
chains in the Genus database with same CATH superfamily
2VT5A 1JQFA 5B70A 2QRYA 3MVYA 4RA1A 4NGUA 2DXRA 1AH5A 1SW1A 5I59A 4GL8A 3C32A 4P0IA 4LZ5A 2AIXA 3G3KA 3HHFA 2ONRA 4R9GA 3IB0A 2REGA 2VPNA 2Y7KA 1SI1A 5AA2B 5I7IA 1Y1MA 4PE3A 3S4UA 4ZECA 3FVGA 1NV1A 5CMMA 4GL0A 5IKBA 3MVWA 5FBPA 5ICQA 3OMBA 3ECRA 5I2NA 5JTYA 4HTGA 2OLBA 2B65A 1MXWA 1SDXA 4PAKA 3OXNA 1IQ7A 2D3IA 4PTKA 2OJTA 2GFEA 4E0XA 4MHFA 2DWAA 4FAJA 2F3BA 1B5IA 4M4GA 4H46A 2XX8A 3S2VA 4GXSB 3UP9A 1AIVA 4GXAA 1HSLA 4RNSA 4F2OA 2FIXA 1INPA 3CSGA 3S9MC 1MDQA 1MY1A 3H3GA 4XIGQ 2FBPA 2THIA 3EHUA 4ZS9A 4OFOA 3HN0A 1ZKBA 3ISPA 3TTRA 3O97A 1Y4TA 2OBGA 5IZZA 1OLCA 4NWCA 3CI8A 2ZYKA 1FQAA 2IA4A 1TT1A 1EZ9A 3QUJA 4O8MA 1UTHB 4MNPA 4HE1A 1PEBA 1MM7A 3QXMA 1YAEA 4U21A 4IO2A 1KZ8A 4JVDA 2R71A 1MXZA 1D3KA 4ZEKA 2DDKA 1SD3A 3OENA 1UIUA 2D5WA 5EQ9A 1MPBA 2H9BA 4U1ZA 2HAVA 3LUYA 4KCCA 3T9VA 4DXCA 3RPWA 4OMBA 4FJPA 3UGWA 2X26A 3HO7A 4OANA 4MH5A 3FGSA 3MQ9A 2DWJA 2I0CA 1Z7NE 1YYZA 4GWSA 2MKZA 4LONB 1MQJA 1K9YA 4ZE9A 2VHAA 4G8NA 3M3LA 3FXUA 2F6PA 4ELPA 2Q9TA 4NQ8A 3KOSA 4Q5TA 1B05A 4AB5A 3FXBA 4KYEA 4ZZAA 1OMPA 4NF8A 3BFUA 1QUJA 2HXRA 4N6KA 2UVJA 3MUQA 3B50A 3KN7A 4GWYA 4YKKA 2CZLA 2XXVA 1S50A 2GHBA 1EYIA 3DP8A 1DBZA 4IO5A 2BJIA 1DPPA 1LAHE 4BDQA 3IB1A 1KWHA 4PAIA 3VFJA 3IL1B 3SEYA 2HCAA 2O6AA 3KC1A 3KJTA 2ALUA 2XXKA 1FTKA 4Z0IA 2QL3A 2VP1A 4P56A 3T93B 1BIYA 3B6TA 3UN6A 1OIBA 4LN5A 3O28A 1N3XA 2HZKA 5I3SA 1FQBA 2Y5LA 2OWSA 1FJ9A 1PBQA 1NL5A 2Q2CA 3G3JA 1EYKA 2ONKE 1XHYA 2DWIA 1FBGA 4JVCA 4EQBA 3OO8A 4KI0E 4R2FA 5K2YA 3RUMA 4R6YA 4XKRA 4U22A 4PFWA 1NMUA 4O7IA 2PT1A 2AL4A 2V25A 5TU0A 2V3UA 4YKPA 1RYOA 4MBPA 4OA4A 1LBCA 2RCAA 3I3VA 2V4CA 1FPFA 5IM2A 5EYHA 1MH4A 3V8XB 4JVIA 4DZ1A 1LBBA 4WKMA 3E79A 2Y7WA 4KD5A 2FHYA 3C33A 4OVSA 2DVCA 1NV0A 3MZ1A 3G3HA 4U2RA 4F1VA 1BTJA 3NOHA 1IIWA 3UA8A 1SBPA 4AS4A 1N04A 1TWYA 1B1XA 3H4ZA 2AL5A 2WX9A 2XXXA 4E0WA 1LBVA 3FUZA 4WXJA 1P1UA 1US5A 4G61A 4JDFA 2I49A 1PB9A 3C9HA 2HZLA 3A29A 1ELJA 3PV0E 4OVJA 3MBPA 3C34A 3TTLA 4R73A 4TLLB 3ZS6A 4PCDA 3VV5A 2KLFA 1IUDA 3E3KA 3N94A 2V93A 4PE5B 5I2KB 4QFLA 1IXGA 4G8HA 4OTEA 1USYH 3GXAA 3ODBA 4NF6B 3LSWA 3IJXB 2QPQA 5A5XA 4GWOA 3TCGA 1OVBA 3LBSA 1P99A 1IMBA 2VGQA 4NAPA 2NUVA 5HM4B 2O1LA 3K4UA 3MP6A 2VD3A 4IO7A 4IO6A 1FSAA 4IB2A 4P1LA 1NV6A 4PDHA 1FBEA 1Y1ZA 4IGRA 3B7DA 4G4PA 3AXFA 1FQFA 3U92A 5EYFA 4H0WA 5H8FA 3CIJA 1FJ6A 4OVRA 3Q27A 2ZXTA 4MIJA 4YKJA 3B8BA 1N76A 4H5GA 3HCQA 3PMXA 4R6KA 3OD7A 3T9HB 4U4SA 3SZPA 4BDMA 4P47A 1D9VA 3K6UA 4OYVA 1M5EA 5A5LA 5B7DA 2DYXA 5H8SA 3QYTA 2DE3A 4QBAA 1MY2A 5DTBA 2I3VA 4GBWA 3Q29A 1JNFA 2PX1A 5L8DA 3RTWB 3MVZA 4MAGA 4YKIA 1PB7A 3RLFE 2RKMA 3HV1A 1EZOA 2KR0A 3E4RA 3RYDA 3TKDA 3N5LA 1LAGE 3I6VA 4OEUA 3FBPA 3VVEA 1MPCA 1B0LA 4X8RA 1FTLA 4G77A 3T1BA 4X9TA 3W9WA 2IEEA 4OWDA 1JW1A 4JWOA 4EF2A 2BJJX 1B52A 1BK4A 1R6ZA 4O3CA 4JWYA 3RN8A 1B5HA 3K01A 4MX6A 1B3GA 3TZAA 3O6IA 3HHGA 4GWUA 1Q35A 3OO9A 3VE1B 3CG3A 4MNIA 2YJPA 1I6AA 3IOVA 1OLAA 1CNQA 3MPKA 1DMBA 2PBWA 1QKBA 3EN3A 4JWXA 1DPEA 5H8QB 1FPIA 2PYYA 4MJOA 5IZ1A 2QS1A 1A7LA 1MXVA 1ZLQA 4N6DA 4ELQA 3MC2A 1JETA 4IO3A 4NMYA 4BDRA 3SESA 1POTA 4DXUA 2B3FA 4OXVA 4PF8A 5CBSA 3LSXA 2Q8MA 4M1VA 3U8QA 1XT8A 1O63A 4LZ8A 3PUXE 3MWBA 4N15A 3JZJA 3OO6A 5AA2D 1O64A 1UIVA 3VVFA 5L9OA 4EQ9A 3IOWA 3DP6A 1RDYA 4P1EA 3H06B 5CRYA 3TQWA 3MZBA 2ZMBA 4LP2B 3N6UA 3FD3A 3BFTA 1XI6A 1MY4A 1NNPA 1H43A 2HQ0A 4H65A 1NH7A 1BLFA 2O7IA 2QFLA 1URDA 1YZ0A 3TDJA 3EPEA 3JV9A 2HAUA 3P7IA 1LB9A 5I57A 1I6BA 1FBHA 2Y5KA 2XXUA 3E78A 1G0IA 2QVUA 1R1NA 3G3IA 5T3JA 2H98A 4Q30B 5DW8A 2P1SA 3IORA 2F78A 3Q28A 1OVTA 5DT6A 3U65A 1LFHA 2I58A 2DSFA 1K9ZA 4GLIA 1Y4CA 3MPLA 4OETA 1GV8A 4YZZA 4TLMB 1IMFA 2DP8A 1DTZA 3WAEA 2E1SA 5EQ8A 3IFAA 4DIGA 4DCXA 1DSNA 1GGGA 3BIHA 2NOOA 2DWHA 1MM6A 5I56B 3ZSFA 2PT2A 3TODA 1QULA 2X7PA 5K2XA 3TTNA 2XXTA 4R9FA 2H4IA 1A54A 2WEFA 1M5FA 3KEIA 4F31B 1LCFA 1A99A 5F24A 4RPNA 3RQTA 4EXLA 3CR9A 1B2HA 3K02A 3KSXA 1PDAA 1US4A 3PUVE 1HSEA 1MDP1 4XFEA 4RYAA 2NVUB 5IZ3B 4F1YA 1B51A 4KXPA 5KZTA 4NG7A 4NE4A 5CI5A 3U93A 1I6QA 4N07A 4U23A 1FPKA 1FCKA 5EHSA 4IO4A 3PPPA 3FVOA 4DXBA 2XXYA 1R9QA 2R9JA 4DLDA 2VD2A 1FBFA 1VFDA 4O3AA 4FORA 2F5XA 4QSEA 3T9UA 4YB5A 1MY0A 3UIFA 2DE4A 1LB8A 4LQ5A 1UTBA 2HFBA 3SEXA 4NEDA 2DXYA 1IMEA 2PFZA 3T0JA 1H44A 3S9NC 2ZNTA 2REJA 4I8CA 1ZBMA 1NFTA 2QVVA 1POY1 4X1BA 2UVHA 4XF5A 1L5TA 2UYFA 1H3DA 2H25A 2ZNUA 4OHNA 1M5DA 1AL3A 1LSTA 1LGBC 3QAXA 4FECA 4P8BA 1CB6A 3O66A 3EQ1A 3B6WA 2RCBA 5KDTB 4HE0A 3PD9A 4GFRA 4OFJA 3W15C 1JVXA 5CBRA 1IXIA 5CMCA 1SYIA 4POWA 1B7HA 5AA4B 2Y7RA 1XOCA 1BKAA 4OERA 5IAIA 1LFGA 3FV2A 3W9VA 2V3QA 2A5SA 5AA2A 4XXUA 3TTKA 1II5A 1MXUA 4ZEDA 4C0RA 2OCUA 3ONMA 1N7XA 4F19A 1DCUA 3MJNA 2B3BA 1XVXA 4N17A 1FPEA 2VPOA 4NF5B 1ANFA 1HSJA 3O6HA 3SERA 1LFIA 2QVRA 2Y84A 1SW5A 1QGXA 3K2DA 4LQ2A 3M3KA 1B7ZA 4KQPA 1FW0A 2XHDA 4LATA 4U4XA 1USYE 3MP8A 2G93A 5I84A 2QS4A 4JSDA 1Y3NA 3IR1A 4H5FA 3CG1A 3ILUB 4H8IA 4R2BA 3CVGA 2I6EA 4H1XA 5I56A 4R6HA 2P3NA 3EF7A 1GTKA 3SEUA 4PFBA 4PGPA 3QUFA 1PC3A 2OWZA 4F18A 2Z23A 4ONYA 4RK9A 4F1UA 3K6WA 5BUUA 2CZIA 4F3SA 4UA8A 5J1DA 1B46A 3KBRA 5LTCA 2XD3A 2Q8JA 5H8NB 4GX4A 2CZKA 1YCJA 5IZ3A 2GH9A 1IZ1A 3G3GA 4PQJA 2QS2A 1B3EA 1MY3A 1VDWA 1M5CA 3KC0A 4H8JA 1UTHA 3OEKA 2Q74A 3GBBA 3PTYA 2F8DA 3R7XA 4HS7A 2Q2AA 3Q26A 3EHTA 4I9DA 4HCWA 4BLAA 1B3LA 4N81A 3KJ7A 2H5YA 1J1NA 1ATGA 2ZYNA 4OENA 4GD5A 5EYGA 2F3DA 3L6GA 1H45A 3IO6A 1Y3PA 1WDNA 2FYIA 4Z7EA 5FHNA 3RT6B 2FIEA 3HPIA 1CE2A 4PF6A 1O7TA 1S9TA 4GX3A 1N7WA 1JEVA 2Z8EA 1D9QA 1Y3QA 2B4MA 1SW2A 4MLQA 5ELVA 3TQLA 1QJMA 2YLNA 3O29A 5AA3A 2P3VA 2F7BA 4GOTA 3H6VA 1D9YA 5ISUA 1SQYA 3S9LC 3KOTA 1B3FA 3L6HA 5AA1A 3ZKLA 4I1DA 4HXVA 4XTCQ 3C35A 4X04A 3CFLA 1B32A 5CMKA 1Y9UA 4O7MA 1EYJA 1BP5A 3EHSA 5I59B 3RTFB 3KFMA 4IY6A 4I3YA 4EQ7A 1MH3A 3H6TA 1SPIA 4PFUA 5CM6A 3BBRA 3D1RA 3U72A 1JEUA 3O9PA 3KN3A 3CHGA 1LBXA 3PUYE 4POXA 1TFDA 4EF1A 3G3FA 3M8UA 4YU0A 2NXOA 1D4NA 1UQWA 4BDOA 4F3GA 2R8TA 2UVIA 2B4LA 4LZ7A 4R75A 2WBDA 1A8EA 1ZU0A 2L5VA 2I3WA 3PPRA 4N4UA 2ESNA 5I2NB 5JTYB 2O1MA 3USDA 4P9KA 3U94A 5JEIA 3K1MA 5H8HB 1NUXA 2F7AA 1TFAA 4ZEIA 3KZGA 1XC1A 3N6TA 5HPQA 3IOTA 4DE8A 1Q1KA 5ITOA 4FATA 1G0HA 1NNFA 3RNNA 1RDZA 2ONSA 4X1DA 4XEQA 2ABHA 4PFRA 2F34A 5L9MA 1Q9DA 4QSDA 3RGYA 3PD8A 4H6DA 3LUZA 5FTIA 3DELB 4L17A 3FZVA 2O7UA 3T66A 3V89B 4YMBA 3LC8A 2XXIA 3PU5A 4BDNA 4RY1A 3TELA 3DP4A 4ESWA 4GQOA 1FBPA 3FVKA 2X7QA 5EHMA 4P11A 2OK2A 3KGCA 4H45A 1QKAA 3LV0A 3MSTA 4RPOA 3V83A 5FTHA 2HHMA 3OSQA 4MMPA 1LBZA 4ZE8A 2DOJA 3QMFA 3LR1A 1P1WA 2XWVA 1GVCA 3RT8A 2A5TB 3TYHA 4PFYA 4XKPA 2CZHA 3D4GA 5CMBA 1B7UA 4N13A 4X48A 5ET7A 2CEXA 3VLUA 3C36A 5LOMA 1MQDA 3THIA 2DQVA 1VE4A 2WYPA 5ET6A 4UABA 1FPGA 4PDDA 3MVXA 3CFZA 4XKQA 1S7YA 2XWKA 1IEJA 2FA7A 2OX3A 2HPGA 1YPNA 5I2KA 1IITA 1RDXA 2FNCA 3MAMA 4QRZA 4ZZEA 2O68A 1WODA 2XXPA 4ECFA 2W7YA 4NF6A 4ISUA 1NV5A 5DVFA 1SYHA 4FEBA 1FTAA 3H03A 1VR5A 3DM0A 3PUWE 4NF8B 4F2QA 1B4ZA 2I0BA 2RC9A 4F22A 4QXDA 1FQDA 1NV4A 1LCTA 3BIGA 4I62A 4ZEFA 2QJEA 3GLBA 3OELA 2XXWA 1XVYA 4DDDA 5FHMA 4NX1A 4MLVA 3K1PA 5KCJB 2CEYA 3E9XA 4OESA 3OEMA 1LLSA 4KFQA 4KPTA 3ILTB 3T9XB 2KQZA 3SEVA 1DTGA 2XX7A 3FIRA 3LSFB 3PPOA 1LEVA 5ESYA 3VXBA 4C1UA 5DYHA 1EU8A 5H8HA 4NF4B 4OFLA 1B9JA 4QFPA 4O3BA 1LBWA 4FBPA 4GVOA 4QF9A 1N3WA 1FPBA 2WKYA 2NWJA 4EUOA 1DOTA 1FBDA 4N91A 2I48A 4U1OA 4K3FA 4NWDA 3HSTA 3UORA 2XX9A 1NNKA 1ZTYA 5I5PA 1QUIA 1OQGA 1B3HA 1QVSA 1IXHA 2QMXA 4GWXA 5FHOA 3H6UA 1NV3A 5AE4A 4IR8A 2V3TA 1QUKA 1NUZA 3IK6B 4P3LA 2H99A 1SVXB 2OWTA 5DEXB 5TPAB 3MW0A 1N0TA 3FXRA 3UK4A 2GHAA 1Z7ME 3KSJA 5LDZA 4NTLA 2AYSA 5TP9B 4G68B 3R26A 3O2AA 2Z8FA 3M3FA 4Q8RA 4QFOA 4IY5A 2DS9A 3S9EA 1RYXA 2QSXA 4OVPA 3A3UA 4TQUQ 2A5TA 3IJOB 5H8QA 2PVUA 1NKXA 4MCOA 3OO7A 4PBHA 4AQ4A 4MF3A 1JVYA 4KYDA 2ZYOA 1MRPA 4PGNA 3TFLA 2F36A 3LSLA 4PAFA 3FJGA 1FTOA 4F3PA 1A8FA 4THIA 5IGAA 1KA1A 1B4HA 4GF8A 4YMAA 4F39A 4OVTA 1AMFA 4I40A 4R72A 1LBYA 2VOZA 4PBQA 1MPDA 1YXIA 3G7WA 1OQHA 1R9LA 4ZEBA 3KG2A 1URSA 2Y7PA 2LAOA 3TMGA 4KR5A 4UACA 4MNCA 4DI3D 5I58B 3QSLA 3RPLB 1VFEA 5A5XB 2JJKA 4GWZA 2HEUA 1IMAA 2DE2A 5EQAA 2OZZA 3E13X 1NV2A 2XXHA 3VDFA 3CRBA 2RINA 4F29A 4G8MA 5KCJA 3PMWA 4XKNA 4QHQA 1KA0A 3PUZE 2Y7IA 1IMCA 5ICTA 2GQ1A 3TTMA 5H8FB 3PMVA 1B58A 3PPNA 4NHBA 1EH3A 3PGFA 2FVZA 4NF0A 1IMDA 4QFNA 3FV1A 3ZKKA 4NF4A 2RF1A 1FPLA 3GZGA 3T22A 1NUWA 3N26A 3SKPA 3QIMA 3OSRA 1A40A 1DK4A 4C1TA 1LAFE 4JB7A 3DLNA 4JSOA 4LVQA 4OQOA 3BKIB 2QMWA 4YICA 4YAHX 4JXIA 5ITPA 3V5AA 4N8GA 3I5OA 3A3CA 4NN3A 4QFKA 2I4CA 4OEVA 1SW4A 2XA5A 3MZ9A 2HXWA 1FBCA 1A55A 3HFUA 5DEXA 3A09A 5TPAA 4AS5A 2ANJA 3SEWA 2XXRA 3TEPA 4WEPA 3Q25A 4N8YA 2XWIA 3JYRA 1YTVA 4RK2A 4OVQA 4FIMA 1B6HA 3K00A 5TP9A 4G68A 1VSOA 1NV7A 3TUSA 4ND9A 2F35A 3IB2A 2ZNSA 4DI4B 3WAFA 5ET5A 3QK6A 2F97A 3C4MA 3O6GA 1NH8A 3TCFA 5F7VA 4HW8A 4H67A 3H7MA 2Q89A 5CC2A 1QW0A 4KHZE 2PFYA 4LUBA 4I3EA 1JW5A 3T96B 3OOAA 4ESXA 4DCYA 2YPNA 4TOZA 1SI0A 2WYKA 4R74A 3VXCA 2P2AA 2Z22A 4EXKA 4KCDA 3MYUA 2Q88A 5KDTA 1B40A 3TCHA 1MQIA 1FTJA 1MQHA 2E0SA 1FTMA 1FRPA 2O51A 2I4BA 2DVZA 3TPAA 2ZYMA 5AA4A 2XXQA 3CFXA 4WEDA 1NUYA 4P0GA 3KBZA 2R6GE 3R6UA 2G29A 4KYSA 1P1NA 1ZMGA 5I58A 4GBVA 4PETA 1H76A 5ET8A 1PB8A 3RPLA 1Y20A 1F9BA 2CMOA 4YB7A 4NF5A 4GRKA 3EKIA 5DVJA 1MG1A 2RC7A 1T0KA 4G2ZA 3K6XA 5HBCA 1FQEA 1XS5A 2UYEA 4AB6A 3KN8A 3IAZA 3RY3A 5I57B 3K1NA 4GX6A 1MQGA 3B6QA 2XD2A 1MXXA 3F11A 2P0SA 2ZZVA 1WVJA 4ELOA 2M8CA 1FQCA 4HE2A 3IX1A 2O84X 2ZZWA 3K6VA 2UXAA 4RXLA 1URGA 3GBAA 5M2VA 4PP0A 4JBZA 3FJMA 5F1QA 3CSBA 1JP4A 5J16A 3FVNA 3VLVA 3IO4A 2PCRA 3GYYA 1EZPA 3FATA 4O94A 4FEDA 1MXYA 4PC9A 5L9SA 3FJ7A 2D21A 3VLWA 5JK4A 1M5BA 5H8NA 2F7CA 4OZ9A 1P1OA 4QSCA 2F6GA 1TXFA 1NNTA 2XWOA 3FXQA 1B0HA 4BDLA 4PFTA 4EDPA 5BWJA 4F3BA 4GWWA 1B1HA 3TAJA 4RJZA 3H6WA 4N6PA 4ZDMA 1GR2A 2UVGA 3K0VA 1IXCA 4Q0CA 4IGTA 5EQ7A 1AOVA 1ZJLA 1PBPA 2RC8A 1ZIUA 4G68C 3ROJA 1AWBA 3D4CA 1N84A 3SETA 1FPDA 4MFIA 1I69A 2GRVA 3FASA 3SDFA 2WBBA 3PPQA 1UTBB 4PFIA 2Z8DA 1MS7A 1JW4A 4HCYA 4YB6A 1FPJA 1NI9A 3U1OA 1RKMA 4ELRA 3IOUA 1LAXA 3IFCA 4LA9A 2QS3A 2O69A 2ZZXA 1P1QA 2PMSA 5DVIA 4FE8A 4GIZA 3C31A 3MP1A 1B5JA 3VVDA 4MEVA 2V84A
chains in the Genus database with same CATH topology
1JQFA 5B70A 2QRYA 3MVYA 4RA1A 2DXRA 1AH5A 1SW1A 5I59A 4GL8A 3C32A 4P0IA 4LZ5A 2AIXA 3G3KA 3HHFA 2ONRA 4R9GA 3IB0A 2REGA 2Y7KA 1SI1A 5AA2B 1Y1MA 3S4UA 4ZECA 3FVGA 5CMMA 4GL0A 5IKBA 3MVWA 5ICQA 3OMBA 3ECRA 5I2NA 5JTYA 4HTGA 2OLBA 2B65A 1MXWA 1SDXA 3OXNA 1IQ7A 2D3IA 2OJTA 2GFEA 4E0XA 2DWAA 4FAJA 1B5IA 4M4GA 2XX8A 3S2VA 4GXSB 3UP9A 1AIVA 4GXAA 1HSLA 4RNSA 4F2OA 3CSGA 3S9MC 1MDQA 1MY1A 3H3GA 4XIGQ 2THIA 3EHUA 4ZS9A 4OFOA 3HN0A 1ZKBA 3TTRA 3O97A 1Y4TA 2OBGA 1OLCA 4NWCA 3CI8A 2ZYKA 1FQAA 2IA4A 1TT1A 1EZ9A 3QUJA 1UTHB 1PEBA 1MM7A 3QXMA 1YAEA 4U21A 4IO2A 2R71A 1MXZA 1D3KA 4ZEKA 1SD3A 3OENA 1UIUA 2D5WA 1MPBA 2H9BA 4U1ZA 2HAVA 3LUYA 4KCCA 3T9VA 4DXCA 3RPWA 4OMBA 4FJPA 3UGWA 2X26A 3HO7A 4MH5A 3FGSA 3MQ9A 2DWJA 2I0CA 1Z7NE 4LONB 1MQJA 4ZE9A 2VHAA 4G8NA 3M3LA 3FXUA 2F6PA 4ELPA 2Q9TA 3KOSA 4Q5TA 1B05A 4AB5A 4KYEA 4ZZAA 1OMPA 4NF8A 3BFUA 1QUJA 2UVJA 3MUQA 3KN7A 4YKKA 2CZLA 2XXVA 1S50A 2GHBA 3DP8A 4IO5A 1DPPA 1LAHE 4BDQA 3IB1A 1KWHA 3VFJA 3IL1B 3SEYA 2HCAA 2O6AA 3KJTA 2ALUA 1FTKA 4Z0IA 2QL3A 2VP1A 3T93B 1BIYA 3B6TA 3UN6A 1OIBA 3O28A 1N3XA 2HZKA 1FQBA 2OWSA 1PBQA 1NL5A 2Q2CA 3G3JA 2ONKE 1XHYA 2DWIA 4EQBA 3OO8A 4KI0E 4R2FA 5K2YA 3RUMA 4R6YA 4XKRA 4U22A 4PFWA 1NMUA 2PT1A 2AL4A 2V25A 5TU0A 2V3UA 4YKPA 1RYOA 4MBPA 1LBCA 2RCAA 3I3VA 1MH4A 3V8XB 4DZ1A 1LBBA 4WKMA 2Y7WA 4KD5A 3C33A 2DVCA 3MZ1A 3G3HA 4U2RA 4F1VA 1BTJA 1IIWA 3UA8A 1SBPA 1N04A 1TWYA 1B1XA 3H4ZA 2AL5A 2XXXA 4E0WA 3FUZA 4WXJA 1P1UA 1US5A 4JDFA 2I49A 1PB9A 3C9HA 2HZLA 1ELJA 3PV0E 4OVJA 3MBPA 3C34A 3TTLA 4R73A 4TLLB 3ZS6A 3VV5A 2KLFA 1IUDA 3E3KA 3N94A 2V93A 4PE5B 5I2KB 4QFLA 1IXGA 4G8HA 4OTEA 1USYH 3GXAA 3ODBA 4NF6B 3LSWA 3IJXB 2QPQA 5A5XA 4GWOA 3TCGA 1OVBA 3LBSA 1P99A 2VGQA 5HM4B 2NUVA 2O1LA 3K4UA 3MP6A 2VD3A 4IO7A 4IO6A 4IB2A 1Y1ZA 4IGRA 3B7DA 4G4PA 3AXFA 1FQFA 3U92A 5EYFA 4H0WA 5H8FA 3CIJA 3Q27A 2ZXTA 4YKJA 1N76A 4H5GA 3HCQA 3PMXA 4R6KA 3OD7A 3T9HB 4U4SA 4BDMA 1D9VA 3K6UA 4OYVA 1M5EA 5B7DA 2DYXA 5H8SA 3QYTA 2DE3A 1MY2A 5DTBA 2I3VA 3Q29A 1JNFA 2PX1A 5L8DA 3RTWB 3MVZA 4YKIA 1PB7A 3RLFE 2RKMA 3HV1A 1EZOA 3E4RA 3TKDA 3N5LA 1LAGE 3I6VA 4OEUA 3VVEA 1MPCA 1B0LA 1FTLA 4G77A 4X9TA 3W9WA 2IEEA 4OWDA 1JW1A 4JWOA 4EF2A 2BJJX 1B52A 1R6ZA 4O3CA 4JWYA 3RN8A 1B5HA 3K01A 1B3GA 3TZAA 3O6IA 3HHGA 1Q35A 3OO9A 3VE1B 3CG3A 2YJPA 1I6AA 3IOVA 1OLAA 3MPKA 1DMBA 2PBWA 1QKBA 3EN3A 4JWXA 1DPEA 5H8QB 2PYYA 2QS1A 1A7LA 1MXVA 1ZLQA 4ELQA 3MC2A 1JETA 4IO3A 4NMYA 4BDRA 3SESA 1POTA 4DXUA 2B3FA 4OXVA 5CBSA 3LSXA 4M1VA 3U8QA 1XT8A 1O63A 4LZ8A 3PUXE 3MWBA 3JZJA 3OO6A 5AA2D 1O64A 1UIVA 3VVFA 5L9OA 4EQ9A 3IOWA 3DP6A 3H06B 5CRYA 3TQWA 3MZBA 2ZMBA 4LP2B 3N6UA 3FD3A 3BFTA 1MY4A 1NNPA 1H43A 2HQ0A 4H65A 1NH7A 1BLFA 2O7IA 1URDA 3TDJA 3EPEA 3JV9A 2HAUA 3P7IA 1LB9A 5I57A 1I6BA 2XXUA 1R1NA 3G3IA 2H98A 4Q30B 2P1SA 3IORA 2F78A 3Q28A 1OVTA 5DT6A 1LFHA 2I58A 2DSFA 4GLIA 1Y4CA 3MPLA 4OETA 1GV8A 4YZZA 4TLMB 2DP8A 1DTZA 3WAEA 2E1SA 4DIGA 4DCXA 1DSNA 1GGGA 2NOOA 2DWHA 1MM6A 5I56B 3ZSFA 2PT2A 3TODA 1QULA 2X7PA 5K2XA 3TTNA 2XXTA 4R9FA 2H4IA 1A54A 3KEIA 1M5FA 4F31B 1LCFA 1A99A 4RPNA 3RQTA 4EXLA 3CR9A 1B2HA 3K02A 3KSXA 1PDAA 1US4A 3PUVE 1HSEA 1MDP1 4RYAA 2NVUB 4F1YA 1B51A 5KZTA 4NE4A 5CI5A 3U93A 1I6QA 4N07A 4U23A 1FCKA 5EHSA 4IO4A 3PPPA 3FVOA 4DXBA 2XXYA 1R9QA 2R9JA 4DLDA 2VD2A 1VFDA 4O3AA 4FORA 2F5XA 4QSEA 3T9UA 4YB5A 1MY0A 3UIFA 2DE4A 1LB8A 4LQ5A 1UTBA 2HFBA 3SEXA 4NEDA 2DXYA 1H44A 3S9NC 2ZNTA 2REJA 4I8CA 1ZBMA 1NFTA 1POY1 4X1BA 2UVHA 1L5TA 2UYFA 1H3DA 2H25A 2ZNUA 4OHNA 1M5DA 1AL3A 1LSTA 1LGBC 3QAXA 4FECA 1CB6A 3O66A 3EQ1A 3B6WA 2RCBA 5KDTB 3PD9A 4GFRA 4OFJA 3W15C 1JVXA 5CBRA 1IXIA 5CMCA 1SYIA 4POWA 1B7HA 5AA4B 2Y7RA 1XOCA 1BKAA 4OERA 5IAIA 1LFGA 3FV2A 3W9VA 2V3QA 2A5SA 5AA2A 4XXUA 3TTKA 1II5A 1MXUA 4ZEDA 4C0RA 2OCUA 3ONMA 1N7XA 4F19A 3MJNA 2B3BA 1XVXA 4NF5B 1ANFA 1HSJA 3O6HA 3SERA 1LFIA 2Y84A 1SW5A 3K2DA 4LQ2A 3M3KA 1B7ZA 4KQPA 1FW0A 2XHDA 4LATA 4U4XA 1USYE 3MP8A 2G93A 5I84A 2QS4A 4JSDA 1Y3NA 3IR1A 4H5FA 3CG1A 3ILUB 4H8IA 4R2BA 3CVGA 2I6EA 4H1XA 5I56A 4R6HA 3EF7A 1GTKA 3SEUA 3QUFA 1PC3A 4F18A 2Z23A 4ONYA 4RK9A 4F1UA 3K6WA 5BUUA 4F3SA 4UA8A 5J1DA 1B46A 3KBRA 2XD3A 2Q8JA 5H8NB 1YCJA 2GH9A 1IZ1A 3G3GA 4PQJA 2QS2A 1B3EA 1MY3A 1M5CA 4H8JA 1UTHA 3OEKA 3GBBA 2F8DA 3R7XA 4HS7A 2Q2AA 3Q26A 3EHTA 4I9DA 4HCWA 4BLAA 1B3LA 3KJ7A 2H5YA 1J1NA 1ATGA 2ZYNA 4OENA 4GD5A 3L6GA 1H45A 3IO6A 1Y3PA 1WDNA 2FYIA 4Z7EA 5FHNA 3RT6B 3HPIA 1CE2A 1O7TA 1S9TA 1N7WA 1JEVA 2Z8EA 1Y3QA 1SW2A 4MLQA 5ELVA 3TQLA 1QJMA 2YLNA 3O29A 5AA3A 2F7BA 4GOTA 3H6VA 1D9YA 5ISUA 1SQYA 3S9LC 3KOTA 1B3FA 3L6HA 5AA1A 3ZKLA 4I1DA 4XTCQ 3C35A 3CFLA 1B32A 5CMKA 1Y9UA 1BP5A 3EHSA 5I59B 3RTFB 3KFMA 4IY6A 4EQ7A 1MH3A 3H6TA 4PFUA 5CM6A 3BBRA 3U72A 1JEUA 3O9PA 3KN3A 3PUYE 4POXA 1TFDA 4EF1A 3G3FA 3M8UA 4YU0A 2NXOA 1D4NA 1UQWA 4BDOA 4F3GA 2UVIA 4LZ7A 4R75A 1A8EA 1ZU0A 2I3WA 3PPRA 2ESNA 5I2NB 5JTYB 2O1MA 3USDA 3U94A 5JEIA 3K1MA 5H8HB 2F7AA 1TFAA 4ZEIA 3KZGA 1XC1A 3N6TA 5HPQA 3IOTA 4DE8A 1Q1KA 5ITOA 4FATA 3RNNA 1NNFA 2ONSA 4X1DA 2ABHA 2F34A 5L9MA 3RGYA 4QSDA 3PD8A 4H6DA 5FTIA 3DELB 4L17A 3FZVA 2O7UA 3T66A 3V89B 4YMBA 3LC8A 2XXIA 3PU5A 4BDNA 4RY1A 3TELA 3DP4A 4ESWA 4GQOA 3FVKA 2X7QA 5EHMA 4P11A 2OK2A 3KGCA 1QKAA 4RPOA 3V83A 5FTHA 3OSQA 4ZE8A 2DOJA 3LR1A 1P1WA 1GVCA 3RT8A 2A5TB 3TYHA 4PFYA 4XKPA 3D4GA 5CMBA 1B7UA 4N13A 4X48A 3VLUA 3C36A 5LOMA 1MQDA 3THIA 2DQVA 1VE4A 3MVXA 3CFZA 4XKQA 1S7YA 1IEJA 2FA7A 1YPNA 5I2KA 1IITA 3MAMA 2FNCA 4QRZA 4ZZEA 2O68A 1WODA 2XXPA 4ECFA 2W7YA 4NF6A 4ISUA 5DVFA 1SYHA 4FEBA 3H03A 1VR5A 3DM0A 3PUWE 4NF8B 4F2QA 1B4ZA 2I0BA 2RC9A 4F22A 1FQDA 1LCTA 4I62A 4ZEFA 2QJEA 3GLBA 3OELA 2XXWA 1XVYA 4DDDA 5FHMA 4MLVA 3K1PA 5KCJB 3E9XA 4OESA 3OEMA 1LLSA 4KFQA 4KPTA 3ILTB 3T9XB 3SEVA 1DTGA 2XX7A 3FIRA 3LSFB 3PPOA 3VXBA 4C1UA 5DYHA 1EU8A 5H8HA 4NF4B 4OFLA 1B9JA 4QFPA 4O3BA 4GVOA 4QF9A 1N3WA 2WKYA 2NWJA 4EUOA 1DOTA 2I48A 4U1OA 4K3FA 4NWDA 3HSTA 3UORA 2XX9A 1NNKA 1ZTYA 1QUIA 1OQGA 1B3HA 1QVSA 1IXHA 2QMXA 5FHOA 3H6UA 5AE4A 2V3TA 1QUKA 3IK6B 2H99A 1SVXB 2OWTA 5DEXB 5TPAB 3MW0A 1N0TA 3UK4A 3FXRA 2GHAA 1Z7ME 3KSJA 4NTLA 2AYSA 5TP9B 4G68B 3R26A 3O2AA 2Z8FA 3M3FA 4Q8RA 4QFOA 4IY5A 2DS9A 3S9EA 1RYXA 2QSXA 3A3UA 4TQUQ 2A5TA 3IJOB 5H8QA 2PVUA 1NKXA 3OO7A 4AQ4A 4MF3A 1JVYA 4KYDA 2ZYOA 1MRPA 3TFLA 2F36A 3LSLA 3FJGA 1FTOA 4F3PA 1A8FA 4THIA 1B4HA 4GF8A 4YMAA 4F39A 1AMFA 4R72A 2VOZA 1MPDA 3G7WA 1OQHA 1R9LA 4ZEBA 3KG2A 1URSA 2Y7PA 2LAOA 3TMGA 4KR5A 4UACA 5I58B 3QSLA 1VFEA 5A5XB 2HEUA 2DE2A 2OZZA 3E13X 2XXHA 3VDFA 3CRBA 2RINA 4F29A 4G8MA 5KCJA 3PMWA 4XKNA 4QHQA 3PUZE 2Y7IA 5ICTA 3TTMA 5H8FB 3PMVA 1B58A 3PPNA 1EH3A 3PGFA 4QFNA 3FV1A 3ZKKA 4NF4A 2RF1A 3GZGA 3T22A 3N26A 3SKPA 3QIMA 3OSRA 1A40A 4C1TA 1LAFE 4JB7A 3DLNA 4JSOA 4LVQA 4OQOA 3BKIB 2QMWA 4YICA 4YAHX 4JXIA 5ITPA 3V5AA 3I5OA 3A3CA 4QFKA 2I4CA 4OEVA 1SW4A 3MZ9A 2HXWA 1A55A 5DEXA 3A09A 5TPAA 2ANJA 3SEWA 2XXRA 3TEPA 4WEPA 3Q25A 3JYRA 1YTVA 4RK2A 4FIMA 1B6HA 3K00A 5TP9A 4G68A 1VSOA 3TUSA 4ND9A 2F35A 3IB2A 2ZNSA 3WAFA 3QK6A 2F97A 3C4MA 3O6GA 1NH8A 3TCFA 5F7VA 4HW8A 4H67A 3H7MA 2Q89A 5CC2A 1QW0A 4KHZE 4LUBA 1JW5A 3T96B 3OOAA 4ESXA 4DCYA 2YPNA 4TOZA 1SI0A 4R74A 3VXCA 2P2AA 2Z22A 4EXKA 4KCDA 2Q88A 5KDTA 1B40A 3TCHA 1MQIA 1FTJA 1MQHA 2E0SA 1FTMA 2O51A 2I4BA 2DVZA 3TPAA 2ZYMA 5AA4A 2XXQA 3CFXA 4WEDA 4P0GA 2R6GE 3R6UA 2G29A 4KYSA 1P1NA 1ZMGA 5I58A 4PETA 1H76A 1PB8A 1Y20A 1F9BA 2CMOA 4YB7A 4NF5A 4GRKA 5DVJA 1MG1A 2RC7A 1T0KA 4G2ZA 3K6XA 5HBCA 1FQEA 1XS5A 2UYEA 4AB6A 3KN8A 3IAZA 3RY3A 5I57B 3K1NA 1MQGA 3B6QA 2XD2A 1MXXA 3F11A 2P0SA 1WVJA 4ELOA 2M8CA 1FQCA 3IX1A 2O84X 3K6VA 2UXAA 4RXLA 5M2VA 1URGA 3GBAA 4PP0A 4JBZA 3FJMA 5F1QA 3CSBA 3FVNA 3VLVA 3IO4A 1EZPA 3FATA 4FEDA 1MXYA 5L9SA 3FJ7A 2D21A 3VLWA 5JK4A 1M5BA 5H8NA 2F7CA 4OZ9A 1P1OA 4QSCA 2F6GA 1TXFA 1NNTA 3FXQA 1B0HA 4BDLA 4PFTA 4EDPA 5BWJA 4F3BA 1B1HA 3TAJA 3H6WA 4N6PA 4RJZA 4ZDMA 1GR2A 2UVGA 3K0VA 1IXCA 4Q0CA 4IGTA 1AOVA 1ZJLA 1PBPA 2RC8A 1ZIUA 4G68C 3D4CA 1N84A 3SETA 4MFIA 1I69A 2GRVA 3FASA 3SDFA 3PPQA 1UTBB 2Z8DA 1MS7A 1JW4A 4HCYA 4YB6A 3U1OA 1RKMA 4ELRA 3IOUA 1LAXA 4LA9A 2QS3A 2O69A 1P1QA 2PMSA 5DVIA 4FE8A 4GIZA 3C31A 3MP1A 1B5JA 3VVDA 2V84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQF A;  5B70 A;  2QRY A;  3MVY A;  4RA1 A;  2DXR A;  1AH5 A;  1SW1 A;  5I59 A;  4GL8 A;  3C32 A;  4P0I A;  4LZ5 A;  2AIX A;  3G3K A;  3HHF A;  2ONR A;  4R9G A;  3IB0 A;  2REG A;  2Y7K A;  1SI1 A;  5AA2 B;  1Y1M A;  3S4U A;  4ZEC A;  3FVG A;  5CMM A;  4GL0 A;  5IKB A;  3MVW A;  5ICQ A;  3OMB A;  3ECR A;  5I2N A;  5JTY A;  4HTG A;  2OLB A;  2B65 A;  1MXW A;  1SDX A;  3OXN A;  1IQ7 A;  2D3I A;  2OJT A;  2GFE A;  4E0X A;  2DWA A;  4FAJ A;  1B5I A;  4M4G A;  2XX8 A;  3S2V A;  4GXS B;  3UP9 A;  1AIV A;  4GXA A;  1HSL A;  4RNS A;  4F2O A;  3CSG A;  3S9M C;  1MDQ A;  1MY1 A;  3H3G A;  4XIG Q;  2THI A;  3EHU A;  4ZS9 A;  4OFO A;  3HN0 A;  1ZKB A;  3TTR A;  3O97 A;  1Y4T A;  2OBG A;  1OLC A;  4NWC A;  3CI8 A;  2ZYK A;  1FQA A;  2IA4 A;  1TT1 A;  1EZ9 A;  3QUJ A;  1UTH B;  1PEB A;  1MM7 A;  3QXM A;  1YAE A;  4U21 A;  4IO2 A;  2R71 A;  1MXZ A;  1D3K A;  4ZEK A;  1SD3 A;  3OEN A;  1UIU A;  2D5W A;  1MPB A;  2H9B A;  4U1Z A;  2HAV A;  3LUY A;  4KCC A;  3T9V A;  4DXC A;  3RPW A;  4OMB A;  4FJP A;  3UGW A;  2X26 A;  3HO7 A;  4MH5 A;  3FGS A;  3MQ9 A;  2DWJ A;  2I0C A;  1Z7N E;  4LON B;  1MQJ A;  4ZE9 A;  2VHA A;  4G8N A;  3M3L A;  3FXU A;  2F6P A;  4ELP A;  2Q9T A;  3KOS A;  4Q5T A;  1B05 A;  4AB5 A;  4KYE A;  4ZZA A;  1OMP A;  4NF8 A;  3BFU A;  1QUJ A;  2UVJ A;  3MUQ A;  3KN7 A;  4YKK A;  2CZL A;  2XXV A;  1S50 A;  2GHB A;  3DP8 A;  4IO5 A;  1DPP A;  1LAH E;  4BDQ A;  3IB1 A;  1KWH A;  3VFJ A;  3IL1 B;  3SEY A;  2HCA A;  2O6A A;  3KJT A;  2ALU A;  1FTK A;  4Z0I A;  2QL3 A;  2VP1 A;  3T93 B;  1BIY A;  3B6T A;  3UN6 A;  1OIB A;  3O28 A;  1N3X A;  2HZK A;  1FQB A;  2OWS A;  1PBQ A;  1NL5 A;  2Q2C A;  3G3J A;  2ONK E;  1XHY A;  2DWI A;  4EQB A;  3OO8 A;  4KI0 E;  4R2F A;  5K2Y A;  3RUM A;  4R6Y A;  4XKR A;  4U22 A;  4PFW A;  1NMU A;  2PT1 A;  2AL4 A;  2V25 A;  5TU0 A;  2V3U A;  4YKP A;  1RYO A;  4MBP A;  1LBC A;  2RCA A;  3I3V A;  1MH4 A;  3V8X B;  4DZ1 A;  1LBB A;  4WKM A;  2Y7W A;  4KD5 A;  3C33 A;  2DVC A;  3MZ1 A;  3G3H A;  4U2R A;  4F1V A;  1BTJ A;  1IIW A;  3UA8 A;  1SBP A;  1N04 A;  1TWY A;  1B1X A;  3H4Z A;  2AL5 A;  2XXX A;  4E0W A;  3FUZ A;  4WXJ A;  1P1U A;  1US5 A;  4JDF A;  2I49 A;  1PB9 A;  3C9H A;  2HZL A;  1ELJ A;  3PV0 E;  4OVJ A;  3MBP A;  3C34 A;  3TTL A;  4R73 A;  4TLL B;  3ZS6 A;  3VV5 A;  2KLF A;  1IUD A;  3E3K A;  3N94 A;  2V93 A;  4PE5 B;  5I2K B;  4QFL A;  1IXG A;  4G8H A;  4OTE A;  1USY H;  3GXA A;  3ODB A;  4NF6 B;  3LSW A;  3IJX B;  2QPQ A;  5A5X A;  4GWO A;  3TCG A;  1OVB A;  3LBS A;  1P99 A;  2VGQ A;  5HM4 B;  2NUV A;  2O1L A;  3K4U A;  3MP6 A;  2VD3 A;  4IO7 A;  4IO6 A;  4IB2 A;  1Y1Z A;  4IGR A;  3B7D A;  4G4P A;  3AXF A;  1FQF A;  3U92 A;  5EYF A;  4H0W A;  5H8F A;  3CIJ A;  3Q27 A;  2ZXT A;  4YKJ A;  1N76 A;  4H5G A;  3HCQ A;  3PMX A;  4R6K A;  3OD7 A;  3T9H B;  4U4S A;  4BDM A;  1D9V A;  3K6U A;  4OYV A;  1M5E A;  5B7D A;  2DYX A;  5H8S A;  3QYT A;  2DE3 A;  1MY2 A;  5DTB A;  2I3V A;  3Q29 A;  1JNF A;  2PX1 A;  5L8D A;  3RTW B;  3MVZ A;  4YKI A;  1PB7 A;  3RLF E;  2RKM A;  3HV1 A;  1EZO A;  3E4R A;  3TKD A;  3N5L A;  1LAG E;  3I6V A;  4OEU A;  3VVE A;  1MPC A;  1B0L A;  1FTL A;  4G77 A;  4X9T A;  3W9W A;  2IEE A;  4OWD A;  1JW1 A;  4JWO A;  4EF2 A;  2BJJ X;  1B52 A;  1R6Z A;  4O3C A;  4JWY A;  3RN8 A;  1B5H A;  3K01 A;  1B3G A;  3TZA A;  3O6I A;  3HHG A;  1Q35 A;  3OO9 A;  3VE1 B;  3CG3 A;  2YJP A;  1I6A A;  3IOV A;  1OLA A;  3MPK A;  1DMB A;  2PBW A;  1QKB A;  3EN3 A;  4JWX A;  1DPE A;  5H8Q B;  2PYY A;  2QS1 A;  1A7L A;  1MXV A;  1ZLQ A;  4ELQ A;  3MC2 A;  1JET A;  4IO3 A;  4NMY A;  4BDR A;  3SES A;  1POT A;  4DXU A;  2B3F A;  4OXV A;  5CBS A;  3LSX A;  4M1V A;  3U8Q A;  1XT8 A;  1O63 A;  4LZ8 A;  3PUX E;  3MWB A;  3JZJ A;  3OO6 A;  5AA2 D;  1O64 A;  1UIV A;  3VVF A;  5L9O A;  4EQ9 A;  3IOW A;  3DP6 A;  3H06 B;  5CRY A;  3TQW A;  3MZB A;  2ZMB A;  4LP2 B;  3N6U A;  3FD3 A;  3BFT A;  1MY4 A;  1NNP A;  1H43 A;  2HQ0 A;  4H65 A;  1NH7 A;  1BLF A;  2O7I A;  1URD A;  3TDJ A;  3EPE A;  3JV9 A;  2HAU A;  3P7I A;  1LB9 A;  5I57 A;  1I6B A;  2XXU A;  1R1N A;  3G3I A;  2H98 A;  4Q30 B;  2P1S A;  3IOR A;  2F78 A;  3Q28 A;  1OVT A;  5DT6 A;  1LFH A;  2I58 A;  2DSF A;  4GLI A;  1Y4C A;  3MPL A;  4OET A;  1GV8 A;  4YZZ A;  4TLM B;  2DP8 A;  1DTZ A;  3WAE A;  2E1S A;  4DIG A;  4DCX A;  1DSN A;  1GGG A;  2NOO A;  2DWH A;  1MM6 A;  5I56 B;  3ZSF A;  2PT2 A;  3TOD A;  1QUL A;  2X7P A;  5K2X A;  3TTN A;  2XXT A;  4R9F A;  2H4I A;  1A54 A;  3KEI A;  1M5F A;  4F31 B;  1LCF A;  1A99 A;  4RPN A;  3RQT A;  4EXL A;  3CR9 A;  1B2H A;  3K02 A;  3KSX A;  1PDA A;  1US4 A;  3PUV E;  1HSE A;  1MDP 1;  4RYA A;  2NVU B;  4F1Y A;  1B51 A;  5KZT A;  4NE4 A;  5CI5 A;  3U93 A;  1I6Q A;  4N07 A;  4U23 A;  1FCK A;  5EHS A;  4IO4 A;  3PPP A;  3FVO A;  4DXB A;  2XXY A;  1R9Q A;  2R9J A;  4DLD A;  2VD2 A;  1VFD A;  4O3A A;  4FOR A;  2F5X A;  4QSE A;  3T9U A;  4YB5 A;  1MY0 A;  3UIF A;  2DE4 A;  1LB8 A;  4LQ5 A;  1UTB A;  2HFB A;  3SEX A;  4NED A;  2DXY A;  1H44 A;  3S9N C;  2ZNT A;  2REJ A;  4I8C A;  1ZBM A;  1NFT A;  1POY 1;  4X1B A;  2UVH A;  1L5T A;  2UYF A;  1H3D A;  2H25 A;  2ZNU A;  4OHN A;  1M5D A;  1AL3 A;  1LST A;  1LGB C;  3QAX A;  4FEC A;  1CB6 A;  3O66 A;  3EQ1 A;  3B6W A;  2RCB A;  5KDT B;  3PD9 A;  4GFR A;  4OFJ A;  3W15 C;  1JVX A;  5CBR A;  1IXI A;  5CMC A;  1SYI A;  4POW A;  1B7H A;  5AA4 B;  2Y7R A;  1XOC A;  1BKA A;  4OER A;  5IAI A;  1LFG A;  3FV2 A;  3W9V A;  2V3Q A;  2A5S A;  5AA2 A;  4XXU A;  3TTK A;  1II5 A;  1MXU A;  4ZED A;  4C0R A;  2OCU A;  3ONM A;  1N7X A;  4F19 A;  3MJN A;  2B3B A;  1XVX A;  4NF5 B;  1ANF A;  1HSJ A;  3O6H A;  3SER A;  1LFI A;  2Y84 A;  1SW5 A;  3K2D A;  4LQ2 A;  3M3K A;  1B7Z A;  4KQP A;  1FW0 A;  2XHD A;  4LAT A;  4U4X A;  1USY E;  3MP8 A;  2G93 A;  5I84 A;  2QS4 A;  4JSD A;  1Y3N A;  3IR1 A;  4H5F A;  3CG1 A;  3ILU B;  4H8I A;  4R2B A;  3CVG A;  2I6E A;  4H1X A;  5I56 A;  4R6H A;  3EF7 A;  1GTK A;  3SEU A;  3QUF A;  1PC3 A;  4F18 A;  2Z23 A;  4ONY A;  4RK9 A;  4F1U A;  3K6W A;  5BUU A;  4F3S A;  4UA8 A;  5J1D A;  1B46 A;  3KBR A;  2XD3 A;  2Q8J A;  5H8N B;  1YCJ A;  2GH9 A;  1IZ1 A;  3G3G A;  4PQJ A;  2QS2 A;  1B3E A;  1MY3 A;  1M5C A;  4H8J A;  1UTH A;  3OEK A;  3GBB A;  2F8D A;  3R7X A;  4HS7 A;  2Q2A A;  3Q26 A;  3EHT A;  4I9D A;  4HCW A;  4BLA A;  1B3L A;  3KJ7 A;  2H5Y A;  1J1N A;  1ATG A;  2ZYN A;  4OEN A;  4GD5 A;  3L6G A;  1H45 A;  3IO6 A;  1Y3P A;  1WDN A;  2FYI A;  4Z7E A;  5FHN A;  3RT6 B;  3HPI A;  1CE2 A;  1O7T A;  1S9T A;  1N7W A;  1JEV A;  2Z8E A;  1Y3Q A;  1SW2 A;  4MLQ A;  5ELV A;  3TQL A;  1QJM A;  2YLN A;  3O29 A;  5AA3 A;  2F7B A;  4GOT A;  3H6V A;  1D9Y A;  5ISU A;  1SQY A;  3S9L C;  3KOT A;  1B3F A;  3L6H A;  5AA1 A;  3ZKL A;  4I1D A;  4XTC Q;  3C35 A;  3CFL A;  1B32 A;  5CMK A;  1Y9U A;  1BP5 A;  3EHS A;  5I59 B;  3RTF B;  3KFM A;  4IY6 A;  4EQ7 A;  1MH3 A;  3H6T A;  4PFU A;  5CM6 A;  3BBR A;  3U72 A;  1JEU A;  3O9P A;  3KN3 A;  3PUY E;  4POX A;  1TFD A;  4EF1 A;  3G3F A;  3M8U A;  4YU0 A;  2NXO A;  1D4N A;  1UQW A;  4BDO A;  4F3G A;  2UVI A;  4LZ7 A;  4R75 A;  1A8E A;  1ZU0 A;  2I3W A;  3PPR A;  2ESN A;  5I2N B;  5JTY B;  2O1M A;  3USD A;  3U94 A;  5JEI A;  3K1M A;  5H8H B;  2F7A A;  1TFA A;  4ZEI A;  3KZG A;  1XC1 A;  3N6T A;  5HPQ A;  3IOT A;  4DE8 A;  1Q1K A;  5ITO A;  4FAT A;  3RNN A;  1NNF A;  2ONS A;  4X1D A;  2ABH A;  2F34 A;  5L9M A;  3RGY A;  4QSD A;  3PD8 A;  4H6D A;  5FTI A;  3DEL B;  4L17 A;  3FZV A;  2O7U A;  3T66 A;  3V89 B;  4YMB A;  3LC8 A;  2XXI A;  3PU5 A;  4BDN A;  4RY1 A;  3TEL A;  3DP4 A;  4ESW A;  4GQO A;  3FVK A;  2X7Q A;  5EHM A;  4P11 A;  2OK2 A;  3KGC A;  1QKA A;  4RPO A;  3V83 A;  5FTH A;  3OSQ A;  4ZE8 A;  2DOJ A;  3LR1 A;  1P1W A;  1GVC A;  3RT8 A;  2A5T B;  3TYH A;  4PFY A;  4XKP A;  3D4G A;  5CMB A;  1B7U A;  4N13 A;  4X48 A;  3VLU A;  3C36 A;  5LOM A;  1MQD A;  3THI A;  2DQV A;  1VE4 A;  3MVX A;  3CFZ A;  4XKQ A;  1S7Y A;  1IEJ A;  2FA7 A;  1YPN A;  5I2K A;  1IIT A;  3MAM A;  2FNC A;  4QRZ A;  4ZZE A;  2O68 A;  1WOD A;  2XXP A;  4ECF A;  2W7Y A;  4NF6 A;  4ISU A;  5DVF A;  1SYH A;  4FEB A;  3H03 A;  1VR5 A;  3DM0 A;  3PUW E;  4NF8 B;  4F2Q A;  1B4Z A;  2I0B A;  2RC9 A;  4F22 A;  1FQD A;  1LCT A;  4I62 A;  4ZEF A;  2QJE A;  3GLB A;  3OEL A;  2XXW A;  1XVY A;  4DDD A;  5FHM A;  4MLV A;  3K1P A;  5KCJ B;  3E9X A;  4OES A;  3OEM A;  1LLS A;  4KFQ A;  4KPT A;  3ILT B;  3T9X B;  3SEV A;  1DTG A;  2XX7 A;  3FIR A;  3LSF B;  3PPO A;  3VXB A;  4C1U A;  5DYH A;  1EU8 A;  5H8H A;  4NF4 B;  4OFL A;  1B9J A;  4QFP A;  4O3B A;  4GVO A;  4QF9 A;  1N3W A;  2WKY A;  2NWJ A;  4EUO A;  1DOT A;  2I48 A;  4U1O A;  4K3F A;  4NWD A;  3HST A;  3UOR A;  2XX9 A;  1NNK A;  1ZTY A;  1QUI A;  1OQG A;  1B3H A;  1QVS A;  1IXH A;  2QMX A;  5FHO A;  3H6U A;  5AE4 A;  2V3T A;  1QUK A;  3IK6 B;  2H99 A;  1SVX B;  2OWT A;  5DEX B;  5TPA B;  3MW0 A;  1N0T A;  3UK4 A;  3FXR A;  2GHA A;  1Z7M E;  3KSJ A;  4NTL A;  2AYS A;  5TP9 B;  4G68 B;  3R26 A;  3O2A A;  2Z8F A;  3M3F A;  4Q8R A;  4QFO A;  4IY5 A;  2DS9 A;  3S9E A;  1RYX A;  2QSX A;  3A3U A;  4TQU Q;  2A5T A;  3IJO B;  5H8Q A;  2PVU A;  1NKX A;  3OO7 A;  4AQ4 A;  4MF3 A;  1JVY A;  4KYD A;  2ZYO A;  1MRP A;  3TFL A;  2F36 A;  3LSL A;  3FJG A;  1FTO A;  4F3P A;  1A8F A;  4THI A;  1B4H A;  4GF8 A;  4YMA A;  4F39 A;  1AMF A;  4R72 A;  2VOZ A;  1MPD A;  3G7W A;  1OQH A;  1R9L A;  4ZEB A;  3KG2 A;  1URS A;  2Y7P A;  2LAO A;  3TMG A;  4KR5 A;  4UAC A;  5I58 B;  3QSL A;  1VFE A;  5A5X B;  2HEU A;  2DE2 A;  2OZZ A;  3E13 X;  2XXH A;  3VDF A;  3CRB A;  2RIN A;  4F29 A;  4G8M A;  5KCJ A;  3PMW A;  4XKN A;  4QHQ A;  3PUZ E;  2Y7I A;  5ICT A;  3TTM A;  5H8F B;  3PMV A;  1B58 A;  3PPN A;  1EH3 A;  3PGF A;  4QFN A;  3FV1 A;  3ZKK A;  4NF4 A;  2RF1 A;  3GZG A;  3T22 A;  3N26 A;  3SKP A;  3QIM A;  3OSR A;  1A40 A;  4C1T A;  1LAF E;  4JB7 A;  3DLN A;  4JSO A;  4LVQ A;  4OQO A;  3BKI B;  2QMW A;  4YIC A;  4YAH X;  4JXI A;  5ITP A;  3V5A A;  3I5O A;  3A3C A;  4QFK A;  2I4C A;  4OEV A;  1SW4 A;  3MZ9 A;  2HXW A;  1A55 A;  5DEX A;  3A09 A;  5TPA A;  2ANJ A;  3SEW A;  2XXR A;  3TEP A;  4WEP A;  3Q25 A;  3JYR A;  1YTV A;  4RK2 A;  4FIM A;  1B6H A;  3K00 A;  5TP9 A;  4G68 A;  1VSO A;  3TUS A;  4ND9 A;  2F35 A;  3IB2 A;  2ZNS A;  3WAF A;  3QK6 A;  2F97 A;  3C4M A;  3O6G A;  1NH8 A;  3TCF A;  5F7V A;  4HW8 A;  4H67 A;  3H7M A;  2Q89 A;  5CC2 A;  1QW0 A;  4KHZ E;  4LUB A;  1JW5 A;  3T96 B;  3OOA A;  4ESX A;  4DCY A;  2YPN A;  4TOZ A;  1SI0 A;  4R74 A;  3VXC A;  2P2A A;  2Z22 A;  4EXK A;  4KCD A;  2Q88 A;  5KDT A;  1B40 A;  3TCH A;  1MQI A;  1FTJ A;  1MQH A;  2E0S A;  1FTM A;  2O51 A;  2I4B A;  2DVZ A;  3TPA A;  2ZYM A;  5AA4 A;  2XXQ A;  3CFX A;  4WED A;  4P0G A;  2R6G E;  3R6U A;  2G29 A;  4KYS A;  1P1N A;  1ZMG A;  5I58 A;  4PET A;  1H76 A;  1PB8 A;  1Y20 A;  1F9B A;  2CMO A;  4YB7 A;  4NF5 A;  4GRK A;  5DVJ A;  1MG1 A;  2RC7 A;  1T0K A;  4G2Z A;  3K6X A;  5HBC A;  1FQE A;  1XS5 A;  2UYE A;  4AB6 A;  3KN8 A;  3IAZ A;  3RY3 A;  5I57 B;  3K1N A;  1MQG A;  3B6Q A;  2XD2 A;  1MXX A;  3F11 A;  2P0S A;  1WVJ A;  4ELO A;  2M8C A;  1FQC A;  3IX1 A;  2O84 X;  3K6V A;  2UXA A;  4RXL A;  5M2V A;  1URG A;  3GBA A;  4PP0 A;  4JBZ A;  3FJM A;  5F1Q A;  3CSB A;  3FVN A;  3VLV A;  3IO4 A;  1EZP A;  3FAT A;  4FED A;  1MXY A;  5L9S A;  3FJ7 A;  2D21 A;  3VLW A;  5JK4 A;  1M5B A;  5H8N A;  2F7C A;  4OZ9 A;  1P1O A;  4QSC A;  2F6G A;  1TXF A;  1NNT A;  3FXQ A;  1B0H A;  4BDL A;  4PFT A;  4EDP A;  5BWJ A;  4F3B A;  1B1H A;  3TAJ A;  3H6W A;  4N6P A;  4RJZ A;  4ZDM A;  1GR2 A;  2UVG A;  3K0V A;  1IXC A;  4Q0C A;  4IGT A;  1AOV A;  1ZJL A;  1PBP A;  2RC8 A;  1ZIU A;  4G68 C;  3D4C A;  1N84 A;  3SET A;  4MFI A;  1I69 A;  2GRV A;  3FAS A;  3SDF A;  3PPQ A;  1UTB B;  2Z8D A;  1MS7 A;  1JW4 A;  4HCY A;  4YB6 A;  3U1O A;  1RKM A;  4ELR A;  3IOU A;  1LAX A;  4LA9 A;  2QS3 A;  2O69 A;  1P1Q A;  2PMS A;  5DVI A;  4FE8 A;  4GIZ A;  3C31 A;  3MP1 A;  1B5J A;  3VVD A;  2V84 A; 
#chains in the Genus database with same CATH topology
 2VT5 A;  1JQF A;  5B70 A;  2QRY A;  3MVY A;  4RA1 A;  4NGU A;  2DXR A;  1AH5 A;  1SW1 A;  5I59 A;  4GL8 A;  3C32 A;  4P0I A;  4LZ5 A;  2AIX A;  3G3K A;  3HHF A;  2ONR A;  4R9G A;  3IB0 A;  2REG A;  2VPN A;  2Y7K A;  1SI1 A;  5AA2 B;  5I7I A;  1Y1M A;  4PE3 A;  3S4U A;  4ZEC A;  3FVG A;  1NV1 A;  5CMM A;  4GL0 A;  5IKB A;  3MVW A;  5FBP A;  5ICQ A;  3OMB A;  3ECR A;  5I2N A;  5JTY A;  4HTG A;  2OLB A;  2B65 A;  1MXW A;  1SDX A;  4PAK A;  3OXN A;  1IQ7 A;  2D3I A;  4PTK A;  2OJT A;  2GFE A;  4E0X A;  4MHF A;  2DWA A;  4FAJ A;  2F3B A;  1B5I A;  4M4G A;  4H46 A;  2XX8 A;  3S2V A;  4GXS B;  3UP9 A;  1AIV A;  4GXA A;  1HSL A;  4RNS A;  4F2O A;  2FIX A;  1INP A;  3CSG A;  3S9M C;  1MDQ A;  1MY1 A;  3H3G A;  4XIG Q;  2FBP A;  2THI A;  3EHU A;  4ZS9 A;  4OFO A;  3HN0 A;  1ZKB A;  3ISP A;  3TTR A;  3O97 A;  1Y4T A;  2OBG A;  5IZZ A;  1OLC A;  4NWC A;  3CI8 A;  2ZYK A;  1FQA A;  2IA4 A;  1TT1 A;  1EZ9 A;  3QUJ A;  4O8M A;  1UTH B;  4MNP A;  4HE1 A;  1PEB A;  1MM7 A;  3QXM A;  1YAE A;  4U21 A;  4IO2 A;  1KZ8 A;  4JVD A;  2R71 A;  1MXZ A;  1D3K A;  4ZEK A;  2DDK A;  1SD3 A;  3OEN A;  1UIU A;  2D5W A;  5EQ9 A;  1MPB A;  2H9B A;  4U1Z A;  2HAV A;  3LUY A;  4KCC A;  3T9V A;  4DXC A;  3RPW A;  4OMB A;  4FJP A;  3UGW A;  2X26 A;  3HO7 A;  4OAN A;  4MH5 A;  3FGS A;  3MQ9 A;  2DWJ A;  2I0C A;  1Z7N E;  1YYZ A;  4GWS A;  2MKZ A;  4LON B;  1MQJ A;  1K9Y A;  4ZE9 A;  2VHA A;  4G8N A;  3M3L A;  3FXU A;  2F6P A;  4ELP A;  2Q9T A;  4NQ8 A;  3KOS A;  4Q5T A;  1B05 A;  4AB5 A;  3FXB A;  4KYE A;  4ZZA A;  1OMP A;  4NF8 A;  3BFU A;  1QUJ A;  2HXR A;  4N6K A;  2UVJ A;  3MUQ A;  3B50 A;  3KN7 A;  4GWY A;  4YKK A;  2CZL A;  2XXV A;  1S50 A;  2GHB A;  1EYI A;  3DP8 A;  1DBZ A;  4IO5 A;  2BJI A;  1DPP A;  1LAH E;  4BDQ A;  3IB1 A;  1KWH A;  4PAI A;  3VFJ A;  3IL1 B;  3SEY A;  2HCA A;  2O6A A;  3KC1 A;  3KJT A;  2ALU A;  2XXK A;  1FTK A;  4Z0I A;  2QL3 A;  2VP1 A;  4P56 A;  3T93 B;  1BIY A;  3B6T A;  3UN6 A;  1OIB A;  4LN5 A;  3O28 A;  1N3X A;  2HZK A;  5I3S A;  1FQB A;  2Y5L A;  2OWS A;  1FJ9 A;  1PBQ A;  1NL5 A;  2Q2C A;  3G3J A;  1EYK A;  2ONK E;  1XHY A;  2DWI A;  1FBG A;  4JVC A;  4EQB A;  3OO8 A;  4KI0 E;  4R2F A;  5K2Y A;  3RUM A;  4R6Y A;  4XKR A;  4U22 A;  4PFW A;  1NMU A;  4O7I A;  2PT1 A;  2AL4 A;  2V25 A;  5TU0 A;  2V3U A;  4YKP A;  1RYO A;  4MBP A;  4OA4 A;  1LBC A;  2RCA A;  3I3V A;  2V4C A;  1FPF A;  5IM2 A;  5EYH A;  1MH4 A;  3V8X B;  4JVI A;  4DZ1 A;  1LBB A;  4WKM A;  3E79 A;  2Y7W A;  4KD5 A;  2FHY A;  3C33 A;  4OVS A;  2DVC A;  1NV0 A;  3MZ1 A;  3G3H A;  4U2R A;  4F1V A;  1BTJ A;  3NOH A;  1IIW A;  3UA8 A;  1SBP A;  4AS4 A;  1N04 A;  1TWY A;  1B1X A;  3H4Z A;  2AL5 A;  2WX9 A;  2XXX A;  4E0W A;  1LBV A;  3FUZ A;  4WXJ A;  1P1U A;  1US5 A;  4G61 A;  4JDF A;  2I49 A;  1PB9 A;  3C9H A;  2HZL A;  3A29 A;  1ELJ A;  3PV0 E;  4OVJ A;  3MBP A;  3C34 A;  3TTL A;  4R73 A;  4TLL B;  3ZS6 A;  4PCD A;  3VV5 A;  2KLF A;  1IUD A;  3E3K A;  3N94 A;  2V93 A;  4PE5 B;  5I2K B;  4QFL A;  1IXG A;  4G8H A;  4OTE A;  1USY H;  3GXA A;  3ODB A;  4NF6 B;  3LSW A;  3IJX B;  2QPQ A;  5A5X A;  4GWO A;  3TCG A;  1OVB A;  3LBS A;  1P99 A;  1IMB A;  2VGQ A;  4NAP A;  2NUV A;  5HM4 B;  2O1L A;  3K4U A;  3MP6 A;  2VD3 A;  4IO7 A;  4IO6 A;  1FSA A;  4IB2 A;  4P1L A;  1NV6 A;  4PDH A;  1FBE A;  1Y1Z A;  4IGR A;  3B7D A;  4G4P A;  3AXF A;  1FQF A;  3U92 A;  5EYF A;  4H0W A;  5H8F A;  3CIJ A;  1FJ6 A;  4OVR A;  3Q27 A;  2ZXT A;  4MIJ A;  4YKJ A;  3B8B A;  1N76 A;  4H5G A;  3HCQ A;  3PMX A;  4R6K A;  3OD7 A;  3T9H B;  4U4S A;  3SZP A;  4BDM A;  4P47 A;  1D9V A;  3K6U A;  4OYV A;  1M5E A;  5A5L A;  5B7D A;  2DYX A;  5H8S A;  3QYT A;  2DE3 A;  4QBA A;  1MY2 A;  5DTB A;  2I3V A;  4GBW A;  3Q29 A;  1JNF A;  2PX1 A;  5L8D A;  3RTW B;  3MVZ A;  4MAG A;  4YKI A;  1PB7 A;  3RLF E;  2RKM A;  3HV1 A;  1EZO A;  2KR0 A;  3E4R A;  3RYD A;  3TKD A;  3N5L A;  1LAG E;  3I6V A;  4OEU A;  3FBP A;  3VVE A;  1MPC A;  1B0L A;  4X8R A;  1FTL A;  4G77 A;  3T1B A;  4X9T A;  3W9W A;  2IEE A;  4OWD A;  1JW1 A;  4JWO A;  4EF2 A;  2BJJ X;  1B52 A;  1BK4 A;  1R6Z A;  4O3C A;  4JWY A;  3RN8 A;  1B5H A;  3K01 A;  4MX6 A;  1B3G A;  3TZA A;  3O6I A;  3HHG A;  4GWU A;  1Q35 A;  3OO9 A;  3VE1 B;  3CG3 A;  4MNI A;  2YJP A;  1I6A A;  3IOV A;  1OLA A;  1CNQ A;  3MPK A;  1DMB A;  2PBW A;  1QKB A;  3EN3 A;  4JWX A;  1DPE A;  5H8Q B;  1FPI A;  2PYY A;  4MJO A;  5IZ1 A;  2QS1 A;  1A7L A;  1MXV A;  1ZLQ A;  4N6D A;  4ELQ A;  3MC2 A;  1JET A;  4IO3 A;  4NMY A;  4BDR A;  3SES A;  1POT A;  4DXU A;  2B3F A;  4OXV A;  4PF8 A;  5CBS A;  3LSX A;  2Q8M A;  4M1V A;  3U8Q A;  1XT8 A;  1O63 A;  4LZ8 A;  3PUX E;  3MWB A;  4N15 A;  3JZJ A;  3OO6 A;  5AA2 D;  1O64 A;  1UIV A;  3VVF A;  5L9O A;  4EQ9 A;  3IOW A;  3DP6 A;  1RDY A;  4P1E A;  3H06 B;  5CRY A;  3TQW A;  3MZB A;  2ZMB A;  4LP2 B;  3N6U A;  3FD3 A;  3BFT A;  1XI6 A;  1MY4 A;  1NNP A;  1H43 A;  2HQ0 A;  4H65 A;  1NH7 A;  1BLF A;  2O7I A;  2QFL A;  1URD A;  1YZ0 A;  3TDJ A;  3EPE A;  3JV9 A;  2HAU A;  3P7I A;  1LB9 A;  5I57 A;  1I6B A;  1FBH A;  2Y5K A;  2XXU A;  3E78 A;  1G0I A;  2QVU A;  1R1N A;  3G3I A;  5T3J A;  2H98 A;  4Q30 B;  5DW8 A;  2P1S A;  3IOR A;  2F78 A;  3Q28 A;  1OVT A;  5DT6 A;  3U65 A;  1LFH A;  2I58 A;  2DSF A;  1K9Z A;  4GLI A;  1Y4C A;  3MPL A;  4OET A;  1GV8 A;  4YZZ A;  4TLM B;  1IMF A;  2DP8 A;  1DTZ A;  3WAE A;  2E1S A;  5EQ8 A;  3IFA A;  4DIG A;  4DCX A;  1DSN A;  1GGG A;  3BIH A;  2NOO A;  2DWH A;  1MM6 A;  5I56 B;  3ZSF A;  2PT2 A;  3TOD A;  1QUL A;  2X7P A;  5K2X A;  3TTN A;  2XXT A;  4R9F A;  2H4I A;  1A54 A;  2WEF A;  1M5F A;  3KEI A;  4F31 B;  1LCF A;  1A99 A;  5F24 A;  4RPN A;  3RQT A;  4EXL A;  3CR9 A;  1B2H A;  3K02 A;  3KSX A;  1PDA A;  1US4 A;  3PUV E;  1HSE A;  1MDP 1;  4XFE A;  4RYA A;  2NVU B;  5IZ3 B;  4F1Y A;  1B51 A;  4KXP A;  5KZT A;  4NG7 A;  4NE4 A;  5CI5 A;  3U93 A;  1I6Q A;  4N07 A;  4U23 A;  1FPK A;  1FCK A;  5EHS A;  4IO4 A;  3PPP A;  3FVO A;  4DXB A;  2XXY A;  1R9Q A;  2R9J A;  4DLD A;  2VD2 A;  1FBF A;  1VFD A;  4O3A A;  4FOR A;  2F5X A;  4QSE A;  3T9U A;  4YB5 A;  1MY0 A;  3UIF A;  2DE4 A;  1LB8 A;  4LQ5 A;  1UTB A;  2HFB A;  3SEX A;  4NED A;  2DXY A;  1IME A;  2PFZ A;  3T0J A;  1H44 A;  3S9N C;  2ZNT A;  2REJ A;  4I8C A;  1ZBM A;  1NFT A;  2QVV A;  1POY 1;  4X1B A;  2UVH A;  4XF5 A;  1L5T A;  2UYF A;  1H3D A;  2H25 A;  2ZNU A;  4OHN A;  1M5D A;  1AL3 A;  1LST A;  1LGB C;  3QAX A;  4FEC A;  4P8B A;  1CB6 A;  3O66 A;  3EQ1 A;  3B6W A;  2RCB A;  5KDT B;  4HE0 A;  3PD9 A;  4GFR A;  4OFJ A;  3W15 C;  1JVX A;  5CBR A;  1IXI A;  5CMC A;  1SYI A;  4POW A;  1B7H A;  5AA4 B;  2Y7R A;  1XOC A;  1BKA A;  4OER A;  5IAI A;  1LFG A;  3FV2 A;  3W9V A;  2V3Q A;  2A5S A;  5AA2 A;  4XXU A;  3TTK A;  1II5 A;  1MXU A;  4ZED A;  4C0R A;  2OCU A;  3ONM A;  1N7X A;  4F19 A;  1DCU A;  3MJN A;  2B3B A;  1XVX A;  4N17 A;  1FPE A;  2VPO A;  4NF5 B;  1ANF A;  1HSJ A;  3O6H A;  3SER A;  1LFI A;  2QVR A;  2Y84 A;  1SW5 A;  1QGX A;  3K2D A;  4LQ2 A;  3M3K A;  1B7Z A;  4KQP A;  1FW0 A;  2XHD A;  4LAT A;  4U4X A;  1USY E;  3MP8 A;  2G93 A;  5I84 A;  2QS4 A;  4JSD A;  1Y3N A;  3IR1 A;  4H5F A;  3CG1 A;  3ILU B;  4H8I A;  4R2B A;  3CVG A;  2I6E A;  4H1X A;  5I56 A;  4R6H A;  2P3N A;  3EF7 A;  1GTK A;  3SEU A;  4PFB A;  4PGP A;  3QUF A;  1PC3 A;  2OWZ A;  4F18 A;  2Z23 A;  4ONY A;  4RK9 A;  4F1U A;  3K6W A;  5BUU A;  2CZI A;  4F3S A;  4UA8 A;  5J1D A;  1B46 A;  3KBR A;  5LTC A;  2XD3 A;  2Q8J A;  5H8N B;  4GX4 A;  2CZK A;  1YCJ A;  5IZ3 A;  2GH9 A;  1IZ1 A;  3G3G A;  4PQJ A;  2QS2 A;  1B3E A;  1MY3 A;  1VDW A;  1M5C A;  3KC0 A;  4H8J A;  1UTH A;  3OEK A;  2Q74 A;  3GBB A;  3PTY A;  2F8D A;  3R7X A;  4HS7 A;  2Q2A A;  3Q26 A;  3EHT A;  4I9D A;  4HCW A;  4BLA A;  1B3L A;  4N81 A;  3KJ7 A;  2H5Y A;  1J1N A;  1ATG A;  2ZYN A;  4OEN A;  4GD5 A;  5EYG A;  2F3D A;  3L6G A;  1H45 A;  3IO6 A;  1Y3P A;  1WDN A;  2FYI A;  4Z7E A;  5FHN A;  3RT6 B;  2FIE A;  3HPI A;  1CE2 A;  4PF6 A;  1O7T A;  1S9T A;  4GX3 A;  1N7W A;  1JEV A;  2Z8E A;  1D9Q A;  1Y3Q A;  2B4M A;  1SW2 A;  4MLQ A;  5ELV A;  3TQL A;  1QJM A;  2YLN A;  3O29 A;  5AA3 A;  2P3V A;  2F7B A;  4GOT A;  3H6V A;  1D9Y A;  5ISU A;  1SQY A;  3S9L C;  3KOT A;  1B3F A;  3L6H A;  5AA1 A;  3ZKL A;  4I1D A;  4HXV A;  4XTC Q;  3C35 A;  4X04 A;  3CFL A;  1B32 A;  5CMK A;  1Y9U A;  4O7M A;  1EYJ A;  1BP5 A;  3EHS A;  5I59 B;  3RTF B;  3KFM A;  4IY6 A;  4I3Y A;  4EQ7 A;  1MH3 A;  3H6T A;  1SPI A;  4PFU A;  5CM6 A;  3BBR A;  3D1R A;  3U72 A;  1JEU A;  3O9P A;  3KN3 A;  3CHG A;  1LBX A;  3PUY E;  4POX A;  1TFD A;  4EF1 A;  3G3F A;  3M8U A;  4YU0 A;  2NXO A;  1D4N A;  1UQW A;  4BDO A;  4F3G A;  2R8T A;  2UVI A;  2B4L A;  4LZ7 A;  4R75 A;  2WBD A;  1A8E A;  1ZU0 A;  2L5V A;  2I3W A;  3PPR A;  4N4U A;  2ESN A;  5I2N B;  5JTY B;  2O1M A;  3USD A;  4P9K A;  3U94 A;  5JEI A;  3K1M A;  5H8H B;  1NUX A;  2F7A A;  1TFA A;  4ZEI A;  3KZG A;  1XC1 A;  3N6T A;  5HPQ A;  3IOT A;  4DE8 A;  1Q1K A;  5ITO A;  4FAT A;  1G0H A;  1NNF A;  3RNN A;  1RDZ A;  2ONS A;  4X1D A;  4XEQ A;  2ABH A;  4PFR A;  2F34 A;  5L9M A;  1Q9D A;  4QSD A;  3RGY A;  3PD8 A;  4H6D A;  3LUZ A;  5FTI A;  3DEL B;  4L17 A;  3FZV A;  2O7U A;  3T66 A;  3V89 B;  4YMB A;  3LC8 A;  2XXI A;  3PU5 A;  4BDN A;  4RY1 A;  3TEL A;  3DP4 A;  4ESW A;  4GQO A;  1FBP A;  3FVK A;  2X7Q A;  5EHM A;  4P11 A;  2OK2 A;  3KGC A;  4H45 A;  1QKA A;  3LV0 A;  3MST A;  4RPO A;  3V83 A;  5FTH A;  2HHM A;  3OSQ A;  4MMP A;  1LBZ A;  4ZE8 A;  2DOJ A;  3QMF A;  3LR1 A;  1P1W A;  2XWV A;  1GVC A;  3RT8 A;  2A5T B;  3TYH A;  4PFY A;  4XKP A;  2CZH A;  3D4G A;  5CMB A;  1B7U A;  4N13 A;  4X48 A;  5ET7 A;  2CEX A;  3VLU A;  3C36 A;  5LOM A;  1MQD A;  3THI A;  2DQV A;  1VE4 A;  2WYP A;  5ET6 A;  4UAB A;  1FPG A;  4PDD A;  3MVX A;  3CFZ A;  4XKQ A;  1S7Y A;  2XWK A;  1IEJ A;  2FA7 A;  2OX3 A;  2HPG A;  1YPN A;  5I2K A;  1IIT A;  1RDX A;  2FNC A;  3MAM A;  4QRZ A;  4ZZE A;  2O68 A;  1WOD A;  2XXP A;  4ECF A;  2W7Y A;  4NF6 A;  4ISU A;  1NV5 A;  5DVF A;  1SYH A;  4FEB A;  1FTA A;  3H03 A;  1VR5 A;  3DM0 A;  3PUW E;  4NF8 B;  4F2Q A;  1B4Z A;  2I0B A;  2RC9 A;  4F22 A;  4QXD A;  1FQD A;  1NV4 A;  1LCT A;  3BIG A;  4I62 A;  4ZEF A;  2QJE A;  3GLB A;  3OEL A;  2XXW A;  1XVY A;  4DDD A;  5FHM A;  4NX1 A;  4MLV A;  3K1P A;  5KCJ B;  2CEY A;  3E9X A;  4OES A;  3OEM A;  1LLS A;  4KFQ A;  4KPT A;  3ILT B;  3T9X B;  2KQZ A;  3SEV A;  1DTG A;  2XX7 A;  3FIR A;  3LSF B;  3PPO A;  1LEV A;  5ESY A;  3VXB A;  4C1U A;  5DYH A;  1EU8 A;  5H8H A;  4NF4 B;  4OFL A;  1B9J A;  4QFP A;  4O3B A;  1LBW A;  4FBP A;  4GVO A;  4QF9 A;  1N3W A;  1FPB A;  2WKY A;  2NWJ A;  4EUO A;  1DOT A;  1FBD A;  4N91 A;  2I48 A;  4U1O A;  4K3F A;  4NWD A;  3HST A;  3UOR A;  2XX9 A;  1NNK A;  1ZTY A;  5I5P A;  1QUI A;  1OQG A;  1B3H A;  1QVS A;  1IXH A;  2QMX A;  4GWX A;  5FHO A;  3H6U A;  1NV3 A;  5AE4 A;  4IR8 A;  2V3T A;  1QUK A;  1NUZ A;  3IK6 B;  4P3L A;  2H99 A;  1SVX B;  2OWT A;  5DEX B;  5TPA B;  3MW0 A;  1N0T A;  3FXR A;  3UK4 A;  2GHA A;  1Z7M E;  3KSJ A;  5LDZ A;  4NTL A;  2AYS A;  5TP9 B;  4G68 B;  3R26 A;  3O2A A;  2Z8F A;  3M3F A;  4Q8R A;  4QFO A;  4IY5 A;  2DS9 A;  3S9E A;  1RYX A;  2QSX A;  4OVP A;  3A3U A;  4TQU Q;  2A5T A;  3IJO B;  5H8Q A;  2PVU A;  1NKX A;  4MCO A;  3OO7 A;  4PBH A;  4AQ4 A;  4MF3 A;  1JVY A;  4KYD A;  2ZYO A;  1MRP A;  4PGN A;  3TFL A;  2F36 A;  3LSL A;  4PAF A;  3FJG A;  1FTO A;  4F3P A;  1A8F A;  4THI A;  5IGA A;  1KA1 A;  1B4H A;  4GF8 A;  4YMA A;  4F39 A;  4OVT A;  1AMF A;  4I40 A;  4R72 A;  1LBY A;  2VOZ A;  4PBQ A;  1MPD A;  1YXI A;  3G7W A;  1OQH A;  1R9L A;  4ZEB A;  3KG2 A;  1URS A;  2Y7P A;  2LAO A;  3TMG A;  4KR5 A;  4UAC A;  4MNC A;  4DI3 D;  5I58 B;  3QSL A;  3RPL B;  1VFE A;  5A5X B;  2JJK A;  4GWZ A;  2HEU A;  1IMA A;  2DE2 A;  5EQA A;  2OZZ A;  3E13 X;  1NV2 A;  2XXH A;  3VDF A;  3CRB A;  2RIN A;  4F29 A;  4G8M A;  5KCJ A;  3PMW A;  4XKN A;  4QHQ A;  1KA0 A;  3PUZ E;  2Y7I A;  1IMC A;  5ICT A;  2GQ1 A;  3TTM A;  5H8F B;  3PMV A;  1B58 A;  3PPN A;  4NHB A;  1EH3 A;  3PGF A;  2FVZ A;  4NF0 A;  1IMD A;  4QFN A;  3FV1 A;  3ZKK A;  4NF4 A;  2RF1 A;  1FPL A;  3GZG A;  3T22 A;  1NUW A;  3N26 A;  3SKP A;  3QIM A;  3OSR A;  1A40 A;  1DK4 A;  4C1T A;  1LAF E;  4JB7 A;  3DLN A;  4JSO A;  4LVQ A;  4OQO A;  3BKI B;  2QMW A;  4YIC A;  4YAH X;  4JXI A;  5ITP A;  3V5A A;  4N8G A;  3I5O A;  3A3C A;  4NN3 A;  4QFK A;  2I4C A;  4OEV A;  1SW4 A;  2XA5 A;  3MZ9 A;  2HXW A;  1FBC A;  1A55 A;  3HFU A;  5DEX A;  3A09 A;  5TPA A;  4AS5 A;  2ANJ A;  3SEW A;  2XXR A;  3TEP A;  4WEP A;  3Q25 A;  4N8Y A;  2XWI A;  3JYR A;  1YTV A;  4RK2 A;  4OVQ A;  4FIM A;  1B6H A;  3K00 A;  5TP9 A;  4G68 A;  1VSO A;  1NV7 A;  3TUS A;  4ND9 A;  2F35 A;  3IB2 A;  2ZNS A;  4DI4 B;  3WAF A;  5ET5 A;  3QK6 A;  2F97 A;  3C4M A;  3O6G A;  1NH8 A;  3TCF A;  5F7V A;  4HW8 A;  4H67 A;  3H7M A;  2Q89 A;  5CC2 A;  1QW0 A;  4KHZ E;  2PFY A;  4LUB A;  4I3E A;  1JW5 A;  3T96 B;  3OOA A;  4ESX A;  4DCY A;  2YPN A;  4TOZ A;  1SI0 A;  2WYK A;  4R74 A;  3VXC A;  2P2A A;  2Z22 A;  4EXK A;  4KCD A;  3MYU A;  2Q88 A;  5KDT A;  1B40 A;  3TCH A;  1MQI A;  1FTJ A;  1MQH A;  2E0S A;  1FTM A;  1FRP A;  2O51 A;  2I4B A;  2DVZ A;  3TPA A;  2ZYM A;  5AA4 A;  2XXQ A;  3CFX A;  4WED A;  1NUY A;  4P0G A;  3KBZ A;  2R6G E;  3R6U A;  2G29 A;  4KYS A;  1P1N A;  1ZMG A;  5I58 A;  4GBV A;  4PET A;  1H76 A;  5ET8 A;  1PB8 A;  3RPL A;  1Y20 A;  1F9B A;  2CMO A;  4YB7 A;  4NF5 A;  4GRK A;  3EKI A;  5DVJ A;  1MG1 A;  2RC7 A;  1T0K A;  4G2Z A;  3K6X A;  5HBC A;  1FQE A;  1XS5 A;  2UYE A;  4AB6 A;  3KN8 A;  3IAZ A;  3RY3 A;  5I57 B;  3K1N A;  4GX6 A;  1MQG A;  3B6Q A;  2XD2 A;  1MXX A;  3F11 A;  2P0S A;  2ZZV A;  1WVJ A;  4ELO A;  2M8C A;  1FQC A;  4HE2 A;  3IX1 A;  2O84 X;  2ZZW A;  3K6V A;  2UXA A;  4RXL A;  1URG A;  3GBA A;  5M2V A;  4PP0 A;  4JBZ A;  3FJM A;  5F1Q A;  3CSB A;  1JP4 A;  5J16 A;  3FVN A;  3VLV A;  3IO4 A;  2PCR A;  3GYY A;  1EZP A;  3FAT A;  4O94 A;  4FED A;  1MXY A;  4PC9 A;  5L9S A;  3FJ7 A;  2D21 A;  3VLW A;  5JK4 A;  1M5B A;  5H8N A;  2F7C A;  4OZ9 A;  1P1O A;  4QSC A;  2F6G A;  1TXF A;  1NNT A;  2XWO A;  3FXQ A;  1B0H A;  4BDL A;  4PFT A;  4EDP A;  5BWJ A;  4F3B A;  4GWW A;  1B1H A;  3TAJ A;  4RJZ A;  3H6W A;  4N6P A;  4ZDM A;  1GR2 A;  2UVG A;  3K0V A;  1IXC A;  4Q0C A;  4IGT A;  5EQ7 A;  1AOV A;  1ZJL A;  1PBP A;  2RC8 A;  1ZIU A;  4G68 C;  3ROJ A;  1AWB A;  3D4C A;  1N84 A;  3SET A;  1FPD A;  4MFI A;  1I69 A;  2GRV A;  3FAS A;  3SDF A;  2WBB A;  3PPQ A;  1UTB B;  4PFI A;  2Z8D A;  1MS7 A;  1JW4 A;  4HCY A;  4YB6 A;  1FPJ A;  1NI9 A;  3U1O A;  1RKM A;  4ELR A;  3IOU A;  1LAX A;  3IFC A;  4LA9 A;  2QS3 A;  2O69 A;  2ZZX A;  1P1Q A;  2PMS A;  5DVI A;  4FE8 A;  4GIZ A;  3C31 A;  3MP1 A;  1B5J A;  3VVD A;  4MEV A;  2V84 A; 
#chains in the Genus database with same CATH homology
 1JQF A;  5B70 A;  2QRY A;  3MVY A;  4RA1 A;  2DXR A;  1AH5 A;  1SW1 A;  5I59 A;  4GL8 A;  3C32 A;  4P0I A;  4LZ5 A;  2AIX A;  3G3K A;  3HHF A;  2ONR A;  4R9G A;  3IB0 A;  2REG A;  2Y7K A;  1SI1 A;  5AA2 B;  1Y1M A;  3S4U A;  4ZEC A;  3FVG A;  5CMM A;  4GL0 A;  5IKB A;  3MVW A;  5ICQ A;  3OMB A;  3ECR A;  5I2N A;  5JTY A;  4HTG A;  2OLB A;  2B65 A;  1MXW A;  1SDX A;  3OXN A;  1IQ7 A;  2D3I A;  2OJT A;  2GFE A;  4E0X A;  2DWA A;  4FAJ A;  1B5I A;  4M4G A;  2XX8 A;  3S2V A;  4GXS B;  3UP9 A;  1AIV A;  4GXA A;  1HSL A;  4RNS A;  4F2O A;  3CSG A;  3S9M C;  1MDQ A;  1MY1 A;  3H3G A;  4XIG Q;  2THI A;  3EHU A;  4ZS9 A;  4OFO A;  3HN0 A;  1ZKB A;  3TTR A;  3O97 A;  1Y4T A;  2OBG A;  1OLC A;  4NWC A;  3CI8 A;  2ZYK A;  1FQA A;  2IA4 A;  1TT1 A;  1EZ9 A;  3QUJ A;  1UTH B;  1PEB A;  1MM7 A;  3QXM A;  1YAE A;  4U21 A;  4IO2 A;  2R71 A;  1MXZ A;  1D3K A;  4ZEK A;  1SD3 A;  3OEN A;  1UIU A;  2D5W A;  1MPB A;  2H9B A;  4U1Z A;  2HAV A;  3LUY A;  4KCC A;  3T9V A;  4DXC A;  3RPW A;  4OMB A;  4FJP A;  3UGW A;  2X26 A;  3HO7 A;  4MH5 A;  3FGS A;  3MQ9 A;  2DWJ A;  2I0C A;  1Z7N E;  4LON B;  1MQJ A;  4ZE9 A;  2VHA A;  4G8N A;  3M3L A;  3FXU A;  2F6P A;  4ELP A;  2Q9T A;  3KOS A;  4Q5T A;  1B05 A;  4AB5 A;  4KYE A;  4ZZA A;  1OMP A;  4NF8 A;  3BFU A;  1QUJ A;  2UVJ A;  3MUQ A;  3KN7 A;  4YKK A;  2CZL A;  2XXV A;  1S50 A;  2GHB A;  3DP8 A;  4IO5 A;  1DPP A;  1LAH E;  4BDQ A;  3IB1 A;  1KWH A;  3VFJ A;  3IL1 B;  3SEY A;  2HCA A;  2O6A A;  3KJT A;  2ALU A;  1FTK A;  4Z0I A;  2QL3 A;  2VP1 A;  3T93 B;  1BIY A;  3B6T A;  3UN6 A;  1OIB A;  3O28 A;  1N3X A;  2HZK A;  1FQB A;  2OWS A;  1PBQ A;  1NL5 A;  2Q2C A;  3G3J A;  2ONK E;  1XHY A;  2DWI A;  4EQB A;  3OO8 A;  4KI0 E;  4R2F A;  5K2Y A;  3RUM A;  4R6Y A;  4XKR A;  4U22 A;  4PFW A;  1NMU A;  2PT1 A;  2AL4 A;  2V25 A;  5TU0 A;  2V3U A;  4YKP A;  1RYO A;  4MBP A;  1LBC A;  2RCA A;  3I3V A;  1MH4 A;  3V8X B;  4DZ1 A;  1LBB A;  4WKM A;  2Y7W A;  4KD5 A;  3C33 A;  2DVC A;  3MZ1 A;  3G3H A;  4U2R A;  4F1V A;  1BTJ A;  1IIW A;  3UA8 A;  1SBP A;  1N04 A;  1TWY A;  1B1X A;  3H4Z A;  2AL5 A;  2XXX A;  4E0W A;  3FUZ A;  4WXJ A;  1P1U A;  1US5 A;  4JDF A;  2I49 A;  1PB9 A;  3C9H A;  2HZL A;  1ELJ A;  3PV0 E;  4OVJ A;  3MBP A;  3C34 A;  3TTL A;  4R73 A;  4TLL B;  3ZS6 A;  3VV5 A;  2KLF A;  1IUD A;  3E3K A;  3N94 A;  2V93 A;  4PE5 B;  5I2K B;  4QFL A;  1IXG A;  4G8H A;  4OTE A;  1USY H;  3GXA A;  3ODB A;  4NF6 B;  3LSW A;  3IJX B;  2QPQ A;  5A5X A;  4GWO A;  3TCG A;  1OVB A;  3LBS A;  1P99 A;  2VGQ A;  5HM4 B;  2NUV A;  2O1L A;  3K4U A;  3MP6 A;  2VD3 A;  4IO7 A;  4IO6 A;  4IB2 A;  1Y1Z A;  4IGR A;  3B7D A;  4G4P A;  3AXF A;  1FQF A;  3U92 A;  5EYF A;  4H0W A;  5H8F A;  3CIJ A;  3Q27 A;  2ZXT A;  4YKJ A;  1N76 A;  4H5G A;  3HCQ A;  3PMX A;  4R6K A;  3OD7 A;  3T9H B;  4U4S A;  4BDM A;  1D9V A;  3K6U A;  4OYV A;  1M5E A;  5B7D A;  2DYX A;  5H8S A;  3QYT A;  2DE3 A;  1MY2 A;  5DTB A;  2I3V A;  3Q29 A;  1JNF A;  2PX1 A;  5L8D A;  3RTW B;  3MVZ A;  4YKI A;  1PB7 A;  3RLF E;  2RKM A;  3HV1 A;  1EZO A;  3E4R A;  3TKD A;  3N5L A;  1LAG E;  3I6V A;  4OEU A;  3VVE A;  1MPC A;  1B0L A;  1FTL A;  4G77 A;  4X9T A;  3W9W A;  2IEE A;  4OWD A;  1JW1 A;  4JWO A;  4EF2 A;  2BJJ X;  1B52 A;  1R6Z A;  4O3C A;  4JWY A;  3RN8 A;  1B5H A;  3K01 A;  1B3G A;  3TZA A;  3O6I A;  3HHG A;  1Q35 A;  3OO9 A;  3VE1 B;  3CG3 A;  2YJP A;  1I6A A;  3IOV A;  1OLA A;  3MPK A;  1DMB A;  2PBW A;  1QKB A;  3EN3 A;  4JWX A;  1DPE A;  5H8Q B;  2PYY A;  2QS1 A;  1A7L A;  1MXV A;  1ZLQ A;  4ELQ A;  3MC2 A;  1JET A;  4IO3 A;  4NMY A;  4BDR A;  3SES A;  1POT A;  4DXU A;  2B3F A;  4OXV A;  5CBS A;  3LSX A;  4M1V A;  3U8Q A;  1XT8 A;  1O63 A;  4LZ8 A;  3PUX E;  3MWB A;  3JZJ A;  3OO6 A;  5AA2 D;  1O64 A;  1UIV A;  3VVF A;  5L9O A;  4EQ9 A;  3IOW A;  3DP6 A;  3H06 B;  5CRY A;  3TQW A;  3MZB A;  2ZMB A;  4LP2 B;  3N6U A;  3FD3 A;  3BFT A;  1MY4 A;  1NNP A;  1H43 A;  2HQ0 A;  4H65 A;  1NH7 A;  1BLF A;  2O7I A;  1URD A;  3TDJ A;  3EPE A;  3JV9 A;  2HAU A;  3P7I A;  1LB9 A;  5I57 A;  1I6B A;  2XXU A;  1R1N A;  3G3I A;  2H98 A;  4Q30 B;  2P1S A;  3IOR A;  2F78 A;  3Q28 A;  1OVT A;  5DT6 A;  1LFH A;  2I58 A;  2DSF A;  4GLI A;  1Y4C A;  3MPL A;  4OET A;  1GV8 A;  4YZZ A;  4TLM B;  2DP8 A;  1DTZ A;  3WAE A;  2E1S A;  4DIG A;  4DCX A;  1DSN A;  1GGG A;  2NOO A;  2DWH A;  1MM6 A;  5I56 B;  3ZSF A;  2PT2 A;  3TOD A;  1QUL A;  2X7P A;  5K2X A;  3TTN A;  2XXT A;  4R9F A;  2H4I A;  1A54 A;  3KEI A;  1M5F A;  4F31 B;  1LCF A;  1A99 A;  4RPN A;  3RQT A;  4EXL A;  3CR9 A;  1B2H A;  3K02 A;  3KSX A;  1PDA A;  1US4 A;  3PUV E;  1HSE A;  1MDP 1;  4RYA A;  2NVU B;  4F1Y A;  1B51 A;  5KZT A;  4NE4 A;  5CI5 A;  3U93 A;  1I6Q A;  4N07 A;  4U23 A;  1FCK A;  5EHS A;  4IO4 A;  3PPP A;  3FVO A;  4DXB A;  2XXY A;  1R9Q A;  2R9J A;  4DLD A;  2VD2 A;  1VFD A;  4O3A A;  4FOR A;  2F5X A;  4QSE A;  3T9U A;  4YB5 A;  1MY0 A;  3UIF A;  2DE4 A;  1LB8 A;  4LQ5 A;  1UTB A;  2HFB A;  3SEX A;  4NED A;  2DXY A;  1H44 A;  3S9N C;  2ZNT A;  2REJ A;  4I8C A;  1ZBM A;  1NFT A;  1POY 1;  4X1B A;  2UVH A;  1L5T A;  2UYF A;  1H3D A;  2H25 A;  2ZNU A;  4OHN A;  1M5D A;  1AL3 A;  1LST A;  1LGB C;  3QAX A;  4FEC A;  1CB6 A;  3O66 A;  3EQ1 A;  3B6W A;  2RCB A;  5KDT B;  3PD9 A;  4GFR A;  4OFJ A;  3W15 C;  1JVX A;  5CBR A;  1IXI A;  5CMC A;  1SYI A;  4POW A;  1B7H A;  5AA4 B;  2Y7R A;  1XOC A;  1BKA A;  4OER A;  5IAI A;  1LFG A;  3FV2 A;  3W9V A;  2V3Q A;  2A5S A;  5AA2 A;  4XXU A;  3TTK A;  1II5 A;  1MXU A;  4ZED A;  4C0R A;  2OCU A;  3ONM A;  1N7X A;  4F19 A;  3MJN A;  2B3B A;  1XVX A;  4NF5 B;  1ANF A;  1HSJ A;  3O6H A;  3SER A;  1LFI A;  2Y84 A;  1SW5 A;  3K2D A;  4LQ2 A;  3M3K A;  1B7Z A;  4KQP A;  1FW0 A;  2XHD A;  4LAT A;  4U4X A;  1USY E;  3MP8 A;  2G93 A;  5I84 A;  2QS4 A;  4JSD A;  1Y3N A;  3IR1 A;  4H5F A;  3CG1 A;  3ILU B;  4H8I A;  4R2B A;  3CVG A;  2I6E A;  4H1X A;  5I56 A;  4R6H A;  3EF7 A;  1GTK A;  3SEU A;  3QUF A;  1PC3 A;  4F18 A;  2Z23 A;  4ONY A;  4RK9 A;  4F1U A;  3K6W A;  5BUU A;  4F3S A;  4UA8 A;  5J1D A;  1B46 A;  3KBR A;  2XD3 A;  2Q8J A;  5H8N B;  1YCJ A;  2GH9 A;  1IZ1 A;  3G3G A;  4PQJ A;  2QS2 A;  1B3E A;  1MY3 A;  1M5C A;  4H8J A;  1UTH A;  3OEK A;  3GBB A;  2F8D A;  3R7X A;  4HS7 A;  2Q2A A;  3Q26 A;  3EHT A;  4I9D A;  4HCW A;  4BLA A;  1B3L A;  3KJ7 A;  2H5Y A;  1J1N A;  1ATG A;  2ZYN A;  4OEN A;  4GD5 A;  3L6G A;  1H45 A;  3IO6 A;  1Y3P A;  1WDN A;  2FYI A;  4Z7E A;  5FHN A;  3RT6 B;  3HPI A;  1CE2 A;  1O7T A;  1S9T A;  1N7W A;  1JEV A;  2Z8E A;  1Y3Q A;  1SW2 A;  4MLQ A;  5ELV A;  3TQL A;  1QJM A;  2YLN A;  3O29 A;  5AA3 A;  2F7B A;  4GOT A;  3H6V A;  1D9Y A;  5ISU A;  1SQY A;  3S9L C;  3KOT A;  1B3F A;  3L6H A;  5AA1 A;  3ZKL A;  4I1D A;  4XTC Q;  3C35 A;  3CFL A;  1B32 A;  5CMK A;  1Y9U A;  1BP5 A;  3EHS A;  5I59 B;  3RTF B;  3KFM A;  4IY6 A;  4EQ7 A;  1MH3 A;  3H6T A;  4PFU A;  5CM6 A;  3BBR A;  3U72 A;  1JEU A;  3O9P A;  3KN3 A;  3PUY E;  4POX A;  1TFD A;  4EF1 A;  3G3F A;  3M8U A;  4YU0 A;  2NXO A;  1D4N A;  1UQW A;  4BDO A;  4F3G A;  2UVI A;  4LZ7 A;  4R75 A;  1A8E A;  1ZU0 A;  2I3W A;  3PPR A;  2ESN A;  5I2N B;  5JTY B;  2O1M A;  3USD A;  3U94 A;  5JEI A;  3K1M A;  5H8H B;  2F7A A;  1TFA A;  4ZEI A;  3KZG A;  1XC1 A;  3N6T A;  5HPQ A;  3IOT A;  4DE8 A;  1Q1K A;  5ITO A;  4FAT A;  3RNN A;  1NNF A;  2ONS A;  4X1D A;  2ABH A;  2F34 A;  5L9M A;  3RGY A;  4QSD A;  3PD8 A;  4H6D A;  5FTI A;  3DEL B;  4L17 A;  3FZV A;  2O7U A;  3T66 A;  3V89 B;  4YMB A;  3LC8 A;  2XXI A;  3PU5 A;  4BDN A;  4RY1 A;  3TEL A;  3DP4 A;  4ESW A;  4GQO A;  3FVK A;  2X7Q A;  5EHM A;  4P11 A;  2OK2 A;  3KGC A;  1QKA A;  4RPO A;  3V83 A;  5FTH A;  3OSQ A;  4ZE8 A;  2DOJ A;  3LR1 A;  1P1W A;  1GVC A;  3RT8 A;  2A5T B;  3TYH A;  4PFY A;  4XKP A;  3D4G A;  5CMB A;  1B7U A;  4N13 A;  4X48 A;  3VLU A;  3C36 A;  5LOM A;  1MQD A;  3THI A;  2DQV A;  1VE4 A;  3MVX A;  3CFZ A;  4XKQ A;  1S7Y A;  1IEJ A;  2FA7 A;  1YPN A;  5I2K A;  1IIT A;  3MAM A;  2FNC A;  4QRZ A;  4ZZE A;  2O68 A;  1WOD A;  2XXP A;  4ECF A;  2W7Y A;  4NF6 A;  4ISU A;  5DVF A;  1SYH A;  4FEB A;  3H03 A;  1VR5 A;  3DM0 A;  3PUW E;  4NF8 B;  4F2Q A;  1B4Z A;  2I0B A;  2RC9 A;  4F22 A;  1FQD A;  1LCT A;  4I62 A;  4ZEF A;  2QJE A;  3GLB A;  3OEL A;  2XXW A;  1XVY A;  4DDD A;  5FHM A;  4MLV A;  3K1P A;  5KCJ B;  3E9X A;  4OES A;  3OEM A;  1LLS A;  4KFQ A;  4KPT A;  3ILT B;  3T9X B;  3SEV A;  1DTG A;  2XX7 A;  3FIR A;  3LSF B;  3PPO A;  3VXB A;  4C1U A;  5DYH A;  1EU8 A;  5H8H A;  4NF4 B;  4OFL A;  1B9J A;  4QFP A;  4O3B A;  4GVO A;  4QF9 A;  1N3W A;  2WKY A;  2NWJ A;  4EUO A;  1DOT A;  2I48 A;  4U1O A;  4K3F A;  4NWD A;  3HST A;  3UOR A;  2XX9 A;  1NNK A;  1ZTY A;  1QUI A;  1OQG A;  1B3H A;  1QVS A;  1IXH A;  2QMX A;  5FHO A;  3H6U A;  5AE4 A;  2V3T A;  1QUK A;  3IK6 B;  2H99 A;  1SVX B;  2OWT A;  5DEX B;  5TPA B;  3MW0 A;  1N0T A;  3UK4 A;  3FXR A;  2GHA A;  1Z7M E;  3KSJ A;  4NTL A;  2AYS A;  5TP9 B;  4G68 B;  3R26 A;  3O2A A;  2Z8F A;  3M3F A;  4Q8R A;  4QFO A;  4IY5 A;  2DS9 A;  3S9E A;  1RYX A;  2QSX A;  3A3U A;  4TQU Q;  2A5T A;  3IJO B;  5H8Q A;  2PVU A;  1NKX A;  3OO7 A;  4AQ4 A;  4MF3 A;  1JVY A;  4KYD A;  2ZYO A;  1MRP A;  3TFL A;  2F36 A;  3LSL A;  3FJG A;  1FTO A;  4F3P A;  1A8F A;  4THI A;  1B4H A;  4GF8 A;  4YMA A;  4F39 A;  1AMF A;  4R72 A;  2VOZ A;  1MPD A;  3G7W A;  1OQH A;  1R9L A;  4ZEB A;  3KG2 A;  1URS A;  2Y7P A;  2LAO A;  3TMG A;  4KR5 A;  4UAC A;  5I58 B;  3QSL A;  1VFE A;  5A5X B;  2HEU A;  2DE2 A;  2OZZ A;  3E13 X;  2XXH A;  3VDF A;  3CRB A;  2RIN A;  4F29 A;  4G8M A;  5KCJ A;  3PMW A;  4XKN A;  4QHQ A;  3PUZ E;  2Y7I A;  5ICT A;  3TTM A;  5H8F B;  3PMV A;  1B58 A;  3PPN A;  1EH3 A;  3PGF A;  4QFN A;  3FV1 A;  3ZKK A;  4NF4 A;  2RF1 A;  3GZG A;  3T22 A;  3N26 A;  3SKP A;  3QIM A;  3OSR A;  1A40 A;  4C1T A;  1LAF E;  4JB7 A;  3DLN A;  4JSO A;  4LVQ A;  4OQO A;  3BKI B;  2QMW A;  4YIC A;  4YAH X;  4JXI A;  5ITP A;  3V5A A;  3I5O A;  3A3C A;  4QFK A;  2I4C A;  4OEV A;  1SW4 A;  3MZ9 A;  2HXW A;  1A55 A;  5DEX A;  3A09 A;  5TPA A;  2ANJ A;  3SEW A;  2XXR A;  3TEP A;  4WEP A;  3Q25 A;  3JYR A;  1YTV A;  4RK2 A;  4FIM A;  1B6H A;  3K00 A;  5TP9 A;  4G68 A;  1VSO A;  3TUS A;  4ND9 A;  2F35 A;  3IB2 A;  2ZNS A;  3WAF A;  3QK6 A;  2F97 A;  3C4M A;  3O6G A;  1NH8 A;  3TCF A;  5F7V A;  4HW8 A;  4H67 A;  3H7M A;  2Q89 A;  5CC2 A;  1QW0 A;  4KHZ E;  4LUB A;  1JW5 A;  3T96 B;  3OOA A;  4ESX A;  4DCY A;  2YPN A;  4TOZ A;  1SI0 A;  4R74 A;  3VXC A;  2P2A A;  2Z22 A;  4EXK A;  4KCD A;  2Q88 A;  5KDT A;  1B40 A;  3TCH A;  1MQI A;  1FTJ A;  1MQH A;  2E0S A;  1FTM A;  2O51 A;  2I4B A;  2DVZ A;  3TPA A;  2ZYM A;  5AA4 A;  2XXQ A;  3CFX A;  4WED A;  4P0G A;  2R6G E;  3R6U A;  2G29 A;  4KYS A;  1P1N A;  1ZMG A;  5I58 A;  4PET A;  1H76 A;  1PB8 A;  1Y20 A;  1F9B A;  2CMO A;  4YB7 A;  4NF5 A;  4GRK A;  5DVJ A;  1MG1 A;  2RC7 A;  1T0K A;  4G2Z A;  3K6X A;  5HBC A;  1FQE A;  1XS5 A;  2UYE A;  4AB6 A;  3KN8 A;  3IAZ A;  3RY3 A;  5I57 B;  3K1N A;  1MQG A;  3B6Q A;  2XD2 A;  1MXX A;  3F11 A;  2P0S A;  1WVJ A;  4ELO A;  2M8C A;  1FQC A;  3IX1 A;  2O84 X;  3K6V A;  2UXA A;  4RXL A;  5M2V A;  1URG A;  3GBA A;  4PP0 A;  4JBZ A;  3FJM A;  5F1Q A;  3CSB A;  3FVN A;  3VLV A;  3IO4 A;  1EZP A;  3FAT A;  4FED A;  1MXY A;  5L9S A;  3FJ7 A;  2D21 A;  3VLW A;  5JK4 A;  1M5B A;  5H8N A;  2F7C A;  4OZ9 A;  1P1O A;  4QSC A;  2F6G A;  1TXF A;  1NNT A;  3FXQ A;  1B0H A;  4BDL A;  4PFT A;  4EDP A;  5BWJ A;  4F3B A;  1B1H A;  3TAJ A;  3H6W A;  4N6P A;  4RJZ A;  4ZDM A;  1GR2 A;  2UVG A;  3K0V A;  1IXC A;  4Q0C A;  4IGT A;  1AOV A;  1ZJL A;  1PBP A;  2RC8 A;  1ZIU A;  4G68 C;  3D4C A;  1N84 A;  3SET A;  4MFI A;  1I69 A;  2GRV A;  3FAS A;  3SDF A;  3PPQ A;  1UTB B;  2Z8D A;  1MS7 A;  1JW4 A;  4HCY A;  4YB6 A;  3U1O A;  1RKM A;  4ELR A;  3IOU A;  1LAX A;  4LA9 A;  2QS3 A;  2O69 A;  1P1Q A;  2PMS A;  5DVI A;  4FE8 A;  4GIZ A;  3C31 A;  3MP1 A;  1B5J A;  3VVD A;  2V84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...