5AA2D

Crystal structure of mltf from pseudomonas aeruginosa in complex with nam-pentapeptide.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
416
structure length
416
Chain Sequence
GVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGRDDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFTQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 131
structure length 416
sequence length 416
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
D PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa2D01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa2D02
3MPKA 1P1NA 4F1VA 5F7VA 3K6WA 2A5SA 4PETA 1Z7NE 2FNCA 1RYXA 2O84X 4EQ9A 1NNFA 4C1TA 2XXRA 3PPOA 1AMFA 3FVNA 3C35A 4TLLB 3VLVA 2PT2A 1PBQA 3PUYE 1MXWA 2DSFA 1CB6A 1NH7A 2RC8A 3CI8A 1T0KA 4OMBA 2P2AA 1B6HA 4FEBA 1NKXA 2QMXA 3L6GA 4G2ZA 3CIJA 3FD3A 3D4CA 2HAUA 4ZEKA 3ILTB 2NUVA 4ELOA 1M5DA 2Y84A 3TTMA 4KHZE 3TMGA 3RPWA 4ZE9A 4F29A 3FATA 1M5BA 2QSXA 2YJPA 4MLVA 1NL5A 3O97A 4NF8B 2CMOA 3ZKLA 1EZ9A 1RYOA 1AOVA 5KCJB 2Z8EA 3HHGA 4N07A 2OJTA 3N5LA 2UVHA 3SKPA 4THIA 3OEMA 4RK9A 1ZJLA 2VHAA 1HSJA 1USYE 1XOCA 5I56A 2I4BA 1ATGA 2Q8JA 1D9YA 3DP6A 2GFEA 2UYFA 1QUKA 4Q8RA 3SDFA 5CMKA 2PVUA 4L17A 3TCFA 4RYAA 4WKMA 1XVYA 2H9BA 1QULA 1D9VA 2UVJA 1URSA 3Q25A 1DPEA 4ELPA 4R6YA 3O2AA 3QYTA 1MS7A 3EHUA 1CE2A 5I57B 1N04A 3K6XA 3G3KA 1MXYA 4QSEA 4HS7A 1ZTYA 1O64A 3TCHA 1IXHA 2HEUA 3GBAA 1S9TA 3HO7A 4JDFA 2DXRA 5FTHA 5ICQA 3DELB 1GGGA 1B3EA 5CMBA 4YKIA 4BDQA 3V83A 3JYRA 3UGWA 4OEUA 4JWXA 5CI5A 1GV8A 5FTIA 1Y9UA 5DT6A 4IB2A 3TQLA 4GOTA 2ONSA 4ZZAA 2H5YA 4NF5A 1SVXB 2PBWA 4RPNA 4ZEBA 3QSLA 2VD3A 4X9TA 3VV5A 3OELA 4KCDA 4DXUA 4LZ8A 3K02A 3LSWA 4GRKA 4ESWA 1MXVA 4X1DA 4EQ7A 3BFUA 4U2RA 3PMXA 3MVWA 3KN8A 1JVXA 3G7WA 5HBCA 3R6UA 2DYXA 2UXAA 4R72A 4MFIA 5EYFA 1P1OA 3I5OA 4YKJA 4GFRA 5I58B 3SEYA 2O6AA 2B3FA 1JW1A 1B3GA 2THIA 4F18A 2Q2AA 4ELQA 1A55A 4G77A 2D5WA 2DE2A 3H6WA 2I0BA 1FQAA 1POTA 2Q9TA 4P0GA 3IB1A 1JQFA 3U72A 3Q27A 4YB7A 3KZGA 3OEKA 1LAFE 4KYSA 4TOZA 4F3GA 5EHMA 2RINA 4OESA 3N6UA 4Q30B 2GH9A 3PV0E 4IO3A 1JEVA 1XVXA 1PEBA 1US4A 3RTFB 1M5EA 2G93A 2XXIA 3RGYA 5AA2A 1TFDA 3HN0A 2V25A 3E3KA 4LONB 1QKBA 2E0SA 2V3QA 4ESXA 3LSFB 2XX8A 4G8NA 3EF7A 1MH3A 5AA4B 3FASA 5ISUA 5I59A 3KOSA 4Z0IA 1IIWA 1MQDA 3SETA 1MH4A 4DCXA 1JW4A 3SEVA 3RY3A 1LLSA 4ZZEA 3U93A 3H06B 3GZGA 2HZLA 1L5TA 3PUZE 2IEEA 4F1YA 1LCFA 1NNKA 1MXUA 2F6PA 2P0SA 1Y4CA 3LSXA 3FV1A 2DP8A 1FQFA 4GF8A 1FTMA 4F31B 2REGA 3WAEA 3KOTA 3TTRA 4NF4A 4ND9A 1R6ZA 1UIUA 1LCTA 3OXNA 4C1UA 4QSDA 3HCQA 3FVOA 4NF6B 5DTBA 3MVYA 1UIVA 5TPAA 2RCBA 2REJA 2UVGA 3DP8A 1NH8A 3P7IA 4DE8A 4PP0A 4FECA 3FIRA 3A09A 2F8DA 3TDJA 2RKMA 4PQJA 2I58A 3ECRA 2Y7PA 1PB7A 3V8XB 2X7QA 2ZNSA 3MP1A 1A7LA 1RKMA 1WODA 4IY5A 1DPPA 1Y3NA 4QFPA 4OFOA 1P1UA 4FEDA 3RN8A 4PFTA 3MW0A 1D4NA 3T93B 1Q35A 3FGSA 5H8NA 4X48A 1H76A 3UK4A 4AQ4A 4R6HA 3ZS6A 2HZKA 1B46A 5I2KB 2Y7WA 2QJEA 3TPAA 4PFWA 3M8UA 3QAXA 3A3CA 4EXLA 3QUJA 4U22A 3M3FA 1ZMGA 4IY6A 2OZZA 1MY2A 3TUSA 4H6DA 4MLQA 4DXCA 1WVJA 2R9JA 1ANFA 3OO7A 3CSBA 2QS3A 3O6HA 1B4ZA 2I3WA 4DXBA 3TFLA 3M3KA 1JVYA 4JXIA 3HV1A 3C31A 4R2FA 2HQ0A 4LATA 3R26A 1LSTA 4X1BA 4BDMA 2DE3A 4M1VA 3H7MA 1JNFA 2B65A 5ELVA 4AB5A 4I62A 5TP9B 4FATA 4HCYA 1NFTA 3SEUA 4ZDMA 4OENA 4IO5A 2XX7A 4KQPA 3T9UA 4H67A 4GXAA 4G68A 5L9SA 3CFXA 5F1QA 3B6WA 4FAJA 4BDRA 4IGTA 3O28A 1SYIA 1ZBMA 1B1HA 3FJ7A 4GL8A 1H44A 3TCGA 2I49A 2ANJA 4NF8A 2H99A 1J1NA 3IORA 3VE1B 1LFIA 4ZEIA 2CZLA 3UIFA 5H8QA 5DEXA 3FXRA 4LVQA 3G3GA 3PPQA 1XS5A 4GQOA 4JSDA 1TWYA 3TQWA 4U23A 3PUWE 3L6HA 3FJMA 1D3KA 1QUJA 3E4RA 2OWTA 4XTCQ 3WAFA 2NOOA 2XXYA 4DZ1A 3IJXB 3N6TA 4QF9A 3T66A 5HPQA 3JZJA 4E0XA 1Y3PA 4GD5A 1B7ZA 4PE5B 1R9LA 4YICA 1VFEA 3H03A 4ONYA 4R9FA 1VSOA 1OQGA 3QUFA 4GVOA 1P99A 4RY1A 1M5FA 3PGFA 1H45A 2I48A 4I8CA 4NTLA 3ZSFA 4F1UA 2G29A 1EU8A 3KEIA 4H1XA 4NEDA 2XXTA 4U21A 5CBRA 1IXCA 2OCUA 1B1XA 1MXXA 5I57A 5I56B 4G8HA 1DTZA 1BP5A 1ZIUA 3IR1A 3H6TA 2O69A 4Z7EA 1N7WA 2KLFA 2D21A 3RQTA 3H6UA 1B3FA 1SW2A 3IO6A 5FHOA 1WDNA 3O9PA 3CVGA 1B5IA 3H3GA 4XKPA 4F3SA 2W7YA 4NWDA 1Q1KA 3FXQA 4H5GA 3VXCA 5H8HA 3BBRA 4YAHX 4BLAA 5CMMA 3B6QA 4ZECA 4YZZA 2NXOA 2OLBA 3T9VA 3VVEA 3C4MA 2VD2A 2X26A 2UYEA 1P1WA 1HSEA 2H98A 1OVTA 3K00A 4LA9A 4F2OA 3OENA 5I2NB 1IXGA 3O66A 4IGRA 3LSLA 1GTKA 3KBRA 2Q89A 2Y7IA 3GBBA 4OZ9A 3EN3A 3IJOB 3S2VA 3UORA 1XC1A 3MPLA 4HTGA 2DWAA 1O7TA 2AL4A 4BDOA 3IL1B 2XD2A 3ZKKA 5I58A 2O51A 4RXLA 1TXFA 5AA1A 3VXBA 1YPNA 4H8IA 4EDPA 1N76A 3S9EA 2NVUB 4F19A 3TZAA 3U94A 2GRVA 2PX1A 2GHAA 1A54A 5DVJA 3K6VA 4KD5A 1I6BA 4OTEA 2E1SA 4IO6A 1H3DA 3CG1A 3G3FA 4MH5A 2YLNA 1UTBB 2O68A 1SBPA 2XXPA 4XKQA 3K1PA 2FYIA 1I6AA 5A5XA 4OETA 1B5JA 4XKRA 4RNSA 3KJTA 3MP6A 4O3CA 3SEWA 1DSNA 1B32A 5AA3A 3HSTA 4POXA 2R6GE 4WEDA 3GXAA 1PB9A 2QS2A 1FW0A 2DWIA 1QKAA 3MWBA 5FHNA 5L8DA 1ZU0A 1XHYA 1N0TA 3RUMA 1UQWA 3GLBA 2H4IA 3MZBA 1PBPA 4EQBA 1EH3A 2F35A 1SW1A 4QRZA 3ONMA 3MUQA 5H8FB 1IZ1A 1YAEA 3U8QA 2QPQA 1FTLA 5IAIA 4ZS9A 1EZOA 1B2HA 2V3UA 4ECFA 2F97A 5AA2B 4GIZA 4JB7A 3TTNA 3UN6A 4FE8A 4F22A 5JTYB 3LC8A 3HHFA 1MDP1 4KPTA 3PU5A 1MRPA 4FIMA 2XX9A 1AH5A 4U1ZA 3QXMA 1A8FA 2DWHA 3T22A 3CR9A 2ONKE 3O6IA 4RA1A 5AE4A 2DE4A 2OWSA 1B4HA 3LR1A 1QUIA 3U92A 3UA8A 2Z8DA 5KDTA 4FJPA 3T9XB 1Y3QA 3T9HB 4F39A 3IAZA 1NNTA 3HPIA 3RLFE 4YB6A 4K3FA 4NF4B 4NMYA 1MY3A 3BFTA 5K2XA 3KJ7A 3TKDA 5KZTA 1LAGE 1SYHA 4ELRA 5CM6A 1PDAA 4KCCA 5EHSA 2V93A 4E0WA 1FQBA 3C36A 1B5HA 2RC9A 2A5TB 4HCWA 1UTHB 2DS9A 4PFYA 1N3WA 3KG2A 1IQ7A 2ESNA 5I2KA 2QRYA 2VOZA 1Y4TA 2PMSA 2YPNA 4OXVA 5LOMA 3S4UA 4EF1A 1YCJA 3SERA 1MQGA 4M4GA 5I84A 2QS1A 3UP9A 3IOUA 2V84A 1NMUA 1JW5A 2DWJA 2Z8FA 1MPCA 3EHSA 2XXUA 3M3LA 1OLCA 1TFAA 1B3HA 3IX1A 2XXQA 3FUZA 4O3AA 5J1DA 5H8NB 2ZYOA 2I0CA 4YU0A 4MBPA 2F36A 1S50A 2QL3A 3MAMA 2HXWA 1DOTA 4BDNA 3K2DA 1GVCA 3N94A 5CRYA 4FORA 2Q2CA 2Z23A 1MQJA 2UVIA 1EZPA 4XXUA 3MZ1A 4POWA 5K2YA 1SDXA 3PUVE 1R9QA 3IOTA 2I3VA 5AA2D 5FHMA 3KFMA 1F9BA 4KYEA 3TODA 4ZE8A 3PPPA 2XHDA 4XIGQ 2ALUA 1SI0A 4P0IA 1QW0A 2D3IA 3RT6B 2DQVA 3W9VA 4R2BA 2IA4A 5DVIA 3TYHA 5TP9A 5M2VA 1A8EA 3Q26A 5CMCA 1B7HA 1LFGA 2DOJA 4IO7A 4N13A 2ABHA 3IB2A 3I3VA 4OVJA 2HAVA 4R74A 4JWOA 1MM6A 2OBGA 3K6UA 1LB9A 3OO9A 3QK6A 1LBCA 1SW5A 1VFDA 2F78A 1IITA 3FVGA 4N6PA 2ZXTA 1AIVA 4R6KA 4GWOA 3V5AA 3CFZA 1MPBA 4RPOA 5CC2A 4H8JA 3IOVA 4H0WA 2F34A 2RC7A 5KCJA 2FA7A 4MF3A 4G68B 4QHQA 4H65A 5IKBA 4LUBA 3QIMA 3V89B 3PMWA 4UACA 1SW4A 3MVXA 1DMBA 3O6GA 3SESA 3MJNA 1LAXA 1N84A 5BUUA 1MQIA 4QSCA 1Y1ZA 1TT1A 5ITPA 5H8QB 5DEXB 1IEJA 3K0VA 5L9MA 3CRBA 2XXVA 3Q29A 2O1LA 3C34A 3BKIB 4EXKA 4YB5A 4JWYA 2ZYKA 3PPRA 2RCAA 4OWDA 1OIBA 1OMPA 1MXZA 2Z22A 1JEUA 4OEVA 3OOAA 4WXJA 2QS4A 3H4ZA 3FVKA 2O7UA 3G3HA 3KGCA 1B51A 4Q0CA 1MDQA 1VR5A 2F7CA 1MY1A 4WEPA 1AL3A 2V3TA 1PB8A 4JSOA 4DLDA 1B0LA 1DTGA 1IXIA 1XT8A 3D4GA 3AXFA 4OERA 5JK4A 1BTJA 2AYSA 2ZYNA 1URGA 2DVZA 2XXWA 3DLNA 3S9MC 4TLMB 1Y1MA 2I6EA 4QFNA 2F7AA 2M8CA 3O29A 3KN7A 2GHBA 4GLIA 4AB6A 5L9OA 2DXYA 3IO4A 4OFLA 4OQOA 2RF1A 2F5XA 2H25A 3FZVA 4I9DA 3JV9A 4KI0E 5I2NA 4F3PA 3VDFA 4EUOA 3RNNA 3R7XA 1LAHE 4QFOA 4U1OA 5H8HB 1P1QA 4U4XA 1B7UA 5B7DA 1BLFA 3S9NC 1M5CA 3K01A 4JBZA 2OK2A 4LZ7A 1PC3A 4G8MA 5B70A 3SEXA 3LBSA 2XXXA 1POY1 4NF5B 3KN3A 3OSRA 3VLUA 3S9LC 3MZ9A 1HSLA 1LFHA 1SD3A 2PYYA 1NNPA 3PD8A 1OLAA 3PMVA 4IO2A 3CSGA 4YMBA 1IUDA 1UTBA 3KSXA 3C32A 2HFBA 3TAJA 3IOWA 3FV2A 3DM0A 4OFJA 2B3BA 2AIXA 2XXHA 2ZMBA 5ITOA 1MG1A 1OQHA 5HM4B 3DP4A 1BIYA 3G3IA 4YKPA 1USYH 2Q88A 3U1OA 3OO8A 3CFLA 1JETA 1YTVA 3B7DA 1B40A 1LBBA 1VE4A 1Y20A 2O7IA 4Q5TA 5A5XB 1II5A 3PUXE 3N26A 1QVSA 4BDLA 1US5A 5H8FA 1SQYA 2ZNTA 4XKNA 3W15C 3VVDA 1O63A 5AA4A 4LQ5A 1N3XA 3G3JA 1SI1A 4DCYA 1I69A 4QFKA 1B52A 1A99A 2HCAA 2X7PA 3RTWB 2PT1A 3EHTA 4PFUA 3F11A 3ILUB 3W9WA 4LP2B 2VGQA 1MM7A 3MP8A 5TU0A 3OO6A 5JTYA 3OMBA 4KFQA 4RJZA 1I6QA 2BJJX 4OHNA 4LZ5A 1ELJA 4F3BA 3IK6B 2F7BA 4EF2A 3ODBA 1FTKA 5I59B 3PPNA 4I1DA 3USDA 1ZKBA 3IB0A 3LUYA 4U4SA 1QJMA 2Y7KA 2QMWA 2WKYA 4R75A 2O1MA 3EPEA 5BWJA 4DDDA 5H8SA 1B05A 4NF6A 1B0HA 3EQ1A 1MQHA 2F6GA 5ICTA 3Q28A 3VFJA 1BKAA 5DYHA 1GR2A 4G68C 1ZLQA 1B3LA 2XD3A 2ZYMA 1LGBC 1KWHA 5CBSA 2Y7RA 4H5FA 3C33A 4UA8A 1Z7ME 3E9XA 3I6VA 3E13X 1S7YA 4YMAA 4F2QA 5KDTB 1LB8A 4QFLA 1FTOA 3MQ9A 1FQCA 4NWCA 1URDA 5TPAB 2LAOA 2A5TA 1FCKA 1R1NA 3PD9A 1UTHA 3B6TA 3VLWA 2NWJA 2P1SA 5JEIA 2VP1A 4TQUQ 1N7XA 3FJGA 4NE4A 3KSJA 1OVBA 1FTJA 4IO4A 2ONRA 2I4CA 3K1NA 4OYVA 4O3BA 1FQEA 1FQDA 2ZNUA 2AL5A 1MPDA 1MY0A 5DVFA 2R71A 3H6VA 4RK2A 3MVZA 1H43A 4G4PA 4KR5A 3MBPA 4HW8A 4P11A 4GL0A 4LQ2A 3FXUA 4ZEDA 3K4UA 4R9GA 3C9HA 1MY4A 3TTKA 1B58A 4R73A 4ISUA 4C0RA 3OD7A 1A40A 3K1MA 4DIGA 3A3UA 2DVCA 3T96B 4ZEFA 4GXSB 3MC2A 3RT8A 3OSQA 3TTLA 1B9JA 3TELA 3CG3A 3THIA 4YKKA 3TEPA 3VVFA 4KYDA
chains in the Genus database with same CATH superfamily
3MPKA 1P1NA 4F1VA 5F7VA 3K6WA 2A5SA 4PETA 1Z7NE 2FNCA 1RYXA 3MYUA 2O84X 4EQ9A 1NNFA 4C1TA 1K9ZA 2XXRA 3PPOA 1AMFA 3FVNA 3C35A 4TLLB 3VLVA 2PT2A 1K9YA 1PBQA 3PUYE 2XA5A 1MXWA 2DSFA 1CB6A 1NH7A 3LV0A 2QFLA 2RC8A 3CI8A 1T0KA 4OMBA 2P2AA 1B6HA 4FEBA 4P3LA 1CNQA 1NKXA 4PFBA 2QMXA 3L6GA 4N91A 4PC9A 4G2ZA 3CIJA 3FD3A 3D4CA 2HAUA 4ZEKA 2CZKA 3ILTB 3SZPA 2NUVA 4NHBA 4ELOA 1M5DA 2Y84A 3TTMA 4KHZE 3TMGA 3ISPA 4PFRA 3RPWA 5IZZA 4ZE9A 4N6DA 4F29A 3FATA 1M5BA 2QSXA 2YJPA 4MLVA 1KA0A 1NL5A 3O97A 4NF8B 2CMOA 3ZKLA 1EYKA 3E79A 1EZ9A 1RYOA 1AOVA 5KCJB 2Z8EA 3HHGA 4N07A 4NGUA 2OJTA 3N5LA 2UVHA 3SKPA 4P1EA 4THIA 4NN3A 3OEMA 2CEXA 4RK9A 3LUZA 1ZJLA 1NI9A 2VHAA 1HSJA 1USYE 4I3EA 2XWKA 1XOCA 5I56A 4MIJA 2I4BA 1ATGA 2Q8JA 1D9YA 5IZ3A 3DP6A 2GFEA 2UYFA 1QUKA 4Q8RA 3SDFA 5CMKA 2PVUA 4L17A 3TCFA 3D1RA 4RYAA 4WKMA 1XVYA 2H9BA 1QULA 1D9VA 2UVJA 4I3YA 1URSA 5ET7A 3Q25A 1DPEA 4ELPA 5I5PA 2QVRA 4R6YA 3O2AA 3QYTA 1MS7A 3EHUA 1FBFA 1CE2A 5I57B 1N04A 3CHGA 3K6XA 3G3KA 1MXYA 4QSEA 5EQ8A 4HS7A 1ZTYA 1O64A 3TCHA 1IXHA 2HEUA 3GBAA 4OVTA 1FJ9A 1S9TA 3HO7A 4JDFA 2DXRA 5FTHA 5ICQA 3DELB 1GGGA 1B3EA 5CMBA 4YKIA 4BDQA 4PBQA 1SPIA 3V83A 4PAIA 3JYRA 3UGWA 1DBZA 4OEUA 4JWXA 5CI5A 5FTIA 1GV8A 1Y9UA 5DT6A 4IB2A 3TQLA 1EYJA 4MNCA 1FPFA 4GOTA 2ONSA 3T1BA 4ZZAA 2H5YA 4NF5A 1SVXB 2CZHA 3FBPA 2PBWA 4RPNA 4ZEBA 3QSLA 2VD3A 4X9TA 3VV5A 4LZ8A 3OELA 4KCDA 4DXUA 3K02A 3LSWA 1FBEA 4GRKA 4ESWA 4MMPA 1MXVA 4X1DA 4EQ7A 1NV7A 3BFUA 4U2RA 3PMXA 3MVWA 3KN8A 1JVXA 3G7WA 5HBCA 3R6UA 2DYXA 2UXAA 4R72A 4MFIA 5EYFA 2FBPA 1P1OA 4HE1A 3I5OA 4YKJA 4GFRA 5I58B 3SEYA 4O7IA 2O6AA 1LBYA 2B3FA 1JW1A 1B3GA 2THIA 4F18A 4GX4A 2Q2AA 4ELQA 1A55A 4G77A 2D5WA 2DE2A 3H6WA 2I0BA 1FQAA 1POTA 1NV1A 2Q9TA 5EQ9A 4P0GA 3IB1A 4GWXA 1JQFA 1RDXA 3U72A 3Q27A 4YB7A 3KZGA 3OEKA 1LAFE 4KYSA 4TOZA 4F3GA 5EHMA 2RINA 4OESA 3N6UA 4Q30B 2GH9A 4PTKA 3PV0E 4IO3A 1JEVA 1XVXA 1PEBA 4MNPA 1US4A 4GWWA 3RTFB 4KXPA 1M5EA 2G93A 2XXIA 3RGYA 5AA2A 1TFDA 3HN0A 2V25A 1NUXA 3E3KA 4LONB 1QKBA 2E0SA 2V3QA 1LBVA 4ESXA 3LSFB 2XX8A 4G8NA 3EF7A 1FBCA 1MH3A 5AA4B 3FASA 5ISUA 1INPA 5I59A 3KOSA 4Z0IA 2QVVA 1FJ6A 1FBPA 1KA1A 1IIWA 1MQDA 3SETA 5IGAA 1MH4A 2B4LA 4DCXA 3IFAA 2BJIA 1JW4A 3SEVA 3RY3A 1LLSA 4ZZEA 3U93A 3H06B 3GZGA 1LBXA 2HZLA 1L5TA 1AWBA 4X04A 3PUZE 2VPOA 2IEEA 4F1YA 1LCFA 1NNKA 1D9QA 1MXUA 2F6PA 2P0SA 2WBBA 1Y4CA 3LSXA 3FV1A 2DP8A 1FQFA 4GF8A 4PAFA 1FTMA 4F31B 2REGA 3WAEA 3KOTA 3TTRA 4NF4A 4ND9A 1R6ZA 1UIUA 1LCTA 3OXNA 4C1UA 4QSDA 4GX6A 3HCQA 3FVOA 4NF6B 5DTBA 3MVYA 1UIVA 3QMFA 5TPAA 2RCBA 2REJA 2UVGA 3DP8A 1NH8A 3P7IA 4JVDA 4DE8A 4PP0A 4FECA 4XEQA 3FIRA 3A09A 2F8DA 5ET8A 3TDJA 2RKMA 4PQJA 2I58A 1FPKA 3ECRA 2Y7PA 1PB7A 3V8XB 3KC1A 2X7QA 2ZNSA 3MP1A 5LDZA 1A7LA 4XF5A 1RKMA 5A5LA 1WODA 2V4CA 4IY5A 1DPPA 1Y3NA 4QFPA 4OFOA 1Q9DA 1P1UA 4FEDA 2FIEA 3RN8A 1DK4A 4PFTA 3MW0A 1D4NA 3T93B 1Q35A 3FGSA 5H8NA 4X48A 1H76A 3UK4A 4AQ4A 4GWUA 1NV0A 4R6HA 3ZS6A 2HZKA 1B46A 5I2KB 2Y7WA 2QJEA 3TPAA 2WEFA 1NV4A 4PFWA 3M8UA 3QAXA 3A3CA 4EXLA 3QUJA 2Y5KA 4U22A 3M3FA 3RYDA 1ZMGA 4IY6A 2OZZA 1MY2A 3TUSA 4H6DA 4MLQA 1NUWA 4XFEA 4DXCA 1WVJA 2QVUA 2R9JA 1ANFA 4X8RA 3OO7A 1LEVA 1EYIA 4OA4A 3CSBA 2QS3A 3O6HA 1B4ZA 2I3WA 4DXBA 3TFLA 3M3KA 1JVYA 4NX1A 4JXIA 3HV1A 3C31A 4R2FA 2HQ0A 4LATA 3R26A 1LSTA 4X1BA 4BDMA 2DE3A 4M1VA 3H7MA 4LN5A 1JNFA 3A29A 2B65A 5ELVA 4AB5A 4I62A 5DW8A 5TP9B 2HHMA 4FATA 4HCYA 1NFTA 3SEUA 4ZDMA 4OENA 4O8MA 4IO5A 2XX7A 4KQPA 3T9UA 4H67A 4GXAA 4OVPA 1FPBA 4G68A 1NV5A 5L9SA 3CFXA 4DI3D 5F1QA 3B6WA 4FAJA 3BIGA 4IGTA 4BDRA 3O28A 1SYIA 1ZBMA 1B1HA 4PE3A 3FJ7A 4GL8A 1H44A 3TCGA 3B8BA 3RPLB 2I49A 2ANJA 4NF8A 2H99A 1J1NA 3IORA 3VE1B 1LFIA 4ZEIA 2CZLA 3UIFA 5H8QA 5DEXA 3FXRA 4LVQA 1JP4A 3G3GA 3PPQA 1XS5A 1YYZA 4GQOA 1IMFA 4JSDA 1TWYA 4FBPA 3TQWA 4U23A 3PUWE 3L6HA 3FJMA 1QUJA 1D3KA 3E4RA 1IMEA 2OWTA 5I7IA 4XTCQ 5EQ7A 3WAFA 2NOOA 2XXYA 4DZ1A 3IJXB 4N81A 3N6TA 4NQ8A 4QF9A 3T66A 5HPQA 4PF6A 3JZJA 4E0XA 1Y3PA 4GD5A 1B7ZA 4PE5B 1R9LA 4YICA 1VFEA 3H03A 4ONYA 4R9FA 1G0HA 3MSTA 1VSOA 1OQGA 3QUFA 4GVOA 4N15A 1P99A 4RY1A 1M5FA 3PGFA 2R8TA 3NOHA 1H45A 2I48A 4I8CA 4NTLA 3ZSFA 4F1UA 2G29A 1EU8A 3KEIA 4H1XA 4NEDA 2XXTA 4U21A 5CBRA 1IXCA 4NG7A 2OX3A 1FBGA 1B1XA 1FBHA 2OCUA 1MXXA 4PAKA 5I57A 4MHFA 5I56B 4G8HA 1DTZA 1BP5A 1FPDA 1ZIUA 3IR1A 3H6TA 2O69A 4Z7EA 1N7WA 4MEVA 5J16A 5IZ3B 2KLFA 2D21A 3RQTA 3H6UA 1B3FA 1SW2A 2PCRA 3IO6A 5FHOA 1WDNA 3IFCA 3O9PA 3CVGA 1B5IA 3H3GA 4XKPA 4F3SA 2W7YA 4NWDA 1Q1KA 3FXQA 4H5GA 2F3BA 3VXCA 5H8HA 3BBRA 4YAHX 4BLAA 5CMMA 3B6QA 4ZECA 4YZZA 2NXOA 2GQ1A 2OLBA 4MAGA 3T9VA 3VVEA 3C4MA 4PDHA 2VD2A 5I3SA 2X26A 5FBPA 1LBZA 2UYEA 1P1WA 1HSEA 2H98A 1OVTA 3K00A 4LA9A 4H46A 3OENA 4F2OA 5I2NB 1LBWA 1IXGA 3O66A 4IGRA 3LSLA 1GTKA 3KBRA 2Q89A 2Y7IA 3GBBA 4OZ9A 3EN3A 3IJOB 3S2VA 3UORA 2WYKA 1XC1A 3MPLA 4HTGA 2DWAA 1O7TA 2AL4A 4BDOA 3IL1B 3FXBA 2XD2A 3ZKKA 5I58A 2O51A 1IMBA 4RXLA 1TXFA 5AA1A 3HFUA 3VXBA 1XI6A 1YPNA 4H8IA 4EDPA 1N76A 3S9EA 2NVUB 4F19A 3TZAA 3U94A 2GRVA 2PX1A 2GHAA 1A54A 5DVJA 1NV2A 1RDZA 3K6VA 4KD5A 1I6BA 4OTEA 2E1SA 2WX9A 4IO6A 1H3DA 3CG1A 3G3FA 4MH5A 2YLNA 2F3DA 1UTBB 4OANA 2O68A 1SBPA 2XXPA 4XKQA 4N17A 3K1PA 2XWIA 2FYIA 1I6AA 4N4UA 5A5XA 4OETA 1B5JA 4XKRA 4RNSA 3KJTA 3MP6A 4O3CA 3SEWA 4O94A 1DSNA 1B32A 1FTAA 5AA3A 3HSTA 2PFYA 4POXA 2R6GE 4WEDA 3GXAA 1PB9A 1FPGA 2QS2A 1FW0A 2DWIA 1QKAA 3MWBA 1IMCA 5FHNA 5L8DA 2Q74A 1ZU0A 1XHYA 1N0TA 3RUMA 1UQWA 2DDKA 3GLBA 2H4IA 3MZBA 1PBPA 4EQBA 1EH3A 2F35A 2WYPA 1SW1A 4QRZA 3ONMA 3MUQA 5H8FB 1IZ1A 1YAEA 3KBZA 3U8QA 2QPQA 1FTLA 5IAIA 4ZS9A 1EZOA 1B2HA 1YXIA 2CEYA 2V3UA 4ECFA 1NUYA 2F97A 5AA2B 4GIZA 4JB7A 3TTNA 3UN6A 4FE8A 4F22A 1IMAA 5JTYB 3LC8A 3HHFA 1MDP1 4KPTA 3PU5A 1MRPA 4FIMA 2XX9A 1AH5A 4I40A 4U1ZA 3QXMA 1A8FA 2DWHA 3T22A 3CR9A 2ONKE 3O6IA 4JVCA 4RA1A 5AE4A 2DE4A 2L5VA 2OWSA 2ZZXA 1B4HA 5EQAA 3E78A 2ZZVA 2PFZA 3LR1A 1QUIA 3U92A 2MKZA 3UA8A 2FIXA 4PF8A 2Z8DA 5KDTA 4FJPA 3T9XB 1Y3QA 3T9HB 4F39A 3IAZA 1NNTA 3HPIA 3RLFE 4YB6A 4K3FA 1DCUA 4NF4B 4NMYA 1MY3A 3BFTA 5K2XA 4GWYA 3KJ7A 3TKDA 5KZTA 4MNIA 1LAGE 1SYHA 4ELRA 5CM6A 1PDAA 4KCCA 3T0JA 1BK4A 4NAPA 2Q8MA 5EHSA 2V93A 4MCOA 4E0WA 1FQBA 4N6KA 3C36A 4GWZA 1B5HA 2RC9A 2A5TB 4HCWA 1UTHB 2DS9A 4PFYA 1N3WA 3KG2A 1IQ7A 2ESNA 5I2KA 5IZ1A 2QRYA 2VOZA 4PGNA 1Y4TA 2PMSA 2YPNA 4GWSA 4OXVA 5LOMA 3S4UA 4EF1A 1YCJA 3SERA 1MQGA 4M4GA 5I84A 2QS1A 3UP9A 3IOUA 2V84A 1NMUA 1JW5A 2DWJA 2Z8FA 1MPCA 3EHSA 2XXUA 3M3LA 1OLCA 1TFAA 1B3HA 3IX1A 2XXQA 3FUZA 2B4MA 4O3AA 5J1DA 5H8NB 3ROJA 2ZYOA 4OVSA 2I0CA 5ET6A 4YU0A 4MBPA 2F36A 1S50A 2QL3A 3MAMA 2HXWA 1DOTA 4BDNA 3K2DA 1GVCA 3B50A 3N94A 5CRYA 4FORA 2Q2CA 2Z23A 1MQJA 2UVIA 1EZPA 4XXUA 3MZ1A 4POWA 5K2YA 1SDXA 3PUVE 1R9QA 3IOTA 2I3VA 5AA2D 5FHMA 3KFMA 1F9BA 4KYEA 3TODA 4ZE8A 3PPPA 2XHDA 4XIGQ 2ALUA 1SI0A 4P0IA 1QW0A 2D3IA 3RT6B 2DQVA 3W9VA 4R2BA 2IA4A 5DVIA 3TYHA 5TP9A 5M2VA 1A8EA 3Q26A 5CMCA 1B7HA 1LFGA 4UABA 2DOJA 4IO7A 4N13A 2ABHA 3IB2A 3I3VA 4OVJA 2HAVA 5ET5A 1KZ8A 2WBDA 4R74A 4JWOA 1MM6A 2OBGA 3K6UA 1LB9A 3OO9A 4P1LA 3QK6A 2CZIA 1LBCA 1SW5A 4P56A 1VFDA 4PFIA 1NV6A 4NF0A 3RPLA 2F78A 1IITA 3FVGA 4PCDA 3BIHA 4N6PA 2ZXTA 1AIVA 4R6KA 4GWOA 3V5AA 3CFZA 1MPBA 4RPOA 5CC2A 4H8JA 3IOVA 4H0WA 2F34A 2RC7A 5KCJA 2FA7A 4MF3A 4G68B 4QHQA 4H65A 5IKBA 4LUBA 3QIMA 1QGXA 3V89B 4N8YA 3PMWA 4UACA 1SW4A 3MVXA 1DMBA 3O6GA 3SESA 3MJNA 1LAXA 1N84A 5BUUA 1MQIA 4QSCA 1Y1ZA 1TT1A 5ITPA 5H8QB 5DEXB 1IEJA 3K0VA 3PTYA 5L9MA 3CRBA 2XXVA 3Q29A 2O1LA 3C34A 3BKIB 4EXKA 4YB5A 4JWYA 2ZYKA 3PPRA 2RCAA 4HXVA 4OWDA 1OIBA 1OMPA 1MXZA 4P8BA 2Z22A 5T3JA 1JEUA 4OEVA 3OOAA 4WXJA 2QS4A 3H4ZA 3FVKA 2O7UA 3G3HA 3KGCA 1B51A 4Q0CA 1MDQA 1VR5A 2F7CA 1MY1A 4WEPA 4MJOA 1AL3A 2V3TA 1PB8A 4QBAA 4JSOA 4DLDA 2P3VA 1B0LA 1DTGA 1IXIA 1XT8A 3D4GA 1IMDA 1FRPA 3AXFA 4OERA 2ZZWA 5JK4A 1BTJA 2AYSA 2ZYNA 1URGA 2DVZA 2XXWA 3DLNA 3S9MC 4TLMB 1Y1MA 2I6EA 4QFNA 2F7AA 2VPNA 2M8CA 3O29A 3KN7A 2GHBA 4GLIA 4GX3A 4AB6A 5L9OA 2DXYA 3IO4A 4OFLA 1FPJA 4OQOA 2RF1A 2F5XA 2H25A 3FZVA 4I9DA 3JV9A 4KI0E 5I2NA 4F3PA 3VDFA 4EUOA 2OWZA 3RNNA 3R7XA 1LAHE 4QFOA 4U1OA 5H8HB 1P1QA 4U4XA 1B7UA 3KC0A 5B7DA 1BLFA 3S9NC 1M5CA 3K01A 4JBZA 2OK2A 1NV3A 4LZ7A 1PC3A 4G8MA 5B70A 3SEXA 3LBSA 4P9KA 2XXXA 1POY1 4NF5B 3KN3A 3OSRA 1FBDA 1G0IA 3VLUA 3S9LC 3MZ9A 1HSLA 1LFHA 1SD3A 4HE0A 2PYYA 1NNPA 3PD8A 1OLAA 3PMVA 4IO2A 4OVQA 3CSGA 4YMBA 4DI4B 1IUDA 4AS5A 1UTBA 3KSXA 4PGPA 3C32A 2HFBA 3TAJA 3IOWA 3FV2A 3DM0A 4OFJA 4JVIA 2B3BA 2AIXA 2XXHA 2ZMBA 5ITOA 1MG1A 1OQHA 5HM4B 4GBVA 3DP4A 1BIYA 2XWOA 3G3IA 4YKPA 1USYH 2Q88A 3U1OA 3OO8A 3CFLA 1JETA 1YTVA 3B7DA 1B40A 1LBBA 1VE4A 1VDWA 1Y20A 2XWVA 1FPEA 2O7IA 4IR8A 1YZ0A 4Q5TA 5A5XB 1II5A 3PUXE 3N26A 1QVSA 4BDLA 1NUZA 1US5A 5H8FA 1SQYA 2ZNTA 4XKNA 3W15C 3VVDA 2Y5LA 1O63A 5AA4A 4LQ5A 1N3XA 3G3JA 1SI1A 4DCYA 1I69A 4QFKA 1B52A 1A99A 2HCAA 2X7PA 3RTWB 2PT1A 5ESYA 3EHTA 4PFUA 3F11A 3ILUB 3W9WA 4LP2B 2VGQA 1MM7A 3MP8A 5TU0A 3OO6A 3EKIA 5JTYA 3OMBA 4PDDA 4KFQA 4RJZA 1I6QA 2BJJX 4OHNA 4LZ5A 2XXKA 1ELJA 4F3BA 3IK6B 2F7BA 5EYHA 4EF2A 3ODBA 1FTKA 4H45A 3U65A 2FHYA 5I59B 3PPNA 4I1DA 3USDA 2VT5A 1ZKBA 2HPGA 3IB0A 3LUYA 4U4SA 1QJMA 2Y7KA 2QMWA 2WKYA 4R75A 2O1MA 3EPEA 5BWJA 4DDDA 5H8SA 1B05A 4NF6A 1B0HA 3EQ1A 1MQHA 2F6GA 4P47A 1FPLA 5ICTA 3Q28A 3VFJA 1BKAA 5DYHA 2KR0A 1GR2A 4G68C 1ZLQA 1B3LA 2XD3A 2ZYMA 1LGBC 1FPIA 1KWHA 5CBSA 2Y7RA 4H5FA 3C33A 4UA8A 1Z7ME 3E9XA 3I6VA 1RDYA 3E13X 1S7YA 4YMAA 4G61A 4F2QA 5KDTB 2HXRA 1LB8A 4QFLA 1FTOA 3MQ9A 1FQCA 4QXDA 4NWCA 1URDA 5TPAB 2LAOA 2A5TA 1FCKA 1R1NA 3PD9A 1UTHA 3B6TA 3VLWA 2NWJA 2P1SA 5JEIA 2VP1A 4TQUQ 1N7XA 3FJGA 5F24A 4NE4A 3KSJA 1OVBA 1FTJA 4HE2A 4IO4A 2ONRA 2I4CA 3K1NA 4OYVA 4O3BA 1FQEA 5IM2A 1FQDA 2ZNUA 2AL5A 1MPDA 1MY0A 3GYYA 5DVFA 2R71A 3H6VA 4RK2A 3MVZA 1H43A 4G4PA 4KR5A 1FSAA 4N8GA 3MBPA 4HW8A 4P11A 4GL0A 4GBWA 4OVRA 4LQ2A 3FXUA 4ZEDA 3K4UA 4MX6A 4R9GA 3C9HA 4AS4A 1MY4A 2P3NA 3TTKA 1B58A 5EYGA 4PBHA 4R73A 4ISUA 2JJKA 3OD7A 4O7MA 4C0RA 1A40A 3K1MA 4DIGA 3A3UA 2DVCA 3T96B 4ZEFA 4GXSB 3MC2A 3RT8A 3OSQA 3TTLA 1B9JA 3TELA 3CG3A 3THIA 2FVZA 4YKKA 2KQZA 3TEPA 5LTCA 3VVFA 4KYDA
chains in the Genus database with same CATH topology
3MPKA 1P1NA 4F1VA 5F7VA 3K6WA 2A5SA 4PETA 1Z7NE 2FNCA 1RYXA 2O84X 4EQ9A 1NNFA 4C1TA 2XXRA 3PPOA 1AMFA 3FVNA 3C35A 4TLLB 3VLVA 2PT2A 1PBQA 3PUYE 1MXWA 2DSFA 1CB6A 1NH7A 2RC8A 3CI8A 1T0KA 4OMBA 2P2AA 1B6HA 4FEBA 1NKXA 2QMXA 3L6GA 4G2ZA 3CIJA 3FD3A 3D4CA 2HAUA 4ZEKA 3ILTB 2NUVA 4ELOA 1M5DA 2Y84A 3TTMA 4KHZE 3TMGA 3RPWA 4ZE9A 4F29A 3FATA 1M5BA 2QSXA 2YJPA 4MLVA 1NL5A 3O97A 4NF8B 2CMOA 3ZKLA 1EZ9A 1RYOA 1AOVA 5KCJB 2Z8EA 3HHGA 4N07A 2OJTA 3N5LA 2UVHA 3SKPA 4THIA 3OEMA 4RK9A 1ZJLA 2VHAA 1HSJA 1USYE 1XOCA 5I56A 2I4BA 1ATGA 2Q8JA 1D9YA 3DP6A 2GFEA 2UYFA 1QUKA 4Q8RA 3SDFA 5CMKA 2PVUA 4L17A 3TCFA 4RYAA 4WKMA 1XVYA 2H9BA 1QULA 1D9VA 2UVJA 1URSA 3Q25A 1DPEA 4ELPA 4R6YA 3O2AA 3QYTA 1MS7A 3EHUA 1CE2A 5I57B 1N04A 3K6XA 3G3KA 1MXYA 4QSEA 4HS7A 1ZTYA 1O64A 3TCHA 1IXHA 2HEUA 3GBAA 1S9TA 3HO7A 4JDFA 2DXRA 5FTHA 5ICQA 3DELB 1GGGA 1B3EA 5CMBA 4YKIA 4BDQA 3V83A 3JYRA 3UGWA 4OEUA 4JWXA 5CI5A 1GV8A 5FTIA 1Y9UA 5DT6A 4IB2A 3TQLA 4GOTA 2ONSA 4ZZAA 2H5YA 4NF5A 1SVXB 2PBWA 4RPNA 4ZEBA 3QSLA 2VD3A 4X9TA 3VV5A 3OELA 4KCDA 4DXUA 4LZ8A 3K02A 3LSWA 4GRKA 4ESWA 1MXVA 4X1DA 4EQ7A 3BFUA 4U2RA 3PMXA 3MVWA 3KN8A 1JVXA 3G7WA 5HBCA 3R6UA 2DYXA 2UXAA 4R72A 4MFIA 5EYFA 1P1OA 3I5OA 4YKJA 4GFRA 5I58B 3SEYA 2O6AA 2B3FA 1JW1A 1B3GA 2THIA 4F18A 2Q2AA 4ELQA 1A55A 4G77A 2D5WA 2DE2A 3H6WA 2I0BA 1FQAA 1POTA 2Q9TA 4P0GA 3IB1A 1JQFA 3U72A 3Q27A 4YB7A 3KZGA 3OEKA 1LAFE 4KYSA 4TOZA 4F3GA 5EHMA 2RINA 4OESA 3N6UA 4Q30B 2GH9A 3PV0E 4IO3A 1JEVA 1XVXA 1PEBA 1US4A 3RTFB 1M5EA 2G93A 2XXIA 3RGYA 5AA2A 1TFDA 3HN0A 2V25A 3E3KA 4LONB 1QKBA 2E0SA 2V3QA 4ESXA 3LSFB 2XX8A 4G8NA 3EF7A 1MH3A 5AA4B 3FASA 5ISUA 5I59A 3KOSA 4Z0IA 1IIWA 1MQDA 3SETA 1MH4A 4DCXA 1JW4A 3SEVA 3RY3A 1LLSA 4ZZEA 3U93A 3H06B 3GZGA 2HZLA 1L5TA 3PUZE 2IEEA 4F1YA 1LCFA 1NNKA 1MXUA 2F6PA 2P0SA 1Y4CA 3LSXA 3FV1A 2DP8A 1FQFA 4GF8A 1FTMA 4F31B 2REGA 3WAEA 3KOTA 3TTRA 4NF4A 4ND9A 1R6ZA 1UIUA 1LCTA 3OXNA 4C1UA 4QSDA 3HCQA 3FVOA 4NF6B 5DTBA 3MVYA 1UIVA 5TPAA 2RCBA 2REJA 2UVGA 3DP8A 1NH8A 3P7IA 4DE8A 4PP0A 4FECA 3FIRA 3A09A 2F8DA 3TDJA 2RKMA 4PQJA 2I58A 3ECRA 2Y7PA 1PB7A 3V8XB 2X7QA 2ZNSA 3MP1A 1A7LA 1RKMA 1WODA 4IY5A 1DPPA 1Y3NA 4QFPA 4OFOA 1P1UA 4FEDA 3RN8A 4PFTA 3MW0A 1D4NA 3T93B 1Q35A 3FGSA 5H8NA 4X48A 1H76A 3UK4A 4AQ4A 4R6HA 3ZS6A 2HZKA 1B46A 5I2KB 2Y7WA 2QJEA 3TPAA 4PFWA 3M8UA 3QAXA 3A3CA 4EXLA 3QUJA 4U22A 3M3FA 1ZMGA 4IY6A 2OZZA 1MY2A 3TUSA 4H6DA 4MLQA 4DXCA 1WVJA 2R9JA 1ANFA 3OO7A 3CSBA 2QS3A 3O6HA 1B4ZA 2I3WA 4DXBA 3TFLA 3M3KA 1JVYA 4JXIA 3HV1A 3C31A 4R2FA 2HQ0A 4LATA 3R26A 1LSTA 4X1BA 4BDMA 2DE3A 4M1VA 3H7MA 1JNFA 2B65A 5ELVA 4AB5A 4I62A 5TP9B 4FATA 4HCYA 1NFTA 3SEUA 4ZDMA 4OENA 4IO5A 2XX7A 4KQPA 3T9UA 4H67A 4GXAA 4G68A 5L9SA 3CFXA 5F1QA 3B6WA 4FAJA 4BDRA 4IGTA 3O28A 1SYIA 1ZBMA 1B1HA 3FJ7A 4GL8A 1H44A 3TCGA 2I49A 2ANJA 4NF8A 2H99A 1J1NA 3IORA 3VE1B 1LFIA 4ZEIA 2CZLA 3UIFA 5H8QA 5DEXA 3FXRA 4LVQA 3G3GA 3PPQA 1XS5A 4GQOA 4JSDA 1TWYA 3TQWA 4U23A 3PUWE 3L6HA 3FJMA 1D3KA 1QUJA 3E4RA 2OWTA 4XTCQ 3WAFA 2NOOA 2XXYA 4DZ1A 3IJXB 3N6TA 4QF9A 3T66A 5HPQA 3JZJA 4E0XA 1Y3PA 4GD5A 1B7ZA 4PE5B 1R9LA 4YICA 1VFEA 3H03A 4ONYA 4R9FA 1VSOA 1OQGA 3QUFA 4GVOA 1P99A 4RY1A 1M5FA 3PGFA 1H45A 2I48A 4I8CA 4NTLA 3ZSFA 4F1UA 2G29A 1EU8A 3KEIA 4H1XA 4NEDA 2XXTA 4U21A 5CBRA 1IXCA 2OCUA 1B1XA 1MXXA 5I57A 5I56B 4G8HA 1DTZA 1BP5A 1ZIUA 3IR1A 3H6TA 2O69A 4Z7EA 1N7WA 2KLFA 2D21A 3RQTA 3H6UA 1B3FA 1SW2A 3IO6A 5FHOA 1WDNA 3O9PA 3CVGA 1B5IA 3H3GA 4XKPA 4F3SA 2W7YA 4NWDA 1Q1KA 3FXQA 4H5GA 3VXCA 5H8HA 3BBRA 4YAHX 4BLAA 5CMMA 3B6QA 4ZECA 4YZZA 2NXOA 2OLBA 3T9VA 3VVEA 3C4MA 2VD2A 2X26A 2UYEA 1P1WA 1HSEA 2H98A 1OVTA 3K00A 4LA9A 4F2OA 3OENA 5I2NB 1IXGA 3O66A 4IGRA 3LSLA 1GTKA 3KBRA 2Q89A 2Y7IA 3GBBA 4OZ9A 3EN3A 3IJOB 3S2VA 3UORA 1XC1A 3MPLA 4HTGA 2DWAA 1O7TA 2AL4A 4BDOA 3IL1B 2XD2A 3ZKKA 5I58A 2O51A 4RXLA 1TXFA 5AA1A 3VXBA 1YPNA 4H8IA 4EDPA 1N76A 3S9EA 2NVUB 4F19A 3TZAA 3U94A 2GRVA 2PX1A 2GHAA 1A54A 5DVJA 3K6VA 4KD5A 1I6BA 4OTEA 2E1SA 4IO6A 1H3DA 3CG1A 3G3FA 4MH5A 2YLNA 1UTBB 2O68A 1SBPA 2XXPA 4XKQA 3K1PA 2FYIA 1I6AA 5A5XA 4OETA 1B5JA 4XKRA 4RNSA 3KJTA 3MP6A 4O3CA 3SEWA 1DSNA 1B32A 5AA3A 3HSTA 4POXA 2R6GE 4WEDA 3GXAA 1PB9A 2QS2A 1FW0A 2DWIA 1QKAA 3MWBA 5FHNA 5L8DA 1ZU0A 1XHYA 1N0TA 3RUMA 1UQWA 3GLBA 2H4IA 3MZBA 1PBPA 4EQBA 1EH3A 2F35A 1SW1A 4QRZA 3ONMA 3MUQA 5H8FB 1IZ1A 1YAEA 3U8QA 2QPQA 1FTLA 5IAIA 4ZS9A 1EZOA 1B2HA 2V3UA 4ECFA 2F97A 5AA2B 4GIZA 4JB7A 3TTNA 3UN6A 4FE8A 4F22A 5JTYB 3LC8A 3HHFA 1MDP1 4KPTA 3PU5A 1MRPA 4FIMA 2XX9A 1AH5A 4U1ZA 3QXMA 1A8FA 2DWHA 3T22A 3CR9A 2ONKE 3O6IA 4RA1A 5AE4A 2DE4A 2OWSA 1B4HA 3LR1A 1QUIA 3U92A 3UA8A 2Z8DA 5KDTA 4FJPA 3T9XB 1Y3QA 3T9HB 4F39A 3IAZA 1NNTA 3HPIA 3RLFE 4YB6A 4K3FA 4NF4B 4NMYA 1MY3A 3BFTA 5K2XA 3KJ7A 3TKDA 5KZTA 1LAGE 1SYHA 4ELRA 5CM6A 1PDAA 4KCCA 5EHSA 2V93A 4E0WA 1FQBA 3C36A 1B5HA 2RC9A 2A5TB 4HCWA 1UTHB 2DS9A 4PFYA 1N3WA 3KG2A 1IQ7A 2ESNA 5I2KA 2QRYA 2VOZA 1Y4TA 2PMSA 2YPNA 4OXVA 5LOMA 3S4UA 4EF1A 1YCJA 3SERA 1MQGA 4M4GA 5I84A 2QS1A 3UP9A 3IOUA 2V84A 1NMUA 1JW5A 2DWJA 2Z8FA 1MPCA 3EHSA 2XXUA 3M3LA 1OLCA 1TFAA 1B3HA 3IX1A 2XXQA 3FUZA 4O3AA 5J1DA 5H8NB 2ZYOA 2I0CA 4YU0A 4MBPA 2F36A 1S50A 2QL3A 3MAMA 2HXWA 1DOTA 4BDNA 3K2DA 1GVCA 3N94A 5CRYA 4FORA 2Q2CA 2Z23A 1MQJA 2UVIA 1EZPA 4XXUA 3MZ1A 4POWA 5K2YA 1SDXA 3PUVE 1R9QA 3IOTA 2I3VA 5AA2D 5FHMA 3KFMA 1F9BA 4KYEA 3TODA 4ZE8A 3PPPA 2XHDA 4XIGQ 2ALUA 1SI0A 4P0IA 1QW0A 2D3IA 3RT6B 2DQVA 3W9VA 4R2BA 2IA4A 5DVIA 3TYHA 5TP9A 5M2VA 1A8EA 3Q26A 5CMCA 1B7HA 1LFGA 2DOJA 4IO7A 4N13A 2ABHA 3IB2A 3I3VA 4OVJA 2HAVA 4R74A 4JWOA 1MM6A 2OBGA 3K6UA 1LB9A 3OO9A 3QK6A 1LBCA 1SW5A 1VFDA 2F78A 1IITA 3FVGA 4N6PA 2ZXTA 1AIVA 4R6KA 4GWOA 3V5AA 3CFZA 1MPBA 4RPOA 5CC2A 4H8JA 3IOVA 4H0WA 2F34A 2RC7A 5KCJA 2FA7A 4MF3A 4G68B 4QHQA 4H65A 5IKBA 4LUBA 3QIMA 3V89B 3PMWA 4UACA 1SW4A 3MVXA 1DMBA 3O6GA 3SESA 3MJNA 1LAXA 1N84A 5BUUA 1MQIA 4QSCA 1Y1ZA 1TT1A 5ITPA 5H8QB 5DEXB 1IEJA 3K0VA 5L9MA 3CRBA 2XXVA 3Q29A 2O1LA 3C34A 3BKIB 4EXKA 4YB5A 4JWYA 2ZYKA 3PPRA 2RCAA 4OWDA 1OIBA 1OMPA 1MXZA 2Z22A 1JEUA 4OEVA 3OOAA 4WXJA 2QS4A 3H4ZA 3FVKA 2O7UA 3G3HA 3KGCA 1B51A 4Q0CA 1MDQA 1VR5A 2F7CA 1MY1A 4WEPA 1AL3A 2V3TA 1PB8A 4JSOA 4DLDA 1B0LA 1DTGA 1IXIA 1XT8A 3D4GA 3AXFA 4OERA 5JK4A 1BTJA 2AYSA 2ZYNA 1URGA 2DVZA 2XXWA 3DLNA 3S9MC 4TLMB 1Y1MA 2I6EA 4QFNA 2F7AA 2M8CA 3O29A 3KN7A 2GHBA 4GLIA 4AB6A 5L9OA 2DXYA 3IO4A 4OFLA 4OQOA 2RF1A 2F5XA 2H25A 3FZVA 4I9DA 3JV9A 4KI0E 5I2NA 4F3PA 3VDFA 4EUOA 3RNNA 3R7XA 1LAHE 4QFOA 4U1OA 5H8HB 1P1QA 4U4XA 1B7UA 5B7DA 1BLFA 3S9NC 1M5CA 3K01A 4JBZA 2OK2A 4LZ7A 1PC3A 4G8MA 5B70A 3SEXA 3LBSA 2XXXA 1POY1 4NF5B 3KN3A 3OSRA 3VLUA 3S9LC 3MZ9A 1HSLA 1LFHA 1SD3A 2PYYA 1NNPA 3PD8A 1OLAA 3PMVA 4IO2A 3CSGA 4YMBA 1IUDA 1UTBA 3KSXA 3C32A 2HFBA 3TAJA 3IOWA 3FV2A 3DM0A 4OFJA 2B3BA 2AIXA 2XXHA 2ZMBA 5ITOA 1MG1A 1OQHA 5HM4B 3DP4A 1BIYA 3G3IA 4YKPA 1USYH 2Q88A 3U1OA 3OO8A 3CFLA 1JETA 1YTVA 3B7DA 1B40A 1LBBA 1VE4A 1Y20A 2O7IA 4Q5TA 5A5XB 1II5A 3PUXE 3N26A 1QVSA 4BDLA 1US5A 5H8FA 1SQYA 2ZNTA 4XKNA 3W15C 3VVDA 1O63A 5AA4A 4LQ5A 1N3XA 3G3JA 1SI1A 4DCYA 1I69A 4QFKA 1B52A 1A99A 2HCAA 2X7PA 3RTWB 2PT1A 3EHTA 4PFUA 3F11A 3ILUB 3W9WA 4LP2B 2VGQA 1MM7A 3MP8A 5TU0A 3OO6A 5JTYA 3OMBA 4KFQA 4RJZA 1I6QA 2BJJX 4OHNA 4LZ5A 1ELJA 4F3BA 3IK6B 2F7BA 4EF2A 3ODBA 1FTKA 5I59B 3PPNA 4I1DA 3USDA 1ZKBA 3IB0A 3LUYA 4U4SA 1QJMA 2Y7KA 2QMWA 2WKYA 4R75A 2O1MA 3EPEA 5BWJA 4DDDA 5H8SA 1B05A 4NF6A 1B0HA 3EQ1A 1MQHA 2F6GA 5ICTA 3Q28A 3VFJA 1BKAA 5DYHA 1GR2A 4G68C 1ZLQA 1B3LA 2XD3A 2ZYMA 1LGBC 1KWHA 5CBSA 2Y7RA 4H5FA 3C33A 4UA8A 1Z7ME 3E9XA 3I6VA 3E13X 1S7YA 4YMAA 4F2QA 5KDTB 1LB8A 4QFLA 1FTOA 3MQ9A 1FQCA 4NWCA 1URDA 5TPAB 2LAOA 2A5TA 1FCKA 1R1NA 3PD9A 1UTHA 3B6TA 3VLWA 2NWJA 2P1SA 5JEIA 2VP1A 4TQUQ 1N7XA 3FJGA 4NE4A 3KSJA 1OVBA 1FTJA 4IO4A 2ONRA 2I4CA 3K1NA 4OYVA 4O3BA 1FQEA 1FQDA 2ZNUA 2AL5A 1MPDA 1MY0A 5DVFA 2R71A 3H6VA 4RK2A 3MVZA 1H43A 4G4PA 4KR5A 3MBPA 4HW8A 4P11A 4GL0A 4LQ2A 3FXUA 4ZEDA 3K4UA 4R9GA 3C9HA 1MY4A 3TTKA 1B58A 4R73A 4ISUA 4C0RA 3OD7A 1A40A 3K1MA 4DIGA 3A3UA 2DVCA 3T96B 4ZEFA 4GXSB 3MC2A 3RT8A 3OSQA 3TTLA 1B9JA 3TELA 3CG3A 3THIA 4YKKA 3TEPA 3VVFA 4KYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MPK A;  1P1N A;  4F1V A;  5F7V A;  3K6W A;  2A5S A;  4PET A;  1Z7N E;  2FNC A;  1RYX A;  2O84 X;  4EQ9 A;  1NNF A;  4C1T A;  2XXR A;  3PPO A;  1AMF A;  3FVN A;  3C35 A;  4TLL B;  3VLV A;  2PT2 A;  1PBQ A;  3PUY E;  1MXW A;  2DSF A;  1CB6 A;  1NH7 A;  2RC8 A;  3CI8 A;  1T0K A;  4OMB A;  2P2A A;  1B6H A;  4FEB A;  1NKX A;  2QMX A;  3L6G A;  4G2Z A;  3CIJ A;  3FD3 A;  3D4C A;  2HAU A;  4ZEK A;  3ILT B;  2NUV A;  4ELO A;  1M5D A;  2Y84 A;  3TTM A;  4KHZ E;  3TMG A;  3RPW A;  4ZE9 A;  4F29 A;  3FAT A;  1M5B A;  2QSX A;  2YJP A;  4MLV A;  1NL5 A;  3O97 A;  4NF8 B;  2CMO A;  3ZKL A;  1EZ9 A;  1RYO A;  1AOV A;  5KCJ B;  2Z8E A;  3HHG A;  4N07 A;  2OJT A;  3N5L A;  2UVH A;  3SKP A;  4THI A;  3OEM A;  4RK9 A;  1ZJL A;  2VHA A;  1HSJ A;  1USY E;  1XOC A;  5I56 A;  2I4B A;  1ATG A;  2Q8J A;  1D9Y A;  3DP6 A;  2GFE A;  2UYF A;  1QUK A;  4Q8R A;  3SDF A;  5CMK A;  2PVU A;  4L17 A;  3TCF A;  4RYA A;  4WKM A;  1XVY A;  2H9B A;  1QUL A;  1D9V A;  2UVJ A;  1URS A;  3Q25 A;  1DPE A;  4ELP A;  4R6Y A;  3O2A A;  3QYT A;  1MS7 A;  3EHU A;  1CE2 A;  5I57 B;  1N04 A;  3K6X A;  3G3K A;  1MXY A;  4QSE A;  4HS7 A;  1ZTY A;  1O64 A;  3TCH A;  1IXH A;  2HEU A;  3GBA A;  1S9T A;  3HO7 A;  4JDF A;  2DXR A;  5FTH A;  5ICQ A;  3DEL B;  1GGG A;  1B3E A;  5CMB A;  4YKI A;  4BDQ A;  3V83 A;  3JYR A;  3UGW A;  4OEU A;  4JWX A;  5CI5 A;  1GV8 A;  5FTI A;  1Y9U A;  5DT6 A;  4IB2 A;  3TQL A;  4GOT A;  2ONS A;  4ZZA A;  2H5Y A;  4NF5 A;  1SVX B;  2PBW A;  4RPN A;  4ZEB A;  3QSL A;  2VD3 A;  4X9T A;  3VV5 A;  3OEL A;  4KCD A;  4DXU A;  4LZ8 A;  3K02 A;  3LSW A;  4GRK A;  4ESW A;  1MXV A;  4X1D A;  4EQ7 A;  3BFU A;  4U2R A;  3PMX A;  3MVW A;  3KN8 A;  1JVX A;  3G7W A;  5HBC A;  3R6U A;  2DYX A;  2UXA A;  4R72 A;  4MFI A;  5EYF A;  1P1O A;  3I5O A;  4YKJ A;  4GFR A;  5I58 B;  3SEY A;  2O6A A;  2B3F A;  1JW1 A;  1B3G A;  2THI A;  4F18 A;  2Q2A A;  4ELQ A;  1A55 A;  4G77 A;  2D5W A;  2DE2 A;  3H6W A;  2I0B A;  1FQA A;  1POT A;  2Q9T A;  4P0G A;  3IB1 A;  1JQF A;  3U72 A;  3Q27 A;  4YB7 A;  3KZG A;  3OEK A;  1LAF E;  4KYS A;  4TOZ A;  4F3G A;  5EHM A;  2RIN A;  4OES A;  3N6U A;  4Q30 B;  2GH9 A;  3PV0 E;  4IO3 A;  1JEV A;  1XVX A;  1PEB A;  1US4 A;  3RTF B;  1M5E A;  2G93 A;  2XXI A;  3RGY A;  5AA2 A;  1TFD A;  3HN0 A;  2V25 A;  3E3K A;  4LON B;  1QKB A;  2E0S A;  2V3Q A;  4ESX A;  3LSF B;  2XX8 A;  4G8N A;  3EF7 A;  1MH3 A;  5AA4 B;  3FAS A;  5ISU A;  5I59 A;  3KOS A;  4Z0I A;  1IIW A;  1MQD A;  3SET A;  1MH4 A;  4DCX A;  1JW4 A;  3SEV A;  3RY3 A;  1LLS A;  4ZZE A;  3U93 A;  3H06 B;  3GZG A;  2HZL A;  1L5T A;  3PUZ E;  2IEE A;  4F1Y A;  1LCF A;  1NNK A;  1MXU A;  2F6P A;  2P0S A;  1Y4C A;  3LSX A;  3FV1 A;  2DP8 A;  1FQF A;  4GF8 A;  1FTM A;  4F31 B;  2REG A;  3WAE A;  3KOT A;  3TTR A;  4NF4 A;  4ND9 A;  1R6Z A;  1UIU A;  1LCT A;  3OXN A;  4C1U A;  4QSD A;  3HCQ A;  3FVO A;  4NF6 B;  5DTB A;  3MVY A;  1UIV A;  5TPA A;  2RCB A;  2REJ A;  2UVG A;  3DP8 A;  1NH8 A;  3P7I A;  4DE8 A;  4PP0 A;  4FEC A;  3FIR A;  3A09 A;  2F8D A;  3TDJ A;  2RKM A;  4PQJ A;  2I58 A;  3ECR A;  2Y7P A;  1PB7 A;  3V8X B;  2X7Q A;  2ZNS A;  3MP1 A;  1A7L A;  1RKM A;  1WOD A;  4IY5 A;  1DPP A;  1Y3N A;  4QFP A;  4OFO A;  1P1U A;  4FED A;  3RN8 A;  4PFT A;  3MW0 A;  1D4N A;  3T93 B;  1Q35 A;  3FGS A;  5H8N A;  4X48 A;  1H76 A;  3UK4 A;  4AQ4 A;  4R6H A;  3ZS6 A;  2HZK A;  1B46 A;  5I2K B;  2Y7W A;  2QJE A;  3TPA A;  4PFW A;  3M8U A;  3QAX A;  3A3C A;  4EXL A;  3QUJ A;  4U22 A;  3M3F A;  1ZMG A;  4IY6 A;  2OZZ A;  1MY2 A;  3TUS A;  4H6D A;  4MLQ A;  4DXC A;  1WVJ A;  2R9J A;  1ANF A;  3OO7 A;  3CSB A;  2QS3 A;  3O6H A;  1B4Z A;  2I3W A;  4DXB A;  3TFL A;  3M3K A;  1JVY A;  4JXI A;  3HV1 A;  3C31 A;  4R2F A;  2HQ0 A;  4LAT A;  3R26 A;  1LST A;  4X1B A;  4BDM A;  2DE3 A;  4M1V A;  3H7M A;  1JNF A;  2B65 A;  5ELV A;  4AB5 A;  4I62 A;  5TP9 B;  4FAT A;  4HCY A;  1NFT A;  3SEU A;  4ZDM A;  4OEN A;  4IO5 A;  2XX7 A;  4KQP A;  3T9U A;  4H67 A;  4GXA A;  4G68 A;  5L9S A;  3CFX A;  5F1Q A;  3B6W A;  4FAJ A;  4BDR A;  4IGT A;  3O28 A;  1SYI A;  1ZBM A;  1B1H A;  3FJ7 A;  4GL8 A;  1H44 A;  3TCG A;  2I49 A;  2ANJ A;  4NF8 A;  2H99 A;  1J1N A;  3IOR A;  3VE1 B;  1LFI A;  4ZEI A;  2CZL A;  3UIF A;  5H8Q A;  5DEX A;  3FXR A;  4LVQ A;  3G3G A;  3PPQ A;  1XS5 A;  4GQO A;  4JSD A;  1TWY A;  3TQW A;  4U23 A;  3PUW E;  3L6H A;  3FJM A;  1D3K A;  1QUJ A;  3E4R A;  2OWT A;  4XTC Q;  3WAF A;  2NOO A;  2XXY A;  4DZ1 A;  3IJX B;  3N6T A;  4QF9 A;  3T66 A;  5HPQ A;  3JZJ A;  4E0X A;  1Y3P A;  4GD5 A;  1B7Z A;  4PE5 B;  1R9L A;  4YIC A;  1VFE A;  3H03 A;  4ONY A;  4R9F A;  1VSO A;  1OQG A;  3QUF A;  4GVO A;  1P99 A;  4RY1 A;  1M5F A;  3PGF A;  1H45 A;  2I48 A;  4I8C A;  4NTL A;  3ZSF A;  4F1U A;  2G29 A;  1EU8 A;  3KEI A;  4H1X A;  4NED A;  2XXT A;  4U21 A;  5CBR A;  1IXC A;  2OCU A;  1B1X A;  1MXX A;  5I57 A;  5I56 B;  4G8H A;  1DTZ A;  1BP5 A;  1ZIU A;  3IR1 A;  3H6T A;  2O69 A;  4Z7E A;  1N7W A;  2KLF A;  2D21 A;  3RQT A;  3H6U A;  1B3F A;  1SW2 A;  3IO6 A;  5FHO A;  1WDN A;  3O9P A;  3CVG A;  1B5I A;  3H3G A;  4XKP A;  4F3S A;  2W7Y A;  4NWD A;  1Q1K A;  3FXQ A;  4H5G A;  3VXC A;  5H8H A;  3BBR A;  4YAH X;  4BLA A;  5CMM A;  3B6Q A;  4ZEC A;  4YZZ A;  2NXO A;  2OLB A;  3T9V A;  3VVE A;  3C4M A;  2VD2 A;  2X26 A;  2UYE A;  1P1W A;  1HSE A;  2H98 A;  1OVT A;  3K00 A;  4LA9 A;  4F2O A;  3OEN A;  5I2N B;  1IXG A;  3O66 A;  4IGR A;  3LSL A;  1GTK A;  3KBR A;  2Q89 A;  2Y7I A;  3GBB A;  4OZ9 A;  3EN3 A;  3IJO B;  3S2V A;  3UOR A;  1XC1 A;  3MPL A;  4HTG A;  2DWA A;  1O7T A;  2AL4 A;  4BDO A;  3IL1 B;  2XD2 A;  3ZKK A;  5I58 A;  2O51 A;  4RXL A;  1TXF A;  5AA1 A;  3VXB A;  1YPN A;  4H8I A;  4EDP A;  1N76 A;  3S9E A;  2NVU B;  4F19 A;  3TZA A;  3U94 A;  2GRV A;  2PX1 A;  2GHA A;  1A54 A;  5DVJ A;  3K6V A;  4KD5 A;  1I6B A;  4OTE A;  2E1S A;  4IO6 A;  1H3D A;  3CG1 A;  3G3F A;  4MH5 A;  2YLN A;  1UTB B;  2O68 A;  1SBP A;  2XXP A;  4XKQ A;  3K1P A;  2FYI A;  1I6A A;  5A5X A;  4OET A;  1B5J A;  4XKR A;  4RNS A;  3KJT A;  3MP6 A;  4O3C A;  3SEW A;  1DSN A;  1B32 A;  5AA3 A;  3HST A;  4POX A;  2R6G E;  4WED A;  3GXA A;  1PB9 A;  2QS2 A;  1FW0 A;  2DWI A;  1QKA A;  3MWB A;  5FHN A;  5L8D A;  1ZU0 A;  1XHY A;  1N0T A;  3RUM A;  1UQW A;  3GLB A;  2H4I A;  3MZB A;  1PBP A;  4EQB A;  1EH3 A;  2F35 A;  1SW1 A;  4QRZ A;  3ONM A;  3MUQ A;  5H8F B;  1IZ1 A;  1YAE A;  3U8Q A;  2QPQ A;  1FTL A;  5IAI A;  4ZS9 A;  1EZO A;  1B2H A;  2V3U A;  4ECF A;  2F97 A;  5AA2 B;  4GIZ A;  4JB7 A;  3TTN A;  3UN6 A;  4FE8 A;  4F22 A;  5JTY B;  3LC8 A;  3HHF A;  1MDP 1;  4KPT A;  3PU5 A;  1MRP A;  4FIM A;  2XX9 A;  1AH5 A;  4U1Z A;  3QXM A;  1A8F A;  2DWH A;  3T22 A;  3CR9 A;  2ONK E;  3O6I A;  4RA1 A;  5AE4 A;  2DE4 A;  2OWS A;  1B4H A;  3LR1 A;  1QUI A;  3U92 A;  3UA8 A;  2Z8D A;  5KDT A;  4FJP A;  3T9X B;  1Y3Q A;  3T9H B;  4F39 A;  3IAZ A;  1NNT A;  3HPI A;  3RLF E;  4YB6 A;  4K3F A;  4NF4 B;  4NMY A;  1MY3 A;  3BFT A;  5K2X A;  3KJ7 A;  3TKD A;  5KZT A;  1LAG E;  1SYH A;  4ELR A;  5CM6 A;  1PDA A;  4KCC A;  5EHS A;  2V93 A;  4E0W A;  1FQB A;  3C36 A;  1B5H A;  2RC9 A;  2A5T B;  4HCW A;  1UTH B;  2DS9 A;  4PFY A;  1N3W A;  3KG2 A;  1IQ7 A;  2ESN A;  5I2K A;  2QRY A;  2VOZ A;  1Y4T A;  2PMS A;  2YPN A;  4OXV A;  5LOM A;  3S4U A;  4EF1 A;  1YCJ A;  3SER A;  1MQG A;  4M4G A;  5I84 A;  2QS1 A;  3UP9 A;  3IOU A;  2V84 A;  1NMU A;  1JW5 A;  2DWJ A;  2Z8F A;  1MPC A;  3EHS A;  2XXU A;  3M3L A;  1OLC A;  1TFA A;  1B3H A;  3IX1 A;  2XXQ A;  3FUZ A;  4O3A A;  5J1D A;  5H8N B;  2ZYO A;  2I0C A;  4YU0 A;  4MBP A;  2F36 A;  1S50 A;  2QL3 A;  3MAM A;  2HXW A;  1DOT A;  4BDN A;  3K2D A;  1GVC A;  3N94 A;  5CRY A;  4FOR A;  2Q2C A;  2Z23 A;  1MQJ A;  2UVI A;  1EZP A;  4XXU A;  3MZ1 A;  4POW A;  5K2Y A;  1SDX A;  3PUV E;  1R9Q A;  3IOT A;  2I3V A;  5AA2 D;  5FHM A;  3KFM A;  1F9B A;  4KYE A;  3TOD A;  4ZE8 A;  3PPP A;  2XHD A;  4XIG Q;  2ALU A;  1SI0 A;  4P0I A;  1QW0 A;  2D3I A;  3RT6 B;  2DQV A;  3W9V A;  4R2B A;  2IA4 A;  5DVI A;  3TYH A;  5TP9 A;  5M2V A;  1A8E A;  3Q26 A;  5CMC A;  1B7H A;  1LFG A;  2DOJ A;  4IO7 A;  4N13 A;  2ABH A;  3IB2 A;  3I3V A;  4OVJ A;  2HAV A;  4R74 A;  4JWO A;  1MM6 A;  2OBG A;  3K6U A;  1LB9 A;  3OO9 A;  3QK6 A;  1LBC A;  1SW5 A;  1VFD A;  2F78 A;  1IIT A;  3FVG A;  4N6P A;  2ZXT A;  1AIV A;  4R6K A;  4GWO A;  3V5A A;  3CFZ A;  1MPB A;  4RPO A;  5CC2 A;  4H8J A;  3IOV A;  4H0W A;  2F34 A;  2RC7 A;  5KCJ A;  2FA7 A;  4MF3 A;  4G68 B;  4QHQ A;  4H65 A;  5IKB A;  4LUB A;  3QIM A;  3V89 B;  3PMW A;  4UAC A;  1SW4 A;  3MVX A;  1DMB A;  3O6G A;  3SES A;  3MJN A;  1LAX A;  1N84 A;  5BUU A;  1MQI A;  4QSC A;  1Y1Z A;  1TT1 A;  5ITP A;  5H8Q B;  5DEX B;  1IEJ A;  3K0V A;  5L9M A;  3CRB A;  2XXV A;  3Q29 A;  2O1L A;  3C34 A;  3BKI B;  4EXK A;  4YB5 A;  4JWY A;  2ZYK A;  3PPR A;  2RCA A;  4OWD A;  1OIB A;  1OMP A;  1MXZ A;  2Z22 A;  1JEU A;  4OEV A;  3OOA A;  4WXJ A;  2QS4 A;  3H4Z A;  3FVK A;  2O7U A;  3G3H A;  3KGC A;  1B51 A;  4Q0C A;  1MDQ A;  1VR5 A;  2F7C A;  1MY1 A;  4WEP A;  1AL3 A;  2V3T A;  1PB8 A;  4JSO A;  4DLD A;  1B0L A;  1DTG A;  1IXI A;  1XT8 A;  3D4G A;  3AXF A;  4OER A;  5JK4 A;  1BTJ A;  2AYS A;  2ZYN A;  1URG A;  2DVZ A;  2XXW A;  3DLN A;  3S9M C;  4TLM B;  1Y1M A;  2I6E A;  4QFN A;  2F7A A;  2M8C A;  3O29 A;  3KN7 A;  2GHB A;  4GLI A;  4AB6 A;  5L9O A;  2DXY A;  3IO4 A;  4OFL A;  4OQO A;  2RF1 A;  2F5X A;  2H25 A;  3FZV A;  4I9D A;  3JV9 A;  4KI0 E;  5I2N A;  4F3P A;  3VDF A;  4EUO A;  3RNN A;  3R7X A;  1LAH E;  4QFO A;  4U1O A;  5H8H B;  1P1Q A;  4U4X A;  1B7U A;  5B7D A;  1BLF A;  3S9N C;  1M5C A;  3K01 A;  4JBZ A;  2OK2 A;  4LZ7 A;  1PC3 A;  4G8M A;  5B70 A;  3SEX A;  3LBS A;  2XXX A;  1POY 1;  4NF5 B;  3KN3 A;  3OSR A;  3VLU A;  3S9L C;  3MZ9 A;  1HSL A;  1LFH A;  1SD3 A;  2PYY A;  1NNP A;  3PD8 A;  1OLA A;  3PMV A;  4IO2 A;  3CSG A;  4YMB A;  1IUD A;  1UTB A;  3KSX A;  3C32 A;  2HFB A;  3TAJ A;  3IOW A;  3FV2 A;  3DM0 A;  4OFJ A;  2B3B A;  2AIX A;  2XXH A;  2ZMB A;  5ITO A;  1MG1 A;  1OQH A;  5HM4 B;  3DP4 A;  1BIY A;  3G3I A;  4YKP A;  1USY H;  2Q88 A;  3U1O A;  3OO8 A;  3CFL A;  1JET A;  1YTV A;  3B7D A;  1B40 A;  1LBB A;  1VE4 A;  1Y20 A;  2O7I A;  4Q5T A;  5A5X B;  1II5 A;  3PUX E;  3N26 A;  1QVS A;  4BDL A;  1US5 A;  5H8F A;  1SQY A;  2ZNT A;  4XKN A;  3W15 C;  3VVD A;  1O63 A;  5AA4 A;  4LQ5 A;  1N3X A;  3G3J A;  1SI1 A;  4DCY A;  1I69 A;  4QFK A;  1B52 A;  1A99 A;  2HCA A;  2X7P A;  3RTW B;  2PT1 A;  3EHT A;  4PFU A;  3F11 A;  3ILU B;  3W9W A;  4LP2 B;  2VGQ A;  1MM7 A;  3MP8 A;  5TU0 A;  3OO6 A;  5JTY A;  3OMB A;  4KFQ A;  4RJZ A;  1I6Q A;  2BJJ X;  4OHN A;  4LZ5 A;  1ELJ A;  4F3B A;  3IK6 B;  2F7B A;  4EF2 A;  3ODB A;  1FTK A;  5I59 B;  3PPN A;  4I1D A;  3USD A;  1ZKB A;  3IB0 A;  3LUY A;  4U4S A;  1QJM A;  2Y7K A;  2QMW A;  2WKY A;  4R75 A;  2O1M A;  3EPE A;  5BWJ A;  4DDD A;  5H8S A;  1B05 A;  4NF6 A;  1B0H A;  3EQ1 A;  1MQH A;  2F6G A;  5ICT A;  3Q28 A;  3VFJ A;  1BKA A;  5DYH A;  1GR2 A;  4G68 C;  1ZLQ A;  1B3L A;  2XD3 A;  2ZYM A;  1LGB C;  1KWH A;  5CBS A;  2Y7R A;  4H5F A;  3C33 A;  4UA8 A;  1Z7M E;  3E9X A;  3I6V A;  3E13 X;  1S7Y A;  4YMA A;  4F2Q A;  5KDT B;  1LB8 A;  4QFL A;  1FTO A;  3MQ9 A;  1FQC A;  4NWC A;  1URD A;  5TPA B;  2LAO A;  2A5T A;  1FCK A;  1R1N A;  3PD9 A;  1UTH A;  3B6T A;  3VLW A;  2NWJ A;  2P1S A;  5JEI A;  2VP1 A;  4TQU Q;  1N7X A;  3FJG A;  4NE4 A;  3KSJ A;  1OVB A;  1FTJ A;  4IO4 A;  2ONR A;  2I4C A;  3K1N A;  4OYV A;  4O3B A;  1FQE A;  1FQD A;  2ZNU A;  2AL5 A;  1MPD A;  1MY0 A;  5DVF A;  2R71 A;  3H6V A;  4RK2 A;  3MVZ A;  1H43 A;  4G4P A;  4KR5 A;  3MBP A;  4HW8 A;  4P11 A;  4GL0 A;  4LQ2 A;  3FXU A;  4ZED A;  3K4U A;  4R9G A;  3C9H A;  1MY4 A;  3TTK A;  1B58 A;  4R73 A;  4ISU A;  4C0R A;  3OD7 A;  1A40 A;  3K1M A;  4DIG A;  3A3U A;  2DVC A;  3T96 B;  4ZEF A;  4GXS B;  3MC2 A;  3RT8 A;  3OSQ A;  3TTL A;  1B9J A;  3TEL A;  3CG3 A;  3THI A;  4YKK A;  3TEP A;  3VVF A;  4KYD A; 
#chains in the Genus database with same CATH topology
 3MPK A;  1P1N A;  4F1V A;  5F7V A;  3K6W A;  2A5S A;  4PET A;  1Z7N E;  2FNC A;  1RYX A;  3MYU A;  2O84 X;  4EQ9 A;  1NNF A;  4C1T A;  1K9Z A;  2XXR A;  3PPO A;  1AMF A;  3FVN A;  3C35 A;  4TLL B;  3VLV A;  2PT2 A;  1K9Y A;  1PBQ A;  3PUY E;  2XA5 A;  1MXW A;  2DSF A;  1CB6 A;  1NH7 A;  3LV0 A;  2QFL A;  2RC8 A;  3CI8 A;  1T0K A;  4OMB A;  2P2A A;  1B6H A;  4FEB A;  4P3L A;  1CNQ A;  1NKX A;  4PFB A;  2QMX A;  3L6G A;  4N91 A;  4PC9 A;  4G2Z A;  3CIJ A;  3FD3 A;  3D4C A;  2HAU A;  4ZEK A;  2CZK A;  3ILT B;  3SZP A;  2NUV A;  4NHB A;  4ELO A;  1M5D A;  2Y84 A;  3TTM A;  4KHZ E;  3TMG A;  3ISP A;  4PFR A;  3RPW A;  5IZZ A;  4ZE9 A;  4N6D A;  4F29 A;  3FAT A;  1M5B A;  2QSX A;  2YJP A;  4MLV A;  1KA0 A;  1NL5 A;  3O97 A;  4NF8 B;  2CMO A;  3ZKL A;  1EYK A;  3E79 A;  1EZ9 A;  1RYO A;  1AOV A;  5KCJ B;  2Z8E A;  3HHG A;  4N07 A;  4NGU A;  2OJT A;  3N5L A;  2UVH A;  3SKP A;  4P1E A;  4THI A;  4NN3 A;  3OEM A;  2CEX A;  4RK9 A;  3LUZ A;  1ZJL A;  1NI9 A;  2VHA A;  1HSJ A;  1USY E;  4I3E A;  2XWK A;  1XOC A;  5I56 A;  4MIJ A;  2I4B A;  1ATG A;  2Q8J A;  1D9Y A;  5IZ3 A;  3DP6 A;  2GFE A;  2UYF A;  1QUK A;  4Q8R A;  3SDF A;  5CMK A;  2PVU A;  4L17 A;  3TCF A;  3D1R A;  4RYA A;  4WKM A;  1XVY A;  2H9B A;  1QUL A;  1D9V A;  2UVJ A;  4I3Y A;  1URS A;  5ET7 A;  3Q25 A;  1DPE A;  4ELP A;  5I5P A;  2QVR A;  4R6Y A;  3O2A A;  3QYT A;  1MS7 A;  3EHU A;  1FBF A;  1CE2 A;  5I57 B;  1N04 A;  3CHG A;  3K6X A;  3G3K A;  1MXY A;  4QSE A;  5EQ8 A;  4HS7 A;  1ZTY A;  1O64 A;  3TCH A;  1IXH A;  2HEU A;  3GBA A;  4OVT A;  1FJ9 A;  1S9T A;  3HO7 A;  4JDF A;  2DXR A;  5FTH A;  5ICQ A;  3DEL B;  1GGG A;  1B3E A;  5CMB A;  4YKI A;  4BDQ A;  4PBQ A;  1SPI A;  3V83 A;  4PAI A;  3JYR A;  3UGW A;  1DBZ A;  4OEU A;  4JWX A;  5CI5 A;  5FTI A;  1GV8 A;  1Y9U A;  5DT6 A;  4IB2 A;  3TQL A;  1EYJ A;  4MNC A;  1FPF A;  4GOT A;  2ONS A;  3T1B A;  4ZZA A;  2H5Y A;  4NF5 A;  1SVX B;  2CZH A;  3FBP A;  2PBW A;  4RPN A;  4ZEB A;  3QSL A;  2VD3 A;  4X9T A;  3VV5 A;  4LZ8 A;  3OEL A;  4KCD A;  4DXU A;  3K02 A;  3LSW A;  1FBE A;  4GRK A;  4ESW A;  4MMP A;  1MXV A;  4X1D A;  4EQ7 A;  1NV7 A;  3BFU A;  4U2R A;  3PMX A;  3MVW A;  3KN8 A;  1JVX A;  3G7W A;  5HBC A;  3R6U A;  2DYX A;  2UXA A;  4R72 A;  4MFI A;  5EYF A;  2FBP A;  1P1O A;  4HE1 A;  3I5O A;  4YKJ A;  4GFR A;  5I58 B;  3SEY A;  4O7I A;  2O6A A;  1LBY A;  2B3F A;  1JW1 A;  1B3G A;  2THI A;  4F18 A;  4GX4 A;  2Q2A A;  4ELQ A;  1A55 A;  4G77 A;  2D5W A;  2DE2 A;  3H6W A;  2I0B A;  1FQA A;  1POT A;  1NV1 A;  2Q9T A;  5EQ9 A;  4P0G A;  3IB1 A;  4GWX A;  1JQF A;  1RDX A;  3U72 A;  3Q27 A;  4YB7 A;  3KZG A;  3OEK A;  1LAF E;  4KYS A;  4TOZ A;  4F3G A;  5EHM A;  2RIN A;  4OES A;  3N6U A;  4Q30 B;  2GH9 A;  4PTK A;  3PV0 E;  4IO3 A;  1JEV A;  1XVX A;  1PEB A;  4MNP A;  1US4 A;  4GWW A;  3RTF B;  4KXP A;  1M5E A;  2G93 A;  2XXI A;  3RGY A;  5AA2 A;  1TFD A;  3HN0 A;  2V25 A;  1NUX A;  3E3K A;  4LON B;  1QKB A;  2E0S A;  2V3Q A;  1LBV A;  4ESX A;  3LSF B;  2XX8 A;  4G8N A;  3EF7 A;  1FBC A;  1MH3 A;  5AA4 B;  3FAS A;  5ISU A;  1INP A;  5I59 A;  3KOS A;  4Z0I A;  2QVV A;  1FJ6 A;  1FBP A;  1KA1 A;  1IIW A;  1MQD A;  3SET A;  5IGA A;  1MH4 A;  2B4L A;  4DCX A;  3IFA A;  2BJI A;  1JW4 A;  3SEV A;  3RY3 A;  1LLS A;  4ZZE A;  3U93 A;  3H06 B;  3GZG A;  1LBX A;  2HZL A;  1L5T A;  1AWB A;  4X04 A;  3PUZ E;  2VPO A;  2IEE A;  4F1Y A;  1LCF A;  1NNK A;  1D9Q A;  1MXU A;  2F6P A;  2P0S A;  2WBB A;  1Y4C A;  3LSX A;  3FV1 A;  2DP8 A;  1FQF A;  4GF8 A;  4PAF A;  1FTM A;  4F31 B;  2REG A;  3WAE A;  3KOT A;  3TTR A;  4NF4 A;  4ND9 A;  1R6Z A;  1UIU A;  1LCT A;  3OXN A;  4C1U A;  4QSD A;  4GX6 A;  3HCQ A;  3FVO A;  4NF6 B;  5DTB A;  3MVY A;  1UIV A;  3QMF A;  5TPA A;  2RCB A;  2REJ A;  2UVG A;  3DP8 A;  1NH8 A;  3P7I A;  4JVD A;  4DE8 A;  4PP0 A;  4FEC A;  4XEQ A;  3FIR A;  3A09 A;  2F8D A;  5ET8 A;  3TDJ A;  2RKM A;  4PQJ A;  2I58 A;  1FPK A;  3ECR A;  2Y7P A;  1PB7 A;  3V8X B;  3KC1 A;  2X7Q A;  2ZNS A;  3MP1 A;  5LDZ A;  1A7L A;  4XF5 A;  1RKM A;  5A5L A;  1WOD A;  2V4C A;  4IY5 A;  1DPP A;  1Y3N A;  4QFP A;  4OFO A;  1Q9D A;  1P1U A;  4FED A;  2FIE A;  3RN8 A;  1DK4 A;  4PFT A;  3MW0 A;  1D4N A;  3T93 B;  1Q35 A;  3FGS A;  5H8N A;  4X48 A;  1H76 A;  3UK4 A;  4AQ4 A;  4GWU A;  1NV0 A;  4R6H A;  3ZS6 A;  2HZK A;  1B46 A;  5I2K B;  2Y7W A;  2QJE A;  3TPA A;  2WEF A;  1NV4 A;  4PFW A;  3M8U A;  3QAX A;  3A3C A;  4EXL A;  3QUJ A;  2Y5K A;  4U22 A;  3M3F A;  3RYD A;  1ZMG A;  4IY6 A;  2OZZ A;  1MY2 A;  3TUS A;  4H6D A;  4MLQ A;  1NUW A;  4XFE A;  4DXC A;  1WVJ A;  2QVU A;  2R9J A;  1ANF A;  4X8R A;  3OO7 A;  1LEV A;  1EYI A;  4OA4 A;  3CSB A;  2QS3 A;  3O6H A;  1B4Z A;  2I3W A;  4DXB A;  3TFL A;  3M3K A;  1JVY A;  4NX1 A;  4JXI A;  3HV1 A;  3C31 A;  4R2F A;  2HQ0 A;  4LAT A;  3R26 A;  1LST A;  4X1B A;  4BDM A;  2DE3 A;  4M1V A;  3H7M A;  4LN5 A;  1JNF A;  3A29 A;  2B65 A;  5ELV A;  4AB5 A;  4I62 A;  5DW8 A;  5TP9 B;  2HHM A;  4FAT A;  4HCY A;  1NFT A;  3SEU A;  4ZDM A;  4OEN A;  4O8M A;  4IO5 A;  2XX7 A;  4KQP A;  3T9U A;  4H67 A;  4GXA A;  4OVP A;  1FPB A;  4G68 A;  1NV5 A;  5L9S A;  3CFX A;  4DI3 D;  5F1Q A;  3B6W A;  4FAJ A;  3BIG A;  4IGT A;  4BDR A;  3O28 A;  1SYI A;  1ZBM A;  1B1H A;  4PE3 A;  3FJ7 A;  4GL8 A;  1H44 A;  3TCG A;  3B8B A;  3RPL B;  2I49 A;  2ANJ A;  4NF8 A;  2H99 A;  1J1N A;  3IOR A;  3VE1 B;  1LFI A;  4ZEI A;  2CZL A;  3UIF A;  5H8Q A;  5DEX A;  3FXR A;  4LVQ A;  1JP4 A;  3G3G A;  3PPQ A;  1XS5 A;  1YYZ A;  4GQO A;  1IMF A;  4JSD A;  1TWY A;  4FBP A;  3TQW A;  4U23 A;  3PUW E;  3L6H A;  3FJM A;  1QUJ A;  1D3K A;  3E4R A;  1IME A;  2OWT A;  5I7I A;  4XTC Q;  5EQ7 A;  3WAF A;  2NOO A;  2XXY A;  4DZ1 A;  3IJX B;  4N81 A;  3N6T A;  4NQ8 A;  4QF9 A;  3T66 A;  5HPQ A;  4PF6 A;  3JZJ A;  4E0X A;  1Y3P A;  4GD5 A;  1B7Z A;  4PE5 B;  1R9L A;  4YIC A;  1VFE A;  3H03 A;  4ONY A;  4R9F A;  1G0H A;  3MST A;  1VSO A;  1OQG A;  3QUF A;  4GVO A;  4N15 A;  1P99 A;  4RY1 A;  1M5F A;  3PGF A;  2R8T A;  3NOH A;  1H45 A;  2I48 A;  4I8C A;  4NTL A;  3ZSF A;  4F1U A;  2G29 A;  1EU8 A;  3KEI A;  4H1X A;  4NED A;  2XXT A;  4U21 A;  5CBR A;  1IXC A;  4NG7 A;  2OX3 A;  1FBG A;  1B1X A;  1FBH A;  2OCU A;  1MXX A;  4PAK A;  5I57 A;  4MHF A;  5I56 B;  4G8H A;  1DTZ A;  1BP5 A;  1FPD A;  1ZIU A;  3IR1 A;  3H6T A;  2O69 A;  4Z7E A;  1N7W A;  4MEV A;  5J16 A;  5IZ3 B;  2KLF A;  2D21 A;  3RQT A;  3H6U A;  1B3F A;  1SW2 A;  2PCR A;  3IO6 A;  5FHO A;  1WDN A;  3IFC A;  3O9P A;  3CVG A;  1B5I A;  3H3G A;  4XKP A;  4F3S A;  2W7Y A;  4NWD A;  1Q1K A;  3FXQ A;  4H5G A;  2F3B A;  3VXC A;  5H8H A;  3BBR A;  4YAH X;  4BLA A;  5CMM A;  3B6Q A;  4ZEC A;  4YZZ A;  2NXO A;  2GQ1 A;  2OLB A;  4MAG A;  3T9V A;  3VVE A;  3C4M A;  4PDH A;  2VD2 A;  5I3S A;  2X26 A;  5FBP A;  1LBZ A;  2UYE A;  1P1W A;  1HSE A;  2H98 A;  1OVT A;  3K00 A;  4LA9 A;  4H46 A;  3OEN A;  4F2O A;  5I2N B;  1LBW A;  1IXG A;  3O66 A;  4IGR A;  3LSL A;  1GTK A;  3KBR A;  2Q89 A;  2Y7I A;  3GBB A;  4OZ9 A;  3EN3 A;  3IJO B;  3S2V A;  3UOR A;  2WYK A;  1XC1 A;  3MPL A;  4HTG A;  2DWA A;  1O7T A;  2AL4 A;  4BDO A;  3IL1 B;  3FXB A;  2XD2 A;  3ZKK A;  5I58 A;  2O51 A;  1IMB A;  4RXL A;  1TXF A;  5AA1 A;  3HFU A;  3VXB A;  1XI6 A;  1YPN A;  4H8I A;  4EDP A;  1N76 A;  3S9E A;  2NVU B;  4F19 A;  3TZA A;  3U94 A;  2GRV A;  2PX1 A;  2GHA A;  1A54 A;  5DVJ A;  1NV2 A;  1RDZ A;  3K6V A;  4KD5 A;  1I6B A;  4OTE A;  2E1S A;  2WX9 A;  4IO6 A;  1H3D A;  3CG1 A;  3G3F A;  4MH5 A;  2YLN A;  2F3D A;  1UTB B;  4OAN A;  2O68 A;  1SBP A;  2XXP A;  4XKQ A;  4N17 A;  3K1P A;  2XWI A;  2FYI A;  1I6A A;  4N4U A;  5A5X A;  4OET A;  1B5J A;  4XKR A;  4RNS A;  3KJT A;  3MP6 A;  4O3C A;  3SEW A;  4O94 A;  1DSN A;  1B32 A;  1FTA A;  5AA3 A;  3HST A;  2PFY A;  4POX A;  2R6G E;  4WED A;  3GXA A;  1PB9 A;  1FPG A;  2QS2 A;  1FW0 A;  2DWI A;  1QKA A;  3MWB A;  1IMC A;  5FHN A;  5L8D A;  2Q74 A;  1ZU0 A;  1XHY A;  1N0T A;  3RUM A;  1UQW A;  2DDK A;  3GLB A;  2H4I A;  3MZB A;  1PBP A;  4EQB A;  1EH3 A;  2F35 A;  2WYP A;  1SW1 A;  4QRZ A;  3ONM A;  3MUQ A;  5H8F B;  1IZ1 A;  1YAE A;  3KBZ A;  3U8Q A;  2QPQ A;  1FTL A;  5IAI A;  4ZS9 A;  1EZO A;  1B2H A;  1YXI A;  2CEY A;  2V3U A;  4ECF A;  1NUY A;  2F97 A;  5AA2 B;  4GIZ A;  4JB7 A;  3TTN A;  3UN6 A;  4FE8 A;  4F22 A;  1IMA A;  5JTY B;  3LC8 A;  3HHF A;  1MDP 1;  4KPT A;  3PU5 A;  1MRP A;  4FIM A;  2XX9 A;  1AH5 A;  4I40 A;  4U1Z A;  3QXM A;  1A8F A;  2DWH A;  3T22 A;  3CR9 A;  2ONK E;  3O6I A;  4JVC A;  4RA1 A;  5AE4 A;  2DE4 A;  2L5V A;  2OWS A;  2ZZX A;  1B4H A;  5EQA A;  3E78 A;  2ZZV A;  2PFZ A;  3LR1 A;  1QUI A;  3U92 A;  2MKZ A;  3UA8 A;  2FIX A;  4PF8 A;  2Z8D A;  5KDT A;  4FJP A;  3T9X B;  1Y3Q A;  3T9H B;  4F39 A;  3IAZ A;  1NNT A;  3HPI A;  3RLF E;  4YB6 A;  4K3F A;  1DCU A;  4NF4 B;  4NMY A;  1MY3 A;  3BFT A;  5K2X A;  4GWY A;  3KJ7 A;  3TKD A;  5KZT A;  4MNI A;  1LAG E;  1SYH A;  4ELR A;  5CM6 A;  1PDA A;  4KCC A;  3T0J A;  1BK4 A;  4NAP A;  2Q8M A;  5EHS A;  2V93 A;  4MCO A;  4E0W A;  1FQB A;  4N6K A;  3C36 A;  4GWZ A;  1B5H A;  2RC9 A;  2A5T B;  4HCW A;  1UTH B;  2DS9 A;  4PFY A;  1N3W A;  3KG2 A;  1IQ7 A;  2ESN A;  5I2K A;  5IZ1 A;  2QRY A;  2VOZ A;  4PGN A;  1Y4T A;  2PMS A;  2YPN A;  4GWS A;  4OXV A;  5LOM A;  3S4U A;  4EF1 A;  1YCJ A;  3SER A;  1MQG A;  4M4G A;  5I84 A;  2QS1 A;  3UP9 A;  3IOU A;  2V84 A;  1NMU A;  1JW5 A;  2DWJ A;  2Z8F A;  1MPC A;  3EHS A;  2XXU A;  3M3L A;  1OLC A;  1TFA A;  1B3H A;  3IX1 A;  2XXQ A;  3FUZ A;  2B4M A;  4O3A A;  5J1D A;  5H8N B;  3ROJ A;  2ZYO A;  4OVS A;  2I0C A;  5ET6 A;  4YU0 A;  4MBP A;  2F36 A;  1S50 A;  2QL3 A;  3MAM A;  2HXW A;  1DOT A;  4BDN A;  3K2D A;  1GVC A;  3B50 A;  3N94 A;  5CRY A;  4FOR A;  2Q2C A;  2Z23 A;  1MQJ A;  2UVI A;  1EZP A;  4XXU A;  3MZ1 A;  4POW A;  5K2Y A;  1SDX A;  3PUV E;  1R9Q A;  3IOT A;  2I3V A;  5AA2 D;  5FHM A;  3KFM A;  1F9B A;  4KYE A;  3TOD A;  4ZE8 A;  3PPP A;  2XHD A;  4XIG Q;  2ALU A;  1SI0 A;  4P0I A;  1QW0 A;  2D3I A;  3RT6 B;  2DQV A;  3W9V A;  4R2B A;  2IA4 A;  5DVI A;  3TYH A;  5TP9 A;  5M2V A;  1A8E A;  3Q26 A;  5CMC A;  1B7H A;  1LFG A;  4UAB A;  2DOJ A;  4IO7 A;  4N13 A;  2ABH A;  3IB2 A;  3I3V A;  4OVJ A;  2HAV A;  5ET5 A;  1KZ8 A;  2WBD A;  4R74 A;  4JWO A;  1MM6 A;  2OBG A;  3K6U A;  1LB9 A;  3OO9 A;  4P1L A;  3QK6 A;  2CZI A;  1LBC A;  1SW5 A;  4P56 A;  1VFD A;  4PFI A;  1NV6 A;  4NF0 A;  3RPL A;  2F78 A;  1IIT A;  3FVG A;  4PCD A;  3BIH A;  4N6P A;  2ZXT A;  1AIV A;  4R6K A;  4GWO A;  3V5A A;  3CFZ A;  1MPB A;  4RPO A;  5CC2 A;  4H8J A;  3IOV A;  4H0W A;  2F34 A;  2RC7 A;  5KCJ A;  2FA7 A;  4MF3 A;  4G68 B;  4QHQ A;  4H65 A;  5IKB A;  4LUB A;  3QIM A;  1QGX A;  3V89 B;  4N8Y A;  3PMW A;  4UAC A;  1SW4 A;  3MVX A;  1DMB A;  3O6G A;  3SES A;  3MJN A;  1LAX A;  1N84 A;  5BUU A;  1MQI A;  4QSC A;  1Y1Z A;  1TT1 A;  5ITP A;  5H8Q B;  5DEX B;  1IEJ A;  3K0V A;  3PTY A;  5L9M A;  3CRB A;  2XXV A;  3Q29 A;  2O1L A;  3C34 A;  3BKI B;  4EXK A;  4YB5 A;  4JWY A;  2ZYK A;  3PPR A;  2RCA A;  4HXV A;  4OWD A;  1OIB A;  1OMP A;  1MXZ A;  4P8B A;  2Z22 A;  5T3J A;  1JEU A;  4OEV A;  3OOA A;  4WXJ A;  2QS4 A;  3H4Z A;  3FVK A;  2O7U A;  3G3H A;  3KGC A;  1B51 A;  4Q0C A;  1MDQ A;  1VR5 A;  2F7C A;  1MY1 A;  4WEP A;  4MJO A;  1AL3 A;  2V3T A;  1PB8 A;  4QBA A;  4JSO A;  4DLD A;  2P3V A;  1B0L A;  1DTG A;  1IXI A;  1XT8 A;  3D4G A;  1IMD A;  1FRP A;  3AXF A;  4OER A;  2ZZW A;  5JK4 A;  1BTJ A;  2AYS A;  2ZYN A;  1URG A;  2DVZ A;  2XXW A;  3DLN A;  3S9M C;  4TLM B;  1Y1M A;  2I6E A;  4QFN A;  2F7A A;  2VPN A;  2M8C A;  3O29 A;  3KN7 A;  2GHB A;  4GLI A;  4GX3 A;  4AB6 A;  5L9O A;  2DXY A;  3IO4 A;  4OFL A;  1FPJ A;  4OQO A;  2RF1 A;  2F5X A;  2H25 A;  3FZV A;  4I9D A;  3JV9 A;  4KI0 E;  5I2N A;  4F3P A;  3VDF A;  4EUO A;  2OWZ A;  3RNN A;  3R7X A;  1LAH E;  4QFO A;  4U1O A;  5H8H B;  1P1Q A;  4U4X A;  1B7U A;  3KC0 A;  5B7D A;  1BLF A;  3S9N C;  1M5C A;  3K01 A;  4JBZ A;  2OK2 A;  1NV3 A;  4LZ7 A;  1PC3 A;  4G8M A;  5B70 A;  3SEX A;  3LBS A;  4P9K A;  2XXX A;  1POY 1;  4NF5 B;  3KN3 A;  3OSR A;  1FBD A;  1G0I A;  3VLU A;  3S9L C;  3MZ9 A;  1HSL A;  1LFH A;  1SD3 A;  4HE0 A;  2PYY A;  1NNP A;  3PD8 A;  1OLA A;  3PMV A;  4IO2 A;  4OVQ A;  3CSG A;  4YMB A;  4DI4 B;  1IUD A;  4AS5 A;  1UTB A;  3KSX A;  4PGP A;  3C32 A;  2HFB A;  3TAJ A;  3IOW A;  3FV2 A;  3DM0 A;  4OFJ A;  4JVI A;  2B3B A;  2AIX A;  2XXH A;  2ZMB A;  5ITO A;  1MG1 A;  1OQH A;  5HM4 B;  4GBV A;  3DP4 A;  1BIY A;  2XWO A;  3G3I A;  4YKP A;  1USY H;  2Q88 A;  3U1O A;  3OO8 A;  3CFL A;  1JET A;  1YTV A;  3B7D A;  1B40 A;  1LBB A;  1VE4 A;  1VDW A;  1Y20 A;  2XWV A;  1FPE A;  2O7I A;  4IR8 A;  1YZ0 A;  4Q5T A;  5A5X B;  1II5 A;  3PUX E;  3N26 A;  1QVS A;  4BDL A;  1NUZ A;  1US5 A;  5H8F A;  1SQY A;  2ZNT A;  4XKN A;  3W15 C;  3VVD A;  2Y5L A;  1O63 A;  5AA4 A;  4LQ5 A;  1N3X A;  3G3J A;  1SI1 A;  4DCY A;  1I69 A;  4QFK A;  1B52 A;  1A99 A;  2HCA A;  2X7P A;  3RTW B;  2PT1 A;  5ESY A;  3EHT A;  4PFU A;  3F11 A;  3ILU B;  3W9W A;  4LP2 B;  2VGQ A;  1MM7 A;  3MP8 A;  5TU0 A;  3OO6 A;  3EKI A;  5JTY A;  3OMB A;  4PDD A;  4KFQ A;  4RJZ A;  1I6Q A;  2BJJ X;  4OHN A;  4LZ5 A;  2XXK A;  1ELJ A;  4F3B A;  3IK6 B;  2F7B A;  5EYH A;  4EF2 A;  3ODB A;  1FTK A;  4H45 A;  3U65 A;  2FHY A;  5I59 B;  3PPN A;  4I1D A;  3USD A;  2VT5 A;  1ZKB A;  2HPG A;  3IB0 A;  3LUY A;  4U4S A;  1QJM A;  2Y7K A;  2QMW A;  2WKY A;  4R75 A;  2O1M A;  3EPE A;  5BWJ A;  4DDD A;  5H8S A;  1B05 A;  4NF6 A;  1B0H A;  3EQ1 A;  1MQH A;  2F6G A;  4P47 A;  1FPL A;  5ICT A;  3Q28 A;  3VFJ A;  1BKA A;  5DYH A;  2KR0 A;  1GR2 A;  4G68 C;  1ZLQ A;  1B3L A;  2XD3 A;  2ZYM A;  1LGB C;  1FPI A;  1KWH A;  5CBS A;  2Y7R A;  4H5F A;  3C33 A;  4UA8 A;  1Z7M E;  3E9X A;  3I6V A;  1RDY A;  3E13 X;  1S7Y A;  4YMA A;  4G61 A;  4F2Q A;  5KDT B;  2HXR A;  1LB8 A;  4QFL A;  1FTO A;  3MQ9 A;  1FQC A;  4QXD A;  4NWC A;  1URD A;  5TPA B;  2LAO A;  2A5T A;  1FCK A;  1R1N A;  3PD9 A;  1UTH A;  3B6T A;  3VLW A;  2NWJ A;  2P1S A;  5JEI A;  2VP1 A;  4TQU Q;  1N7X A;  3FJG A;  5F24 A;  4NE4 A;  3KSJ A;  1OVB A;  1FTJ A;  4HE2 A;  4IO4 A;  2ONR A;  2I4C A;  3K1N A;  4OYV A;  4O3B A;  1FQE A;  5IM2 A;  1FQD A;  2ZNU A;  2AL5 A;  1MPD A;  1MY0 A;  3GYY A;  5DVF A;  2R71 A;  3H6V A;  4RK2 A;  3MVZ A;  1H43 A;  4G4P A;  4KR5 A;  1FSA A;  4N8G A;  3MBP A;  4HW8 A;  4P11 A;  4GL0 A;  4GBW A;  4OVR A;  4LQ2 A;  3FXU A;  4ZED A;  3K4U A;  4MX6 A;  4R9G A;  3C9H A;  4AS4 A;  1MY4 A;  2P3N A;  3TTK A;  1B58 A;  5EYG A;  4PBH A;  4R73 A;  4ISU A;  2JJK A;  3OD7 A;  4O7M A;  4C0R A;  1A40 A;  3K1M A;  4DIG A;  3A3U A;  2DVC A;  3T96 B;  4ZEF A;  4GXS B;  3MC2 A;  3RT8 A;  3OSQ A;  3TTL A;  1B9J A;  3TEL A;  3CG3 A;  3THI A;  2FVZ A;  4YKK A;  2KQZ A;  3TEP A;  5LTC A;  3VVF A;  4KYD A; 
#chains in the Genus database with same CATH homology
 3MPK A;  1P1N A;  4F1V A;  5F7V A;  3K6W A;  2A5S A;  4PET A;  1Z7N E;  2FNC A;  1RYX A;  2O84 X;  4EQ9 A;  1NNF A;  4C1T A;  2XXR A;  3PPO A;  1AMF A;  3FVN A;  3C35 A;  4TLL B;  3VLV A;  2PT2 A;  1PBQ A;  3PUY E;  1MXW A;  2DSF A;  1CB6 A;  1NH7 A;  2RC8 A;  3CI8 A;  1T0K A;  4OMB A;  2P2A A;  1B6H A;  4FEB A;  1NKX A;  2QMX A;  3L6G A;  4G2Z A;  3CIJ A;  3FD3 A;  3D4C A;  2HAU A;  4ZEK A;  3ILT B;  2NUV A;  4ELO A;  1M5D A;  2Y84 A;  3TTM A;  4KHZ E;  3TMG A;  3RPW A;  4ZE9 A;  4F29 A;  3FAT A;  1M5B A;  2QSX A;  2YJP A;  4MLV A;  1NL5 A;  3O97 A;  4NF8 B;  2CMO A;  3ZKL A;  1EZ9 A;  1RYO A;  1AOV A;  5KCJ B;  2Z8E A;  3HHG A;  4N07 A;  2OJT A;  3N5L A;  2UVH A;  3SKP A;  4THI A;  3OEM A;  4RK9 A;  1ZJL A;  2VHA A;  1HSJ A;  1USY E;  1XOC A;  5I56 A;  2I4B A;  1ATG A;  2Q8J A;  1D9Y A;  3DP6 A;  2GFE A;  2UYF A;  1QUK A;  4Q8R A;  3SDF A;  5CMK A;  2PVU A;  4L17 A;  3TCF A;  4RYA A;  4WKM A;  1XVY A;  2H9B A;  1QUL A;  1D9V A;  2UVJ A;  1URS A;  3Q25 A;  1DPE A;  4ELP A;  4R6Y A;  3O2A A;  3QYT A;  1MS7 A;  3EHU A;  1CE2 A;  5I57 B;  1N04 A;  3K6X A;  3G3K A;  1MXY A;  4QSE A;  4HS7 A;  1ZTY A;  1O64 A;  3TCH A;  1IXH A;  2HEU A;  3GBA A;  1S9T A;  3HO7 A;  4JDF A;  2DXR A;  5FTH A;  5ICQ A;  3DEL B;  1GGG A;  1B3E A;  5CMB A;  4YKI A;  4BDQ A;  3V83 A;  3JYR A;  3UGW A;  4OEU A;  4JWX A;  5CI5 A;  1GV8 A;  5FTI A;  1Y9U A;  5DT6 A;  4IB2 A;  3TQL A;  4GOT A;  2ONS A;  4ZZA A;  2H5Y A;  4NF5 A;  1SVX B;  2PBW A;  4RPN A;  4ZEB A;  3QSL A;  2VD3 A;  4X9T A;  3VV5 A;  3OEL A;  4KCD A;  4DXU A;  4LZ8 A;  3K02 A;  3LSW A;  4GRK A;  4ESW A;  1MXV A;  4X1D A;  4EQ7 A;  3BFU A;  4U2R A;  3PMX A;  3MVW A;  3KN8 A;  1JVX A;  3G7W A;  5HBC A;  3R6U A;  2DYX A;  2UXA A;  4R72 A;  4MFI A;  5EYF A;  1P1O A;  3I5O A;  4YKJ A;  4GFR A;  5I58 B;  3SEY A;  2O6A A;  2B3F A;  1JW1 A;  1B3G A;  2THI A;  4F18 A;  2Q2A A;  4ELQ A;  1A55 A;  4G77 A;  2D5W A;  2DE2 A;  3H6W A;  2I0B A;  1FQA A;  1POT A;  2Q9T A;  4P0G A;  3IB1 A;  1JQF A;  3U72 A;  3Q27 A;  4YB7 A;  3KZG A;  3OEK A;  1LAF E;  4KYS A;  4TOZ A;  4F3G A;  5EHM A;  2RIN A;  4OES A;  3N6U A;  4Q30 B;  2GH9 A;  3PV0 E;  4IO3 A;  1JEV A;  1XVX A;  1PEB A;  1US4 A;  3RTF B;  1M5E A;  2G93 A;  2XXI A;  3RGY A;  5AA2 A;  1TFD A;  3HN0 A;  2V25 A;  3E3K A;  4LON B;  1QKB A;  2E0S A;  2V3Q A;  4ESX A;  3LSF B;  2XX8 A;  4G8N A;  3EF7 A;  1MH3 A;  5AA4 B;  3FAS A;  5ISU A;  5I59 A;  3KOS A;  4Z0I A;  1IIW A;  1MQD A;  3SET A;  1MH4 A;  4DCX A;  1JW4 A;  3SEV A;  3RY3 A;  1LLS A;  4ZZE A;  3U93 A;  3H06 B;  3GZG A;  2HZL A;  1L5T A;  3PUZ E;  2IEE A;  4F1Y A;  1LCF A;  1NNK A;  1MXU A;  2F6P A;  2P0S A;  1Y4C A;  3LSX A;  3FV1 A;  2DP8 A;  1FQF A;  4GF8 A;  1FTM A;  4F31 B;  2REG A;  3WAE A;  3KOT A;  3TTR A;  4NF4 A;  4ND9 A;  1R6Z A;  1UIU A;  1LCT A;  3OXN A;  4C1U A;  4QSD A;  3HCQ A;  3FVO A;  4NF6 B;  5DTB A;  3MVY A;  1UIV A;  5TPA A;  2RCB A;  2REJ A;  2UVG A;  3DP8 A;  1NH8 A;  3P7I A;  4DE8 A;  4PP0 A;  4FEC A;  3FIR A;  3A09 A;  2F8D A;  3TDJ A;  2RKM A;  4PQJ A;  2I58 A;  3ECR A;  2Y7P A;  1PB7 A;  3V8X B;  2X7Q A;  2ZNS A;  3MP1 A;  1A7L A;  1RKM A;  1WOD A;  4IY5 A;  1DPP A;  1Y3N A;  4QFP A;  4OFO A;  1P1U A;  4FED A;  3RN8 A;  4PFT A;  3MW0 A;  1D4N A;  3T93 B;  1Q35 A;  3FGS A;  5H8N A;  4X48 A;  1H76 A;  3UK4 A;  4AQ4 A;  4R6H A;  3ZS6 A;  2HZK A;  1B46 A;  5I2K B;  2Y7W A;  2QJE A;  3TPA A;  4PFW A;  3M8U A;  3QAX A;  3A3C A;  4EXL A;  3QUJ A;  4U22 A;  3M3F A;  1ZMG A;  4IY6 A;  2OZZ A;  1MY2 A;  3TUS A;  4H6D A;  4MLQ A;  4DXC A;  1WVJ A;  2R9J A;  1ANF A;  3OO7 A;  3CSB A;  2QS3 A;  3O6H A;  1B4Z A;  2I3W A;  4DXB A;  3TFL A;  3M3K A;  1JVY A;  4JXI A;  3HV1 A;  3C31 A;  4R2F A;  2HQ0 A;  4LAT A;  3R26 A;  1LST A;  4X1B A;  4BDM A;  2DE3 A;  4M1V A;  3H7M A;  1JNF A;  2B65 A;  5ELV A;  4AB5 A;  4I62 A;  5TP9 B;  4FAT A;  4HCY A;  1NFT A;  3SEU A;  4ZDM A;  4OEN A;  4IO5 A;  2XX7 A;  4KQP A;  3T9U A;  4H67 A;  4GXA A;  4G68 A;  5L9S A;  3CFX A;  5F1Q A;  3B6W A;  4FAJ A;  4BDR A;  4IGT A;  3O28 A;  1SYI A;  1ZBM A;  1B1H A;  3FJ7 A;  4GL8 A;  1H44 A;  3TCG A;  2I49 A;  2ANJ A;  4NF8 A;  2H99 A;  1J1N A;  3IOR A;  3VE1 B;  1LFI A;  4ZEI A;  2CZL A;  3UIF A;  5H8Q A;  5DEX A;  3FXR A;  4LVQ A;  3G3G A;  3PPQ A;  1XS5 A;  4GQO A;  4JSD A;  1TWY A;  3TQW A;  4U23 A;  3PUW E;  3L6H A;  3FJM A;  1D3K A;  1QUJ A;  3E4R A;  2OWT A;  4XTC Q;  3WAF A;  2NOO A;  2XXY A;  4DZ1 A;  3IJX B;  3N6T A;  4QF9 A;  3T66 A;  5HPQ A;  3JZJ A;  4E0X A;  1Y3P A;  4GD5 A;  1B7Z A;  4PE5 B;  1R9L A;  4YIC A;  1VFE A;  3H03 A;  4ONY A;  4R9F A;  1VSO A;  1OQG A;  3QUF A;  4GVO A;  1P99 A;  4RY1 A;  1M5F A;  3PGF A;  1H45 A;  2I48 A;  4I8C A;  4NTL A;  3ZSF A;  4F1U A;  2G29 A;  1EU8 A;  3KEI A;  4H1X A;  4NED A;  2XXT A;  4U21 A;  5CBR A;  1IXC A;  2OCU A;  1B1X A;  1MXX A;  5I57 A;  5I56 B;  4G8H A;  1DTZ A;  1BP5 A;  1ZIU A;  3IR1 A;  3H6T A;  2O69 A;  4Z7E A;  1N7W A;  2KLF A;  2D21 A;  3RQT A;  3H6U A;  1B3F A;  1SW2 A;  3IO6 A;  5FHO A;  1WDN A;  3O9P A;  3CVG A;  1B5I A;  3H3G A;  4XKP A;  4F3S A;  2W7Y A;  4NWD A;  1Q1K A;  3FXQ A;  4H5G A;  3VXC A;  5H8H A;  3BBR A;  4YAH X;  4BLA A;  5CMM A;  3B6Q A;  4ZEC A;  4YZZ A;  2NXO A;  2OLB A;  3T9V A;  3VVE A;  3C4M A;  2VD2 A;  2X26 A;  2UYE A;  1P1W A;  1HSE A;  2H98 A;  1OVT A;  3K00 A;  4LA9 A;  4F2O A;  3OEN A;  5I2N B;  1IXG A;  3O66 A;  4IGR A;  3LSL A;  1GTK A;  3KBR A;  2Q89 A;  2Y7I A;  3GBB A;  4OZ9 A;  3EN3 A;  3IJO B;  3S2V A;  3UOR A;  1XC1 A;  3MPL A;  4HTG A;  2DWA A;  1O7T A;  2AL4 A;  4BDO A;  3IL1 B;  2XD2 A;  3ZKK A;  5I58 A;  2O51 A;  4RXL A;  1TXF A;  5AA1 A;  3VXB A;  1YPN A;  4H8I A;  4EDP A;  1N76 A;  3S9E A;  2NVU B;  4F19 A;  3TZA A;  3U94 A;  2GRV A;  2PX1 A;  2GHA A;  1A54 A;  5DVJ A;  3K6V A;  4KD5 A;  1I6B A;  4OTE A;  2E1S A;  4IO6 A;  1H3D A;  3CG1 A;  3G3F A;  4MH5 A;  2YLN A;  1UTB B;  2O68 A;  1SBP A;  2XXP A;  4XKQ A;  3K1P A;  2FYI A;  1I6A A;  5A5X A;  4OET A;  1B5J A;  4XKR A;  4RNS A;  3KJT A;  3MP6 A;  4O3C A;  3SEW A;  1DSN A;  1B32 A;  5AA3 A;  3HST A;  4POX A;  2R6G E;  4WED A;  3GXA A;  1PB9 A;  2QS2 A;  1FW0 A;  2DWI A;  1QKA A;  3MWB A;  5FHN A;  5L8D A;  1ZU0 A;  1XHY A;  1N0T A;  3RUM A;  1UQW A;  3GLB A;  2H4I A;  3MZB A;  1PBP A;  4EQB A;  1EH3 A;  2F35 A;  1SW1 A;  4QRZ A;  3ONM A;  3MUQ A;  5H8F B;  1IZ1 A;  1YAE A;  3U8Q A;  2QPQ A;  1FTL A;  5IAI A;  4ZS9 A;  1EZO A;  1B2H A;  2V3U A;  4ECF A;  2F97 A;  5AA2 B;  4GIZ A;  4JB7 A;  3TTN A;  3UN6 A;  4FE8 A;  4F22 A;  5JTY B;  3LC8 A;  3HHF A;  1MDP 1;  4KPT A;  3PU5 A;  1MRP A;  4FIM A;  2XX9 A;  1AH5 A;  4U1Z A;  3QXM A;  1A8F A;  2DWH A;  3T22 A;  3CR9 A;  2ONK E;  3O6I A;  4RA1 A;  5AE4 A;  2DE4 A;  2OWS A;  1B4H A;  3LR1 A;  1QUI A;  3U92 A;  3UA8 A;  2Z8D A;  5KDT A;  4FJP A;  3T9X B;  1Y3Q A;  3T9H B;  4F39 A;  3IAZ A;  1NNT A;  3HPI A;  3RLF E;  4YB6 A;  4K3F A;  4NF4 B;  4NMY A;  1MY3 A;  3BFT A;  5K2X A;  3KJ7 A;  3TKD A;  5KZT A;  1LAG E;  1SYH A;  4ELR A;  5CM6 A;  1PDA A;  4KCC A;  5EHS A;  2V93 A;  4E0W A;  1FQB A;  3C36 A;  1B5H A;  2RC9 A;  2A5T B;  4HCW A;  1UTH B;  2DS9 A;  4PFY A;  1N3W A;  3KG2 A;  1IQ7 A;  2ESN A;  5I2K A;  2QRY A;  2VOZ A;  1Y4T A;  2PMS A;  2YPN A;  4OXV A;  5LOM A;  3S4U A;  4EF1 A;  1YCJ A;  3SER A;  1MQG A;  4M4G A;  5I84 A;  2QS1 A;  3UP9 A;  3IOU A;  2V84 A;  1NMU A;  1JW5 A;  2DWJ A;  2Z8F A;  1MPC A;  3EHS A;  2XXU A;  3M3L A;  1OLC A;  1TFA A;  1B3H A;  3IX1 A;  2XXQ A;  3FUZ A;  4O3A A;  5J1D A;  5H8N B;  2ZYO A;  2I0C A;  4YU0 A;  4MBP A;  2F36 A;  1S50 A;  2QL3 A;  3MAM A;  2HXW A;  1DOT A;  4BDN A;  3K2D A;  1GVC A;  3N94 A;  5CRY A;  4FOR A;  2Q2C A;  2Z23 A;  1MQJ A;  2UVI A;  1EZP A;  4XXU A;  3MZ1 A;  4POW A;  5K2Y A;  1SDX A;  3PUV E;  1R9Q A;  3IOT A;  2I3V A;  5AA2 D;  5FHM A;  3KFM A;  1F9B A;  4KYE A;  3TOD A;  4ZE8 A;  3PPP A;  2XHD A;  4XIG Q;  2ALU A;  1SI0 A;  4P0I A;  1QW0 A;  2D3I A;  3RT6 B;  2DQV A;  3W9V A;  4R2B A;  2IA4 A;  5DVI A;  3TYH A;  5TP9 A;  5M2V A;  1A8E A;  3Q26 A;  5CMC A;  1B7H A;  1LFG A;  2DOJ A;  4IO7 A;  4N13 A;  2ABH A;  3IB2 A;  3I3V A;  4OVJ A;  2HAV A;  4R74 A;  4JWO A;  1MM6 A;  2OBG A;  3K6U A;  1LB9 A;  3OO9 A;  3QK6 A;  1LBC A;  1SW5 A;  1VFD A;  2F78 A;  1IIT A;  3FVG A;  4N6P A;  2ZXT A;  1AIV A;  4R6K A;  4GWO A;  3V5A A;  3CFZ A;  1MPB A;  4RPO A;  5CC2 A;  4H8J A;  3IOV A;  4H0W A;  2F34 A;  2RC7 A;  5KCJ A;  2FA7 A;  4MF3 A;  4G68 B;  4QHQ A;  4H65 A;  5IKB A;  4LUB A;  3QIM A;  3V89 B;  3PMW A;  4UAC A;  1SW4 A;  3MVX A;  1DMB A;  3O6G A;  3SES A;  3MJN A;  1LAX A;  1N84 A;  5BUU A;  1MQI A;  4QSC A;  1Y1Z A;  1TT1 A;  5ITP A;  5H8Q B;  5DEX B;  1IEJ A;  3K0V A;  5L9M A;  3CRB A;  2XXV A;  3Q29 A;  2O1L A;  3C34 A;  3BKI B;  4EXK A;  4YB5 A;  4JWY A;  2ZYK A;  3PPR A;  2RCA A;  4OWD A;  1OIB A;  1OMP A;  1MXZ A;  2Z22 A;  1JEU A;  4OEV A;  3OOA A;  4WXJ A;  2QS4 A;  3H4Z A;  3FVK A;  2O7U A;  3G3H A;  3KGC A;  1B51 A;  4Q0C A;  1MDQ A;  1VR5 A;  2F7C A;  1MY1 A;  4WEP A;  1AL3 A;  2V3T A;  1PB8 A;  4JSO A;  4DLD A;  1B0L A;  1DTG A;  1IXI A;  1XT8 A;  3D4G A;  3AXF A;  4OER A;  5JK4 A;  1BTJ A;  2AYS A;  2ZYN A;  1URG A;  2DVZ A;  2XXW A;  3DLN A;  3S9M C;  4TLM B;  1Y1M A;  2I6E A;  4QFN A;  2F7A A;  2M8C A;  3O29 A;  3KN7 A;  2GHB A;  4GLI A;  4AB6 A;  5L9O A;  2DXY A;  3IO4 A;  4OFL A;  4OQO A;  2RF1 A;  2F5X A;  2H25 A;  3FZV A;  4I9D A;  3JV9 A;  4KI0 E;  5I2N A;  4F3P A;  3VDF A;  4EUO A;  3RNN A;  3R7X A;  1LAH E;  4QFO A;  4U1O A;  5H8H B;  1P1Q A;  4U4X A;  1B7U A;  5B7D A;  1BLF A;  3S9N C;  1M5C A;  3K01 A;  4JBZ A;  2OK2 A;  4LZ7 A;  1PC3 A;  4G8M A;  5B70 A;  3SEX A;  3LBS A;  2XXX A;  1POY 1;  4NF5 B;  3KN3 A;  3OSR A;  3VLU A;  3S9L C;  3MZ9 A;  1HSL A;  1LFH A;  1SD3 A;  2PYY A;  1NNP A;  3PD8 A;  1OLA A;  3PMV A;  4IO2 A;  3CSG A;  4YMB A;  1IUD A;  1UTB A;  3KSX A;  3C32 A;  2HFB A;  3TAJ A;  3IOW A;  3FV2 A;  3DM0 A;  4OFJ A;  2B3B A;  2AIX A;  2XXH A;  2ZMB A;  5ITO A;  1MG1 A;  1OQH A;  5HM4 B;  3DP4 A;  1BIY A;  3G3I A;  4YKP A;  1USY H;  2Q88 A;  3U1O A;  3OO8 A;  3CFL A;  1JET A;  1YTV A;  3B7D A;  1B40 A;  1LBB A;  1VE4 A;  1Y20 A;  2O7I A;  4Q5T A;  5A5X B;  1II5 A;  3PUX E;  3N26 A;  1QVS A;  4BDL A;  1US5 A;  5H8F A;  1SQY A;  2ZNT A;  4XKN A;  3W15 C;  3VVD A;  1O63 A;  5AA4 A;  4LQ5 A;  1N3X A;  3G3J A;  1SI1 A;  4DCY A;  1I69 A;  4QFK A;  1B52 A;  1A99 A;  2HCA A;  2X7P A;  3RTW B;  2PT1 A;  3EHT A;  4PFU A;  3F11 A;  3ILU B;  3W9W A;  4LP2 B;  2VGQ A;  1MM7 A;  3MP8 A;  5TU0 A;  3OO6 A;  5JTY A;  3OMB A;  4KFQ A;  4RJZ A;  1I6Q A;  2BJJ X;  4OHN A;  4LZ5 A;  1ELJ A;  4F3B A;  3IK6 B;  2F7B A;  4EF2 A;  3ODB A;  1FTK A;  5I59 B;  3PPN A;  4I1D A;  3USD A;  1ZKB A;  3IB0 A;  3LUY A;  4U4S A;  1QJM A;  2Y7K A;  2QMW A;  2WKY A;  4R75 A;  2O1M A;  3EPE A;  5BWJ A;  4DDD A;  5H8S A;  1B05 A;  4NF6 A;  1B0H A;  3EQ1 A;  1MQH A;  2F6G A;  5ICT A;  3Q28 A;  3VFJ A;  1BKA A;  5DYH A;  1GR2 A;  4G68 C;  1ZLQ A;  1B3L A;  2XD3 A;  2ZYM A;  1LGB C;  1KWH A;  5CBS A;  2Y7R A;  4H5F A;  3C33 A;  4UA8 A;  1Z7M E;  3E9X A;  3I6V A;  3E13 X;  1S7Y A;  4YMA A;  4F2Q A;  5KDT B;  1LB8 A;  4QFL A;  1FTO A;  3MQ9 A;  1FQC A;  4NWC A;  1URD A;  5TPA B;  2LAO A;  2A5T A;  1FCK A;  1R1N A;  3PD9 A;  1UTH A;  3B6T A;  3VLW A;  2NWJ A;  2P1S A;  5JEI A;  2VP1 A;  4TQU Q;  1N7X A;  3FJG A;  4NE4 A;  3KSJ A;  1OVB A;  1FTJ A;  4IO4 A;  2ONR A;  2I4C A;  3K1N A;  4OYV A;  4O3B A;  1FQE A;  1FQD A;  2ZNU A;  2AL5 A;  1MPD A;  1MY0 A;  5DVF A;  2R71 A;  3H6V A;  4RK2 A;  3MVZ A;  1H43 A;  4G4P A;  4KR5 A;  3MBP A;  4HW8 A;  4P11 A;  4GL0 A;  4LQ2 A;  3FXU A;  4ZED A;  3K4U A;  4R9G A;  3C9H A;  1MY4 A;  3TTK A;  1B58 A;  4R73 A;  4ISU A;  4C0R A;  3OD7 A;  1A40 A;  3K1M A;  4DIG A;  3A3U A;  2DVC A;  3T96 B;  4ZEF A;  4GXS B;  3MC2 A;  3RT8 A;  3OSQ A;  3TTL A;  1B9J A;  3TEL A;  3CG3 A;  3THI A;  4YKK A;  3TEP A;  3VVF A;  4KYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...