5HPQA

Crystal structure of cyclohexadienyl dehydratase from pseudomonas aeruginosa bound to acetate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
238
Chain Sequence
ESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEARFQTLEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKADLMMTDAIEARLQSRLHPELCAVHPQQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRMEHWLEYRWPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Cyclohexadienyl dehydratase
publication title Crystal structure of cyclohexadienyl dehydratase from Pseudomonas aeruginosa bound to acetate
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
total genus 85
structure length 238
sequence length 238
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5hpqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5hpqA02
1LFIA 4LP2B 5H8SA 1LFGA 4ZE9A 3PUXE 3S9MC 4LZ8A 4RA1A 4QSCA 3CFZA 2UXAA 3PUZE 3V83A 4RPOA 1URGA 4R9GA 1NNKA 2THIA 3G3HA 5H8QA 3B6TA 1UIVA 3OELA 1S7YA 3QAXA 1GTKA 5KCJB 3B6WA 1NH7A 1ZKBA 4JBZA 4OEUA 3RUMA 1JW4A 3LUYA 4GL0A 2NWJA 2Q89A 3IB1A 4DDDA 1MQIA 3FJMA 5CRYA 4LA9A 3DP8A 2F6GA 2ONSA 2V84A 3IAZA 1VSOA 2GFEA 3PMXA 4YMBA 3G3JA 3MVZA 1IIWA 3JV9A 2UYFA 4QSDA 3O66A 4KHZE 2X26A 4DXCA 4YKKA 1POTA 4DLDA 3KGCA 4U4SA 3RTWB 2AL5A 1MPBA 5BUUA 2VGQA 2I3WA 4F1YA 1DPPA 2F5XA 3LSWA 3EHTA 3CG1A 2F78A 1SW4A 3QK6A 2DQVA 4H65A 3CFXA 1R6ZA 4KQPA 5I57A 1LBCA 3OEMA 4K3FA 4H0WA 3K2DA 2YPNA 5AA4B 2DXRA 4G77A 1RKMA 2Z23A 2Z8FA 1B46A 3IOWA 1JNFA 2RCAA 1A7LA 4ISUA 1I6QA 2I3VA 3ODBA 2ONKE 3TCFA 4OFOA 4POXA 2V3UA 5A5XB 4OESA 3WAFA 2DE4A 4NF5A 3U93A 3TEPA 3RTFB 3KOSA 4NF8B 1B7UA 4JSOA 5EYFA 3MZ1A 1Y3QA 3KFMA 1MPDA 1FQCA 5JTYA 3H7MA 3VFJA 3I6VA 2O84X 4MLQA 2FNCA 4QSEA 3RPWA 3IR1A 2RCBA 4R9FA 3DLNA 5H8FB 2I4BA 4OFJA 5JK4A 2XXIA 3SETA 5KZTA 1AMFA 1B3FA 1VE4A 4OQOA 1UTHA 2AL4A 3FXQA 3CVGA 3VLWA 3BBRA 1B51A 4POWA 3VVFA 1CB6A 5DTBA 4JWXA 1P1QA 3HSTA 3HCQA 3TTMA 2QS4A 3FXUA 3K4UA 3N26A 2BJJX 5TP9A 1B32A 5DEXB 5I56A 2OBGA 5H8NB 2E0SA 1MH3A 2V3QA 3OXNA 1FCKA 4UACA 3T9VA 3B6QA 2ABHA 1LCFA 4OFLA 4LVQA 3PV0E 4P11A 3H03A 2O1LA 3FVGA 1MY4A 3OO7A 4PP0A 3RLFE 5L9MA 4BDRA 4R75A 1B9JA 3ILTB 3W9VA 1QULA 3E3KA 2F36A 3K6UA 3H6VA 1GVCA 1Y4CA 2Z22A 1R9LA 4KPTA 3IJXB 4F31B 2RKMA 1SW2A 5CMMA 5LOMA 4F1VA 5IAIA 3MJNA 3SEYA 4KR5A 4ND9A 1MS7A 1MM6A 2HEUA 3C4MA 1YTVA 4PFWA 4R6YA 4LATA 1UIUA 4ZE8A 3V8XB 3PD9A 1Y3NA 1MQHA 4FE8A 3MVWA 3ZSFA 1US4A 1XOCA 2B3FA 3V89B 3O6HA 4YAHX 3BFTA 1OLAA 2Q2AA 4MH5A 3T9HB 4HS7A 1BLFA 5B70A 5I2NB 3PMVA 5TU0A 4YKJA 1L5TA 3KG2A 2O6AA 3FGSA 3FASA 3GBBA 5ITOA 3G7WA 1IITA 3H6UA 3I5OA 4YB6A 2A5TB 1LFHA 1NH8A 2X7PA 4FIMA 4ESWA 3UA8A 2XXRA 3TODA 4OMBA 3VLUA 4JWYA 2F7AA 4HTGA 4DZ1A 4Q30B 1DOTA 1US5A 4DXUA 4ZZEA 3U8QA 4G68B 1QUJA 4QHQA 5L8DA 3U72A 3DP4A 5H8HA 4L17A 1XS5A 3Q27A 4OENA 1MY2A 2YJPA 3S9LC 1Y1ZA 3OSRA 4KI0E 4F1UA 3TFLA 4Q5TA 5CMCA 2PT1A 3CI8A 2DOJA 1LBBA 1YCJA 2Y7KA 2ZYNA 3T66A 4GRKA 3EQ1A 5JEIA 1SDXA 1A8FA 3KN3A 4R73A 3IB0A 1XVXA 4N13A 2ZNUA 1IZ1A 4BDLA 4JXIA 2P1SA 3QXMA 2OWSA 1OVTA 3R26A 3TUSA 4I9DA 3Q25A 4EDPA 1IEJA 1NKXA 3GLBA 3SESA 3OMBA 3OSQA 3N5LA 4XKNA 4IO3A 1N04A 1JVYA 3CG3A 1N3XA 4XXUA 1MQDA 5TPAB 2ZYOA 1URDA 2UVGA 1Y1MA 4HCWA 1XC1A 3L6GA 2I4CA 5KCJA 4N07A 2PYYA 1H43A 3E9XA 1WVJA 4GXSB 3UN6A 3UGWA 4F3BA 3VVDA 3UIFA 1MXYA 4OWDA 2DWJA 4IO2A 3FATA 3PPPA 2R71A 1B40A 1ZMGA 2CMOA 1PB7A 1B0LA 1P1NA 3IO6A 3MP8A 5I59B 2RC8A 2H99A 1Z7NE 2XXUA 2Y7WA 1B7ZA 1OIBA 5F7VA 3T22A 4M1VA 4OEVA 1USYE 4IGTA 1Y3PA 1B05A 1NL5A 1FTJA 1URSA 4NF4A 2H25A 2A5SA 2G29A 1Q35A 4GQOA 4MBPA 4ZEKA 2DYXA 2XXVA 4X1BA 2XXXA 1A99A 3PU5A 3C33A 4QFLA 3U1OA 3FVNA 1SYIA 1DTGA 2FYIA 3FJGA 4NF6A 4DE8A 1P1OA 3HO7A 2PT2A 1PBPA 4R74A 2OZZA 4TLLB 4FATA 3PPQA 2OK2A 4RYAA 3LSXA 3K00A 2HZLA 2RINA 5IKBA 5AA2B 4YB5A 3C34A 3AXFA 4X9TA 3CSGA 5J1DA 3TQWA 2XX8A 5K2XA 4R6HA 3SKPA 3MPLA 2F35A 4GL8A 4JDFA 3N6UA 3S4UA 3IB2A 2ZMBA 1A40A 2X7QA 4NF8A 5CBRA 2NXOA 1WODA 4EF1A 4IO7A 1B2HA 1TFAA 2V25A 5ICQA 1P1WA 3O9PA 4I62A 1LAFE 1O63A 4IY5A 2Y84A 2Z8EA 1N0TA 5H8QB 5H8FA 1MDP1 1FW0A 2XXWA 4MFIA 2UVHA 2XXPA 3GXAA 1B5JA 1SI1A 2PMSA 1TWYA 4NWDA 1EZPA 5ISUA 2VHAA 3MZBA 3OO6A 2WKYA 3O6GA 5DEXA 4KCCA 4F39A 1M5EA 2IEEA 5H8NA 5K2YA 3M3FA 4WKMA 4IO6A 1POY1 1M5FA 3JZJA 3OD7A 3PUWE 3UK4A 2YLNA 3PPRA 4PE5B 2OLBA 1NNPA 4Q0CA 3QUJA 3MC2A 1ANFA 3K1PA 1O64A 1MM7A 4U4XA 3TCHA 1PDAA 4ELOA 1RYOA 5DVFA 2HZKA 5L9SA 2QJEA 1QKBA 2XD2A 2LAOA 3IJOB 5CMBA 5I58B 1T0KA 1ZLQA 2FA7A 3K01A 3FVKA 3W15C 4JSDA 1LCTA 5ICTA 4JB7A 4OZ9A 3N6TA 3ONMA 3LC8A 1F9BA 1EZOA 4TOZA 3M3LA 3VXCA 1CE2A 1SD3A 4JWOA 3F11A 1I6BA 3H06B 3H6WA 5CC2A 1N7WA 3GBAA 1FTLA 1EZ9A 2AIXA 4WEPA 4YMAA 3FV1A 4NF5B 3IL1B 4KD5A 2DWAA 3OOAA 1IXCA 2GRVA 3K0VA 4I8CA 1LGBC 2PX1A 1P99A 1B7HA 5I2NA 3DELB 5JTYB 3Q26A 4KYEA 1MXXA 2XXTA 1LSTA 4R2FA 2ANJA 4X48A 4C1TA 1TT1A 2XXQA 4R72A 3CIJA 3SEUA 3ECRA 3O97A 3MWBA 1XVYA 4H5FA 1N7XA 1ZIUA 3RN8A 1Z7ME 4C1UA 1I69A 3T9UA 2QSXA 1UTHB 2Q8JA 2QS2A 4I1DA 4PFTA 4NE4A 1J1NA 3MP6A 4KFQA 4TQUQ 3EHUA 5TP9B 1N76A 1MXUA 3KZGA 2XXHA 4OVJA 4C0RA 1UTBA 1NFTA 4PFYA 3ILUB 1JW1A 4TLMB 3Q28A 3QSLA 3BKIB 1SI0A 3TPAA 2E1SA 1LB8A 1BTJA 1ATGA 2HAUA 5CBSA 1MQJA 3RT6B 3TDJA 3KJ7A 3TTLA 4PFUA 1GR2A 3OO8A 1SQYA 3UP9A 1FQDA 4NTLA 2DWHA 2UVIA 5DYHA 2ZNTA 4ZEBA 3CRBA 3RY3A 3MVXA 4E0WA 4DXBA 1M5CA 3IO4A 3FV2A 3PGFA 3S9EA 3OEKA 1MY1A 5DVJA 4BDQA 5CM6A 3BFUA 5FTHA 1BKAA 2H9BA 4ZEIA 5KDTA 4QFPA 1SW1A 1D9VA 4RY1A 3KJTA 1JETA 1Y4TA 1R1NA 3EPEA 2OWTA 1A8EA 2NUVA 1B4HA 1N3WA 2UVJA 4NMYA 1ZU0A 1MY0A 3TMGA 4THIA 4BDNA 1HSEA 1MQGA 3USDA 5AA1A 1MY3A 2QPQA 3HHGA 1AOVA 3LSFB 2O69A 2UYEA 1IQ7A 4GWOA 2NOOA 3MP1A 4U1ZA 4O3BA 2M8CA 3K1NA 1QUIA 3I3VA 3FJ7A 4U1OA 3SEWA 1I6AA 3TZAA 4RNSA 1MG1A 4P0GA 4ELRA 3FIRA 4F2OA 3KOTA 2GHBA 4GFRA 1GV8A 3T9XB 1D9YA 4BLAA 4XTCQ 1PC3A 3PD8A 4XKQA 5AE4A 4LZ5A 5AA3A 4FAJA 3KBRA 1ZJLA 2AYSA 4H1XA 2VD3A 3TTRA 1A54A 5CMKA 1QVSA 2HQ0A 4YICA 3TKDA 1FTMA 2GHAA 5EHSA 2I6EA 1H45A 2OCUA 4EXKA 3A3UA 2ESNA 1BP5A 2RC9A 4GIZA 4WXJA 4ESXA 1D4NA 3B7DA 1FTKA 1II5A 4R2BA 2VD2A 4IGRA 1OMPA 4Q8RA 3IK6B 2PBWA 2ZXTA 4GVOA 2IA4A 4G8MA 4G8NA 2D5WA 1H3DA 4ONYA 3O29A 3UORA 5FTIA 2QMXA 3PUYE 2XXYA 3MAMA 2DWIA 3IOUA 2F7CA 1NNFA 3SDFA 2XX9A 1QW0A 1B3LA 5BWJA 1VFDA 1SBPA 3TCGA 1QJMA 4LONB 1FQFA 4FORA 2O68A 1TFDA 4G68C 5FHNA 1XHYA 2DVZA 3TYHA 3VDFA 1FQBA 3K1MA 3RQTA 3PUVE 1ZBMA 3MVYA 3ZS6A 1IXHA 4G4PA 5F1QA 1B4ZA 1GGGA 1LAXA 3VVEA 1PBQA 1MXVA 4BDOA 4KCDA 2G93A 3VLVA 2HCAA 2Z8DA 3RT8A 4YB7A 3VE1B 2DE2A 3IX1A 5AA4A 3KN7A 3EF7A 4M4GA 3G3KA 5DT6A 2ONRA 3GZGA 3Q29A 5I84A 4ZDMA 2OJTA 1LB9A 3FD3A 1PB9A 2NVUB 3HV1A 1SYHA 4QFNA 5DVIA 3H3GA 1B5IA 4BDMA 4F3PA 1M5BA 3TTKA 2F97A 3OENA 5A5XA 2HFBA 4GXAA 3HHFA 2RF1A 3OO9A 2H98A 3EHSA 4NWCA 4RXLA 1NMUA 5I2KB 1JW5A 1TXFA 4LQ2A 4AB6A 1Q1KA 3VXBA 4QF9A 2DSFA 1B6HA 3N94A 3FZVA 5L9OA 1SVXB 4IB2A 4PQJA 1PEBA 4R6KA 1B3HA 4NF4B 3KSXA 1MRPA 1MXWA 1LLSA 4LUBA 3TELA 2H4IA 4EXLA 2R6GE 1B3EA 1M5DA 3S9NC 5ITPA 4ZEDA 4OTEA 5I58A 4NF6B 1RYXA 2KLFA 3FXRA 4N6PA 2XD3A 4XIGQ 1B1XA 2ZYKA 4IY6A 4ELPA 1EH3A 3MUQA 1IUDA 1MH4A 2PVUA 4MF3A 1SW5A 4FEBA 1HSJA 1PB8A 1YPNA 3R7XA 1OVBA 3O6IA 3WAEA 1MPCA 3LBSA 3MW0A 4RJZA 1P1UA 1B1HA 3E4RA 3K6XA 3MZ9A 2O51A 4IO5A 3EN3A 3K6WA 3C32A 3O28A 3DP6A 5HM4B 2O7IA 1AL3A 3FVOA 2O7UA 1B52A 2DE3A 5B7DA 3PMWA 4EQ9A 1S9TA 2XHDA 4H8IA 5I57B 2DXYA 2F7BA 1ELJA 3IOTA 1QUKA 1BIYA 2Q2CA 4EUOA 4NEDA 3TAJA 3MQ9A 2B3BA 3A3CA 5CI5A 5ELVA 3T93B 3G3GA 3H6TA 2F34A 3IOVA 3PPNA 4P0IA 3C31A 1DTZA 4YU0A 3O2AA 5EHMA 4OHNA 5AA2D 1DSNA 3DM0A 4F29A 4GOTA 1R9QA 5HPQA 1AH5A 1O7TA 1LAGE 4EF2A 1LAHE 4KYSA 3U94A 2HXWA 3U92A 3A09A 2VP1A 2XX7A 3RNNA 2A5TA 3QYTA 4RK9A 4Z0IA 1UQWA 1YAEA 3K02A 4LZ7A 2I58A 3L6HA 2Y7IA 4ZZAA 2DS9A 2H5YA 1FQAA 1NNTA 2CZLA 1XT8A 4X1DA 1OQHA 4RK2A 2Y7RA 4G68A 1JVXA 4F3SA 2ZNSA 4MLVA 5I56B 3MPKA 4O3CA 4ZS9A 4QRZA 2DVCA 1KWHA 4F22A 4EQ7A 3MBPA 1OQGA 3TTNA 2VOZA 4OYVA 2W7YA 3ZKLA 3H4ZA 2B65A 3RGYA 1ZTYA 4F18A 1QKAA 3IORA 3KSJA 3CSBA 2P2AA 3C9HA 2Q9TA 5HBCA 1VFEA 4AB5A 1JEUA 4EQBA 4F2QA 2D3IA 1MDQA 3SERA 3T96B 2REGA 4U22A 4UA8A 1USYH 2QS3A 4XKRA 1FTOA 2I0CA 4H8JA 4OXVA 3LR1A 3ZKKA 4HW8A 3LSLA 1HSLA 1EU8A 4XKPA 4DCXA 2F6PA 3QUFA 3TQLA 4F3GA 3C35A 3W9WA 4H5GA 2DP8A 3E13X 5TPAA 4GF8A 4ZECA 3M3KA 1FQEA 4OETA 4QFKA 2Y7PA 1UTBB 1JEVA 4H6DA 2HAVA 4RPNA 1H44A 1B0HA 4AQ4A 3CR9A 4PETA 3SEXA 4FEDA 1A55A 4QFOA 3KEIA 4HCYA 3G3IA 3S2VA 2V3TA 1B3GA 5M2VA 1DMBA 2GH9A 4H67A 3V5AA 5FHMA 1MXZA 4WEDA 1WDNA 4U21A 1VR5A 2V93A 3JYRA 4GLIA 1IXIA 5I59A 1IXGA 3VV5A 2I48A 4F19A 4FJPA 3C36A 3KN8A 3CFLA 3PPOA 3THIA 4LQ5A 4OERA 3FUZA 4YZZA 3R6UA 4KYDA 4E0XA 4FECA 3D4CA 4ZEFA 5KDTB 1H76A 5FHOA 2QRYA 5H8HB 1JQFA 4ELQA 4G8HA 4YKIA 2RC7A 2QS1A 4U23A 2ZYMA 3D4GA 2I49A 2P0SA 1N84A 1DPEA 1AIVA 1Y20A 2QL3A 1Y9UA 3G3FA 4DIGA 3QIMA 4GD5A 4U2RA 4YKPA 1OLCA 2I0BA 2O1MA 4IO4A 2R9JA 2D21A 2ALUA 3HN0A 3P7IA 1B5HA 1S50A 2Q88A 5AA2A 3SEVA 4G2ZA 2F8DA 1D3KA 3HPIA 3K6VA 3M8UA 4O3AA 4DCYA 2QMWA 2REJA 4ECFA 4Z7EA 1B58A 5I2KA
chains in the Genus database with same CATH superfamily
1LFIA 4LP2B 5H8SA 1LFGA 4ZE9A 3T1BA 3PUXE 3S9MC 4LZ8A 4RA1A 4QSCA 3CFZA 2BJIA 4X8RA 2UXAA 3PUZE 3V83A 4RPOA 1URGA 4R9GA 1NNKA 2THIA 3G3HA 5H8QA 3B6TA 1UIVA 3OELA 1S7YA 3QAXA 1GTKA 5KCJB 3B6WA 4OVPA 1NH7A 4IR8A 1ZKBA 4NF0A 4JBZA 4OEUA 3RUMA 1JW4A 3LUYA 4GL0A 2NWJA 4PFIA 2Q89A 3IB1A 2MKZA 1DBZA 4DDDA 1MQIA 3FJMA 5CRYA 4LA9A 3DP8A 5ET7A 2F6GA 2ONSA 2V84A 4P3LA 1D9QA 3IAZA 1VSOA 2GFEA 3PMXA 4YMBA 3G3JA 1CNQA 3IFCA 4QXDA 3MVZA 1IIWA 4P47A 3JV9A 2UYFA 2XWVA 4QSDA 3O66A 4KHZE 2X26A 4DXCA 4YKKA 1POTA 4DLDA 3KGCA 4U4SA 3RTWB 2AL5A 1MPBA 5BUUA 2VGQA 2I3WA 4F1YA 1DPPA 2F5XA 3LSWA 3EHTA 3CG1A 2F78A 1SW4A 2OX3A 3QK6A 1QGXA 2DQVA 4H65A 3CFXA 1R6ZA 4KQPA 2VPNA 5I57A 1LBCA 3OEMA 4K3FA 4H0WA 3K2DA 2YPNA 5AA4B 1FBEA 2DXRA 4G77A 3RPLB 1RKMA 2Z23A 2Z8FA 1B46A 3IOWA 1JNFA 2RCAA 1A7LA 4ISUA 2QFLA 1I6QA 2I3VA 3ODBA 4GBVA 2ONKE 4N17A 3TCFA 4OFOA 4POXA 2V3UA 2DDKA 4AS5A 5A5XB 4OESA 3WAFA 2DE4A 4NF5A 3U93A 3TEPA 3RTFB 3KOSA 2HPGA 4NF8B 1B7UA 4JSOA 5EYFA 3MZ1A 4O7MA 1Y3QA 4PDHA 3KFMA 1MPDA 1FQCA 5JTYA 2CZKA 3H7MA 2Y5LA 3VFJA 2XWKA 3I6VA 2O84X 4N6KA 4MLQA 2FNCA 4QSEA 3RPWA 3IR1A 2RCBA 4R9FA 4MMPA 3DLNA 3FXBA 5H8FB 2I4BA 4OFJA 5JK4A 2XXIA 3SETA 5KZTA 1AMFA 1B3FA 1FPKA 1VE4A 4MJOA 4OQOA 1UTHA 2AL4A 3FXQA 3CVGA 3VLWA 4QBAA 3BBRA 1B51A 4POWA 3VVFA 1CB6A 5DTBA 4JWXA 1P1QA 3HSTA 3HCQA 3TTMA 4MNPA 2QS4A 3FXUA 3K4UA 1KZ8A 3N26A 2BJJX 5TP9A 1B32A 5DEXB 5I56A 2OBGA 5H8NB 1LBVA 2E0SA 1MH3A 2V3QA 3OXNA 1FCKA 4UACA 3T9VA 3B6QA 1LBYA 2ABHA 1LCFA 2WX9A 4OFLA 4LVQA 3PV0E 3EKIA 4P11A 3H03A 3QMFA 2P3VA 3B8BA 2O1LA 3FVGA 2B4MA 1MY4A 3OO7A 4MHFA 4PP0A 3RLFE 5L9MA 4BDRA 4R75A 1B9JA 3ILTB 3W9VA 1QULA 3E3KA 3GYYA 2V4CA 2F36A 3K6UA 3H6VA 5IZ3B 1GVCA 1Y4CA 2Z22A 1R9LA 1LBZA 4KPTA 3IJXB 4F31B 2RKMA 1SW2A 1G0IA 5CMMA 1NUZA 5LOMA 4F1VA 5IAIA 3MJNA 3SEYA 1NV6A 4KR5A 4ND9A 1MS7A 1MM6A 4PGPA 2Q8MA 2OWZA 2HEUA 3C4MA 1YTVA 4PFWA 4R6YA 4LATA 1UIUA 4XFEA 4ZE8A 3V8XB 3PD9A 1Y3NA 1MQHA 4FE8A 3MVWA 3ZSFA 1US4A 1XOCA 2B3FA 3V89B 3O6HA 4YAHX 3BFTA 3IFAA 1OLAA 2Q2AA 4MH5A 3T9HB 4HS7A 1BLFA 1IMAA 5B70A 5I2NB 3PMVA 5TU0A 4YKJA 1L5TA 3KG2A 2O6AA 3FGSA 3FASA 3GBBA 5ITOA 3G7WA 2HXRA 1IITA 3H6UA 3I5OA 4YB6A 2A5TB 1LFHA 2QVVA 1NH8A 2X7PA 4FIMA 4ESWA 2FBPA 3UA8A 2XXRA 3TODA 3KC1A 4OMBA 3VLUA 4JWYA 2F7AA 4HTGA 1FSAA 4Q30B 4DZ1A 1DOTA 1US5A 4DXUA 4ZZEA 3U8QA 2VPOA 2L5VA 4G68B 5FBPA 1QUJA 2F3DA 4QHQA 5L8DA 3U72A 3DP4A 5H8HA 4L17A 1XS5A 3Q27A 2ZZVA 4OENA 1MY2A 2YJPA 3S9LC 1Y1ZA 1AWBA 4P56A 3OSRA 2ZZWA 4KI0E 4F1UA 3KBZA 2PFYA 3TFLA 4Q5TA 5CMCA 2PT1A 3CI8A 4GWWA 2DOJA 1LBBA 4PBQA 1YCJA 2Y7KA 2ZYNA 3T66A 4GRKA 3EQ1A 5JEIA 1SDXA 4UABA 1A8FA 3KN3A 4MNIA 4R73A 3IB0A 1XVXA 1IMFA 4N13A 2ZNUA 5I5PA 1IZ1A 4BDLA 4JXIA 2P1SA 3QXMA 2OWSA 1OVTA 3R26A 4O8MA 4OVRA 3TUSA 4I9DA 3Q25A 4EDPA 1IEJA 1NKXA 3GLBA 3SESA 3OMBA 3OSQA 3N5LA 4XKNA 4IO3A 1N04A 1JVYA 3CG3A 1N3XA 4XXUA 1MQDA 5TPAB 2ZYOA 1URDA 2UVGA 1Y1MA 4HCWA 1XC1A 3L6GA 5DW8A 2I4CA 5KCJA 4N07A 2CZHA 2PYYA 1H43A 3E9XA 1WVJA 4GXSB 3UN6A 3UGWA 4F3BA 3VVDA 3UIFA 1IMCA 1MXYA 4OWDA 1NV1A 2DWJA 4IO2A 3FATA 3PPPA 2R71A 1B40A 1ZMGA 2CMOA 1PB7A 1B0LA 4AS4A 5I3SA 1P1NA 1LEVA 3IO6A 3MP8A 5I59B 2RC8A 2H99A 1Z7NE 2XXUA 2Y7WA 2HHMA 1B7ZA 1OIBA 2Y5KA 5F7VA 2VT5A 5ET8A 3T22A 4M1VA 4OEVA 1USYE 4NQ8A 4IGTA 1Y3PA 1B05A 1NL5A 1FTJA 4PDDA 1URSA 4NF4A 2H25A 1YXIA 2A5SA 2G29A 1Q35A 4GQOA 4MBPA 4ZEKA 2DYXA 2XXVA 5IZ1A 4X1BA 2XXXA 1A99A 3PU5A 3C33A 4QFLA 3U1OA 2WEFA 3FVNA 1SYIA 1DTGA 2FYIA 3FJGA 4NF6A 4PE3A 4DE8A 1P1OA 3HO7A 2PT2A 1PBPA 4R74A 2OZZA 4TLLB 4FATA 2CEYA 3PPQA 3RPLA 2OK2A 4RYAA 3LSXA 3K00A 4O94A 2HZLA 4OANA 2RINA 5IKBA 1VDWA 4N15A 5AA2B 4YB5A 3C34A 3AXFA 4NN3A 4X9TA 3CSGA 5J1DA 3TQWA 2XX8A 4PBHA 4LN5A 5K2XA 1FRPA 4R6HA 5EQ8A 3SKPA 3MPLA 2F35A 4GL8A 4JDFA 3N6UA 3S4UA 3IB2A 2ZMBA 1A40A 2X7QA 4NF8A 5CBRA 2NXOA 1WODA 4EF1A 4IO7A 1B2HA 1FPIA 4PCDA 1TFAA 2V25A 5ICQA 1P1WA 3O9PA 4I62A 1LAFE 1O63A 4IY5A 2Y84A 2Z8EA 1N0TA 5H8QB 4P1EA 5H8FA 1MDP1 1FW0A 2XXWA 4MFIA 2WYKA 1IMDA 1FBHA 2UVHA 2XXPA 5I7IA 3GXAA 1B5JA 1FPLA 1SI1A 2PMSA 1TWYA 4NWDA 1FJ9A 1EZPA 5ISUA 2VHAA 3MZBA 3OO6A 4PC9A 2WKYA 3O6GA 4N8YA 4FBPA 5DEXA 4KCCA 4F39A 1M5EA 2IEEA 5H8NA 5K2YA 3M3FA 4WKMA 4IO6A 1POY1 1M5FA 5T3JA 3JZJA 4NHBA 3OD7A 4H46A 3PUWE 3UK4A 2YLNA 3PPRA 4PE5B 2OLBA 1NNPA 4Q0CA 3QUJA 1FPEA 1ANFA 3MC2A 3K1PA 1O64A 1MM7A 4U4XA 3TCHA 1PDAA 4ELOA 1RYOA 5DVFA 2HZKA 3CHGA 5L9SA 2QJEA 1QKBA 2XD2A 4MCOA 2LAOA 5IZ3A 3IJOB 5CMBA 5I58B 1T0KA 1ZLQA 2FA7A 3K01A 3FVKA 3W15C 4JSDA 1LCTA 1FPBA 5ICTA 4JB7A 2FIEA 4OZ9A 3N6TA 3ONMA 3LC8A 1F9BA 1EZOA 4TOZA 3M3LA 3VXCA 1CE2A 1SD3A 4JWOA 3F11A 1I6BA 3H06B 4NGUA 3H6WA 5CC2A 1N7WA 3GBAA 1FTLA 1EZ9A 2AIXA 4WEPA 4YMAA 3FV1A 4NF5B 3IL1B 4KD5A 2DWAA 3OOAA 1K9ZA 1IXCA 2GRVA 3K0VA 4I8CA 1LGBC 2PX1A 1P99A 1B7HA 5I2NA 3DELB 5JTYB 3Q26A 4KYEA 1MXXA 2XXTA 4P9KA 1LSTA 3T0JA 4R2FA 2ANJA 4X48A 4C1TA 1TT1A 2XXQA 4R72A 3CIJA 3SEUA 2FVZA 1NV2A 3ECRA 3O97A 3MWBA 1XVYA 4H5FA 1N7XA 1ZIUA 3RN8A 1DK4A 1Z7ME 4C1UA 1I69A 3T9UA 2QSXA 1UTHB 2Q8JA 2QS2A 4I1DA 4DI4B 4PFTA 4NE4A 1J1NA 3MP6A 4KFQA 4OVTA 4TQUQ 1NV0A 3ROJA 5EYGA 1INPA 3E79A 3EHUA 5TP9B 3A29A 1N76A 2GQ1A 1MXUA 3KZGA 2XXHA 4OVJA 1K9YA 4C0RA 1UTBA 1NFTA 4PFYA 3ILUB 1JW1A 4TLMB 3Q28A 2PCRA 3U65A 3QSLA 3BKIB 1SI0A 4G61A 1FBFA 3TPAA 2E1SA 1LB8A 1BTJA 1ATGA 2HAUA 5LTCA 4OVQA 5CBSA 1MQJA 3RT6B 3BIGA 3TDJA 3KJ7A 2WYPA 3TTLA 4PFUA 1GR2A 3OO8A 1SQYA 3UP9A 1FPFA 1FQDA 4NTLA 2DWHA 2UVIA 5DYHA 2ZNTA 4MNCA 4ZEBA 3CRBA 3RY3A 3MVXA 4E0WA 4DXBA 1M5CA 3IO4A 3FV2A 3PGFA 3S9EA 3OEKA 1MY1A 5DVJA 5EQ7A 4KXPA 4BDQA 5CM6A 3BFUA 1EYJA 5FTHA 1BKAA 3MSTA 2H9BA 4ZEIA 1LBWA 5KDTA 2B4LA 1XI6A 1IMEA 4QFPA 4PTKA 1SW1A 1D9VA 4RY1A 3KJTA 1JETA 4GWUA 1Y4TA 1R1NA 3EPEA 2OWTA 1A8EA 2NUVA 1B4HA 1N3WA 2UVJA 4GX6A 4NMYA 1ZU0A 1MY0A 3TMGA 4THIA 4BDNA 1HSEA 1MQGA 3USDA 5AA1A 1MY3A 1EYKA 3B50A 2QPQA 3HHGA 5ET6A 1AOVA 1NUYA 4MEVA 3LSFB 2O69A 4GWXA 4PAFA 2UYEA 1IQ7A 4GWOA 2NOOA 3MP1A 4U1ZA 4O3BA 2M8CA 3K1NA 1QUIA 2WBDA 3I3VA 4N91A 3FJ7A 5ESYA 4U1OA 3SEWA 1I6AA 3TZAA 4RNSA 1MG1A 4P0GA 4ELRA 3FIRA 4F2OA 3KOTA 2GHBA 4GFRA 1GV8A 3LV0A 4HE1A 3T9XB 1D9YA 4BLAA 4XTCQ 1PC3A 3PD8A 4XKQA 5AE4A 4LZ5A 5AA3A 4FAJA 3KBRA 2WBBA 1ZJLA 2AYSA 4H1XA 2VD3A 3TTRA 4GWYA 1A54A 5CMKA 5J16A 1QVSA 2HQ0A 4YICA 3TKDA 1FTMA 2GHAA 5EHSA 5IGAA 5LDZA 2I6EA 1H45A 2OCUA 4EXKA 3LUZA 4NX1A 3A3UA 1SPIA 4PFRA 2ESNA 1BP5A 2RC9A 4GIZA 4WXJA 4ESXA 1D4NA 1FBCA 3B7DA 1FTKA 4PFBA 1II5A 4R2BA 2VD2A 4IGRA 1NI9A 4MAGA 1OMPA 4Q8RA 4I40A 3IK6B 2PBWA 2ZXTA 4GVOA 2IA4A 4G8MA 1KA1A 4JVIA 4G8NA 1FPJA 1Q9DA 1H3DA 2D5WA 4ONYA 3O29A 4N4UA 3UORA 5FTIA 2QMXA 3PUYE 2XXYA 3MAMA 4HE0A 1JP4A 2DWIA 3IOUA 2F7CA 4I3YA 1NNFA 3SDFA 2XX9A 1QW0A 1B3LA 5BWJA 1VFDA 1SBPA 3TCGA 1QJMA 4LONB 1FQFA 4FORA 2O68A 1TFDA 4G68C 5FHNA 1XHYA 5F24A 2ZZXA 1NUWA 2DVZA 3TYHA 3VDFA 1FQBA 2P3NA 3K1MA 1G0HA 3RQTA 3PUVE 1ZBMA 3MVYA 3ZS6A 1IXHA 4G4PA 5F1QA 4X04A 1B4ZA 1GGGA 4XEQA 1LAXA 3VVEA 1PBQA 4PAIA 1MXVA 4BDOA 4KCDA 1NV7A 2G93A 3VLVA 2HCAA 5EYHA 2Z8DA 3RT8A 4YB7A 3VE1B 2DE2A 3IX1A 5AA4A 2CZIA 3KN7A 3EF7A 4M4GA 2FIXA 3G3KA 5DT6A 2ONRA 3GZGA 3Q29A 5I84A 4ZDMA 2OJTA 1LB9A 3FD3A 3BIHA 1PB9A 2NVUB 3HV1A 1SYHA 4QFNA 5DVIA 3H3GA 1B5IA 4BDMA 4F3PA 1M5BA 1KA0A 3TTKA 2F97A 1LBXA 4P8BA 3OENA 3HFUA 5A5XA 2HFBA 4GXAA 3HHFA 1BK4A 2RF1A 1FBGA 1FPDA 3OO9A 2H98A 3EHSA 4NWCA 4RXLA 4H45A 1NMUA 5I2KB 1JW5A 1TXFA 3SZPA 4LQ2A 4AB6A 1Q1KA 3VXBA 4QF9A 2DSFA 1B6HA 3N94A 3FZVA 5L9OA 1SVXB 3ISPA 4IB2A 4PQJA 1RDYA 1PEBA 4R6KA 1B3HA 4NF4B 3KSXA 1MRPA 3KC0A 1MXWA 1LLSA 4LUBA 2JJKA 2H4IA 3TELA 4EXLA 2R6GE 1B3EA 1M5DA 3S9NC 5ITPA 4ZEDA 4OTEA 5I58A 4NF6B 4XF5A 1RYXA 2KLFA 3FXRA 4N6PA 1FJ6A 2XD3A 4OA4A 1B1XA 4XIGQ 2ZYKA 4IY6A 4ELPA 1EH3A 3MUQA 1IUDA 1MH4A 2PVUA 4MF3A 1SW5A 4FEBA 1HSJA 4GX3A 1PB8A 1YPNA 3R7XA 1OVBA 3O6IA 3WAEA 1MPCA 3LBSA 3MW0A 4RJZA 1P1UA 1B1HA 3E4RA 4PGNA 2F3BA 3MYUA 3K6XA 3MZ9A 2Q74A 2O51A 4IO5A 3EN3A 3K6WA 3C32A 3O28A 3DP6A 5HM4B 4P1LA 2O7IA 1AL3A 3FVOA 2O7UA 2PFZA 1B52A 2DE3A 5B7DA 3PMWA 4EQ9A 1S9TA 2XHDA 4H8IA 5I57B 1FTAA 2DXYA 5ET5A 2F7BA 1ELJA 3IOTA 2XXKA 1QUKA 1BIYA 5A5LA 4PF8A 2CEXA 2Q2CA 4HXVA 4EUOA 4OVSA 4NEDA 3TAJA 3MQ9A 2XWIA 2B3BA 3A3CA 5CI5A 5ELVA 3T93B 4NG7A 3G3GA 3H6TA 5EQAA 2FHYA 2F34A 3IOVA 3PPNA 4P0IA 3C31A 1DTZA 1YYZA 4YU0A 4N6DA 3O2AA 5EHMA 4OHNA 5AA2D 1DSNA 3DM0A 4JVCA 4F29A 4GOTA 4GWZA 1R9QA 5HPQA 1AH5A 1O7TA 1LAGE 4EF2A 1NV3A 1LAHE 4KYSA 3U94A 1IMBA 2HXWA 3U92A 1DCUA 3A09A 2VP1A 2XX7A 3RNNA 5IZZA 2A5TA 3QYTA 4PAKA 4RK9A 4Z0IA 1UQWA 1YAEA 3K02A 4LZ7A 2I58A 3L6HA 2Y7IA 4ZZAA 2DS9A 2H5YA 1FQAA 1EYIA 1RDXA 3PTYA 5IM2A 1NNTA 2CZLA 4MIJA 1XT8A 4X1DA 1NV5A 1OQHA 4RK2A 2Y7RA 4G68A 1JVXA 4F3SA 1NUXA 2ZNSA 4MLVA 5I56B 3MPKA 4O3CA 4ZS9A 4QRZA 2DVCA 1KWHA 4F22A 4GBWA 1RDZA 4EQ7A 3MBPA 1OQGA 3TTNA 2VOZA 4OYVA 2W7YA 3ZKLA 3H4ZA 2B65A 3RGYA 1ZTYA 4F18A 1QKAA 3IORA 3KSJA 3CSBA 2P2AA 1NV4A 3C9HA 2Q9TA 5HBCA 1VFEA 4AB5A 1JEUA 4EQBA 4F2QA 2D3IA 1MDQA 3SERA 3T96B 2REGA 4U22A 4UA8A 4MX6A 1USYH 2QS3A 4XKRA 1FTOA 2I0CA 4H8JA 4JVDA 4OXVA 3LR1A 3ZKKA 4HW8A 3LSLA 1HSLA 1EU8A 4XKPA 4DCXA 2F6PA 3QUFA 3TQLA 4F3GA 3C35A 3W9WA 4H5GA 2DP8A 2XWOA 3E13X 5TPAA 4GF8A 3M3KA 4ZECA 1FQEA 4OETA 4QFKA 2Y7PA 1UTBB 1JEVA 4H6DA 2HAVA 1FBPA 4RPNA 1H44A 3NOHA 1B0HA 4AQ4A 3CR9A 4PETA 3SEXA 5EQ9A 4FEDA 1A55A 4N81A 4QFOA 3KEIA 4HCYA 3G3IA 4I3EA 3S2VA 2V3TA 1B3GA 5M2VA 1DMBA 2GH9A 4H67A 3V5AA 4NAPA 5FHMA 1MXZA 4WEDA 1WDNA 4U21A 1VR5A 2V93A 2QVUA 3JYRA 4GLIA 1IXIA 5I59A 1IXGA 4GX4A 3VV5A 2I48A 4F19A 4FJPA 4HE2A 3C36A 3KN8A 4O7IA 3CFLA 3PPOA 3THIA 4LQ5A 4OERA 1FBDA 3FUZA 4N8GA 4YZZA 3R6UA 4KYDA 4E0XA 4FECA 3D4CA 4GWSA 4ZEFA 5KDTB 1H76A 5FHOA 2QRYA 5H8HB 1JQFA 4ELQA 3D1RA 4G8HA 2QVRA 4YKIA 2RC7A 2KQZA 2QS1A 4U23A 2ZYMA 3D4GA 2I49A 2P0SA 1N84A 1DPEA 4PF6A 1AIVA 1Y20A 2QL3A 2XA5A 1YZ0A 1Y9UA 3G3FA 4DIGA 3QIMA 4GD5A 4U2RA 4YKPA 1OLCA 2I0BA 2O1MA 4IO4A 2R9JA 2D21A 4DI3D 2ALUA 2KR0A 3HN0A 3P7IA 1B5HA 1S50A 3E78A 2Q88A 5AA2A 3SEVA 4G2ZA 2F8DA 1D3KA 3HPIA 3K6VA 3M8UA 4O3AA 4DCYA 2QMWA 2R8TA 2REJA 4ECFA 4Z7EA 1FPGA 3FBPA 1B58A 3RYDA 5I2KA
chains in the Genus database with same CATH topology
1LFIA 4LP2B 5H8SA 1LFGA 4ZE9A 3PUXE 3S9MC 4LZ8A 4RA1A 4QSCA 3CFZA 2UXAA 3PUZE 3V83A 4RPOA 1URGA 4R9GA 1NNKA 2THIA 3G3HA 5H8QA 3B6TA 1UIVA 3OELA 1S7YA 3QAXA 1GTKA 5KCJB 3B6WA 1NH7A 1ZKBA 4JBZA 4OEUA 3RUMA 1JW4A 3LUYA 4GL0A 2NWJA 2Q89A 3IB1A 4DDDA 1MQIA 3FJMA 5CRYA 4LA9A 3DP8A 2F6GA 2ONSA 2V84A 3IAZA 1VSOA 2GFEA 3PMXA 4YMBA 3G3JA 3MVZA 1IIWA 3JV9A 2UYFA 4QSDA 3O66A 4KHZE 2X26A 4DXCA 4YKKA 1POTA 4DLDA 3KGCA 4U4SA 3RTWB 2AL5A 1MPBA 5BUUA 2VGQA 2I3WA 4F1YA 1DPPA 2F5XA 3LSWA 3EHTA 3CG1A 2F78A 1SW4A 3QK6A 2DQVA 4H65A 3CFXA 1R6ZA 4KQPA 5I57A 1LBCA 3OEMA 4K3FA 4H0WA 3K2DA 2YPNA 5AA4B 2DXRA 4G77A 1RKMA 2Z23A 2Z8FA 1B46A 3IOWA 1JNFA 2RCAA 1A7LA 4ISUA 1I6QA 2I3VA 3ODBA 2ONKE 3TCFA 4OFOA 4POXA 2V3UA 5A5XB 4OESA 3WAFA 2DE4A 4NF5A 3U93A 3TEPA 3RTFB 3KOSA 4NF8B 1B7UA 4JSOA 5EYFA 3MZ1A 1Y3QA 3KFMA 1MPDA 1FQCA 5JTYA 3H7MA 3VFJA 3I6VA 2O84X 4MLQA 2FNCA 4QSEA 3RPWA 3IR1A 2RCBA 4R9FA 3DLNA 5H8FB 2I4BA 4OFJA 5JK4A 2XXIA 3SETA 5KZTA 1AMFA 1B3FA 1VE4A 4OQOA 1UTHA 2AL4A 3FXQA 3CVGA 3VLWA 3BBRA 1B51A 4POWA 3VVFA 1CB6A 5DTBA 4JWXA 1P1QA 3HSTA 3HCQA 3TTMA 2QS4A 3FXUA 3K4UA 3N26A 2BJJX 5TP9A 1B32A 5DEXB 5I56A 2OBGA 5H8NB 2E0SA 1MH3A 2V3QA 3OXNA 1FCKA 4UACA 3T9VA 3B6QA 2ABHA 1LCFA 4OFLA 4LVQA 3PV0E 4P11A 3H03A 2O1LA 3FVGA 1MY4A 3OO7A 4PP0A 3RLFE 5L9MA 4BDRA 4R75A 1B9JA 3ILTB 3W9VA 1QULA 3E3KA 2F36A 3K6UA 3H6VA 1GVCA 1Y4CA 2Z22A 1R9LA 4KPTA 3IJXB 4F31B 2RKMA 1SW2A 5CMMA 5LOMA 4F1VA 5IAIA 3MJNA 3SEYA 4KR5A 4ND9A 1MS7A 1MM6A 2HEUA 3C4MA 1YTVA 4PFWA 4R6YA 4LATA 1UIUA 4ZE8A 3V8XB 3PD9A 1Y3NA 1MQHA 4FE8A 3MVWA 3ZSFA 1US4A 1XOCA 2B3FA 3V89B 3O6HA 4YAHX 3BFTA 1OLAA 2Q2AA 4MH5A 3T9HB 4HS7A 1BLFA 5B70A 5I2NB 3PMVA 5TU0A 4YKJA 1L5TA 3KG2A 2O6AA 3FGSA 3FASA 3GBBA 5ITOA 3G7WA 1IITA 3H6UA 3I5OA 4YB6A 2A5TB 1LFHA 1NH8A 2X7PA 4FIMA 4ESWA 3UA8A 2XXRA 3TODA 4OMBA 3VLUA 4JWYA 2F7AA 4HTGA 4DZ1A 4Q30B 1DOTA 1US5A 4DXUA 4ZZEA 3U8QA 4G68B 1QUJA 4QHQA 5L8DA 3U72A 3DP4A 5H8HA 4L17A 1XS5A 3Q27A 4OENA 1MY2A 2YJPA 3S9LC 1Y1ZA 3OSRA 4KI0E 4F1UA 3TFLA 4Q5TA 5CMCA 2PT1A 3CI8A 2DOJA 1LBBA 1YCJA 2Y7KA 2ZYNA 3T66A 4GRKA 3EQ1A 5JEIA 1SDXA 1A8FA 3KN3A 4R73A 3IB0A 1XVXA 4N13A 2ZNUA 1IZ1A 4BDLA 4JXIA 2P1SA 3QXMA 2OWSA 1OVTA 3R26A 3TUSA 4I9DA 3Q25A 4EDPA 1IEJA 1NKXA 3GLBA 3SESA 3OMBA 3OSQA 3N5LA 4XKNA 4IO3A 1N04A 1JVYA 3CG3A 1N3XA 4XXUA 1MQDA 5TPAB 2ZYOA 1URDA 2UVGA 1Y1MA 4HCWA 1XC1A 3L6GA 2I4CA 5KCJA 4N07A 2PYYA 1H43A 3E9XA 1WVJA 4GXSB 3UN6A 3UGWA 4F3BA 3VVDA 3UIFA 1MXYA 4OWDA 2DWJA 4IO2A 3FATA 3PPPA 2R71A 1B40A 1ZMGA 2CMOA 1PB7A 1B0LA 1P1NA 3IO6A 3MP8A 5I59B 2RC8A 2H99A 1Z7NE 2XXUA 2Y7WA 1B7ZA 1OIBA 5F7VA 3T22A 4M1VA 4OEVA 1USYE 4IGTA 1Y3PA 1B05A 1NL5A 1FTJA 1URSA 4NF4A 2H25A 2A5SA 2G29A 1Q35A 4GQOA 4MBPA 4ZEKA 2DYXA 2XXVA 4X1BA 2XXXA 1A99A 3PU5A 3C33A 4QFLA 3U1OA 3FVNA 1SYIA 1DTGA 2FYIA 3FJGA 4NF6A 4DE8A 1P1OA 3HO7A 2PT2A 1PBPA 4R74A 2OZZA 4TLLB 4FATA 3PPQA 2OK2A 4RYAA 3LSXA 3K00A 2HZLA 2RINA 5IKBA 5AA2B 4YB5A 3C34A 3AXFA 4X9TA 3CSGA 5J1DA 3TQWA 2XX8A 5K2XA 4R6HA 3SKPA 3MPLA 2F35A 4GL8A 4JDFA 3N6UA 3S4UA 3IB2A 2ZMBA 1A40A 2X7QA 4NF8A 5CBRA 2NXOA 1WODA 4EF1A 4IO7A 1B2HA 1TFAA 2V25A 5ICQA 1P1WA 3O9PA 4I62A 1LAFE 1O63A 4IY5A 2Y84A 2Z8EA 1N0TA 5H8QB 5H8FA 1MDP1 1FW0A 2XXWA 4MFIA 2UVHA 2XXPA 3GXAA 1B5JA 1SI1A 2PMSA 1TWYA 4NWDA 1EZPA 5ISUA 2VHAA 3MZBA 3OO6A 2WKYA 3O6GA 5DEXA 4KCCA 4F39A 1M5EA 2IEEA 5H8NA 5K2YA 3M3FA 4WKMA 4IO6A 1POY1 1M5FA 3JZJA 3OD7A 3PUWE 3UK4A 2YLNA 3PPRA 4PE5B 2OLBA 1NNPA 4Q0CA 3QUJA 3MC2A 1ANFA 3K1PA 1O64A 1MM7A 4U4XA 3TCHA 1PDAA 4ELOA 1RYOA 5DVFA 2HZKA 5L9SA 2QJEA 1QKBA 2XD2A 2LAOA 3IJOB 5CMBA 5I58B 1T0KA 1ZLQA 2FA7A 3K01A 3FVKA 3W15C 4JSDA 1LCTA 5ICTA 4JB7A 4OZ9A 3N6TA 3ONMA 3LC8A 1F9BA 1EZOA 4TOZA 3M3LA 3VXCA 1CE2A 1SD3A 4JWOA 3F11A 1I6BA 3H06B 3H6WA 5CC2A 1N7WA 3GBAA 1FTLA 1EZ9A 2AIXA 4WEPA 4YMAA 3FV1A 4NF5B 3IL1B 4KD5A 2DWAA 3OOAA 1IXCA 2GRVA 3K0VA 4I8CA 1LGBC 2PX1A 1P99A 1B7HA 5I2NA 3DELB 5JTYB 3Q26A 4KYEA 1MXXA 2XXTA 1LSTA 4R2FA 2ANJA 4X48A 4C1TA 1TT1A 2XXQA 4R72A 3CIJA 3SEUA 3ECRA 3O97A 3MWBA 1XVYA 4H5FA 1N7XA 1ZIUA 3RN8A 1Z7ME 4C1UA 1I69A 3T9UA 2QSXA 1UTHB 2Q8JA 2QS2A 4I1DA 4PFTA 4NE4A 1J1NA 3MP6A 4KFQA 4TQUQ 3EHUA 5TP9B 1N76A 1MXUA 3KZGA 2XXHA 4OVJA 4C0RA 1UTBA 1NFTA 4PFYA 3ILUB 1JW1A 4TLMB 3Q28A 3QSLA 3BKIB 1SI0A 3TPAA 2E1SA 1LB8A 1BTJA 1ATGA 2HAUA 5CBSA 1MQJA 3RT6B 3TDJA 3KJ7A 3TTLA 4PFUA 1GR2A 3OO8A 1SQYA 3UP9A 1FQDA 4NTLA 2DWHA 2UVIA 5DYHA 2ZNTA 4ZEBA 3CRBA 3RY3A 3MVXA 4E0WA 4DXBA 1M5CA 3IO4A 3FV2A 3PGFA 3S9EA 3OEKA 1MY1A 5DVJA 4BDQA 5CM6A 3BFUA 5FTHA 1BKAA 2H9BA 4ZEIA 5KDTA 4QFPA 1SW1A 1D9VA 4RY1A 3KJTA 1JETA 1Y4TA 1R1NA 3EPEA 2OWTA 1A8EA 2NUVA 1B4HA 1N3WA 2UVJA 4NMYA 1ZU0A 1MY0A 3TMGA 4THIA 4BDNA 1HSEA 1MQGA 3USDA 5AA1A 1MY3A 2QPQA 3HHGA 1AOVA 3LSFB 2O69A 2UYEA 1IQ7A 4GWOA 2NOOA 3MP1A 4U1ZA 4O3BA 2M8CA 3K1NA 1QUIA 3I3VA 3FJ7A 4U1OA 3SEWA 1I6AA 3TZAA 4RNSA 1MG1A 4P0GA 4ELRA 3FIRA 4F2OA 3KOTA 2GHBA 4GFRA 1GV8A 3T9XB 1D9YA 4BLAA 4XTCQ 1PC3A 3PD8A 4XKQA 5AE4A 4LZ5A 5AA3A 4FAJA 3KBRA 1ZJLA 2AYSA 4H1XA 2VD3A 3TTRA 1A54A 5CMKA 1QVSA 2HQ0A 4YICA 3TKDA 1FTMA 2GHAA 5EHSA 2I6EA 1H45A 2OCUA 4EXKA 3A3UA 2ESNA 1BP5A 2RC9A 4GIZA 4WXJA 4ESXA 1D4NA 3B7DA 1FTKA 1II5A 4R2BA 2VD2A 4IGRA 1OMPA 4Q8RA 3IK6B 2PBWA 2ZXTA 4GVOA 2IA4A 4G8MA 4G8NA 2D5WA 1H3DA 4ONYA 3O29A 3UORA 5FTIA 2QMXA 3PUYE 2XXYA 3MAMA 2DWIA 3IOUA 2F7CA 1NNFA 3SDFA 2XX9A 1QW0A 1B3LA 5BWJA 1VFDA 1SBPA 3TCGA 1QJMA 4LONB 1FQFA 4FORA 2O68A 1TFDA 4G68C 5FHNA 1XHYA 2DVZA 3TYHA 3VDFA 1FQBA 3K1MA 3RQTA 3PUVE 1ZBMA 3MVYA 3ZS6A 1IXHA 4G4PA 5F1QA 1B4ZA 1GGGA 1LAXA 3VVEA 1PBQA 1MXVA 4BDOA 4KCDA 2G93A 3VLVA 2HCAA 2Z8DA 3RT8A 4YB7A 3VE1B 2DE2A 3IX1A 5AA4A 3KN7A 3EF7A 4M4GA 3G3KA 5DT6A 2ONRA 3GZGA 3Q29A 5I84A 4ZDMA 2OJTA 1LB9A 3FD3A 1PB9A 2NVUB 3HV1A 1SYHA 4QFNA 5DVIA 3H3GA 1B5IA 4BDMA 4F3PA 1M5BA 3TTKA 2F97A 3OENA 5A5XA 2HFBA 4GXAA 3HHFA 2RF1A 3OO9A 2H98A 3EHSA 4NWCA 4RXLA 1NMUA 5I2KB 1JW5A 1TXFA 4LQ2A 4AB6A 1Q1KA 3VXBA 4QF9A 2DSFA 1B6HA 3N94A 3FZVA 5L9OA 1SVXB 4IB2A 4PQJA 1PEBA 4R6KA 1B3HA 4NF4B 3KSXA 1MRPA 1MXWA 1LLSA 4LUBA 3TELA 2H4IA 4EXLA 2R6GE 1B3EA 1M5DA 3S9NC 5ITPA 4ZEDA 4OTEA 5I58A 4NF6B 1RYXA 2KLFA 3FXRA 4N6PA 2XD3A 4XIGQ 1B1XA 2ZYKA 4IY6A 4ELPA 1EH3A 3MUQA 1IUDA 1MH4A 2PVUA 4MF3A 1SW5A 4FEBA 1HSJA 1PB8A 1YPNA 3R7XA 1OVBA 3O6IA 3WAEA 1MPCA 3LBSA 3MW0A 4RJZA 1P1UA 1B1HA 3E4RA 3K6XA 3MZ9A 2O51A 4IO5A 3EN3A 3K6WA 3C32A 3O28A 3DP6A 5HM4B 2O7IA 1AL3A 3FVOA 2O7UA 1B52A 2DE3A 5B7DA 3PMWA 4EQ9A 1S9TA 2XHDA 4H8IA 5I57B 2DXYA 2F7BA 1ELJA 3IOTA 1QUKA 1BIYA 2Q2CA 4EUOA 4NEDA 3TAJA 3MQ9A 2B3BA 3A3CA 5CI5A 5ELVA 3T93B 3G3GA 3H6TA 2F34A 3IOVA 3PPNA 4P0IA 3C31A 1DTZA 4YU0A 3O2AA 5EHMA 4OHNA 5AA2D 1DSNA 3DM0A 4F29A 4GOTA 1R9QA 5HPQA 1AH5A 1O7TA 1LAGE 4EF2A 1LAHE 4KYSA 3U94A 2HXWA 3U92A 3A09A 2VP1A 2XX7A 3RNNA 2A5TA 3QYTA 4RK9A 4Z0IA 1UQWA 1YAEA 3K02A 4LZ7A 2I58A 3L6HA 2Y7IA 4ZZAA 2DS9A 2H5YA 1FQAA 1NNTA 2CZLA 1XT8A 4X1DA 1OQHA 4RK2A 2Y7RA 4G68A 1JVXA 4F3SA 2ZNSA 4MLVA 5I56B 3MPKA 4O3CA 4ZS9A 4QRZA 2DVCA 1KWHA 4F22A 4EQ7A 3MBPA 1OQGA 3TTNA 2VOZA 4OYVA 2W7YA 3ZKLA 3H4ZA 2B65A 3RGYA 1ZTYA 4F18A 1QKAA 3IORA 3KSJA 3CSBA 2P2AA 3C9HA 2Q9TA 5HBCA 1VFEA 4AB5A 1JEUA 4EQBA 4F2QA 2D3IA 1MDQA 3SERA 3T96B 2REGA 4U22A 4UA8A 1USYH 2QS3A 4XKRA 1FTOA 2I0CA 4H8JA 4OXVA 3LR1A 3ZKKA 4HW8A 3LSLA 1HSLA 1EU8A 4XKPA 4DCXA 2F6PA 3QUFA 3TQLA 4F3GA 3C35A 3W9WA 4H5GA 2DP8A 3E13X 5TPAA 4GF8A 4ZECA 3M3KA 1FQEA 4OETA 4QFKA 2Y7PA 1UTBB 1JEVA 4H6DA 2HAVA 4RPNA 1H44A 1B0HA 4AQ4A 3CR9A 4PETA 3SEXA 4FEDA 1A55A 4QFOA 3KEIA 4HCYA 3G3IA 3S2VA 2V3TA 1B3GA 5M2VA 1DMBA 2GH9A 4H67A 3V5AA 5FHMA 1MXZA 4WEDA 1WDNA 4U21A 1VR5A 2V93A 3JYRA 4GLIA 1IXIA 5I59A 1IXGA 3VV5A 2I48A 4F19A 4FJPA 3C36A 3KN8A 3CFLA 3PPOA 3THIA 4LQ5A 4OERA 3FUZA 4YZZA 3R6UA 4KYDA 4E0XA 4FECA 3D4CA 4ZEFA 5KDTB 1H76A 5FHOA 2QRYA 5H8HB 1JQFA 4ELQA 4G8HA 4YKIA 2RC7A 2QS1A 4U23A 2ZYMA 3D4GA 2I49A 2P0SA 1N84A 1DPEA 1AIVA 1Y20A 2QL3A 1Y9UA 3G3FA 4DIGA 3QIMA 4GD5A 4U2RA 4YKPA 1OLCA 2I0BA 2O1MA 4IO4A 2R9JA 2D21A 2ALUA 3HN0A 3P7IA 1B5HA 1S50A 2Q88A 5AA2A 3SEVA 4G2ZA 2F8DA 1D3KA 3HPIA 3K6VA 3M8UA 4O3AA 4DCYA 2QMWA 2REJA 4ECFA 4Z7EA 1B58A 5I2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFI A;  4LP2 B;  5H8S A;  1LFG A;  4ZE9 A;  3PUX E;  3S9M C;  4LZ8 A;  4RA1 A;  4QSC A;  3CFZ A;  2UXA A;  3PUZ E;  3V83 A;  4RPO A;  1URG A;  4R9G A;  1NNK A;  2THI A;  3G3H A;  5H8Q A;  3B6T A;  1UIV A;  3OEL A;  1S7Y A;  3QAX A;  1GTK A;  5KCJ B;  3B6W A;  1NH7 A;  1ZKB A;  4JBZ A;  4OEU A;  3RUM A;  1JW4 A;  3LUY A;  4GL0 A;  2NWJ A;  2Q89 A;  3IB1 A;  4DDD A;  1MQI A;  3FJM A;  5CRY A;  4LA9 A;  3DP8 A;  2F6G A;  2ONS A;  2V84 A;  3IAZ A;  1VSO A;  2GFE A;  3PMX A;  4YMB A;  3G3J A;  3MVZ A;  1IIW A;  3JV9 A;  2UYF A;  4QSD A;  3O66 A;  4KHZ E;  2X26 A;  4DXC A;  4YKK A;  1POT A;  4DLD A;  3KGC A;  4U4S A;  3RTW B;  2AL5 A;  1MPB A;  5BUU A;  2VGQ A;  2I3W A;  4F1Y A;  1DPP A;  2F5X A;  3LSW A;  3EHT A;  3CG1 A;  2F78 A;  1SW4 A;  3QK6 A;  2DQV A;  4H65 A;  3CFX A;  1R6Z A;  4KQP A;  5I57 A;  1LBC A;  3OEM A;  4K3F A;  4H0W A;  3K2D A;  2YPN A;  5AA4 B;  2DXR A;  4G77 A;  1RKM A;  2Z23 A;  2Z8F A;  1B46 A;  3IOW A;  1JNF A;  2RCA A;  1A7L A;  4ISU A;  1I6Q A;  2I3V A;  3ODB A;  2ONK E;  3TCF A;  4OFO A;  4POX A;  2V3U A;  5A5X B;  4OES A;  3WAF A;  2DE4 A;  4NF5 A;  3U93 A;  3TEP A;  3RTF B;  3KOS A;  4NF8 B;  1B7U A;  4JSO A;  5EYF A;  3MZ1 A;  1Y3Q A;  3KFM A;  1MPD A;  1FQC A;  5JTY A;  3H7M A;  3VFJ A;  3I6V A;  2O84 X;  4MLQ A;  2FNC A;  4QSE A;  3RPW A;  3IR1 A;  2RCB A;  4R9F A;  3DLN A;  5H8F B;  2I4B A;  4OFJ A;  5JK4 A;  2XXI A;  3SET A;  5KZT A;  1AMF A;  1B3F A;  1VE4 A;  4OQO A;  1UTH A;  2AL4 A;  3FXQ A;  3CVG A;  3VLW A;  3BBR A;  1B51 A;  4POW A;  3VVF A;  1CB6 A;  5DTB A;  4JWX A;  1P1Q A;  3HST A;  3HCQ A;  3TTM A;  2QS4 A;  3FXU A;  3K4U A;  3N26 A;  2BJJ X;  5TP9 A;  1B32 A;  5DEX B;  5I56 A;  2OBG A;  5H8N B;  2E0S A;  1MH3 A;  2V3Q A;  3OXN A;  1FCK A;  4UAC A;  3T9V A;  3B6Q A;  2ABH A;  1LCF A;  4OFL A;  4LVQ A;  3PV0 E;  4P11 A;  3H03 A;  2O1L A;  3FVG A;  1MY4 A;  3OO7 A;  4PP0 A;  3RLF E;  5L9M A;  4BDR A;  4R75 A;  1B9J A;  3ILT B;  3W9V A;  1QUL A;  3E3K A;  2F36 A;  3K6U A;  3H6V A;  1GVC A;  1Y4C A;  2Z22 A;  1R9L A;  4KPT A;  3IJX B;  4F31 B;  2RKM A;  1SW2 A;  5CMM A;  5LOM A;  4F1V A;  5IAI A;  3MJN A;  3SEY A;  4KR5 A;  4ND9 A;  1MS7 A;  1MM6 A;  2HEU A;  3C4M A;  1YTV A;  4PFW A;  4R6Y A;  4LAT A;  1UIU A;  4ZE8 A;  3V8X B;  3PD9 A;  1Y3N A;  1MQH A;  4FE8 A;  3MVW A;  3ZSF A;  1US4 A;  1XOC A;  2B3F A;  3V89 B;  3O6H A;  4YAH X;  3BFT A;  1OLA A;  2Q2A A;  4MH5 A;  3T9H B;  4HS7 A;  1BLF A;  5B70 A;  5I2N B;  3PMV A;  5TU0 A;  4YKJ A;  1L5T A;  3KG2 A;  2O6A A;  3FGS A;  3FAS A;  3GBB A;  5ITO A;  3G7W A;  1IIT A;  3H6U A;  3I5O A;  4YB6 A;  2A5T B;  1LFH A;  1NH8 A;  2X7P A;  4FIM A;  4ESW A;  3UA8 A;  2XXR A;  3TOD A;  4OMB A;  3VLU A;  4JWY A;  2F7A A;  4HTG A;  4DZ1 A;  4Q30 B;  1DOT A;  1US5 A;  4DXU A;  4ZZE A;  3U8Q A;  4G68 B;  1QUJ A;  4QHQ A;  5L8D A;  3U72 A;  3DP4 A;  5H8H A;  4L17 A;  1XS5 A;  3Q27 A;  4OEN A;  1MY2 A;  2YJP A;  3S9L C;  1Y1Z A;  3OSR A;  4KI0 E;  4F1U A;  3TFL A;  4Q5T A;  5CMC A;  2PT1 A;  3CI8 A;  2DOJ A;  1LBB A;  1YCJ A;  2Y7K A;  2ZYN A;  3T66 A;  4GRK A;  3EQ1 A;  5JEI A;  1SDX A;  1A8F A;  3KN3 A;  4R73 A;  3IB0 A;  1XVX A;  4N13 A;  2ZNU A;  1IZ1 A;  4BDL A;  4JXI A;  2P1S A;  3QXM A;  2OWS A;  1OVT A;  3R26 A;  3TUS A;  4I9D A;  3Q25 A;  4EDP A;  1IEJ A;  1NKX A;  3GLB A;  3SES A;  3OMB A;  3OSQ A;  3N5L A;  4XKN A;  4IO3 A;  1N04 A;  1JVY A;  3CG3 A;  1N3X A;  4XXU A;  1MQD A;  5TPA B;  2ZYO A;  1URD A;  2UVG A;  1Y1M A;  4HCW A;  1XC1 A;  3L6G A;  2I4C A;  5KCJ A;  4N07 A;  2PYY A;  1H43 A;  3E9X A;  1WVJ A;  4GXS B;  3UN6 A;  3UGW A;  4F3B A;  3VVD A;  3UIF A;  1MXY A;  4OWD A;  2DWJ A;  4IO2 A;  3FAT A;  3PPP A;  2R71 A;  1B40 A;  1ZMG A;  2CMO A;  1PB7 A;  1B0L A;  1P1N A;  3IO6 A;  3MP8 A;  5I59 B;  2RC8 A;  2H99 A;  1Z7N E;  2XXU A;  2Y7W A;  1B7Z A;  1OIB A;  5F7V A;  3T22 A;  4M1V A;  4OEV A;  1USY E;  4IGT A;  1Y3P A;  1B05 A;  1NL5 A;  1FTJ A;  1URS A;  4NF4 A;  2H25 A;  2A5S A;  2G29 A;  1Q35 A;  4GQO A;  4MBP A;  4ZEK A;  2DYX A;  2XXV A;  4X1B A;  2XXX A;  1A99 A;  3PU5 A;  3C33 A;  4QFL A;  3U1O A;  3FVN A;  1SYI A;  1DTG A;  2FYI A;  3FJG A;  4NF6 A;  4DE8 A;  1P1O A;  3HO7 A;  2PT2 A;  1PBP A;  4R74 A;  2OZZ A;  4TLL B;  4FAT A;  3PPQ A;  2OK2 A;  4RYA A;  3LSX A;  3K00 A;  2HZL A;  2RIN A;  5IKB A;  5AA2 B;  4YB5 A;  3C34 A;  3AXF A;  4X9T A;  3CSG A;  5J1D A;  3TQW A;  2XX8 A;  5K2X A;  4R6H A;  3SKP A;  3MPL A;  2F35 A;  4GL8 A;  4JDF A;  3N6U A;  3S4U A;  3IB2 A;  2ZMB A;  1A40 A;  2X7Q A;  4NF8 A;  5CBR A;  2NXO A;  1WOD A;  4EF1 A;  4IO7 A;  1B2H A;  1TFA A;  2V25 A;  5ICQ A;  1P1W A;  3O9P A;  4I62 A;  1LAF E;  1O63 A;  4IY5 A;  2Y84 A;  2Z8E A;  1N0T A;  5H8Q B;  5H8F A;  1MDP 1;  1FW0 A;  2XXW A;  4MFI A;  2UVH A;  2XXP A;  3GXA A;  1B5J A;  1SI1 A;  2PMS A;  1TWY A;  4NWD A;  1EZP A;  5ISU A;  2VHA A;  3MZB A;  3OO6 A;  2WKY A;  3O6G A;  5DEX A;  4KCC A;  4F39 A;  1M5E A;  2IEE A;  5H8N A;  5K2Y A;  3M3F A;  4WKM A;  4IO6 A;  1POY 1;  1M5F A;  3JZJ A;  3OD7 A;  3PUW E;  3UK4 A;  2YLN A;  3PPR A;  4PE5 B;  2OLB A;  1NNP A;  4Q0C A;  3QUJ A;  3MC2 A;  1ANF A;  3K1P A;  1O64 A;  1MM7 A;  4U4X A;  3TCH A;  1PDA A;  4ELO A;  1RYO A;  5DVF A;  2HZK A;  5L9S A;  2QJE A;  1QKB A;  2XD2 A;  2LAO A;  3IJO B;  5CMB A;  5I58 B;  1T0K A;  1ZLQ A;  2FA7 A;  3K01 A;  3FVK A;  3W15 C;  4JSD A;  1LCT A;  5ICT A;  4JB7 A;  4OZ9 A;  3N6T A;  3ONM A;  3LC8 A;  1F9B A;  1EZO A;  4TOZ A;  3M3L A;  3VXC A;  1CE2 A;  1SD3 A;  4JWO A;  3F11 A;  1I6B A;  3H06 B;  3H6W A;  5CC2 A;  1N7W A;  3GBA A;  1FTL A;  1EZ9 A;  2AIX A;  4WEP A;  4YMA A;  3FV1 A;  4NF5 B;  3IL1 B;  4KD5 A;  2DWA A;  3OOA A;  1IXC A;  2GRV A;  3K0V A;  4I8C A;  1LGB C;  2PX1 A;  1P99 A;  1B7H A;  5I2N A;  3DEL B;  5JTY B;  3Q26 A;  4KYE A;  1MXX A;  2XXT A;  1LST A;  4R2F A;  2ANJ A;  4X48 A;  4C1T A;  1TT1 A;  2XXQ A;  4R72 A;  3CIJ A;  3SEU A;  3ECR A;  3O97 A;  3MWB A;  1XVY A;  4H5F A;  1N7X A;  1ZIU A;  3RN8 A;  1Z7M E;  4C1U A;  1I69 A;  3T9U A;  2QSX A;  1UTH B;  2Q8J A;  2QS2 A;  4I1D A;  4PFT A;  4NE4 A;  1J1N A;  3MP6 A;  4KFQ A;  4TQU Q;  3EHU A;  5TP9 B;  1N76 A;  1MXU A;  3KZG A;  2XXH A;  4OVJ A;  4C0R A;  1UTB A;  1NFT A;  4PFY A;  3ILU B;  1JW1 A;  4TLM B;  3Q28 A;  3QSL A;  3BKI B;  1SI0 A;  3TPA A;  2E1S A;  1LB8 A;  1BTJ A;  1ATG A;  2HAU A;  5CBS A;  1MQJ A;  3RT6 B;  3TDJ A;  3KJ7 A;  3TTL A;  4PFU A;  1GR2 A;  3OO8 A;  1SQY A;  3UP9 A;  1FQD A;  4NTL A;  2DWH A;  2UVI A;  5DYH A;  2ZNT A;  4ZEB A;  3CRB A;  3RY3 A;  3MVX A;  4E0W A;  4DXB A;  1M5C A;  3IO4 A;  3FV2 A;  3PGF A;  3S9E A;  3OEK A;  1MY1 A;  5DVJ A;  4BDQ A;  5CM6 A;  3BFU A;  5FTH A;  1BKA A;  2H9B A;  4ZEI A;  5KDT A;  4QFP A;  1SW1 A;  1D9V A;  4RY1 A;  3KJT A;  1JET A;  1Y4T A;  1R1N A;  3EPE A;  2OWT A;  1A8E A;  2NUV A;  1B4H A;  1N3W A;  2UVJ A;  4NMY A;  1ZU0 A;  1MY0 A;  3TMG A;  4THI A;  4BDN A;  1HSE A;  1MQG A;  3USD A;  5AA1 A;  1MY3 A;  2QPQ A;  3HHG A;  1AOV A;  3LSF B;  2O69 A;  2UYE A;  1IQ7 A;  4GWO A;  2NOO A;  3MP1 A;  4U1Z A;  4O3B A;  2M8C A;  3K1N A;  1QUI A;  3I3V A;  3FJ7 A;  4U1O A;  3SEW A;  1I6A A;  3TZA A;  4RNS A;  1MG1 A;  4P0G A;  4ELR A;  3FIR A;  4F2O A;  3KOT A;  2GHB A;  4GFR A;  1GV8 A;  3T9X B;  1D9Y A;  4BLA A;  4XTC Q;  1PC3 A;  3PD8 A;  4XKQ A;  5AE4 A;  4LZ5 A;  5AA3 A;  4FAJ A;  3KBR A;  1ZJL A;  2AYS A;  4H1X A;  2VD3 A;  3TTR A;  1A54 A;  5CMK A;  1QVS A;  2HQ0 A;  4YIC A;  3TKD A;  1FTM A;  2GHA A;  5EHS A;  2I6E A;  1H45 A;  2OCU A;  4EXK A;  3A3U A;  2ESN A;  1BP5 A;  2RC9 A;  4GIZ A;  4WXJ A;  4ESX A;  1D4N A;  3B7D A;  1FTK A;  1II5 A;  4R2B A;  2VD2 A;  4IGR A;  1OMP A;  4Q8R A;  3IK6 B;  2PBW A;  2ZXT A;  4GVO A;  2IA4 A;  4G8M A;  4G8N A;  2D5W A;  1H3D A;  4ONY A;  3O29 A;  3UOR A;  5FTI A;  2QMX A;  3PUY E;  2XXY A;  3MAM A;  2DWI A;  3IOU A;  2F7C A;  1NNF A;  3SDF A;  2XX9 A;  1QW0 A;  1B3L A;  5BWJ A;  1VFD A;  1SBP A;  3TCG A;  1QJM A;  4LON B;  1FQF A;  4FOR A;  2O68 A;  1TFD A;  4G68 C;  5FHN A;  1XHY A;  2DVZ A;  3TYH A;  3VDF A;  1FQB A;  3K1M A;  3RQT A;  3PUV E;  1ZBM A;  3MVY A;  3ZS6 A;  1IXH A;  4G4P A;  5F1Q A;  1B4Z A;  1GGG A;  1LAX A;  3VVE A;  1PBQ A;  1MXV A;  4BDO A;  4KCD A;  2G93 A;  3VLV A;  2HCA A;  2Z8D A;  3RT8 A;  4YB7 A;  3VE1 B;  2DE2 A;  3IX1 A;  5AA4 A;  3KN7 A;  3EF7 A;  4M4G A;  3G3K A;  5DT6 A;  2ONR A;  3GZG A;  3Q29 A;  5I84 A;  4ZDM A;  2OJT A;  1LB9 A;  3FD3 A;  1PB9 A;  2NVU B;  3HV1 A;  1SYH A;  4QFN A;  5DVI A;  3H3G A;  1B5I A;  4BDM A;  4F3P A;  1M5B A;  3TTK A;  2F97 A;  3OEN A;  5A5X A;  2HFB A;  4GXA A;  3HHF A;  2RF1 A;  3OO9 A;  2H98 A;  3EHS A;  4NWC A;  4RXL A;  1NMU A;  5I2K B;  1JW5 A;  1TXF A;  4LQ2 A;  4AB6 A;  1Q1K A;  3VXB A;  4QF9 A;  2DSF A;  1B6H A;  3N94 A;  3FZV A;  5L9O A;  1SVX B;  4IB2 A;  4PQJ A;  1PEB A;  4R6K A;  1B3H A;  4NF4 B;  3KSX A;  1MRP A;  1MXW A;  1LLS A;  4LUB A;  3TEL A;  2H4I A;  4EXL A;  2R6G E;  1B3E A;  1M5D A;  3S9N C;  5ITP A;  4ZED A;  4OTE A;  5I58 A;  4NF6 B;  1RYX A;  2KLF A;  3FXR A;  4N6P A;  2XD3 A;  4XIG Q;  1B1X A;  2ZYK A;  4IY6 A;  4ELP A;  1EH3 A;  3MUQ A;  1IUD A;  1MH4 A;  2PVU A;  4MF3 A;  1SW5 A;  4FEB A;  1HSJ A;  1PB8 A;  1YPN A;  3R7X A;  1OVB A;  3O6I A;  3WAE A;  1MPC A;  3LBS A;  3MW0 A;  4RJZ A;  1P1U A;  1B1H A;  3E4R A;  3K6X A;  3MZ9 A;  2O51 A;  4IO5 A;  3EN3 A;  3K6W A;  3C32 A;  3O28 A;  3DP6 A;  5HM4 B;  2O7I A;  1AL3 A;  3FVO A;  2O7U A;  1B52 A;  2DE3 A;  5B7D A;  3PMW A;  4EQ9 A;  1S9T A;  2XHD A;  4H8I A;  5I57 B;  2DXY A;  2F7B A;  1ELJ A;  3IOT A;  1QUK A;  1BIY A;  2Q2C A;  4EUO A;  4NED A;  3TAJ A;  3MQ9 A;  2B3B A;  3A3C A;  5CI5 A;  5ELV A;  3T93 B;  3G3G A;  3H6T A;  2F34 A;  3IOV A;  3PPN A;  4P0I A;  3C31 A;  1DTZ A;  4YU0 A;  3O2A A;  5EHM A;  4OHN A;  5AA2 D;  1DSN A;  3DM0 A;  4F29 A;  4GOT A;  1R9Q A;  5HPQ A;  1AH5 A;  1O7T A;  1LAG E;  4EF2 A;  1LAH E;  4KYS A;  3U94 A;  2HXW A;  3U92 A;  3A09 A;  2VP1 A;  2XX7 A;  3RNN A;  2A5T A;  3QYT A;  4RK9 A;  4Z0I A;  1UQW A;  1YAE A;  3K02 A;  4LZ7 A;  2I58 A;  3L6H A;  2Y7I A;  4ZZA A;  2DS9 A;  2H5Y A;  1FQA A;  1NNT A;  2CZL A;  1XT8 A;  4X1D A;  1OQH A;  4RK2 A;  2Y7R A;  4G68 A;  1JVX A;  4F3S A;  2ZNS A;  4MLV A;  5I56 B;  3MPK A;  4O3C A;  4ZS9 A;  4QRZ A;  2DVC A;  1KWH A;  4F22 A;  4EQ7 A;  3MBP A;  1OQG A;  3TTN A;  2VOZ A;  4OYV A;  2W7Y A;  3ZKL A;  3H4Z A;  2B65 A;  3RGY A;  1ZTY A;  4F18 A;  1QKA A;  3IOR A;  3KSJ A;  3CSB A;  2P2A A;  3C9H A;  2Q9T A;  5HBC A;  1VFE A;  4AB5 A;  1JEU A;  4EQB A;  4F2Q A;  2D3I A;  1MDQ A;  3SER A;  3T96 B;  2REG A;  4U22 A;  4UA8 A;  1USY H;  2QS3 A;  4XKR A;  1FTO A;  2I0C A;  4H8J A;  4OXV A;  3LR1 A;  3ZKK A;  4HW8 A;  3LSL A;  1HSL A;  1EU8 A;  4XKP A;  4DCX A;  2F6P A;  3QUF A;  3TQL A;  4F3G A;  3C35 A;  3W9W A;  4H5G A;  2DP8 A;  3E13 X;  5TPA A;  4GF8 A;  4ZEC A;  3M3K A;  1FQE A;  4OET A;  4QFK A;  2Y7P A;  1UTB B;  1JEV A;  4H6D A;  2HAV A;  4RPN A;  1H44 A;  1B0H A;  4AQ4 A;  3CR9 A;  4PET A;  3SEX A;  4FED A;  1A55 A;  4QFO A;  3KEI A;  4HCY A;  3G3I A;  3S2V A;  2V3T A;  1B3G A;  5M2V A;  1DMB A;  2GH9 A;  4H67 A;  3V5A A;  5FHM A;  1MXZ A;  4WED A;  1WDN A;  4U21 A;  1VR5 A;  2V93 A;  3JYR A;  4GLI A;  1IXI A;  5I59 A;  1IXG A;  3VV5 A;  2I48 A;  4F19 A;  4FJP A;  3C36 A;  3KN8 A;  3CFL A;  3PPO A;  3THI A;  4LQ5 A;  4OER A;  3FUZ A;  4YZZ A;  3R6U A;  4KYD A;  4E0X A;  4FEC A;  3D4C A;  4ZEF A;  5KDT B;  1H76 A;  5FHO A;  2QRY A;  5H8H B;  1JQF A;  4ELQ A;  4G8H A;  4YKI A;  2RC7 A;  2QS1 A;  4U23 A;  2ZYM A;  3D4G A;  2I49 A;  2P0S A;  1N84 A;  1DPE A;  1AIV A;  1Y20 A;  2QL3 A;  1Y9U A;  3G3F A;  4DIG A;  3QIM A;  4GD5 A;  4U2R A;  4YKP A;  1OLC A;  2I0B A;  2O1M A;  4IO4 A;  2R9J A;  2D21 A;  2ALU A;  3HN0 A;  3P7I A;  1B5H A;  1S50 A;  2Q88 A;  5AA2 A;  3SEV A;  4G2Z A;  2F8D A;  1D3K A;  3HPI A;  3K6V A;  3M8U A;  4O3A A;  4DCY A;  2QMW A;  2REJ A;  4ECF A;  4Z7E A;  1B58 A;  5I2K A; 
#chains in the Genus database with same CATH topology
 1LFI A;  4LP2 B;  5H8S A;  1LFG A;  4ZE9 A;  3T1B A;  3PUX E;  3S9M C;  4LZ8 A;  4RA1 A;  4QSC A;  3CFZ A;  2BJI A;  4X8R A;  2UXA A;  3PUZ E;  3V83 A;  4RPO A;  1URG A;  4R9G A;  1NNK A;  2THI A;  3G3H A;  5H8Q A;  3B6T A;  1UIV A;  3OEL A;  1S7Y A;  3QAX A;  1GTK A;  5KCJ B;  3B6W A;  4OVP A;  1NH7 A;  4IR8 A;  1ZKB A;  4NF0 A;  4JBZ A;  4OEU A;  3RUM A;  1JW4 A;  3LUY A;  4GL0 A;  2NWJ A;  4PFI A;  2Q89 A;  3IB1 A;  2MKZ A;  1DBZ A;  4DDD A;  1MQI A;  3FJM A;  5CRY A;  4LA9 A;  3DP8 A;  5ET7 A;  2F6G A;  2ONS A;  2V84 A;  4P3L A;  1D9Q A;  3IAZ A;  1VSO A;  2GFE A;  3PMX A;  4YMB A;  3G3J A;  1CNQ A;  3IFC A;  4QXD A;  3MVZ A;  1IIW A;  4P47 A;  3JV9 A;  2UYF A;  2XWV A;  4QSD A;  3O66 A;  4KHZ E;  2X26 A;  4DXC A;  4YKK A;  1POT A;  4DLD A;  3KGC A;  4U4S A;  3RTW B;  2AL5 A;  1MPB A;  5BUU A;  2VGQ A;  2I3W A;  4F1Y A;  1DPP A;  2F5X A;  3LSW A;  3EHT A;  3CG1 A;  2F78 A;  1SW4 A;  2OX3 A;  3QK6 A;  1QGX A;  2DQV A;  4H65 A;  3CFX A;  1R6Z A;  4KQP A;  2VPN A;  5I57 A;  1LBC A;  3OEM A;  4K3F A;  4H0W A;  3K2D A;  2YPN A;  5AA4 B;  1FBE A;  2DXR A;  4G77 A;  3RPL B;  1RKM A;  2Z23 A;  2Z8F A;  1B46 A;  3IOW A;  1JNF A;  2RCA A;  1A7L A;  4ISU A;  2QFL A;  1I6Q A;  2I3V A;  3ODB A;  4GBV A;  2ONK E;  4N17 A;  3TCF A;  4OFO A;  4POX A;  2V3U A;  2DDK A;  4AS5 A;  5A5X B;  4OES A;  3WAF A;  2DE4 A;  4NF5 A;  3U93 A;  3TEP A;  3RTF B;  3KOS A;  2HPG A;  4NF8 B;  1B7U A;  4JSO A;  5EYF A;  3MZ1 A;  4O7M A;  1Y3Q A;  4PDH A;  3KFM A;  1MPD A;  1FQC A;  5JTY A;  2CZK A;  3H7M A;  2Y5L A;  3VFJ A;  2XWK A;  3I6V A;  2O84 X;  4N6K A;  4MLQ A;  2FNC A;  4QSE A;  3RPW A;  3IR1 A;  2RCB A;  4R9F A;  4MMP A;  3DLN A;  3FXB A;  5H8F B;  2I4B A;  4OFJ A;  5JK4 A;  2XXI A;  3SET A;  5KZT A;  1AMF A;  1B3F A;  1FPK A;  1VE4 A;  4MJO A;  4OQO A;  1UTH A;  2AL4 A;  3FXQ A;  3CVG A;  3VLW A;  4QBA A;  3BBR A;  1B51 A;  4POW A;  3VVF A;  1CB6 A;  5DTB A;  4JWX A;  1P1Q A;  3HST A;  3HCQ A;  3TTM A;  4MNP A;  2QS4 A;  3FXU A;  3K4U A;  1KZ8 A;  3N26 A;  2BJJ X;  5TP9 A;  1B32 A;  5DEX B;  5I56 A;  2OBG A;  5H8N B;  1LBV A;  2E0S A;  1MH3 A;  2V3Q A;  3OXN A;  1FCK A;  4UAC A;  3T9V A;  3B6Q A;  1LBY A;  2ABH A;  1LCF A;  2WX9 A;  4OFL A;  4LVQ A;  3PV0 E;  3EKI A;  4P11 A;  3H03 A;  3QMF A;  2P3V A;  3B8B A;  2O1L A;  3FVG A;  2B4M A;  1MY4 A;  3OO7 A;  4MHF A;  4PP0 A;  3RLF E;  5L9M A;  4BDR A;  4R75 A;  1B9J A;  3ILT B;  3W9V A;  1QUL A;  3E3K A;  3GYY A;  2V4C A;  2F36 A;  3K6U A;  3H6V A;  5IZ3 B;  1GVC A;  1Y4C A;  2Z22 A;  1R9L A;  1LBZ A;  4KPT A;  3IJX B;  4F31 B;  2RKM A;  1SW2 A;  1G0I A;  5CMM A;  1NUZ A;  5LOM A;  4F1V A;  5IAI A;  3MJN A;  3SEY A;  1NV6 A;  4KR5 A;  4ND9 A;  1MS7 A;  1MM6 A;  4PGP A;  2Q8M A;  2OWZ A;  2HEU A;  3C4M A;  1YTV A;  4PFW A;  4R6Y A;  4LAT A;  1UIU A;  4XFE A;  4ZE8 A;  3V8X B;  3PD9 A;  1Y3N A;  1MQH A;  4FE8 A;  3MVW A;  3ZSF A;  1US4 A;  1XOC A;  2B3F A;  3V89 B;  3O6H A;  4YAH X;  3BFT A;  3IFA A;  1OLA A;  2Q2A A;  4MH5 A;  3T9H B;  4HS7 A;  1BLF A;  1IMA A;  5B70 A;  5I2N B;  3PMV A;  5TU0 A;  4YKJ A;  1L5T A;  3KG2 A;  2O6A A;  3FGS A;  3FAS A;  3GBB A;  5ITO A;  3G7W A;  2HXR A;  1IIT A;  3H6U A;  3I5O A;  4YB6 A;  2A5T B;  1LFH A;  2QVV A;  1NH8 A;  2X7P A;  4FIM A;  4ESW A;  2FBP A;  3UA8 A;  2XXR A;  3TOD A;  3KC1 A;  4OMB A;  3VLU A;  4JWY A;  2F7A A;  4HTG A;  1FSA A;  4Q30 B;  4DZ1 A;  1DOT A;  1US5 A;  4DXU A;  4ZZE A;  3U8Q A;  2VPO A;  2L5V A;  4G68 B;  5FBP A;  1QUJ A;  2F3D A;  4QHQ A;  5L8D A;  3U72 A;  3DP4 A;  5H8H A;  4L17 A;  1XS5 A;  3Q27 A;  2ZZV A;  4OEN A;  1MY2 A;  2YJP A;  3S9L C;  1Y1Z A;  1AWB A;  4P56 A;  3OSR A;  2ZZW A;  4KI0 E;  4F1U A;  3KBZ A;  2PFY A;  3TFL A;  4Q5T A;  5CMC A;  2PT1 A;  3CI8 A;  4GWW A;  2DOJ A;  1LBB A;  4PBQ A;  1YCJ A;  2Y7K A;  2ZYN A;  3T66 A;  4GRK A;  3EQ1 A;  5JEI A;  1SDX A;  4UAB A;  1A8F A;  3KN3 A;  4MNI A;  4R73 A;  3IB0 A;  1XVX A;  1IMF A;  4N13 A;  2ZNU A;  5I5P A;  1IZ1 A;  4BDL A;  4JXI A;  2P1S A;  3QXM A;  2OWS A;  1OVT A;  3R26 A;  4O8M A;  4OVR A;  3TUS A;  4I9D A;  3Q25 A;  4EDP A;  1IEJ A;  1NKX A;  3GLB A;  3SES A;  3OMB A;  3OSQ A;  3N5L A;  4XKN A;  4IO3 A;  1N04 A;  1JVY A;  3CG3 A;  1N3X A;  4XXU A;  1MQD A;  5TPA B;  2ZYO A;  1URD A;  2UVG A;  1Y1M A;  4HCW A;  1XC1 A;  3L6G A;  5DW8 A;  2I4C A;  5KCJ A;  4N07 A;  2CZH A;  2PYY A;  1H43 A;  3E9X A;  1WVJ A;  4GXS B;  3UN6 A;  3UGW A;  4F3B A;  3VVD A;  3UIF A;  1IMC A;  1MXY A;  4OWD A;  1NV1 A;  2DWJ A;  4IO2 A;  3FAT A;  3PPP A;  2R71 A;  1B40 A;  1ZMG A;  2CMO A;  1PB7 A;  1B0L A;  4AS4 A;  5I3S A;  1P1N A;  1LEV A;  3IO6 A;  3MP8 A;  5I59 B;  2RC8 A;  2H99 A;  1Z7N E;  2XXU A;  2Y7W A;  2HHM A;  1B7Z A;  1OIB A;  2Y5K A;  5F7V A;  2VT5 A;  5ET8 A;  3T22 A;  4M1V A;  4OEV A;  1USY E;  4NQ8 A;  4IGT A;  1Y3P A;  1B05 A;  1NL5 A;  1FTJ A;  4PDD A;  1URS A;  4NF4 A;  2H25 A;  1YXI A;  2A5S A;  2G29 A;  1Q35 A;  4GQO A;  4MBP A;  4ZEK A;  2DYX A;  2XXV A;  5IZ1 A;  4X1B A;  2XXX A;  1A99 A;  3PU5 A;  3C33 A;  4QFL A;  3U1O A;  2WEF A;  3FVN A;  1SYI A;  1DTG A;  2FYI A;  3FJG A;  4NF6 A;  4PE3 A;  4DE8 A;  1P1O A;  3HO7 A;  2PT2 A;  1PBP A;  4R74 A;  2OZZ A;  4TLL B;  4FAT A;  2CEY A;  3PPQ A;  3RPL A;  2OK2 A;  4RYA A;  3LSX A;  3K00 A;  4O94 A;  2HZL A;  4OAN A;  2RIN A;  5IKB A;  1VDW A;  4N15 A;  5AA2 B;  4YB5 A;  3C34 A;  3AXF A;  4NN3 A;  4X9T A;  3CSG A;  5J1D A;  3TQW A;  2XX8 A;  4PBH A;  4LN5 A;  5K2X A;  1FRP A;  4R6H A;  5EQ8 A;  3SKP A;  3MPL A;  2F35 A;  4GL8 A;  4JDF A;  3N6U A;  3S4U A;  3IB2 A;  2ZMB A;  1A40 A;  2X7Q A;  4NF8 A;  5CBR A;  2NXO A;  1WOD A;  4EF1 A;  4IO7 A;  1B2H A;  1FPI A;  4PCD A;  1TFA A;  2V25 A;  5ICQ A;  1P1W A;  3O9P A;  4I62 A;  1LAF E;  1O63 A;  4IY5 A;  2Y84 A;  2Z8E A;  1N0T A;  5H8Q B;  4P1E A;  5H8F A;  1MDP 1;  1FW0 A;  2XXW A;  4MFI A;  2WYK A;  1IMD A;  1FBH A;  2UVH A;  2XXP A;  5I7I A;  3GXA A;  1B5J A;  1FPL A;  1SI1 A;  2PMS A;  1TWY A;  4NWD A;  1FJ9 A;  1EZP A;  5ISU A;  2VHA A;  3MZB A;  3OO6 A;  4PC9 A;  2WKY A;  3O6G A;  4N8Y A;  4FBP A;  5DEX A;  4KCC A;  4F39 A;  1M5E A;  2IEE A;  5H8N A;  5K2Y A;  3M3F A;  4WKM A;  4IO6 A;  1POY 1;  1M5F A;  5T3J A;  3JZJ A;  4NHB A;  3OD7 A;  4H46 A;  3PUW E;  3UK4 A;  2YLN A;  3PPR A;  4PE5 B;  2OLB A;  1NNP A;  4Q0C A;  3QUJ A;  1FPE A;  1ANF A;  3MC2 A;  3K1P A;  1O64 A;  1MM7 A;  4U4X A;  3TCH A;  1PDA A;  4ELO A;  1RYO A;  5DVF A;  2HZK A;  3CHG A;  5L9S A;  2QJE A;  1QKB A;  2XD2 A;  4MCO A;  2LAO A;  5IZ3 A;  3IJO B;  5CMB A;  5I58 B;  1T0K A;  1ZLQ A;  2FA7 A;  3K01 A;  3FVK A;  3W15 C;  4JSD A;  1LCT A;  1FPB A;  5ICT A;  4JB7 A;  2FIE A;  4OZ9 A;  3N6T A;  3ONM A;  3LC8 A;  1F9B A;  1EZO A;  4TOZ A;  3M3L A;  3VXC A;  1CE2 A;  1SD3 A;  4JWO A;  3F11 A;  1I6B A;  3H06 B;  4NGU A;  3H6W A;  5CC2 A;  1N7W A;  3GBA A;  1FTL A;  1EZ9 A;  2AIX A;  4WEP A;  4YMA A;  3FV1 A;  4NF5 B;  3IL1 B;  4KD5 A;  2DWA A;  3OOA A;  1K9Z A;  1IXC A;  2GRV A;  3K0V A;  4I8C A;  1LGB C;  2PX1 A;  1P99 A;  1B7H A;  5I2N A;  3DEL B;  5JTY B;  3Q26 A;  4KYE A;  1MXX A;  2XXT A;  4P9K A;  1LST A;  3T0J A;  4R2F A;  2ANJ A;  4X48 A;  4C1T A;  1TT1 A;  2XXQ A;  4R72 A;  3CIJ A;  3SEU A;  2FVZ A;  1NV2 A;  3ECR A;  3O97 A;  3MWB A;  1XVY A;  4H5F A;  1N7X A;  1ZIU A;  3RN8 A;  1DK4 A;  1Z7M E;  4C1U A;  1I69 A;  3T9U A;  2QSX A;  1UTH B;  2Q8J A;  2QS2 A;  4I1D A;  4DI4 B;  4PFT A;  4NE4 A;  1J1N A;  3MP6 A;  4KFQ A;  4OVT A;  4TQU Q;  1NV0 A;  3ROJ A;  5EYG A;  1INP A;  3E79 A;  3EHU A;  5TP9 B;  3A29 A;  1N76 A;  2GQ1 A;  1MXU A;  3KZG A;  2XXH A;  4OVJ A;  1K9Y A;  4C0R A;  1UTB A;  1NFT A;  4PFY A;  3ILU B;  1JW1 A;  4TLM B;  3Q28 A;  2PCR A;  3U65 A;  3QSL A;  3BKI B;  1SI0 A;  4G61 A;  1FBF A;  3TPA A;  2E1S A;  1LB8 A;  1BTJ A;  1ATG A;  2HAU A;  5LTC A;  4OVQ A;  5CBS A;  1MQJ A;  3RT6 B;  3BIG A;  3TDJ A;  3KJ7 A;  2WYP A;  3TTL A;  4PFU A;  1GR2 A;  3OO8 A;  1SQY A;  3UP9 A;  1FPF A;  1FQD A;  4NTL A;  2DWH A;  2UVI A;  5DYH A;  2ZNT A;  4MNC A;  4ZEB A;  3CRB A;  3RY3 A;  3MVX A;  4E0W A;  4DXB A;  1M5C A;  3IO4 A;  3FV2 A;  3PGF A;  3S9E A;  3OEK A;  1MY1 A;  5DVJ A;  5EQ7 A;  4KXP A;  4BDQ A;  5CM6 A;  3BFU A;  1EYJ A;  5FTH A;  1BKA A;  3MST A;  2H9B A;  4ZEI A;  1LBW A;  5KDT A;  2B4L A;  1XI6 A;  1IME A;  4QFP A;  4PTK A;  1SW1 A;  1D9V A;  4RY1 A;  3KJT A;  1JET A;  4GWU A;  1Y4T A;  1R1N A;  3EPE A;  2OWT A;  1A8E A;  2NUV A;  1B4H A;  1N3W A;  2UVJ A;  4GX6 A;  4NMY A;  1ZU0 A;  1MY0 A;  3TMG A;  4THI A;  4BDN A;  1HSE A;  1MQG A;  3USD A;  5AA1 A;  1MY3 A;  1EYK A;  3B50 A;  2QPQ A;  3HHG A;  5ET6 A;  1AOV A;  1NUY A;  4MEV A;  3LSF B;  2O69 A;  4GWX A;  4PAF A;  2UYE A;  1IQ7 A;  4GWO A;  2NOO A;  3MP1 A;  4U1Z A;  4O3B A;  2M8C A;  3K1N A;  1QUI A;  2WBD A;  3I3V A;  4N91 A;  3FJ7 A;  5ESY A;  4U1O A;  3SEW A;  1I6A A;  3TZA A;  4RNS A;  1MG1 A;  4P0G A;  4ELR A;  3FIR A;  4F2O A;  3KOT A;  2GHB A;  4GFR A;  1GV8 A;  3LV0 A;  4HE1 A;  3T9X B;  1D9Y A;  4BLA A;  4XTC Q;  1PC3 A;  3PD8 A;  4XKQ A;  5AE4 A;  4LZ5 A;  5AA3 A;  4FAJ A;  3KBR A;  2WBB A;  1ZJL A;  2AYS A;  4H1X A;  2VD3 A;  3TTR A;  4GWY A;  1A54 A;  5CMK A;  5J16 A;  1QVS A;  2HQ0 A;  4YIC A;  3TKD A;  1FTM A;  2GHA A;  5EHS A;  5IGA A;  5LDZ A;  2I6E A;  1H45 A;  2OCU A;  4EXK A;  3LUZ A;  4NX1 A;  3A3U A;  1SPI A;  4PFR A;  2ESN A;  1BP5 A;  2RC9 A;  4GIZ A;  4WXJ A;  4ESX A;  1D4N A;  1FBC A;  3B7D A;  1FTK A;  4PFB A;  1II5 A;  4R2B A;  2VD2 A;  4IGR A;  1NI9 A;  4MAG A;  1OMP A;  4Q8R A;  4I40 A;  3IK6 B;  2PBW A;  2ZXT A;  4GVO A;  2IA4 A;  4G8M A;  1KA1 A;  4JVI A;  4G8N A;  1FPJ A;  1Q9D A;  1H3D A;  2D5W A;  4ONY A;  3O29 A;  4N4U A;  3UOR A;  5FTI A;  2QMX A;  3PUY E;  2XXY A;  3MAM A;  4HE0 A;  1JP4 A;  2DWI A;  3IOU A;  2F7C A;  4I3Y A;  1NNF A;  3SDF A;  2XX9 A;  1QW0 A;  1B3L A;  5BWJ A;  1VFD A;  1SBP A;  3TCG A;  1QJM A;  4LON B;  1FQF A;  4FOR A;  2O68 A;  1TFD A;  4G68 C;  5FHN A;  1XHY A;  5F24 A;  2ZZX A;  1NUW A;  2DVZ A;  3TYH A;  3VDF A;  1FQB A;  2P3N A;  3K1M A;  1G0H A;  3RQT A;  3PUV E;  1ZBM A;  3MVY A;  3ZS6 A;  1IXH A;  4G4P A;  5F1Q A;  4X04 A;  1B4Z A;  1GGG A;  4XEQ A;  1LAX A;  3VVE A;  1PBQ A;  4PAI A;  1MXV A;  4BDO A;  4KCD A;  1NV7 A;  2G93 A;  3VLV A;  2HCA A;  5EYH A;  2Z8D A;  3RT8 A;  4YB7 A;  3VE1 B;  2DE2 A;  3IX1 A;  5AA4 A;  2CZI A;  3KN7 A;  3EF7 A;  4M4G A;  2FIX A;  3G3K A;  5DT6 A;  2ONR A;  3GZG A;  3Q29 A;  5I84 A;  4ZDM A;  2OJT A;  1LB9 A;  3FD3 A;  3BIH A;  1PB9 A;  2NVU B;  3HV1 A;  1SYH A;  4QFN A;  5DVI A;  3H3G A;  1B5I A;  4BDM A;  4F3P A;  1M5B A;  1KA0 A;  3TTK A;  2F97 A;  1LBX A;  4P8B A;  3OEN A;  3HFU A;  5A5X A;  2HFB A;  4GXA A;  3HHF A;  1BK4 A;  2RF1 A;  1FBG A;  1FPD A;  3OO9 A;  2H98 A;  3EHS A;  4NWC A;  4RXL A;  4H45 A;  1NMU A;  5I2K B;  1JW5 A;  1TXF A;  3SZP A;  4LQ2 A;  4AB6 A;  1Q1K A;  3VXB A;  4QF9 A;  2DSF A;  1B6H A;  3N94 A;  3FZV A;  5L9O A;  1SVX B;  3ISP A;  4IB2 A;  4PQJ A;  1RDY A;  1PEB A;  4R6K A;  1B3H A;  4NF4 B;  3KSX A;  1MRP A;  3KC0 A;  1MXW A;  1LLS A;  4LUB A;  2JJK A;  2H4I A;  3TEL A;  4EXL A;  2R6G E;  1B3E A;  1M5D A;  3S9N C;  5ITP A;  4ZED A;  4OTE A;  5I58 A;  4NF6 B;  4XF5 A;  1RYX A;  2KLF A;  3FXR A;  4N6P A;  1FJ6 A;  2XD3 A;  4OA4 A;  1B1X A;  4XIG Q;  2ZYK A;  4IY6 A;  4ELP A;  1EH3 A;  3MUQ A;  1IUD A;  1MH4 A;  2PVU A;  4MF3 A;  1SW5 A;  4FEB A;  1HSJ A;  4GX3 A;  1PB8 A;  1YPN A;  3R7X A;  1OVB A;  3O6I A;  3WAE A;  1MPC A;  3LBS A;  3MW0 A;  4RJZ A;  1P1U A;  1B1H A;  3E4R A;  4PGN A;  2F3B A;  3MYU A;  3K6X A;  3MZ9 A;  2Q74 A;  2O51 A;  4IO5 A;  3EN3 A;  3K6W A;  3C32 A;  3O28 A;  3DP6 A;  5HM4 B;  4P1L A;  2O7I A;  1AL3 A;  3FVO A;  2O7U A;  2PFZ A;  1B52 A;  2DE3 A;  5B7D A;  3PMW A;  4EQ9 A;  1S9T A;  2XHD A;  4H8I A;  5I57 B;  1FTA A;  2DXY A;  5ET5 A;  2F7B A;  1ELJ A;  3IOT A;  2XXK A;  1QUK A;  1BIY A;  5A5L A;  4PF8 A;  2CEX A;  2Q2C A;  4HXV A;  4EUO A;  4OVS A;  4NED A;  3TAJ A;  3MQ9 A;  2XWI A;  2B3B A;  3A3C A;  5CI5 A;  5ELV A;  3T93 B;  4NG7 A;  3G3G A;  3H6T A;  5EQA A;  2FHY A;  2F34 A;  3IOV A;  3PPN A;  4P0I A;  3C31 A;  1DTZ A;  1YYZ A;  4YU0 A;  4N6D A;  3O2A A;  5EHM A;  4OHN A;  5AA2 D;  1DSN A;  3DM0 A;  4JVC A;  4F29 A;  4GOT A;  4GWZ A;  1R9Q A;  5HPQ A;  1AH5 A;  1O7T A;  1LAG E;  4EF2 A;  1NV3 A;  1LAH E;  4KYS A;  3U94 A;  1IMB A;  2HXW A;  3U92 A;  1DCU A;  3A09 A;  2VP1 A;  2XX7 A;  3RNN A;  5IZZ A;  2A5T A;  3QYT A;  4PAK A;  4RK9 A;  4Z0I A;  1UQW A;  1YAE A;  3K02 A;  4LZ7 A;  2I58 A;  3L6H A;  2Y7I A;  4ZZA A;  2DS9 A;  2H5Y A;  1FQA A;  1EYI A;  1RDX A;  3PTY A;  5IM2 A;  1NNT A;  2CZL A;  4MIJ A;  1XT8 A;  4X1D A;  1NV5 A;  1OQH A;  4RK2 A;  2Y7R A;  4G68 A;  1JVX A;  4F3S A;  1NUX A;  2ZNS A;  4MLV A;  5I56 B;  3MPK A;  4O3C A;  4ZS9 A;  4QRZ A;  2DVC A;  1KWH A;  4F22 A;  4GBW A;  1RDZ A;  4EQ7 A;  3MBP A;  1OQG A;  3TTN A;  2VOZ A;  4OYV A;  2W7Y A;  3ZKL A;  3H4Z A;  2B65 A;  3RGY A;  1ZTY A;  4F18 A;  1QKA A;  3IOR A;  3KSJ A;  3CSB A;  2P2A A;  1NV4 A;  3C9H A;  2Q9T A;  5HBC A;  1VFE A;  4AB5 A;  1JEU A;  4EQB A;  4F2Q A;  2D3I A;  1MDQ A;  3SER A;  3T96 B;  2REG A;  4U22 A;  4UA8 A;  4MX6 A;  1USY H;  2QS3 A;  4XKR A;  1FTO A;  2I0C A;  4H8J A;  4JVD A;  4OXV A;  3LR1 A;  3ZKK A;  4HW8 A;  3LSL A;  1HSL A;  1EU8 A;  4XKP A;  4DCX A;  2F6P A;  3QUF A;  3TQL A;  4F3G A;  3C35 A;  3W9W A;  4H5G A;  2DP8 A;  2XWO A;  3E13 X;  5TPA A;  4GF8 A;  3M3K A;  4ZEC A;  1FQE A;  4OET A;  4QFK A;  2Y7P A;  1UTB B;  1JEV A;  4H6D A;  2HAV A;  1FBP A;  4RPN A;  1H44 A;  3NOH A;  1B0H A;  4AQ4 A;  3CR9 A;  4PET A;  3SEX A;  5EQ9 A;  4FED A;  1A55 A;  4N81 A;  4QFO A;  3KEI A;  4HCY A;  3G3I A;  4I3E A;  3S2V A;  2V3T A;  1B3G A;  5M2V A;  1DMB A;  2GH9 A;  4H67 A;  3V5A A;  4NAP A;  5FHM A;  1MXZ A;  4WED A;  1WDN A;  4U21 A;  1VR5 A;  2V93 A;  2QVU A;  3JYR A;  4GLI A;  1IXI A;  5I59 A;  1IXG A;  4GX4 A;  3VV5 A;  2I48 A;  4F19 A;  4FJP A;  4HE2 A;  3C36 A;  3KN8 A;  4O7I A;  3CFL A;  3PPO A;  3THI A;  4LQ5 A;  4OER A;  1FBD A;  3FUZ A;  4N8G A;  4YZZ A;  3R6U A;  4KYD A;  4E0X A;  4FEC A;  3D4C A;  4GWS A;  4ZEF A;  5KDT B;  1H76 A;  5FHO A;  2QRY A;  5H8H B;  1JQF A;  4ELQ A;  3D1R A;  4G8H A;  2QVR A;  4YKI A;  2RC7 A;  2KQZ A;  2QS1 A;  4U23 A;  2ZYM A;  3D4G A;  2I49 A;  2P0S A;  1N84 A;  1DPE A;  4PF6 A;  1AIV A;  1Y20 A;  2QL3 A;  2XA5 A;  1YZ0 A;  1Y9U A;  3G3F A;  4DIG A;  3QIM A;  4GD5 A;  4U2R A;  4YKP A;  1OLC A;  2I0B A;  2O1M A;  4IO4 A;  2R9J A;  2D21 A;  4DI3 D;  2ALU A;  2KR0 A;  3HN0 A;  3P7I A;  1B5H A;  1S50 A;  3E78 A;  2Q88 A;  5AA2 A;  3SEV A;  4G2Z A;  2F8D A;  1D3K A;  3HPI A;  3K6V A;  3M8U A;  4O3A A;  4DCY A;  2QMW A;  2R8T A;  2REJ A;  4ECF A;  4Z7E A;  1FPG A;  3FBP A;  1B58 A;  3RYD A;  5I2K A; 
#chains in the Genus database with same CATH homology
 1LFI A;  4LP2 B;  5H8S A;  1LFG A;  4ZE9 A;  3PUX E;  3S9M C;  4LZ8 A;  4RA1 A;  4QSC A;  3CFZ A;  2UXA A;  3PUZ E;  3V83 A;  4RPO A;  1URG A;  4R9G A;  1NNK A;  2THI A;  3G3H A;  5H8Q A;  3B6T A;  1UIV A;  3OEL A;  1S7Y A;  3QAX A;  1GTK A;  5KCJ B;  3B6W A;  1NH7 A;  1ZKB A;  4JBZ A;  4OEU A;  3RUM A;  1JW4 A;  3LUY A;  4GL0 A;  2NWJ A;  2Q89 A;  3IB1 A;  4DDD A;  1MQI A;  3FJM A;  5CRY A;  4LA9 A;  3DP8 A;  2F6G A;  2ONS A;  2V84 A;  3IAZ A;  1VSO A;  2GFE A;  3PMX A;  4YMB A;  3G3J A;  3MVZ A;  1IIW A;  3JV9 A;  2UYF A;  4QSD A;  3O66 A;  4KHZ E;  2X26 A;  4DXC A;  4YKK A;  1POT A;  4DLD A;  3KGC A;  4U4S A;  3RTW B;  2AL5 A;  1MPB A;  5BUU A;  2VGQ A;  2I3W A;  4F1Y A;  1DPP A;  2F5X A;  3LSW A;  3EHT A;  3CG1 A;  2F78 A;  1SW4 A;  3QK6 A;  2DQV A;  4H65 A;  3CFX A;  1R6Z A;  4KQP A;  5I57 A;  1LBC A;  3OEM A;  4K3F A;  4H0W A;  3K2D A;  2YPN A;  5AA4 B;  2DXR A;  4G77 A;  1RKM A;  2Z23 A;  2Z8F A;  1B46 A;  3IOW A;  1JNF A;  2RCA A;  1A7L A;  4ISU A;  1I6Q A;  2I3V A;  3ODB A;  2ONK E;  3TCF A;  4OFO A;  4POX A;  2V3U A;  5A5X B;  4OES A;  3WAF A;  2DE4 A;  4NF5 A;  3U93 A;  3TEP A;  3RTF B;  3KOS A;  4NF8 B;  1B7U A;  4JSO A;  5EYF A;  3MZ1 A;  1Y3Q A;  3KFM A;  1MPD A;  1FQC A;  5JTY A;  3H7M A;  3VFJ A;  3I6V A;  2O84 X;  4MLQ A;  2FNC A;  4QSE A;  3RPW A;  3IR1 A;  2RCB A;  4R9F A;  3DLN A;  5H8F B;  2I4B A;  4OFJ A;  5JK4 A;  2XXI A;  3SET A;  5KZT A;  1AMF A;  1B3F A;  1VE4 A;  4OQO A;  1UTH A;  2AL4 A;  3FXQ A;  3CVG A;  3VLW A;  3BBR A;  1B51 A;  4POW A;  3VVF A;  1CB6 A;  5DTB A;  4JWX A;  1P1Q A;  3HST A;  3HCQ A;  3TTM A;  2QS4 A;  3FXU A;  3K4U A;  3N26 A;  2BJJ X;  5TP9 A;  1B32 A;  5DEX B;  5I56 A;  2OBG A;  5H8N B;  2E0S A;  1MH3 A;  2V3Q A;  3OXN A;  1FCK A;  4UAC A;  3T9V A;  3B6Q A;  2ABH A;  1LCF A;  4OFL A;  4LVQ A;  3PV0 E;  4P11 A;  3H03 A;  2O1L A;  3FVG A;  1MY4 A;  3OO7 A;  4PP0 A;  3RLF E;  5L9M A;  4BDR A;  4R75 A;  1B9J A;  3ILT B;  3W9V A;  1QUL A;  3E3K A;  2F36 A;  3K6U A;  3H6V A;  1GVC A;  1Y4C A;  2Z22 A;  1R9L A;  4KPT A;  3IJX B;  4F31 B;  2RKM A;  1SW2 A;  5CMM A;  5LOM A;  4F1V A;  5IAI A;  3MJN A;  3SEY A;  4KR5 A;  4ND9 A;  1MS7 A;  1MM6 A;  2HEU A;  3C4M A;  1YTV A;  4PFW A;  4R6Y A;  4LAT A;  1UIU A;  4ZE8 A;  3V8X B;  3PD9 A;  1Y3N A;  1MQH A;  4FE8 A;  3MVW A;  3ZSF A;  1US4 A;  1XOC A;  2B3F A;  3V89 B;  3O6H A;  4YAH X;  3BFT A;  1OLA A;  2Q2A A;  4MH5 A;  3T9H B;  4HS7 A;  1BLF A;  5B70 A;  5I2N B;  3PMV A;  5TU0 A;  4YKJ A;  1L5T A;  3KG2 A;  2O6A A;  3FGS A;  3FAS A;  3GBB A;  5ITO A;  3G7W A;  1IIT A;  3H6U A;  3I5O A;  4YB6 A;  2A5T B;  1LFH A;  1NH8 A;  2X7P A;  4FIM A;  4ESW A;  3UA8 A;  2XXR A;  3TOD A;  4OMB A;  3VLU A;  4JWY A;  2F7A A;  4HTG A;  4DZ1 A;  4Q30 B;  1DOT A;  1US5 A;  4DXU A;  4ZZE A;  3U8Q A;  4G68 B;  1QUJ A;  4QHQ A;  5L8D A;  3U72 A;  3DP4 A;  5H8H A;  4L17 A;  1XS5 A;  3Q27 A;  4OEN A;  1MY2 A;  2YJP A;  3S9L C;  1Y1Z A;  3OSR A;  4KI0 E;  4F1U A;  3TFL A;  4Q5T A;  5CMC A;  2PT1 A;  3CI8 A;  2DOJ A;  1LBB A;  1YCJ A;  2Y7K A;  2ZYN A;  3T66 A;  4GRK A;  3EQ1 A;  5JEI A;  1SDX A;  1A8F A;  3KN3 A;  4R73 A;  3IB0 A;  1XVX A;  4N13 A;  2ZNU A;  1IZ1 A;  4BDL A;  4JXI A;  2P1S A;  3QXM A;  2OWS A;  1OVT A;  3R26 A;  3TUS A;  4I9D A;  3Q25 A;  4EDP A;  1IEJ A;  1NKX A;  3GLB A;  3SES A;  3OMB A;  3OSQ A;  3N5L A;  4XKN A;  4IO3 A;  1N04 A;  1JVY A;  3CG3 A;  1N3X A;  4XXU A;  1MQD A;  5TPA B;  2ZYO A;  1URD A;  2UVG A;  1Y1M A;  4HCW A;  1XC1 A;  3L6G A;  2I4C A;  5KCJ A;  4N07 A;  2PYY A;  1H43 A;  3E9X A;  1WVJ A;  4GXS B;  3UN6 A;  3UGW A;  4F3B A;  3VVD A;  3UIF A;  1MXY A;  4OWD A;  2DWJ A;  4IO2 A;  3FAT A;  3PPP A;  2R71 A;  1B40 A;  1ZMG A;  2CMO A;  1PB7 A;  1B0L A;  1P1N A;  3IO6 A;  3MP8 A;  5I59 B;  2RC8 A;  2H99 A;  1Z7N E;  2XXU A;  2Y7W A;  1B7Z A;  1OIB A;  5F7V A;  3T22 A;  4M1V A;  4OEV A;  1USY E;  4IGT A;  1Y3P A;  1B05 A;  1NL5 A;  1FTJ A;  1URS A;  4NF4 A;  2H25 A;  2A5S A;  2G29 A;  1Q35 A;  4GQO A;  4MBP A;  4ZEK A;  2DYX A;  2XXV A;  4X1B A;  2XXX A;  1A99 A;  3PU5 A;  3C33 A;  4QFL A;  3U1O A;  3FVN A;  1SYI A;  1DTG A;  2FYI A;  3FJG A;  4NF6 A;  4DE8 A;  1P1O A;  3HO7 A;  2PT2 A;  1PBP A;  4R74 A;  2OZZ A;  4TLL B;  4FAT A;  3PPQ A;  2OK2 A;  4RYA A;  3LSX A;  3K00 A;  2HZL A;  2RIN A;  5IKB A;  5AA2 B;  4YB5 A;  3C34 A;  3AXF A;  4X9T A;  3CSG A;  5J1D A;  3TQW A;  2XX8 A;  5K2X A;  4R6H A;  3SKP A;  3MPL A;  2F35 A;  4GL8 A;  4JDF A;  3N6U A;  3S4U A;  3IB2 A;  2ZMB A;  1A40 A;  2X7Q A;  4NF8 A;  5CBR A;  2NXO A;  1WOD A;  4EF1 A;  4IO7 A;  1B2H A;  1TFA A;  2V25 A;  5ICQ A;  1P1W A;  3O9P A;  4I62 A;  1LAF E;  1O63 A;  4IY5 A;  2Y84 A;  2Z8E A;  1N0T A;  5H8Q B;  5H8F A;  1MDP 1;  1FW0 A;  2XXW A;  4MFI A;  2UVH A;  2XXP A;  3GXA A;  1B5J A;  1SI1 A;  2PMS A;  1TWY A;  4NWD A;  1EZP A;  5ISU A;  2VHA A;  3MZB A;  3OO6 A;  2WKY A;  3O6G A;  5DEX A;  4KCC A;  4F39 A;  1M5E A;  2IEE A;  5H8N A;  5K2Y A;  3M3F A;  4WKM A;  4IO6 A;  1POY 1;  1M5F A;  3JZJ A;  3OD7 A;  3PUW E;  3UK4 A;  2YLN A;  3PPR A;  4PE5 B;  2OLB A;  1NNP A;  4Q0C A;  3QUJ A;  3MC2 A;  1ANF A;  3K1P A;  1O64 A;  1MM7 A;  4U4X A;  3TCH A;  1PDA A;  4ELO A;  1RYO A;  5DVF A;  2HZK A;  5L9S A;  2QJE A;  1QKB A;  2XD2 A;  2LAO A;  3IJO B;  5CMB A;  5I58 B;  1T0K A;  1ZLQ A;  2FA7 A;  3K01 A;  3FVK A;  3W15 C;  4JSD A;  1LCT A;  5ICT A;  4JB7 A;  4OZ9 A;  3N6T A;  3ONM A;  3LC8 A;  1F9B A;  1EZO A;  4TOZ A;  3M3L A;  3VXC A;  1CE2 A;  1SD3 A;  4JWO A;  3F11 A;  1I6B A;  3H06 B;  3H6W A;  5CC2 A;  1N7W A;  3GBA A;  1FTL A;  1EZ9 A;  2AIX A;  4WEP A;  4YMA A;  3FV1 A;  4NF5 B;  3IL1 B;  4KD5 A;  2DWA A;  3OOA A;  1IXC A;  2GRV A;  3K0V A;  4I8C A;  1LGB C;  2PX1 A;  1P99 A;  1B7H A;  5I2N A;  3DEL B;  5JTY B;  3Q26 A;  4KYE A;  1MXX A;  2XXT A;  1LST A;  4R2F A;  2ANJ A;  4X48 A;  4C1T A;  1TT1 A;  2XXQ A;  4R72 A;  3CIJ A;  3SEU A;  3ECR A;  3O97 A;  3MWB A;  1XVY A;  4H5F A;  1N7X A;  1ZIU A;  3RN8 A;  1Z7M E;  4C1U A;  1I69 A;  3T9U A;  2QSX A;  1UTH B;  2Q8J A;  2QS2 A;  4I1D A;  4PFT A;  4NE4 A;  1J1N A;  3MP6 A;  4KFQ A;  4TQU Q;  3EHU A;  5TP9 B;  1N76 A;  1MXU A;  3KZG A;  2XXH A;  4OVJ A;  4C0R A;  1UTB A;  1NFT A;  4PFY A;  3ILU B;  1JW1 A;  4TLM B;  3Q28 A;  3QSL A;  3BKI B;  1SI0 A;  3TPA A;  2E1S A;  1LB8 A;  1BTJ A;  1ATG A;  2HAU A;  5CBS A;  1MQJ A;  3RT6 B;  3TDJ A;  3KJ7 A;  3TTL A;  4PFU A;  1GR2 A;  3OO8 A;  1SQY A;  3UP9 A;  1FQD A;  4NTL A;  2DWH A;  2UVI A;  5DYH A;  2ZNT A;  4ZEB A;  3CRB A;  3RY3 A;  3MVX A;  4E0W A;  4DXB A;  1M5C A;  3IO4 A;  3FV2 A;  3PGF A;  3S9E A;  3OEK A;  1MY1 A;  5DVJ A;  4BDQ A;  5CM6 A;  3BFU A;  5FTH A;  1BKA A;  2H9B A;  4ZEI A;  5KDT A;  4QFP A;  1SW1 A;  1D9V A;  4RY1 A;  3KJT A;  1JET A;  1Y4T A;  1R1N A;  3EPE A;  2OWT A;  1A8E A;  2NUV A;  1B4H A;  1N3W A;  2UVJ A;  4NMY A;  1ZU0 A;  1MY0 A;  3TMG A;  4THI A;  4BDN A;  1HSE A;  1MQG A;  3USD A;  5AA1 A;  1MY3 A;  2QPQ A;  3HHG A;  1AOV A;  3LSF B;  2O69 A;  2UYE A;  1IQ7 A;  4GWO A;  2NOO A;  3MP1 A;  4U1Z A;  4O3B A;  2M8C A;  3K1N A;  1QUI A;  3I3V A;  3FJ7 A;  4U1O A;  3SEW A;  1I6A A;  3TZA A;  4RNS A;  1MG1 A;  4P0G A;  4ELR A;  3FIR A;  4F2O A;  3KOT A;  2GHB A;  4GFR A;  1GV8 A;  3T9X B;  1D9Y A;  4BLA A;  4XTC Q;  1PC3 A;  3PD8 A;  4XKQ A;  5AE4 A;  4LZ5 A;  5AA3 A;  4FAJ A;  3KBR A;  1ZJL A;  2AYS A;  4H1X A;  2VD3 A;  3TTR A;  1A54 A;  5CMK A;  1QVS A;  2HQ0 A;  4YIC A;  3TKD A;  1FTM A;  2GHA A;  5EHS A;  2I6E A;  1H45 A;  2OCU A;  4EXK A;  3A3U A;  2ESN A;  1BP5 A;  2RC9 A;  4GIZ A;  4WXJ A;  4ESX A;  1D4N A;  3B7D A;  1FTK A;  1II5 A;  4R2B A;  2VD2 A;  4IGR A;  1OMP A;  4Q8R A;  3IK6 B;  2PBW A;  2ZXT A;  4GVO A;  2IA4 A;  4G8M A;  4G8N A;  2D5W A;  1H3D A;  4ONY A;  3O29 A;  3UOR A;  5FTI A;  2QMX A;  3PUY E;  2XXY A;  3MAM A;  2DWI A;  3IOU A;  2F7C A;  1NNF A;  3SDF A;  2XX9 A;  1QW0 A;  1B3L A;  5BWJ A;  1VFD A;  1SBP A;  3TCG A;  1QJM A;  4LON B;  1FQF A;  4FOR A;  2O68 A;  1TFD A;  4G68 C;  5FHN A;  1XHY A;  2DVZ A;  3TYH A;  3VDF A;  1FQB A;  3K1M A;  3RQT A;  3PUV E;  1ZBM A;  3MVY A;  3ZS6 A;  1IXH A;  4G4P A;  5F1Q A;  1B4Z A;  1GGG A;  1LAX A;  3VVE A;  1PBQ A;  1MXV A;  4BDO A;  4KCD A;  2G93 A;  3VLV A;  2HCA A;  2Z8D A;  3RT8 A;  4YB7 A;  3VE1 B;  2DE2 A;  3IX1 A;  5AA4 A;  3KN7 A;  3EF7 A;  4M4G A;  3G3K A;  5DT6 A;  2ONR A;  3GZG A;  3Q29 A;  5I84 A;  4ZDM A;  2OJT A;  1LB9 A;  3FD3 A;  1PB9 A;  2NVU B;  3HV1 A;  1SYH A;  4QFN A;  5DVI A;  3H3G A;  1B5I A;  4BDM A;  4F3P A;  1M5B A;  3TTK A;  2F97 A;  3OEN A;  5A5X A;  2HFB A;  4GXA A;  3HHF A;  2RF1 A;  3OO9 A;  2H98 A;  3EHS A;  4NWC A;  4RXL A;  1NMU A;  5I2K B;  1JW5 A;  1TXF A;  4LQ2 A;  4AB6 A;  1Q1K A;  3VXB A;  4QF9 A;  2DSF A;  1B6H A;  3N94 A;  3FZV A;  5L9O A;  1SVX B;  4IB2 A;  4PQJ A;  1PEB A;  4R6K A;  1B3H A;  4NF4 B;  3KSX A;  1MRP A;  1MXW A;  1LLS A;  4LUB A;  3TEL A;  2H4I A;  4EXL A;  2R6G E;  1B3E A;  1M5D A;  3S9N C;  5ITP A;  4ZED A;  4OTE A;  5I58 A;  4NF6 B;  1RYX A;  2KLF A;  3FXR A;  4N6P A;  2XD3 A;  4XIG Q;  1B1X A;  2ZYK A;  4IY6 A;  4ELP A;  1EH3 A;  3MUQ A;  1IUD A;  1MH4 A;  2PVU A;  4MF3 A;  1SW5 A;  4FEB A;  1HSJ A;  1PB8 A;  1YPN A;  3R7X A;  1OVB A;  3O6I A;  3WAE A;  1MPC A;  3LBS A;  3MW0 A;  4RJZ A;  1P1U A;  1B1H A;  3E4R A;  3K6X A;  3MZ9 A;  2O51 A;  4IO5 A;  3EN3 A;  3K6W A;  3C32 A;  3O28 A;  3DP6 A;  5HM4 B;  2O7I A;  1AL3 A;  3FVO A;  2O7U A;  1B52 A;  2DE3 A;  5B7D A;  3PMW A;  4EQ9 A;  1S9T A;  2XHD A;  4H8I A;  5I57 B;  2DXY A;  2F7B A;  1ELJ A;  3IOT A;  1QUK A;  1BIY A;  2Q2C A;  4EUO A;  4NED A;  3TAJ A;  3MQ9 A;  2B3B A;  3A3C A;  5CI5 A;  5ELV A;  3T93 B;  3G3G A;  3H6T A;  2F34 A;  3IOV A;  3PPN A;  4P0I A;  3C31 A;  1DTZ A;  4YU0 A;  3O2A A;  5EHM A;  4OHN A;  5AA2 D;  1DSN A;  3DM0 A;  4F29 A;  4GOT A;  1R9Q A;  5HPQ A;  1AH5 A;  1O7T A;  1LAG E;  4EF2 A;  1LAH E;  4KYS A;  3U94 A;  2HXW A;  3U92 A;  3A09 A;  2VP1 A;  2XX7 A;  3RNN A;  2A5T A;  3QYT A;  4RK9 A;  4Z0I A;  1UQW A;  1YAE A;  3K02 A;  4LZ7 A;  2I58 A;  3L6H A;  2Y7I A;  4ZZA A;  2DS9 A;  2H5Y A;  1FQA A;  1NNT A;  2CZL A;  1XT8 A;  4X1D A;  1OQH A;  4RK2 A;  2Y7R A;  4G68 A;  1JVX A;  4F3S A;  2ZNS A;  4MLV A;  5I56 B;  3MPK A;  4O3C A;  4ZS9 A;  4QRZ A;  2DVC A;  1KWH A;  4F22 A;  4EQ7 A;  3MBP A;  1OQG A;  3TTN A;  2VOZ A;  4OYV A;  2W7Y A;  3ZKL A;  3H4Z A;  2B65 A;  3RGY A;  1ZTY A;  4F18 A;  1QKA A;  3IOR A;  3KSJ A;  3CSB A;  2P2A A;  3C9H A;  2Q9T A;  5HBC A;  1VFE A;  4AB5 A;  1JEU A;  4EQB A;  4F2Q A;  2D3I A;  1MDQ A;  3SER A;  3T96 B;  2REG A;  4U22 A;  4UA8 A;  1USY H;  2QS3 A;  4XKR A;  1FTO A;  2I0C A;  4H8J A;  4OXV A;  3LR1 A;  3ZKK A;  4HW8 A;  3LSL A;  1HSL A;  1EU8 A;  4XKP A;  4DCX A;  2F6P A;  3QUF A;  3TQL A;  4F3G A;  3C35 A;  3W9W A;  4H5G A;  2DP8 A;  3E13 X;  5TPA A;  4GF8 A;  4ZEC A;  3M3K A;  1FQE A;  4OET A;  4QFK A;  2Y7P A;  1UTB B;  1JEV A;  4H6D A;  2HAV A;  4RPN A;  1H44 A;  1B0H A;  4AQ4 A;  3CR9 A;  4PET A;  3SEX A;  4FED A;  1A55 A;  4QFO A;  3KEI A;  4HCY A;  3G3I A;  3S2V A;  2V3T A;  1B3G A;  5M2V A;  1DMB A;  2GH9 A;  4H67 A;  3V5A A;  5FHM A;  1MXZ A;  4WED A;  1WDN A;  4U21 A;  1VR5 A;  2V93 A;  3JYR A;  4GLI A;  1IXI A;  5I59 A;  1IXG A;  3VV5 A;  2I48 A;  4F19 A;  4FJP A;  3C36 A;  3KN8 A;  3CFL A;  3PPO A;  3THI A;  4LQ5 A;  4OER A;  3FUZ A;  4YZZ A;  3R6U A;  4KYD A;  4E0X A;  4FEC A;  3D4C A;  4ZEF A;  5KDT B;  1H76 A;  5FHO A;  2QRY A;  5H8H B;  1JQF A;  4ELQ A;  4G8H A;  4YKI A;  2RC7 A;  2QS1 A;  4U23 A;  2ZYM A;  3D4G A;  2I49 A;  2P0S A;  1N84 A;  1DPE A;  1AIV A;  1Y20 A;  2QL3 A;  1Y9U A;  3G3F A;  4DIG A;  3QIM A;  4GD5 A;  4U2R A;  4YKP A;  1OLC A;  2I0B A;  2O1M A;  4IO4 A;  2R9J A;  2D21 A;  2ALU A;  3HN0 A;  3P7I A;  1B5H A;  1S50 A;  2Q88 A;  5AA2 A;  3SEV A;  4G2Z A;  2F8D A;  1D3K A;  3HPI A;  3K6V A;  3M8U A;  4O3A A;  4DCY A;  2QMW A;  2REJ A;  4ECF A;  4Z7E A;  1B58 A;  5I2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...