3MC2A

Crystal structure of the murine inhibitor of carbonic anhydrase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
679
structure length
675
Chain Sequence
EKTIRWCVVSDHEATKCSSFRDNMKKVLPAGGPAVTCVRKMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYYGSKDDPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETAAATFFSSSCVPCADGKMFPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVSFVKHLTVFEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDSIQELLRVAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKIDISLYLGYEFLSAFRNLKRSQRVKWCAVGQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEADAMSLDGGFAYVAGHCGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVGITWKSLQGKKSCHTAVGTSEGWNVPMGLIYDQTGSCKFDAFFSRSCAPGSDPDSPLCALCVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGLKHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSAKDLLFSDDTECLSNLQDKTTYKTYLGPQYLTLMDNFRQCLSSELLDACTFHKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Inhibitor of Carbonic Anhydrase
publication title The structure and evolution of the murine inhibitor of carbonic anhydrase: A member of the transferrin superfamily.
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase inhibitor
total genus 154
structure length 675
sequence length 679
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A03
3TCHA 4X48A 5AE4A 4P0GA 1B1HA 1N04A 3M3KA 4EDPA 2REGA 3JYRA 1SI0A 2H5YA 1EZOA 3G3KA 3IOUA 4F1UA 1N84A 4KYDA 5DVIA 2UYFA 2BJJX 2UVJA 4YZZA 3DELB 4F18A 3HHFA 3Q25A 3I6VA 2QS4A 3IB2A 3AXFA 1B5HA 4F22A 1BIYA 4DXBA 4IO5A 4TLLB 3FXQA 3QYTA 4PFYA 4ZZAA 2ZYNA 4POXA 2I49A 4C1TA 2THIA 1LAGE 1MDP1 3IB1A 1D9VA 5KCJA 3MZ9A 2I4BA 3OSRA 4QHQA 2VGQA 2VOZA 3S2VA 3WAFA 3N94A 3C4MA 1SDXA 5TU0A 3EHSA 3FUZA 3LC8A 5CRYA 3PD8A 5K2XA 3DM0A 1CE2A 3LR1A 1DPPA 4R72A 1MS7A 2DE3A 3KN7A 1WDNA 5FHMA 3THIA 1MPBA 3CSBA 2ZNUA 1H3DA 1M5DA 5FHOA 4F3PA 1B5IA 1H45A 3ZS6A 5CBRA 4LZ8A 5TP9A 1SQYA 3FD3A 3QXMA 2QMWA 4POWA 3N6TA 2UVIA 2NXOA 4R75A 1TXFA 3CR9A 3IJOB 4XKQA 4RK9A 2OK2A 1Z7NE 1HSLA 2Y7WA 4QFKA 3MVZA 4H1XA 1MXVA 1DMBA 1SW5A 4R73A 3MJNA 3Q27A 1XHYA 2NWJA 3V89B 1CB6A 1AH5A 2D5WA 4RY1A 3M3LA 3PPQA 3DLNA 1D9YA 3B6TA 5FTHA 3ODBA 1RYOA 3T9VA 1BTJA 4QFPA 3MPLA 2F5XA 3OEKA 1UIVA 2NUVA 5JTYB 3E4RA 2NVUB 1XC1A 5DEXB 3H6VA 4HS7A 2O1MA 1MQIA 4DCXA 3UIFA 4YU0A 1PC3A 4NF6A 3MQ9A 1POY1 4KCDA 4C0RA 5I58B 3N5LA 4F1VA 3IOVA 3A3UA 1SD3A 4BDMA 1GV8A 3ONMA 1LBCA 1N76A 3FGSA 4R74A 4F1YA 2H99A 4YB6A 1J1NA 3KEIA 1N0TA 2M8CA 3GLBA 4KCCA 1Y20A 5CMKA 2VD3A 4ISUA 2RC7A 4ZZEA 3PUYE 4EQ7A 5HPQA 1JEUA 3RTWB 3H4ZA 5CI5A 2WKYA 4RA1A 2O68A 1Y3NA 3PUWE 1B7HA 3K0VA 4RK2A 2ONSA 1PB8A 4TLMB 1WODA 5H8NB 4YKKA 1B52A 1L5TA 4YB7A 3M3FA 2XD2A 3OO8A 4BDRA 4YAHX 2NOOA 5I2KB 1ANFA 4KYSA 1NH7A 3ILUB 1NNFA 4Q8RA 4ELPA 4MF3A 1O63A 3OXNA 3FVNA 3QUJA 3VV5A 3PD9A 3SERA 3FV2A 1A54A 4NEDA 4EUOA 3C35A 1MY2A 4OVJA 3W9WA 1QKBA 4NF5A 1JW5A 3VXCA 3EPEA 3K1NA 3PMWA 3KOTA 2F78A 1MM7A 3EQ1A 3ZSFA 4Z7EA 4G8NA 1S9TA 1NFTA 3S9LC 2FNCA 3GBAA 1FQFA 3FV1A 4PFWA 5EHMA 1MQJA 1B58A 4NWDA 4IB2A 3EHUA 3OELA 3R7XA 3TCGA 4BDOA 1N7WA 1LB8A 1Y9UA 4GD5A 3IK6B 2Z8EA 4HCWA 1JEVA 4G68A 3SEWA 1AOVA 2QS2A 2D21A 4FJPA 3OOAA 1XVYA 3CFZA 3G3IA 4GL8A 2PT1A 1QUIA 3E9XA 3TODA 1IZ1A 1FTMA 2Y84A 1S7YA 3PPNA 4FIMA 2XXWA 4FECA 4PFTA 3V8XB 4ESXA 5I56A 4BDLA 3IORA 5I2NA 1JW4A 1A55A 4MH5A 3G3HA 4OFLA 3MW0A 1US5A 3T9HB 4HW8A 3A3CA 1JVYA 5F7VA 1I6AA 3KSJA 3TAJA 1FQDA 4JDFA 1OLAA 3C9HA 2PVUA 4G8HA 4G77A 1ZJLA 4AB6A 4PE5B 2F36A 4DZ1A 3PGFA 5ITPA 3I5OA 4FEBA 2YLNA 4NF8A 3U1OA 3LBSA 5FHNA 3UORA 4NMYA 2XHDA 1UQWA 3PV0E 4QSCA 2G93A 3HPIA 1P1NA 1YAEA 2F7AA 3DP6A 3TFLA 3VLUA 4F19A 3OO7A 1IXCA 3UK4A 1VSOA 3T96B 4GF8A 3VVDA 4NF6B 4EXKA 1B9JA 4QF9A 5I57B 3O97A 4OXVA 4PP0A 1LSTA 3CIJA 4TOZA 1B7ZA 3TZAA 3RNNA 1MXUA 3TMGA 2O69A 1SW4A 3PPPA 2B3FA 1URSA 1Y3PA 3K6XA 4JSOA 3MBPA 4H8IA 2CMOA 2Q9TA 3TELA 1I69A 2FA7A 1MQHA 1H43A 1FTOA 4NTLA 1MG1A 5CMMA 3A09A 3OD7A 4JWOA 4ZS9A 4RPNA 1US4A 2V3TA 4GXSB 1Y4TA 5L9OA 1RKMA 5AA2A 4AQ4A 1DTZA 4F3SA 4BDQA 1LLSA 3KN3A 2IA4A 1XOCA 1JVXA 3O6IA 3B6WA 3MZBA 2V93A 3OSQA 1Z7ME 2QSXA 3IO4A 3FXUA 4BLAA 4OYVA 3SKPA 4OETA 3CFLA 4LQ2A 2A5TB 4JXIA 5L8DA 5KDTA 4Q5TA 4GOTA 1NMUA 1B2HA 3D4CA 5JK4A 1KWHA 5F1QA 3JZJA 4XKPA 1POTA 3QAXA 1QUKA 1A7LA 3L6GA 1MM6A 4RYAA 1ZMGA 3HN0A 4ZEKA 3QUFA 3C31A 4H67A 2Q2AA 2PYYA 4G8MA 2Z8FA 2GFEA 2OWSA 1MPCA 1MY1A 1NL5A 3BKIB 4OHNA 2RC8A 4F2OA 4N13A 4YKIA 2XXIA 1XT8A 3B7DA 3MVYA 3KN8A 3FXRA 2ZYKA 2Z8DA 4GFRA 1UIUA 2IEEA 4P11A 2V3QA 3FJMA 1MH4A 4G68B 3FATA 3ZKLA 4KQPA 3C32A 1R9QA 3LUYA 3TEPA 5AA4A 4KD5A 2B65A 3KOSA 4YICA 3OO9A 1MPDA 3U8QA 4U1ZA 4U4SA 3IL1B 1H76A 1M5BA 3KJ7A 4ESWA 1SYHA 4JWYA 3TCFA 3BFUA 5I56B 2ZYMA 3SDFA 4K3FA 3SEXA 2F7CA 1HSJA 5I2NB 1GVCA 4QSEA 2F6GA 1DSNA 2QJEA 1OIBA 4AB5A 3QIMA 2XXRA 4F3GA 3K1MA 2VHAA 5ICQA 2VP1A 2QPQA 5L9SA 2DWJA 1I6BA 2I3WA 3HV1A 4OZ9A 2XX9A 2ABHA 2HCAA 4OESA 1MY4A 3H6UA 3U92A 3GXAA 2XXHA 2XXYA 4KHZE 2QS1A 2QMXA 3IB0A 2YPNA 4G68C 5H8FB 2DSFA 3HHGA 3W15C 1LCTA 1BP5A 2Q89A 4OFJA 1QKAA 3KGCA 2RCBA 1B7UA 2ZNSA 3LSWA 4G2ZA 2O7IA 3IAZA 5H8HB 3FJGA 1NNKA 1P1UA 3H6WA 2XXPA 1B0LA 4DE8A 5A5XA 2XXTA 2ALUA 1OVTA 5H8QB 1O7TA 3G3GA 1SW2A 1B4HA 2X7QA 5I59B 4KI0E 2DE2A 1UTHB 5ITOA 3UP9A 4ZEIA 4FEDA 2XX8A 2I48A 3O28A 1DPEA 3K6UA 2H98A 3CG1A 1OQHA 3RGYA 1IQ7A 2Q8JA 1YTVA 1JW1A 1R1NA 3VLVA 2UVHA 4PQJA 2ZYOA 2RKMA 3K4UA 2RCAA 4KFQA 4OMBA 4F31B 3RN8A 1MXWA 3G3JA 4U4XA 4ZE8A 1EZ9A 3QSLA 3H06B 1VFDA 2OWTA 3PMVA 2Z23A 2VD2A 3RQTA 3H03A 4XKNA 3VVEA 1HSEA 2DOJA 3O66A 1MQDA 2I0CA 1TFAA 2V84A 2HXWA 1PB9A 1QUJA 3OO6A 3SEUA 5CM6A 5KDTB 4ZEDA 3EHTA 3GBBA 1SYIA 5JEIA 4GWOA 4EQBA 1AL3A 1Q35A 3T9XB 4R9GA 1Y1MA 3KSXA 4O3BA 1ELJA 4E0XA 2W7YA 4KR5A 4F2QA 5KCJB 1FQBA 3K02A 4H0WA 4MFIA 5FTIA 3TUSA 4DIGA 4BDNA 4XTCQ 2ONRA 4OTEA 4EXLA 5CC2A 3MPKA 3UA8A 2PMSA 3O6GA 1TFDA 5DTBA 3HCQA 3MP8A 1B3GA 5B70A 3MWBA 4O3CA 2XXVA 3G3FA 2OBGA 2XXXA 3C36A 1OMPA 5TPAA 4N6PA 1IUDA 5EYFA 4I9DA 4QRZA 2DWHA 2GH9A 4ELOA 3S9EA 2UYEA 2I4CA 3TYHA 3D4GA 5AA4B 2HAUA 5TP9B 4LA9A 2ZXTA 3H3GA 4U23A 3KBRA 1P1OA 3CG3A 4I62A 4QFLA 3FVOA 3VDFA 3FJ7A 4P0IA 2GHAA 1Y3QA 4I1DA 3BBRA 2R9JA 2DVCA 5JTYA 4DXCA 1URDA 1VE4A 4ELQA 4R9FA 2E0SA 2QRYA 2HFBA 4YMAA 1DTGA 5DEXA 5J1DA 2Q2CA 3EN3A 3MUQA 4ZEBA 4KPTA 3FIRA 1NH8A 1S50A 5B7DA 5DVFA 4R2BA 4R6YA 5KZTA 3PUVE 5I58A 3MC2A 1T0KA 3Q28A 3S4UA 3VFJA 3OENA 4NE4A 1MY0A 2ZNTA 1B51A 3N26A 3IX1A 4OEUA 4THIA 3U72A 4F29A 4RXLA 4DCYA 2Z22A 4H5FA 1NNTA 4IO7A 4QSDA 4R6KA 3FVGA 3JV9A 1M5EA 4ONYA 3O6HA 3TTRA 1VFEA 1MQGA 1SVXB 1R6ZA 4OENA 4LVQA 3K6WA 3Q26A 3S9NC 4OEVA 4IO6A 1OQGA 4RJZA 4XXUA 4IO2A 1IXIA 1OVBA 1QVSA 5A5XB 2O1LA 4JB7A 3TTMA 5I2KA 3TKDA 1ZBMA 2QL3A 2QS3A 4XKRA 1GTKA 3IOTA 5LOMA 5ICTA 1F9BA 4YKPA 1B0HA 2DWAA 4OERA 2Y7RA 3K01A 2P1SA 1LAXA 3MAMA 3S9MC 1MXZA 4Q0CA 1LFIA 3KFMA 3K1PA 1MDQA 1SI1A 1USYH 1FCKA 4IO3A 4H8JA 1B4ZA 1QW0A 2AIXA 4LP2B 4ZEFA 5AA1A 2O51A 1N7XA 1URGA 1SW1A 2V25A 2X26A 3ZKKA 4IGTA 4XIGQ 4NF5B 4ND9A 5L9MA 3TTKA 1ATGA 3SEYA 1PDAA 1B05A 1MXYA 4I8CA 1PB7A 3HSTA 2PBWA 4U1OA 3LSLA 2HZLA 1D4NA 2ANJA 5HM4B 4RNSA 5K2YA 2DYXA 2O84X 3DP4A 3I3VA 2V3UA 1QJMA 2GHBA 2AYSA 3TTLA 1MH3A 3PPOA 1DOTA 1FTLA 1FQAA 3TQWA 2FYIA 4WEDA 3MVWA 4JSDA 3K2DA 3IOWA 3TDJA 1GGGA 4R2FA 3LSXA 2DE4A 2DWIA 3VXBA 4WEPA 5DYHA 4LUBA 1OLCA 3USDA 1EZPA 2ESNA 3MP6A 1PBPA 4OQOA 1LFGA 4X9TA 3KG2A 4EQ9A 2D3IA 3EF7A 1UTBA 1P1WA 3O2AA 2XX7A 4X1DA 2F8DA 3U93A 2I6EA 4OFOA 2B3BA 2O6AA 1AIVA 1XVXA 3UGWA 1YCJA 4Z0IA 4YMBA 5IAIA 5TPAB 1N3WA 4LATA 4UA8A 1JETA 1B3HA 2DXRA 3RPWA 5IKBA 3H6TA 1RYXA 2DP8A 1FTKA 4PETA 1A8EA 2KLFA 4GVOA 3G7WA 4C1UA 1LCFA 1NNPA 5EHSA 4TQUQ 3T66A 3PUZE 5I84A 2OZZA 1R9LA 3ILTB 3T93B 3E13X 1B46A 2AL5A 2YJPA 4DLDA 4NF4A 5CBSA 4QFOA 1LGBC 2DS9A 4NF8B 1ZIUA 1XS5A 2Q88A 2RF1A 4IY5A 4ZECA 3FASA 2Y7PA 2H25A 1ZTYA 5ISUA 4FATA 1TT1A 3IO6A 5I57A 1SBPA 3IR1A 4LQ5A 5CMBA 3DP8A 4U22A 1FQEA 2XXQA 2HEUA 3L6HA 3V83A 3WAEA 1B3FA 1B1XA 2I0BA 2I58A 3KZGA 3H7MA 1ZU0A 1MY3A 5DVJA 3V5AA 3T22A 4EF2A 4GXAA 2E1SA 3RUMA 4GL0A 1IXHA 1VR5A 1BKAA 1B3LA 5BUUA 2XXUA 4U2RA 3U94A 1B3EA 3RLFE 3OMBA 4H6DA 1PEBA 4UACA 5DT6A 4JWXA 1M5FA 4O3AA 4MBPA 4NWCA 1EU8A 4HTGA 2F97A 1A8FA 2A5SA 1MXXA 2HQ0A 3CFXA 2F35A 1Y1ZA 1NKXA 4OWDA 1LFHA 1LB9A 3MZ1A 1AMFA 3CVGA 5AA2D 1I6QA 5AA2B 2P2AA 2CZLA 2UVGA 3VE1B 2A5TA 3SETA 3VVFA 4MLQA 2OJTA 1EH3A 4ELRA 1JQFA 1LAHE 4GRKA 4LZ7A 1IEJA 1A99A 3PPRA 5M2VA 4FAJA 4JBZA 1Q1KA 1B40A 2H9BA 4GIZA 1JNFA 3FZVA 1IITA 2G29A 1A40A 3GZGA 4N07A 1PBQA 2Y7IA 4HCYA 2X7PA 3M8UA 4DXUA 2HAVA 3CI8A 2O7UA 5CMCA 1Y4CA 3MVXA 1MRPA 4QFNA 2H4IA 3PU5A 1B6HA 1ZKBA 1GR2A 2Y7KA 2LAOA 3P7IA 2PX1A 2REJA 3RT8A 2F34A 3TPAA 4PFUA 4Q30B 3O9PA 1USYE 4GLIA 3N6UA 4RPOA 2I3VA 4M4GA 3Q29A 3IJXB 5ELVA 2PT2A 1H44A 4E0WA 2GRVA 1B32A 3C34A 1FW0A 3MP1A 4LONB 1UTBB 4IGRA 4FORA 4X1BA 1P1QA 4F3BA 2HZKA 3SEVA 3CRBA 3O29A 3E3KA 1YPNA 3CSGA 2UXAA 1M5CA 3QK6A 3HO7A 1N3XA 2ONKE 1TWYA 5HBCA 5AA3A 1D3KA 4M1VA 4WKMA 3TQLA 1LBBA 2OCUA 1IXGA 3T9UA 4F39A 3PMXA 2RINA 4H65A 2R6GE 3OEMA 3SESA 3FVKA 3K00A 3UN6A 2DVZA 5BWJA 1FTJA 5H8FA 2R71A 1QULA 3C33A 2OLBA 3RT6B 4DDDA 4NF4B 3TTNA 2RC9A 1IIWA 3RTFB 3KJTA 2P0SA 4L17A 4ZE9A 4MLVA 1BLFA 4YB5A 1LAFE 4KYEA 4IO4A 2F6PA 5H8HA 3RY3A 1O64A 3R6UA 4H5GA 3B6QA 1B5JA 3K6VA 4LZ5A 4G4PA 5H8QA 2ZMBA 5H8NA 5I59A 1II5A 4GQOA 1UTHA 3R26A 3PUXE 5H8SA 2XD3A 2DQVA 4YKJA 4WXJA 4R6HA 3W9VA 4EF1A 4FE8A 2DXYA 3ECRA 1ZLQA 2F7BA 3BFTA 4ZDMA 2AL4A 4ECFA 4IY6A 4U21A 3VLWA 1FQCA 3F11A 1P99A 3LSFB 1WVJA
chains in the Genus database with same CATH superfamily
3TCHA 4X48A 5AE4A 4P0GA 1B1HA 1N04A 3M3KA 4EDPA 4N81A 5LDZA 2REGA 3JYRA 1SI0A 4PCDA 3GYYA 2H5YA 1EZOA 3G3KA 3MYUA 3IOUA 4F1UA 5EQ9A 1N84A 4KYDA 5DVIA 2UYFA 2BJJX 1FTAA 2UVJA 2VPNA 4QXDA 3QMFA 4YZZA 5EQ8A 3DELB 4F18A 3HHFA 3Q25A 3I6VA 2QS4A 3IB2A 3AXFA 1B5HA 4F22A 1BIYA 4DXBA 4IO5A 4TLLB 3FXQA 3QYTA 4PFYA 4ZZAA 2ZYNA 4N8GA 4POXA 2I49A 4C1TA 2THIA 1LAGE 1MDP1 1FBFA 3IB1A 1D9VA 5KCJA 4MIJA 3MZ9A 2I4BA 3OSRA 1LBVA 4GX6A 4QHQA 2VGQA 2VOZA 3S2VA 3WAFA 2FIEA 3N94A 3C4MA 3RPLA 1SDXA 5TU0A 2XA5A 3EHSA 3FUZA 3LC8A 5CRYA 4MMPA 3PD8A 5K2XA 3DM0A 1CE2A 3LR1A 1DPPA 4R72A 1MS7A 2DE3A 3KN7A 1WDNA 5FHMA 3THIA 1MPBA 3CSBA 2ZNUA 1H3DA 1M5DA 1EYJA 5FHOA 4F3PA 1B5IA 1H45A 3ZS6A 5CBRA 4N4UA 4LZ8A 5TP9A 1SQYA 3FD3A 3QXMA 2QMWA 4POWA 3N6TA 2UVIA 2NXOA 4R75A 1TXFA 3CR9A 3IJOB 4XKQA 4RK9A 2OK2A 1Z7NE 1HSLA 2WX9A 2Y7WA 4QFKA 3MVZA 4H1XA 1MXVA 1DMBA 1SW5A 4R73A 3MJNA 3Q27A 1XHYA 2NWJA 3V89B 1CB6A 2QVUA 4H46A 1AH5A 2D5WA 4RY1A 3M3LA 3PPQA 3DLNA 4O7MA 1D9YA 3B6TA 5FTHA 3ODBA 1RYOA 5EQ7A 3T9VA 1FJ6A 1BTJA 4XF5A 4QFPA 3MPLA 2F5XA 3OEKA 5A5LA 1UIVA 1NUYA 2NUVA 5JTYB 3E4RA 2NVUB 1XC1A 5DEXB 2FVZA 3H6VA 1NV7A 4HS7A 2O1MA 1MQIA 4DCXA 4GBWA 3UIFA 1XI6A 4YU0A 1PC3A 4NF6A 3MQ9A 1POY1 4KCDA 4C0RA 5I58B 3N5LA 4F1VA 5IZZA 3IOVA 3A3UA 5ET8A 1SD3A 4OVSA 4BDMA 1GV8A 3ONMA 1LBCA 1FJ9A 4GWUA 4PFBA 1IMCA 1N76A 3FGSA 4R74A 4F1YA 1KA0A 2H99A 4YB6A 1J1NA 1G0HA 3KEIA 1N0TA 2M8CA 3GLBA 4KCCA 1Y20A 5CMKA 2VD3A 4ISUA 2RC7A 4ZZEA 3PUYE 4EQ7A 5HPQA 4O94A 1QGXA 1JEUA 3RTWB 2ZZXA 3H4ZA 5CI5A 2WKYA 4RA1A 2O68A 1FPEA 1Y3NA 2HPGA 3PUWE 1B7HA 3K0VA 4RK2A 2ONSA 1PB8A 4TLMB 1WODA 5H8NB 4YKKA 1B52A 1L5TA 4YB7A 4N17A 3M3FA 2XD2A 3E79A 2Q74A 3OO8A 4BDRA 4YAHX 2NOOA 5I2KB 1ANFA 3BIGA 2WYPA 4KYSA 1NH7A 3ILUB 1NNFA 4Q8RA 4ELPA 4MF3A 4H45A 1O63A 3OXNA 3FVNA 3QUJA 3VV5A 3PD9A 3SERA 3FV2A 1A54A 4NEDA 4EUOA 2OX3A 4UABA 3C35A 1MY2A 4OVJA 3W9WA 1QKBA 4NF5A 5EYGA 1JW5A 3VXCA 4LN5A 3EPEA 3K1NA 4P1EA 3PMWA 3KOTA 2F78A 1MM7A 3EQ1A 3ZSFA 4Z7EA 4G8NA 1S9TA 4OVPA 3KC0A 1NFTA 1YYZA 4MHFA 3S9LC 2FNCA 3GBAA 5EYHA 1FQFA 4HE1A 3FV1A 4PFWA 5EHMA 1MQJA 1B58A 4NWDA 4IB2A 3EHUA 2FBPA 3OELA 3R7XA 1LBZA 1CNQA 3NOHA 3TCGA 4AS4A 4BDOA 1N7WA 1LB8A 1Y9UA 4GD5A 4OVQA 3IK6B 4HCWA 2Z8EA 1JEVA 4G68A 3SEWA 1AOVA 2QS2A 2D21A 4FJPA 1IMBA 3RPLB 3OOAA 1XVYA 3CFZA 4XEQA 3G3IA 1FPIA 4NG7A 4GL8A 4MX6A 2PT1A 1QUIA 3E9XA 3TODA 4DI4B 1IZ1A 1FTMA 2Y84A 1S7YA 3PPNA 4FIMA 2XXWA 4FECA 4PFTA 3V8XB 4ESXA 5I56A 4BDLA 3IORA 5I2NA 1JW4A 1A55A 4MH5A 3G3HA 4OFLA 3MW0A 1US5A 3T9HB 4HW8A 3A3CA 1JVYA 5F7VA 1I6AA 3KSJA 3TAJA 1FQDA 4JDFA 1OLAA 3C9HA 4MNPA 2PVUA 4G8HA 4G77A 1ZJLA 4AB6A 4PE5B 2F36A 4DZ1A 3PGFA 5ITPA 3I5OA 3ISPA 4FEBA 2YLNA 4NF8A 1FRPA 3U1OA 3LBSA 5FHNA 3UORA 4NMYA 2XHDA 2ZZVA 1UQWA 4P47A 4O8MA 3PV0E 4QSCA 2G93A 3HPIA 1P1NA 1YAEA 2F7AA 3DP6A 3TFLA 3VLUA 4F19A 3OO7A 1IXCA 3UK4A 4NGUA 1VSOA 3T96B 4GF8A 3VVDA 4NF6B 4EXKA 4PFRA 1B9JA 4QF9A 1NUWA 2OWZA 3T1BA 5I57B 3O97A 4OXVA 4PP0A 1LSTA 3CIJA 4N8YA 4TOZA 1B7ZA 5I3SA 3TZAA 3RNNA 1MXUA 3TMGA 2O69A 1SW4A 3PPPA 2B3FA 1URSA 1Y3PA 2WEFA 3K6XA 2CEYA 4JSOA 3MBPA 4H8IA 2CMOA 1NV1A 2Q9TA 3TELA 4I40A 1Q9DA 4O7IA 1I69A 2FA7A 1MQHA 1H43A 1FTOA 4PBHA 4NTLA 1MG1A 5CMMA 3A09A 3OD7A 5IZ3A 4JWOA 4ZS9A 4HXVA 4RPNA 1US4A 2V3TA 4GXSB 1Y4TA 5L9OA 1RKMA 5AA2A 4NN3A 4AQ4A 3CHGA 1FBDA 1DTZA 4F3SA 4BDQA 1LLSA 3KN3A 2IA4A 1XOCA 1JVXA 3O6IA 3B6WA 3MZBA 2V93A 3OSQA 1Z7ME 2QSXA 3IO4A 3FXUA 4BLAA 4OYVA 3SKPA 4OETA 3CFLA 4LQ2A 2A5TB 4JXIA 2PFZA 5L8DA 5KDTA 4Q5TA 4GOTA 1NMUA 1B2HA 3D4CA 5JK4A 1KWHA 5F1QA 4N15A 1NV3A 3JZJA 4XKPA 1POTA 3QAXA 5LTCA 1QUKA 1A7LA 3L6GA 1MM6A 4RYAA 1VDWA 1ZMGA 2CEXA 2Q8MA 3HN0A 4ZEKA 3QUFA 3C31A 4H67A 2Q2AA 2PYYA 4G8MA 2Z8FA 2GFEA 2OWSA 1MPCA 1MY1A 1NL5A 3BKIB 4OHNA 4HE2A 2RC8A 1FPLA 4F2OA 4N13A 4YKIA 2XXIA 1XT8A 3B7DA 3MVYA 3KN8A 3FXRA 2ZYKA 1FPJA 2Z8DA 2B4LA 4GFRA 1UIUA 2IEEA 3MSTA 2XXKA 4P11A 2V3QA 3FJMA 4XFEA 3LV0A 1MH4A 4G68B 3FATA 3ZKLA 4KQPA 3C32A 1R9QA 3LUYA 3TEPA 1AWBA 1FBHA 5AA4A 4GWYA 4KD5A 2B65A 3KOSA 4YICA 3OO9A 1MPDA 3PTYA 3U8QA 4U1ZA 3LUZA 4U4SA 5J16A 3IL1B 1H76A 3BIHA 1M5BA 3KJ7A 4ESWA 4OA4A 1SYHA 4JWYA 3TCFA 3BFUA 5I56B 2ZYMA 3SDFA 4K3FA 3SEXA 2F7CA 1HSJA 5I2NB 1GVCA 4QSEA 2F6GA 1DSNA 2QJEA 1OIBA 4AB5A 2KQZA 1NUZA 3QIMA 2XXRA 4F3GA 3K1MA 2VPOA 2V4CA 2VHAA 5ICQA 2VP1A 2QPQA 5L9SA 2DWJA 1I6BA 2I3WA 2Y5LA 3HV1A 5ET6A 4OZ9A 2XX9A 2ABHA 1FSAA 2HCAA 4OESA 1MY4A 3H6UA 3U92A 3GXAA 2XXHA 2XXYA 4KHZE 2QS1A 2QMXA 5EQAA 3IB0A 2YPNA 4G68C 5H8FB 2DSFA 4PF8A 3HHGA 3W15C 1LCTA 1BP5A 2Q89A 4OFJA 1QKAA 4MNIA 3KGCA 2RCBA 1B7UA 2ZNSA 3LSWA 4G2ZA 2O7IA 2QVRA 3IAZA 5H8HB 3FJGA 1IMFA 1NNKA 1P1UA 3H6WA 2XXPA 1B0LA 1NV4A 4DE8A 5A5XA 2XXTA 2ALUA 1OVTA 1RDYA 5H8QB 1O7TA 3G3GA 1SW2A 1B4HA 2X7QA 3FBPA 5I59B 4KI0E 2DE2A 1UTHB 1FBCA 5ITOA 3UP9A 4GBVA 4ZEIA 4FEDA 4P8BA 2XX8A 2I48A 3O28A 2CZIA 1DPEA 4GX3A 4HE0A 3K6UA 2H98A 4PF6A 3CG1A 1OQHA 4NX1A 3RGYA 1IQ7A 4NAPA 2PFYA 5ESYA 2Q8JA 1YTVA 1JW1A 4PFIA 1R1NA 1FBGA 3VLVA 2UVHA 4PQJA 2ZYOA 2RKMA 2L5VA 2VT5A 1FPFA 3K4UA 2RCAA 4KFQA 4OMBA 4F31B 3RN8A 1MXWA 3G3JA 3RYDA 4U4XA 4ZE8A 1EYKA 1EZ9A 3QSLA 3H06B 1VFDA 2OWTA 2F3BA 3PMVA 2Z23A 2VD2A 2XWIA 3RQTA 3H03A 4XKNA 3VVEA 2WBBA 1HSEA 2DOJA 3O66A 1MQDA 2I0CA 1TFAA 2V84A 2HXWA 1PB9A 1QUJA 3OO6A 3SEUA 5CM6A 5DW8A 5KDTB 4ZEDA 3EHTA 3GBBA 1SYIA 5JEIA 4GWOA 1FBEA 4EQBA 1AL3A 1Q35A 3T9XB 4R9GA 1K9ZA 1Y1MA 4P3LA 3KSXA 4O3BA 1ELJA 4E0XA 2W7YA 3U65A 4KR5A 5ET7A 4F2QA 5KCJB 1FQBA 3K02A 4H0WA 4MFIA 5FTIA 3TUSA 4DIGA 4BDNA 4XTCQ 2ONRA 2XWKA 4OTEA 4EXLA 5CC2A 4P56A 3MPKA 3UA8A 2PMSA 2WBDA 3IFCA 3D1RA 3O6GA 1TFDA 5DTBA 3HCQA 1IMDA 3MP8A 3EKIA 1B3GA 5B70A 3MWBA 4O3CA 2Y5KA 2XXVA 3G3FA 2OBGA 2XXXA 3C36A 1OMPA 5TPAA 4N6PA 1IUDA 5EYFA 4I9DA 4QRZA 2DWHA 2GH9A 4ELOA 3S9EA 2UYEA 2I4CA 3TYHA 3D4GA 5AA4B 2HAUA 1NV5A 5TP9B 4LA9A 2ZXTA 4U23A 3H3GA 3KBRA 1P1OA 4NHBA 2B4MA 3CG3A 4I62A 4QFLA 3FVOA 4GWXA 3VDFA 3FJ7A 4P0IA 4MCOA 2GHAA 1Y3QA 4I1DA 3BBRA 3SZPA 2GQ1A 2R9JA 2DVCA 5JTYA 4DXCA 1URDA 1VE4A 4ELQA 4R9FA 2E0SA 4N6DA 2QRYA 2HFBA 4YMAA 1DTGA 5DEXA 5J1DA 2Q2CA 1FBPA 4PAFA 3EN3A 3MUQA 4ZEBA 4KPTA 3FIRA 1NH8A 1BK4A 1S50A 5B7DA 5DVFA 1LEVA 4R2BA 4R6YA 5KZTA 3PUVE 5I58A 3MC2A 1T0KA 2FIXA 3Q28A 3S4UA 3VFJA 3OENA 4NE4A 1MY0A 2ZNTA 1B51A 4QBAA 4NF0A 3N26A 2P3NA 1IMAA 1NV2A 3IX1A 4OEUA 4THIA 5ET5A 3U72A 4P9KA 3IFAA 4F29A 4RXLA 4DCYA 2Z22A 4H5FA 1NNTA 4IO7A 4QSDA 4R6KA 3FVGA 2HHMA 3JV9A 1M5EA 4ONYA 3O6HA 3TTRA 1VFEA 1G0IA 4GWSA 1MQGA 1SVXB 1R6ZA 4OENA 4LVQA 4IR8A 3K6WA 1DBZA 3Q26A 3S9NC 4OEVA 4IO6A 1OQGA 4MAGA 4RJZA 4XXUA 4PDDA 4IO2A 1IXIA 1OVBA 1NV0A 1QVSA 5A5XB 4X8RA 3ROJA 1YXIA 2O1LA 4JB7A 3TTMA 5I2KA 3TKDA 1ZBMA 2QL3A 2QS3A 4XKRA 1GTKA 3IOTA 5LOMA 5ICTA 1F9BA 4YKPA 4KXPA 2R8TA 5IM2A 1B0HA 2DWAA 4OERA 2Y7RA 3K01A 2P1SA 1LAXA 3MAMA 3S9MC 4JVCA 1MXZA 4Q0CA 1LFIA 3KFMA 3K1PA 1MDQA 1SI1A 1USYH 4PAIA 1FCKA 4IO3A 4H8JA 1B4ZA 1QW0A 2AIXA 4LP2B 4MJOA 4ZEFA 5AA1A 2O51A 1N7XA 1URGA 1SW1A 2V25A 2X26A 3ZKKA 4IGTA 4XIGQ 4NF5B 4ND9A 5L9MA 3TTKA 1ATGA 3SEYA 1PDAA 4JVIA 1B05A 1MXYA 4I8CA 5I7IA 2QFLA 1PB7A 3HSTA 2PBWA 4U1OA 3LSLA 2HZLA 1D4NA 2ANJA 5HM4B 4RNSA 5F24A 5K2YA 2DYXA 2O84X 3DP4A 3I3VA 2V3UA 1QJMA 2GHBA 2AYSA 3FXBA 3TTLA 1MH3A 3PPOA 1DOTA 1FTLA 1FQAA 3TQWA 2FYIA 4WEDA 3MVWA 4JSDA 2CZKA 3K2DA 3IOWA 3TDJA 4PBQA 1GGGA 4R2FA 3LSXA 4PAKA 2DE4A 2DWIA 3VXBA 4WEPA 5DYHA 4LUBA 1OLCA 3USDA 1DCUA 1KA1A 1EZPA 2ESNA 3MP6A 1PBPA 4OQOA 1LFGA 4X9TA 3KG2A 4EQ9A 2D3IA 3A29A 3EF7A 1UTBA 4X04A 1P1WA 3O2AA 2XX7A 4X1DA 2F8DA 3U93A 2I6EA 4OFOA 2B3BA 2O6AA 1AIVA 1XVXA 3UGWA 1YCJA 4Z0IA 4YMBA 4OANA 4GWWA 5IAIA 5TPAB 1N3WA 4LATA 4UA8A 4DI3D 2CZHA 1JETA 1B3HA 1NUXA 1DK4A 2DXRA 3RPWA 5IKBA 3H6TA 1RYXA 2DP8A 1FTKA 4P1LA 4PETA 1A8EA 4FBPA 2KLFA 4GVOA 3G7WA 4C1UA 1LCFA 1FPKA 1NNPA 5EHSA 4TQUQ 3T66A 3PUZE 5I84A 2OZZA 1R9LA 4PGNA 3ILTB 3T93B 3E13X 1B46A 2AL5A 2YJPA 4DLDA 5IZ1A 4NF4A 5CBSA 4QFOA 1LGBC 2DS9A 4NF8B 4MEVA 3E78A 1ZIUA 1XS5A 2Q88A 5I5PA 2RF1A 4IY5A 4ZECA 4OVRA 3FASA 4I3EA 2Y7PA 1K9YA 2H25A 2DDKA 5T3JA 1ZTYA 1SPIA 5ISUA 2PCRA 4FATA 1TT1A 3IO6A 1JP4A 5I57A 1SBPA 3T0JA 3IR1A 4LQ5A 5CMBA 2FHYA 3DP8A 4U22A 1FQEA 3HFUA 2JJKA 2HEUA 2XXQA 3L6HA 3V83A 2XWOA 3WAEA 1RDZA 1B3FA 2MKZA 1B1XA 2I0BA 2I58A 3KZGA 3H7MA 1ZU0A 1MY3A 2KR0A 5DVJA 3V5AA 3T22A 4EF2A 4GXAA 4PDHA 2E1SA 3RUMA 4GL0A 1IXHA 1VR5A 1BKAA 1B3LA 5BUUA 2XXUA 4U2RA 1FPGA 3U94A 1B3EA 3RLFE 1FPDA 3OMBA 4H6DA 1PEBA 4UACA 5DT6A 4JWXA 1M5FA 4O3AA 4MBPA 4OVTA 4NWCA 1EU8A 4HTGA 2F97A 1A8FA 4N91A 2A5SA 5IZ3B 1MXXA 4PGPA 2HQ0A 3CFXA 2F35A 1Y1ZA 1NKXA 4OWDA 1LFHA 4GWZA 1LB9A 4N6KA 3MZ1A 1AMFA 3CVGA 5AA2D 1I6QA 5AA2B 4GX4A 1LBXA 2P2AA 2CZLA 2UVGA 3VE1B 2A5TA 3SETA 3VVFA 1FPBA 4MLQA 2OJTA 1EH3A 4ELRA 1JQFA 1LAHE 4GRKA 4PTKA 4LZ7A 1IEJA 1A99A 3PPRA 5M2VA 3KBZA 4FAJA 4JBZA 1Q1KA 1B40A 2H9BA 2BJIA 4GIZA 1JNFA 3FZVA 1IITA 2G29A 1A40A 3GZGA 4N07A 1PBQA 2Y7IA 4HCYA 4NQ8A 2X7PA 2F3DA 3M8UA 4DXUA 2HAVA 3CI8A 2O7UA 5CMCA 1Y4CA 3MVXA 4PC9A 4MNCA 1MRPA 4QFNA 1EYIA 2H4IA 1D9QA 4JVDA 3PU5A 1B6HA 1ZKBA 1GR2A 2Y7KA 2LAOA 3P7IA 2PX1A 2REJA 3RT8A 2F34A 3TPAA 2P3VA 3B8BA 4PFUA 4Q30B 3KC1A 3O9PA 1USYE 4GLIA 3N6UA 4RPOA 2I3VA 1YZ0A 4M4GA 3Q29A 3IJXB 5ELVA 2PT2A 1H44A 4E0WA 4G61A 2GRVA 1B32A 3C34A 4PE3A 1IMEA 1FW0A 3MP1A 4LONB 1UTBB 4IGRA 4FORA 1LBYA 4X1BA 1P1QA 4F3BA 2HZKA 4I3YA 3SEVA 3CRBA 3O29A 3E3KA 1YPNA 3CSGA 2UXAA 1NV6A 1M5CA 3QK6A 3HO7A 1N3XA 2ONKE 1TWYA 5HBCA 5AA3A 1D3KA 4M1VA 4WKMA 3TQLA 1LBBA 2OCUA 4AS5A 1IXGA 3T9UA 4F39A 3PMXA 2RINA 4H65A 2R6GE 3OEMA 3SESA 2XWVA 3FVKA 3K00A 3UN6A 2DVZA 5BWJA 1FTJA 5FBPA 5H8FA 2R71A 1QULA 3C33A 1NI9A 2OLBA 3RT6B 4DDDA 4NF4B 3TTNA 2RC9A 1IIWA 3RTFB 3KJTA 2P0SA 4L17A 4ZE9A 4MLVA 1BLFA 4YB5A 1LAFE 4KYEA 4IO4A 2F6PA 5H8HA 5IGAA 3RY3A 1O64A 2QVVA 3R6UA 4H5GA 3B6QA 1B5JA 3K6VA 4LZ5A 4G4PA 5H8QA 2ZMBA 1INPA 5H8NA 5I59A 1II5A 4GQOA 1UTHA 3R26A 3PUXE 2ZZWA 5H8SA 2XD3A 2DQVA 4YKJA 4WXJA 4R6HA 3W9VA 4EF1A 4FE8A 2WYKA 2DXYA 3ECRA 1ZLQA 2F7BA 1LBWA 1KZ8A 3BFTA 4ZDMA 2HXRA 2AL4A 4ECFA 4IY6A 3B50A 4U21A 3VLWA 1FQCA 3F11A 1RDXA 1P99A 3LSFB 1WVJA
chains in the Genus database with same CATH topology
3TCHA 4X48A 5AE4A 4P0GA 1B1HA 1N04A 3M3KA 4EDPA 2REGA 3JYRA 1SI0A 2H5YA 1EZOA 3G3KA 3IOUA 4F1UA 1N84A 4KYDA 5DVIA 2UYFA 2BJJX 2UVJA 4YZZA 3DELB 4F18A 3HHFA 3Q25A 3I6VA 2QS4A 3IB2A 3AXFA 1B5HA 4F22A 1BIYA 4DXBA 4IO5A 4TLLB 3FXQA 3QYTA 4PFYA 4ZZAA 2ZYNA 4POXA 2I49A 4C1TA 2THIA 1LAGE 1MDP1 3IB1A 1D9VA 5KCJA 3MZ9A 2I4BA 3OSRA 4QHQA 2VGQA 2VOZA 3S2VA 3WAFA 3N94A 3C4MA 1SDXA 5TU0A 3EHSA 3FUZA 3LC8A 5CRYA 3PD8A 5K2XA 3DM0A 1CE2A 3LR1A 1DPPA 4R72A 1MS7A 2DE3A 3KN7A 1WDNA 5FHMA 3THIA 1MPBA 3CSBA 2ZNUA 1H3DA 1M5DA 5FHOA 4F3PA 1B5IA 1H45A 3ZS6A 5CBRA 4LZ8A 5TP9A 1SQYA 3FD3A 3QXMA 2QMWA 4POWA 3N6TA 2UVIA 2NXOA 4R75A 1TXFA 3CR9A 3IJOB 4XKQA 4RK9A 2OK2A 1Z7NE 1HSLA 2Y7WA 4QFKA 3MVZA 4H1XA 1MXVA 1DMBA 1SW5A 4R73A 3MJNA 3Q27A 1XHYA 2NWJA 3V89B 1CB6A 1AH5A 2D5WA 4RY1A 3M3LA 3PPQA 3DLNA 1D9YA 3B6TA 5FTHA 3ODBA 1RYOA 3T9VA 1BTJA 4QFPA 3MPLA 2F5XA 3OEKA 1UIVA 2NUVA 5JTYB 3E4RA 2NVUB 1XC1A 5DEXB 3H6VA 4HS7A 2O1MA 1MQIA 4DCXA 3UIFA 4YU0A 1PC3A 4NF6A 3MQ9A 1POY1 4KCDA 4C0RA 5I58B 3N5LA 4F1VA 3IOVA 3A3UA 1SD3A 4BDMA 1GV8A 3ONMA 1LBCA 1N76A 3FGSA 4R74A 4F1YA 2H99A 4YB6A 1J1NA 3KEIA 1N0TA 2M8CA 3GLBA 4KCCA 1Y20A 5CMKA 2VD3A 4ISUA 2RC7A 4ZZEA 3PUYE 4EQ7A 5HPQA 1JEUA 3RTWB 3H4ZA 5CI5A 2WKYA 4RA1A 2O68A 1Y3NA 3PUWE 1B7HA 3K0VA 4RK2A 2ONSA 1PB8A 4TLMB 1WODA 5H8NB 4YKKA 1B52A 1L5TA 4YB7A 3M3FA 2XD2A 3OO8A 4BDRA 4YAHX 2NOOA 5I2KB 1ANFA 4KYSA 1NH7A 3ILUB 1NNFA 4Q8RA 4ELPA 4MF3A 1O63A 3OXNA 3FVNA 3QUJA 3VV5A 3PD9A 3SERA 3FV2A 1A54A 4NEDA 4EUOA 3C35A 1MY2A 4OVJA 3W9WA 1QKBA 4NF5A 1JW5A 3VXCA 3EPEA 3K1NA 3PMWA 3KOTA 2F78A 1MM7A 3EQ1A 3ZSFA 4Z7EA 4G8NA 1S9TA 1NFTA 3S9LC 2FNCA 3GBAA 1FQFA 3FV1A 4PFWA 5EHMA 1MQJA 1B58A 4NWDA 4IB2A 3EHUA 3OELA 3R7XA 3TCGA 4BDOA 1N7WA 1LB8A 1Y9UA 4GD5A 3IK6B 2Z8EA 4HCWA 1JEVA 4G68A 3SEWA 1AOVA 2QS2A 2D21A 4FJPA 3OOAA 1XVYA 3CFZA 3G3IA 4GL8A 2PT1A 1QUIA 3E9XA 3TODA 1IZ1A 1FTMA 2Y84A 1S7YA 3PPNA 4FIMA 2XXWA 4FECA 4PFTA 3V8XB 4ESXA 5I56A 4BDLA 3IORA 5I2NA 1JW4A 1A55A 4MH5A 3G3HA 4OFLA 3MW0A 1US5A 3T9HB 4HW8A 3A3CA 1JVYA 5F7VA 1I6AA 3KSJA 3TAJA 1FQDA 4JDFA 1OLAA 3C9HA 2PVUA 4G8HA 4G77A 1ZJLA 4AB6A 4PE5B 2F36A 4DZ1A 3PGFA 5ITPA 3I5OA 4FEBA 2YLNA 4NF8A 3U1OA 3LBSA 5FHNA 3UORA 4NMYA 2XHDA 1UQWA 3PV0E 4QSCA 2G93A 3HPIA 1P1NA 1YAEA 2F7AA 3DP6A 3TFLA 3VLUA 4F19A 3OO7A 1IXCA 3UK4A 1VSOA 3T96B 4GF8A 3VVDA 4NF6B 4EXKA 1B9JA 4QF9A 5I57B 3O97A 4OXVA 4PP0A 1LSTA 3CIJA 4TOZA 1B7ZA 3TZAA 3RNNA 1MXUA 3TMGA 2O69A 1SW4A 3PPPA 2B3FA 1URSA 1Y3PA 3K6XA 4JSOA 3MBPA 4H8IA 2CMOA 2Q9TA 3TELA 1I69A 2FA7A 1MQHA 1H43A 1FTOA 4NTLA 1MG1A 5CMMA 3A09A 3OD7A 4JWOA 4ZS9A 4RPNA 1US4A 2V3TA 4GXSB 1Y4TA 5L9OA 1RKMA 5AA2A 4AQ4A 1DTZA 4F3SA 4BDQA 1LLSA 3KN3A 2IA4A 1XOCA 1JVXA 3O6IA 3B6WA 3MZBA 2V93A 3OSQA 1Z7ME 2QSXA 3IO4A 3FXUA 4BLAA 4OYVA 3SKPA 4OETA 3CFLA 4LQ2A 2A5TB 4JXIA 5L8DA 5KDTA 4Q5TA 4GOTA 1NMUA 1B2HA 3D4CA 5JK4A 1KWHA 5F1QA 3JZJA 4XKPA 1POTA 3QAXA 1QUKA 1A7LA 3L6GA 1MM6A 4RYAA 1ZMGA 3HN0A 4ZEKA 3QUFA 3C31A 4H67A 2Q2AA 2PYYA 4G8MA 2Z8FA 2GFEA 2OWSA 1MPCA 1MY1A 1NL5A 3BKIB 4OHNA 2RC8A 4F2OA 4N13A 4YKIA 2XXIA 1XT8A 3B7DA 3MVYA 3KN8A 3FXRA 2ZYKA 2Z8DA 4GFRA 1UIUA 2IEEA 4P11A 2V3QA 3FJMA 1MH4A 4G68B 3FATA 3ZKLA 4KQPA 3C32A 1R9QA 3LUYA 3TEPA 5AA4A 4KD5A 2B65A 3KOSA 4YICA 3OO9A 1MPDA 3U8QA 4U1ZA 4U4SA 3IL1B 1H76A 1M5BA 3KJ7A 4ESWA 1SYHA 4JWYA 3TCFA 3BFUA 5I56B 2ZYMA 3SDFA 4K3FA 3SEXA 2F7CA 1HSJA 5I2NB 1GVCA 4QSEA 2F6GA 1DSNA 2QJEA 1OIBA 4AB5A 3QIMA 2XXRA 4F3GA 3K1MA 2VHAA 5ICQA 2VP1A 2QPQA 5L9SA 2DWJA 1I6BA 2I3WA 3HV1A 4OZ9A 2XX9A 2ABHA 2HCAA 4OESA 1MY4A 3H6UA 3U92A 3GXAA 2XXHA 2XXYA 4KHZE 2QS1A 2QMXA 3IB0A 2YPNA 4G68C 5H8FB 2DSFA 3HHGA 3W15C 1LCTA 1BP5A 2Q89A 4OFJA 1QKAA 3KGCA 2RCBA 1B7UA 2ZNSA 3LSWA 4G2ZA 2O7IA 3IAZA 5H8HB 3FJGA 1NNKA 1P1UA 3H6WA 2XXPA 1B0LA 4DE8A 5A5XA 2XXTA 2ALUA 1OVTA 5H8QB 1O7TA 3G3GA 1SW2A 1B4HA 2X7QA 5I59B 4KI0E 2DE2A 1UTHB 5ITOA 3UP9A 4ZEIA 4FEDA 2XX8A 2I48A 3O28A 1DPEA 3K6UA 2H98A 3CG1A 1OQHA 3RGYA 1IQ7A 2Q8JA 1YTVA 1JW1A 1R1NA 3VLVA 2UVHA 4PQJA 2ZYOA 2RKMA 3K4UA 2RCAA 4KFQA 4OMBA 4F31B 3RN8A 1MXWA 3G3JA 4U4XA 4ZE8A 1EZ9A 3QSLA 3H06B 1VFDA 2OWTA 3PMVA 2Z23A 2VD2A 3RQTA 3H03A 4XKNA 3VVEA 1HSEA 2DOJA 3O66A 1MQDA 2I0CA 1TFAA 2V84A 2HXWA 1PB9A 1QUJA 3OO6A 3SEUA 5CM6A 5KDTB 4ZEDA 3EHTA 3GBBA 1SYIA 5JEIA 4GWOA 4EQBA 1AL3A 1Q35A 3T9XB 4R9GA 1Y1MA 3KSXA 4O3BA 1ELJA 4E0XA 2W7YA 4KR5A 4F2QA 5KCJB 1FQBA 3K02A 4H0WA 4MFIA 5FTIA 3TUSA 4DIGA 4BDNA 4XTCQ 2ONRA 4OTEA 4EXLA 5CC2A 3MPKA 3UA8A 2PMSA 3O6GA 1TFDA 5DTBA 3HCQA 3MP8A 1B3GA 5B70A 3MWBA 4O3CA 2XXVA 3G3FA 2OBGA 2XXXA 3C36A 1OMPA 5TPAA 4N6PA 1IUDA 5EYFA 4I9DA 4QRZA 2DWHA 2GH9A 4ELOA 3S9EA 2UYEA 2I4CA 3TYHA 3D4GA 5AA4B 2HAUA 5TP9B 4LA9A 2ZXTA 3H3GA 4U23A 3KBRA 1P1OA 3CG3A 4I62A 4QFLA 3FVOA 3VDFA 3FJ7A 4P0IA 2GHAA 1Y3QA 4I1DA 3BBRA 2R9JA 2DVCA 5JTYA 4DXCA 1URDA 1VE4A 4ELQA 4R9FA 2E0SA 2QRYA 2HFBA 4YMAA 1DTGA 5DEXA 5J1DA 2Q2CA 3EN3A 3MUQA 4ZEBA 4KPTA 3FIRA 1NH8A 1S50A 5B7DA 5DVFA 4R2BA 4R6YA 5KZTA 3PUVE 5I58A 3MC2A 1T0KA 3Q28A 3S4UA 3VFJA 3OENA 4NE4A 1MY0A 2ZNTA 1B51A 3N26A 3IX1A 4OEUA 4THIA 3U72A 4F29A 4RXLA 4DCYA 2Z22A 4H5FA 1NNTA 4IO7A 4QSDA 4R6KA 3FVGA 3JV9A 1M5EA 4ONYA 3O6HA 3TTRA 1VFEA 1MQGA 1SVXB 1R6ZA 4OENA 4LVQA 3K6WA 3Q26A 3S9NC 4OEVA 4IO6A 1OQGA 4RJZA 4XXUA 4IO2A 1IXIA 1OVBA 1QVSA 5A5XB 2O1LA 4JB7A 3TTMA 5I2KA 3TKDA 1ZBMA 2QL3A 2QS3A 4XKRA 1GTKA 3IOTA 5LOMA 5ICTA 1F9BA 4YKPA 1B0HA 2DWAA 4OERA 2Y7RA 3K01A 2P1SA 1LAXA 3MAMA 3S9MC 1MXZA 4Q0CA 1LFIA 3KFMA 3K1PA 1MDQA 1SI1A 1USYH 1FCKA 4IO3A 4H8JA 1B4ZA 1QW0A 2AIXA 4LP2B 4ZEFA 5AA1A 2O51A 1N7XA 1URGA 1SW1A 2V25A 2X26A 3ZKKA 4IGTA 4XIGQ 4NF5B 4ND9A 5L9MA 3TTKA 1ATGA 3SEYA 1PDAA 1B05A 1MXYA 4I8CA 1PB7A 3HSTA 2PBWA 4U1OA 3LSLA 2HZLA 1D4NA 2ANJA 5HM4B 4RNSA 5K2YA 2DYXA 2O84X 3DP4A 3I3VA 2V3UA 1QJMA 2GHBA 2AYSA 3TTLA 1MH3A 3PPOA 1DOTA 1FTLA 1FQAA 3TQWA 2FYIA 4WEDA 3MVWA 4JSDA 3K2DA 3IOWA 3TDJA 1GGGA 4R2FA 3LSXA 2DE4A 2DWIA 3VXBA 4WEPA 5DYHA 4LUBA 1OLCA 3USDA 1EZPA 2ESNA 3MP6A 1PBPA 4OQOA 1LFGA 4X9TA 3KG2A 4EQ9A 2D3IA 3EF7A 1UTBA 1P1WA 3O2AA 2XX7A 4X1DA 2F8DA 3U93A 2I6EA 4OFOA 2B3BA 2O6AA 1AIVA 1XVXA 3UGWA 1YCJA 4Z0IA 4YMBA 5IAIA 5TPAB 1N3WA 4LATA 4UA8A 1JETA 1B3HA 2DXRA 3RPWA 5IKBA 3H6TA 1RYXA 2DP8A 1FTKA 4PETA 1A8EA 2KLFA 4GVOA 3G7WA 4C1UA 1LCFA 1NNPA 5EHSA 4TQUQ 3T66A 3PUZE 5I84A 2OZZA 1R9LA 3ILTB 3T93B 3E13X 1B46A 2AL5A 2YJPA 4DLDA 4NF4A 5CBSA 4QFOA 1LGBC 2DS9A 4NF8B 1ZIUA 1XS5A 2Q88A 2RF1A 4IY5A 4ZECA 3FASA 2Y7PA 2H25A 1ZTYA 5ISUA 4FATA 1TT1A 3IO6A 5I57A 1SBPA 3IR1A 4LQ5A 5CMBA 3DP8A 4U22A 1FQEA 2XXQA 2HEUA 3L6HA 3V83A 3WAEA 1B3FA 1B1XA 2I0BA 2I58A 3KZGA 3H7MA 1ZU0A 1MY3A 5DVJA 3V5AA 3T22A 4EF2A 4GXAA 2E1SA 3RUMA 4GL0A 1IXHA 1VR5A 1BKAA 1B3LA 5BUUA 2XXUA 4U2RA 3U94A 1B3EA 3RLFE 3OMBA 4H6DA 1PEBA 4UACA 5DT6A 4JWXA 1M5FA 4O3AA 4MBPA 4NWCA 1EU8A 4HTGA 2F97A 1A8FA 2A5SA 1MXXA 2HQ0A 3CFXA 2F35A 1Y1ZA 1NKXA 4OWDA 1LFHA 1LB9A 3MZ1A 1AMFA 3CVGA 5AA2D 1I6QA 5AA2B 2P2AA 2CZLA 2UVGA 3VE1B 2A5TA 3SETA 3VVFA 4MLQA 2OJTA 1EH3A 4ELRA 1JQFA 1LAHE 4GRKA 4LZ7A 1IEJA 1A99A 3PPRA 5M2VA 4FAJA 4JBZA 1Q1KA 1B40A 2H9BA 4GIZA 1JNFA 3FZVA 1IITA 2G29A 1A40A 3GZGA 4N07A 1PBQA 2Y7IA 4HCYA 2X7PA 3M8UA 4DXUA 2HAVA 3CI8A 2O7UA 5CMCA 1Y4CA 3MVXA 1MRPA 4QFNA 2H4IA 3PU5A 1B6HA 1ZKBA 1GR2A 2Y7KA 2LAOA 3P7IA 2PX1A 2REJA 3RT8A 2F34A 3TPAA 4PFUA 4Q30B 3O9PA 1USYE 4GLIA 3N6UA 4RPOA 2I3VA 4M4GA 3Q29A 3IJXB 5ELVA 2PT2A 1H44A 4E0WA 2GRVA 1B32A 3C34A 1FW0A 3MP1A 4LONB 1UTBB 4IGRA 4FORA 4X1BA 1P1QA 4F3BA 2HZKA 3SEVA 3CRBA 3O29A 3E3KA 1YPNA 3CSGA 2UXAA 1M5CA 3QK6A 3HO7A 1N3XA 2ONKE 1TWYA 5HBCA 5AA3A 1D3KA 4M1VA 4WKMA 3TQLA 1LBBA 2OCUA 1IXGA 3T9UA 4F39A 3PMXA 2RINA 4H65A 2R6GE 3OEMA 3SESA 3FVKA 3K00A 3UN6A 2DVZA 5BWJA 1FTJA 5H8FA 2R71A 1QULA 3C33A 2OLBA 3RT6B 4DDDA 4NF4B 3TTNA 2RC9A 1IIWA 3RTFB 3KJTA 2P0SA 4L17A 4ZE9A 4MLVA 1BLFA 4YB5A 1LAFE 4KYEA 4IO4A 2F6PA 5H8HA 3RY3A 1O64A 3R6UA 4H5GA 3B6QA 1B5JA 3K6VA 4LZ5A 4G4PA 5H8QA 2ZMBA 5H8NA 5I59A 1II5A 4GQOA 1UTHA 3R26A 3PUXE 5H8SA 2XD3A 2DQVA 4YKJA 4WXJA 4R6HA 3W9VA 4EF1A 4FE8A 2DXYA 3ECRA 1ZLQA 2F7BA 3BFTA 4ZDMA 2AL4A 4ECFA 4IY6A 4U21A 3VLWA 1FQCA 3F11A 1P99A 3LSFB 1WVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCH A;  4X48 A;  5AE4 A;  4P0G A;  1B1H A;  1N04 A;  3M3K A;  4EDP A;  2REG A;  3JYR A;  1SI0 A;  2H5Y A;  1EZO A;  3G3K A;  3IOU A;  4F1U A;  1N84 A;  4KYD A;  5DVI A;  2UYF A;  2BJJ X;  2UVJ A;  4YZZ A;  3DEL B;  4F18 A;  3HHF A;  3Q25 A;  3I6V A;  2QS4 A;  3IB2 A;  3AXF A;  1B5H A;  4F22 A;  1BIY A;  4DXB A;  4IO5 A;  4TLL B;  3FXQ A;  3QYT A;  4PFY A;  4ZZA A;  2ZYN A;  4POX A;  2I49 A;  4C1T A;  2THI A;  1LAG E;  1MDP 1;  3IB1 A;  1D9V A;  5KCJ A;  3MZ9 A;  2I4B A;  3OSR A;  4QHQ A;  2VGQ A;  2VOZ A;  3S2V A;  3WAF A;  3N94 A;  3C4M A;  1SDX A;  5TU0 A;  3EHS A;  3FUZ A;  3LC8 A;  5CRY A;  3PD8 A;  5K2X A;  3DM0 A;  1CE2 A;  3LR1 A;  1DPP A;  4R72 A;  1MS7 A;  2DE3 A;  3KN7 A;  1WDN A;  5FHM A;  3THI A;  1MPB A;  3CSB A;  2ZNU A;  1H3D A;  1M5D A;  5FHO A;  4F3P A;  1B5I A;  1H45 A;  3ZS6 A;  5CBR A;  4LZ8 A;  5TP9 A;  1SQY A;  3FD3 A;  3QXM A;  2QMW A;  4POW A;  3N6T A;  2UVI A;  2NXO A;  4R75 A;  1TXF A;  3CR9 A;  3IJO B;  4XKQ A;  4RK9 A;  2OK2 A;  1Z7N E;  1HSL A;  2Y7W A;  4QFK A;  3MVZ A;  4H1X A;  1MXV A;  1DMB A;  1SW5 A;  4R73 A;  3MJN A;  3Q27 A;  1XHY A;  2NWJ A;  3V89 B;  1CB6 A;  1AH5 A;  2D5W A;  4RY1 A;  3M3L A;  3PPQ A;  3DLN A;  1D9Y A;  3B6T A;  5FTH A;  3ODB A;  1RYO A;  3T9V A;  1BTJ A;  4QFP A;  3MPL A;  2F5X A;  3OEK A;  1UIV A;  2NUV A;  5JTY B;  3E4R A;  2NVU B;  1XC1 A;  5DEX B;  3H6V A;  4HS7 A;  2O1M A;  1MQI A;  4DCX A;  3UIF A;  4YU0 A;  1PC3 A;  4NF6 A;  3MQ9 A;  1POY 1;  4KCD A;  4C0R A;  5I58 B;  3N5L A;  4F1V A;  3IOV A;  3A3U A;  1SD3 A;  4BDM A;  1GV8 A;  3ONM A;  1LBC A;  1N76 A;  3FGS A;  4R74 A;  4F1Y A;  2H99 A;  4YB6 A;  1J1N A;  3KEI A;  1N0T A;  2M8C A;  3GLB A;  4KCC A;  1Y20 A;  5CMK A;  2VD3 A;  4ISU A;  2RC7 A;  4ZZE A;  3PUY E;  4EQ7 A;  5HPQ A;  1JEU A;  3RTW B;  3H4Z A;  5CI5 A;  2WKY A;  4RA1 A;  2O68 A;  1Y3N A;  3PUW E;  1B7H A;  3K0V A;  4RK2 A;  2ONS A;  1PB8 A;  4TLM B;  1WOD A;  5H8N B;  4YKK A;  1B52 A;  1L5T A;  4YB7 A;  3M3F A;  2XD2 A;  3OO8 A;  4BDR A;  4YAH X;  2NOO A;  5I2K B;  1ANF A;  4KYS A;  1NH7 A;  3ILU B;  1NNF A;  4Q8R A;  4ELP A;  4MF3 A;  1O63 A;  3OXN A;  3FVN A;  3QUJ A;  3VV5 A;  3PD9 A;  3SER A;  3FV2 A;  1A54 A;  4NED A;  4EUO A;  3C35 A;  1MY2 A;  4OVJ A;  3W9W A;  1QKB A;  4NF5 A;  1JW5 A;  3VXC A;  3EPE A;  3K1N A;  3PMW A;  3KOT A;  2F78 A;  1MM7 A;  3EQ1 A;  3ZSF A;  4Z7E A;  4G8N A;  1S9T A;  1NFT A;  3S9L C;  2FNC A;  3GBA A;  1FQF A;  3FV1 A;  4PFW A;  5EHM A;  1MQJ A;  1B58 A;  4NWD A;  4IB2 A;  3EHU A;  3OEL A;  3R7X A;  3TCG A;  4BDO A;  1N7W A;  1LB8 A;  1Y9U A;  4GD5 A;  3IK6 B;  2Z8E A;  4HCW A;  1JEV A;  4G68 A;  3SEW A;  1AOV A;  2QS2 A;  2D21 A;  4FJP A;  3OOA A;  1XVY A;  3CFZ A;  3G3I A;  4GL8 A;  2PT1 A;  1QUI A;  3E9X A;  3TOD A;  1IZ1 A;  1FTM A;  2Y84 A;  1S7Y A;  3PPN A;  4FIM A;  2XXW A;  4FEC A;  4PFT A;  3V8X B;  4ESX A;  5I56 A;  4BDL A;  3IOR A;  5I2N A;  1JW4 A;  1A55 A;  4MH5 A;  3G3H A;  4OFL A;  3MW0 A;  1US5 A;  3T9H B;  4HW8 A;  3A3C A;  1JVY A;  5F7V A;  1I6A A;  3KSJ A;  3TAJ A;  1FQD A;  4JDF A;  1OLA A;  3C9H A;  2PVU A;  4G8H A;  4G77 A;  1ZJL A;  4AB6 A;  4PE5 B;  2F36 A;  4DZ1 A;  3PGF A;  5ITP A;  3I5O A;  4FEB A;  2YLN A;  4NF8 A;  3U1O A;  3LBS A;  5FHN A;  3UOR A;  4NMY A;  2XHD A;  1UQW A;  3PV0 E;  4QSC A;  2G93 A;  3HPI A;  1P1N A;  1YAE A;  2F7A A;  3DP6 A;  3TFL A;  3VLU A;  4F19 A;  3OO7 A;  1IXC A;  3UK4 A;  1VSO A;  3T96 B;  4GF8 A;  3VVD A;  4NF6 B;  4EXK A;  1B9J A;  4QF9 A;  5I57 B;  3O97 A;  4OXV A;  4PP0 A;  1LST A;  3CIJ A;  4TOZ A;  1B7Z A;  3TZA A;  3RNN A;  1MXU A;  3TMG A;  2O69 A;  1SW4 A;  3PPP A;  2B3F A;  1URS A;  1Y3P A;  3K6X A;  4JSO A;  3MBP A;  4H8I A;  2CMO A;  2Q9T A;  3TEL A;  1I69 A;  2FA7 A;  1MQH A;  1H43 A;  1FTO A;  4NTL A;  1MG1 A;  5CMM A;  3A09 A;  3OD7 A;  4JWO A;  4ZS9 A;  4RPN A;  1US4 A;  2V3T A;  4GXS B;  1Y4T A;  5L9O A;  1RKM A;  5AA2 A;  4AQ4 A;  1DTZ A;  4F3S A;  4BDQ A;  1LLS A;  3KN3 A;  2IA4 A;  1XOC A;  1JVX A;  3O6I A;  3B6W A;  3MZB A;  2V93 A;  3OSQ A;  1Z7M E;  2QSX A;  3IO4 A;  3FXU A;  4BLA A;  4OYV A;  3SKP A;  4OET A;  3CFL A;  4LQ2 A;  2A5T B;  4JXI A;  5L8D A;  5KDT A;  4Q5T A;  4GOT A;  1NMU A;  1B2H A;  3D4C A;  5JK4 A;  1KWH A;  5F1Q A;  3JZJ A;  4XKP A;  1POT A;  3QAX A;  1QUK A;  1A7L A;  3L6G A;  1MM6 A;  4RYA A;  1ZMG A;  3HN0 A;  4ZEK A;  3QUF A;  3C31 A;  4H67 A;  2Q2A A;  2PYY A;  4G8M A;  2Z8F A;  2GFE A;  2OWS A;  1MPC A;  1MY1 A;  1NL5 A;  3BKI B;  4OHN A;  2RC8 A;  4F2O A;  4N13 A;  4YKI A;  2XXI A;  1XT8 A;  3B7D A;  3MVY A;  3KN8 A;  3FXR A;  2ZYK A;  2Z8D A;  4GFR A;  1UIU A;  2IEE A;  4P11 A;  2V3Q A;  3FJM A;  1MH4 A;  4G68 B;  3FAT A;  3ZKL A;  4KQP A;  3C32 A;  1R9Q A;  3LUY A;  3TEP A;  5AA4 A;  4KD5 A;  2B65 A;  3KOS A;  4YIC A;  3OO9 A;  1MPD A;  3U8Q A;  4U1Z A;  4U4S A;  3IL1 B;  1H76 A;  1M5B A;  3KJ7 A;  4ESW A;  1SYH A;  4JWY A;  3TCF A;  3BFU A;  5I56 B;  2ZYM A;  3SDF A;  4K3F A;  3SEX A;  2F7C A;  1HSJ A;  5I2N B;  1GVC A;  4QSE A;  2F6G A;  1DSN A;  2QJE A;  1OIB A;  4AB5 A;  3QIM A;  2XXR A;  4F3G A;  3K1M A;  2VHA A;  5ICQ A;  2VP1 A;  2QPQ A;  5L9S A;  2DWJ A;  1I6B A;  2I3W A;  3HV1 A;  4OZ9 A;  2XX9 A;  2ABH A;  2HCA A;  4OES A;  1MY4 A;  3H6U A;  3U92 A;  3GXA A;  2XXH A;  2XXY A;  4KHZ E;  2QS1 A;  2QMX A;  3IB0 A;  2YPN A;  4G68 C;  5H8F B;  2DSF A;  3HHG A;  3W15 C;  1LCT A;  1BP5 A;  2Q89 A;  4OFJ A;  1QKA A;  3KGC A;  2RCB A;  1B7U A;  2ZNS A;  3LSW A;  4G2Z A;  2O7I A;  3IAZ A;  5H8H B;  3FJG A;  1NNK A;  1P1U A;  3H6W A;  2XXP A;  1B0L A;  4DE8 A;  5A5X A;  2XXT A;  2ALU A;  1OVT A;  5H8Q B;  1O7T A;  3G3G A;  1SW2 A;  1B4H A;  2X7Q A;  5I59 B;  4KI0 E;  2DE2 A;  1UTH B;  5ITO A;  3UP9 A;  4ZEI A;  4FED A;  2XX8 A;  2I48 A;  3O28 A;  1DPE A;  3K6U A;  2H98 A;  3CG1 A;  1OQH A;  3RGY A;  1IQ7 A;  2Q8J A;  1YTV A;  1JW1 A;  1R1N A;  3VLV A;  2UVH A;  4PQJ A;  2ZYO A;  2RKM A;  3K4U A;  2RCA A;  4KFQ A;  4OMB A;  4F31 B;  3RN8 A;  1MXW A;  3G3J A;  4U4X A;  4ZE8 A;  1EZ9 A;  3QSL A;  3H06 B;  1VFD A;  2OWT A;  3PMV A;  2Z23 A;  2VD2 A;  3RQT A;  3H03 A;  4XKN A;  3VVE A;  1HSE A;  2DOJ A;  3O66 A;  1MQD A;  2I0C A;  1TFA A;  2V84 A;  2HXW A;  1PB9 A;  1QUJ A;  3OO6 A;  3SEU A;  5CM6 A;  5KDT B;  4ZED A;  3EHT A;  3GBB A;  1SYI A;  5JEI A;  4GWO A;  4EQB A;  1AL3 A;  1Q35 A;  3T9X B;  4R9G A;  1Y1M A;  3KSX A;  4O3B A;  1ELJ A;  4E0X A;  2W7Y A;  4KR5 A;  4F2Q A;  5KCJ B;  1FQB A;  3K02 A;  4H0W A;  4MFI A;  5FTI A;  3TUS A;  4DIG A;  4BDN A;  4XTC Q;  2ONR A;  4OTE A;  4EXL A;  5CC2 A;  3MPK A;  3UA8 A;  2PMS A;  3O6G A;  1TFD A;  5DTB A;  3HCQ A;  3MP8 A;  1B3G A;  5B70 A;  3MWB A;  4O3C A;  2XXV A;  3G3F A;  2OBG A;  2XXX A;  3C36 A;  1OMP A;  5TPA A;  4N6P A;  1IUD A;  5EYF A;  4I9D A;  4QRZ A;  2DWH A;  2GH9 A;  4ELO A;  3S9E A;  2UYE A;  2I4C A;  3TYH A;  3D4G A;  5AA4 B;  2HAU A;  5TP9 B;  4LA9 A;  2ZXT A;  3H3G A;  4U23 A;  3KBR A;  1P1O A;  3CG3 A;  4I62 A;  4QFL A;  3FVO A;  3VDF A;  3FJ7 A;  4P0I A;  2GHA A;  1Y3Q A;  4I1D A;  3BBR A;  2R9J A;  2DVC A;  5JTY A;  4DXC A;  1URD A;  1VE4 A;  4ELQ A;  4R9F A;  2E0S A;  2QRY A;  2HFB A;  4YMA A;  1DTG A;  5DEX A;  5J1D A;  2Q2C A;  3EN3 A;  3MUQ A;  4ZEB A;  4KPT A;  3FIR A;  1NH8 A;  1S50 A;  5B7D A;  5DVF A;  4R2B A;  4R6Y A;  5KZT A;  3PUV E;  5I58 A;  3MC2 A;  1T0K A;  3Q28 A;  3S4U A;  3VFJ A;  3OEN A;  4NE4 A;  1MY0 A;  2ZNT A;  1B51 A;  3N26 A;  3IX1 A;  4OEU A;  4THI A;  3U72 A;  4F29 A;  4RXL A;  4DCY A;  2Z22 A;  4H5F A;  1NNT A;  4IO7 A;  4QSD A;  4R6K A;  3FVG A;  3JV9 A;  1M5E A;  4ONY A;  3O6H A;  3TTR A;  1VFE A;  1MQG A;  1SVX B;  1R6Z A;  4OEN A;  4LVQ A;  3K6W A;  3Q26 A;  3S9N C;  4OEV A;  4IO6 A;  1OQG A;  4RJZ A;  4XXU A;  4IO2 A;  1IXI A;  1OVB A;  1QVS A;  5A5X B;  2O1L A;  4JB7 A;  3TTM A;  5I2K A;  3TKD A;  1ZBM A;  2QL3 A;  2QS3 A;  4XKR A;  1GTK A;  3IOT A;  5LOM A;  5ICT A;  1F9B A;  4YKP A;  1B0H A;  2DWA A;  4OER A;  2Y7R A;  3K01 A;  2P1S A;  1LAX A;  3MAM A;  3S9M C;  1MXZ A;  4Q0C A;  1LFI A;  3KFM A;  3K1P A;  1MDQ A;  1SI1 A;  1USY H;  1FCK A;  4IO3 A;  4H8J A;  1B4Z A;  1QW0 A;  2AIX A;  4LP2 B;  4ZEF A;  5AA1 A;  2O51 A;  1N7X A;  1URG A;  1SW1 A;  2V25 A;  2X26 A;  3ZKK A;  4IGT A;  4XIG Q;  4NF5 B;  4ND9 A;  5L9M A;  3TTK A;  1ATG A;  3SEY A;  1PDA A;  1B05 A;  1MXY A;  4I8C A;  1PB7 A;  3HST A;  2PBW A;  4U1O A;  3LSL A;  2HZL A;  1D4N A;  2ANJ A;  5HM4 B;  4RNS A;  5K2Y A;  2DYX A;  2O84 X;  3DP4 A;  3I3V A;  2V3U A;  1QJM A;  2GHB A;  2AYS A;  3TTL A;  1MH3 A;  3PPO A;  1DOT A;  1FTL A;  1FQA A;  3TQW A;  2FYI A;  4WED A;  3MVW A;  4JSD A;  3K2D A;  3IOW A;  3TDJ A;  1GGG A;  4R2F A;  3LSX A;  2DE4 A;  2DWI A;  3VXB A;  4WEP A;  5DYH A;  4LUB A;  1OLC A;  3USD A;  1EZP A;  2ESN A;  3MP6 A;  1PBP A;  4OQO A;  1LFG A;  4X9T A;  3KG2 A;  4EQ9 A;  2D3I A;  3EF7 A;  1UTB A;  1P1W A;  3O2A A;  2XX7 A;  4X1D A;  2F8D A;  3U93 A;  2I6E A;  4OFO A;  2B3B A;  2O6A A;  1AIV A;  1XVX A;  3UGW A;  1YCJ A;  4Z0I A;  4YMB A;  5IAI A;  5TPA B;  1N3W A;  4LAT A;  4UA8 A;  1JET A;  1B3H A;  2DXR A;  3RPW A;  5IKB A;  3H6T A;  1RYX A;  2DP8 A;  1FTK A;  4PET A;  1A8E A;  2KLF A;  4GVO A;  3G7W A;  4C1U A;  1LCF A;  1NNP A;  5EHS A;  4TQU Q;  3T66 A;  3PUZ E;  5I84 A;  2OZZ A;  1R9L A;  3ILT B;  3T93 B;  3E13 X;  1B46 A;  2AL5 A;  2YJP A;  4DLD A;  4NF4 A;  5CBS A;  4QFO A;  1LGB C;  2DS9 A;  4NF8 B;  1ZIU A;  1XS5 A;  2Q88 A;  2RF1 A;  4IY5 A;  4ZEC A;  3FAS A;  2Y7P A;  2H25 A;  1ZTY A;  5ISU A;  4FAT A;  1TT1 A;  3IO6 A;  5I57 A;  1SBP A;  3IR1 A;  4LQ5 A;  5CMB A;  3DP8 A;  4U22 A;  1FQE A;  2XXQ A;  2HEU A;  3L6H A;  3V83 A;  3WAE A;  1B3F A;  1B1X A;  2I0B A;  2I58 A;  3KZG A;  3H7M A;  1ZU0 A;  1MY3 A;  5DVJ A;  3V5A A;  3T22 A;  4EF2 A;  4GXA A;  2E1S A;  3RUM A;  4GL0 A;  1IXH A;  1VR5 A;  1BKA A;  1B3L A;  5BUU A;  2XXU A;  4U2R A;  3U94 A;  1B3E A;  3RLF E;  3OMB A;  4H6D A;  1PEB A;  4UAC A;  5DT6 A;  4JWX A;  1M5F A;  4O3A A;  4MBP A;  4NWC A;  1EU8 A;  4HTG A;  2F97 A;  1A8F A;  2A5S A;  1MXX A;  2HQ0 A;  3CFX A;  2F35 A;  1Y1Z A;  1NKX A;  4OWD A;  1LFH A;  1LB9 A;  3MZ1 A;  1AMF A;  3CVG A;  5AA2 D;  1I6Q A;  5AA2 B;  2P2A A;  2CZL A;  2UVG A;  3VE1 B;  2A5T A;  3SET A;  3VVF A;  4MLQ A;  2OJT A;  1EH3 A;  4ELR A;  1JQF A;  1LAH E;  4GRK A;  4LZ7 A;  1IEJ A;  1A99 A;  3PPR A;  5M2V A;  4FAJ A;  4JBZ A;  1Q1K A;  1B40 A;  2H9B A;  4GIZ A;  1JNF A;  3FZV A;  1IIT A;  2G29 A;  1A40 A;  3GZG A;  4N07 A;  1PBQ A;  2Y7I A;  4HCY A;  2X7P A;  3M8U A;  4DXU A;  2HAV A;  3CI8 A;  2O7U A;  5CMC A;  1Y4C A;  3MVX A;  1MRP A;  4QFN A;  2H4I A;  3PU5 A;  1B6H A;  1ZKB A;  1GR2 A;  2Y7K A;  2LAO A;  3P7I A;  2PX1 A;  2REJ A;  3RT8 A;  2F34 A;  3TPA A;  4PFU A;  4Q30 B;  3O9P A;  1USY E;  4GLI A;  3N6U A;  4RPO A;  2I3V A;  4M4G A;  3Q29 A;  3IJX B;  5ELV A;  2PT2 A;  1H44 A;  4E0W A;  2GRV A;  1B32 A;  3C34 A;  1FW0 A;  3MP1 A;  4LON B;  1UTB B;  4IGR A;  4FOR A;  4X1B A;  1P1Q A;  4F3B A;  2HZK A;  3SEV A;  3CRB A;  3O29 A;  3E3K A;  1YPN A;  3CSG A;  2UXA A;  1M5C A;  3QK6 A;  3HO7 A;  1N3X A;  2ONK E;  1TWY A;  5HBC A;  5AA3 A;  1D3K A;  4M1V A;  4WKM A;  3TQL A;  1LBB A;  2OCU A;  1IXG A;  3T9U A;  4F39 A;  3PMX A;  2RIN A;  4H65 A;  2R6G E;  3OEM A;  3SES A;  3FVK A;  3K00 A;  3UN6 A;  2DVZ A;  5BWJ A;  1FTJ A;  5H8F A;  2R71 A;  1QUL A;  3C33 A;  2OLB A;  3RT6 B;  4DDD A;  4NF4 B;  3TTN A;  2RC9 A;  1IIW A;  3RTF B;  3KJT A;  2P0S A;  4L17 A;  4ZE9 A;  4MLV A;  1BLF A;  4YB5 A;  1LAF E;  4KYE A;  4IO4 A;  2F6P A;  5H8H A;  3RY3 A;  1O64 A;  3R6U A;  4H5G A;  3B6Q A;  1B5J A;  3K6V A;  4LZ5 A;  4G4P A;  5H8Q A;  2ZMB A;  5H8N A;  5I59 A;  1II5 A;  4GQO A;  1UTH A;  3R26 A;  3PUX E;  5H8S A;  2XD3 A;  2DQV A;  4YKJ A;  4WXJ A;  4R6H A;  3W9V A;  4EF1 A;  4FE8 A;  2DXY A;  3ECR A;  1ZLQ A;  2F7B A;  3BFT A;  4ZDM A;  2AL4 A;  4ECF A;  4IY6 A;  4U21 A;  3VLW A;  1FQC A;  3F11 A;  1P99 A;  3LSF B;  1WVJ A; 
#chains in the Genus database with same CATH topology
 3TCH A;  4X48 A;  5AE4 A;  4P0G A;  1B1H A;  1N04 A;  3M3K A;  4EDP A;  4N81 A;  5LDZ A;  2REG A;  3JYR A;  1SI0 A;  4PCD A;  3GYY A;  2H5Y A;  1EZO A;  3G3K A;  3MYU A;  3IOU A;  4F1U A;  5EQ9 A;  1N84 A;  4KYD A;  5DVI A;  2UYF A;  2BJJ X;  1FTA A;  2UVJ A;  2VPN A;  4QXD A;  3QMF A;  4YZZ A;  5EQ8 A;  3DEL B;  4F18 A;  3HHF A;  3Q25 A;  3I6V A;  2QS4 A;  3IB2 A;  3AXF A;  1B5H A;  4F22 A;  1BIY A;  4DXB A;  4IO5 A;  4TLL B;  3FXQ A;  3QYT A;  4PFY A;  4ZZA A;  2ZYN A;  4N8G A;  4POX A;  2I49 A;  4C1T A;  2THI A;  1LAG E;  1MDP 1;  1FBF A;  3IB1 A;  1D9V A;  5KCJ A;  4MIJ A;  3MZ9 A;  2I4B A;  3OSR A;  1LBV A;  4GX6 A;  4QHQ A;  2VGQ A;  2VOZ A;  3S2V A;  3WAF A;  2FIE A;  3N94 A;  3C4M A;  3RPL A;  1SDX A;  5TU0 A;  2XA5 A;  3EHS A;  3FUZ A;  3LC8 A;  5CRY A;  4MMP A;  3PD8 A;  5K2X A;  3DM0 A;  1CE2 A;  3LR1 A;  1DPP A;  4R72 A;  1MS7 A;  2DE3 A;  3KN7 A;  1WDN A;  5FHM A;  3THI A;  1MPB A;  3CSB A;  2ZNU A;  1H3D A;  1M5D A;  1EYJ A;  5FHO A;  4F3P A;  1B5I A;  1H45 A;  3ZS6 A;  5CBR A;  4N4U A;  4LZ8 A;  5TP9 A;  1SQY A;  3FD3 A;  3QXM A;  2QMW A;  4POW A;  3N6T A;  2UVI A;  2NXO A;  4R75 A;  1TXF A;  3CR9 A;  3IJO B;  4XKQ A;  4RK9 A;  2OK2 A;  1Z7N E;  1HSL A;  2WX9 A;  2Y7W A;  4QFK A;  3MVZ A;  4H1X A;  1MXV A;  1DMB A;  1SW5 A;  4R73 A;  3MJN A;  3Q27 A;  1XHY A;  2NWJ A;  3V89 B;  1CB6 A;  2QVU A;  4H46 A;  1AH5 A;  2D5W A;  4RY1 A;  3M3L A;  3PPQ A;  3DLN A;  4O7M A;  1D9Y A;  3B6T A;  5FTH A;  3ODB A;  1RYO A;  5EQ7 A;  3T9V A;  1FJ6 A;  1BTJ A;  4XF5 A;  4QFP A;  3MPL A;  2F5X A;  3OEK A;  5A5L A;  1UIV A;  1NUY A;  2NUV A;  5JTY B;  3E4R A;  2NVU B;  1XC1 A;  5DEX B;  2FVZ A;  3H6V A;  1NV7 A;  4HS7 A;  2O1M A;  1MQI A;  4DCX A;  4GBW A;  3UIF A;  1XI6 A;  4YU0 A;  1PC3 A;  4NF6 A;  3MQ9 A;  1POY 1;  4KCD A;  4C0R A;  5I58 B;  3N5L A;  4F1V A;  5IZZ A;  3IOV A;  3A3U A;  5ET8 A;  1SD3 A;  4OVS A;  4BDM A;  1GV8 A;  3ONM A;  1LBC A;  1FJ9 A;  4GWU A;  4PFB A;  1IMC A;  1N76 A;  3FGS A;  4R74 A;  4F1Y A;  1KA0 A;  2H99 A;  4YB6 A;  1J1N A;  1G0H A;  3KEI A;  1N0T A;  2M8C A;  3GLB A;  4KCC A;  1Y20 A;  5CMK A;  2VD3 A;  4ISU A;  2RC7 A;  4ZZE A;  3PUY E;  4EQ7 A;  5HPQ A;  4O94 A;  1QGX A;  1JEU A;  3RTW B;  2ZZX A;  3H4Z A;  5CI5 A;  2WKY A;  4RA1 A;  2O68 A;  1FPE A;  1Y3N A;  2HPG A;  3PUW E;  1B7H A;  3K0V A;  4RK2 A;  2ONS A;  1PB8 A;  4TLM B;  1WOD A;  5H8N B;  4YKK A;  1B52 A;  1L5T A;  4YB7 A;  4N17 A;  3M3F A;  2XD2 A;  3E79 A;  2Q74 A;  3OO8 A;  4BDR A;  4YAH X;  2NOO A;  5I2K B;  1ANF A;  3BIG A;  2WYP A;  4KYS A;  1NH7 A;  3ILU B;  1NNF A;  4Q8R A;  4ELP A;  4MF3 A;  4H45 A;  1O63 A;  3OXN A;  3FVN A;  3QUJ A;  3VV5 A;  3PD9 A;  3SER A;  3FV2 A;  1A54 A;  4NED A;  4EUO A;  2OX3 A;  4UAB A;  3C35 A;  1MY2 A;  4OVJ A;  3W9W A;  1QKB A;  4NF5 A;  5EYG A;  1JW5 A;  3VXC A;  4LN5 A;  3EPE A;  3K1N A;  4P1E A;  3PMW A;  3KOT A;  2F78 A;  1MM7 A;  3EQ1 A;  3ZSF A;  4Z7E A;  4G8N A;  1S9T A;  4OVP A;  3KC0 A;  1NFT A;  1YYZ A;  4MHF A;  3S9L C;  2FNC A;  3GBA A;  5EYH A;  1FQF A;  4HE1 A;  3FV1 A;  4PFW A;  5EHM A;  1MQJ A;  1B58 A;  4NWD A;  4IB2 A;  3EHU A;  2FBP A;  3OEL A;  3R7X A;  1LBZ A;  1CNQ A;  3NOH A;  3TCG A;  4AS4 A;  4BDO A;  1N7W A;  1LB8 A;  1Y9U A;  4GD5 A;  4OVQ A;  3IK6 B;  4HCW A;  2Z8E A;  1JEV A;  4G68 A;  3SEW A;  1AOV A;  2QS2 A;  2D21 A;  4FJP A;  1IMB A;  3RPL B;  3OOA A;  1XVY A;  3CFZ A;  4XEQ A;  3G3I A;  1FPI A;  4NG7 A;  4GL8 A;  4MX6 A;  2PT1 A;  1QUI A;  3E9X A;  3TOD A;  4DI4 B;  1IZ1 A;  1FTM A;  2Y84 A;  1S7Y A;  3PPN A;  4FIM A;  2XXW A;  4FEC A;  4PFT A;  3V8X B;  4ESX A;  5I56 A;  4BDL A;  3IOR A;  5I2N A;  1JW4 A;  1A55 A;  4MH5 A;  3G3H A;  4OFL A;  3MW0 A;  1US5 A;  3T9H B;  4HW8 A;  3A3C A;  1JVY A;  5F7V A;  1I6A A;  3KSJ A;  3TAJ A;  1FQD A;  4JDF A;  1OLA A;  3C9H A;  4MNP A;  2PVU A;  4G8H A;  4G77 A;  1ZJL A;  4AB6 A;  4PE5 B;  2F36 A;  4DZ1 A;  3PGF A;  5ITP A;  3I5O A;  3ISP A;  4FEB A;  2YLN A;  4NF8 A;  1FRP A;  3U1O A;  3LBS A;  5FHN A;  3UOR A;  4NMY A;  2XHD A;  2ZZV A;  1UQW A;  4P47 A;  4O8M A;  3PV0 E;  4QSC A;  2G93 A;  3HPI A;  1P1N A;  1YAE A;  2F7A A;  3DP6 A;  3TFL A;  3VLU A;  4F19 A;  3OO7 A;  1IXC A;  3UK4 A;  4NGU A;  1VSO A;  3T96 B;  4GF8 A;  3VVD A;  4NF6 B;  4EXK A;  4PFR A;  1B9J A;  4QF9 A;  1NUW A;  2OWZ A;  3T1B A;  5I57 B;  3O97 A;  4OXV A;  4PP0 A;  1LST A;  3CIJ A;  4N8Y A;  4TOZ A;  1B7Z A;  5I3S A;  3TZA A;  3RNN A;  1MXU A;  3TMG A;  2O69 A;  1SW4 A;  3PPP A;  2B3F A;  1URS A;  1Y3P A;  2WEF A;  3K6X A;  2CEY A;  4JSO A;  3MBP A;  4H8I A;  2CMO A;  1NV1 A;  2Q9T A;  3TEL A;  4I40 A;  1Q9D A;  4O7I A;  1I69 A;  2FA7 A;  1MQH A;  1H43 A;  1FTO A;  4PBH A;  4NTL A;  1MG1 A;  5CMM A;  3A09 A;  3OD7 A;  5IZ3 A;  4JWO A;  4ZS9 A;  4HXV A;  4RPN A;  1US4 A;  2V3T A;  4GXS B;  1Y4T A;  5L9O A;  1RKM A;  5AA2 A;  4NN3 A;  4AQ4 A;  3CHG A;  1FBD A;  1DTZ A;  4F3S A;  4BDQ A;  1LLS A;  3KN3 A;  2IA4 A;  1XOC A;  1JVX A;  3O6I A;  3B6W A;  3MZB A;  2V93 A;  3OSQ A;  1Z7M E;  2QSX A;  3IO4 A;  3FXU A;  4BLA A;  4OYV A;  3SKP A;  4OET A;  3CFL A;  4LQ2 A;  2A5T B;  4JXI A;  2PFZ A;  5L8D A;  5KDT A;  4Q5T A;  4GOT A;  1NMU A;  1B2H A;  3D4C A;  5JK4 A;  1KWH A;  5F1Q A;  4N15 A;  1NV3 A;  3JZJ A;  4XKP A;  1POT A;  3QAX A;  5LTC A;  1QUK A;  1A7L A;  3L6G A;  1MM6 A;  4RYA A;  1VDW A;  1ZMG A;  2CEX A;  2Q8M A;  3HN0 A;  4ZEK A;  3QUF A;  3C31 A;  4H67 A;  2Q2A A;  2PYY A;  4G8M A;  2Z8F A;  2GFE A;  2OWS A;  1MPC A;  1MY1 A;  1NL5 A;  3BKI B;  4OHN A;  4HE2 A;  2RC8 A;  1FPL A;  4F2O A;  4N13 A;  4YKI A;  2XXI A;  1XT8 A;  3B7D A;  3MVY A;  3KN8 A;  3FXR A;  2ZYK A;  1FPJ A;  2Z8D A;  2B4L A;  4GFR A;  1UIU A;  2IEE A;  3MST A;  2XXK A;  4P11 A;  2V3Q A;  3FJM A;  4XFE A;  3LV0 A;  1MH4 A;  4G68 B;  3FAT A;  3ZKL A;  4KQP A;  3C32 A;  1R9Q A;  3LUY A;  3TEP A;  1AWB A;  1FBH A;  5AA4 A;  4GWY A;  4KD5 A;  2B65 A;  3KOS A;  4YIC A;  3OO9 A;  1MPD A;  3PTY A;  3U8Q A;  4U1Z A;  3LUZ A;  4U4S A;  5J16 A;  3IL1 B;  1H76 A;  3BIH A;  1M5B A;  3KJ7 A;  4ESW A;  4OA4 A;  1SYH A;  4JWY A;  3TCF A;  3BFU A;  5I56 B;  2ZYM A;  3SDF A;  4K3F A;  3SEX A;  2F7C A;  1HSJ A;  5I2N B;  1GVC A;  4QSE A;  2F6G A;  1DSN A;  2QJE A;  1OIB A;  4AB5 A;  2KQZ A;  1NUZ A;  3QIM A;  2XXR A;  4F3G A;  3K1M A;  2VPO A;  2V4C A;  2VHA A;  5ICQ A;  2VP1 A;  2QPQ A;  5L9S A;  2DWJ A;  1I6B A;  2I3W A;  2Y5L A;  3HV1 A;  5ET6 A;  4OZ9 A;  2XX9 A;  2ABH A;  1FSA A;  2HCA A;  4OES A;  1MY4 A;  3H6U A;  3U92 A;  3GXA A;  2XXH A;  2XXY A;  4KHZ E;  2QS1 A;  2QMX A;  5EQA A;  3IB0 A;  2YPN A;  4G68 C;  5H8F B;  2DSF A;  4PF8 A;  3HHG A;  3W15 C;  1LCT A;  1BP5 A;  2Q89 A;  4OFJ A;  1QKA A;  4MNI A;  3KGC A;  2RCB A;  1B7U A;  2ZNS A;  3LSW A;  4G2Z A;  2O7I A;  2QVR A;  3IAZ A;  5H8H B;  3FJG A;  1IMF A;  1NNK A;  1P1U A;  3H6W A;  2XXP A;  1B0L A;  1NV4 A;  4DE8 A;  5A5X A;  2XXT A;  2ALU A;  1OVT A;  1RDY A;  5H8Q B;  1O7T A;  3G3G A;  1SW2 A;  1B4H A;  2X7Q A;  3FBP A;  5I59 B;  4KI0 E;  2DE2 A;  1UTH B;  1FBC A;  5ITO A;  3UP9 A;  4GBV A;  4ZEI A;  4FED A;  4P8B A;  2XX8 A;  2I48 A;  3O28 A;  2CZI A;  1DPE A;  4GX3 A;  4HE0 A;  3K6U A;  2H98 A;  4PF6 A;  3CG1 A;  1OQH A;  4NX1 A;  3RGY A;  1IQ7 A;  4NAP A;  2PFY A;  5ESY A;  2Q8J A;  1YTV A;  1JW1 A;  4PFI A;  1R1N A;  1FBG A;  3VLV A;  2UVH A;  4PQJ A;  2ZYO A;  2RKM A;  2L5V A;  2VT5 A;  1FPF A;  3K4U A;  2RCA A;  4KFQ A;  4OMB A;  4F31 B;  3RN8 A;  1MXW A;  3G3J A;  3RYD A;  4U4X A;  4ZE8 A;  1EYK A;  1EZ9 A;  3QSL A;  3H06 B;  1VFD A;  2OWT A;  2F3B A;  3PMV A;  2Z23 A;  2VD2 A;  2XWI A;  3RQT A;  3H03 A;  4XKN A;  3VVE A;  2WBB A;  1HSE A;  2DOJ A;  3O66 A;  1MQD A;  2I0C A;  1TFA A;  2V84 A;  2HXW A;  1PB9 A;  1QUJ A;  3OO6 A;  3SEU A;  5CM6 A;  5DW8 A;  5KDT B;  4ZED A;  3EHT A;  3GBB A;  1SYI A;  5JEI A;  4GWO A;  1FBE A;  4EQB A;  1AL3 A;  1Q35 A;  3T9X B;  4R9G A;  1K9Z A;  1Y1M A;  4P3L A;  3KSX A;  4O3B A;  1ELJ A;  4E0X A;  2W7Y A;  3U65 A;  4KR5 A;  5ET7 A;  4F2Q A;  5KCJ B;  1FQB A;  3K02 A;  4H0W A;  4MFI A;  5FTI A;  3TUS A;  4DIG A;  4BDN A;  4XTC Q;  2ONR A;  2XWK A;  4OTE A;  4EXL A;  5CC2 A;  4P56 A;  3MPK A;  3UA8 A;  2PMS A;  2WBD A;  3IFC A;  3D1R A;  3O6G A;  1TFD A;  5DTB A;  3HCQ A;  1IMD A;  3MP8 A;  3EKI A;  1B3G A;  5B70 A;  3MWB A;  4O3C A;  2Y5K A;  2XXV A;  3G3F A;  2OBG A;  2XXX A;  3C36 A;  1OMP A;  5TPA A;  4N6P A;  1IUD A;  5EYF A;  4I9D A;  4QRZ A;  2DWH A;  2GH9 A;  4ELO A;  3S9E A;  2UYE A;  2I4C A;  3TYH A;  3D4G A;  5AA4 B;  2HAU A;  1NV5 A;  5TP9 B;  4LA9 A;  2ZXT A;  4U23 A;  3H3G A;  3KBR A;  1P1O A;  4NHB A;  2B4M A;  3CG3 A;  4I62 A;  4QFL A;  3FVO A;  4GWX A;  3VDF A;  3FJ7 A;  4P0I A;  4MCO A;  2GHA A;  1Y3Q A;  4I1D A;  3BBR A;  3SZP A;  2GQ1 A;  2R9J A;  2DVC A;  5JTY A;  4DXC A;  1URD A;  1VE4 A;  4ELQ A;  4R9F A;  2E0S A;  4N6D A;  2QRY A;  2HFB A;  4YMA A;  1DTG A;  5DEX A;  5J1D A;  2Q2C A;  1FBP A;  4PAF A;  3EN3 A;  3MUQ A;  4ZEB A;  4KPT A;  3FIR A;  1NH8 A;  1BK4 A;  1S50 A;  5B7D A;  5DVF A;  1LEV A;  4R2B A;  4R6Y A;  5KZT A;  3PUV E;  5I58 A;  3MC2 A;  1T0K A;  2FIX A;  3Q28 A;  3S4U A;  3VFJ A;  3OEN A;  4NE4 A;  1MY0 A;  2ZNT A;  1B51 A;  4QBA A;  4NF0 A;  3N26 A;  2P3N A;  1IMA A;  1NV2 A;  3IX1 A;  4OEU A;  4THI A;  5ET5 A;  3U72 A;  4P9K A;  3IFA A;  4F29 A;  4RXL A;  4DCY A;  2Z22 A;  4H5F A;  1NNT A;  4IO7 A;  4QSD A;  4R6K A;  3FVG A;  2HHM A;  3JV9 A;  1M5E A;  4ONY A;  3O6H A;  3TTR A;  1VFE A;  1G0I A;  4GWS A;  1MQG A;  1SVX B;  1R6Z A;  4OEN A;  4LVQ A;  4IR8 A;  3K6W A;  1DBZ A;  3Q26 A;  3S9N C;  4OEV A;  4IO6 A;  1OQG A;  4MAG A;  4RJZ A;  4XXU A;  4PDD A;  4IO2 A;  1IXI A;  1OVB A;  1NV0 A;  1QVS A;  5A5X B;  4X8R A;  3ROJ A;  1YXI A;  2O1L A;  4JB7 A;  3TTM A;  5I2K A;  3TKD A;  1ZBM A;  2QL3 A;  2QS3 A;  4XKR A;  1GTK A;  3IOT A;  5LOM A;  5ICT A;  1F9B A;  4YKP A;  4KXP A;  2R8T A;  5IM2 A;  1B0H A;  2DWA A;  4OER A;  2Y7R A;  3K01 A;  2P1S A;  1LAX A;  3MAM A;  3S9M C;  4JVC A;  1MXZ A;  4Q0C A;  1LFI A;  3KFM A;  3K1P A;  1MDQ A;  1SI1 A;  1USY H;  4PAI A;  1FCK A;  4IO3 A;  4H8J A;  1B4Z A;  1QW0 A;  2AIX A;  4LP2 B;  4MJO A;  4ZEF A;  5AA1 A;  2O51 A;  1N7X A;  1URG A;  1SW1 A;  2V25 A;  2X26 A;  3ZKK A;  4IGT A;  4XIG Q;  4NF5 B;  4ND9 A;  5L9M A;  3TTK A;  1ATG A;  3SEY A;  1PDA A;  4JVI A;  1B05 A;  1MXY A;  4I8C A;  5I7I A;  2QFL A;  1PB7 A;  3HST A;  2PBW A;  4U1O A;  3LSL A;  2HZL A;  1D4N A;  2ANJ A;  5HM4 B;  4RNS A;  5F24 A;  5K2Y A;  2DYX A;  2O84 X;  3DP4 A;  3I3V A;  2V3U A;  1QJM A;  2GHB A;  2AYS A;  3FXB A;  3TTL A;  1MH3 A;  3PPO A;  1DOT A;  1FTL A;  1FQA A;  3TQW A;  2FYI A;  4WED A;  3MVW A;  4JSD A;  2CZK A;  3K2D A;  3IOW A;  3TDJ A;  4PBQ A;  1GGG A;  4R2F A;  3LSX A;  4PAK A;  2DE4 A;  2DWI A;  3VXB A;  4WEP A;  5DYH A;  4LUB A;  1OLC A;  3USD A;  1DCU A;  1KA1 A;  1EZP A;  2ESN A;  3MP6 A;  1PBP A;  4OQO A;  1LFG A;  4X9T A;  3KG2 A;  4EQ9 A;  2D3I A;  3A29 A;  3EF7 A;  1UTB A;  4X04 A;  1P1W A;  3O2A A;  2XX7 A;  4X1D A;  2F8D A;  3U93 A;  2I6E A;  4OFO A;  2B3B A;  2O6A A;  1AIV A;  1XVX A;  3UGW A;  1YCJ A;  4Z0I A;  4YMB A;  4OAN A;  4GWW A;  5IAI A;  5TPA B;  1N3W A;  4LAT A;  4UA8 A;  4DI3 D;  2CZH A;  1JET A;  1B3H A;  1NUX A;  1DK4 A;  2DXR A;  3RPW A;  5IKB A;  3H6T A;  1RYX A;  2DP8 A;  1FTK A;  4P1L A;  4PET A;  1A8E A;  4FBP A;  2KLF A;  4GVO A;  3G7W A;  4C1U A;  1LCF A;  1FPK A;  1NNP A;  5EHS A;  4TQU Q;  3T66 A;  3PUZ E;  5I84 A;  2OZZ A;  1R9L A;  4PGN A;  3ILT B;  3T93 B;  3E13 X;  1B46 A;  2AL5 A;  2YJP A;  4DLD A;  5IZ1 A;  4NF4 A;  5CBS A;  4QFO A;  1LGB C;  2DS9 A;  4NF8 B;  4MEV A;  3E78 A;  1ZIU A;  1XS5 A;  2Q88 A;  5I5P A;  2RF1 A;  4IY5 A;  4ZEC A;  4OVR A;  3FAS A;  4I3E A;  2Y7P A;  1K9Y A;  2H25 A;  2DDK A;  5T3J A;  1ZTY A;  1SPI A;  5ISU A;  2PCR A;  4FAT A;  1TT1 A;  3IO6 A;  1JP4 A;  5I57 A;  1SBP A;  3T0J A;  3IR1 A;  4LQ5 A;  5CMB A;  2FHY A;  3DP8 A;  4U22 A;  1FQE A;  3HFU A;  2JJK A;  2HEU A;  2XXQ A;  3L6H A;  3V83 A;  2XWO A;  3WAE A;  1RDZ A;  1B3F A;  2MKZ A;  1B1X A;  2I0B A;  2I58 A;  3KZG A;  3H7M A;  1ZU0 A;  1MY3 A;  2KR0 A;  5DVJ A;  3V5A A;  3T22 A;  4EF2 A;  4GXA A;  4PDH A;  2E1S A;  3RUM A;  4GL0 A;  1IXH A;  1VR5 A;  1BKA A;  1B3L A;  5BUU A;  2XXU A;  4U2R A;  1FPG A;  3U94 A;  1B3E A;  3RLF E;  1FPD A;  3OMB A;  4H6D A;  1PEB A;  4UAC A;  5DT6 A;  4JWX A;  1M5F A;  4O3A A;  4MBP A;  4OVT A;  4NWC A;  1EU8 A;  4HTG A;  2F97 A;  1A8F A;  4N91 A;  2A5S A;  5IZ3 B;  1MXX A;  4PGP A;  2HQ0 A;  3CFX A;  2F35 A;  1Y1Z A;  1NKX A;  4OWD A;  1LFH A;  4GWZ A;  1LB9 A;  4N6K A;  3MZ1 A;  1AMF A;  3CVG A;  5AA2 D;  1I6Q A;  5AA2 B;  4GX4 A;  1LBX A;  2P2A A;  2CZL A;  2UVG A;  3VE1 B;  2A5T A;  3SET A;  3VVF A;  1FPB A;  4MLQ A;  2OJT A;  1EH3 A;  4ELR A;  1JQF A;  1LAH E;  4GRK A;  4PTK A;  4LZ7 A;  1IEJ A;  1A99 A;  3PPR A;  5M2V A;  3KBZ A;  4FAJ A;  4JBZ A;  1Q1K A;  1B40 A;  2H9B A;  2BJI A;  4GIZ A;  1JNF A;  3FZV A;  1IIT A;  2G29 A;  1A40 A;  3GZG A;  4N07 A;  1PBQ A;  2Y7I A;  4HCY A;  4NQ8 A;  2X7P A;  2F3D A;  3M8U A;  4DXU A;  2HAV A;  3CI8 A;  2O7U A;  5CMC A;  1Y4C A;  3MVX A;  4PC9 A;  4MNC A;  1MRP A;  4QFN A;  1EYI A;  2H4I A;  1D9Q A;  4JVD A;  3PU5 A;  1B6H A;  1ZKB A;  1GR2 A;  2Y7K A;  2LAO A;  3P7I A;  2PX1 A;  2REJ A;  3RT8 A;  2F34 A;  3TPA A;  2P3V A;  3B8B A;  4PFU A;  4Q30 B;  3KC1 A;  3O9P A;  1USY E;  4GLI A;  3N6U A;  4RPO A;  2I3V A;  1YZ0 A;  4M4G A;  3Q29 A;  3IJX B;  5ELV A;  2PT2 A;  1H44 A;  4E0W A;  4G61 A;  2GRV A;  1B32 A;  3C34 A;  4PE3 A;  1IME A;  1FW0 A;  3MP1 A;  4LON B;  1UTB B;  4IGR A;  4FOR A;  1LBY A;  4X1B A;  1P1Q A;  4F3B A;  2HZK A;  4I3Y A;  3SEV A;  3CRB A;  3O29 A;  3E3K A;  1YPN A;  3CSG A;  2UXA A;  1NV6 A;  1M5C A;  3QK6 A;  3HO7 A;  1N3X A;  2ONK E;  1TWY A;  5HBC A;  5AA3 A;  1D3K A;  4M1V A;  4WKM A;  3TQL A;  1LBB A;  2OCU A;  4AS5 A;  1IXG A;  3T9U A;  4F39 A;  3PMX A;  2RIN A;  4H65 A;  2R6G E;  3OEM A;  3SES A;  2XWV A;  3FVK A;  3K00 A;  3UN6 A;  2DVZ A;  5BWJ A;  1FTJ A;  5FBP A;  5H8F A;  2R71 A;  1QUL A;  3C33 A;  1NI9 A;  2OLB A;  3RT6 B;  4DDD A;  4NF4 B;  3TTN A;  2RC9 A;  1IIW A;  3RTF B;  3KJT A;  2P0S A;  4L17 A;  4ZE9 A;  4MLV A;  1BLF A;  4YB5 A;  1LAF E;  4KYE A;  4IO4 A;  2F6P A;  5H8H A;  5IGA A;  3RY3 A;  1O64 A;  2QVV A;  3R6U A;  4H5G A;  3B6Q A;  1B5J A;  3K6V A;  4LZ5 A;  4G4P A;  5H8Q A;  2ZMB A;  1INP A;  5H8N A;  5I59 A;  1II5 A;  4GQO A;  1UTH A;  3R26 A;  3PUX E;  2ZZW A;  5H8S A;  2XD3 A;  2DQV A;  4YKJ A;  4WXJ A;  4R6H A;  3W9V A;  4EF1 A;  4FE8 A;  2WYK A;  2DXY A;  3ECR A;  1ZLQ A;  2F7B A;  1LBW A;  1KZ8 A;  3BFT A;  4ZDM A;  2HXR A;  2AL4 A;  4ECF A;  4IY6 A;  3B50 A;  4U21 A;  3VLW A;  1FQC A;  3F11 A;  1RDX A;  1P99 A;  3LSF B;  1WVJ A; 
#chains in the Genus database with same CATH homology
 3TCH A;  4X48 A;  5AE4 A;  4P0G A;  1B1H A;  1N04 A;  3M3K A;  4EDP A;  2REG A;  3JYR A;  1SI0 A;  2H5Y A;  1EZO A;  3G3K A;  3IOU A;  4F1U A;  1N84 A;  4KYD A;  5DVI A;  2UYF A;  2BJJ X;  2UVJ A;  4YZZ A;  3DEL B;  4F18 A;  3HHF A;  3Q25 A;  3I6V A;  2QS4 A;  3IB2 A;  3AXF A;  1B5H A;  4F22 A;  1BIY A;  4DXB A;  4IO5 A;  4TLL B;  3FXQ A;  3QYT A;  4PFY A;  4ZZA A;  2ZYN A;  4POX A;  2I49 A;  4C1T A;  2THI A;  1LAG E;  1MDP 1;  3IB1 A;  1D9V A;  5KCJ A;  3MZ9 A;  2I4B A;  3OSR A;  4QHQ A;  2VGQ A;  2VOZ A;  3S2V A;  3WAF A;  3N94 A;  3C4M A;  1SDX A;  5TU0 A;  3EHS A;  3FUZ A;  3LC8 A;  5CRY A;  3PD8 A;  5K2X A;  3DM0 A;  1CE2 A;  3LR1 A;  1DPP A;  4R72 A;  1MS7 A;  2DE3 A;  3KN7 A;  1WDN A;  5FHM A;  3THI A;  1MPB A;  3CSB A;  2ZNU A;  1H3D A;  1M5D A;  5FHO A;  4F3P A;  1B5I A;  1H45 A;  3ZS6 A;  5CBR A;  4LZ8 A;  5TP9 A;  1SQY A;  3FD3 A;  3QXM A;  2QMW A;  4POW A;  3N6T A;  2UVI A;  2NXO A;  4R75 A;  1TXF A;  3CR9 A;  3IJO B;  4XKQ A;  4RK9 A;  2OK2 A;  1Z7N E;  1HSL A;  2Y7W A;  4QFK A;  3MVZ A;  4H1X A;  1MXV A;  1DMB A;  1SW5 A;  4R73 A;  3MJN A;  3Q27 A;  1XHY A;  2NWJ A;  3V89 B;  1CB6 A;  1AH5 A;  2D5W A;  4RY1 A;  3M3L A;  3PPQ A;  3DLN A;  1D9Y A;  3B6T A;  5FTH A;  3ODB A;  1RYO A;  3T9V A;  1BTJ A;  4QFP A;  3MPL A;  2F5X A;  3OEK A;  1UIV A;  2NUV A;  5JTY B;  3E4R A;  2NVU B;  1XC1 A;  5DEX B;  3H6V A;  4HS7 A;  2O1M A;  1MQI A;  4DCX A;  3UIF A;  4YU0 A;  1PC3 A;  4NF6 A;  3MQ9 A;  1POY 1;  4KCD A;  4C0R A;  5I58 B;  3N5L A;  4F1V A;  3IOV A;  3A3U A;  1SD3 A;  4BDM A;  1GV8 A;  3ONM A;  1LBC A;  1N76 A;  3FGS A;  4R74 A;  4F1Y A;  2H99 A;  4YB6 A;  1J1N A;  3KEI A;  1N0T A;  2M8C A;  3GLB A;  4KCC A;  1Y20 A;  5CMK A;  2VD3 A;  4ISU A;  2RC7 A;  4ZZE A;  3PUY E;  4EQ7 A;  5HPQ A;  1JEU A;  3RTW B;  3H4Z A;  5CI5 A;  2WKY A;  4RA1 A;  2O68 A;  1Y3N A;  3PUW E;  1B7H A;  3K0V A;  4RK2 A;  2ONS A;  1PB8 A;  4TLM B;  1WOD A;  5H8N B;  4YKK A;  1B52 A;  1L5T A;  4YB7 A;  3M3F A;  2XD2 A;  3OO8 A;  4BDR A;  4YAH X;  2NOO A;  5I2K B;  1ANF A;  4KYS A;  1NH7 A;  3ILU B;  1NNF A;  4Q8R A;  4ELP A;  4MF3 A;  1O63 A;  3OXN A;  3FVN A;  3QUJ A;  3VV5 A;  3PD9 A;  3SER A;  3FV2 A;  1A54 A;  4NED A;  4EUO A;  3C35 A;  1MY2 A;  4OVJ A;  3W9W A;  1QKB A;  4NF5 A;  1JW5 A;  3VXC A;  3EPE A;  3K1N A;  3PMW A;  3KOT A;  2F78 A;  1MM7 A;  3EQ1 A;  3ZSF A;  4Z7E A;  4G8N A;  1S9T A;  1NFT A;  3S9L C;  2FNC A;  3GBA A;  1FQF A;  3FV1 A;  4PFW A;  5EHM A;  1MQJ A;  1B58 A;  4NWD A;  4IB2 A;  3EHU A;  3OEL A;  3R7X A;  3TCG A;  4BDO A;  1N7W A;  1LB8 A;  1Y9U A;  4GD5 A;  3IK6 B;  2Z8E A;  4HCW A;  1JEV A;  4G68 A;  3SEW A;  1AOV A;  2QS2 A;  2D21 A;  4FJP A;  3OOA A;  1XVY A;  3CFZ A;  3G3I A;  4GL8 A;  2PT1 A;  1QUI A;  3E9X A;  3TOD A;  1IZ1 A;  1FTM A;  2Y84 A;  1S7Y A;  3PPN A;  4FIM A;  2XXW A;  4FEC A;  4PFT A;  3V8X B;  4ESX A;  5I56 A;  4BDL A;  3IOR A;  5I2N A;  1JW4 A;  1A55 A;  4MH5 A;  3G3H A;  4OFL A;  3MW0 A;  1US5 A;  3T9H B;  4HW8 A;  3A3C A;  1JVY A;  5F7V A;  1I6A A;  3KSJ A;  3TAJ A;  1FQD A;  4JDF A;  1OLA A;  3C9H A;  2PVU A;  4G8H A;  4G77 A;  1ZJL A;  4AB6 A;  4PE5 B;  2F36 A;  4DZ1 A;  3PGF A;  5ITP A;  3I5O A;  4FEB A;  2YLN A;  4NF8 A;  3U1O A;  3LBS A;  5FHN A;  3UOR A;  4NMY A;  2XHD A;  1UQW A;  3PV0 E;  4QSC A;  2G93 A;  3HPI A;  1P1N A;  1YAE A;  2F7A A;  3DP6 A;  3TFL A;  3VLU A;  4F19 A;  3OO7 A;  1IXC A;  3UK4 A;  1VSO A;  3T96 B;  4GF8 A;  3VVD A;  4NF6 B;  4EXK A;  1B9J A;  4QF9 A;  5I57 B;  3O97 A;  4OXV A;  4PP0 A;  1LST A;  3CIJ A;  4TOZ A;  1B7Z A;  3TZA A;  3RNN A;  1MXU A;  3TMG A;  2O69 A;  1SW4 A;  3PPP A;  2B3F A;  1URS A;  1Y3P A;  3K6X A;  4JSO A;  3MBP A;  4H8I A;  2CMO A;  2Q9T A;  3TEL A;  1I69 A;  2FA7 A;  1MQH A;  1H43 A;  1FTO A;  4NTL A;  1MG1 A;  5CMM A;  3A09 A;  3OD7 A;  4JWO A;  4ZS9 A;  4RPN A;  1US4 A;  2V3T A;  4GXS B;  1Y4T A;  5L9O A;  1RKM A;  5AA2 A;  4AQ4 A;  1DTZ A;  4F3S A;  4BDQ A;  1LLS A;  3KN3 A;  2IA4 A;  1XOC A;  1JVX A;  3O6I A;  3B6W A;  3MZB A;  2V93 A;  3OSQ A;  1Z7M E;  2QSX A;  3IO4 A;  3FXU A;  4BLA A;  4OYV A;  3SKP A;  4OET A;  3CFL A;  4LQ2 A;  2A5T B;  4JXI A;  5L8D A;  5KDT A;  4Q5T A;  4GOT A;  1NMU A;  1B2H A;  3D4C A;  5JK4 A;  1KWH A;  5F1Q A;  3JZJ A;  4XKP A;  1POT A;  3QAX A;  1QUK A;  1A7L A;  3L6G A;  1MM6 A;  4RYA A;  1ZMG A;  3HN0 A;  4ZEK A;  3QUF A;  3C31 A;  4H67 A;  2Q2A A;  2PYY A;  4G8M A;  2Z8F A;  2GFE A;  2OWS A;  1MPC A;  1MY1 A;  1NL5 A;  3BKI B;  4OHN A;  2RC8 A;  4F2O A;  4N13 A;  4YKI A;  2XXI A;  1XT8 A;  3B7D A;  3MVY A;  3KN8 A;  3FXR A;  2ZYK A;  2Z8D A;  4GFR A;  1UIU A;  2IEE A;  4P11 A;  2V3Q A;  3FJM A;  1MH4 A;  4G68 B;  3FAT A;  3ZKL A;  4KQP A;  3C32 A;  1R9Q A;  3LUY A;  3TEP A;  5AA4 A;  4KD5 A;  2B65 A;  3KOS A;  4YIC A;  3OO9 A;  1MPD A;  3U8Q A;  4U1Z A;  4U4S A;  3IL1 B;  1H76 A;  1M5B A;  3KJ7 A;  4ESW A;  1SYH A;  4JWY A;  3TCF A;  3BFU A;  5I56 B;  2ZYM A;  3SDF A;  4K3F A;  3SEX A;  2F7C A;  1HSJ A;  5I2N B;  1GVC A;  4QSE A;  2F6G A;  1DSN A;  2QJE A;  1OIB A;  4AB5 A;  3QIM A;  2XXR A;  4F3G A;  3K1M A;  2VHA A;  5ICQ A;  2VP1 A;  2QPQ A;  5L9S A;  2DWJ A;  1I6B A;  2I3W A;  3HV1 A;  4OZ9 A;  2XX9 A;  2ABH A;  2HCA A;  4OES A;  1MY4 A;  3H6U A;  3U92 A;  3GXA A;  2XXH A;  2XXY A;  4KHZ E;  2QS1 A;  2QMX A;  3IB0 A;  2YPN A;  4G68 C;  5H8F B;  2DSF A;  3HHG A;  3W15 C;  1LCT A;  1BP5 A;  2Q89 A;  4OFJ A;  1QKA A;  3KGC A;  2RCB A;  1B7U A;  2ZNS A;  3LSW A;  4G2Z A;  2O7I A;  3IAZ A;  5H8H B;  3FJG A;  1NNK A;  1P1U A;  3H6W A;  2XXP A;  1B0L A;  4DE8 A;  5A5X A;  2XXT A;  2ALU A;  1OVT A;  5H8Q B;  1O7T A;  3G3G A;  1SW2 A;  1B4H A;  2X7Q A;  5I59 B;  4KI0 E;  2DE2 A;  1UTH B;  5ITO A;  3UP9 A;  4ZEI A;  4FED A;  2XX8 A;  2I48 A;  3O28 A;  1DPE A;  3K6U A;  2H98 A;  3CG1 A;  1OQH A;  3RGY A;  1IQ7 A;  2Q8J A;  1YTV A;  1JW1 A;  1R1N A;  3VLV A;  2UVH A;  4PQJ A;  2ZYO A;  2RKM A;  3K4U A;  2RCA A;  4KFQ A;  4OMB A;  4F31 B;  3RN8 A;  1MXW A;  3G3J A;  4U4X A;  4ZE8 A;  1EZ9 A;  3QSL A;  3H06 B;  1VFD A;  2OWT A;  3PMV A;  2Z23 A;  2VD2 A;  3RQT A;  3H03 A;  4XKN A;  3VVE A;  1HSE A;  2DOJ A;  3O66 A;  1MQD A;  2I0C A;  1TFA A;  2V84 A;  2HXW A;  1PB9 A;  1QUJ A;  3OO6 A;  3SEU A;  5CM6 A;  5KDT B;  4ZED A;  3EHT A;  3GBB A;  1SYI A;  5JEI A;  4GWO A;  4EQB A;  1AL3 A;  1Q35 A;  3T9X B;  4R9G A;  1Y1M A;  3KSX A;  4O3B A;  1ELJ A;  4E0X A;  2W7Y A;  4KR5 A;  4F2Q A;  5KCJ B;  1FQB A;  3K02 A;  4H0W A;  4MFI A;  5FTI A;  3TUS A;  4DIG A;  4BDN A;  4XTC Q;  2ONR A;  4OTE A;  4EXL A;  5CC2 A;  3MPK A;  3UA8 A;  2PMS A;  3O6G A;  1TFD A;  5DTB A;  3HCQ A;  3MP8 A;  1B3G A;  5B70 A;  3MWB A;  4O3C A;  2XXV A;  3G3F A;  2OBG A;  2XXX A;  3C36 A;  1OMP A;  5TPA A;  4N6P A;  1IUD A;  5EYF A;  4I9D A;  4QRZ A;  2DWH A;  2GH9 A;  4ELO A;  3S9E A;  2UYE A;  2I4C A;  3TYH A;  3D4G A;  5AA4 B;  2HAU A;  5TP9 B;  4LA9 A;  2ZXT A;  3H3G A;  4U23 A;  3KBR A;  1P1O A;  3CG3 A;  4I62 A;  4QFL A;  3FVO A;  3VDF A;  3FJ7 A;  4P0I A;  2GHA A;  1Y3Q A;  4I1D A;  3BBR A;  2R9J A;  2DVC A;  5JTY A;  4DXC A;  1URD A;  1VE4 A;  4ELQ A;  4R9F A;  2E0S A;  2QRY A;  2HFB A;  4YMA A;  1DTG A;  5DEX A;  5J1D A;  2Q2C A;  3EN3 A;  3MUQ A;  4ZEB A;  4KPT A;  3FIR A;  1NH8 A;  1S50 A;  5B7D A;  5DVF A;  4R2B A;  4R6Y A;  5KZT A;  3PUV E;  5I58 A;  3MC2 A;  1T0K A;  3Q28 A;  3S4U A;  3VFJ A;  3OEN A;  4NE4 A;  1MY0 A;  2ZNT A;  1B51 A;  3N26 A;  3IX1 A;  4OEU A;  4THI A;  3U72 A;  4F29 A;  4RXL A;  4DCY A;  2Z22 A;  4H5F A;  1NNT A;  4IO7 A;  4QSD A;  4R6K A;  3FVG A;  3JV9 A;  1M5E A;  4ONY A;  3O6H A;  3TTR A;  1VFE A;  1MQG A;  1SVX B;  1R6Z A;  4OEN A;  4LVQ A;  3K6W A;  3Q26 A;  3S9N C;  4OEV A;  4IO6 A;  1OQG A;  4RJZ A;  4XXU A;  4IO2 A;  1IXI A;  1OVB A;  1QVS A;  5A5X B;  2O1L A;  4JB7 A;  3TTM A;  5I2K A;  3TKD A;  1ZBM A;  2QL3 A;  2QS3 A;  4XKR A;  1GTK A;  3IOT A;  5LOM A;  5ICT A;  1F9B A;  4YKP A;  1B0H A;  2DWA A;  4OER A;  2Y7R A;  3K01 A;  2P1S A;  1LAX A;  3MAM A;  3S9M C;  1MXZ A;  4Q0C A;  1LFI A;  3KFM A;  3K1P A;  1MDQ A;  1SI1 A;  1USY H;  1FCK A;  4IO3 A;  4H8J A;  1B4Z A;  1QW0 A;  2AIX A;  4LP2 B;  4ZEF A;  5AA1 A;  2O51 A;  1N7X A;  1URG A;  1SW1 A;  2V25 A;  2X26 A;  3ZKK A;  4IGT A;  4XIG Q;  4NF5 B;  4ND9 A;  5L9M A;  3TTK A;  1ATG A;  3SEY A;  1PDA A;  1B05 A;  1MXY A;  4I8C A;  1PB7 A;  3HST A;  2PBW A;  4U1O A;  3LSL A;  2HZL A;  1D4N A;  2ANJ A;  5HM4 B;  4RNS A;  5K2Y A;  2DYX A;  2O84 X;  3DP4 A;  3I3V A;  2V3U A;  1QJM A;  2GHB A;  2AYS A;  3TTL A;  1MH3 A;  3PPO A;  1DOT A;  1FTL A;  1FQA A;  3TQW A;  2FYI A;  4WED A;  3MVW A;  4JSD A;  3K2D A;  3IOW A;  3TDJ A;  1GGG A;  4R2F A;  3LSX A;  2DE4 A;  2DWI A;  3VXB A;  4WEP A;  5DYH A;  4LUB A;  1OLC A;  3USD A;  1EZP A;  2ESN A;  3MP6 A;  1PBP A;  4OQO A;  1LFG A;  4X9T A;  3KG2 A;  4EQ9 A;  2D3I A;  3EF7 A;  1UTB A;  1P1W A;  3O2A A;  2XX7 A;  4X1D A;  2F8D A;  3U93 A;  2I6E A;  4OFO A;  2B3B A;  2O6A A;  1AIV A;  1XVX A;  3UGW A;  1YCJ A;  4Z0I A;  4YMB A;  5IAI A;  5TPA B;  1N3W A;  4LAT A;  4UA8 A;  1JET A;  1B3H A;  2DXR A;  3RPW A;  5IKB A;  3H6T A;  1RYX A;  2DP8 A;  1FTK A;  4PET A;  1A8E A;  2KLF A;  4GVO A;  3G7W A;  4C1U A;  1LCF A;  1NNP A;  5EHS A;  4TQU Q;  3T66 A;  3PUZ E;  5I84 A;  2OZZ A;  1R9L A;  3ILT B;  3T93 B;  3E13 X;  1B46 A;  2AL5 A;  2YJP A;  4DLD A;  4NF4 A;  5CBS A;  4QFO A;  1LGB C;  2DS9 A;  4NF8 B;  1ZIU A;  1XS5 A;  2Q88 A;  2RF1 A;  4IY5 A;  4ZEC A;  3FAS A;  2Y7P A;  2H25 A;  1ZTY A;  5ISU A;  4FAT A;  1TT1 A;  3IO6 A;  5I57 A;  1SBP A;  3IR1 A;  4LQ5 A;  5CMB A;  3DP8 A;  4U22 A;  1FQE A;  2XXQ A;  2HEU A;  3L6H A;  3V83 A;  3WAE A;  1B3F A;  1B1X A;  2I0B A;  2I58 A;  3KZG A;  3H7M A;  1ZU0 A;  1MY3 A;  5DVJ A;  3V5A A;  3T22 A;  4EF2 A;  4GXA A;  2E1S A;  3RUM A;  4GL0 A;  1IXH A;  1VR5 A;  1BKA A;  1B3L A;  5BUU A;  2XXU A;  4U2R A;  3U94 A;  1B3E A;  3RLF E;  3OMB A;  4H6D A;  1PEB A;  4UAC A;  5DT6 A;  4JWX A;  1M5F A;  4O3A A;  4MBP A;  4NWC A;  1EU8 A;  4HTG A;  2F97 A;  1A8F A;  2A5S A;  1MXX A;  2HQ0 A;  3CFX A;  2F35 A;  1Y1Z A;  1NKX A;  4OWD A;  1LFH A;  1LB9 A;  3MZ1 A;  1AMF A;  3CVG A;  5AA2 D;  1I6Q A;  5AA2 B;  2P2A A;  2CZL A;  2UVG A;  3VE1 B;  2A5T A;  3SET A;  3VVF A;  4MLQ A;  2OJT A;  1EH3 A;  4ELR A;  1JQF A;  1LAH E;  4GRK A;  4LZ7 A;  1IEJ A;  1A99 A;  3PPR A;  5M2V A;  4FAJ A;  4JBZ A;  1Q1K A;  1B40 A;  2H9B A;  4GIZ A;  1JNF A;  3FZV A;  1IIT A;  2G29 A;  1A40 A;  3GZG A;  4N07 A;  1PBQ A;  2Y7I A;  4HCY A;  2X7P A;  3M8U A;  4DXU A;  2HAV A;  3CI8 A;  2O7U A;  5CMC A;  1Y4C A;  3MVX A;  1MRP A;  4QFN A;  2H4I A;  3PU5 A;  1B6H A;  1ZKB A;  1GR2 A;  2Y7K A;  2LAO A;  3P7I A;  2PX1 A;  2REJ A;  3RT8 A;  2F34 A;  3TPA A;  4PFU A;  4Q30 B;  3O9P A;  1USY E;  4GLI A;  3N6U A;  4RPO A;  2I3V A;  4M4G A;  3Q29 A;  3IJX B;  5ELV A;  2PT2 A;  1H44 A;  4E0W A;  2GRV A;  1B32 A;  3C34 A;  1FW0 A;  3MP1 A;  4LON B;  1UTB B;  4IGR A;  4FOR A;  4X1B A;  1P1Q A;  4F3B A;  2HZK A;  3SEV A;  3CRB A;  3O29 A;  3E3K A;  1YPN A;  3CSG A;  2UXA A;  1M5C A;  3QK6 A;  3HO7 A;  1N3X A;  2ONK E;  1TWY A;  5HBC A;  5AA3 A;  1D3K A;  4M1V A;  4WKM A;  3TQL A;  1LBB A;  2OCU A;  1IXG A;  3T9U A;  4F39 A;  3PMX A;  2RIN A;  4H65 A;  2R6G E;  3OEM A;  3SES A;  3FVK A;  3K00 A;  3UN6 A;  2DVZ A;  5BWJ A;  1FTJ A;  5H8F A;  2R71 A;  1QUL A;  3C33 A;  2OLB A;  3RT6 B;  4DDD A;  4NF4 B;  3TTN A;  2RC9 A;  1IIW A;  3RTF B;  3KJT A;  2P0S A;  4L17 A;  4ZE9 A;  4MLV A;  1BLF A;  4YB5 A;  1LAF E;  4KYE A;  4IO4 A;  2F6P A;  5H8H A;  3RY3 A;  1O64 A;  3R6U A;  4H5G A;  3B6Q A;  1B5J A;  3K6V A;  4LZ5 A;  4G4P A;  5H8Q A;  2ZMB A;  5H8N A;  5I59 A;  1II5 A;  4GQO A;  1UTH A;  3R26 A;  3PUX E;  5H8S A;  2XD3 A;  2DQV A;  4YKJ A;  4WXJ A;  4R6H A;  3W9V A;  4EF1 A;  4FE8 A;  2DXY A;  3ECR A;  1ZLQ A;  2F7B A;  3BFT A;  4ZDM A;  2AL4 A;  4ECF A;  4IY6 A;  4U21 A;  3VLW A;  1FQC A;  3F11 A;  1P99 A;  3LSF B;  1WVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...