3MC2A

Crystal structure of the murine inhibitor of carbonic anhydrase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
679
structure length
675
Chain Sequence
EKTIRWCVVSDHEATKCSSFRDNMKKVLPAGGPAVTCVRKMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYYGSKDDPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETAAATFFSSSCVPCADGKMFPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVSFVKHLTVFEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDSIQELLRVAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKIDISLYLGYEFLSAFRNLKRSQRVKWCAVGQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEADAMSLDGGFAYVAGHCGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVGITWKSLQGKKSCHTAVGTSEGWNVPMGLIYDQTGSCKFDAFFSRSCAPGSDPDSPLCALCVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGLKHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSAKDLLFSDDTECLSNLQDKTTYKTYLGPQYLTLMDNFRQCLSSELLDACTFHKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure and evolution of the murine inhibitor of carbonic anhydrase: A member of the transferrin superfamily.
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase inhibitor
molecule keywords Inhibitor of Carbonic Anhydrase
total genus 154
structure length 675
sequence length 679
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A03
1MXZA 1S7YA 4PFYA 3C4MA 1DMBA 4POWA 1FQDA 1OQGA 2RC9A 3O97A 3EF7A 4PQJA 4ZEBA 3WAFA 3MW0A 3IR1A 5CMKA 3FZVA 3OELA 3N94A 1MY2A 2I49A 3G3IA 4GOTA 2H99A 4POXA 1KWHA 1JVYA 4OFLA 1YPNA 4R73A 1MQIA 1ZMGA 3P7IA 4TOZA 2OWSA 5I59B 2PBWA 1B0LA 1SBPA 1MM6A 2NVUB 3KZGA 3L6HA 4XKRA 5I58B 1A8FA 1Y4TA 3TODA 3O2AA 3CG3A 3TCHA 1Y3QA 1GVCA 4U4SA 5AA3A 2F34A 4NWDA 2VHAA 3LBSA 1SDXA 2DXYA 2NWJA 1FQCA 1MXVA 2VOZA 2DS9A 3ZSFA 4ELPA 3FATA 4GXAA 4GWOA 4FIMA 2W7YA 1CB6A 3IB1A 3EHTA 2RCAA 3PV0E 4PFWA 1PBQA 1TXFA 3KEIA 4OVJA 3TTKA 2Y7KA 4KHZE 2AYSA 2B3FA 2I58A 5I57A 3QK6A 3KFMA 1A40A 1B7ZA 4FECA 2XX8A 2FA7A 4R2BA 4G68C 1MG1A 4N6PA 3RT6B 5BUUA 1UTHA 3V5AA 2Q2CA 3LC8A 3MPLA 4JBZA 5JEIA 1JEVA 4YKIA 3TDJA 4XXUA 2ZYMA 5L9SA 3MVXA 3TEPA 3SEYA 4FORA 5KCJB 3FIRA 3MP1A 3ODBA 4IY5A 4QFLA 3PD9A 3VVDA 4H0WA 5F1QA 3FJGA 1BKAA 1DPPA 1B1HA 3MJNA 2GHBA 3MVZA 1PBPA 2O6AA 4GD5A 2Q2AA 5K2YA 4IGTA 4O3BA 4F3PA 4IO6A 5ITOA 2A5SA 3K6WA 4XTCQ 1OVTA 2REJA 4YAHX 4Z7EA 3VFJA 2XX9A 1HSEA 2IEEA 3C33A 2BJJX 2PVUA 3IO6A 1ELJA 2RINA 4DXCA 1FTJA 2QS3A 5H8SA 3VLWA 3PPQA 1RYXA 2ESNA 1N3WA 5DEXB 2OWTA 3H3GA 4HS7A 4RY1A 4ELQA 2DXRA 4G8HA 4EQBA 2F8DA 4H6DA 3N6TA 2YLNA 4I9DA 3PPPA 2F6PA 1MXYA 1QVSA 4IO7A 4NEDA 3TCFA 5FHNA 4AQ4A 4FEBA 2QMWA 4QSDA 4ZECA 5M2VA 2ZNTA 2DE3A 3IAZA 3ZKLA 3RY3A 1M5CA 1LBCA 1R9QA 3Q25A 4F1VA 2R6GE 4R6HA 2QMXA 1IXIA 2QS2A 1JW5A 1CE2A 4GF8A 2O68A 1WDNA 4E0XA 5IAIA 1VFEA 3VE1B 2O69A 3DP4A 4H67A 2RC7A 4QHQA 2X7PA 2XHDA 4H1XA 2ONKE 5L8DA 5TP9B 3FD3A 1NNKA 5LOMA 1EZOA 2G93A 1B40A 3VXBA 5AA2B 1IIWA 1URDA 3S9LC 3QYTA 1QUJA 4R74A 1P1QA 1XC1A 3OEKA 1FTMA 5CBRA 1IEJA 3CRBA 2O51A 3PUXE 5AA1A 3R7XA 3TELA 1LAGE 2RKMA 1LAFE 4F2QA 4R6KA 1P1UA 1B2HA 2F78A 2A5TB 1O64A 3FASA 2V3QA 3C35A 3K2DA 3MVWA 4KI0E 2I48A 3AXFA 4U4XA 5K2XA 4LONB 4F1YA 4F31B 4YKJA 2ALUA 1OLCA 2F7CA 2O1LA 1RYOA 3FXUA 2VP1A 2OCUA 4XKNA 2V93A 1AH5A 4MF3A 4XIGQ 2Z23A 4C1TA 4IY6A 3C31A 3T9HB 3D4GA 1IUDA 3T9XB 1UIVA 4EUOA 1VR5A 2Q88A 2HAVA 5CC2A 3OENA 1B4ZA 3QUFA 1GV8A 1LCFA 2Z8DA 4JDFA 4OTEA 1GGGA 2PMSA 1JQFA 3C34A 4OMBA 2DWHA 3DELB 1M5BA 2VGQA 3HO7A 2XXQA 4LATA 4NMYA 1AIVA 3TMGA 4BDMA 2H5YA 4NF6B 5L9MA 3HPIA 2HEUA 3MAMA 3N5LA 2D5WA 3IB2A 4X1BA 3Q27A 4UACA 4U21A 5CRYA 3V8XB 4KR5A 4F18A 1IXGA 2F36A 3CI8A 4TLMB 4AB6A 1T0KA 3U8QA 4WEDA 1SQYA 4YKKA 2Q8JA 1LCTA 2F5XA 4MLQA 2H25A 2Q89A 4G4PA 5AA4A 3H7MA 1IQ7A 1VFDA 3LSLA 1ZLQA 1MQDA 3BFTA 3CFLA 1N76A 4M1VA 1SW1A 4YU0A 1M5FA 4OETA 3W9VA 4R6YA 4AB5A 3OO8A 1N84A 1OIBA 3S4UA 4OFOA 4NTLA 3HHGA 1B6HA 3D4CA 2O7IA 2UVGA 3MC2A 1NH7A 3FVNA 3WAEA 4GL0A 1I6BA 2DVZA 2I6EA 3OMBA 2PX1A 4R9GA 5CMCA 4BDQA 3MWBA 4BDNA 3PPOA 3H06B 4GVOA 2UVHA 1LBBA 4C0RA 2XX7A 4DXBA 1USYH 4FE8A 4LA9A 4DDDA 1FTOA 1B3EA 2H4IA 1SW4A 2DQVA 3IOUA 4I62A 1MDQA 4QRZA 3ZS6A 3QAXA 5CMBA 2HQ0A 1Q35A 4ESXA 4F3GA 3S9MC 1DTGA 4FAJA 5ICTA 3VLUA 2XXUA 2PT1A 3PUVE 3QXMA 3KGCA 4JXIA 1B5JA 5DT6A 4DIGA 1ZBMA 3GZGA 3HHFA 5HPQA 1ZTYA 2UYFA 2HZLA 3ILTB 4GL8A 5JTYB 1L5TA 4LZ7A 1HSLA 1NH8A 3U93A 1YAEA 5CI5A 3THIA 4HW8A 1P1OA 1B1XA 1N7XA 1N7WA 1MY3A 2V25A 3FVGA 3R6UA 3E9XA 1OLAA 4H8IA 3TCGA 3U1OA 3UA8A 3LR1A 1SI0A 5FHMA 3B6QA 1B7UA 3Q26A 2Y84A 5H8NB 2Z8EA 1N0TA 1VE4A 3FVOA 1MRPA 1EZ9A 2RF1A 2ZNSA 3UORA 4MLVA 1UIUA 2OBGA 2XXYA 4HCYA 1SD3A 1B5IA 2IA4A 3K0VA 4P0GA 4BDLA 4NWCA 3KG2A 3MP8A 2QRYA 4QFKA 1Y9UA 2ZNUA 2XXPA 3G3HA 5H8FB 2ONRA 3M3FA 5HBCA 2UVJA 2XXIA 3M3LA 3MUQA 3H6WA 1B05A 1S50A 3PMWA 2P1SA 4KPTA 4MBPA 4EQ7A 3IJOB 4JSDA 1TFAA 3EPEA 4R72A 4ZEFA 1SYIA 2P0SA 4TQUQ 1MDP1 3SKPA 3ZKKA 1H3DA 2I0BA 2I3VA 2UYEA 3Q28A 3K00A 5TPAB 2ZYNA 4NF5B 2DSFA 2F6GA 3USDA 1B0HA 1GR2A 4YICA 1I6AA 2YJPA 1S9TA 2I4BA 4PP0A 4RYAA 3UP9A 4I1DA 4Q0CA 1D4NA 1POTA 4NF6A 4YZZA 5H8NA 4JWYA 1JW1A 3A3UA 4WKMA 1NNTA 1LB9A 1PDAA 3PMXA 1OVBA 4G8NA 2ABHA 2O84X 2X26A 3UIFA 1URGA 2B65A 2Q9TA 3RT8A 4PFTA 4MFIA 2B3BA 3PGFA 1QUIA 4GFRA 5DVFA 3U94A 1XS5A 4KQPA 2NXOA 2Z8FA 3PU5A 1BIYA 1B9JA 4U1OA 4PE5B 4KCDA 1MQHA 3FV1A 1FQBA 3O29A 4OERA 4OXVA 3FVKA 1NL5A 4PETA 3KN7A 4H65A 4ZZAA 1Y20A 3IOVA 4UA8A 1ANFA 4NE4A 3IJXB 1B46A 4H5FA 3T22A 1IITA 1HSJA 1P99A 1QJMA 2I3WA 3CVGA 4G68A 1XHYA 4NF8A 1MY1A 3G7WA 4THIA 3E4RA 4U1ZA 3OSQA 3V83A 4YB5A 3OO9A 4LQ5A 5KCJA 5FTIA 3S9NC 3IX1A 1PEBA 2ZXTA 1B3FA 1VSOA 3CFZA 3OXNA 4XKPA 4EDPA 3LSXA 2ZYOA 3VXCA 4FJPA 2D3IA 4LP2B 2V84A 4OFJA 3IL1B 1UTBA 5TPAA 3KOTA 5ITPA 1USYE 3SEXA 3QSLA 1NFTA 3CSBA 3ONMA 4JWOA 3SESA 2DYXA 3UN6A 1I6QA 3DP8A 4OZ9A 1MH3A 1I69A 4K3FA 3FJ7A 4JB7A 4OWDA 2RCBA 3B6WA 3RUMA 4FATA 1US4A 3TTRA 3T66A 4KFQA 1DPEA 3W15C 3KSXA 3G3FA 4ELRA 2ONSA 1TT1A 1BLFA 3LUYA 4HTGA 4RK2A 4ZEKA 3TTNA 3H6TA 1O7TA 4PFUA 3CFXA 4P0IA 3TAJA 3KBRA 1Z7NE 4XKQA 4IO2A 4GRKA 5DVIA 1EU8A 2DOJA 4F1UA 4LQ2A 3G3KA 3HN0A 4N07A 3SEVA 3IOWA 5I56A 3DLNA 1ZJLA 5BWJA 3TTLA 2Y7PA 4F3BA 2F97A 1UQWA 4TLLB 5F7VA 3U72A 1BTJA 4YMBA 1RKMA 1SVXB 1ZU0A 1SW5A 2F35A 2Y7IA 3GBBA 3O6IA 3VVEA 5I2KB 1QW0A 3I6VA 3OD7A 4EF2A 3C9HA 4DCXA 1B7HA 3C36A 4ONYA 3L6GA 4U22A 3RTWB 3T9UA 3TPAA 4DXUA 1A99A 3MZ1A 3RLFE 5J1DA 1JETA 1DTZA 2OLBA 3S2VA 4EF1A 1FQEA 4IO5A 3PUZE 4C1UA 2DWJA 2QS1A 1R1NA 3QUJA 4RPOA 1B32A 1EH3A 1QKAA 1WODA 3KJTA 2XXXA 4RXLA 1NMUA 2AL5A 4EXKA 2DP8A 2R71A 1MPCA 2XD2A 2XXVA 5ELVA 3K1NA 1O63A 3M3KA 1H76A 5ICQA 4ZEIA 3TZAA 5A5XA 3K4UA 1MQGA 3CG1A 4QFOA 3PUWE 1D9VA 1EZPA 3TQLA 4KCCA 1Y1MA 2AL4A 5FTHA 2OJTA 1MQJA 3G3GA 3V89B 4F3SA 3MBPA 4X1DA 4ZE8A 3SETA 1Q1KA 4DE8A 2UXAA 3HSTA 4OYVA 2FNCA 2XXTA 5CBSA 1D3KA 4L17A 3M8UA 1PB7A 5AA2D 3C32A 1UTHB 4GIZA 2O7UA 3H03A 4QSEA 4X48A 5JK4A 4DCYA 3I3VA 4QF9A 1N04A 3MP6A 4OHNA 4WEPA 5ISUA 2H9BA 4O3CA 3K6UA 4IO3A 3RPWA 5I57B 2G29A 3FXRA 3FJMA 3R26A 4F29A 1PC3A 3TUSA 3RQTA 3OO6A 5H8FA 1M5EA 2GH9A 3EHUA 1B5HA 1MXWA 3RTFB 5I58A 2P2AA 2YPNA 3MPKA 3VDFA 4BLAA 5HM4B 5KDTB 1PB9A 5AA4B 1FW0A 2HXWA 2HZKA 1FTKA 3KN3A 3PPRA 3OEMA 4LVQA 5DEXA 2NOOA 3B7DA 3VVFA 4EQ9A 5DYHA 3O6HA 1IXHA 2E1SA 1OQHA 2V3TA 4KYEA 1A54A 3Q29A 3OOAA 4R2FA 3FUZA 1H45A 2FYIA 2NUVA 3LSWA 5I2NA 3S9EA 4ZS9A 3PPNA 1AMFA 1B4HA 2ZMBA 3SEUA 5CMMA 3TKDA 2OZZA 3GXAA 3CSGA 4IGRA 1MM7A 3O6GA 4G2ZA 1P1NA 4ISUA 4O3AA 4X9TA 5CM6A 1LSTA 5H8QB 1XVXA 1M5DA 3A09A 1WVJA 2CZLA 4F22A 2X7QA 1Y3PA 1FTLA 1US5A 1A7LA 4G77A 4GQOA 2HAUA 4OESA 3MZ9A 5L9OA 1IZ1A 4ZZEA 5TP9A 1F9BA 1MH4A 2V3UA 3U92A 3SEWA 4R75A 5AA2A 5EHMA 1ZIUA 1R9LA 1MXUA 1MPBA 2DVCA 3K02A 3MVYA 5I56B 1AOVA 3K6XA 1NNPA 4G8MA 1URSA 1QUKA 3ECRA 2LAOA 2XXHA 3OSRA 4ND9A 3FGSA 2F7AA 4N13A 4R9FA 2I4CA 2GRVA 3EQ1A 3N26A 1D9YA 4YB6A 2QJEA 2CMOA 4U2RA 2QPQA 2GHAA 2KLFA 4WXJA 3DP6A 5KDTA 4Q8RA 3B6TA 1P1WA 1II5A 4FEDA 4ELOA 3KSJA 2H98A 2E0SA 1MPDA 1JVXA 1DOTA 3N6UA 3PD8A 4QSCA 1Y3NA 3SDFA 3A3CA 4RJZA 5B70A 4LUBA 3EN3A 3K1MA 4NF5A 3BBRA 4IO4A 4ZE9A 1XOCA 3EHSA 2ANJA 2Y7WA 4NF8B 1MY4A 4IB2A 3FXQA 1FCKA 4I8CA 4DLDA 2QS4A 3I5OA 3UGWA 1B3HA 3T93B 1SI1A 3IB0A 5DTBA 5TU0A 3T9VA 5IKBA 2HCAA 4BDRA 2A5TA 3IK6B 2QSXA 1POY1 2XD3A 1LFIA 1FQAA 1MS7A 1Y1ZA 3H4ZA 3TQWA 3MZBA 3KJ7A 3F11A 3FV2A 4RK9A 3UK4A 1B51A 4P11A 3VLVA 1YTVA 4YKPA 3MQ9A 2VD2A 1UTBB 3KOSA 1ZKBA 4ZDMA 5EYFA 1B3LA 1MY0A 2OK2A 4JSOA 1LLSA 3DM0A 3JV9A 3GLBA 2REGA 1SW2A 4KYDA 4BDOA 4Q30B 5AE4A 5KZTA 4OEVA 3H6VA 1LAXA 4EXLA 4HCWA 4F19A 1TWYA 4DZ1A 5JTYA 3SERA 1NNFA 3BFUA 2DWIA 1LGBC 3CIJA 4LZ8A 3O28A 4M4GA 4Z0IA 4QFPA 2D21A 5H8HA 2M8CA 2Y7RA 1DSNA 5FHOA 1ATGA 1B58A 3TFLA 4NF4B 4LZ5A 3RGYA 4E0WA 3IORA 4MH5A 1A55A 3CR9A 1PB8A 4GXSB 4RPNA 4GLIA 2DE4A 1LFHA 1JNFA 1XVYA 2XXRA 3LSFB 3RN8A 3W9WA 3IO4A 3O9PA 3K01A 4H5GA 1LAHE 3TYHA 5I2NB 2R9JA 3GBAA 3HV1A 1Z7ME 3PMVA 4ECFA 1IXCA 2WKYA 3ILUB 1TFDA 2GFEA 4KYSA 2XXWA 4G68B 1SYHA 1MXXA 2QL3A 3E3KA 3KN8A 4Q5TA 5EHSA 1BP5A 3E13X 4YB7A 2UVIA 2F7BA 2I0CA 2DE2A 2THIA 5A5XB 1B3GA 2Z22A 5H8QA 5I59A 4OENA 1H44A 3T96B 5DVJA 3K1PA 1J1NA 3JZJA 5B7DA 1B52A 2PT2A 2AIXA 1JW4A 3H6UA 4U23A 4F39A 1GTKA 4QFNA 1YCJA 4RNSA 1NKXA 1XT8A 3HCQA 4YMAA 2HFBA 1LB8A 4OQOA 4OEUA 3VV5A 3PUYE 4H8JA 4F2OA 1JEUA 2VD3A 2PYYA 3G3JA 4RA1A 1N3XA 2ZYKA 4JWXA 5I84A 3IOTA 2DWAA 1QULA 3RNNA 1LFGA 5H8HB 1A8EA 4KD5A 4ZEDA 1QKBA 4ESWA 2O1MA 1AL3A 1FQFA 3JYRA 1Y4CA 3QIMA 4NF4A 3OO7A 3TTMA 5I2KA 2RC8A 3K6VA 3BKIB 1R6ZA 1OMPA 1H43A 3O66A
chains in the Genus database with same CATH superfamily
3C4MA 4GWWA 1OQGA 5CMKA 3OELA 2PFYA 2OWSA 2PBWA 1MM6A 3L6HA 4XKRA 3CG3A 5AA3A 1GVCA 4U4SA 2F34A 1EYJA 1JP4A 4GWOA 3IB1A 3KEIA 2Y7KA 3QMFA 2B4MA 1UTHA 3V5AA 3LC8A 4NF0A 3TEPA 4MIJA 3ODBA 4QFLA 3VVDA 3PD9A 4H0WA 5F1QA 1BKAA 5L9MA 1B1HA 3MJNA 2GHBA 3MVZA 4F3PA 2O6AA 4YAHX 1LBZA 2IEEA 3C33A 3IO6A 1N3WA 4HS7A 2Y5LA 1MXYA 1QVSA 2ZNTA 3RY3A 1IXIA 1WDNA 4E0XA 1FSAA 3VE1B 4HE0A 2RC7A 3FD3A 1NNKA 1FTAA 3TELA 3PUXE 1LAFE 4R6KA 3KBZA 3FASA 3K2DA 3MVWA 4F1YA 4F31B 4YKJA 2O1LA 3FXUA 2VP1A 3T9HB 3D4GA 1IUDA 1VR5A 1GV8A 4OTEA 1GGGA 2PMSA 2VGQA 2XXQA 2H5YA 4I3YA 3HPIA 2HEUA 4UACA 4KR5A 4TLMB 1IQ7A 3LSLA 3CFLA 4M1VA 4YU0A 1M5FA 1OIBA 1NH7A 4PFBA 5I7IA 4C0RA 1LBBA 4DXBA 4LA9A 1RDZA 2H4IA 1SW4A 2DQVA 4F3GA 3S9MC 2P3NA 2XXUA 2PT1A 1D9QA 5JTYB 2HZLA 4LZ7A 1YAEA 5CI5A 3R6UA 3LR1A 5FHMA 3B6QA 2Y84A 2GQ1A 5H8NB 3FVOA 1MRPA 4P8BA 4X04A 3UORA 1UIUA 3K0VA 4PAFA 2QRYA 3FXBA 3G3HA 5HBCA 2ONRA 3M3LA 3PMWA 4BDLA 1B05A 4EQ7A 3SKPA 4TQUQ 1MDP1 2I0BA 3Q28A 3K00A 2ZYNA 2F6GA 1GR2A 1S9TA 4RYAA 1POTA 3A3UA 1NNTA 2X26A 2B4LA 1URGA 3PGFA 1XS5A 2NXOA 1BIYA 1B9JA 4KCDA 1MQHA 1FQBA 3FVKA 4H65A 5F24A 1HSJA 1P99A 1QJMA 4G68A 4THIA 3E4RA 4P1EA 5IZ3B 4LQ5A 4NX1A 5FTIA 1VSOA 3VXCA 4OFJA 3SEXA 3ONMA 2DYXA 3FJ7A 2XWVA 1US4A 3TTRA 3T66A 3G3FA 2XA5A 4ELRA 4HTGA 3LUYA 4PFUA 4JVDA 2QFLA 4N6DA 5I56A 1ZJLA 2Y7PA 2F97A 3U72A 4O7MA 1SVXB 2Y7IA 5IKBA 1QW0A 3L6GA 3RTWB 3T9UA 4PE3A 1A99A 5J1DA 3S2VA 2QS1A 2Q74A 2R8TA 1B32A 1EH3A 1QKAA 5ESYA 2XXXA 4P47A 1NMUA 2XXVA 1MPCA 5A5XA 4QFOA 3PUWE 3TQLA 2AL4A 3V89B 4F3SA 2FNCA 1D3KA 5AA2D 3H03A 4QSEA 4X48A 1FBDA 1N04A 3MP6A 2H9BA 4O3CA 5I57B 2G29A 3FJMA 3RQTA 3OO6A 2P2AA 3KN3A 1FTKA 2NOOA 3B7DA 3O6HA 2E1SA 4KYEA 1A54A 3Q29A 5I2NA 1H45A 3PPNA 1B4HA 3GXAA 4IGRA 1MM7A 4G2ZA 4X9TA 5CM6A 5H8QB 3A09A 1M5DA 1Y3PA 5L9OA 2HAUA 1F9BA 4GBWA 5AA2A 5I56B 1MXUA 1AOVA 2QVUA 1NNPA 3EQ1A 1LBVA 2GHAA 5KDTA 1II5A 1KA1A 3KSJA 2H98A 3PD8A 3SDFA 3A3CA 4LUBA 3EN3A 3K1MA 4NF5A 2ANJA 2Y7WA 1MY4A 4I8CA 3IB0A 4BDRA 2QSXA 3H4ZA 3TQWA 3VLVA 3KJ7A 3F11A 3KOSA 1ZKBA 5EYFA 3JV9A 1SW2A 1LAXA 4EXLA 4HCWA 4F19A 1EYIA 4PFIA 2DWIA 3CIJA 3O28A 4QFPA 5H8HA 5J16A 2Y7RA 5FHOA 3TFLA 4RPNA 3CR9A 3W9WA 3K01A 1LAHE 5I2NB 3HV1A 1Z7ME 2WKYA 1TFDA 2GFEA 4KYSA 2XXWA 3E3KA 3FBPA 4YB7A 3U65A 2F7BA 2DE2A 5A5XB 5I59A 5H8QA 4MEVA 4I3EA 4N8GA 1NKXA 2PFZA 4F2OA 5I84A 1FQFA 1KA0A 4PGNA 3K6VA 5ET5A 1H43A 4HE1A 3WAFA 2RC9A 4PQJA 3MW0A 3IR1A 2I49A 4GOTA 2H99A 1NV0A 1KWHA 4TOZA 1MQIA 2WX9A 3KZGA 4MNPA 1A8FA 3TODA 2CZHA 2VHAA 3LBSA 2NWJA 4ELPA 2DS9A 3GYYA 4FIMA 2W7YA 1K9ZA 2AYSA 2B3FA 2XX8A 4R2BA 4G68C 1FBGA 1NV5A 5JEIA 1JEVA 4YKIA 3TDJA 4XXUA 2ZYMA 4FORA 3FIRA 4IY5A 2XWIA 4IGTA 4O3BA 4IO6A 3VFJA 2XX9A 1HSEA 4OVQA 1ELJA 2RINA 4DXCA 1RYXA 5DEXB 2DXRA 2MKZA 4G8HA 3N6TA 3PPPA 5FHNA 4FEBA 2QMWA 3IAZA 2XWKA 3Q25A 1IMAA 2R6GE 4R6HA 2QS2A 2O68A 2O69A 3DP4A 4H67A 4QHQA 2XHDA 4H1XA 2ONKE 2WYKA 3S9LC 2ZZWA 4R74A 1P1QA 3OEKA 5CBRA 2Q8MA 4F2QA 1LAGE 2RKMA 1FPLA 1P1UA 2P3VA 2A5TB 2V3QA 1YYZA 5K2XA 3AXFA 1RYOA 2HHMA 2Z23A 3T0JA 4C1TA 4EUOA 2HAVA 5EQ7A 1LCFA 4JDFA 4OMBA 2DWHA 1M5BA 3TMGA 4BDMA 1DK4A 4N81A 3Q27A 4F18A 1IXGA 1T0KA 3U8QA 4WEDA 2Q8JA 2Q89A 5AA4A 3H7MA 1MQDA 4OETA 3W9VA 1N84A 1B6HA 2UVGA 3WAEA 4GL0A 1I6BA 2DVZA 5KCJB 5ISUA 5CMCA 3MWBA 3H06B 2UVHA 2XX7A 3CHGA 4I62A 4NQ8A 3B50A 3ZS6A 3QAXA 1RDXA 1Q35A 4ESXA 1DTGA 5ICTA 3VLUA 4DIGA 3QXMA 5DT6A 4EQBA 5HPQA 3GZGA 3HHFA 3ILTB 4GL8A 3U93A 3THIA 2FBPA 1N7XA 4N4UA 1N7WA 1IMEA 2FIXA 1B7UA 3Q26A 2Z8EA 4DI4B 4QBAA 1N0TA 1EZ9A 2ZNSA 2OBGA 4HCYA 4H45A 4QFKA 1Y9UA 5H8FB 2UVJA 2XXIA 3MUQA 4MBPA 4JSDA 3EPEA 5LDZA 2PCRA 3ZKKA 5TPAB 1B0HA 4YICA 5DW8A 2YJPA 3UP9A 4YZZA 1JW1A 1OVBA 4G8NA 2O84X 4PFTA 4NGUA 3RYDA 4UABA 4N91A 4ZZAA 3KN7A 3LV0A 4UA8A 1ANFA 3IJXB 1G0HA 5KCJA 1PEBA 2ZXTA 3OXNA 4XKPA 1FPEA 2ZYOA 4FJPA 3IL1B 1UTBA 1USYE 1NFTA 3ZSFA 1VDWA 3UN6A 4GWSA 3DP8A 4JB7A 4OWDA 4P0IA 4GRKA 4XFEA 4F1UA 4LQ2A 3G3KA 3IOWA 3DLNA 5BWJA 2KQZA 4F3BA 4GX3A 1ZU0A 2F35A 1FBEA 3VVEA 3O6IA 4EF2A 5LTCA 1NI9A 3I6VA 3C9HA 1B7HA 3TPAA 3MZ1A 4EF1A 1FQEA 3KJTA 4RXLA 2DP8A 2R71A 2F3DA 2XD2A 4PF8A 3K1NA 5T3JA 5ICQA 4ZEIA 3TZAA 4P1LA 1EZPA 1Y1MA 2OJTA 4ZE8A 1Q1KA 3HSTA 5CBSA 4L17A 3M8UA 1PB7A 2O7UA 5JK4A 4PDHA 3RPWA 4F29A 1PC3A 5IGAA 5H8FA 3RTFB 1B5HA 2YPNA 1DBZA 1PB9A 2HZKA 3VVFA 3OEMA 4EQ9A 1NUYA 2FYIA 2NUVA 4ZS9A 2QVVA 4XF5A 3SEUA 5CMMA 4ISUA 3O6GA 4O3AA 1LEVA 1XVXA 1WVJA 4F22A 4GQOA 3MZ9A 4ZZEA 5TP9A 5ET8A 2V3UA 1R9LA 5ET7A 1MPBA 3MVYA 3K6XA 4G8MA 3EKIA 2XXHA 3FGSA 2GRVA 3N26A 1D9YA 1NUWA 2QJEA 2CMOA 4MMPA 3B6TA 4Q8RA 2E0SA 1MPDA 4GX4A 4IO4A 1XOCA 4IB2A 1FCKA 4DLDA 2QS4A 3UGWA 5EQAA 3T93B 1SI1A 2HCAA 3IK6B 1POY1 2XD3A 1MS7A 3MZBA 3MYUA 3FV2A 1B51A 4P11A 1MY0A 5KZTA 4Q30B 3H6VA 1LBXA 4DZ1A 5IZ1A 3SERA 2D21A 2WBBA 1ATGA 4LZ5A 3RGYA 4P9KA 1A55A 1PB8A 1LFHA 1JNFA 3LSFB 3IO4A 4H5GA 2R9JA 4ECFA 2BJIA 4G68B 5EHSA 1MXXA 3E13X 1FPFA 4OENA 1H44A 4N17A 5DVJA 3JZJA 5B7DA 1JW4A 1GTKA 2ZZXA 1YCJA 1NV2A 2HFBA 5JTYA 3VV5A 3G3JA 4NN3A 1N3XA 4JWXA 3IOTA 3RNNA 5H8HB 1A8EA 4KD5A 4ZEDA 1QKBA 1AL3A 4PAIA 1Y4CA 4NF4A 3OO7A 1R6ZA 1S7YA 4PBQA 1FQDA 3O97A 3EF7A 3G3IA 4MX6A 4OFLA 4R73A 1ZMGA 3P7IA 3RPLA 3ISPA 1B0LA 1SBPA 5I58B 2NVUB 1NV6A 1Y4TA 1Y3QA 4O7IA 4GBVA 1SDXA 1FQCA 1MXVA 2WYPA 4GXAA 1CB6A 2RCAA 4PFWA 1TXFA 4KHZE 1FRPA 3KFMA 1B7ZA 3A29A 4FECA 2FA7A 4N6PA 4PF6A 1EYKA 5BUUA 2Q2CA 4JBZA 3MVXA 1NV3A 3SEYA 3FJGA 5K2YA 2Q2AA 3K6WA 4AS4A 2BJJX 4PC9A 1IMBA 1G0IA 2ESNA 2OWTA 2YLNA 4AQ4A 3TCFA 4NEDA 4QSDA 2ZZVA 3PTYA 2VT5A 3ZKLA 1M5CA 1LBCA 5IAIA 1VFEA 1Q9DA 1EZOA 1B40A 1QUJA 1XC1A 1IEJA 4IR8A 5AA1A 4OANA 1B2HA 4KI0E 2I48A 2ALUA 1OLCA 2OCUA 4XKNA 1UIVA 3IFAA 5CC2A 1B4ZA 4PTKA 1IMCA 4JVCA 2L5VA 1BK4A 1JQFA 1YXIA 4NMYA 4NF6B 3MAMA 2D5WA 4U21A 5CRYA 3CI8A 1SQYA 4MLQA 2H25A 1ZLQA 3BFTA 1N76A 1SW1A 4R6YA 3S4UA 4GWZA 4OFOA 3HHGA 3MC2A 3FVNA 2PX1A 1KZ8A 2V4CA 4R9GA 4BDNA 3PPOA 4GVOA 1USYH 4FE8A 4DDDA 1FTOA 1B3EA 1MDQA 5CMBA 2HQ0A 2XXKA 4FAJA 2KR0A 3PUVE 4O94A 1B5JA 2UYFA 1HSLA 1NH8A 4HW8A 1B1XA 4H8IA 2V25A 3FVGA 1OLAA 4NAPA 1SI0A 2FHYA 2RF1A 4P0GA 1SD3A 1B5IA 3KG2A 3MP8A 3M3FA 4KPTA 3H6WA 3IJOB 1TFAA 4R72A 1SYIA 2I3VA 2UYEA 4NF5B 4AS5A 3NOHA 1LBYA 1I6AA 5A5LA 2I4BA 1D4NA 4JWYA 4WKMA 3PMXA 2ABHA 2Q9TA 2B3BA 1QUIA 4GFRA 3E79A 3U94A 4KQPA 2Z8FA 3PU5A 4U1OA 4OERA 1Y20A 1NV7A 3IOVA 4H5FA 1IITA 2I3WA 1AWBA 3G7WA 3V83A 4U1ZA 3OSQA 4YB5A 3OO9A 3S9NC 3CFZA 4EDPA 1INPA 3LSXA 4LP2B 2V84A 5TPAA 3QSLA 4JWOA 3SESA 3VDFA 4OZ9A 1MH3A 1I69A 3B6WA 3W15C 5ET6A 1TT1A 1BLFA 4RK2A 3TTNA 3H6TA 5FBPA 3CFXA 3TAJA 3KBRA 3KC1A 4NHBA 3SEVA 3HN0A 1UQWA 4YMBA 3GBBA 4MNIA 3LUZA 4DCXA 3C36A 4ONYA 4U22A 4DXUA 3RLFE 1JETA 2OLBA 3PUZE 4C1UA 2DWJA 3QUJA 1NV1A 4X8RA 1WODA 2AL5A 4EXKA 5ELVA 1O63A 3SZPA 1H76A 3K4UA 1MQGA 1D9VA 4KCCA 3G3GA 3MBPA 3IFCA 3SETA 4DE8A 4OVTA 4OYVA 2XXTA 1FPBA 4DCYA 3I3VA 4IO3A 1FBPA 2GH9A 2JJKA 1MXWA 3MPKA 4BLAA 5HM4B 5AA4B 5DEXA 4ELOA 3PPRA 1FBFA 5DYHA 2CZIA 2V3TA 3FUZA 1AMFA 2HXRA 2ZMBA 1FPGA 2OZZA 3CSGA 4N6KA 1US5A 4NG7A 4QXDA 4LN5A 3SEWA 4R75A 4PDDA 1ZIUA 5IM2A 1URSA 3ECRA 2LAOA 3OSRA 2F7AA 4N13A 1QGXA 2I4CA 4YB6A 4U2RA 2QPQA 2KLFA 3DP6A 1P1WA 4FEDA 4QSCA 5B70A 4RJZA 3BBRA 3EHSA 4NF8B 3FXQA 3I5OA 1IMFA 5DTBA 2A5TA 1FQAA 3UK4A 4YKPA 4ZDMA 1B3LA 2REGA 4BDOA 4OEVA 4MAGA 1TWYA 3BFUA 1LGBC 1NV4A 4M4GA 4LZ8A 4Z0IA 2M8CA 2HPGA 4E0WA 4GXSB 2XXRA 1XVYA 3RN8A 2CEXA 3O9PA 3TYHA 3PMVA 1SYHA 2QL3A 1BP5A 2QVRA 5IZ3A 2THIA 1B3GA 5EQ9A 1FBCA 3T96B 1FPDA 1RDYA 2AIXA 3H6UA 4U23A 4QFNA 4YMAA 1LB8A 4OQOA 3PUYE 4H8JA 4N15A 4RA1A 2PYYA 2FIEA 2ZYKA 1LFGA 1FPIA 4ESWA 3JYRA 5I2KA 3BKIB 3KC0A 1OMPA 3O66A 1MXZA 4PFYA 1DMBA 4POWA 2WBDA 4ZEBA 2F3BA 1NUXA 3FZVA 3N94A 1MY2A 4POXA 1JVYA 1YPNA 5I59B 5EYGA 1K9YA 3O2AA 3TCHA 2CZKA 4NWDA 2DXYA 1FBHA 2VOZA 2XWOA 3FATA 4PBHA 3EHTA 3PV0E 1PBQA 3TTKA 4OVJA 2I58A 5I57A 3QK6A 1A40A 4PGPA 1MG1A 3RT6B 3MPLA 5L9SA 4OVRA 3MP1A 1DPPA 4GD5A 4PAKA 1PBPA 4JVIA 5ITOA 2OX3A 2A5SA 4XTCQ 4Z7EA 1OVTA 2REJA 4FBPA 2PVUA 1FTJA 2QS3A 5H8SA 3VLWA 3PPQA 4RY1A 3H3GA 4ELQA 2F8DA 4H6DA 4IO7A 4I9DA 2F6PA 4ZECA 5M2VA 5EQ8A 2DE3A 1R9QA 4F1VA 2QMXA 4GF8A 1JW5A 1CE2A 2X7PA 4OVSA 5TP9B 5L8DA 5LOMA 2G93A 2FVZA 3VXBA 5AA2B 1IIWA 1URDA 3QYTA 2CEYA 1FTMA 3CRBA 3R7XA 2O51A 5EYHA 4HE2A 1FPKA 2F78A 4ZEFA 1O64A 3C35A 4U4XA 1CNQA 4LONB 1DCUA 2F7CA 2V93A 1AH5A 4MF3A 4XIGQ 4GWYA 1FPJA 4IY6A 3C31A 3T9XB 2Q88A 1XI6A 3OENA 3QUFA 2Z8DA 3C34A 3DELB 3HO7A 4LATA 1AIVA 3N5LA 3IB2A 4X1BA 2WEFA 2F36A 4AB6A 4YKKA 1LCTA 1IMDA 2F5XA 4G4PA 1VFDA 4AB5A 3OO8A 4NTLA 3D4CA 2O7IA 4KXPA 2I6EA 3OMBA 4BDQA 4MHFA 5I5PA 3IOUA 4QRZA 4MCOA 4JXIA 3KGCA 1ZBMA 1ZTYA 1L5TA 4P56A 1P1OA 1MY3A 3E9XA 3TCGA 3U1OA 3HFUA 3UA8A 1VE4A 2VPNA 4MLVA 2XXYA 2IA4A 4NWCA 3MSTA 2ZNUA 2XXPA 1S50A 2P1SA 2P0SA 1H3DA 2DSFA 3USDA 4GWUA 4PP0A 4I1DA 4Q0CA 4OA4A 4NF6A 1LB9A 1PDAA 1NUZA 3UIFA 2B65A 3RT8A 1YZ0A 4MFIA 5DVFA 4PE5B 3O29A 3FV1A 4OXVA 1NL5A 4PETA 4NE4A 1B46A 3T22A 4NF8A 3V8XB 3CVGA 1XHYA 1MY1A 4HXVA 3IX1A 1B3FA 3RPLB 2D3IA 3D1RA 3KOTA 5ITPA 3CSBA 1I6QA 4K3FA 3RUMA 2RCBA 4FATA 4KFQA 1DPEA 3KSXA 4N8YA 2ONSA 4ZEKA 1O7TA 1Z7NE 4XKQA 4IO2A 5DVIA 1EU8A 2DOJA 4N07A 3TTLA 4P3LA 4TLLB 5F7VA 1BTJA 1RKMA 1SW5A 5I2KB 1DTZA 3BIGA 4IO5A 1R1NA 4RPOA 1LBWA 3M3KA 3B8BA 3CG1A 4I40A 5FTHA 1MQJA 4X1DA 4DI3D 2UXAA 2VPOA 3C32A 1UTHB 4GIZA 2OWZA 4QF9A 4OHNA 4WEPA 3K6UA 3FXRA 3R26A 3TUSA 1M5EA 3EHUA 5I58A 5KDTB 4OVPA 1FW0A 5H8NA 2HXWA 4LVQA 1IXHA 1OQHA 2Y5KA 3OOAA 4R2FA 3LSWA 3S9EA 3TKDA 4G61A 1P1NA 1LSTA 5IZZA 2CZLA 2X7QA 1FTLA 4XEQA 1A7LA 4G77A 4OESA 1IZ1A 1MH4A 3U92A 5EHMA 2DVCA 3K02A 1QUKA 4ND9A 4PFRA 1FJ9A 4R9FA 1SPIA 4WXJA 3N6UA 1JVXA 1DOTA 1Y3NA 4ZE9A 4H46A 1B3HA 3T9VA 5TU0A 3ROJA 1LFIA 3BIHA 1Y1ZA 4RK9A 3T1BA 1YTVA 3MQ9A 2VD2A 1UTBB 2OK2A 4GX6A 4JSOA 1LLSA 3DM0A 4GWXA 3GLBA 5AE4A 5I3SA 1NNFA 1DSNA 4MJOA 1B58A 4NF4B 3IORA 4MH5A 4GLIA 2DE4A 4MNCA 3GBAA 1IXCA 3ILUB 4PCDA 4Q5TA 3KN8A 3E78A 2UVIA 2I0CA 2Z22A 1FJ6A 3K1PA 1J1NA 1B52A 2PT2A 4O8MA 4F39A 4RNSA 3HCQA 1XT8A 2DDKA 4OEUA 1JEUA 2VD3A 2DWAA 1QULA 2O1MA 3TTMA 3QIMA 2RC8A 3OD7A 4KYDA
chains in the Genus database with same CATH topology
1MXZA 1S7YA 4PFYA 3C4MA 1DMBA 4POWA 1FQDA 1OQGA 2RC9A 3O97A 3EF7A 4PQJA 4ZEBA 3WAFA 3MW0A 3IR1A 5CMKA 3FZVA 3OELA 3N94A 1MY2A 2I49A 3G3IA 4GOTA 2H99A 4POXA 1KWHA 1JVYA 4OFLA 1YPNA 4R73A 1MQIA 1ZMGA 3P7IA 4TOZA 2OWSA 5I59B 2PBWA 1B0LA 1SBPA 1MM6A 2NVUB 3KZGA 3L6HA 4XKRA 5I58B 1A8FA 1Y4TA 3TODA 3O2AA 3CG3A 3TCHA 1Y3QA 1GVCA 4U4SA 5AA3A 2F34A 4NWDA 2VHAA 3LBSA 1SDXA 2DXYA 2NWJA 1FQCA 1MXVA 2VOZA 2DS9A 3ZSFA 4ELPA 3FATA 4GXAA 4GWOA 4FIMA 2W7YA 1CB6A 3IB1A 3EHTA 2RCAA 3PV0E 4PFWA 1PBQA 1TXFA 3KEIA 4OVJA 3TTKA 2Y7KA 4KHZE 2AYSA 2B3FA 2I58A 5I57A 3QK6A 3KFMA 1A40A 1B7ZA 4FECA 2XX8A 2FA7A 4R2BA 4G68C 1MG1A 4N6PA 3RT6B 5BUUA 1UTHA 3V5AA 2Q2CA 3LC8A 3MPLA 4JBZA 5JEIA 1JEVA 4YKIA 3TDJA 4XXUA 2ZYMA 5L9SA 3MVXA 3TEPA 3SEYA 4FORA 5KCJB 3FIRA 3MP1A 3ODBA 4IY5A 4QFLA 3PD9A 3VVDA 4H0WA 5F1QA 3FJGA 1BKAA 1DPPA 1B1HA 3MJNA 2GHBA 3MVZA 1PBPA 2O6AA 4GD5A 2Q2AA 5K2YA 4IGTA 4O3BA 4F3PA 4IO6A 5ITOA 2A5SA 3K6WA 4XTCQ 1OVTA 2REJA 4YAHX 4Z7EA 3VFJA 2XX9A 1HSEA 2IEEA 3C33A 2BJJX 2PVUA 3IO6A 1ELJA 2RINA 4DXCA 1FTJA 2QS3A 5H8SA 3VLWA 3PPQA 1RYXA 2ESNA 1N3WA 5DEXB 2OWTA 3H3GA 4HS7A 4RY1A 4ELQA 2DXRA 4G8HA 4EQBA 2F8DA 4H6DA 3N6TA 2YLNA 4I9DA 3PPPA 2F6PA 1MXYA 1QVSA 4IO7A 4NEDA 3TCFA 5FHNA 4AQ4A 4FEBA 2QMWA 4QSDA 4ZECA 5M2VA 2ZNTA 2DE3A 3IAZA 3ZKLA 3RY3A 1M5CA 1LBCA 1R9QA 3Q25A 4F1VA 2R6GE 4R6HA 2QMXA 1IXIA 2QS2A 1JW5A 1CE2A 4GF8A 2O68A 1WDNA 4E0XA 5IAIA 1VFEA 3VE1B 2O69A 3DP4A 4H67A 2RC7A 4QHQA 2X7PA 2XHDA 4H1XA 2ONKE 5L8DA 5TP9B 3FD3A 1NNKA 5LOMA 1EZOA 2G93A 1B40A 3VXBA 5AA2B 1IIWA 1URDA 3S9LC 3QYTA 1QUJA 4R74A 1P1QA 1XC1A 3OEKA 1FTMA 5CBRA 1IEJA 3CRBA 2O51A 3PUXE 5AA1A 3R7XA 3TELA 1LAGE 2RKMA 1LAFE 4F2QA 4R6KA 1P1UA 1B2HA 2F78A 2A5TB 1O64A 3FASA 2V3QA 3C35A 3K2DA 3MVWA 4KI0E 2I48A 3AXFA 4U4XA 5K2XA 4LONB 4F1YA 4F31B 4YKJA 2ALUA 1OLCA 2F7CA 2O1LA 1RYOA 3FXUA 2VP1A 2OCUA 4XKNA 2V93A 1AH5A 4MF3A 4XIGQ 2Z23A 4C1TA 4IY6A 3C31A 3T9HB 3D4GA 1IUDA 3T9XB 1UIVA 4EUOA 1VR5A 2Q88A 2HAVA 5CC2A 3OENA 1B4ZA 3QUFA 1GV8A 1LCFA 2Z8DA 4JDFA 4OTEA 1GGGA 2PMSA 1JQFA 3C34A 4OMBA 2DWHA 3DELB 1M5BA 2VGQA 3HO7A 2XXQA 4LATA 4NMYA 1AIVA 3TMGA 4BDMA 2H5YA 4NF6B 5L9MA 3HPIA 2HEUA 3MAMA 3N5LA 2D5WA 3IB2A 4X1BA 3Q27A 4UACA 4U21A 5CRYA 3V8XB 4KR5A 4F18A 1IXGA 2F36A 3CI8A 4TLMB 4AB6A 1T0KA 3U8QA 4WEDA 1SQYA 4YKKA 2Q8JA 1LCTA 2F5XA 4MLQA 2H25A 2Q89A 4G4PA 5AA4A 3H7MA 1IQ7A 1VFDA 3LSLA 1ZLQA 1MQDA 3BFTA 3CFLA 1N76A 4M1VA 1SW1A 4YU0A 1M5FA 4OETA 3W9VA 4R6YA 4AB5A 3OO8A 1N84A 1OIBA 3S4UA 4OFOA 4NTLA 3HHGA 1B6HA 3D4CA 2O7IA 2UVGA 3MC2A 1NH7A 3FVNA 3WAEA 4GL0A 1I6BA 2DVZA 2I6EA 3OMBA 2PX1A 4R9GA 5CMCA 4BDQA 3MWBA 4BDNA 3PPOA 3H06B 4GVOA 2UVHA 1LBBA 4C0RA 2XX7A 4DXBA 1USYH 4FE8A 4LA9A 4DDDA 1FTOA 1B3EA 2H4IA 1SW4A 2DQVA 3IOUA 4I62A 1MDQA 4QRZA 3ZS6A 3QAXA 5CMBA 2HQ0A 1Q35A 4ESXA 4F3GA 3S9MC 1DTGA 4FAJA 5ICTA 3VLUA 2XXUA 2PT1A 3PUVE 3QXMA 3KGCA 4JXIA 1B5JA 5DT6A 4DIGA 1ZBMA 3GZGA 3HHFA 5HPQA 1ZTYA 2UYFA 2HZLA 3ILTB 4GL8A 5JTYB 1L5TA 4LZ7A 1HSLA 1NH8A 3U93A 1YAEA 5CI5A 3THIA 4HW8A 1P1OA 1B1XA 1N7XA 1N7WA 1MY3A 2V25A 3FVGA 3R6UA 3E9XA 1OLAA 4H8IA 3TCGA 3U1OA 3UA8A 3LR1A 1SI0A 5FHMA 3B6QA 1B7UA 3Q26A 2Y84A 5H8NB 2Z8EA 1N0TA 1VE4A 3FVOA 1MRPA 1EZ9A 2RF1A 2ZNSA 3UORA 4MLVA 1UIUA 2OBGA 2XXYA 4HCYA 1SD3A 1B5IA 2IA4A 3K0VA 4P0GA 4BDLA 4NWCA 3KG2A 3MP8A 2QRYA 4QFKA 1Y9UA 2ZNUA 2XXPA 3G3HA 5H8FB 2ONRA 3M3FA 5HBCA 2UVJA 2XXIA 3M3LA 3MUQA 3H6WA 1B05A 1S50A 3PMWA 2P1SA 4KPTA 4MBPA 4EQ7A 3IJOB 4JSDA 1TFAA 3EPEA 4R72A 4ZEFA 1SYIA 2P0SA 4TQUQ 1MDP1 3SKPA 3ZKKA 1H3DA 2I0BA 2I3VA 2UYEA 3Q28A 3K00A 5TPAB 2ZYNA 4NF5B 2DSFA 2F6GA 3USDA 1B0HA 1GR2A 4YICA 1I6AA 2YJPA 1S9TA 2I4BA 4PP0A 4RYAA 3UP9A 4I1DA 4Q0CA 1D4NA 1POTA 4NF6A 4YZZA 5H8NA 4JWYA 1JW1A 3A3UA 4WKMA 1NNTA 1LB9A 1PDAA 3PMXA 1OVBA 4G8NA 2ABHA 2O84X 2X26A 3UIFA 1URGA 2B65A 2Q9TA 3RT8A 4PFTA 4MFIA 2B3BA 3PGFA 1QUIA 4GFRA 5DVFA 3U94A 1XS5A 4KQPA 2NXOA 2Z8FA 3PU5A 1BIYA 1B9JA 4U1OA 4PE5B 4KCDA 1MQHA 3FV1A 1FQBA 3O29A 4OERA 4OXVA 3FVKA 1NL5A 4PETA 3KN7A 4H65A 4ZZAA 1Y20A 3IOVA 4UA8A 1ANFA 4NE4A 3IJXB 1B46A 4H5FA 3T22A 1IITA 1HSJA 1P99A 1QJMA 2I3WA 3CVGA 4G68A 1XHYA 4NF8A 1MY1A 3G7WA 4THIA 3E4RA 4U1ZA 3OSQA 3V83A 4YB5A 3OO9A 4LQ5A 5KCJA 5FTIA 3S9NC 3IX1A 1PEBA 2ZXTA 1B3FA 1VSOA 3CFZA 3OXNA 4XKPA 4EDPA 3LSXA 2ZYOA 3VXCA 4FJPA 2D3IA 4LP2B 2V84A 4OFJA 3IL1B 1UTBA 5TPAA 3KOTA 5ITPA 1USYE 3SEXA 3QSLA 1NFTA 3CSBA 3ONMA 4JWOA 3SESA 2DYXA 3UN6A 1I6QA 3DP8A 4OZ9A 1MH3A 1I69A 4K3FA 3FJ7A 4JB7A 4OWDA 2RCBA 3B6WA 3RUMA 4FATA 1US4A 3TTRA 3T66A 4KFQA 1DPEA 3W15C 3KSXA 3G3FA 4ELRA 2ONSA 1TT1A 1BLFA 3LUYA 4HTGA 4RK2A 4ZEKA 3TTNA 3H6TA 1O7TA 4PFUA 3CFXA 4P0IA 3TAJA 3KBRA 1Z7NE 4XKQA 4IO2A 4GRKA 5DVIA 1EU8A 2DOJA 4F1UA 4LQ2A 3G3KA 3HN0A 4N07A 3SEVA 3IOWA 5I56A 3DLNA 1ZJLA 5BWJA 3TTLA 2Y7PA 4F3BA 2F97A 1UQWA 4TLLB 5F7VA 3U72A 1BTJA 4YMBA 1RKMA 1SVXB 1ZU0A 1SW5A 2F35A 2Y7IA 3GBBA 3O6IA 3VVEA 5I2KB 1QW0A 3I6VA 3OD7A 4EF2A 3C9HA 4DCXA 1B7HA 3C36A 4ONYA 3L6GA 4U22A 3RTWB 3T9UA 3TPAA 4DXUA 1A99A 3MZ1A 3RLFE 5J1DA 1JETA 1DTZA 2OLBA 3S2VA 4EF1A 1FQEA 4IO5A 3PUZE 4C1UA 2DWJA 2QS1A 1R1NA 3QUJA 4RPOA 1B32A 1EH3A 1QKAA 1WODA 3KJTA 2XXXA 4RXLA 1NMUA 2AL5A 4EXKA 2DP8A 2R71A 1MPCA 2XD2A 2XXVA 5ELVA 3K1NA 1O63A 3M3KA 1H76A 5ICQA 4ZEIA 3TZAA 5A5XA 3K4UA 1MQGA 3CG1A 4QFOA 3PUWE 1D9VA 1EZPA 3TQLA 4KCCA 1Y1MA 2AL4A 5FTHA 2OJTA 1MQJA 3G3GA 3V89B 4F3SA 3MBPA 4X1DA 4ZE8A 3SETA 1Q1KA 4DE8A 2UXAA 3HSTA 4OYVA 2FNCA 2XXTA 5CBSA 1D3KA 4L17A 3M8UA 1PB7A 5AA2D 3C32A 1UTHB 4GIZA 2O7UA 3H03A 4QSEA 4X48A 5JK4A 4DCYA 3I3VA 4QF9A 1N04A 3MP6A 4OHNA 4WEPA 5ISUA 2H9BA 4O3CA 3K6UA 4IO3A 3RPWA 5I57B 2G29A 3FXRA 3FJMA 3R26A 4F29A 1PC3A 3TUSA 3RQTA 3OO6A 5H8FA 1M5EA 2GH9A 3EHUA 1B5HA 1MXWA 3RTFB 5I58A 2P2AA 2YPNA 3MPKA 3VDFA 4BLAA 5HM4B 5KDTB 1PB9A 5AA4B 1FW0A 2HXWA 2HZKA 1FTKA 3KN3A 3PPRA 3OEMA 4LVQA 5DEXA 2NOOA 3B7DA 3VVFA 4EQ9A 5DYHA 3O6HA 1IXHA 2E1SA 1OQHA 2V3TA 4KYEA 1A54A 3Q29A 3OOAA 4R2FA 3FUZA 1H45A 2FYIA 2NUVA 3LSWA 5I2NA 3S9EA 4ZS9A 3PPNA 1AMFA 1B4HA 2ZMBA 3SEUA 5CMMA 3TKDA 2OZZA 3GXAA 3CSGA 4IGRA 1MM7A 3O6GA 4G2ZA 1P1NA 4ISUA 4O3AA 4X9TA 5CM6A 1LSTA 5H8QB 1XVXA 1M5DA 3A09A 1WVJA 2CZLA 4F22A 2X7QA 1Y3PA 1FTLA 1US5A 1A7LA 4G77A 4GQOA 2HAUA 4OESA 3MZ9A 5L9OA 1IZ1A 4ZZEA 5TP9A 1F9BA 1MH4A 2V3UA 3U92A 3SEWA 4R75A 5AA2A 5EHMA 1ZIUA 1R9LA 1MXUA 1MPBA 2DVCA 3K02A 3MVYA 5I56B 1AOVA 3K6XA 1NNPA 4G8MA 1URSA 1QUKA 3ECRA 2LAOA 2XXHA 3OSRA 4ND9A 3FGSA 2F7AA 4N13A 4R9FA 2I4CA 2GRVA 3EQ1A 3N26A 1D9YA 4YB6A 2QJEA 2CMOA 4U2RA 2QPQA 2GHAA 2KLFA 4WXJA 3DP6A 5KDTA 4Q8RA 3B6TA 1P1WA 1II5A 4FEDA 4ELOA 3KSJA 2H98A 2E0SA 1MPDA 1JVXA 1DOTA 3N6UA 3PD8A 4QSCA 1Y3NA 3SDFA 3A3CA 4RJZA 5B70A 4LUBA 3EN3A 3K1MA 4NF5A 3BBRA 4IO4A 4ZE9A 1XOCA 3EHSA 2ANJA 2Y7WA 4NF8B 1MY4A 4IB2A 3FXQA 1FCKA 4I8CA 4DLDA 2QS4A 3I5OA 3UGWA 1B3HA 3T93B 1SI1A 3IB0A 5DTBA 5TU0A 3T9VA 5IKBA 2HCAA 4BDRA 2A5TA 3IK6B 2QSXA 1POY1 2XD3A 1LFIA 1FQAA 1MS7A 1Y1ZA 3H4ZA 3TQWA 3MZBA 3KJ7A 3F11A 3FV2A 4RK9A 3UK4A 1B51A 4P11A 3VLVA 1YTVA 4YKPA 3MQ9A 2VD2A 1UTBB 3KOSA 1ZKBA 4ZDMA 5EYFA 1B3LA 1MY0A 2OK2A 4JSOA 1LLSA 3DM0A 3JV9A 3GLBA 2REGA 1SW2A 4KYDA 4BDOA 4Q30B 5AE4A 5KZTA 4OEVA 3H6VA 1LAXA 4EXLA 4HCWA 4F19A 1TWYA 4DZ1A 5JTYA 3SERA 1NNFA 3BFUA 2DWIA 1LGBC 3CIJA 4LZ8A 3O28A 4M4GA 4Z0IA 4QFPA 2D21A 5H8HA 2M8CA 2Y7RA 1DSNA 5FHOA 1ATGA 1B58A 3TFLA 4NF4B 4LZ5A 3RGYA 4E0WA 3IORA 4MH5A 1A55A 3CR9A 1PB8A 4GXSB 4RPNA 4GLIA 2DE4A 1LFHA 1JNFA 1XVYA 2XXRA 3LSFB 3RN8A 3W9WA 3IO4A 3O9PA 3K01A 4H5GA 1LAHE 3TYHA 5I2NB 2R9JA 3GBAA 3HV1A 1Z7ME 3PMVA 4ECFA 1IXCA 2WKYA 3ILUB 1TFDA 2GFEA 4KYSA 2XXWA 4G68B 1SYHA 1MXXA 2QL3A 3E3KA 3KN8A 4Q5TA 5EHSA 1BP5A 3E13X 4YB7A 2UVIA 2F7BA 2I0CA 2DE2A 2THIA 5A5XB 1B3GA 2Z22A 5H8QA 5I59A 4OENA 1H44A 3T96B 5DVJA 3K1PA 1J1NA 3JZJA 5B7DA 1B52A 2PT2A 2AIXA 1JW4A 3H6UA 4U23A 4F39A 1GTKA 4QFNA 1YCJA 4RNSA 1NKXA 1XT8A 3HCQA 4YMAA 2HFBA 1LB8A 4OQOA 4OEUA 3VV5A 3PUYE 4H8JA 4F2OA 1JEUA 2VD3A 2PYYA 3G3JA 4RA1A 1N3XA 2ZYKA 4JWXA 5I84A 3IOTA 2DWAA 1QULA 3RNNA 1LFGA 5H8HB 1A8EA 4KD5A 4ZEDA 1QKBA 4ESWA 2O1MA 1AL3A 1FQFA 3JYRA 1Y4CA 3QIMA 4NF4A 3OO7A 3TTMA 5I2KA 2RC8A 3K6VA 3BKIB 1R6ZA 1OMPA 1H43A 3O66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXZ A;  1S7Y A;  4PFY A;  3C4M A;  1DMB A;  4POW A;  1FQD A;  1OQG A;  2RC9 A;  3O97 A;  3EF7 A;  4PQJ A;  4ZEB A;  3WAF A;  3MW0 A;  3IR1 A;  5CMK A;  3FZV A;  3OEL A;  3N94 A;  1MY2 A;  2I49 A;  3G3I A;  4GOT A;  2H99 A;  4POX A;  1KWH A;  1JVY A;  4OFL A;  1YPN A;  4R73 A;  1MQI A;  1ZMG A;  3P7I A;  4TOZ A;  2OWS A;  5I59 B;  2PBW A;  1B0L A;  1SBP A;  1MM6 A;  2NVU B;  3KZG A;  3L6H A;  4XKR A;  5I58 B;  1A8F A;  1Y4T A;  3TOD A;  3O2A A;  3CG3 A;  3TCH A;  1Y3Q A;  1GVC A;  4U4S A;  5AA3 A;  2F34 A;  4NWD A;  2VHA A;  3LBS A;  1SDX A;  2DXY A;  2NWJ A;  1FQC A;  1MXV A;  2VOZ A;  2DS9 A;  3ZSF A;  4ELP A;  3FAT A;  4GXA A;  4GWO A;  4FIM A;  2W7Y A;  1CB6 A;  3IB1 A;  3EHT A;  2RCA A;  3PV0 E;  4PFW A;  1PBQ A;  1TXF A;  3KEI A;  4OVJ A;  3TTK A;  2Y7K A;  4KHZ E;  2AYS A;  2B3F A;  2I58 A;  5I57 A;  3QK6 A;  3KFM A;  1A40 A;  1B7Z A;  4FEC A;  2XX8 A;  2FA7 A;  4R2B A;  4G68 C;  1MG1 A;  4N6P A;  3RT6 B;  5BUU A;  1UTH A;  3V5A A;  2Q2C A;  3LC8 A;  3MPL A;  4JBZ A;  5JEI A;  1JEV A;  4YKI A;  3TDJ A;  4XXU A;  2ZYM A;  5L9S A;  3MVX A;  3TEP A;  3SEY A;  4FOR A;  5KCJ B;  3FIR A;  3MP1 A;  3ODB A;  4IY5 A;  4QFL A;  3PD9 A;  3VVD A;  4H0W A;  5F1Q A;  3FJG A;  1BKA A;  1DPP A;  1B1H A;  3MJN A;  2GHB A;  3MVZ A;  1PBP A;  2O6A A;  4GD5 A;  2Q2A A;  5K2Y A;  4IGT A;  4O3B A;  4F3P A;  4IO6 A;  5ITO A;  2A5S A;  3K6W A;  4XTC Q;  1OVT A;  2REJ A;  4YAH X;  4Z7E A;  3VFJ A;  2XX9 A;  1HSE A;  2IEE A;  3C33 A;  2BJJ X;  2PVU A;  3IO6 A;  1ELJ A;  2RIN A;  4DXC A;  1FTJ A;  2QS3 A;  5H8S A;  3VLW A;  3PPQ A;  1RYX A;  2ESN A;  1N3W A;  5DEX B;  2OWT A;  3H3G A;  4HS7 A;  4RY1 A;  4ELQ A;  2DXR A;  4G8H A;  4EQB A;  2F8D A;  4H6D A;  3N6T A;  2YLN A;  4I9D A;  3PPP A;  2F6P A;  1MXY A;  1QVS A;  4IO7 A;  4NED A;  3TCF A;  5FHN A;  4AQ4 A;  4FEB A;  2QMW A;  4QSD A;  4ZEC A;  5M2V A;  2ZNT A;  2DE3 A;  3IAZ A;  3ZKL A;  3RY3 A;  1M5C A;  1LBC A;  1R9Q A;  3Q25 A;  4F1V A;  2R6G E;  4R6H A;  2QMX A;  1IXI A;  2QS2 A;  1JW5 A;  1CE2 A;  4GF8 A;  2O68 A;  1WDN A;  4E0X A;  5IAI A;  1VFE A;  3VE1 B;  2O69 A;  3DP4 A;  4H67 A;  2RC7 A;  4QHQ A;  2X7P A;  2XHD A;  4H1X A;  2ONK E;  5L8D A;  5TP9 B;  3FD3 A;  1NNK A;  5LOM A;  1EZO A;  2G93 A;  1B40 A;  3VXB A;  5AA2 B;  1IIW A;  1URD A;  3S9L C;  3QYT A;  1QUJ A;  4R74 A;  1P1Q A;  1XC1 A;  3OEK A;  1FTM A;  5CBR A;  1IEJ A;  3CRB A;  2O51 A;  3PUX E;  5AA1 A;  3R7X A;  3TEL A;  1LAG E;  2RKM A;  1LAF E;  4F2Q A;  4R6K A;  1P1U A;  1B2H A;  2F78 A;  2A5T B;  1O64 A;  3FAS A;  2V3Q A;  3C35 A;  3K2D A;  3MVW A;  4KI0 E;  2I48 A;  3AXF A;  4U4X A;  5K2X A;  4LON B;  4F1Y A;  4F31 B;  4YKJ A;  2ALU A;  1OLC A;  2F7C A;  2O1L A;  1RYO A;  3FXU A;  2VP1 A;  2OCU A;  4XKN A;  2V93 A;  1AH5 A;  4MF3 A;  4XIG Q;  2Z23 A;  4C1T A;  4IY6 A;  3C31 A;  3T9H B;  3D4G A;  1IUD A;  3T9X B;  1UIV A;  4EUO A;  1VR5 A;  2Q88 A;  2HAV A;  5CC2 A;  3OEN A;  1B4Z A;  3QUF A;  1GV8 A;  1LCF A;  2Z8D A;  4JDF A;  4OTE A;  1GGG A;  2PMS A;  1JQF A;  3C34 A;  4OMB A;  2DWH A;  3DEL B;  1M5B A;  2VGQ A;  3HO7 A;  2XXQ A;  4LAT A;  4NMY A;  1AIV A;  3TMG A;  4BDM A;  2H5Y A;  4NF6 B;  5L9M A;  3HPI A;  2HEU A;  3MAM A;  3N5L A;  2D5W A;  3IB2 A;  4X1B A;  3Q27 A;  4UAC A;  4U21 A;  5CRY A;  3V8X B;  4KR5 A;  4F18 A;  1IXG A;  2F36 A;  3CI8 A;  4TLM B;  4AB6 A;  1T0K A;  3U8Q A;  4WED A;  1SQY A;  4YKK A;  2Q8J A;  1LCT A;  2F5X A;  4MLQ A;  2H25 A;  2Q89 A;  4G4P A;  5AA4 A;  3H7M A;  1IQ7 A;  1VFD A;  3LSL A;  1ZLQ A;  1MQD A;  3BFT A;  3CFL A;  1N76 A;  4M1V A;  1SW1 A;  4YU0 A;  1M5F A;  4OET A;  3W9V A;  4R6Y A;  4AB5 A;  3OO8 A;  1N84 A;  1OIB A;  3S4U A;  4OFO A;  4NTL A;  3HHG A;  1B6H A;  3D4C A;  2O7I A;  2UVG A;  3MC2 A;  1NH7 A;  3FVN A;  3WAE A;  4GL0 A;  1I6B A;  2DVZ A;  2I6E A;  3OMB A;  2PX1 A;  4R9G A;  5CMC A;  4BDQ A;  3MWB A;  4BDN A;  3PPO A;  3H06 B;  4GVO A;  2UVH A;  1LBB A;  4C0R A;  2XX7 A;  4DXB A;  1USY H;  4FE8 A;  4LA9 A;  4DDD A;  1FTO A;  1B3E A;  2H4I A;  1SW4 A;  2DQV A;  3IOU A;  4I62 A;  1MDQ A;  4QRZ A;  3ZS6 A;  3QAX A;  5CMB A;  2HQ0 A;  1Q35 A;  4ESX A;  4F3G A;  3S9M C;  1DTG A;  4FAJ A;  5ICT A;  3VLU A;  2XXU A;  2PT1 A;  3PUV E;  3QXM A;  3KGC A;  4JXI A;  1B5J A;  5DT6 A;  4DIG A;  1ZBM A;  3GZG A;  3HHF A;  5HPQ A;  1ZTY A;  2UYF A;  2HZL A;  3ILT B;  4GL8 A;  5JTY B;  1L5T A;  4LZ7 A;  1HSL A;  1NH8 A;  3U93 A;  1YAE A;  5CI5 A;  3THI A;  4HW8 A;  1P1O A;  1B1X A;  1N7X A;  1N7W A;  1MY3 A;  2V25 A;  3FVG A;  3R6U A;  3E9X A;  1OLA A;  4H8I A;  3TCG A;  3U1O A;  3UA8 A;  3LR1 A;  1SI0 A;  5FHM A;  3B6Q A;  1B7U A;  3Q26 A;  2Y84 A;  5H8N B;  2Z8E A;  1N0T A;  1VE4 A;  3FVO A;  1MRP A;  1EZ9 A;  2RF1 A;  2ZNS A;  3UOR A;  4MLV A;  1UIU A;  2OBG A;  2XXY A;  4HCY A;  1SD3 A;  1B5I A;  2IA4 A;  3K0V A;  4P0G A;  4BDL A;  4NWC A;  3KG2 A;  3MP8 A;  2QRY A;  4QFK A;  1Y9U A;  2ZNU A;  2XXP A;  3G3H A;  5H8F B;  2ONR A;  3M3F A;  5HBC A;  2UVJ A;  2XXI A;  3M3L A;  3MUQ A;  3H6W A;  1B05 A;  1S50 A;  3PMW A;  2P1S A;  4KPT A;  4MBP A;  4EQ7 A;  3IJO B;  4JSD A;  1TFA A;  3EPE A;  4R72 A;  4ZEF A;  1SYI A;  2P0S A;  4TQU Q;  1MDP 1;  3SKP A;  3ZKK A;  1H3D A;  2I0B A;  2I3V A;  2UYE A;  3Q28 A;  3K00 A;  5TPA B;  2ZYN A;  4NF5 B;  2DSF A;  2F6G A;  3USD A;  1B0H A;  1GR2 A;  4YIC A;  1I6A A;  2YJP A;  1S9T A;  2I4B A;  4PP0 A;  4RYA A;  3UP9 A;  4I1D A;  4Q0C A;  1D4N A;  1POT A;  4NF6 A;  4YZZ A;  5H8N A;  4JWY A;  1JW1 A;  3A3U A;  4WKM A;  1NNT A;  1LB9 A;  1PDA A;  3PMX A;  1OVB A;  4G8N A;  2ABH A;  2O84 X;  2X26 A;  3UIF A;  1URG A;  2B65 A;  2Q9T A;  3RT8 A;  4PFT A;  4MFI A;  2B3B A;  3PGF A;  1QUI A;  4GFR A;  5DVF A;  3U94 A;  1XS5 A;  4KQP A;  2NXO A;  2Z8F A;  3PU5 A;  1BIY A;  1B9J A;  4U1O A;  4PE5 B;  4KCD A;  1MQH A;  3FV1 A;  1FQB A;  3O29 A;  4OER A;  4OXV A;  3FVK A;  1NL5 A;  4PET A;  3KN7 A;  4H65 A;  4ZZA A;  1Y20 A;  3IOV A;  4UA8 A;  1ANF A;  4NE4 A;  3IJX B;  1B46 A;  4H5F A;  3T22 A;  1IIT A;  1HSJ A;  1P99 A;  1QJM A;  2I3W A;  3CVG A;  4G68 A;  1XHY A;  4NF8 A;  1MY1 A;  3G7W A;  4THI A;  3E4R A;  4U1Z A;  3OSQ A;  3V83 A;  4YB5 A;  3OO9 A;  4LQ5 A;  5KCJ A;  5FTI A;  3S9N C;  3IX1 A;  1PEB A;  2ZXT A;  1B3F A;  1VSO A;  3CFZ A;  3OXN A;  4XKP A;  4EDP A;  3LSX A;  2ZYO A;  3VXC A;  4FJP A;  2D3I A;  4LP2 B;  2V84 A;  4OFJ A;  3IL1 B;  1UTB A;  5TPA A;  3KOT A;  5ITP A;  1USY E;  3SEX A;  3QSL A;  1NFT A;  3CSB A;  3ONM A;  4JWO A;  3SES A;  2DYX A;  3UN6 A;  1I6Q A;  3DP8 A;  4OZ9 A;  1MH3 A;  1I69 A;  4K3F A;  3FJ7 A;  4JB7 A;  4OWD A;  2RCB A;  3B6W A;  3RUM A;  4FAT A;  1US4 A;  3TTR A;  3T66 A;  4KFQ A;  1DPE A;  3W15 C;  3KSX A;  3G3F A;  4ELR A;  2ONS A;  1TT1 A;  1BLF A;  3LUY A;  4HTG A;  4RK2 A;  4ZEK A;  3TTN A;  3H6T A;  1O7T A;  4PFU A;  3CFX A;  4P0I A;  3TAJ A;  3KBR A;  1Z7N E;  4XKQ A;  4IO2 A;  4GRK A;  5DVI A;  1EU8 A;  2DOJ A;  4F1U A;  4LQ2 A;  3G3K A;  3HN0 A;  4N07 A;  3SEV A;  3IOW A;  5I56 A;  3DLN A;  1ZJL A;  5BWJ A;  3TTL A;  2Y7P A;  4F3B A;  2F97 A;  1UQW A;  4TLL B;  5F7V A;  3U72 A;  1BTJ A;  4YMB A;  1RKM A;  1SVX B;  1ZU0 A;  1SW5 A;  2F35 A;  2Y7I A;  3GBB A;  3O6I A;  3VVE A;  5I2K B;  1QW0 A;  3I6V A;  3OD7 A;  4EF2 A;  3C9H A;  4DCX A;  1B7H A;  3C36 A;  4ONY A;  3L6G A;  4U22 A;  3RTW B;  3T9U A;  3TPA A;  4DXU A;  1A99 A;  3MZ1 A;  3RLF E;  5J1D A;  1JET A;  1DTZ A;  2OLB A;  3S2V A;  4EF1 A;  1FQE A;  4IO5 A;  3PUZ E;  4C1U A;  2DWJ A;  2QS1 A;  1R1N A;  3QUJ A;  4RPO A;  1B32 A;  1EH3 A;  1QKA A;  1WOD A;  3KJT A;  2XXX A;  4RXL A;  1NMU A;  2AL5 A;  4EXK A;  2DP8 A;  2R71 A;  1MPC A;  2XD2 A;  2XXV A;  5ELV A;  3K1N A;  1O63 A;  3M3K A;  1H76 A;  5ICQ A;  4ZEI A;  3TZA A;  5A5X A;  3K4U A;  1MQG A;  3CG1 A;  4QFO A;  3PUW E;  1D9V A;  1EZP A;  3TQL A;  4KCC A;  1Y1M A;  2AL4 A;  5FTH A;  2OJT A;  1MQJ A;  3G3G A;  3V89 B;  4F3S A;  3MBP A;  4X1D A;  4ZE8 A;  3SET A;  1Q1K A;  4DE8 A;  2UXA A;  3HST A;  4OYV A;  2FNC A;  2XXT A;  5CBS A;  1D3K A;  4L17 A;  3M8U A;  1PB7 A;  5AA2 D;  3C32 A;  1UTH B;  4GIZ A;  2O7U A;  3H03 A;  4QSE A;  4X48 A;  5JK4 A;  4DCY A;  3I3V A;  4QF9 A;  1N04 A;  3MP6 A;  4OHN A;  4WEP A;  5ISU A;  2H9B A;  4O3C A;  3K6U A;  4IO3 A;  3RPW A;  5I57 B;  2G29 A;  3FXR A;  3FJM A;  3R26 A;  4F29 A;  1PC3 A;  3TUS A;  3RQT A;  3OO6 A;  5H8F A;  1M5E A;  2GH9 A;  3EHU A;  1B5H A;  1MXW A;  3RTF B;  5I58 A;  2P2A A;  2YPN A;  3MPK A;  3VDF A;  4BLA A;  5HM4 B;  5KDT B;  1PB9 A;  5AA4 B;  1FW0 A;  2HXW A;  2HZK A;  1FTK A;  3KN3 A;  3PPR A;  3OEM A;  4LVQ A;  5DEX A;  2NOO A;  3B7D A;  3VVF A;  4EQ9 A;  5DYH A;  3O6H A;  1IXH A;  2E1S A;  1OQH A;  2V3T A;  4KYE A;  1A54 A;  3Q29 A;  3OOA A;  4R2F A;  3FUZ A;  1H45 A;  2FYI A;  2NUV A;  3LSW A;  5I2N A;  3S9E A;  4ZS9 A;  3PPN A;  1AMF A;  1B4H A;  2ZMB A;  3SEU A;  5CMM A;  3TKD A;  2OZZ A;  3GXA A;  3CSG A;  4IGR A;  1MM7 A;  3O6G A;  4G2Z A;  1P1N A;  4ISU A;  4O3A A;  4X9T A;  5CM6 A;  1LST A;  5H8Q B;  1XVX A;  1M5D A;  3A09 A;  1WVJ A;  2CZL A;  4F22 A;  2X7Q A;  1Y3P A;  1FTL A;  1US5 A;  1A7L A;  4G77 A;  4GQO A;  2HAU A;  4OES A;  3MZ9 A;  5L9O A;  1IZ1 A;  4ZZE A;  5TP9 A;  1F9B A;  1MH4 A;  2V3U A;  3U92 A;  3SEW A;  4R75 A;  5AA2 A;  5EHM A;  1ZIU A;  1R9L A;  1MXU A;  1MPB A;  2DVC A;  3K02 A;  3MVY A;  5I56 B;  1AOV A;  3K6X A;  1NNP A;  4G8M A;  1URS A;  1QUK A;  3ECR A;  2LAO A;  2XXH A;  3OSR A;  4ND9 A;  3FGS A;  2F7A A;  4N13 A;  4R9F A;  2I4C A;  2GRV A;  3EQ1 A;  3N26 A;  1D9Y A;  4YB6 A;  2QJE A;  2CMO A;  4U2R A;  2QPQ A;  2GHA A;  2KLF A;  4WXJ A;  3DP6 A;  5KDT A;  4Q8R A;  3B6T A;  1P1W A;  1II5 A;  4FED A;  4ELO A;  3KSJ A;  2H98 A;  2E0S A;  1MPD A;  1JVX A;  1DOT A;  3N6U A;  3PD8 A;  4QSC A;  1Y3N A;  3SDF A;  3A3C A;  4RJZ A;  5B70 A;  4LUB A;  3EN3 A;  3K1M A;  4NF5 A;  3BBR A;  4IO4 A;  4ZE9 A;  1XOC A;  3EHS A;  2ANJ A;  2Y7W A;  4NF8 B;  1MY4 A;  4IB2 A;  3FXQ A;  1FCK A;  4I8C A;  4DLD A;  2QS4 A;  3I5O A;  3UGW A;  1B3H A;  3T93 B;  1SI1 A;  3IB0 A;  5DTB A;  5TU0 A;  3T9V A;  5IKB A;  2HCA A;  4BDR A;  2A5T A;  3IK6 B;  2QSX A;  1POY 1;  2XD3 A;  1LFI A;  1FQA A;  1MS7 A;  1Y1Z A;  3H4Z A;  3TQW A;  3MZB A;  3KJ7 A;  3F11 A;  3FV2 A;  4RK9 A;  3UK4 A;  1B51 A;  4P11 A;  3VLV A;  1YTV A;  4YKP A;  3MQ9 A;  2VD2 A;  1UTB B;  3KOS A;  1ZKB A;  4ZDM A;  5EYF A;  1B3L A;  1MY0 A;  2OK2 A;  4JSO A;  1LLS A;  3DM0 A;  3JV9 A;  3GLB A;  2REG A;  1SW2 A;  4KYD A;  4BDO A;  4Q30 B;  5AE4 A;  5KZT A;  4OEV A;  3H6V A;  1LAX A;  4EXL A;  4HCW A;  4F19 A;  1TWY A;  4DZ1 A;  5JTY A;  3SER A;  1NNF A;  3BFU A;  2DWI A;  1LGB C;  3CIJ A;  4LZ8 A;  3O28 A;  4M4G A;  4Z0I A;  4QFP A;  2D21 A;  5H8H A;  2M8C A;  2Y7R A;  1DSN A;  5FHO A;  1ATG A;  1B58 A;  3TFL A;  4NF4 B;  4LZ5 A;  3RGY A;  4E0W A;  3IOR A;  4MH5 A;  1A55 A;  3CR9 A;  1PB8 A;  4GXS B;  4RPN A;  4GLI A;  2DE4 A;  1LFH A;  1JNF A;  1XVY A;  2XXR A;  3LSF B;  3RN8 A;  3W9W A;  3IO4 A;  3O9P A;  3K01 A;  4H5G A;  1LAH E;  3TYH A;  5I2N B;  2R9J A;  3GBA A;  3HV1 A;  1Z7M E;  3PMV A;  4ECF A;  1IXC A;  2WKY A;  3ILU B;  1TFD A;  2GFE A;  4KYS A;  2XXW A;  4G68 B;  1SYH A;  1MXX A;  2QL3 A;  3E3K A;  3KN8 A;  4Q5T A;  5EHS A;  1BP5 A;  3E13 X;  4YB7 A;  2UVI A;  2F7B A;  2I0C A;  2DE2 A;  2THI A;  5A5X B;  1B3G A;  2Z22 A;  5H8Q A;  5I59 A;  4OEN A;  1H44 A;  3T96 B;  5DVJ A;  3K1P A;  1J1N A;  3JZJ A;  5B7D A;  1B52 A;  2PT2 A;  2AIX A;  1JW4 A;  3H6U A;  4U23 A;  4F39 A;  1GTK A;  4QFN A;  1YCJ A;  4RNS A;  1NKX A;  1XT8 A;  3HCQ A;  4YMA A;  2HFB A;  1LB8 A;  4OQO A;  4OEU A;  3VV5 A;  3PUY E;  4H8J A;  4F2O A;  1JEU A;  2VD3 A;  2PYY A;  3G3J A;  4RA1 A;  1N3X A;  2ZYK A;  4JWX A;  5I84 A;  3IOT A;  2DWA A;  1QUL A;  3RNN A;  1LFG A;  5H8H B;  1A8E A;  4KD5 A;  4ZED A;  1QKB A;  4ESW A;  2O1M A;  1AL3 A;  1FQF A;  3JYR A;  1Y4C A;  3QIM A;  4NF4 A;  3OO7 A;  3TTM A;  5I2K A;  2RC8 A;  3K6V A;  3BKI B;  1R6Z A;  1OMP A;  1H43 A;  3O66 A; 
#chains in the Genus database with same CATH topology
 3C4M A;  4GWW A;  1OQG A;  5CMK A;  3OEL A;  2PFY A;  2OWS A;  2PBW A;  1MM6 A;  3L6H A;  4XKR A;  3CG3 A;  5AA3 A;  1GVC A;  4U4S A;  2F34 A;  1EYJ A;  1JP4 A;  4GWO A;  3IB1 A;  3KEI A;  2Y7K A;  3QMF A;  2B4M A;  1UTH A;  3V5A A;  3LC8 A;  4NF0 A;  3TEP A;  4MIJ A;  3ODB A;  4QFL A;  3VVD A;  3PD9 A;  4H0W A;  5F1Q A;  1BKA A;  5L9M A;  1B1H A;  3MJN A;  2GHB A;  3MVZ A;  4F3P A;  2O6A A;  4YAH X;  1LBZ A;  2IEE A;  3C33 A;  3IO6 A;  1N3W A;  4HS7 A;  2Y5L A;  1MXY A;  1QVS A;  2ZNT A;  3RY3 A;  1IXI A;  1WDN A;  4E0X A;  1FSA A;  3VE1 B;  4HE0 A;  2RC7 A;  3FD3 A;  1NNK A;  1FTA A;  3TEL A;  3PUX E;  1LAF E;  4R6K A;  3KBZ A;  3FAS A;  3K2D A;  3MVW A;  4F1Y A;  4F31 B;  4YKJ A;  2O1L A;  3FXU A;  2VP1 A;  3T9H B;  3D4G A;  1IUD A;  1VR5 A;  1GV8 A;  4OTE A;  1GGG A;  2PMS A;  2VGQ A;  2XXQ A;  2H5Y A;  4I3Y A;  3HPI A;  2HEU A;  4UAC A;  4KR5 A;  4TLM B;  1IQ7 A;  3LSL A;  3CFL A;  4M1V A;  4YU0 A;  1M5F A;  1OIB A;  1NH7 A;  4PFB A;  5I7I A;  4C0R A;  1LBB A;  4DXB A;  4LA9 A;  1RDZ A;  2H4I A;  1SW4 A;  2DQV A;  4F3G A;  3S9M C;  2P3N A;  2XXU A;  2PT1 A;  1D9Q A;  5JTY B;  2HZL A;  4LZ7 A;  1YAE A;  5CI5 A;  3R6U A;  3LR1 A;  5FHM A;  3B6Q A;  2Y84 A;  2GQ1 A;  5H8N B;  3FVO A;  1MRP A;  4P8B A;  4X04 A;  3UOR A;  1UIU A;  3K0V A;  4PAF A;  2QRY A;  3FXB A;  3G3H A;  5HBC A;  2ONR A;  3M3L A;  3PMW A;  4BDL A;  1B05 A;  4EQ7 A;  3SKP A;  4TQU Q;  1MDP 1;  2I0B A;  3Q28 A;  3K00 A;  2ZYN A;  2F6G A;  1GR2 A;  1S9T A;  4RYA A;  1POT A;  3A3U A;  1NNT A;  2X26 A;  2B4L A;  1URG A;  3PGF A;  1XS5 A;  2NXO A;  1BIY A;  1B9J A;  4KCD A;  1MQH A;  1FQB A;  3FVK A;  4H65 A;  5F24 A;  1HSJ A;  1P99 A;  1QJM A;  4G68 A;  4THI A;  3E4R A;  4P1E A;  5IZ3 B;  4LQ5 A;  4NX1 A;  5FTI A;  1VSO A;  3VXC A;  4OFJ A;  3SEX A;  3ONM A;  2DYX A;  3FJ7 A;  2XWV A;  1US4 A;  3TTR A;  3T66 A;  3G3F A;  2XA5 A;  4ELR A;  4HTG A;  3LUY A;  4PFU A;  4JVD A;  2QFL A;  4N6D A;  5I56 A;  1ZJL A;  2Y7P A;  2F97 A;  3U72 A;  4O7M A;  1SVX B;  2Y7I A;  5IKB A;  1QW0 A;  3L6G A;  3RTW B;  3T9U A;  4PE3 A;  1A99 A;  5J1D A;  3S2V A;  2QS1 A;  2Q74 A;  2R8T A;  1B32 A;  1EH3 A;  1QKA A;  5ESY A;  2XXX A;  4P47 A;  1NMU A;  2XXV A;  1MPC A;  5A5X A;  4QFO A;  3PUW E;  3TQL A;  2AL4 A;  3V89 B;  4F3S A;  2FNC A;  1D3K A;  5AA2 D;  3H03 A;  4QSE A;  4X48 A;  1FBD A;  1N04 A;  3MP6 A;  2H9B A;  4O3C A;  5I57 B;  2G29 A;  3FJM A;  3RQT A;  3OO6 A;  2P2A A;  3KN3 A;  1FTK A;  2NOO A;  3B7D A;  3O6H A;  2E1S A;  4KYE A;  1A54 A;  3Q29 A;  5I2N A;  1H45 A;  3PPN A;  1B4H A;  3GXA A;  4IGR A;  1MM7 A;  4G2Z A;  4X9T A;  5CM6 A;  5H8Q B;  3A09 A;  1M5D A;  1Y3P A;  5L9O A;  2HAU A;  1F9B A;  4GBW A;  5AA2 A;  5I56 B;  1MXU A;  1AOV A;  2QVU A;  1NNP A;  3EQ1 A;  1LBV A;  2GHA A;  5KDT A;  1II5 A;  1KA1 A;  3KSJ A;  2H98 A;  3PD8 A;  3SDF A;  3A3C A;  4LUB A;  3EN3 A;  3K1M A;  4NF5 A;  2ANJ A;  2Y7W A;  1MY4 A;  4I8C A;  3IB0 A;  4BDR A;  2QSX A;  3H4Z A;  3TQW A;  3VLV A;  3KJ7 A;  3F11 A;  3KOS A;  1ZKB A;  5EYF A;  3JV9 A;  1SW2 A;  1LAX A;  4EXL A;  4HCW A;  4F19 A;  1EYI A;  4PFI A;  2DWI A;  3CIJ A;  3O28 A;  4QFP A;  5H8H A;  5J16 A;  2Y7R A;  5FHO A;  3TFL A;  4RPN A;  3CR9 A;  3W9W A;  3K01 A;  1LAH E;  5I2N B;  3HV1 A;  1Z7M E;  2WKY A;  1TFD A;  2GFE A;  4KYS A;  2XXW A;  3E3K A;  3FBP A;  4YB7 A;  3U65 A;  2F7B A;  2DE2 A;  5A5X B;  5I59 A;  5H8Q A;  4MEV A;  4I3E A;  4N8G A;  1NKX A;  2PFZ A;  4F2O A;  5I84 A;  1FQF A;  1KA0 A;  4PGN A;  3K6V A;  5ET5 A;  1H43 A;  4HE1 A;  3WAF A;  2RC9 A;  4PQJ A;  3MW0 A;  3IR1 A;  2I49 A;  4GOT A;  2H99 A;  1NV0 A;  1KWH A;  4TOZ A;  1MQI A;  2WX9 A;  3KZG A;  4MNP A;  1A8F A;  3TOD A;  2CZH A;  2VHA A;  3LBS A;  2NWJ A;  4ELP A;  2DS9 A;  3GYY A;  4FIM A;  2W7Y A;  1K9Z A;  2AYS A;  2B3F A;  2XX8 A;  4R2B A;  4G68 C;  1FBG A;  1NV5 A;  5JEI A;  1JEV A;  4YKI A;  3TDJ A;  4XXU A;  2ZYM A;  4FOR A;  3FIR A;  4IY5 A;  2XWI A;  4IGT A;  4O3B A;  4IO6 A;  3VFJ A;  2XX9 A;  1HSE A;  4OVQ A;  1ELJ A;  2RIN A;  4DXC A;  1RYX A;  5DEX B;  2DXR A;  2MKZ A;  4G8H A;  3N6T A;  3PPP A;  5FHN A;  4FEB A;  2QMW A;  3IAZ A;  2XWK A;  3Q25 A;  1IMA A;  2R6G E;  4R6H A;  2QS2 A;  2O68 A;  2O69 A;  3DP4 A;  4H67 A;  4QHQ A;  2XHD A;  4H1X A;  2ONK E;  2WYK A;  3S9L C;  2ZZW A;  4R74 A;  1P1Q A;  3OEK A;  5CBR A;  2Q8M A;  4F2Q A;  1LAG E;  2RKM A;  1FPL A;  1P1U A;  2P3V A;  2A5T B;  2V3Q A;  1YYZ A;  5K2X A;  3AXF A;  1RYO A;  2HHM A;  2Z23 A;  3T0J A;  4C1T A;  4EUO A;  2HAV A;  5EQ7 A;  1LCF A;  4JDF A;  4OMB A;  2DWH A;  1M5B A;  3TMG A;  4BDM A;  1DK4 A;  4N81 A;  3Q27 A;  4F18 A;  1IXG A;  1T0K A;  3U8Q A;  4WED A;  2Q8J A;  2Q89 A;  5AA4 A;  3H7M A;  1MQD A;  4OET A;  3W9V A;  1N84 A;  1B6H A;  2UVG A;  3WAE A;  4GL0 A;  1I6B A;  2DVZ A;  5KCJ B;  5ISU A;  5CMC A;  3MWB A;  3H06 B;  2UVH A;  2XX7 A;  3CHG A;  4I62 A;  4NQ8 A;  3B50 A;  3ZS6 A;  3QAX A;  1RDX A;  1Q35 A;  4ESX A;  1DTG A;  5ICT A;  3VLU A;  4DIG A;  3QXM A;  5DT6 A;  4EQB A;  5HPQ A;  3GZG A;  3HHF A;  3ILT B;  4GL8 A;  3U93 A;  3THI A;  2FBP A;  1N7X A;  4N4U A;  1N7W A;  1IME A;  2FIX A;  1B7U A;  3Q26 A;  2Z8E A;  4DI4 B;  4QBA A;  1N0T A;  1EZ9 A;  2ZNS A;  2OBG A;  4HCY A;  4H45 A;  4QFK A;  1Y9U A;  5H8F B;  2UVJ A;  2XXI A;  3MUQ A;  4MBP A;  4JSD A;  3EPE A;  5LDZ A;  2PCR A;  3ZKK A;  5TPA B;  1B0H A;  4YIC A;  5DW8 A;  2YJP A;  3UP9 A;  4YZZ A;  1JW1 A;  1OVB A;  4G8N A;  2O84 X;  4PFT A;  4NGU A;  3RYD A;  4UAB A;  4N91 A;  4ZZA A;  3KN7 A;  3LV0 A;  4UA8 A;  1ANF A;  3IJX B;  1G0H A;  5KCJ A;  1PEB A;  2ZXT A;  3OXN A;  4XKP A;  1FPE A;  2ZYO A;  4FJP A;  3IL1 B;  1UTB A;  1USY E;  1NFT A;  3ZSF A;  1VDW A;  3UN6 A;  4GWS A;  3DP8 A;  4JB7 A;  4OWD A;  4P0I A;  4GRK A;  4XFE A;  4F1U A;  4LQ2 A;  3G3K A;  3IOW A;  3DLN A;  5BWJ A;  2KQZ A;  4F3B A;  4GX3 A;  1ZU0 A;  2F35 A;  1FBE A;  3VVE A;  3O6I A;  4EF2 A;  5LTC A;  1NI9 A;  3I6V A;  3C9H A;  1B7H A;  3TPA A;  3MZ1 A;  4EF1 A;  1FQE A;  3KJT A;  4RXL A;  2DP8 A;  2R71 A;  2F3D A;  2XD2 A;  4PF8 A;  3K1N A;  5T3J A;  5ICQ A;  4ZEI A;  3TZA A;  4P1L A;  1EZP A;  1Y1M A;  2OJT A;  4ZE8 A;  1Q1K A;  3HST A;  5CBS A;  4L17 A;  3M8U A;  1PB7 A;  2O7U A;  5JK4 A;  4PDH A;  3RPW A;  4F29 A;  1PC3 A;  5IGA A;  5H8F A;  3RTF B;  1B5H A;  2YPN A;  1DBZ A;  1PB9 A;  2HZK A;  3VVF A;  3OEM A;  4EQ9 A;  1NUY A;  2FYI A;  2NUV A;  4ZS9 A;  2QVV A;  4XF5 A;  3SEU A;  5CMM A;  4ISU A;  3O6G A;  4O3A A;  1LEV A;  1XVX A;  1WVJ A;  4F22 A;  4GQO A;  3MZ9 A;  4ZZE A;  5TP9 A;  5ET8 A;  2V3U A;  1R9L A;  5ET7 A;  1MPB A;  3MVY A;  3K6X A;  4G8M A;  3EKI A;  2XXH A;  3FGS A;  2GRV A;  3N26 A;  1D9Y A;  1NUW A;  2QJE A;  2CMO A;  4MMP A;  3B6T A;  4Q8R A;  2E0S A;  1MPD A;  4GX4 A;  4IO4 A;  1XOC A;  4IB2 A;  1FCK A;  4DLD A;  2QS4 A;  3UGW A;  5EQA A;  3T93 B;  1SI1 A;  2HCA A;  3IK6 B;  1POY 1;  2XD3 A;  1MS7 A;  3MZB A;  3MYU A;  3FV2 A;  1B51 A;  4P11 A;  1MY0 A;  5KZT A;  4Q30 B;  3H6V A;  1LBX A;  4DZ1 A;  5IZ1 A;  3SER A;  2D21 A;  2WBB A;  1ATG A;  4LZ5 A;  3RGY A;  4P9K A;  1A55 A;  1PB8 A;  1LFH A;  1JNF A;  3LSF B;  3IO4 A;  4H5G A;  2R9J A;  4ECF A;  2BJI A;  4G68 B;  5EHS A;  1MXX A;  3E13 X;  1FPF A;  4OEN A;  1H44 A;  4N17 A;  5DVJ A;  3JZJ A;  5B7D A;  1JW4 A;  1GTK A;  2ZZX A;  1YCJ A;  1NV2 A;  2HFB A;  5JTY A;  3VV5 A;  3G3J A;  4NN3 A;  1N3X A;  4JWX A;  3IOT A;  3RNN A;  5H8H B;  1A8E A;  4KD5 A;  4ZED A;  1QKB A;  1AL3 A;  4PAI A;  1Y4C A;  4NF4 A;  3OO7 A;  1R6Z A;  1S7Y A;  4PBQ A;  1FQD A;  3O97 A;  3EF7 A;  3G3I A;  4MX6 A;  4OFL A;  4R73 A;  1ZMG A;  3P7I A;  3RPL A;  3ISP A;  1B0L A;  1SBP A;  5I58 B;  2NVU B;  1NV6 A;  1Y4T A;  1Y3Q A;  4O7I A;  4GBV A;  1SDX A;  1FQC A;  1MXV A;  2WYP A;  4GXA A;  1CB6 A;  2RCA A;  4PFW A;  1TXF A;  4KHZ E;  1FRP A;  3KFM A;  1B7Z A;  3A29 A;  4FEC A;  2FA7 A;  4N6P A;  4PF6 A;  1EYK A;  5BUU A;  2Q2C A;  4JBZ A;  3MVX A;  1NV3 A;  3SEY A;  3FJG A;  5K2Y A;  2Q2A A;  3K6W A;  4AS4 A;  2BJJ X;  4PC9 A;  1IMB A;  1G0I A;  2ESN A;  2OWT A;  2YLN A;  4AQ4 A;  3TCF A;  4NED A;  4QSD A;  2ZZV A;  3PTY A;  2VT5 A;  3ZKL A;  1M5C A;  1LBC A;  5IAI A;  1VFE A;  1Q9D A;  1EZO A;  1B40 A;  1QUJ A;  1XC1 A;  1IEJ A;  4IR8 A;  5AA1 A;  4OAN A;  1B2H A;  4KI0 E;  2I48 A;  2ALU A;  1OLC A;  2OCU A;  4XKN A;  1UIV A;  3IFA A;  5CC2 A;  1B4Z A;  4PTK A;  1IMC A;  4JVC A;  2L5V A;  1BK4 A;  1JQF A;  1YXI A;  4NMY A;  4NF6 B;  3MAM A;  2D5W A;  4U21 A;  5CRY A;  3CI8 A;  1SQY A;  4MLQ A;  2H25 A;  1ZLQ A;  3BFT A;  1N76 A;  1SW1 A;  4R6Y A;  3S4U A;  4GWZ A;  4OFO A;  3HHG A;  3MC2 A;  3FVN A;  2PX1 A;  1KZ8 A;  2V4C A;  4R9G A;  4BDN A;  3PPO A;  4GVO A;  1USY H;  4FE8 A;  4DDD A;  1FTO A;  1B3E A;  1MDQ A;  5CMB A;  2HQ0 A;  2XXK A;  4FAJ A;  2KR0 A;  3PUV E;  4O94 A;  1B5J A;  2UYF A;  1HSL A;  1NH8 A;  4HW8 A;  1B1X A;  4H8I A;  2V25 A;  3FVG A;  1OLA A;  4NAP A;  1SI0 A;  2FHY A;  2RF1 A;  4P0G A;  1SD3 A;  1B5I A;  3KG2 A;  3MP8 A;  3M3F A;  4KPT A;  3H6W A;  3IJO B;  1TFA A;  4R72 A;  1SYI A;  2I3V A;  2UYE A;  4NF5 B;  4AS5 A;  3NOH A;  1LBY A;  1I6A A;  5A5L A;  2I4B A;  1D4N A;  4JWY A;  4WKM A;  3PMX A;  2ABH A;  2Q9T A;  2B3B A;  1QUI A;  4GFR A;  3E79 A;  3U94 A;  4KQP A;  2Z8F A;  3PU5 A;  4U1O A;  4OER A;  1Y20 A;  1NV7 A;  3IOV A;  4H5F A;  1IIT A;  2I3W A;  1AWB A;  3G7W A;  3V83 A;  4U1Z A;  3OSQ A;  4YB5 A;  3OO9 A;  3S9N C;  3CFZ A;  4EDP A;  1INP A;  3LSX A;  4LP2 B;  2V84 A;  5TPA A;  3QSL A;  4JWO A;  3SES A;  3VDF A;  4OZ9 A;  1MH3 A;  1I69 A;  3B6W A;  3W15 C;  5ET6 A;  1TT1 A;  1BLF A;  4RK2 A;  3TTN A;  3H6T A;  5FBP A;  3CFX A;  3TAJ A;  3KBR A;  3KC1 A;  4NHB A;  3SEV A;  3HN0 A;  1UQW A;  4YMB A;  3GBB A;  4MNI A;  3LUZ A;  4DCX A;  3C36 A;  4ONY A;  4U22 A;  4DXU A;  3RLF E;  1JET A;  2OLB A;  3PUZ E;  4C1U A;  2DWJ A;  3QUJ A;  1NV1 A;  4X8R A;  1WOD A;  2AL5 A;  4EXK A;  5ELV A;  1O63 A;  3SZP A;  1H76 A;  3K4U A;  1MQG A;  1D9V A;  4KCC A;  3G3G A;  3MBP A;  3IFC A;  3SET A;  4DE8 A;  4OVT A;  4OYV A;  2XXT A;  1FPB A;  4DCY A;  3I3V A;  4IO3 A;  1FBP A;  2GH9 A;  2JJK A;  1MXW A;  3MPK A;  4BLA A;  5HM4 B;  5AA4 B;  5DEX A;  4ELO A;  3PPR A;  1FBF A;  5DYH A;  2CZI A;  2V3T A;  3FUZ A;  1AMF A;  2HXR A;  2ZMB A;  1FPG A;  2OZZ A;  3CSG A;  4N6K A;  1US5 A;  4NG7 A;  4QXD A;  4LN5 A;  3SEW A;  4R75 A;  4PDD A;  1ZIU A;  5IM2 A;  1URS A;  3ECR A;  2LAO A;  3OSR A;  2F7A A;  4N13 A;  1QGX A;  2I4C A;  4YB6 A;  4U2R A;  2QPQ A;  2KLF A;  3DP6 A;  1P1W A;  4FED A;  4QSC A;  5B70 A;  4RJZ A;  3BBR A;  3EHS A;  4NF8 B;  3FXQ A;  3I5O A;  1IMF A;  5DTB A;  2A5T A;  1FQA A;  3UK4 A;  4YKP A;  4ZDM A;  1B3L A;  2REG A;  4BDO A;  4OEV A;  4MAG A;  1TWY A;  3BFU A;  1LGB C;  1NV4 A;  4M4G A;  4LZ8 A;  4Z0I A;  2M8C A;  2HPG A;  4E0W A;  4GXS B;  2XXR A;  1XVY A;  3RN8 A;  2CEX A;  3O9P A;  3TYH A;  3PMV A;  1SYH A;  2QL3 A;  1BP5 A;  2QVR A;  5IZ3 A;  2THI A;  1B3G A;  5EQ9 A;  1FBC A;  3T96 B;  1FPD A;  1RDY A;  2AIX A;  3H6U A;  4U23 A;  4QFN A;  4YMA A;  1LB8 A;  4OQO A;  3PUY E;  4H8J A;  4N15 A;  4RA1 A;  2PYY A;  2FIE A;  2ZYK A;  1LFG A;  1FPI A;  4ESW A;  3JYR A;  5I2K A;  3BKI B;  3KC0 A;  1OMP A;  3O66 A;  1MXZ A;  4PFY A;  1DMB A;  4POW A;  2WBD A;  4ZEB A;  2F3B A;  1NUX A;  3FZV A;  3N94 A;  1MY2 A;  4POX A;  1JVY A;  1YPN A;  5I59 B;  5EYG A;  1K9Y A;  3O2A A;  3TCH A;  2CZK A;  4NWD A;  2DXY A;  1FBH A;  2VOZ A;  2XWO A;  3FAT A;  4PBH A;  3EHT A;  3PV0 E;  1PBQ A;  3TTK A;  4OVJ A;  2I58 A;  5I57 A;  3QK6 A;  1A40 A;  4PGP A;  1MG1 A;  3RT6 B;  3MPL A;  5L9S A;  4OVR A;  3MP1 A;  1DPP A;  4GD5 A;  4PAK A;  1PBP A;  4JVI A;  5ITO A;  2OX3 A;  2A5S A;  4XTC Q;  4Z7E A;  1OVT A;  2REJ A;  4FBP A;  2PVU A;  1FTJ A;  2QS3 A;  5H8S A;  3VLW A;  3PPQ A;  4RY1 A;  3H3G A;  4ELQ A;  2F8D A;  4H6D A;  4IO7 A;  4I9D A;  2F6P A;  4ZEC A;  5M2V A;  5EQ8 A;  2DE3 A;  1R9Q A;  4F1V A;  2QMX A;  4GF8 A;  1JW5 A;  1CE2 A;  2X7P A;  4OVS A;  5TP9 B;  5L8D A;  5LOM A;  2G93 A;  2FVZ A;  3VXB A;  5AA2 B;  1IIW A;  1URD A;  3QYT A;  2CEY A;  1FTM A;  3CRB A;  3R7X A;  2O51 A;  5EYH A;  4HE2 A;  1FPK A;  2F78 A;  4ZEF A;  1O64 A;  3C35 A;  4U4X A;  1CNQ A;  4LON B;  1DCU A;  2F7C A;  2V93 A;  1AH5 A;  4MF3 A;  4XIG Q;  4GWY A;  1FPJ A;  4IY6 A;  3C31 A;  3T9X B;  2Q88 A;  1XI6 A;  3OEN A;  3QUF A;  2Z8D A;  3C34 A;  3DEL B;  3HO7 A;  4LAT A;  1AIV A;  3N5L A;  3IB2 A;  4X1B A;  2WEF A;  2F36 A;  4AB6 A;  4YKK A;  1LCT A;  1IMD A;  2F5X A;  4G4P A;  1VFD A;  4AB5 A;  3OO8 A;  4NTL A;  3D4C A;  2O7I A;  4KXP A;  2I6E A;  3OMB A;  4BDQ A;  4MHF A;  5I5P A;  3IOU A;  4QRZ A;  4MCO A;  4JXI A;  3KGC A;  1ZBM A;  1ZTY A;  1L5T A;  4P56 A;  1P1O A;  1MY3 A;  3E9X A;  3TCG A;  3U1O A;  3HFU A;  3UA8 A;  1VE4 A;  2VPN A;  4MLV A;  2XXY A;  2IA4 A;  4NWC A;  3MST A;  2ZNU A;  2XXP A;  1S50 A;  2P1S A;  2P0S A;  1H3D A;  2DSF A;  3USD A;  4GWU A;  4PP0 A;  4I1D A;  4Q0C A;  4OA4 A;  4NF6 A;  1LB9 A;  1PDA A;  1NUZ A;  3UIF A;  2B65 A;  3RT8 A;  1YZ0 A;  4MFI A;  5DVF A;  4PE5 B;  3O29 A;  3FV1 A;  4OXV A;  1NL5 A;  4PET A;  4NE4 A;  1B46 A;  3T22 A;  4NF8 A;  3V8X B;  3CVG A;  1XHY A;  1MY1 A;  4HXV A;  3IX1 A;  1B3F A;  3RPL B;  2D3I A;  3D1R A;  3KOT A;  5ITP A;  3CSB A;  1I6Q A;  4K3F A;  3RUM A;  2RCB A;  4FAT A;  4KFQ A;  1DPE A;  3KSX A;  4N8Y A;  2ONS A;  4ZEK A;  1O7T A;  1Z7N E;  4XKQ A;  4IO2 A;  5DVI A;  1EU8 A;  2DOJ A;  4N07 A;  3TTL A;  4P3L A;  4TLL B;  5F7V A;  1BTJ A;  1RKM A;  1SW5 A;  5I2K B;  1DTZ A;  3BIG A;  4IO5 A;  1R1N A;  4RPO A;  1LBW A;  3M3K A;  3B8B A;  3CG1 A;  4I40 A;  5FTH A;  1MQJ A;  4X1D A;  4DI3 D;  2UXA A;  2VPO A;  3C32 A;  1UTH B;  4GIZ A;  2OWZ A;  4QF9 A;  4OHN A;  4WEP A;  3K6U A;  3FXR A;  3R26 A;  3TUS A;  1M5E A;  3EHU A;  5I58 A;  5KDT B;  4OVP A;  1FW0 A;  5H8N A;  2HXW A;  4LVQ A;  1IXH A;  1OQH A;  2Y5K A;  3OOA A;  4R2F A;  3LSW A;  3S9E A;  3TKD A;  4G61 A;  1P1N A;  1LST A;  5IZZ A;  2CZL A;  2X7Q A;  1FTL A;  4XEQ A;  1A7L A;  4G77 A;  4OES A;  1IZ1 A;  1MH4 A;  3U92 A;  5EHM A;  2DVC A;  3K02 A;  1QUK A;  4ND9 A;  4PFR A;  1FJ9 A;  4R9F A;  1SPI A;  4WXJ A;  3N6U A;  1JVX A;  1DOT A;  1Y3N A;  4ZE9 A;  4H46 A;  1B3H A;  3T9V A;  5TU0 A;  3ROJ A;  1LFI A;  3BIH A;  1Y1Z A;  4RK9 A;  3T1B A;  1YTV A;  3MQ9 A;  2VD2 A;  1UTB B;  2OK2 A;  4GX6 A;  4JSO A;  1LLS A;  3DM0 A;  4GWX A;  3GLB A;  5AE4 A;  5I3S A;  1NNF A;  1DSN A;  4MJO A;  1B58 A;  4NF4 B;  3IOR A;  4MH5 A;  4GLI A;  2DE4 A;  4MNC A;  3GBA A;  1IXC A;  3ILU B;  4PCD A;  4Q5T A;  3KN8 A;  3E78 A;  2UVI A;  2I0C A;  2Z22 A;  1FJ6 A;  3K1P A;  1J1N A;  1B52 A;  2PT2 A;  4O8M A;  4F39 A;  4RNS A;  3HCQ A;  1XT8 A;  2DDK A;  4OEU A;  1JEU A;  2VD3 A;  2DWA A;  1QUL A;  2O1M A;  3TTM A;  3QIM A;  2RC8 A;  3OD7 A;  4KYD A; 
#chains in the Genus database with same CATH homology
 1MXZ A;  1S7Y A;  4PFY A;  3C4M A;  1DMB A;  4POW A;  1FQD A;  1OQG A;  2RC9 A;  3O97 A;  3EF7 A;  4PQJ A;  4ZEB A;  3WAF A;  3MW0 A;  3IR1 A;  5CMK A;  3FZV A;  3OEL A;  3N94 A;  1MY2 A;  2I49 A;  3G3I A;  4GOT A;  2H99 A;  4POX A;  1KWH A;  1JVY A;  4OFL A;  1YPN A;  4R73 A;  1MQI A;  1ZMG A;  3P7I A;  4TOZ A;  2OWS A;  5I59 B;  2PBW A;  1B0L A;  1SBP A;  1MM6 A;  2NVU B;  3KZG A;  3L6H A;  4XKR A;  5I58 B;  1A8F A;  1Y4T A;  3TOD A;  3O2A A;  3CG3 A;  3TCH A;  1Y3Q A;  1GVC A;  4U4S A;  5AA3 A;  2F34 A;  4NWD A;  2VHA A;  3LBS A;  1SDX A;  2DXY A;  2NWJ A;  1FQC A;  1MXV A;  2VOZ A;  2DS9 A;  3ZSF A;  4ELP A;  3FAT A;  4GXA A;  4GWO A;  4FIM A;  2W7Y A;  1CB6 A;  3IB1 A;  3EHT A;  2RCA A;  3PV0 E;  4PFW A;  1PBQ A;  1TXF A;  3KEI A;  4OVJ A;  3TTK A;  2Y7K A;  4KHZ E;  2AYS A;  2B3F A;  2I58 A;  5I57 A;  3QK6 A;  3KFM A;  1A40 A;  1B7Z A;  4FEC A;  2XX8 A;  2FA7 A;  4R2B A;  4G68 C;  1MG1 A;  4N6P A;  3RT6 B;  5BUU A;  1UTH A;  3V5A A;  2Q2C A;  3LC8 A;  3MPL A;  4JBZ A;  5JEI A;  1JEV A;  4YKI A;  3TDJ A;  4XXU A;  2ZYM A;  5L9S A;  3MVX A;  3TEP A;  3SEY A;  4FOR A;  5KCJ B;  3FIR A;  3MP1 A;  3ODB A;  4IY5 A;  4QFL A;  3PD9 A;  3VVD A;  4H0W A;  5F1Q A;  3FJG A;  1BKA A;  1DPP A;  1B1H A;  3MJN A;  2GHB A;  3MVZ A;  1PBP A;  2O6A A;  4GD5 A;  2Q2A A;  5K2Y A;  4IGT A;  4O3B A;  4F3P A;  4IO6 A;  5ITO A;  2A5S A;  3K6W A;  4XTC Q;  1OVT A;  2REJ A;  4YAH X;  4Z7E A;  3VFJ A;  2XX9 A;  1HSE A;  2IEE A;  3C33 A;  2BJJ X;  2PVU A;  3IO6 A;  1ELJ A;  2RIN A;  4DXC A;  1FTJ A;  2QS3 A;  5H8S A;  3VLW A;  3PPQ A;  1RYX A;  2ESN A;  1N3W A;  5DEX B;  2OWT A;  3H3G A;  4HS7 A;  4RY1 A;  4ELQ A;  2DXR A;  4G8H A;  4EQB A;  2F8D A;  4H6D A;  3N6T A;  2YLN A;  4I9D A;  3PPP A;  2F6P A;  1MXY A;  1QVS A;  4IO7 A;  4NED A;  3TCF A;  5FHN A;  4AQ4 A;  4FEB A;  2QMW A;  4QSD A;  4ZEC A;  5M2V A;  2ZNT A;  2DE3 A;  3IAZ A;  3ZKL A;  3RY3 A;  1M5C A;  1LBC A;  1R9Q A;  3Q25 A;  4F1V A;  2R6G E;  4R6H A;  2QMX A;  1IXI A;  2QS2 A;  1JW5 A;  1CE2 A;  4GF8 A;  2O68 A;  1WDN A;  4E0X A;  5IAI A;  1VFE A;  3VE1 B;  2O69 A;  3DP4 A;  4H67 A;  2RC7 A;  4QHQ A;  2X7P A;  2XHD A;  4H1X A;  2ONK E;  5L8D A;  5TP9 B;  3FD3 A;  1NNK A;  5LOM A;  1EZO A;  2G93 A;  1B40 A;  3VXB A;  5AA2 B;  1IIW A;  1URD A;  3S9L C;  3QYT A;  1QUJ A;  4R74 A;  1P1Q A;  1XC1 A;  3OEK A;  1FTM A;  5CBR A;  1IEJ A;  3CRB A;  2O51 A;  3PUX E;  5AA1 A;  3R7X A;  3TEL A;  1LAG E;  2RKM A;  1LAF E;  4F2Q A;  4R6K A;  1P1U A;  1B2H A;  2F78 A;  2A5T B;  1O64 A;  3FAS A;  2V3Q A;  3C35 A;  3K2D A;  3MVW A;  4KI0 E;  2I48 A;  3AXF A;  4U4X A;  5K2X A;  4LON B;  4F1Y A;  4F31 B;  4YKJ A;  2ALU A;  1OLC A;  2F7C A;  2O1L A;  1RYO A;  3FXU A;  2VP1 A;  2OCU A;  4XKN A;  2V93 A;  1AH5 A;  4MF3 A;  4XIG Q;  2Z23 A;  4C1T A;  4IY6 A;  3C31 A;  3T9H B;  3D4G A;  1IUD A;  3T9X B;  1UIV A;  4EUO A;  1VR5 A;  2Q88 A;  2HAV A;  5CC2 A;  3OEN A;  1B4Z A;  3QUF A;  1GV8 A;  1LCF A;  2Z8D A;  4JDF A;  4OTE A;  1GGG A;  2PMS A;  1JQF A;  3C34 A;  4OMB A;  2DWH A;  3DEL B;  1M5B A;  2VGQ A;  3HO7 A;  2XXQ A;  4LAT A;  4NMY A;  1AIV A;  3TMG A;  4BDM A;  2H5Y A;  4NF6 B;  5L9M A;  3HPI A;  2HEU A;  3MAM A;  3N5L A;  2D5W A;  3IB2 A;  4X1B A;  3Q27 A;  4UAC A;  4U21 A;  5CRY A;  3V8X B;  4KR5 A;  4F18 A;  1IXG A;  2F36 A;  3CI8 A;  4TLM B;  4AB6 A;  1T0K A;  3U8Q A;  4WED A;  1SQY A;  4YKK A;  2Q8J A;  1LCT A;  2F5X A;  4MLQ A;  2H25 A;  2Q89 A;  4G4P A;  5AA4 A;  3H7M A;  1IQ7 A;  1VFD A;  3LSL A;  1ZLQ A;  1MQD A;  3BFT A;  3CFL A;  1N76 A;  4M1V A;  1SW1 A;  4YU0 A;  1M5F A;  4OET A;  3W9V A;  4R6Y A;  4AB5 A;  3OO8 A;  1N84 A;  1OIB A;  3S4U A;  4OFO A;  4NTL A;  3HHG A;  1B6H A;  3D4C A;  2O7I A;  2UVG A;  3MC2 A;  1NH7 A;  3FVN A;  3WAE A;  4GL0 A;  1I6B A;  2DVZ A;  2I6E A;  3OMB A;  2PX1 A;  4R9G A;  5CMC A;  4BDQ A;  3MWB A;  4BDN A;  3PPO A;  3H06 B;  4GVO A;  2UVH A;  1LBB A;  4C0R A;  2XX7 A;  4DXB A;  1USY H;  4FE8 A;  4LA9 A;  4DDD A;  1FTO A;  1B3E A;  2H4I A;  1SW4 A;  2DQV A;  3IOU A;  4I62 A;  1MDQ A;  4QRZ A;  3ZS6 A;  3QAX A;  5CMB A;  2HQ0 A;  1Q35 A;  4ESX A;  4F3G A;  3S9M C;  1DTG A;  4FAJ A;  5ICT A;  3VLU A;  2XXU A;  2PT1 A;  3PUV E;  3QXM A;  3KGC A;  4JXI A;  1B5J A;  5DT6 A;  4DIG A;  1ZBM A;  3GZG A;  3HHF A;  5HPQ A;  1ZTY A;  2UYF A;  2HZL A;  3ILT B;  4GL8 A;  5JTY B;  1L5T A;  4LZ7 A;  1HSL A;  1NH8 A;  3U93 A;  1YAE A;  5CI5 A;  3THI A;  4HW8 A;  1P1O A;  1B1X A;  1N7X A;  1N7W A;  1MY3 A;  2V25 A;  3FVG A;  3R6U A;  3E9X A;  1OLA A;  4H8I A;  3TCG A;  3U1O A;  3UA8 A;  3LR1 A;  1SI0 A;  5FHM A;  3B6Q A;  1B7U A;  3Q26 A;  2Y84 A;  5H8N B;  2Z8E A;  1N0T A;  1VE4 A;  3FVO A;  1MRP A;  1EZ9 A;  2RF1 A;  2ZNS A;  3UOR A;  4MLV A;  1UIU A;  2OBG A;  2XXY A;  4HCY A;  1SD3 A;  1B5I A;  2IA4 A;  3K0V A;  4P0G A;  4BDL A;  4NWC A;  3KG2 A;  3MP8 A;  2QRY A;  4QFK A;  1Y9U A;  2ZNU A;  2XXP A;  3G3H A;  5H8F B;  2ONR A;  3M3F A;  5HBC A;  2UVJ A;  2XXI A;  3M3L A;  3MUQ A;  3H6W A;  1B05 A;  1S50 A;  3PMW A;  2P1S A;  4KPT A;  4MBP A;  4EQ7 A;  3IJO B;  4JSD A;  1TFA A;  3EPE A;  4R72 A;  4ZEF A;  1SYI A;  2P0S A;  4TQU Q;  1MDP 1;  3SKP A;  3ZKK A;  1H3D A;  2I0B A;  2I3V A;  2UYE A;  3Q28 A;  3K00 A;  5TPA B;  2ZYN A;  4NF5 B;  2DSF A;  2F6G A;  3USD A;  1B0H A;  1GR2 A;  4YIC A;  1I6A A;  2YJP A;  1S9T A;  2I4B A;  4PP0 A;  4RYA A;  3UP9 A;  4I1D A;  4Q0C A;  1D4N A;  1POT A;  4NF6 A;  4YZZ A;  5H8N A;  4JWY A;  1JW1 A;  3A3U A;  4WKM A;  1NNT A;  1LB9 A;  1PDA A;  3PMX A;  1OVB A;  4G8N A;  2ABH A;  2O84 X;  2X26 A;  3UIF A;  1URG A;  2B65 A;  2Q9T A;  3RT8 A;  4PFT A;  4MFI A;  2B3B A;  3PGF A;  1QUI A;  4GFR A;  5DVF A;  3U94 A;  1XS5 A;  4KQP A;  2NXO A;  2Z8F A;  3PU5 A;  1BIY A;  1B9J A;  4U1O A;  4PE5 B;  4KCD A;  1MQH A;  3FV1 A;  1FQB A;  3O29 A;  4OER A;  4OXV A;  3FVK A;  1NL5 A;  4PET A;  3KN7 A;  4H65 A;  4ZZA A;  1Y20 A;  3IOV A;  4UA8 A;  1ANF A;  4NE4 A;  3IJX B;  1B46 A;  4H5F A;  3T22 A;  1IIT A;  1HSJ A;  1P99 A;  1QJM A;  2I3W A;  3CVG A;  4G68 A;  1XHY A;  4NF8 A;  1MY1 A;  3G7W A;  4THI A;  3E4R A;  4U1Z A;  3OSQ A;  3V83 A;  4YB5 A;  3OO9 A;  4LQ5 A;  5KCJ A;  5FTI A;  3S9N C;  3IX1 A;  1PEB A;  2ZXT A;  1B3F A;  1VSO A;  3CFZ A;  3OXN A;  4XKP A;  4EDP A;  3LSX A;  2ZYO A;  3VXC A;  4FJP A;  2D3I A;  4LP2 B;  2V84 A;  4OFJ A;  3IL1 B;  1UTB A;  5TPA A;  3KOT A;  5ITP A;  1USY E;  3SEX A;  3QSL A;  1NFT A;  3CSB A;  3ONM A;  4JWO A;  3SES A;  2DYX A;  3UN6 A;  1I6Q A;  3DP8 A;  4OZ9 A;  1MH3 A;  1I69 A;  4K3F A;  3FJ7 A;  4JB7 A;  4OWD A;  2RCB A;  3B6W A;  3RUM A;  4FAT A;  1US4 A;  3TTR A;  3T66 A;  4KFQ A;  1DPE A;  3W15 C;  3KSX A;  3G3F A;  4ELR A;  2ONS A;  1TT1 A;  1BLF A;  3LUY A;  4HTG A;  4RK2 A;  4ZEK A;  3TTN A;  3H6T A;  1O7T A;  4PFU A;  3CFX A;  4P0I A;  3TAJ A;  3KBR A;  1Z7N E;  4XKQ A;  4IO2 A;  4GRK A;  5DVI A;  1EU8 A;  2DOJ A;  4F1U A;  4LQ2 A;  3G3K A;  3HN0 A;  4N07 A;  3SEV A;  3IOW A;  5I56 A;  3DLN A;  1ZJL A;  5BWJ A;  3TTL A;  2Y7P A;  4F3B A;  2F97 A;  1UQW A;  4TLL B;  5F7V A;  3U72 A;  1BTJ A;  4YMB A;  1RKM A;  1SVX B;  1ZU0 A;  1SW5 A;  2F35 A;  2Y7I A;  3GBB A;  3O6I A;  3VVE A;  5I2K B;  1QW0 A;  3I6V A;  3OD7 A;  4EF2 A;  3C9H A;  4DCX A;  1B7H A;  3C36 A;  4ONY A;  3L6G A;  4U22 A;  3RTW B;  3T9U A;  3TPA A;  4DXU A;  1A99 A;  3MZ1 A;  3RLF E;  5J1D A;  1JET A;  1DTZ A;  2OLB A;  3S2V A;  4EF1 A;  1FQE A;  4IO5 A;  3PUZ E;  4C1U A;  2DWJ A;  2QS1 A;  1R1N A;  3QUJ A;  4RPO A;  1B32 A;  1EH3 A;  1QKA A;  1WOD A;  3KJT A;  2XXX A;  4RXL A;  1NMU A;  2AL5 A;  4EXK A;  2DP8 A;  2R71 A;  1MPC A;  2XD2 A;  2XXV A;  5ELV A;  3K1N A;  1O63 A;  3M3K A;  1H76 A;  5ICQ A;  4ZEI A;  3TZA A;  5A5X A;  3K4U A;  1MQG A;  3CG1 A;  4QFO A;  3PUW E;  1D9V A;  1EZP A;  3TQL A;  4KCC A;  1Y1M A;  2AL4 A;  5FTH A;  2OJT A;  1MQJ A;  3G3G A;  3V89 B;  4F3S A;  3MBP A;  4X1D A;  4ZE8 A;  3SET A;  1Q1K A;  4DE8 A;  2UXA A;  3HST A;  4OYV A;  2FNC A;  2XXT A;  5CBS A;  1D3K A;  4L17 A;  3M8U A;  1PB7 A;  5AA2 D;  3C32 A;  1UTH B;  4GIZ A;  2O7U A;  3H03 A;  4QSE A;  4X48 A;  5JK4 A;  4DCY A;  3I3V A;  4QF9 A;  1N04 A;  3MP6 A;  4OHN A;  4WEP A;  5ISU A;  2H9B A;  4O3C A;  3K6U A;  4IO3 A;  3RPW A;  5I57 B;  2G29 A;  3FXR A;  3FJM A;  3R26 A;  4F29 A;  1PC3 A;  3TUS A;  3RQT A;  3OO6 A;  5H8F A;  1M5E A;  2GH9 A;  3EHU A;  1B5H A;  1MXW A;  3RTF B;  5I58 A;  2P2A A;  2YPN A;  3MPK A;  3VDF A;  4BLA A;  5HM4 B;  5KDT B;  1PB9 A;  5AA4 B;  1FW0 A;  2HXW A;  2HZK A;  1FTK A;  3KN3 A;  3PPR A;  3OEM A;  4LVQ A;  5DEX A;  2NOO A;  3B7D A;  3VVF A;  4EQ9 A;  5DYH A;  3O6H A;  1IXH A;  2E1S A;  1OQH A;  2V3T A;  4KYE A;  1A54 A;  3Q29 A;  3OOA A;  4R2F A;  3FUZ A;  1H45 A;  2FYI A;  2NUV A;  3LSW A;  5I2N A;  3S9E A;  4ZS9 A;  3PPN A;  1AMF A;  1B4H A;  2ZMB A;  3SEU A;  5CMM A;  3TKD A;  2OZZ A;  3GXA A;  3CSG A;  4IGR A;  1MM7 A;  3O6G A;  4G2Z A;  1P1N A;  4ISU A;  4O3A A;  4X9T A;  5CM6 A;  1LST A;  5H8Q B;  1XVX A;  1M5D A;  3A09 A;  1WVJ A;  2CZL A;  4F22 A;  2X7Q A;  1Y3P A;  1FTL A;  1US5 A;  1A7L A;  4G77 A;  4GQO A;  2HAU A;  4OES A;  3MZ9 A;  5L9O A;  1IZ1 A;  4ZZE A;  5TP9 A;  1F9B A;  1MH4 A;  2V3U A;  3U92 A;  3SEW A;  4R75 A;  5AA2 A;  5EHM A;  1ZIU A;  1R9L A;  1MXU A;  1MPB A;  2DVC A;  3K02 A;  3MVY A;  5I56 B;  1AOV A;  3K6X A;  1NNP A;  4G8M A;  1URS A;  1QUK A;  3ECR A;  2LAO A;  2XXH A;  3OSR A;  4ND9 A;  3FGS A;  2F7A A;  4N13 A;  4R9F A;  2I4C A;  2GRV A;  3EQ1 A;  3N26 A;  1D9Y A;  4YB6 A;  2QJE A;  2CMO A;  4U2R A;  2QPQ A;  2GHA A;  2KLF A;  4WXJ A;  3DP6 A;  5KDT A;  4Q8R A;  3B6T A;  1P1W A;  1II5 A;  4FED A;  4ELO A;  3KSJ A;  2H98 A;  2E0S A;  1MPD A;  1JVX A;  1DOT A;  3N6U A;  3PD8 A;  4QSC A;  1Y3N A;  3SDF A;  3A3C A;  4RJZ A;  5B70 A;  4LUB A;  3EN3 A;  3K1M A;  4NF5 A;  3BBR A;  4IO4 A;  4ZE9 A;  1XOC A;  3EHS A;  2ANJ A;  2Y7W A;  4NF8 B;  1MY4 A;  4IB2 A;  3FXQ A;  1FCK A;  4I8C A;  4DLD A;  2QS4 A;  3I5O A;  3UGW A;  1B3H A;  3T93 B;  1SI1 A;  3IB0 A;  5DTB A;  5TU0 A;  3T9V A;  5IKB A;  2HCA A;  4BDR A;  2A5T A;  3IK6 B;  2QSX A;  1POY 1;  2XD3 A;  1LFI A;  1FQA A;  1MS7 A;  1Y1Z A;  3H4Z A;  3TQW A;  3MZB A;  3KJ7 A;  3F11 A;  3FV2 A;  4RK9 A;  3UK4 A;  1B51 A;  4P11 A;  3VLV A;  1YTV A;  4YKP A;  3MQ9 A;  2VD2 A;  1UTB B;  3KOS A;  1ZKB A;  4ZDM A;  5EYF A;  1B3L A;  1MY0 A;  2OK2 A;  4JSO A;  1LLS A;  3DM0 A;  3JV9 A;  3GLB A;  2REG A;  1SW2 A;  4KYD A;  4BDO A;  4Q30 B;  5AE4 A;  5KZT A;  4OEV A;  3H6V A;  1LAX A;  4EXL A;  4HCW A;  4F19 A;  1TWY A;  4DZ1 A;  5JTY A;  3SER A;  1NNF A;  3BFU A;  2DWI A;  1LGB C;  3CIJ A;  4LZ8 A;  3O28 A;  4M4G A;  4Z0I A;  4QFP A;  2D21 A;  5H8H A;  2M8C A;  2Y7R A;  1DSN A;  5FHO A;  1ATG A;  1B58 A;  3TFL A;  4NF4 B;  4LZ5 A;  3RGY A;  4E0W A;  3IOR A;  4MH5 A;  1A55 A;  3CR9 A;  1PB8 A;  4GXS B;  4RPN A;  4GLI A;  2DE4 A;  1LFH A;  1JNF A;  1XVY A;  2XXR A;  3LSF B;  3RN8 A;  3W9W A;  3IO4 A;  3O9P A;  3K01 A;  4H5G A;  1LAH E;  3TYH A;  5I2N B;  2R9J A;  3GBA A;  3HV1 A;  1Z7M E;  3PMV A;  4ECF A;  1IXC A;  2WKY A;  3ILU B;  1TFD A;  2GFE A;  4KYS A;  2XXW A;  4G68 B;  1SYH A;  1MXX A;  2QL3 A;  3E3K A;  3KN8 A;  4Q5T A;  5EHS A;  1BP5 A;  3E13 X;  4YB7 A;  2UVI A;  2F7B A;  2I0C A;  2DE2 A;  2THI A;  5A5X B;  1B3G A;  2Z22 A;  5H8Q A;  5I59 A;  4OEN A;  1H44 A;  3T96 B;  5DVJ A;  3K1P A;  1J1N A;  3JZJ A;  5B7D A;  1B52 A;  2PT2 A;  2AIX A;  1JW4 A;  3H6U A;  4U23 A;  4F39 A;  1GTK A;  4QFN A;  1YCJ A;  4RNS A;  1NKX A;  1XT8 A;  3HCQ A;  4YMA A;  2HFB A;  1LB8 A;  4OQO A;  4OEU A;  3VV5 A;  3PUY E;  4H8J A;  4F2O A;  1JEU A;  2VD3 A;  2PYY A;  3G3J A;  4RA1 A;  1N3X A;  2ZYK A;  4JWX A;  5I84 A;  3IOT A;  2DWA A;  1QUL A;  3RNN A;  1LFG A;  5H8H B;  1A8E A;  4KD5 A;  4ZED A;  1QKB A;  4ESW A;  2O1M A;  1AL3 A;  1FQF A;  3JYR A;  1Y4C A;  3QIM A;  4NF4 A;  3OO7 A;  3TTM A;  5I2K A;  2RC8 A;  3K6V A;  3BKI B;  1R6Z A;  1OMP A;  1H43 A;  3O66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...