3MC2A

Crystal structure of the murine inhibitor of carbonic anhydrase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
679
structure length
675
Chain Sequence
EKTIRWCVVSDHEATKCSSFRDNMKKVLPAGGPAVTCVRKMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYYGSKDDPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETAAATFFSSSCVPCADGKMFPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVSFVKHLTVFEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDSIQELLRVAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKIDISLYLGYEFLSAFRNLKRSQRVKWCAVGQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEADAMSLDGGFAYVAGHCGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVGITWKSLQGKKSCHTAVGTSEGWNVPMGLIYDQTGSCKFDAFFSRSCAPGSDPDSPLCALCVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGLKHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSAKDLLFSDDTECLSNLQDKTTYKTYLGPQYLTLMDNFRQCLSSELLDACTFHKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure and evolution of the murine inhibitor of carbonic anhydrase: A member of the transferrin superfamily.
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase inhibitor
molecule keywords Inhibitor of Carbonic Anhydrase
total genus 154
structure length 675
sequence length 679
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mc2A03
2O69A 5BWJA 4NF5B 3S9LC 4U23A 3FJ7A 5L9MA 2PBWA 1YCJA 1GV8A 4BDMA 2R9JA 3TTLA 1MQHA 4R6KA 1TXFA 1LAFE 3IOUA 3EPEA 4R72A 5F1QA 3G3HA 5TP9A 4F22A 2H4IA 1Z7NE 3A3CA 2V3TA 2KLFA 2YPNA 3RPWA 1IQ7A 3KSJA 3MAMA 3PPNA 3N26A 1URDA 1WVJA 3M3KA 5HM4B 4F3PA 3C33A 3K6VA 2Y7RA 3EN3A 3FD3A 3G3JA 3SETA 4U2RA 4AQ4A 2F8DA 3ECRA 4GIZA 3EQ1A 1XHYA 4M4GA 2AIXA 4KFQA 4OVJA 2V93A 4ZE8A 4BDRA 3KSXA 1R6ZA 4H5FA 3VVDA 4FAJA 1LBCA 3Q25A 4LQ2A 3T22A 5IAIA 4G8HA 2Y7PA 5DVIA 3G3GA 4ZS9A 3TFLA 1VFDA 3W15C 3IX1A 4R2BA 2HEUA 1MXVA 4F31B 3LSWA 3S9MC 5JTYB 2O68A 3TTNA 5I2KA 2XXTA 2REJA 3E3KA 4IY6A 1OQHA 2VGQA 4WKMA 4P0IA 1LLSA 3MVZA 2DE2A 3LBSA 1MS7A 1XS5A 3E9XA 2NXOA 3M8UA 3PV0E 4JWYA 4QFOA 1N04A 1N3WA 1PDAA 3O6HA 4G68A 5FHMA 2I58A 3UN6A 2XX8A 4ECFA 1NL5A 5AA2B 4OFLA 4GRKA 4QSDA 2ZYMA 3U1OA 3Q26A 5BUUA 3TQWA 4U4SA 3W9WA 1B1XA 4WEDA 3CRBA 3SEUA 5B70A 1SW5A 2DYXA 1II5A 1A7LA 1QW0A 3FVKA 1SVXB 1MH3A 1P1UA 3LSFB 3H7MA 2A5TB 3MJNA 1XT8A 4FEBA 1D9YA 2OZZA 3RT6B 4Z7EA 4KYEA 2F6GA 3QIMA 3DLNA 3OOAA 4F3BA 4EF1A 1EH3A 1FQAA 4DIGA 3G7WA 4EXLA 1URGA 3TKDA 3ODBA 1QVSA 2GFEA 4IO6A 4LP2B 2YLNA 1NNKA 3TUSA 2DWIA 3EHUA 3PGFA 4GD5A 1CB6A 5LOMA 3KJ7A 4FATA 2XXPA 4G68C 2Y7KA 2GHAA 1Y9UA 3C4MA 4THIA 3L6GA 4ZDMA 3H6TA 3O6IA 3ONMA 4IO4A 4N13A 1A8FA 1VE4A 4RA1A 4U4XA 3OO8A 4I9DA 1SBPA 3CIJA 3S2VA 2O1LA 1PB8A 4IY5A 4F1YA 4GL0A 3C36A 3IJOB 3VFJA 5A5XB 5DVJA 1BP5A 2M8CA 3IOWA 4LATA 4ZZAA 3ZKLA 3AXFA 3CSGA 1B58A 2OWSA 5KZTA 2P1SA 3VLWA 5ISUA 1Y4CA 2DVCA 2DXYA 1Q1KA 3V8XB 1B9JA 5EHSA 3R6UA 1B3LA 2ZNUA 1EU8A 2I49A 4PP0A 5ELVA 5B7DA 3F11A 3MP6A 1MPBA 2NVUB 3UORA 3V5AA 1S7YA 1I6QA 5AA3A 1JW1A 2DE4A 2QSXA 3PMWA 4GOTA 1B5HA 1OLAA 4RYAA 3H03A 3CFLA 3RNNA 3SESA 2F34A 3U8QA 4C1UA 2Z8DA 3GBAA 5I58A 3C35A 1B7UA 4NEDA 1ANFA 1TT1A 2O7UA 3MBPA 1B5IA 2Q2CA 2OLBA 3KOSA 4LZ7A 5KDTA 4DZ1A 4U21A 3SEWA 1RYOA 4ELOA 1MXWA 1SYIA 2F5XA 3T9VA 1OIBA 1B7HA 2H99A 1B2HA 1J1NA 2O1MA 3FZVA 2AL4A 5K2YA 2O7IA 3G3KA 1XVYA 3SERA 1B1HA 1GVCA 5I2NA 3M3LA 1UIUA 4TLLB 4KHZE 2DP8A 2XD3A 3T66A 2UVIA 1H45A 2OWTA 2ZNSA 3CR9A 3Q28A 4K3FA 4DCYA 4F3SA 1H44A 2ONSA 2ONKE 5JEIA 1QULA 2QMWA 3O2AA 3VVEA 3K4UA 2UVGA 4R6YA 3PMVA 2UVJA 4GLIA 1USYE 3IORA 3SKPA 2DWJA 2XX9A 3QXMA 4F1VA 1FW0A 2I4BA 3ILTB 2PVUA 3MPLA 3MP8A 2F7BA 3K6UA 3O6GA 4N07A 3BFUA 2V3UA 4DE8A 3SEVA 1NH8A 1PEBA 2ZXTA 3D4GA 1H76A 1YPNA 4XTCQ 3LR1A 4PETA 1MDP1 1BIYA 1R9QA 3FV2A 1FQEA 4M1VA 1CE2A 1Q35A 3EHSA 3HN0A 4YMBA 1MY2A 1RYXA 3G3IA 3G3FA 4LUBA 4RPOA 4YKJA 4FIMA 3QAXA 3IOTA 5H8FB 1S9TA 4BDNA 1JEUA 4PE5B 3VDFA 2I6EA 4L17A 3S9NC 1I6AA 3KG2A 3SEYA 1IXHA 2R71A 3M3FA 4TLMB 3SDFA 3K0VA 5HBCA 1DTGA 1MM6A 2H5YA 4IO7A 4IO2A 1NKXA 1SW1A 4PFUA 4XIGQ 1R9LA 2W7YA 4LA9A 4G68B 4R2FA 3IO6A 4OESA 2UYFA 3IAZA 1M5CA 2QRYA 3PPOA 4FORA 4O3BA 2OBGA 4F18A 2RF1A 5I58B 1MM7A 1IZ1A 1XC1A 4OEUA 1QUKA 2XX7A 4R9GA 5I56A 3U72A 2I3VA 4E0WA 5I84A 1NMUA 3C31A 4H65A 4TOZA 2LAOA 3HPIA 4U1ZA 1HSLA 3TCGA 3BKIB 3OSQA 2Q89A 4OEVA 2NUVA 3GZGA 3JYRA 3N6UA 5AE4A 3QYTA 2RC9A 2DWHA 5ICQA 1QKBA 1LFIA 2Q88A 3DELB 4NMYA 4ZEDA 3PPQA 1P1NA 1ZU0A 4G4PA 4MF3A 1D4NA 2ONRA 1UTHA 1FTMA 3E4RA 3KEIA 2G93A 5H8QB 3FJGA 4ZEFA 1LFHA 4LVQA 2D21A 3THIA 1Y3NA 3C34A 3O97A 3OD7A 3CG1A 3KJTA 1MH4A 1OVTA 5CMKA 3K02A 3TELA 3HCQA 1B51A 1ELJA 1F9BA 2B3FA 4UA8A 3I6VA 3T93B 3TCHA 2QJEA 2DOJA 5K2XA 4ELPA 1O63A 5AA2A 1ZMGA 2HQ0A 4OFOA 3U92A 3RLFE 5L9OA 4JWOA 1FQFA 5L8DA 2A5SA 4IO5A 3K01A 4RNSA 4YICA 3K2DA 4DLDA 4JWXA 2IEEA 1AL3A 1HSEA 2V84A 2XXYA 3BBRA 1B32A 4R74A 4NE4A 2NOOA 4RJZA 3TQLA 3PUVE 1XOCA 4OHNA 5DEXB 2RINA 1SYHA 2V25A 1Y1MA 1UTBB 2VP1A 3CFZA 3KN8A 4R6HA 4O3AA 3PUWE 3L6HA 3TTKA 1IXCA 1MXUA 4XKNA 1L5TA 1PC3A 2ESNA 1NNTA 2REGA 2H9BA 3VXCA 3TTMA 4GWOA 5CC2A 5FHNA 1IIWA 5CMBA 1MXXA 4QFPA 2I0BA 1WODA 1MY1A 1BTJA 4MBPA 4OENA 4RPNA 1EZPA 1P1WA 3C9HA 3K00A 1US4A 3FVNA 3N5LA 2BJJX 1N7WA 4QRZA 3TYHA 3B6TA 1HSJA 2RCBA 3DP6A 1JEVA 4ELRA 3EHTA 2HFBA 3K6WA 3PPPA 4NF8A 4U22A 5F7VA 2RKMA 4GXAA 3PD9A 2QS4A 3CVGA 3U93A 1B0LA 3VLVA 5CBSA 4KYSA 4EQBA 1MDQA 4ELQA 3KGCA 4EF2A 2Y84A 1P99A 1QUIA 4KCCA 5H8QA 3A3UA 4XKRA 2F7AA 1MQDA 2XXUA 4WEPA 5J1DA 4I1DA 1MQIA 1NNFA 2H98A 1USYH 2RC7A 2XXQA 4NF4A 3O9PA 1FCKA 2XXVA 5EHMA 3PPRA 2V3QA 3KOTA 5TU0A 2ABHA 2QL3A 4ESWA 1OVBA 2PT1A 4H8IA 4Q0CA 4PQJA 3VLUA 1LSTA 3JV9A 4ZEIA 3WAFA 1MG1A 4HCYA 4ESXA 1OLCA 5L9SA 1Y1ZA 1ZIUA 2HAUA 2RC8A 3B6QA 5CRYA 5AA4A 5KCJB 4ONYA 3V89B 2ZYOA 1URSA 2FYIA 2VOZA 4EQ9A 1M5DA 4KR5A 1JW5A 4DDDA 4MH5A 1JETA 1LCTA 2Q2AA 4IGRA 4QSCA 1TFAA 4KYDA 5H8FA 3QUFA 4NWCA 5ICTA 2OJTA 2ZYKA 3PUYE 2Y7IA 4OWDA 5FTHA 3CFXA 3OSRA 2AYSA 1UTBA 2DVZA 2PT2A 4GQOA 3PUXE 3H6VA 2NWJA 3D4CA 2Q8JA 1S50A 3CI8A 3PU5A 5CM6A 1B5JA 3FXQA 3KFMA 4KPTA 4DXUA 1OQGA 1FTOA 1FQDA 3UA8A 5TPAB 2YJPA 3B6WA 4GL8A 2QS1A 3ZKKA 1A40A 4E0XA 5FTIA 1MQJA 1N76A 1VFEA 2O84X 3KBRA 4NF6A 3I3VA 4JB7A 4ZECA 3PD8A 2HCAA 4H6DA 1FTLA 2X7PA 4NF8B 5I57B 1DSNA 5CMCA 4H0WA 3OEMA 4Q30B 2GH9A 1LGBC 5EYFA 4IGTA 2XXIA 3FIRA 4R75A 3DP4A 2A5TA 4FE8A 3RT8A 1GGGA 4JDFA 2DE3A 3TPAA 1YAEA 5CBRA 1I69A 3FGSA 3MP1A 3I5OA 1SDXA 3IR1A 4NF4B 1PBQA 4YKPA 4QHQA 4ZZEA 3MZ9A 3T96B 5TP9B 1JVYA 1NFTA 3H3GA 1A99A 1TFDA 1KWHA 4YB5A 4H1XA 3HV1A 3ZS6A 4WXJA 1GR2A 4BDLA 4OETA 4H8JA 1IEJA 1ZTYA 2HZKA 4YB7A 4YZZA 1Y3QA 4KQPA 1UIVA 2QS3A 5KCJA 3H6WA 3PMXA 3O29A 3Q27A 3VV5A 1ZBMA 4TQUQ 3LC8A 3TZAA 4AB5A 1SQYA 2E1SA 5A5XA 2ZNTA 4ND9A 4BDQA 3V83A 4LZ8A 4F19A 4FECA 4FJPA 4F29A 1MY3A 4C1TA 1JW4A 1DPPA 2DQVA 4EUOA 1TWYA 2R6GE 3OO9A 5DT6A 4AB6A 1A54A 2HAVA 3LSLA 2OK2A 5CMMA 4ZEBA 2HZLA 4QF9A 3MW0A 3MVYA 4ZEKA 1LCFA 5IKBA 2PMSA 3FUZA 5I2KB 2DSFA 1LFGA 3TDJA 3CSBA 2I3WA 1I6BA 3TTRA 3SEXA 2ZMBA 1H43A 2QMXA 1H3DA 3H6UA 4YB6A 2XXRA 5H8SA 4OXVA 4JSDA 3W9VA 2DXRA 3FVOA 2Z23A 1VSOA 3RUMA 4JBZA 3TAJA 3N94A 1IITA 3IB0A 3CG3A 4NF6B 2B65A 2GRVA 1DTZA 3RGYA 2CMOA 1OMPA 3MUQA 3GXAA 1B4HA 2IA4A 3C32A 3IL1B 1DOTA 4G2ZA 1Y20A 2E0SA 4O3CA 4UACA 3TEPA 4QFNA 4BLAA 1XVXA 1MY4A 2DWAA 3TODA 4F2OA 1ZJLA 3MWBA 4YKKA 2F78A 4F2QA 1QJMA 2F6PA 5HPQA 2XD2A 3E13X 4H5GA 2Y7WA 3K1MA 3LUYA 3IK6B 3MPKA 4POXA 2O51A 4NTLA 1N3XA 4EDPA 2DS9A 3BFTA 1T0KA 3HSTA 4GVOA 1LAGE 3Q29A 1POTA 4RY1A 1Z7ME 2XXWA 3HHFA 5ITOA 3USDA 4NF5A 3IB2A 3KN3A 4YKIA 1WDNA 1B3HA 3OMBA 2XXXA 5CI5A 5AA1A 3S9EA 3KN7A 1IXIA 1P1OA 4LQ5A 4QSEA 1P1QA 2F36A 4YMAA 3DM0A 2VD2A 4OERA 4I62A 2QPQA 1LB8A 3MQ9A 2D5WA 4F39A 1B3GA 1B46A 4G8NA 2FA7A 3R7XA 3OENA 2D3IA 4IO3A 2Z8FA 1PB9A 3WAEA 5ITPA 3MVXA 1POY1 5AA4B 1GTKA 1ATGA 2THIA 1B7ZA 4XXUA 4Z0IA 1N0TA 3UK4A 2UVHA 5DEXA 1JNFA 3IO4A 1AIVA 1YTVA 1SW4A 3B7DA 3S4UA 1AH5A 2ALUA 3K1NA 4G8MA 1AMFA 1B3FA 1FQBA 4BDOA 2UXAA 3FASA 1Y3PA 1B3EA 2Z22A 3GBBA 2X7QA 1NNPA 2P2AA 4LZ5A 4YAHX 3IB1A 4P11A 2O6AA 3H4ZA 1AOVA 2G29A 3N6TA 1M5EA 5M2VA 3TMGA 1PBPA 3QUJA 4GXSB 1SI0A 4EQ7A 4PFYA 2F35A 1B05A 2XXHA 3T9XB 3VVFA 4EXKA 1O64A 4JSOA 1Y4TA 1PB7A 1NH7A 2GHBA 3EF7A 4POWA 5TPAA 3RN8A 3OXNA 1LAXA 2ZYNA 3A09A 1B4ZA 3OO6A 1DPEA 1D3KA 3K6XA 3T9HB 4F3GA 5I56B 2XHDA 3GLBA 4MFIA 1B40A 1B52A 1MQGA 3RY3A 3FJMA 3MC2A 2Z8EA 1D9VA 2X26A 5JK4A 2AL5A 4G77A 2OCUA 4ZE9A 2FNCA 3ILUB 5I2NB 5DYHA 2H25A 3MZBA 4C0RA 4X1DA 4KCDA 3KZGA 4DCXA 1UQWA 3QK6A 1VR5A 4HS7A 2QS2A 3RTFB 5H8HA 3UGWA 1BKAA 1MXZA 4H67A 4RK2A 1A55A 4X1BA 3T9UA 4Q5TA 1LAHE 4QFKA 2B3BA 2CZLA 4PFWA 5H8HB 5H8NB 3JZJA 2F7CA 2P0SA 4GF8A 4F1UA 3O28A 4NWDA 3MVWA 2HXWA 5H8NA 4DXCA 3ZSFA 2PYYA 4PFTA 3UIFA 1B0HA 3RTWB 1M5BA 3H06B 4HCWA 4XKPA 5DVFA 4OYVA 4N6PA 2VD3A 1JVXA 1ZLQA 4OMBA 3FV1A 4U1OA 4X48A 1SW2A 2WKYA 1MY0A 3FXUA 4HW8A 4MLVA 3O66A 2VHAA 1O7TA 4GFRA 1N84A 4RXLA 5I59B 2UYEA 3FVGA 3QSLA 5FHOA 4RK9A 3IJXB 4JXIA 1EZ9A 1ZKBA 3OELA 1LBBA 4KI0E 1FTKA 3VE1B 4FEDA 5I59A 4LONB 3K1PA 4YU0A 2I48A 1B6HA 5JTYA 5AA2D 2I4CA 2PX1A 3OEKA 1SI1A 1FQCA 4HTGA 3VXBA 3UP9A 4KD5A 1QKAA 1A8EA 4P0GA 3OO7A 1R1NA 3LSXA 1SD3A 1RKMA 4DXBA 4OQOA 3MZ1A 3P7IA 2RCAA 1FTJA 3HHGA 3IOVA 4Q8RA 2I0CA 1US5A 4IB2A 2ANJA 1IXGA 4ISUA 1MPDA 4R9FA 2F97A 1BLFA 1MRPA 3TCFA 1M5FA 5I57A 1LB9A 4QFLA 5DTBA 1MPCA 1DMBA 3HO7A 1N7XA 3FATA 3U94A 5KDTB 4OTEA 1MXYA 1IUDA 1JQFA 2Q9TA 1QUJA 3DP8A 3FXRA 3PUZE 3R26A 4I8CA 4OFJA 4OZ9A 1UTHB 4R73A 4XKQA 4MLQA 3RQTA 1EZOA 4X9TA
chains in the Genus database with same CATH superfamily
5BWJA 5L9MA 1XI6A 3RYDA 1Z7NE 2V3TA 3RPWA 1IQ7A 3MAMA 3PPNA 3N26A 1WVJA 3M3KA 3C33A 3E78A 4OVJA 4KFQA 4H5FA 3VVDA 3Q25A 3IFCA 3TFLA 4R2BA 2ZZXA 5I2KA 3E3KA 4IY6A 4MNCA 3MVZA 3LBSA 3M8UA 2NXOA 2HHMA 3PV0E 3O6HA 3UN6A 5AA2B 5FHMA 1FJ6A 4GRKA 4QSDA 3U1OA 4U4SA 3W9WA 4HE2A 3D1RA 5B70A 2DYXA 1A7LA 1MH3A 1P1UA 3MJNA 2PCRA 1XT8A 3DLNA 3OOAA 4EF1A 1EH3A 3ODBA 4LP2B 1KZ8A 4FATA 4G68C 2Y7KA 4GX4A 3O6IA 3OO8A 1SBPA 4IY5A 1BP5A 2PFZA 3IOWA 3ZKLA 3CSGA 5KZTA 3VLWA 2B4LA 3V8XB 3R6UA 4PP0A 5B7DA 2FIXA 2PFYA 1S7YA 1JW1A 4GOTA 4RYAA 1B5HA 3RNNA 2FVZA 2F34A 3GBAA 3C35A 2Q2CA 1SYIA 1OIBA 1J1NA 3FZVA 1XVYA 2DP8A 4DE8A 2ZNSA 3CR9A 3A29A 4N91A 3VVEA 1IMFA 2UVGA 3IORA 5ET8A 3SKPA 2QVVA 4N07A 1NV4A 3O6GA 2F7BA 3K6UA 3BFUA 2V3UA 1LBXA 1PEBA 4XTCQ 3LR1A 1DK4A 1FQEA 4M1VA 3FBPA 3EHSA 3HN0A 1JEUA 2I6EA 3M3FA 4TLMB 4IO2A 1NKXA 4XIGQ 5I5PA 4OESA 2UYFA 4P3LA 2QRYA 4F18A 2RF1A 4OEUA 1IZ1A 1D9QA 2XX7A 3U72A 4H65A 2LAOA 4U1ZA 1HSLA 2Q89A 3JYRA 3GZGA 2RC9A 4ZEDA 1LFIA 2Q88A 2G93A 3THIA 1FBDA 4G61A 1B51A 3I6VA 4ELPA 2QJEA 1O63A 1ZMGA 4PAFA 1FQFA 2A5SA 4RNSA 4DLDA 4RJZA 4R74A 4AS5A 4OHNA 3TTKA 4XKNA 1L5TA 1PC3A 2XXKA 2H9BA 5CC2A 5FHNA 2FIEA 4OENA 4RPNA 3C9HA 2OWZA 4QRZA 4GXAA 3PD9A 1B0LA 3VLVA 5CBSA 4EQBA 1MDQA 5H8QA 1EYJA 2XXUA 4WEPA 5J1DA 1MQIA 3O9PA 1FCKA 5EHMA 3PPRA 2V3QA 4ESWA 1VDWA 4Q0CA 3VLUA 4ZEIA 3WAFA 4MCOA 1ZIUA 2RC8A 2F3DA 3V89B 2ZYOA 1URSA 2FYIA 1LCTA 1FTAA 4NWCA 2OJTA 4PGNA 1UTBA 4GQOA 4N81A 2NWJA 3PU5A 5CM6A 4KPTA 3B6WA 1A40A 5FTIA 1MQJA 2O84X 3I3VA 2HCAA 4H6DA 2X7PA 4NF8B 1DSNA 2GH9A 4KXPA 1LGBC 3T1BA 2A5TA 4JDFA 3MP1A 4YKPA 3T96B 5IM2A 3MZ9A 1JVYA 1KWHA 3ZS6A 4WXJA 3U65A 4BDLA 5EQ7A 1IEJA 2FHYA 2HZKA 4H46A 4YB7A 1Y3QA 3Q27A 4TQUQ 4ND9A 4FECA 4FJPA 4C1TA 2DQVA 1DPPA 3OO9A 2HAVA 4ZEKA 2V4CA 3TDJA 5H8SA 4YB6A 3W9VA 2Z23A 2ZZWA 3TAJA 3IB0A 4MMPA 5ET6A 1OMPA 2IA4A 3IL1B 1ZJLA 4YKKA 2F78A 4F2QA 1QJMA 2F6PA 2QVRA 5K2YA 3E13X 2Y7WA 1JP4A 2O51A 2DS9A 3HSTA 3Q29A 3HHFA 5ITOA 3IB2A 5CI5A 3S9EA 3IFAA 2F36A 2VD2A 1LB8A 3MQ9A 2D5WA 4PE3A 1B46A 4IO3A 2D3IA 2Z8FA 1PB9A 5AA4B 1ATGA 4Z0IA 1QGXA 2UVHA 1FBFA 1SW4A 3B7DA 1AH5A 2ALUA 4BDOA 1B3EA 4P11A 3H4ZA 2G29A 1M5EA 3TMGA 2F3BA 2XXHA 1B05A 3T9XB 2WX9A 1PB7A 1NH7A 3K6XA 3T9HB 4MFIA 2Z8EA 1D9VA 5JK4A 4ZE9A 2FNCA 3ILUB 4C0RA 4X1DA 3RTFB 4H67A 4RK2A 4X1BA 4PFWA 5IZ3A 2P0SA 3BIHA 3MVWA 2HXWA 3ROJA 4PFTA 3RTWB 4GBWA 4N6PA 2DDKA 1NI9A 1JVXA 4X48A 4P1LA 2XWKA 4GFRA 1O7TA 1N84A 2UYEA 3OELA 4KI0E 5EYGA 2I4CA 3UP9A 1QKAA 1R1NA 4DXBA 1NV6A 3MZ1A 3HHGA 3IOVA 3TCFA 2F97A 4QFLA 5DTBA 1N7XA 3FATA 5KDTB 4OTEA 4OFJA 1IUDA 1JQFA 3PUZE 3R26A 1RDZA 1EZOA 1FPKA 2O69A 3FJ7A 4BDMA 2R9JA 3TTLA 5TP9A 4R72A 3EPEA 1IMDA 2YPNA 2KLFA 4MAGA 4PAIA 3EN3A 3FD3A 4GIZA 4MHFA 4ZE8A 2CEXA 1LBCA 5DVIA 1VFDA 3W15C 3IX1A 2HEUA 2XXTA 2DE2A 1MS7A 1XS5A 3E9XA 4JWYA 1PDAA 1CNQA 2I58A 2XX8A 3Q26A 4WEDA 3CRBA 3SEUA 1SW5A 1SVXB 2CZKA 3H7MA 1D9YA 2OZZA 2F6GA 4NF0A 3TKDA 2GFEA 1CB6A 4THIA 3C4MA 4ZDMA 3H6TA 3ONMA 1A8FA 2O1LA 1PB8A 2M8CA 3ISPA 4ZZAA 1B58A 1NV1A 5ISUA 2L5VA 5EHSA 1EU8A 2WBDA 4X8RA 1MPBA 2NVUB 3V5AA 1I6QA 3U8QA 3SESA 4Z7EA 3H03A 3CFLA 2Z8DA 1B7UA 1TT1A 2OLBA 3KOSA 4U21A 3SEWA 1RYOA 3T9VA 2O7IA 2BJIA 5I2NA 4KHZE 3Q28A 4DCYA 4F3SA 1H44A 2ONKE 5JEIA 2QMWA 1SPIA 2I4BA 3MP8A 3ILTB 2PVUA 3MPLA 2R8TA 3SEVA 1FPIA 4LN5A 1MY2A 4LUBA 4GWUA 4RPOA 5H8FB 2VPOA 1G0HA 4OVQA 3VDFA 1I6AA 3SEYA 1IXHA 3SDFA 5HBCA 1MM6A 4PFUA 3GYYA 3IO6A 4FORA 5I58B 5ICQA 1IMEA 1MM7A 1XC1A 5I56A 3BIGA 5I84A 1NMUA 3HPIA 4OEVA 3N6UA 2HXRA 2DWHA 4NMYA 3PPQA 3T0JA 5H8QB 1FTMA 3KEIA 3FJGA 4LVQA 4PDHA 2XWVA 4N4UA 3C34A 3O97A 3OD7A 3CG1A 3KJTA 1MH4A 4MEVA 3TCHA 2B3FA 2DOJA 4HXVA 2JJKA 5A5LA 4JWOA 4JWXA 1AL3A 2V84A 3TQLA 3PUVE 4R6HA 1SYHA 3HFUA 3CFZA 3PUWE 1IXCA 3VXCA 4GWOA 5CMBA 4OA4A 4QFPA 2I0BA 1MY1A 2VT5A 1EZPA 1P1WA 2WYKA 2HFBA 3PPPA 4NF8A 3KGCA 4KCCA 1MQDA 1NV2A 2RC7A 2H98A 5TU0A 2ABHA 4H8IA 2PT1A 2KQZA 3NOHA 4PQJA 3JV9A 5EYHA 2HAUA 5KCJB 5CRYA 4KR5A 4IGRA 1FPBA 4P8BA 4QSCA 1TFAA 4OWDA 3OSRA 2AYSA 2DVZA 2PT2A 3PUXE 3H6VA 4PF6A 2Q8JA 4GWSA 4PC9A 4DXUA 1FTOA 1FQDA 1LBYA 5TPAB 2ZZVA 4GL8A 3CHGA 5I7IA 1VFEA 4NF6A 4ZECA 5I57B 2Q74A 5CMCA 3OEMA 4Q30B 5EYFA 2XXIA 1GGGA 1FBCA 2WYPA 3FGSA 3IR1A 1SDXA 1NFTA 4OVSA 1A99A 4GX3A 4YB5A 4H1XA 1UIVA 5KCJA 3H6WA 3VV5A 3O29A 5DW8A 3LC8A 4AB6A 1A54A 3LSLA 4ZEBA 2OK2A 1LCFA 5IKBA 2PMSA 5I2KB 1LFGA 3CSBA 1I6BA 1H43A 2QMXA 2XXRA 2WBBA 1LBZA 2XWOA 1IITA 3CG3A 4NF6B 1DTZA 3GXAA 1B4HA 3C32A 5LTCA 1Y20A 4GWWA 4QFNA 4BLAA 1EYIA 4PAKA 5HPQA 4POXA 4H5GA 4GVOA 1LAGE 4NAPA 3USDA 1WDNA 5AA1A 2XXXA 1P1OA 4LQ5A 1B3GA 2FBPA 3MVXA 1FPLA 2THIA 1N0TA 4XEQA 2VPNA 5DEXA 1JNFA 3IO4A 4G8MA 2UXAA 1Y3PA 4LZ5A 2P2AA 4YAHX 4GWZA 3IB1A 1PBPA 3QUJA 4EQ7A 2F35A 4H45A 1O64A 4POWA 1Y4TA 5TPAA 2ZYNA 1FJ9A 1D3KA 3GLBA 1KA1A 1MQGA 3FJMA 4MNPA 4G77A 2OCUA 2H25A 1LBWA 4KCDA 3KZGA 1VR5A 4HS7A 3UGWA 1MXZA 5H8HB 2B3BA 1Q9DA 4F1UA 4DXCA 3ZSFA 3UIFA 1M5BA 5EQ9A 4XKPA 5DVFA 4XF5A 3FV1A 4U1OA 4MLVA 3O66A 3FVGA 4LONB 4HTGA 3OO7A 4OVRA 1SD3A 4OQOA 1FTJA 4R9FA 4F3PA 1IXGA 1IMCA 1MRPA 4MNIA 1M5FA 1LB9A 4NGUA 4XKQA 4I8CA 1UTHB 2GQ1A 4NF5B 1YCJA 1GV8A 5F1QA 1TXFA 1LAFE 3G3HA 4FBPA 2H4IA 1YXIA 1URDA 5HM4B 4U2RA 4AQ4A 2V93A 1NUYA 3KSXA 4LQ2A 3T22A 3G3GA 4ZS9A 3LV0A 1MXVA 3LSWA 5JTYB 2REJA 1OQHA 1LLSA 1DCUA 4QFOA 1N3WA 4G68A 4DI3D 1NL5A 3E79A 5BUUA 4I3EA 3RPLA 1B1XA 1II5A 1K9ZA 2A5TB 3RT6B 4KYEA 3QIMA 4F3BA 1FQAA 3G7WA 1URGA 4UABA 3TUSA 4IO6A 2YLNA 2DWIA 4GD5A 5LOMA 5J16A 3KJ7A 2XXPA 5T3JA 2GHAA 1Y9UA 4IO4A 4N13A 4RA1A 4I9DA 3C36A 4GWYA 5A5XB 4LATA 3AXFA 2OWSA 2P1SA 1Y4CA 2DVCA 1B3LA 2I49A 5ELVA 4PFIA 4N17A 2DE4A 3PMWA 5I58A 3KBZA 2O7UA 3MBPA 1B5IA 4ELOA 1MXWA 1YZ0A 2F5XA 4PBHA 1B7HA 1B2HA 2O1MA 2AL4A 3G3KA 1UIUA 4TLLB 4K3FA 2ONSA 3O2AA 3PMVA 2UVJA 1USYE 3QXMA 4F1VA 1FW0A 1G0IA 2OX3A 1YPNA 4PETA 1LBVA 3FV2A 1CE2A 1Q35A 4YMBA 1RYXA 4NN3A 4YKJA 4DI4B 4FIMA 3QAXA 4BDNA 4PE5B 4GX6A 3KG2A 4PTKA 3FXBA 1SW1A 2W7YA 4LA9A 4R2FA 3IAZA 3PPOA 2OBGA 4N8GA 1QUKA 3C31A 4TOZA 4I40A 3OSQA 5AE4A 4JVCA 1QKBA 1P1NA 1ZU0A 1D4NA 2ONRA 3E4RA 1LFHA 2D21A 1Y3NA 4JVIA 5CMKA 4O94A 1F9BA 4UA8A 3T93B 4NG7A 5IZZA 2HQ0A 3RLFE 5L9OA 5L8DA 2XA5A 4IO5A 4YICA 3K2DA 1FPDA 2XXYA 3BBRA 1B32A 4NE4A 2NOOA 2RINA 1Y1MA 1UTBB 2VP1A 1MXUA 2ESNA 1NNTA 2REGA 1NV3A 4P1EA 1IIWA 1MXXA 4MBPA 2KR0A 3K00A 5F24A 1N7WA 2BJJX 3B6TA 1HSJA 2RCBA 4ELRA 1JEVA 1DBZA 1K9YA 4U22A 2WEFA 2RKMA 2QS4A 3LUZA 1QUIA 2F7AA 1NNFA 1USYH 3KOTA 2QL3A 4PCDA 1OVBA 4HCYA 4MX6A 4ESXA 1OLCA 1Y1ZA 3B6QA 4EQ9A 1M5DA 4MH5A 1BK4A 2Q2AA 2MKZA 5I3SA 4AS4A 2Y7IA 5FTHA 3CFXA 1IMBA 3D4CA 1S50A 3KFMA 1OQGA 2YJPA 3SZPA 3ZKKA 1INPA 3KBRA 4HE1A 4JB7A 2Y5LA 3FIRA 3DP4A 4FE8A 2DE3A 5CBRA 4NF4B 4ZZEA 3H3GA 1TFDA 3HV1A 4OETA 4YZZA 1ZTYA 4KQPA 2QS3A 4AB5A 1ZBMA 3TZAA 2E1SA 4LZ8A 4F19A 4F29A 1MY3A 5DT6A 4JVDA 1RDYA 2HZLA 4QF9A 3MW0A 3MVYA 5ET5A 5ET7A 3FUZA 2I3WA 3TTRA 2ZMBA 4OXVA 3FVOA 5EQ8A 3RUMA 3EKIA 2GRVA 2CMOA 3MUQA 4G2ZA 2E0SA 4F2OA 3MWBA 3K1MA 4NTLA 1POTA 1IXIA 1P1QA 4YMAA 3DM0A 4I3YA 4I62A 4OERA 4X04A 4F39A 3KC1A 3KC0A 3WAEA 5ITPA 1B7ZA 1NUXA 4HE0A 1AIVA 3K1NA 1B3FA 3FASA 2P3VA 2O6AA 1AOVA 3N6TA 4GXSB 4PFYA 4EXKA 3EF7A 3RN8A 3OXNA 3A09A 1B4ZA 3OO6A 1DPEA 4F3GA 3RY3A 3MC2A 2X26A 4DCXA 3MZBA 1FBEA 1UQWA 3QK6A 1BKAA 3T9UA 1YYZA 2CZLA 5H8NB 4OVTA 4PFBA 3JZJA 4GF8A 3O28A 4NWDA 2Y5KA 4OYVA 1ZLQA 1SW2A 2WKYA 3FXUA 4HW8A 5I59B 3QSLA 5FHOA 4RK9A 4JXIA 1EZ9A 1ZKBA 1FTKA 4FEDA 3PTYA 1B6HA 2PX1A 1FQCA 4KD5A 1A8EA 3LSXA 4Q8RA 2I0CA 4IB2A 4ISUA 1MPDA 3HO7A 3U94A 1MXYA 2Q9TA 4XFEA 1QUJA 4OZ9A 4EUOA 1FPGA 3RQTA 4GBVA 4MLQA 4X9TA 4NQ8A 3S9LC 4U23A 2PBWA 1MQHA 4R6KA 3IOUA 4F22A 5IGAA 1FBGA 3A3CA 3KSJA 3K6VA 2Y7RA 3G3JA 1EYKA 3SETA 4PFRA 2F8DA 3ECRA 3EQ1A 1XHYA 2P3NA 2AIXA 4M4GA 4N6DA 4BDRA 1R6ZA 4FAJA 5IAIA 4G8HA 2Y7PA 4F31B 3S9MC 2O68A 4WKMA 2VGQA 4P0IA 4PF8A 5AA2A 1N04A 4ECFA 4OFLA 2ZYMA 3QMFA 3TQWA 1QW0A 3FVKA 3LSFB 4FEBA 4DIGA 4EXLA 1QVSA 1KA0A 1NNKA 4N6KA 3EHUA 3PGFA 4PBQA 2Q8MA 3L6GA 4U4XA 1VE4A 3CIJA 3S2VA 4F1YA 4GL0A 3IJOB 3VFJA 5DVJA 1NV5A 2DXYA 1FPFA 1Q1KA 1B9JA 2ZNUA 3F11A 3MP6A 3UORA 5AA3A 1NV7A 2QSXA 1OLAA 4C1UA 4NEDA 1ANFA 1LEVA 4LZ7A 5KDTA 4DZ1A 2H99A 3SERA 1B1HA 1GVCA 1FSAA 3M3LA 2XD3A 3T66A 2UVIA 1H45A 2OWTA 5IZ3B 2CZIA 1QULA 3K4UA 4R6YA 4GLIA 2DWJA 2XX9A 1NH8A 1NUWA 2ZXTA 3D4GA 1H76A 1MDP1 1BIYA 1R9QA 4MJOA 3G3IA 3G3FA 3IOTA 1S9TA 3S9NC 1FPEA 4L17A 2R71A 2CEYA 3K0VA 3TEPA 1DTGA 2H5YA 4IO7A 1R9LA 4G68B 1M5CA 4O3BA 4R9GA 2I3VA 4E0WA 1FRPA 3TCGA 3BKIB 2NUVA 4GWXA 3QYTA 4PDDA 3DELB 4G4PA 4MF3A 1UTHA 4ZEFA 3B50A 1OVTA 3K02A 3TELA 3HCQA 3TTNA 1ELJA 5K2XA 4OFOA 5LDZA 3U92A 5ESYA 3K01A 5EQAA 4QBAA 2IEEA 1HSEA 1XOCA 5DEXB 2V25A 3KN8A 4O3AA 5FBPA 3L6HA 3TTMA 1WODA 1BTJA 3TYHA 1US4A 2QFLA 3FVNA 3N5LA 3DP6A 3EHTA 3K6WA 5F7VA 3CVGA 3U93A 4KYSA 4ELQA 4EF2A 2Y84A 1P99A 3A3UA 4XKRA 4I1DA 4NF4A 2XXQA 2XXVA 1LSTA 1MG1A 5L9SA 5AA4A 4ONYA 2VOZA 1JW5A 4DDDA 1JETA 4N8YA 4KYDA 5H8FA 3QUFA 5ICTA 2ZYKA 3PUYE 4OVPA 4NHBA 3CI8A 1B5JA 3FXQA 1AWBA 3UA8A 2QS1A 4E0XA 1N76A 3PD8A 1FTLA 3MSTA 4NX1A 4H0WA 2XWIA 4IGTA 4R75A 3RT8A 3TPAA 1YAEA 1I69A 3I5OA 1PBQA 4QHQA 5TP9B 1FBPA 1GR2A 4H8JA 3PMXA 1SQYA 5A5XA 2ZNTA 4O7MA 4BDQA 3V83A 1JW4A 4P56A 1TWYA 2R6GE 3MYUA 1NUZA 4MIJA 5CMMA 4IR8A 4O7IA 1FPJA 2DSFA 3SEXA 3H6UA 1H3DA 4JSDA 2DXRA 1VSOA 4JBZA 3N94A 2B65A 3RGYA 1DOTA 4UACA 4O3CA 1XVXA 1MY4A 2DWAA 3TODA 3RPLB 4OANA 5IZ1A 2XD2A 3MPKA 3LUYA 3IK6B 1T0KA 4EDPA 1N3XA 3BFTA 4RY1A 1Z7ME 2XXWA 4NF5A 1NV0A 3KN3A 4YKIA 1B3HA 3OMBA 4QXDA 3KN7A 4P9KA 4QSEA 2QPQA 4G8NA 2FA7A 2CZHA 3OENA 3R7XA 1POY1 1GTKA 4XXUA 3UK4A 1YTVA 3S4UA 1AMFA 1FQBA 3GBBA 2Z22A 2X7QA 1NNPA 5M2VA 4O8MA 1SI0A 3VVFA 4JSOA 2GHBA 1LAXA 1RDXA 5I56B 2XHDA 1B40A 1B52A 2B4MA 2AL5A 5I2NB 5DYHA 2QS2A 4PGPA 5H8HA 1A55A 4Q5TA 1LAHE 4QFKA 2F7CA 5H8NA 2PYYA 1B0HA 3H06B 1FBHA 4HCWA 2VD3A 4OMBA 4P47A 1MY0A 3B8BA 2HPGA 2VHAA 4RXLA 1IMAA 3IJXB 3VE1B 1LBBA 5I59A 2QVUA 3K1PA 4YU0A 2I48A 5JTYA 5AA2D 3OEKA 1SI1A 3VXBA 4P0GA 1RKMA 3P7IA 2RCAA 4N15A 1US5A 2ANJA 5I57A 1BLFA 1MPCA 1DMBA 3DP8A 3FXRA 4R73A
chains in the Genus database with same CATH topology
2O69A 5BWJA 4NF5B 3S9LC 4U23A 3FJ7A 5L9MA 2PBWA 1YCJA 1GV8A 4BDMA 2R9JA 3TTLA 1MQHA 4R6KA 1TXFA 1LAFE 3IOUA 3EPEA 4R72A 5F1QA 3G3HA 5TP9A 4F22A 2H4IA 1Z7NE 3A3CA 2V3TA 2KLFA 2YPNA 3RPWA 1IQ7A 3KSJA 3MAMA 3PPNA 3N26A 1URDA 1WVJA 3M3KA 5HM4B 4F3PA 3C33A 3K6VA 2Y7RA 3EN3A 3FD3A 3G3JA 3SETA 4U2RA 4AQ4A 2F8DA 3ECRA 4GIZA 3EQ1A 1XHYA 4M4GA 2AIXA 4KFQA 4OVJA 2V93A 4ZE8A 4BDRA 3KSXA 1R6ZA 4H5FA 3VVDA 4FAJA 1LBCA 3Q25A 4LQ2A 3T22A 5IAIA 4G8HA 2Y7PA 5DVIA 3G3GA 4ZS9A 3TFLA 1VFDA 3W15C 3IX1A 4R2BA 2HEUA 1MXVA 4F31B 3LSWA 3S9MC 5JTYB 2O68A 3TTNA 5I2KA 2XXTA 2REJA 3E3KA 4IY6A 1OQHA 2VGQA 4WKMA 4P0IA 1LLSA 3MVZA 2DE2A 3LBSA 1MS7A 1XS5A 3E9XA 2NXOA 3M8UA 3PV0E 4JWYA 4QFOA 1N04A 1N3WA 1PDAA 3O6HA 4G68A 5FHMA 2I58A 3UN6A 2XX8A 4ECFA 1NL5A 5AA2B 4OFLA 4GRKA 4QSDA 2ZYMA 3U1OA 3Q26A 5BUUA 3TQWA 4U4SA 3W9WA 1B1XA 4WEDA 3CRBA 3SEUA 5B70A 1SW5A 2DYXA 1II5A 1A7LA 1QW0A 3FVKA 1SVXB 1MH3A 1P1UA 3LSFB 3H7MA 2A5TB 3MJNA 1XT8A 4FEBA 1D9YA 2OZZA 3RT6B 4Z7EA 4KYEA 2F6GA 3QIMA 3DLNA 3OOAA 4F3BA 4EF1A 1EH3A 1FQAA 4DIGA 3G7WA 4EXLA 1URGA 3TKDA 3ODBA 1QVSA 2GFEA 4IO6A 4LP2B 2YLNA 1NNKA 3TUSA 2DWIA 3EHUA 3PGFA 4GD5A 1CB6A 5LOMA 3KJ7A 4FATA 2XXPA 4G68C 2Y7KA 2GHAA 1Y9UA 3C4MA 4THIA 3L6GA 4ZDMA 3H6TA 3O6IA 3ONMA 4IO4A 4N13A 1A8FA 1VE4A 4RA1A 4U4XA 3OO8A 4I9DA 1SBPA 3CIJA 3S2VA 2O1LA 1PB8A 4IY5A 4F1YA 4GL0A 3C36A 3IJOB 3VFJA 5A5XB 5DVJA 1BP5A 2M8CA 3IOWA 4LATA 4ZZAA 3ZKLA 3AXFA 3CSGA 1B58A 2OWSA 5KZTA 2P1SA 3VLWA 5ISUA 1Y4CA 2DVCA 2DXYA 1Q1KA 3V8XB 1B9JA 5EHSA 3R6UA 1B3LA 2ZNUA 1EU8A 2I49A 4PP0A 5ELVA 5B7DA 3F11A 3MP6A 1MPBA 2NVUB 3UORA 3V5AA 1S7YA 1I6QA 5AA3A 1JW1A 2DE4A 2QSXA 3PMWA 4GOTA 1B5HA 1OLAA 4RYAA 3H03A 3CFLA 3RNNA 3SESA 2F34A 3U8QA 4C1UA 2Z8DA 3GBAA 5I58A 3C35A 1B7UA 4NEDA 1ANFA 1TT1A 2O7UA 3MBPA 1B5IA 2Q2CA 2OLBA 3KOSA 4LZ7A 5KDTA 4DZ1A 4U21A 3SEWA 1RYOA 4ELOA 1MXWA 1SYIA 2F5XA 3T9VA 1OIBA 1B7HA 2H99A 1B2HA 1J1NA 2O1MA 3FZVA 2AL4A 5K2YA 2O7IA 3G3KA 1XVYA 3SERA 1B1HA 1GVCA 5I2NA 3M3LA 1UIUA 4TLLB 4KHZE 2DP8A 2XD3A 3T66A 2UVIA 1H45A 2OWTA 2ZNSA 3CR9A 3Q28A 4K3FA 4DCYA 4F3SA 1H44A 2ONSA 2ONKE 5JEIA 1QULA 2QMWA 3O2AA 3VVEA 3K4UA 2UVGA 4R6YA 3PMVA 2UVJA 4GLIA 1USYE 3IORA 3SKPA 2DWJA 2XX9A 3QXMA 4F1VA 1FW0A 2I4BA 3ILTB 2PVUA 3MPLA 3MP8A 2F7BA 3K6UA 3O6GA 4N07A 3BFUA 2V3UA 4DE8A 3SEVA 1NH8A 1PEBA 2ZXTA 3D4GA 1H76A 1YPNA 4XTCQ 3LR1A 4PETA 1MDP1 1BIYA 1R9QA 3FV2A 1FQEA 4M1VA 1CE2A 1Q35A 3EHSA 3HN0A 4YMBA 1MY2A 1RYXA 3G3IA 3G3FA 4LUBA 4RPOA 4YKJA 4FIMA 3QAXA 3IOTA 5H8FB 1S9TA 4BDNA 1JEUA 4PE5B 3VDFA 2I6EA 4L17A 3S9NC 1I6AA 3KG2A 3SEYA 1IXHA 2R71A 3M3FA 4TLMB 3SDFA 3K0VA 5HBCA 1DTGA 1MM6A 2H5YA 4IO7A 4IO2A 1NKXA 1SW1A 4PFUA 4XIGQ 1R9LA 2W7YA 4LA9A 4G68B 4R2FA 3IO6A 4OESA 2UYFA 3IAZA 1M5CA 2QRYA 3PPOA 4FORA 4O3BA 2OBGA 4F18A 2RF1A 5I58B 1MM7A 1IZ1A 1XC1A 4OEUA 1QUKA 2XX7A 4R9GA 5I56A 3U72A 2I3VA 4E0WA 5I84A 1NMUA 3C31A 4H65A 4TOZA 2LAOA 3HPIA 4U1ZA 1HSLA 3TCGA 3BKIB 3OSQA 2Q89A 4OEVA 2NUVA 3GZGA 3JYRA 3N6UA 5AE4A 3QYTA 2RC9A 2DWHA 5ICQA 1QKBA 1LFIA 2Q88A 3DELB 4NMYA 4ZEDA 3PPQA 1P1NA 1ZU0A 4G4PA 4MF3A 1D4NA 2ONRA 1UTHA 1FTMA 3E4RA 3KEIA 2G93A 5H8QB 3FJGA 4ZEFA 1LFHA 4LVQA 2D21A 3THIA 1Y3NA 3C34A 3O97A 3OD7A 3CG1A 3KJTA 1MH4A 1OVTA 5CMKA 3K02A 3TELA 3HCQA 1B51A 1ELJA 1F9BA 2B3FA 4UA8A 3I6VA 3T93B 3TCHA 2QJEA 2DOJA 5K2XA 4ELPA 1O63A 5AA2A 1ZMGA 2HQ0A 4OFOA 3U92A 3RLFE 5L9OA 4JWOA 1FQFA 5L8DA 2A5SA 4IO5A 3K01A 4RNSA 4YICA 3K2DA 4DLDA 4JWXA 2IEEA 1AL3A 1HSEA 2V84A 2XXYA 3BBRA 1B32A 4R74A 4NE4A 2NOOA 4RJZA 3TQLA 3PUVE 1XOCA 4OHNA 5DEXB 2RINA 1SYHA 2V25A 1Y1MA 1UTBB 2VP1A 3CFZA 3KN8A 4R6HA 4O3AA 3PUWE 3L6HA 3TTKA 1IXCA 1MXUA 4XKNA 1L5TA 1PC3A 2ESNA 1NNTA 2REGA 2H9BA 3VXCA 3TTMA 4GWOA 5CC2A 5FHNA 1IIWA 5CMBA 1MXXA 4QFPA 2I0BA 1WODA 1MY1A 1BTJA 4MBPA 4OENA 4RPNA 1EZPA 1P1WA 3C9HA 3K00A 1US4A 3FVNA 3N5LA 2BJJX 1N7WA 4QRZA 3TYHA 3B6TA 1HSJA 2RCBA 3DP6A 1JEVA 4ELRA 3EHTA 2HFBA 3K6WA 3PPPA 4NF8A 4U22A 5F7VA 2RKMA 4GXAA 3PD9A 2QS4A 3CVGA 3U93A 1B0LA 3VLVA 5CBSA 4KYSA 4EQBA 1MDQA 4ELQA 3KGCA 4EF2A 2Y84A 1P99A 1QUIA 4KCCA 5H8QA 3A3UA 4XKRA 2F7AA 1MQDA 2XXUA 4WEPA 5J1DA 4I1DA 1MQIA 1NNFA 2H98A 1USYH 2RC7A 2XXQA 4NF4A 3O9PA 1FCKA 2XXVA 5EHMA 3PPRA 2V3QA 3KOTA 5TU0A 2ABHA 2QL3A 4ESWA 1OVBA 2PT1A 4H8IA 4Q0CA 4PQJA 3VLUA 1LSTA 3JV9A 4ZEIA 3WAFA 1MG1A 4HCYA 4ESXA 1OLCA 5L9SA 1Y1ZA 1ZIUA 2HAUA 2RC8A 3B6QA 5CRYA 5AA4A 5KCJB 4ONYA 3V89B 2ZYOA 1URSA 2FYIA 2VOZA 4EQ9A 1M5DA 4KR5A 1JW5A 4DDDA 4MH5A 1JETA 1LCTA 2Q2AA 4IGRA 4QSCA 1TFAA 4KYDA 5H8FA 3QUFA 4NWCA 5ICTA 2OJTA 2ZYKA 3PUYE 2Y7IA 4OWDA 5FTHA 3CFXA 3OSRA 2AYSA 1UTBA 2DVZA 2PT2A 4GQOA 3PUXE 3H6VA 2NWJA 3D4CA 2Q8JA 1S50A 3CI8A 3PU5A 5CM6A 1B5JA 3FXQA 3KFMA 4KPTA 4DXUA 1OQGA 1FTOA 1FQDA 3UA8A 5TPAB 2YJPA 3B6WA 4GL8A 2QS1A 3ZKKA 1A40A 4E0XA 5FTIA 1MQJA 1N76A 1VFEA 2O84X 3KBRA 4NF6A 3I3VA 4JB7A 4ZECA 3PD8A 2HCAA 4H6DA 1FTLA 2X7PA 4NF8B 5I57B 1DSNA 5CMCA 4H0WA 3OEMA 4Q30B 2GH9A 1LGBC 5EYFA 4IGTA 2XXIA 3FIRA 4R75A 3DP4A 2A5TA 4FE8A 3RT8A 1GGGA 4JDFA 2DE3A 3TPAA 1YAEA 5CBRA 1I69A 3FGSA 3MP1A 3I5OA 1SDXA 3IR1A 4NF4B 1PBQA 4YKPA 4QHQA 4ZZEA 3MZ9A 3T96B 5TP9B 1JVYA 1NFTA 3H3GA 1A99A 1TFDA 1KWHA 4YB5A 4H1XA 3HV1A 3ZS6A 4WXJA 1GR2A 4BDLA 4OETA 4H8JA 1IEJA 1ZTYA 2HZKA 4YB7A 4YZZA 1Y3QA 4KQPA 1UIVA 2QS3A 5KCJA 3H6WA 3PMXA 3O29A 3Q27A 3VV5A 1ZBMA 4TQUQ 3LC8A 3TZAA 4AB5A 1SQYA 2E1SA 5A5XA 2ZNTA 4ND9A 4BDQA 3V83A 4LZ8A 4F19A 4FECA 4FJPA 4F29A 1MY3A 4C1TA 1JW4A 1DPPA 2DQVA 4EUOA 1TWYA 2R6GE 3OO9A 5DT6A 4AB6A 1A54A 2HAVA 3LSLA 2OK2A 5CMMA 4ZEBA 2HZLA 4QF9A 3MW0A 3MVYA 4ZEKA 1LCFA 5IKBA 2PMSA 3FUZA 5I2KB 2DSFA 1LFGA 3TDJA 3CSBA 2I3WA 1I6BA 3TTRA 3SEXA 2ZMBA 1H43A 2QMXA 1H3DA 3H6UA 4YB6A 2XXRA 5H8SA 4OXVA 4JSDA 3W9VA 2DXRA 3FVOA 2Z23A 1VSOA 3RUMA 4JBZA 3TAJA 3N94A 1IITA 3IB0A 3CG3A 4NF6B 2B65A 2GRVA 1DTZA 3RGYA 2CMOA 1OMPA 3MUQA 3GXAA 1B4HA 2IA4A 3C32A 3IL1B 1DOTA 4G2ZA 1Y20A 2E0SA 4O3CA 4UACA 3TEPA 4QFNA 4BLAA 1XVXA 1MY4A 2DWAA 3TODA 4F2OA 1ZJLA 3MWBA 4YKKA 2F78A 4F2QA 1QJMA 2F6PA 5HPQA 2XD2A 3E13X 4H5GA 2Y7WA 3K1MA 3LUYA 3IK6B 3MPKA 4POXA 2O51A 4NTLA 1N3XA 4EDPA 2DS9A 3BFTA 1T0KA 3HSTA 4GVOA 1LAGE 3Q29A 1POTA 4RY1A 1Z7ME 2XXWA 3HHFA 5ITOA 3USDA 4NF5A 3IB2A 3KN3A 4YKIA 1WDNA 1B3HA 3OMBA 2XXXA 5CI5A 5AA1A 3S9EA 3KN7A 1IXIA 1P1OA 4LQ5A 4QSEA 1P1QA 2F36A 4YMAA 3DM0A 2VD2A 4OERA 4I62A 2QPQA 1LB8A 3MQ9A 2D5WA 4F39A 1B3GA 1B46A 4G8NA 2FA7A 3R7XA 3OENA 2D3IA 4IO3A 2Z8FA 1PB9A 3WAEA 5ITPA 3MVXA 1POY1 5AA4B 1GTKA 1ATGA 2THIA 1B7ZA 4XXUA 4Z0IA 1N0TA 3UK4A 2UVHA 5DEXA 1JNFA 3IO4A 1AIVA 1YTVA 1SW4A 3B7DA 3S4UA 1AH5A 2ALUA 3K1NA 4G8MA 1AMFA 1B3FA 1FQBA 4BDOA 2UXAA 3FASA 1Y3PA 1B3EA 2Z22A 3GBBA 2X7QA 1NNPA 2P2AA 4LZ5A 4YAHX 3IB1A 4P11A 2O6AA 3H4ZA 1AOVA 2G29A 3N6TA 1M5EA 5M2VA 3TMGA 1PBPA 3QUJA 4GXSB 1SI0A 4EQ7A 4PFYA 2F35A 1B05A 2XXHA 3T9XB 3VVFA 4EXKA 1O64A 4JSOA 1Y4TA 1PB7A 1NH7A 2GHBA 3EF7A 4POWA 5TPAA 3RN8A 3OXNA 1LAXA 2ZYNA 3A09A 1B4ZA 3OO6A 1DPEA 1D3KA 3K6XA 3T9HB 4F3GA 5I56B 2XHDA 3GLBA 4MFIA 1B40A 1B52A 1MQGA 3RY3A 3FJMA 3MC2A 2Z8EA 1D9VA 2X26A 5JK4A 2AL5A 4G77A 2OCUA 4ZE9A 2FNCA 3ILUB 5I2NB 5DYHA 2H25A 3MZBA 4C0RA 4X1DA 4KCDA 3KZGA 4DCXA 1UQWA 3QK6A 1VR5A 4HS7A 2QS2A 3RTFB 5H8HA 3UGWA 1BKAA 1MXZA 4H67A 4RK2A 1A55A 4X1BA 3T9UA 4Q5TA 1LAHE 4QFKA 2B3BA 2CZLA 4PFWA 5H8HB 5H8NB 3JZJA 2F7CA 2P0SA 4GF8A 4F1UA 3O28A 4NWDA 3MVWA 2HXWA 5H8NA 4DXCA 3ZSFA 2PYYA 4PFTA 3UIFA 1B0HA 3RTWB 1M5BA 3H06B 4HCWA 4XKPA 5DVFA 4OYVA 4N6PA 2VD3A 1JVXA 1ZLQA 4OMBA 3FV1A 4U1OA 4X48A 1SW2A 2WKYA 1MY0A 3FXUA 4HW8A 4MLVA 3O66A 2VHAA 1O7TA 4GFRA 1N84A 4RXLA 5I59B 2UYEA 3FVGA 3QSLA 5FHOA 4RK9A 3IJXB 4JXIA 1EZ9A 1ZKBA 3OELA 1LBBA 4KI0E 1FTKA 3VE1B 4FEDA 5I59A 4LONB 3K1PA 4YU0A 2I48A 1B6HA 5JTYA 5AA2D 2I4CA 2PX1A 3OEKA 1SI1A 1FQCA 4HTGA 3VXBA 3UP9A 4KD5A 1QKAA 1A8EA 4P0GA 3OO7A 1R1NA 3LSXA 1SD3A 1RKMA 4DXBA 4OQOA 3MZ1A 3P7IA 2RCAA 1FTJA 3HHGA 3IOVA 4Q8RA 2I0CA 1US5A 4IB2A 2ANJA 1IXGA 4ISUA 1MPDA 4R9FA 2F97A 1BLFA 1MRPA 3TCFA 1M5FA 5I57A 1LB9A 4QFLA 5DTBA 1MPCA 1DMBA 3HO7A 1N7XA 3FATA 3U94A 5KDTB 4OTEA 1MXYA 1IUDA 1JQFA 2Q9TA 1QUJA 3DP8A 3FXRA 3PUZE 3R26A 4I8CA 4OFJA 4OZ9A 1UTHB 4R73A 4XKQA 4MLQA 3RQTA 1EZOA 4X9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O69 A;  5BWJ A;  4NF5 B;  3S9L C;  4U23 A;  3FJ7 A;  5L9M A;  2PBW A;  1YCJ A;  1GV8 A;  4BDM A;  2R9J A;  3TTL A;  1MQH A;  4R6K A;  1TXF A;  1LAF E;  3IOU A;  3EPE A;  4R72 A;  5F1Q A;  3G3H A;  5TP9 A;  4F22 A;  2H4I A;  1Z7N E;  3A3C A;  2V3T A;  2KLF A;  2YPN A;  3RPW A;  1IQ7 A;  3KSJ A;  3MAM A;  3PPN A;  3N26 A;  1URD A;  1WVJ A;  3M3K A;  5HM4 B;  4F3P A;  3C33 A;  3K6V A;  2Y7R A;  3EN3 A;  3FD3 A;  3G3J A;  3SET A;  4U2R A;  4AQ4 A;  2F8D A;  3ECR A;  4GIZ A;  3EQ1 A;  1XHY A;  4M4G A;  2AIX A;  4KFQ A;  4OVJ A;  2V93 A;  4ZE8 A;  4BDR A;  3KSX A;  1R6Z A;  4H5F A;  3VVD A;  4FAJ A;  1LBC A;  3Q25 A;  4LQ2 A;  3T22 A;  5IAI A;  4G8H A;  2Y7P A;  5DVI A;  3G3G A;  4ZS9 A;  3TFL A;  1VFD A;  3W15 C;  3IX1 A;  4R2B A;  2HEU A;  1MXV A;  4F31 B;  3LSW A;  3S9M C;  5JTY B;  2O68 A;  3TTN A;  5I2K A;  2XXT A;  2REJ A;  3E3K A;  4IY6 A;  1OQH A;  2VGQ A;  4WKM A;  4P0I A;  1LLS A;  3MVZ A;  2DE2 A;  3LBS A;  1MS7 A;  1XS5 A;  3E9X A;  2NXO A;  3M8U A;  3PV0 E;  4JWY A;  4QFO A;  1N04 A;  1N3W A;  1PDA A;  3O6H A;  4G68 A;  5FHM A;  2I58 A;  3UN6 A;  2XX8 A;  4ECF A;  1NL5 A;  5AA2 B;  4OFL A;  4GRK A;  4QSD A;  2ZYM A;  3U1O A;  3Q26 A;  5BUU A;  3TQW A;  4U4S A;  3W9W A;  1B1X A;  4WED A;  3CRB A;  3SEU A;  5B70 A;  1SW5 A;  2DYX A;  1II5 A;  1A7L A;  1QW0 A;  3FVK A;  1SVX B;  1MH3 A;  1P1U A;  3LSF B;  3H7M A;  2A5T B;  3MJN A;  1XT8 A;  4FEB A;  1D9Y A;  2OZZ A;  3RT6 B;  4Z7E A;  4KYE A;  2F6G A;  3QIM A;  3DLN A;  3OOA A;  4F3B A;  4EF1 A;  1EH3 A;  1FQA A;  4DIG A;  3G7W A;  4EXL A;  1URG A;  3TKD A;  3ODB A;  1QVS A;  2GFE A;  4IO6 A;  4LP2 B;  2YLN A;  1NNK A;  3TUS A;  2DWI A;  3EHU A;  3PGF A;  4GD5 A;  1CB6 A;  5LOM A;  3KJ7 A;  4FAT A;  2XXP A;  4G68 C;  2Y7K A;  2GHA A;  1Y9U A;  3C4M A;  4THI A;  3L6G A;  4ZDM A;  3H6T A;  3O6I A;  3ONM A;  4IO4 A;  4N13 A;  1A8F A;  1VE4 A;  4RA1 A;  4U4X A;  3OO8 A;  4I9D A;  1SBP A;  3CIJ A;  3S2V A;  2O1L A;  1PB8 A;  4IY5 A;  4F1Y A;  4GL0 A;  3C36 A;  3IJO B;  3VFJ A;  5A5X B;  5DVJ A;  1BP5 A;  2M8C A;  3IOW A;  4LAT A;  4ZZA A;  3ZKL A;  3AXF A;  3CSG A;  1B58 A;  2OWS A;  5KZT A;  2P1S A;  3VLW A;  5ISU A;  1Y4C A;  2DVC A;  2DXY A;  1Q1K A;  3V8X B;  1B9J A;  5EHS A;  3R6U A;  1B3L A;  2ZNU A;  1EU8 A;  2I49 A;  4PP0 A;  5ELV A;  5B7D A;  3F11 A;  3MP6 A;  1MPB A;  2NVU B;  3UOR A;  3V5A A;  1S7Y A;  1I6Q A;  5AA3 A;  1JW1 A;  2DE4 A;  2QSX A;  3PMW A;  4GOT A;  1B5H A;  1OLA A;  4RYA A;  3H03 A;  3CFL A;  3RNN A;  3SES A;  2F34 A;  3U8Q A;  4C1U A;  2Z8D A;  3GBA A;  5I58 A;  3C35 A;  1B7U A;  4NED A;  1ANF A;  1TT1 A;  2O7U A;  3MBP A;  1B5I A;  2Q2C A;  2OLB A;  3KOS A;  4LZ7 A;  5KDT A;  4DZ1 A;  4U21 A;  3SEW A;  1RYO A;  4ELO A;  1MXW A;  1SYI A;  2F5X A;  3T9V A;  1OIB A;  1B7H A;  2H99 A;  1B2H A;  1J1N A;  2O1M A;  3FZV A;  2AL4 A;  5K2Y A;  2O7I A;  3G3K A;  1XVY A;  3SER A;  1B1H A;  1GVC A;  5I2N A;  3M3L A;  1UIU A;  4TLL B;  4KHZ E;  2DP8 A;  2XD3 A;  3T66 A;  2UVI A;  1H45 A;  2OWT A;  2ZNS A;  3CR9 A;  3Q28 A;  4K3F A;  4DCY A;  4F3S A;  1H44 A;  2ONS A;  2ONK E;  5JEI A;  1QUL A;  2QMW A;  3O2A A;  3VVE A;  3K4U A;  2UVG A;  4R6Y A;  3PMV A;  2UVJ A;  4GLI A;  1USY E;  3IOR A;  3SKP A;  2DWJ A;  2XX9 A;  3QXM A;  4F1V A;  1FW0 A;  2I4B A;  3ILT B;  2PVU A;  3MPL A;  3MP8 A;  2F7B A;  3K6U A;  3O6G A;  4N07 A;  3BFU A;  2V3U A;  4DE8 A;  3SEV A;  1NH8 A;  1PEB A;  2ZXT A;  3D4G A;  1H76 A;  1YPN A;  4XTC Q;  3LR1 A;  4PET A;  1MDP 1;  1BIY A;  1R9Q A;  3FV2 A;  1FQE A;  4M1V A;  1CE2 A;  1Q35 A;  3EHS A;  3HN0 A;  4YMB A;  1MY2 A;  1RYX A;  3G3I A;  3G3F A;  4LUB A;  4RPO A;  4YKJ A;  4FIM A;  3QAX A;  3IOT A;  5H8F B;  1S9T A;  4BDN A;  1JEU A;  4PE5 B;  3VDF A;  2I6E A;  4L17 A;  3S9N C;  1I6A A;  3KG2 A;  3SEY A;  1IXH A;  2R71 A;  3M3F A;  4TLM B;  3SDF A;  3K0V A;  5HBC A;  1DTG A;  1MM6 A;  2H5Y A;  4IO7 A;  4IO2 A;  1NKX A;  1SW1 A;  4PFU A;  4XIG Q;  1R9L A;  2W7Y A;  4LA9 A;  4G68 B;  4R2F A;  3IO6 A;  4OES A;  2UYF A;  3IAZ A;  1M5C A;  2QRY A;  3PPO A;  4FOR A;  4O3B A;  2OBG A;  4F18 A;  2RF1 A;  5I58 B;  1MM7 A;  1IZ1 A;  1XC1 A;  4OEU A;  1QUK A;  2XX7 A;  4R9G A;  5I56 A;  3U72 A;  2I3V A;  4E0W A;  5I84 A;  1NMU A;  3C31 A;  4H65 A;  4TOZ A;  2LAO A;  3HPI A;  4U1Z A;  1HSL A;  3TCG A;  3BKI B;  3OSQ A;  2Q89 A;  4OEV A;  2NUV A;  3GZG A;  3JYR A;  3N6U A;  5AE4 A;  3QYT A;  2RC9 A;  2DWH A;  5ICQ A;  1QKB A;  1LFI A;  2Q88 A;  3DEL B;  4NMY A;  4ZED A;  3PPQ A;  1P1N A;  1ZU0 A;  4G4P A;  4MF3 A;  1D4N A;  2ONR A;  1UTH A;  1FTM A;  3E4R A;  3KEI A;  2G93 A;  5H8Q B;  3FJG A;  4ZEF A;  1LFH A;  4LVQ A;  2D21 A;  3THI A;  1Y3N A;  3C34 A;  3O97 A;  3OD7 A;  3CG1 A;  3KJT A;  1MH4 A;  1OVT A;  5CMK A;  3K02 A;  3TEL A;  3HCQ A;  1B51 A;  1ELJ A;  1F9B A;  2B3F A;  4UA8 A;  3I6V A;  3T93 B;  3TCH A;  2QJE A;  2DOJ A;  5K2X A;  4ELP A;  1O63 A;  5AA2 A;  1ZMG A;  2HQ0 A;  4OFO A;  3U92 A;  3RLF E;  5L9O A;  4JWO A;  1FQF A;  5L8D A;  2A5S A;  4IO5 A;  3K01 A;  4RNS A;  4YIC A;  3K2D A;  4DLD A;  4JWX A;  2IEE A;  1AL3 A;  1HSE A;  2V84 A;  2XXY A;  3BBR A;  1B32 A;  4R74 A;  4NE4 A;  2NOO A;  4RJZ A;  3TQL A;  3PUV E;  1XOC A;  4OHN A;  5DEX B;  2RIN A;  1SYH A;  2V25 A;  1Y1M A;  1UTB B;  2VP1 A;  3CFZ A;  3KN8 A;  4R6H A;  4O3A A;  3PUW E;  3L6H A;  3TTK A;  1IXC A;  1MXU A;  4XKN A;  1L5T A;  1PC3 A;  2ESN A;  1NNT A;  2REG A;  2H9B A;  3VXC A;  3TTM A;  4GWO A;  5CC2 A;  5FHN A;  1IIW A;  5CMB A;  1MXX A;  4QFP A;  2I0B A;  1WOD A;  1MY1 A;  1BTJ A;  4MBP A;  4OEN A;  4RPN A;  1EZP A;  1P1W A;  3C9H A;  3K00 A;  1US4 A;  3FVN A;  3N5L A;  2BJJ X;  1N7W A;  4QRZ A;  3TYH A;  3B6T A;  1HSJ A;  2RCB A;  3DP6 A;  1JEV A;  4ELR A;  3EHT A;  2HFB A;  3K6W A;  3PPP A;  4NF8 A;  4U22 A;  5F7V A;  2RKM A;  4GXA A;  3PD9 A;  2QS4 A;  3CVG A;  3U93 A;  1B0L A;  3VLV A;  5CBS A;  4KYS A;  4EQB A;  1MDQ A;  4ELQ A;  3KGC A;  4EF2 A;  2Y84 A;  1P99 A;  1QUI A;  4KCC A;  5H8Q A;  3A3U A;  4XKR A;  2F7A A;  1MQD A;  2XXU A;  4WEP A;  5J1D A;  4I1D A;  1MQI A;  1NNF A;  2H98 A;  1USY H;  2RC7 A;  2XXQ A;  4NF4 A;  3O9P A;  1FCK A;  2XXV A;  5EHM A;  3PPR A;  2V3Q A;  3KOT A;  5TU0 A;  2ABH A;  2QL3 A;  4ESW A;  1OVB A;  2PT1 A;  4H8I A;  4Q0C A;  4PQJ A;  3VLU A;  1LST A;  3JV9 A;  4ZEI A;  3WAF A;  1MG1 A;  4HCY A;  4ESX A;  1OLC A;  5L9S A;  1Y1Z A;  1ZIU A;  2HAU A;  2RC8 A;  3B6Q A;  5CRY A;  5AA4 A;  5KCJ B;  4ONY A;  3V89 B;  2ZYO A;  1URS A;  2FYI A;  2VOZ A;  4EQ9 A;  1M5D A;  4KR5 A;  1JW5 A;  4DDD A;  4MH5 A;  1JET A;  1LCT A;  2Q2A A;  4IGR A;  4QSC A;  1TFA A;  4KYD A;  5H8F A;  3QUF A;  4NWC A;  5ICT A;  2OJT A;  2ZYK A;  3PUY E;  2Y7I A;  4OWD A;  5FTH A;  3CFX A;  3OSR A;  2AYS A;  1UTB A;  2DVZ A;  2PT2 A;  4GQO A;  3PUX E;  3H6V A;  2NWJ A;  3D4C A;  2Q8J A;  1S50 A;  3CI8 A;  3PU5 A;  5CM6 A;  1B5J A;  3FXQ A;  3KFM A;  4KPT A;  4DXU A;  1OQG A;  1FTO A;  1FQD A;  3UA8 A;  5TPA B;  2YJP A;  3B6W A;  4GL8 A;  2QS1 A;  3ZKK A;  1A40 A;  4E0X A;  5FTI A;  1MQJ A;  1N76 A;  1VFE A;  2O84 X;  3KBR A;  4NF6 A;  3I3V A;  4JB7 A;  4ZEC A;  3PD8 A;  2HCA A;  4H6D A;  1FTL A;  2X7P A;  4NF8 B;  5I57 B;  1DSN A;  5CMC A;  4H0W A;  3OEM A;  4Q30 B;  2GH9 A;  1LGB C;  5EYF A;  4IGT A;  2XXI A;  3FIR A;  4R75 A;  3DP4 A;  2A5T A;  4FE8 A;  3RT8 A;  1GGG A;  4JDF A;  2DE3 A;  3TPA A;  1YAE A;  5CBR A;  1I69 A;  3FGS A;  3MP1 A;  3I5O A;  1SDX A;  3IR1 A;  4NF4 B;  1PBQ A;  4YKP A;  4QHQ A;  4ZZE A;  3MZ9 A;  3T96 B;  5TP9 B;  1JVY A;  1NFT A;  3H3G A;  1A99 A;  1TFD A;  1KWH A;  4YB5 A;  4H1X A;  3HV1 A;  3ZS6 A;  4WXJ A;  1GR2 A;  4BDL A;  4OET A;  4H8J A;  1IEJ A;  1ZTY A;  2HZK A;  4YB7 A;  4YZZ A;  1Y3Q A;  4KQP A;  1UIV A;  2QS3 A;  5KCJ A;  3H6W A;  3PMX A;  3O29 A;  3Q27 A;  3VV5 A;  1ZBM A;  4TQU Q;  3LC8 A;  3TZA A;  4AB5 A;  1SQY A;  2E1S A;  5A5X A;  2ZNT A;  4ND9 A;  4BDQ A;  3V83 A;  4LZ8 A;  4F19 A;  4FEC A;  4FJP A;  4F29 A;  1MY3 A;  4C1T A;  1JW4 A;  1DPP A;  2DQV A;  4EUO A;  1TWY A;  2R6G E;  3OO9 A;  5DT6 A;  4AB6 A;  1A54 A;  2HAV A;  3LSL A;  2OK2 A;  5CMM A;  4ZEB A;  2HZL A;  4QF9 A;  3MW0 A;  3MVY A;  4ZEK A;  1LCF A;  5IKB A;  2PMS A;  3FUZ A;  5I2K B;  2DSF A;  1LFG A;  3TDJ A;  3CSB A;  2I3W A;  1I6B A;  3TTR A;  3SEX A;  2ZMB A;  1H43 A;  2QMX A;  1H3D A;  3H6U A;  4YB6 A;  2XXR A;  5H8S A;  4OXV A;  4JSD A;  3W9V A;  2DXR A;  3FVO A;  2Z23 A;  1VSO A;  3RUM A;  4JBZ A;  3TAJ A;  3N94 A;  1IIT A;  3IB0 A;  3CG3 A;  4NF6 B;  2B65 A;  2GRV A;  1DTZ A;  3RGY A;  2CMO A;  1OMP A;  3MUQ A;  3GXA A;  1B4H A;  2IA4 A;  3C32 A;  3IL1 B;  1DOT A;  4G2Z A;  1Y20 A;  2E0S A;  4O3C A;  4UAC A;  3TEP A;  4QFN A;  4BLA A;  1XVX A;  1MY4 A;  2DWA A;  3TOD A;  4F2O A;  1ZJL A;  3MWB A;  4YKK A;  2F78 A;  4F2Q A;  1QJM A;  2F6P A;  5HPQ A;  2XD2 A;  3E13 X;  4H5G A;  2Y7W A;  3K1M A;  3LUY A;  3IK6 B;  3MPK A;  4POX A;  2O51 A;  4NTL A;  1N3X A;  4EDP A;  2DS9 A;  3BFT A;  1T0K A;  3HST A;  4GVO A;  1LAG E;  3Q29 A;  1POT A;  4RY1 A;  1Z7M E;  2XXW A;  3HHF A;  5ITO A;  3USD A;  4NF5 A;  3IB2 A;  3KN3 A;  4YKI A;  1WDN A;  1B3H A;  3OMB A;  2XXX A;  5CI5 A;  5AA1 A;  3S9E A;  3KN7 A;  1IXI A;  1P1O A;  4LQ5 A;  4QSE A;  1P1Q A;  2F36 A;  4YMA A;  3DM0 A;  2VD2 A;  4OER A;  4I62 A;  2QPQ A;  1LB8 A;  3MQ9 A;  2D5W A;  4F39 A;  1B3G A;  1B46 A;  4G8N A;  2FA7 A;  3R7X A;  3OEN A;  2D3I A;  4IO3 A;  2Z8F A;  1PB9 A;  3WAE A;  5ITP A;  3MVX A;  1POY 1;  5AA4 B;  1GTK A;  1ATG A;  2THI A;  1B7Z A;  4XXU A;  4Z0I A;  1N0T A;  3UK4 A;  2UVH A;  5DEX A;  1JNF A;  3IO4 A;  1AIV A;  1YTV A;  1SW4 A;  3B7D A;  3S4U A;  1AH5 A;  2ALU A;  3K1N A;  4G8M A;  1AMF A;  1B3F A;  1FQB A;  4BDO A;  2UXA A;  3FAS A;  1Y3P A;  1B3E A;  2Z22 A;  3GBB A;  2X7Q A;  1NNP A;  2P2A A;  4LZ5 A;  4YAH X;  3IB1 A;  4P11 A;  2O6A A;  3H4Z A;  1AOV A;  2G29 A;  3N6T A;  1M5E A;  5M2V A;  3TMG A;  1PBP A;  3QUJ A;  4GXS B;  1SI0 A;  4EQ7 A;  4PFY A;  2F35 A;  1B05 A;  2XXH A;  3T9X B;  3VVF A;  4EXK A;  1O64 A;  4JSO A;  1Y4T A;  1PB7 A;  1NH7 A;  2GHB A;  3EF7 A;  4POW A;  5TPA A;  3RN8 A;  3OXN A;  1LAX A;  2ZYN A;  3A09 A;  1B4Z A;  3OO6 A;  1DPE A;  1D3K A;  3K6X A;  3T9H B;  4F3G A;  5I56 B;  2XHD A;  3GLB A;  4MFI A;  1B40 A;  1B52 A;  1MQG A;  3RY3 A;  3FJM A;  3MC2 A;  2Z8E A;  1D9V A;  2X26 A;  5JK4 A;  2AL5 A;  4G77 A;  2OCU A;  4ZE9 A;  2FNC A;  3ILU B;  5I2N B;  5DYH A;  2H25 A;  3MZB A;  4C0R A;  4X1D A;  4KCD A;  3KZG A;  4DCX A;  1UQW A;  3QK6 A;  1VR5 A;  4HS7 A;  2QS2 A;  3RTF B;  5H8H A;  3UGW A;  1BKA A;  1MXZ A;  4H67 A;  4RK2 A;  1A55 A;  4X1B A;  3T9U A;  4Q5T A;  1LAH E;  4QFK A;  2B3B A;  2CZL A;  4PFW A;  5H8H B;  5H8N B;  3JZJ A;  2F7C A;  2P0S A;  4GF8 A;  4F1U A;  3O28 A;  4NWD A;  3MVW A;  2HXW A;  5H8N A;  4DXC A;  3ZSF A;  2PYY A;  4PFT A;  3UIF A;  1B0H A;  3RTW B;  1M5B A;  3H06 B;  4HCW A;  4XKP A;  5DVF A;  4OYV A;  4N6P A;  2VD3 A;  1JVX A;  1ZLQ A;  4OMB A;  3FV1 A;  4U1O A;  4X48 A;  1SW2 A;  2WKY A;  1MY0 A;  3FXU A;  4HW8 A;  4MLV A;  3O66 A;  2VHA A;  1O7T A;  4GFR A;  1N84 A;  4RXL A;  5I59 B;  2UYE A;  3FVG A;  3QSL A;  5FHO A;  4RK9 A;  3IJX B;  4JXI A;  1EZ9 A;  1ZKB A;  3OEL A;  1LBB A;  4KI0 E;  1FTK A;  3VE1 B;  4FED A;  5I59 A;  4LON B;  3K1P A;  4YU0 A;  2I48 A;  1B6H A;  5JTY A;  5AA2 D;  2I4C A;  2PX1 A;  3OEK A;  1SI1 A;  1FQC A;  4HTG A;  3VXB A;  3UP9 A;  4KD5 A;  1QKA A;  1A8E A;  4P0G A;  3OO7 A;  1R1N A;  3LSX A;  1SD3 A;  1RKM A;  4DXB A;  4OQO A;  3MZ1 A;  3P7I A;  2RCA A;  1FTJ A;  3HHG A;  3IOV A;  4Q8R A;  2I0C A;  1US5 A;  4IB2 A;  2ANJ A;  1IXG A;  4ISU A;  1MPD A;  4R9F A;  2F97 A;  1BLF A;  1MRP A;  3TCF A;  1M5F A;  5I57 A;  1LB9 A;  4QFL A;  5DTB A;  1MPC A;  1DMB A;  3HO7 A;  1N7X A;  3FAT A;  3U94 A;  5KDT B;  4OTE A;  1MXY A;  1IUD A;  1JQF A;  2Q9T A;  1QUJ A;  3DP8 A;  3FXR A;  3PUZ E;  3R26 A;  4I8C A;  4OFJ A;  4OZ9 A;  1UTH B;  4R73 A;  4XKQ A;  4MLQ A;  3RQT A;  1EZO A;  4X9T A; 
#chains in the Genus database with same CATH topology
 5BWJ A;  5L9M A;  1XI6 A;  3RYD A;  1Z7N E;  2V3T A;  3RPW A;  1IQ7 A;  3MAM A;  3PPN A;  3N26 A;  1WVJ A;  3M3K A;  3C33 A;  3E78 A;  4OVJ A;  4KFQ A;  4H5F A;  3VVD A;  3Q25 A;  3IFC A;  3TFL A;  4R2B A;  2ZZX A;  5I2K A;  3E3K A;  4IY6 A;  4MNC A;  3MVZ A;  3LBS A;  3M8U A;  2NXO A;  2HHM A;  3PV0 E;  3O6H A;  3UN6 A;  5AA2 B;  5FHM A;  1FJ6 A;  4GRK A;  4QSD A;  3U1O A;  4U4S A;  3W9W A;  4HE2 A;  3D1R A;  5B70 A;  2DYX A;  1A7L A;  1MH3 A;  1P1U A;  3MJN A;  2PCR A;  1XT8 A;  3DLN A;  3OOA A;  4EF1 A;  1EH3 A;  3ODB A;  4LP2 B;  1KZ8 A;  4FAT A;  4G68 C;  2Y7K A;  4GX4 A;  3O6I A;  3OO8 A;  1SBP A;  4IY5 A;  1BP5 A;  2PFZ A;  3IOW A;  3ZKL A;  3CSG A;  5KZT A;  3VLW A;  2B4L A;  3V8X B;  3R6U A;  4PP0 A;  5B7D A;  2FIX A;  2PFY A;  1S7Y A;  1JW1 A;  4GOT A;  4RYA A;  1B5H A;  3RNN A;  2FVZ A;  2F34 A;  3GBA A;  3C35 A;  2Q2C A;  1SYI A;  1OIB A;  1J1N A;  3FZV A;  1XVY A;  2DP8 A;  4DE8 A;  2ZNS A;  3CR9 A;  3A29 A;  4N91 A;  3VVE A;  1IMF A;  2UVG A;  3IOR A;  5ET8 A;  3SKP A;  2QVV A;  4N07 A;  1NV4 A;  3O6G A;  2F7B A;  3K6U A;  3BFU A;  2V3U A;  1LBX A;  1PEB A;  4XTC Q;  3LR1 A;  1DK4 A;  1FQE A;  4M1V A;  3FBP A;  3EHS A;  3HN0 A;  1JEU A;  2I6E A;  3M3F A;  4TLM B;  4IO2 A;  1NKX A;  4XIG Q;  5I5P A;  4OES A;  2UYF A;  4P3L A;  2QRY A;  4F18 A;  2RF1 A;  4OEU A;  1IZ1 A;  1D9Q A;  2XX7 A;  3U72 A;  4H65 A;  2LAO A;  4U1Z A;  1HSL A;  2Q89 A;  3JYR A;  3GZG A;  2RC9 A;  4ZED A;  1LFI A;  2Q88 A;  2G93 A;  3THI A;  1FBD A;  4G61 A;  1B51 A;  3I6V A;  4ELP A;  2QJE A;  1O63 A;  1ZMG A;  4PAF A;  1FQF A;  2A5S A;  4RNS A;  4DLD A;  4RJZ A;  4R74 A;  4AS5 A;  4OHN A;  3TTK A;  4XKN A;  1L5T A;  1PC3 A;  2XXK A;  2H9B A;  5CC2 A;  5FHN A;  2FIE A;  4OEN A;  4RPN A;  3C9H A;  2OWZ A;  4QRZ A;  4GXA A;  3PD9 A;  1B0L A;  3VLV A;  5CBS A;  4EQB A;  1MDQ A;  5H8Q A;  1EYJ A;  2XXU A;  4WEP A;  5J1D A;  1MQI A;  3O9P A;  1FCK A;  5EHM A;  3PPR A;  2V3Q A;  4ESW A;  1VDW A;  4Q0C A;  3VLU A;  4ZEI A;  3WAF A;  4MCO A;  1ZIU A;  2RC8 A;  2F3D A;  3V89 B;  2ZYO A;  1URS A;  2FYI A;  1LCT A;  1FTA A;  4NWC A;  2OJT A;  4PGN A;  1UTB A;  4GQO A;  4N81 A;  2NWJ A;  3PU5 A;  5CM6 A;  4KPT A;  3B6W A;  1A40 A;  5FTI A;  1MQJ A;  2O84 X;  3I3V A;  2HCA A;  4H6D A;  2X7P A;  4NF8 B;  1DSN A;  2GH9 A;  4KXP A;  1LGB C;  3T1B A;  2A5T A;  4JDF A;  3MP1 A;  4YKP A;  3T96 B;  5IM2 A;  3MZ9 A;  1JVY A;  1KWH A;  3ZS6 A;  4WXJ A;  3U65 A;  4BDL A;  5EQ7 A;  1IEJ A;  2FHY A;  2HZK A;  4H46 A;  4YB7 A;  1Y3Q A;  3Q27 A;  4TQU Q;  4ND9 A;  4FEC A;  4FJP A;  4C1T A;  2DQV A;  1DPP A;  3OO9 A;  2HAV A;  4ZEK A;  2V4C A;  3TDJ A;  5H8S A;  4YB6 A;  3W9V A;  2Z23 A;  2ZZW A;  3TAJ A;  3IB0 A;  4MMP A;  5ET6 A;  1OMP A;  2IA4 A;  3IL1 B;  1ZJL A;  4YKK A;  2F78 A;  4F2Q A;  1QJM A;  2F6P A;  2QVR A;  5K2Y A;  3E13 X;  2Y7W A;  1JP4 A;  2O51 A;  2DS9 A;  3HST A;  3Q29 A;  3HHF A;  5ITO A;  3IB2 A;  5CI5 A;  3S9E A;  3IFA A;  2F36 A;  2VD2 A;  1LB8 A;  3MQ9 A;  2D5W A;  4PE3 A;  1B46 A;  4IO3 A;  2D3I A;  2Z8F A;  1PB9 A;  5AA4 B;  1ATG A;  4Z0I A;  1QGX A;  2UVH A;  1FBF A;  1SW4 A;  3B7D A;  1AH5 A;  2ALU A;  4BDO A;  1B3E A;  4P11 A;  3H4Z A;  2G29 A;  1M5E A;  3TMG A;  2F3B A;  2XXH A;  1B05 A;  3T9X B;  2WX9 A;  1PB7 A;  1NH7 A;  3K6X A;  3T9H B;  4MFI A;  2Z8E A;  1D9V A;  5JK4 A;  4ZE9 A;  2FNC A;  3ILU B;  4C0R A;  4X1D A;  3RTF B;  4H67 A;  4RK2 A;  4X1B A;  4PFW A;  5IZ3 A;  2P0S A;  3BIH A;  3MVW A;  2HXW A;  3ROJ A;  4PFT A;  3RTW B;  4GBW A;  4N6P A;  2DDK A;  1NI9 A;  1JVX A;  4X48 A;  4P1L A;  2XWK A;  4GFR A;  1O7T A;  1N84 A;  2UYE A;  3OEL A;  4KI0 E;  5EYG A;  2I4C A;  3UP9 A;  1QKA A;  1R1N A;  4DXB A;  1NV6 A;  3MZ1 A;  3HHG A;  3IOV A;  3TCF A;  2F97 A;  4QFL A;  5DTB A;  1N7X A;  3FAT A;  5KDT B;  4OTE A;  4OFJ A;  1IUD A;  1JQF A;  3PUZ E;  3R26 A;  1RDZ A;  1EZO A;  1FPK A;  2O69 A;  3FJ7 A;  4BDM A;  2R9J A;  3TTL A;  5TP9 A;  4R72 A;  3EPE A;  1IMD A;  2YPN A;  2KLF A;  4MAG A;  4PAI A;  3EN3 A;  3FD3 A;  4GIZ A;  4MHF A;  4ZE8 A;  2CEX A;  1LBC A;  5DVI A;  1VFD A;  3W15 C;  3IX1 A;  2HEU A;  2XXT A;  2DE2 A;  1MS7 A;  1XS5 A;  3E9X A;  4JWY A;  1PDA A;  1CNQ A;  2I58 A;  2XX8 A;  3Q26 A;  4WED A;  3CRB A;  3SEU A;  1SW5 A;  1SVX B;  2CZK A;  3H7M A;  1D9Y A;  2OZZ A;  2F6G A;  4NF0 A;  3TKD A;  2GFE A;  1CB6 A;  4THI A;  3C4M A;  4ZDM A;  3H6T A;  3ONM A;  1A8F A;  2O1L A;  1PB8 A;  2M8C A;  3ISP A;  4ZZA A;  1B58 A;  1NV1 A;  5ISU A;  2L5V A;  5EHS A;  1EU8 A;  2WBD A;  4X8R A;  1MPB A;  2NVU B;  3V5A A;  1I6Q A;  3U8Q A;  3SES A;  4Z7E A;  3H03 A;  3CFL A;  2Z8D A;  1B7U A;  1TT1 A;  2OLB A;  3KOS A;  4U21 A;  3SEW A;  1RYO A;  3T9V A;  2O7I A;  2BJI A;  5I2N A;  4KHZ E;  3Q28 A;  4DCY A;  4F3S A;  1H44 A;  2ONK E;  5JEI A;  2QMW A;  1SPI A;  2I4B A;  3MP8 A;  3ILT B;  2PVU A;  3MPL A;  2R8T A;  3SEV A;  1FPI A;  4LN5 A;  1MY2 A;  4LUB A;  4GWU A;  4RPO A;  5H8F B;  2VPO A;  1G0H A;  4OVQ A;  3VDF A;  1I6A A;  3SEY A;  1IXH A;  3SDF A;  5HBC A;  1MM6 A;  4PFU A;  3GYY A;  3IO6 A;  4FOR A;  5I58 B;  5ICQ A;  1IME A;  1MM7 A;  1XC1 A;  5I56 A;  3BIG A;  5I84 A;  1NMU A;  3HPI A;  4OEV A;  3N6U A;  2HXR A;  2DWH A;  4NMY A;  3PPQ A;  3T0J A;  5H8Q B;  1FTM A;  3KEI A;  3FJG A;  4LVQ A;  4PDH A;  2XWV A;  4N4U A;  3C34 A;  3O97 A;  3OD7 A;  3CG1 A;  3KJT A;  1MH4 A;  4MEV A;  3TCH A;  2B3F A;  2DOJ A;  4HXV A;  2JJK A;  5A5L A;  4JWO A;  4JWX A;  1AL3 A;  2V84 A;  3TQL A;  3PUV E;  4R6H A;  1SYH A;  3HFU A;  3CFZ A;  3PUW E;  1IXC A;  3VXC A;  4GWO A;  5CMB A;  4OA4 A;  4QFP A;  2I0B A;  1MY1 A;  2VT5 A;  1EZP A;  1P1W A;  2WYK A;  2HFB A;  3PPP A;  4NF8 A;  3KGC A;  4KCC A;  1MQD A;  1NV2 A;  2RC7 A;  2H98 A;  5TU0 A;  2ABH A;  4H8I A;  2PT1 A;  2KQZ A;  3NOH A;  4PQJ A;  3JV9 A;  5EYH A;  2HAU A;  5KCJ B;  5CRY A;  4KR5 A;  4IGR A;  1FPB A;  4P8B A;  4QSC A;  1TFA A;  4OWD A;  3OSR A;  2AYS A;  2DVZ A;  2PT2 A;  3PUX E;  3H6V A;  4PF6 A;  2Q8J A;  4GWS A;  4PC9 A;  4DXU A;  1FTO A;  1FQD A;  1LBY A;  5TPA B;  2ZZV A;  4GL8 A;  3CHG A;  5I7I A;  1VFE A;  4NF6 A;  4ZEC A;  5I57 B;  2Q74 A;  5CMC A;  3OEM A;  4Q30 B;  5EYF A;  2XXI A;  1GGG A;  1FBC A;  2WYP A;  3FGS A;  3IR1 A;  1SDX A;  1NFT A;  4OVS A;  1A99 A;  4GX3 A;  4YB5 A;  4H1X A;  1UIV A;  5KCJ A;  3H6W A;  3VV5 A;  3O29 A;  5DW8 A;  3LC8 A;  4AB6 A;  1A54 A;  3LSL A;  4ZEB A;  2OK2 A;  1LCF A;  5IKB A;  2PMS A;  5I2K B;  1LFG A;  3CSB A;  1I6B A;  1H43 A;  2QMX A;  2XXR A;  2WBB A;  1LBZ A;  2XWO A;  1IIT A;  3CG3 A;  4NF6 B;  1DTZ A;  3GXA A;  1B4H A;  3C32 A;  5LTC A;  1Y20 A;  4GWW A;  4QFN A;  4BLA A;  1EYI A;  4PAK A;  5HPQ A;  4POX A;  4H5G A;  4GVO A;  1LAG E;  4NAP A;  3USD A;  1WDN A;  5AA1 A;  2XXX A;  1P1O A;  4LQ5 A;  1B3G A;  2FBP A;  3MVX A;  1FPL A;  2THI A;  1N0T A;  4XEQ A;  2VPN A;  5DEX A;  1JNF A;  3IO4 A;  4G8M A;  2UXA A;  1Y3P A;  4LZ5 A;  2P2A A;  4YAH X;  4GWZ A;  3IB1 A;  1PBP A;  3QUJ A;  4EQ7 A;  2F35 A;  4H45 A;  1O64 A;  4POW A;  1Y4T A;  5TPA A;  2ZYN A;  1FJ9 A;  1D3K A;  3GLB A;  1KA1 A;  1MQG A;  3FJM A;  4MNP A;  4G77 A;  2OCU A;  2H25 A;  1LBW A;  4KCD A;  3KZG A;  1VR5 A;  4HS7 A;  3UGW A;  1MXZ A;  5H8H B;  2B3B A;  1Q9D A;  4F1U A;  4DXC A;  3ZSF A;  3UIF A;  1M5B A;  5EQ9 A;  4XKP A;  5DVF A;  4XF5 A;  3FV1 A;  4U1O A;  4MLV A;  3O66 A;  3FVG A;  4LON B;  4HTG A;  3OO7 A;  4OVR A;  1SD3 A;  4OQO A;  1FTJ A;  4R9F A;  4F3P A;  1IXG A;  1IMC A;  1MRP A;  4MNI A;  1M5F A;  1LB9 A;  4NGU A;  4XKQ A;  4I8C A;  1UTH B;  2GQ1 A;  4NF5 B;  1YCJ A;  1GV8 A;  5F1Q A;  1TXF A;  1LAF E;  3G3H A;  4FBP A;  2H4I A;  1YXI A;  1URD A;  5HM4 B;  4U2R A;  4AQ4 A;  2V93 A;  1NUY A;  3KSX A;  4LQ2 A;  3T22 A;  3G3G A;  4ZS9 A;  3LV0 A;  1MXV A;  3LSW A;  5JTY B;  2REJ A;  1OQH A;  1LLS A;  1DCU A;  4QFO A;  1N3W A;  4G68 A;  4DI3 D;  1NL5 A;  3E79 A;  5BUU A;  4I3E A;  3RPL A;  1B1X A;  1II5 A;  1K9Z A;  2A5T B;  3RT6 B;  4KYE A;  3QIM A;  4F3B A;  1FQA A;  3G7W A;  1URG A;  4UAB A;  3TUS A;  4IO6 A;  2YLN A;  2DWI A;  4GD5 A;  5LOM A;  5J16 A;  3KJ7 A;  2XXP A;  5T3J A;  2GHA A;  1Y9U A;  4IO4 A;  4N13 A;  4RA1 A;  4I9D A;  3C36 A;  4GWY A;  5A5X B;  4LAT A;  3AXF A;  2OWS A;  2P1S A;  1Y4C A;  2DVC A;  1B3L A;  2I49 A;  5ELV A;  4PFI A;  4N17 A;  2DE4 A;  3PMW A;  5I58 A;  3KBZ A;  2O7U A;  3MBP A;  1B5I A;  4ELO A;  1MXW A;  1YZ0 A;  2F5X A;  4PBH A;  1B7H A;  1B2H A;  2O1M A;  2AL4 A;  3G3K A;  1UIU A;  4TLL B;  4K3F A;  2ONS A;  3O2A A;  3PMV A;  2UVJ A;  1USY E;  3QXM A;  4F1V A;  1FW0 A;  1G0I A;  2OX3 A;  1YPN A;  4PET A;  1LBV A;  3FV2 A;  1CE2 A;  1Q35 A;  4YMB A;  1RYX A;  4NN3 A;  4YKJ A;  4DI4 B;  4FIM A;  3QAX A;  4BDN A;  4PE5 B;  4GX6 A;  3KG2 A;  4PTK A;  3FXB A;  1SW1 A;  2W7Y A;  4LA9 A;  4R2F A;  3IAZ A;  3PPO A;  2OBG A;  4N8G A;  1QUK A;  3C31 A;  4TOZ A;  4I40 A;  3OSQ A;  5AE4 A;  4JVC A;  1QKB A;  1P1N A;  1ZU0 A;  1D4N A;  2ONR A;  3E4R A;  1LFH A;  2D21 A;  1Y3N A;  4JVI A;  5CMK A;  4O94 A;  1F9B A;  4UA8 A;  3T93 B;  4NG7 A;  5IZZ A;  2HQ0 A;  3RLF E;  5L9O A;  5L8D A;  2XA5 A;  4IO5 A;  4YIC A;  3K2D A;  1FPD A;  2XXY A;  3BBR A;  1B32 A;  4NE4 A;  2NOO A;  2RIN A;  1Y1M A;  1UTB B;  2VP1 A;  1MXU A;  2ESN A;  1NNT A;  2REG A;  1NV3 A;  4P1E A;  1IIW A;  1MXX A;  4MBP A;  2KR0 A;  3K00 A;  5F24 A;  1N7W A;  2BJJ X;  3B6T A;  1HSJ A;  2RCB A;  4ELR A;  1JEV A;  1DBZ A;  1K9Y A;  4U22 A;  2WEF A;  2RKM A;  2QS4 A;  3LUZ A;  1QUI A;  2F7A A;  1NNF A;  1USY H;  3KOT A;  2QL3 A;  4PCD A;  1OVB A;  4HCY A;  4MX6 A;  4ESX A;  1OLC A;  1Y1Z A;  3B6Q A;  4EQ9 A;  1M5D A;  4MH5 A;  1BK4 A;  2Q2A A;  2MKZ A;  5I3S A;  4AS4 A;  2Y7I A;  5FTH A;  3CFX A;  1IMB A;  3D4C A;  1S50 A;  3KFM A;  1OQG A;  2YJP A;  3SZP A;  3ZKK A;  1INP A;  3KBR A;  4HE1 A;  4JB7 A;  2Y5L A;  3FIR A;  3DP4 A;  4FE8 A;  2DE3 A;  5CBR A;  4NF4 B;  4ZZE A;  3H3G A;  1TFD A;  3HV1 A;  4OET A;  4YZZ A;  1ZTY A;  4KQP A;  2QS3 A;  4AB5 A;  1ZBM A;  3TZA A;  2E1S A;  4LZ8 A;  4F19 A;  4F29 A;  1MY3 A;  5DT6 A;  4JVD A;  1RDY A;  2HZL A;  4QF9 A;  3MW0 A;  3MVY A;  5ET5 A;  5ET7 A;  3FUZ A;  2I3W A;  3TTR A;  2ZMB A;  4OXV A;  3FVO A;  5EQ8 A;  3RUM A;  3EKI A;  2GRV A;  2CMO A;  3MUQ A;  4G2Z A;  2E0S A;  4F2O A;  3MWB A;  3K1M A;  4NTL A;  1POT A;  1IXI A;  1P1Q A;  4YMA A;  3DM0 A;  4I3Y A;  4I62 A;  4OER A;  4X04 A;  4F39 A;  3KC1 A;  3KC0 A;  3WAE A;  5ITP A;  1B7Z A;  1NUX A;  4HE0 A;  1AIV A;  3K1N A;  1B3F A;  3FAS A;  2P3V A;  2O6A A;  1AOV A;  3N6T A;  4GXS B;  4PFY A;  4EXK A;  3EF7 A;  3RN8 A;  3OXN A;  3A09 A;  1B4Z A;  3OO6 A;  1DPE A;  4F3G A;  3RY3 A;  3MC2 A;  2X26 A;  4DCX A;  3MZB A;  1FBE A;  1UQW A;  3QK6 A;  1BKA A;  3T9U A;  1YYZ A;  2CZL A;  5H8N B;  4OVT A;  4PFB A;  3JZJ A;  4GF8 A;  3O28 A;  4NWD A;  2Y5K A;  4OYV A;  1ZLQ A;  1SW2 A;  2WKY A;  3FXU A;  4HW8 A;  5I59 B;  3QSL A;  5FHO A;  4RK9 A;  4JXI A;  1EZ9 A;  1ZKB A;  1FTK A;  4FED A;  3PTY A;  1B6H A;  2PX1 A;  1FQC A;  4KD5 A;  1A8E A;  3LSX A;  4Q8R A;  2I0C A;  4IB2 A;  4ISU A;  1MPD A;  3HO7 A;  3U94 A;  1MXY A;  2Q9T A;  4XFE A;  1QUJ A;  4OZ9 A;  4EUO A;  1FPG A;  3RQT A;  4GBV A;  4MLQ A;  4X9T A;  4NQ8 A;  3S9L C;  4U23 A;  2PBW A;  1MQH A;  4R6K A;  3IOU A;  4F22 A;  5IGA A;  1FBG A;  3A3C A;  3KSJ A;  3K6V A;  2Y7R A;  3G3J A;  1EYK A;  3SET A;  4PFR A;  2F8D A;  3ECR A;  3EQ1 A;  1XHY A;  2P3N A;  2AIX A;  4M4G A;  4N6D A;  4BDR A;  1R6Z A;  4FAJ A;  5IAI A;  4G8H A;  2Y7P A;  4F31 B;  3S9M C;  2O68 A;  4WKM A;  2VGQ A;  4P0I A;  4PF8 A;  5AA2 A;  1N04 A;  4ECF A;  4OFL A;  2ZYM A;  3QMF A;  3TQW A;  1QW0 A;  3FVK A;  3LSF B;  4FEB A;  4DIG A;  4EXL A;  1QVS A;  1KA0 A;  1NNK A;  4N6K A;  3EHU A;  3PGF A;  4PBQ A;  2Q8M A;  3L6G A;  4U4X A;  1VE4 A;  3CIJ A;  3S2V A;  4F1Y A;  4GL0 A;  3IJO B;  3VFJ A;  5DVJ A;  1NV5 A;  2DXY A;  1FPF A;  1Q1K A;  1B9J A;  2ZNU A;  3F11 A;  3MP6 A;  3UOR A;  5AA3 A;  1NV7 A;  2QSX A;  1OLA A;  4C1U A;  4NED A;  1ANF A;  1LEV A;  4LZ7 A;  5KDT A;  4DZ1 A;  2H99 A;  3SER A;  1B1H A;  1GVC A;  1FSA A;  3M3L A;  2XD3 A;  3T66 A;  2UVI A;  1H45 A;  2OWT A;  5IZ3 B;  2CZI A;  1QUL A;  3K4U A;  4R6Y A;  4GLI A;  2DWJ A;  2XX9 A;  1NH8 A;  1NUW A;  2ZXT A;  3D4G A;  1H76 A;  1MDP 1;  1BIY A;  1R9Q A;  4MJO A;  3G3I A;  3G3F A;  3IOT A;  1S9T A;  3S9N C;  1FPE A;  4L17 A;  2R71 A;  2CEY A;  3K0V A;  3TEP A;  1DTG A;  2H5Y A;  4IO7 A;  1R9L A;  4G68 B;  1M5C A;  4O3B A;  4R9G A;  2I3V A;  4E0W A;  1FRP A;  3TCG A;  3BKI B;  2NUV A;  4GWX A;  3QYT A;  4PDD A;  3DEL B;  4G4P A;  4MF3 A;  1UTH A;  4ZEF A;  3B50 A;  1OVT A;  3K02 A;  3TEL A;  3HCQ A;  3TTN A;  1ELJ A;  5K2X A;  4OFO A;  5LDZ A;  3U92 A;  5ESY A;  3K01 A;  5EQA A;  4QBA A;  2IEE A;  1HSE A;  1XOC A;  5DEX B;  2V25 A;  3KN8 A;  4O3A A;  5FBP A;  3L6H A;  3TTM A;  1WOD A;  1BTJ A;  3TYH A;  1US4 A;  2QFL A;  3FVN A;  3N5L A;  3DP6 A;  3EHT A;  3K6W A;  5F7V A;  3CVG A;  3U93 A;  4KYS A;  4ELQ A;  4EF2 A;  2Y84 A;  1P99 A;  3A3U A;  4XKR A;  4I1D A;  4NF4 A;  2XXQ A;  2XXV A;  1LST A;  1MG1 A;  5L9S A;  5AA4 A;  4ONY A;  2VOZ A;  1JW5 A;  4DDD A;  1JET A;  4N8Y A;  4KYD A;  5H8F A;  3QUF A;  5ICT A;  2ZYK A;  3PUY E;  4OVP A;  4NHB A;  3CI8 A;  1B5J A;  3FXQ A;  1AWB A;  3UA8 A;  2QS1 A;  4E0X A;  1N76 A;  3PD8 A;  1FTL A;  3MST A;  4NX1 A;  4H0W A;  2XWI A;  4IGT A;  4R75 A;  3RT8 A;  3TPA A;  1YAE A;  1I69 A;  3I5O A;  1PBQ A;  4QHQ A;  5TP9 B;  1FBP A;  1GR2 A;  4H8J A;  3PMX A;  1SQY A;  5A5X A;  2ZNT A;  4O7M A;  4BDQ A;  3V83 A;  1JW4 A;  4P56 A;  1TWY A;  2R6G E;  3MYU A;  1NUZ A;  4MIJ A;  5CMM A;  4IR8 A;  4O7I A;  1FPJ A;  2DSF A;  3SEX A;  3H6U A;  1H3D A;  4JSD A;  2DXR A;  1VSO A;  4JBZ A;  3N94 A;  2B65 A;  3RGY A;  1DOT A;  4UAC A;  4O3C A;  1XVX A;  1MY4 A;  2DWA A;  3TOD A;  3RPL B;  4OAN A;  5IZ1 A;  2XD2 A;  3MPK A;  3LUY A;  3IK6 B;  1T0K A;  4EDP A;  1N3X A;  3BFT A;  4RY1 A;  1Z7M E;  2XXW A;  4NF5 A;  1NV0 A;  3KN3 A;  4YKI A;  1B3H A;  3OMB A;  4QXD A;  3KN7 A;  4P9K A;  4QSE A;  2QPQ A;  4G8N A;  2FA7 A;  2CZH A;  3OEN A;  3R7X A;  1POY 1;  1GTK A;  4XXU A;  3UK4 A;  1YTV A;  3S4U A;  1AMF A;  1FQB A;  3GBB A;  2Z22 A;  2X7Q A;  1NNP A;  5M2V A;  4O8M A;  1SI0 A;  3VVF A;  4JSO A;  2GHB A;  1LAX A;  1RDX A;  5I56 B;  2XHD A;  1B40 A;  1B52 A;  2B4M A;  2AL5 A;  5I2N B;  5DYH A;  2QS2 A;  4PGP A;  5H8H A;  1A55 A;  4Q5T A;  1LAH E;  4QFK A;  2F7C A;  5H8N A;  2PYY A;  1B0H A;  3H06 B;  1FBH A;  4HCW A;  2VD3 A;  4OMB A;  4P47 A;  1MY0 A;  3B8B A;  2HPG A;  2VHA A;  4RXL A;  1IMA A;  3IJX B;  3VE1 B;  1LBB A;  5I59 A;  2QVU A;  3K1P A;  4YU0 A;  2I48 A;  5JTY A;  5AA2 D;  3OEK A;  1SI1 A;  3VXB A;  4P0G A;  1RKM A;  3P7I A;  2RCA A;  4N15 A;  1US5 A;  2ANJ A;  5I57 A;  1BLF A;  1MPC A;  1DMB A;  3DP8 A;  3FXR A;  4R73 A; 
#chains in the Genus database with same CATH homology
 2O69 A;  5BWJ A;  4NF5 B;  3S9L C;  4U23 A;  3FJ7 A;  5L9M A;  2PBW A;  1YCJ A;  1GV8 A;  4BDM A;  2R9J A;  3TTL A;  1MQH A;  4R6K A;  1TXF A;  1LAF E;  3IOU A;  3EPE A;  4R72 A;  5F1Q A;  3G3H A;  5TP9 A;  4F22 A;  2H4I A;  1Z7N E;  3A3C A;  2V3T A;  2KLF A;  2YPN A;  3RPW A;  1IQ7 A;  3KSJ A;  3MAM A;  3PPN A;  3N26 A;  1URD A;  1WVJ A;  3M3K A;  5HM4 B;  4F3P A;  3C33 A;  3K6V A;  2Y7R A;  3EN3 A;  3FD3 A;  3G3J A;  3SET A;  4U2R A;  4AQ4 A;  2F8D A;  3ECR A;  4GIZ A;  3EQ1 A;  1XHY A;  4M4G A;  2AIX A;  4KFQ A;  4OVJ A;  2V93 A;  4ZE8 A;  4BDR A;  3KSX A;  1R6Z A;  4H5F A;  3VVD A;  4FAJ A;  1LBC A;  3Q25 A;  4LQ2 A;  3T22 A;  5IAI A;  4G8H A;  2Y7P A;  5DVI A;  3G3G A;  4ZS9 A;  3TFL A;  1VFD A;  3W15 C;  3IX1 A;  4R2B A;  2HEU A;  1MXV A;  4F31 B;  3LSW A;  3S9M C;  5JTY B;  2O68 A;  3TTN A;  5I2K A;  2XXT A;  2REJ A;  3E3K A;  4IY6 A;  1OQH A;  2VGQ A;  4WKM A;  4P0I A;  1LLS A;  3MVZ A;  2DE2 A;  3LBS A;  1MS7 A;  1XS5 A;  3E9X A;  2NXO A;  3M8U A;  3PV0 E;  4JWY A;  4QFO A;  1N04 A;  1N3W A;  1PDA A;  3O6H A;  4G68 A;  5FHM A;  2I58 A;  3UN6 A;  2XX8 A;  4ECF A;  1NL5 A;  5AA2 B;  4OFL A;  4GRK A;  4QSD A;  2ZYM A;  3U1O A;  3Q26 A;  5BUU A;  3TQW A;  4U4S A;  3W9W A;  1B1X A;  4WED A;  3CRB A;  3SEU A;  5B70 A;  1SW5 A;  2DYX A;  1II5 A;  1A7L A;  1QW0 A;  3FVK A;  1SVX B;  1MH3 A;  1P1U A;  3LSF B;  3H7M A;  2A5T B;  3MJN A;  1XT8 A;  4FEB A;  1D9Y A;  2OZZ A;  3RT6 B;  4Z7E A;  4KYE A;  2F6G A;  3QIM A;  3DLN A;  3OOA A;  4F3B A;  4EF1 A;  1EH3 A;  1FQA A;  4DIG A;  3G7W A;  4EXL A;  1URG A;  3TKD A;  3ODB A;  1QVS A;  2GFE A;  4IO6 A;  4LP2 B;  2YLN A;  1NNK A;  3TUS A;  2DWI A;  3EHU A;  3PGF A;  4GD5 A;  1CB6 A;  5LOM A;  3KJ7 A;  4FAT A;  2XXP A;  4G68 C;  2Y7K A;  2GHA A;  1Y9U A;  3C4M A;  4THI A;  3L6G A;  4ZDM A;  3H6T A;  3O6I A;  3ONM A;  4IO4 A;  4N13 A;  1A8F A;  1VE4 A;  4RA1 A;  4U4X A;  3OO8 A;  4I9D A;  1SBP A;  3CIJ A;  3S2V A;  2O1L A;  1PB8 A;  4IY5 A;  4F1Y A;  4GL0 A;  3C36 A;  3IJO B;  3VFJ A;  5A5X B;  5DVJ A;  1BP5 A;  2M8C A;  3IOW A;  4LAT A;  4ZZA A;  3ZKL A;  3AXF A;  3CSG A;  1B58 A;  2OWS A;  5KZT A;  2P1S A;  3VLW A;  5ISU A;  1Y4C A;  2DVC A;  2DXY A;  1Q1K A;  3V8X B;  1B9J A;  5EHS A;  3R6U A;  1B3L A;  2ZNU A;  1EU8 A;  2I49 A;  4PP0 A;  5ELV A;  5B7D A;  3F11 A;  3MP6 A;  1MPB A;  2NVU B;  3UOR A;  3V5A A;  1S7Y A;  1I6Q A;  5AA3 A;  1JW1 A;  2DE4 A;  2QSX A;  3PMW A;  4GOT A;  1B5H A;  1OLA A;  4RYA A;  3H03 A;  3CFL A;  3RNN A;  3SES A;  2F34 A;  3U8Q A;  4C1U A;  2Z8D A;  3GBA A;  5I58 A;  3C35 A;  1B7U A;  4NED A;  1ANF A;  1TT1 A;  2O7U A;  3MBP A;  1B5I A;  2Q2C A;  2OLB A;  3KOS A;  4LZ7 A;  5KDT A;  4DZ1 A;  4U21 A;  3SEW A;  1RYO A;  4ELO A;  1MXW A;  1SYI A;  2F5X A;  3T9V A;  1OIB A;  1B7H A;  2H99 A;  1B2H A;  1J1N A;  2O1M A;  3FZV A;  2AL4 A;  5K2Y A;  2O7I A;  3G3K A;  1XVY A;  3SER A;  1B1H A;  1GVC A;  5I2N A;  3M3L A;  1UIU A;  4TLL B;  4KHZ E;  2DP8 A;  2XD3 A;  3T66 A;  2UVI A;  1H45 A;  2OWT A;  2ZNS A;  3CR9 A;  3Q28 A;  4K3F A;  4DCY A;  4F3S A;  1H44 A;  2ONS A;  2ONK E;  5JEI A;  1QUL A;  2QMW A;  3O2A A;  3VVE A;  3K4U A;  2UVG A;  4R6Y A;  3PMV A;  2UVJ A;  4GLI A;  1USY E;  3IOR A;  3SKP A;  2DWJ A;  2XX9 A;  3QXM A;  4F1V A;  1FW0 A;  2I4B A;  3ILT B;  2PVU A;  3MPL A;  3MP8 A;  2F7B A;  3K6U A;  3O6G A;  4N07 A;  3BFU A;  2V3U A;  4DE8 A;  3SEV A;  1NH8 A;  1PEB A;  2ZXT A;  3D4G A;  1H76 A;  1YPN A;  4XTC Q;  3LR1 A;  4PET A;  1MDP 1;  1BIY A;  1R9Q A;  3FV2 A;  1FQE A;  4M1V A;  1CE2 A;  1Q35 A;  3EHS A;  3HN0 A;  4YMB A;  1MY2 A;  1RYX A;  3G3I A;  3G3F A;  4LUB A;  4RPO A;  4YKJ A;  4FIM A;  3QAX A;  3IOT A;  5H8F B;  1S9T A;  4BDN A;  1JEU A;  4PE5 B;  3VDF A;  2I6E A;  4L17 A;  3S9N C;  1I6A A;  3KG2 A;  3SEY A;  1IXH A;  2R71 A;  3M3F A;  4TLM B;  3SDF A;  3K0V A;  5HBC A;  1DTG A;  1MM6 A;  2H5Y A;  4IO7 A;  4IO2 A;  1NKX A;  1SW1 A;  4PFU A;  4XIG Q;  1R9L A;  2W7Y A;  4LA9 A;  4G68 B;  4R2F A;  3IO6 A;  4OES A;  2UYF A;  3IAZ A;  1M5C A;  2QRY A;  3PPO A;  4FOR A;  4O3B A;  2OBG A;  4F18 A;  2RF1 A;  5I58 B;  1MM7 A;  1IZ1 A;  1XC1 A;  4OEU A;  1QUK A;  2XX7 A;  4R9G A;  5I56 A;  3U72 A;  2I3V A;  4E0W A;  5I84 A;  1NMU A;  3C31 A;  4H65 A;  4TOZ A;  2LAO A;  3HPI A;  4U1Z A;  1HSL A;  3TCG A;  3BKI B;  3OSQ A;  2Q89 A;  4OEV A;  2NUV A;  3GZG A;  3JYR A;  3N6U A;  5AE4 A;  3QYT A;  2RC9 A;  2DWH A;  5ICQ A;  1QKB A;  1LFI A;  2Q88 A;  3DEL B;  4NMY A;  4ZED A;  3PPQ A;  1P1N A;  1ZU0 A;  4G4P A;  4MF3 A;  1D4N A;  2ONR A;  1UTH A;  1FTM A;  3E4R A;  3KEI A;  2G93 A;  5H8Q B;  3FJG A;  4ZEF A;  1LFH A;  4LVQ A;  2D21 A;  3THI A;  1Y3N A;  3C34 A;  3O97 A;  3OD7 A;  3CG1 A;  3KJT A;  1MH4 A;  1OVT A;  5CMK A;  3K02 A;  3TEL A;  3HCQ A;  1B51 A;  1ELJ A;  1F9B A;  2B3F A;  4UA8 A;  3I6V A;  3T93 B;  3TCH A;  2QJE A;  2DOJ A;  5K2X A;  4ELP A;  1O63 A;  5AA2 A;  1ZMG A;  2HQ0 A;  4OFO A;  3U92 A;  3RLF E;  5L9O A;  4JWO A;  1FQF A;  5L8D A;  2A5S A;  4IO5 A;  3K01 A;  4RNS A;  4YIC A;  3K2D A;  4DLD A;  4JWX A;  2IEE A;  1AL3 A;  1HSE A;  2V84 A;  2XXY A;  3BBR A;  1B32 A;  4R74 A;  4NE4 A;  2NOO A;  4RJZ A;  3TQL A;  3PUV E;  1XOC A;  4OHN A;  5DEX B;  2RIN A;  1SYH A;  2V25 A;  1Y1M A;  1UTB B;  2VP1 A;  3CFZ A;  3KN8 A;  4R6H A;  4O3A A;  3PUW E;  3L6H A;  3TTK A;  1IXC A;  1MXU A;  4XKN A;  1L5T A;  1PC3 A;  2ESN A;  1NNT A;  2REG A;  2H9B A;  3VXC A;  3TTM A;  4GWO A;  5CC2 A;  5FHN A;  1IIW A;  5CMB A;  1MXX A;  4QFP A;  2I0B A;  1WOD A;  1MY1 A;  1BTJ A;  4MBP A;  4OEN A;  4RPN A;  1EZP A;  1P1W A;  3C9H A;  3K00 A;  1US4 A;  3FVN A;  3N5L A;  2BJJ X;  1N7W A;  4QRZ A;  3TYH A;  3B6T A;  1HSJ A;  2RCB A;  3DP6 A;  1JEV A;  4ELR A;  3EHT A;  2HFB A;  3K6W A;  3PPP A;  4NF8 A;  4U22 A;  5F7V A;  2RKM A;  4GXA A;  3PD9 A;  2QS4 A;  3CVG A;  3U93 A;  1B0L A;  3VLV A;  5CBS A;  4KYS A;  4EQB A;  1MDQ A;  4ELQ A;  3KGC A;  4EF2 A;  2Y84 A;  1P99 A;  1QUI A;  4KCC A;  5H8Q A;  3A3U A;  4XKR A;  2F7A A;  1MQD A;  2XXU A;  4WEP A;  5J1D A;  4I1D A;  1MQI A;  1NNF A;  2H98 A;  1USY H;  2RC7 A;  2XXQ A;  4NF4 A;  3O9P A;  1FCK A;  2XXV A;  5EHM A;  3PPR A;  2V3Q A;  3KOT A;  5TU0 A;  2ABH A;  2QL3 A;  4ESW A;  1OVB A;  2PT1 A;  4H8I A;  4Q0C A;  4PQJ A;  3VLU A;  1LST A;  3JV9 A;  4ZEI A;  3WAF A;  1MG1 A;  4HCY A;  4ESX A;  1OLC A;  5L9S A;  1Y1Z A;  1ZIU A;  2HAU A;  2RC8 A;  3B6Q A;  5CRY A;  5AA4 A;  5KCJ B;  4ONY A;  3V89 B;  2ZYO A;  1URS A;  2FYI A;  2VOZ A;  4EQ9 A;  1M5D A;  4KR5 A;  1JW5 A;  4DDD A;  4MH5 A;  1JET A;  1LCT A;  2Q2A A;  4IGR A;  4QSC A;  1TFA A;  4KYD A;  5H8F A;  3QUF A;  4NWC A;  5ICT A;  2OJT A;  2ZYK A;  3PUY E;  2Y7I A;  4OWD A;  5FTH A;  3CFX A;  3OSR A;  2AYS A;  1UTB A;  2DVZ A;  2PT2 A;  4GQO A;  3PUX E;  3H6V A;  2NWJ A;  3D4C A;  2Q8J A;  1S50 A;  3CI8 A;  3PU5 A;  5CM6 A;  1B5J A;  3FXQ A;  3KFM A;  4KPT A;  4DXU A;  1OQG A;  1FTO A;  1FQD A;  3UA8 A;  5TPA B;  2YJP A;  3B6W A;  4GL8 A;  2QS1 A;  3ZKK A;  1A40 A;  4E0X A;  5FTI A;  1MQJ A;  1N76 A;  1VFE A;  2O84 X;  3KBR A;  4NF6 A;  3I3V A;  4JB7 A;  4ZEC A;  3PD8 A;  2HCA A;  4H6D A;  1FTL A;  2X7P A;  4NF8 B;  5I57 B;  1DSN A;  5CMC A;  4H0W A;  3OEM A;  4Q30 B;  2GH9 A;  1LGB C;  5EYF A;  4IGT A;  2XXI A;  3FIR A;  4R75 A;  3DP4 A;  2A5T A;  4FE8 A;  3RT8 A;  1GGG A;  4JDF A;  2DE3 A;  3TPA A;  1YAE A;  5CBR A;  1I69 A;  3FGS A;  3MP1 A;  3I5O A;  1SDX A;  3IR1 A;  4NF4 B;  1PBQ A;  4YKP A;  4QHQ A;  4ZZE A;  3MZ9 A;  3T96 B;  5TP9 B;  1JVY A;  1NFT A;  3H3G A;  1A99 A;  1TFD A;  1KWH A;  4YB5 A;  4H1X A;  3HV1 A;  3ZS6 A;  4WXJ A;  1GR2 A;  4BDL A;  4OET A;  4H8J A;  1IEJ A;  1ZTY A;  2HZK A;  4YB7 A;  4YZZ A;  1Y3Q A;  4KQP A;  1UIV A;  2QS3 A;  5KCJ A;  3H6W A;  3PMX A;  3O29 A;  3Q27 A;  3VV5 A;  1ZBM A;  4TQU Q;  3LC8 A;  3TZA A;  4AB5 A;  1SQY A;  2E1S A;  5A5X A;  2ZNT A;  4ND9 A;  4BDQ A;  3V83 A;  4LZ8 A;  4F19 A;  4FEC A;  4FJP A;  4F29 A;  1MY3 A;  4C1T A;  1JW4 A;  1DPP A;  2DQV A;  4EUO A;  1TWY A;  2R6G E;  3OO9 A;  5DT6 A;  4AB6 A;  1A54 A;  2HAV A;  3LSL A;  2OK2 A;  5CMM A;  4ZEB A;  2HZL A;  4QF9 A;  3MW0 A;  3MVY A;  4ZEK A;  1LCF A;  5IKB A;  2PMS A;  3FUZ A;  5I2K B;  2DSF A;  1LFG A;  3TDJ A;  3CSB A;  2I3W A;  1I6B A;  3TTR A;  3SEX A;  2ZMB A;  1H43 A;  2QMX A;  1H3D A;  3H6U A;  4YB6 A;  2XXR A;  5H8S A;  4OXV A;  4JSD A;  3W9V A;  2DXR A;  3FVO A;  2Z23 A;  1VSO A;  3RUM A;  4JBZ A;  3TAJ A;  3N94 A;  1IIT A;  3IB0 A;  3CG3 A;  4NF6 B;  2B65 A;  2GRV A;  1DTZ A;  3RGY A;  2CMO A;  1OMP A;  3MUQ A;  3GXA A;  1B4H A;  2IA4 A;  3C32 A;  3IL1 B;  1DOT A;  4G2Z A;  1Y20 A;  2E0S A;  4O3C A;  4UAC A;  3TEP A;  4QFN A;  4BLA A;  1XVX A;  1MY4 A;  2DWA A;  3TOD A;  4F2O A;  1ZJL A;  3MWB A;  4YKK A;  2F78 A;  4F2Q A;  1QJM A;  2F6P A;  5HPQ A;  2XD2 A;  3E13 X;  4H5G A;  2Y7W A;  3K1M A;  3LUY A;  3IK6 B;  3MPK A;  4POX A;  2O51 A;  4NTL A;  1N3X A;  4EDP A;  2DS9 A;  3BFT A;  1T0K A;  3HST A;  4GVO A;  1LAG E;  3Q29 A;  1POT A;  4RY1 A;  1Z7M E;  2XXW A;  3HHF A;  5ITO A;  3USD A;  4NF5 A;  3IB2 A;  3KN3 A;  4YKI A;  1WDN A;  1B3H A;  3OMB A;  2XXX A;  5CI5 A;  5AA1 A;  3S9E A;  3KN7 A;  1IXI A;  1P1O A;  4LQ5 A;  4QSE A;  1P1Q A;  2F36 A;  4YMA A;  3DM0 A;  2VD2 A;  4OER A;  4I62 A;  2QPQ A;  1LB8 A;  3MQ9 A;  2D5W A;  4F39 A;  1B3G A;  1B46 A;  4G8N A;  2FA7 A;  3R7X A;  3OEN A;  2D3I A;  4IO3 A;  2Z8F A;  1PB9 A;  3WAE A;  5ITP A;  3MVX A;  1POY 1;  5AA4 B;  1GTK A;  1ATG A;  2THI A;  1B7Z A;  4XXU A;  4Z0I A;  1N0T A;  3UK4 A;  2UVH A;  5DEX A;  1JNF A;  3IO4 A;  1AIV A;  1YTV A;  1SW4 A;  3B7D A;  3S4U A;  1AH5 A;  2ALU A;  3K1N A;  4G8M A;  1AMF A;  1B3F A;  1FQB A;  4BDO A;  2UXA A;  3FAS A;  1Y3P A;  1B3E A;  2Z22 A;  3GBB A;  2X7Q A;  1NNP A;  2P2A A;  4LZ5 A;  4YAH X;  3IB1 A;  4P11 A;  2O6A A;  3H4Z A;  1AOV A;  2G29 A;  3N6T A;  1M5E A;  5M2V A;  3TMG A;  1PBP A;  3QUJ A;  4GXS B;  1SI0 A;  4EQ7 A;  4PFY A;  2F35 A;  1B05 A;  2XXH A;  3T9X B;  3VVF A;  4EXK A;  1O64 A;  4JSO A;  1Y4T A;  1PB7 A;  1NH7 A;  2GHB A;  3EF7 A;  4POW A;  5TPA A;  3RN8 A;  3OXN A;  1LAX A;  2ZYN A;  3A09 A;  1B4Z A;  3OO6 A;  1DPE A;  1D3K A;  3K6X A;  3T9H B;  4F3G A;  5I56 B;  2XHD A;  3GLB A;  4MFI A;  1B40 A;  1B52 A;  1MQG A;  3RY3 A;  3FJM A;  3MC2 A;  2Z8E A;  1D9V A;  2X26 A;  5JK4 A;  2AL5 A;  4G77 A;  2OCU A;  4ZE9 A;  2FNC A;  3ILU B;  5I2N B;  5DYH A;  2H25 A;  3MZB A;  4C0R A;  4X1D A;  4KCD A;  3KZG A;  4DCX A;  1UQW A;  3QK6 A;  1VR5 A;  4HS7 A;  2QS2 A;  3RTF B;  5H8H A;  3UGW A;  1BKA A;  1MXZ A;  4H67 A;  4RK2 A;  1A55 A;  4X1B A;  3T9U A;  4Q5T A;  1LAH E;  4QFK A;  2B3B A;  2CZL A;  4PFW A;  5H8H B;  5H8N B;  3JZJ A;  2F7C A;  2P0S A;  4GF8 A;  4F1U A;  3O28 A;  4NWD A;  3MVW A;  2HXW A;  5H8N A;  4DXC A;  3ZSF A;  2PYY A;  4PFT A;  3UIF A;  1B0H A;  3RTW B;  1M5B A;  3H06 B;  4HCW A;  4XKP A;  5DVF A;  4OYV A;  4N6P A;  2VD3 A;  1JVX A;  1ZLQ A;  4OMB A;  3FV1 A;  4U1O A;  4X48 A;  1SW2 A;  2WKY A;  1MY0 A;  3FXU A;  4HW8 A;  4MLV A;  3O66 A;  2VHA A;  1O7T A;  4GFR A;  1N84 A;  4RXL A;  5I59 B;  2UYE A;  3FVG A;  3QSL A;  5FHO A;  4RK9 A;  3IJX B;  4JXI A;  1EZ9 A;  1ZKB A;  3OEL A;  1LBB A;  4KI0 E;  1FTK A;  3VE1 B;  4FED A;  5I59 A;  4LON B;  3K1P A;  4YU0 A;  2I48 A;  1B6H A;  5JTY A;  5AA2 D;  2I4C A;  2PX1 A;  3OEK A;  1SI1 A;  1FQC A;  4HTG A;  3VXB A;  3UP9 A;  4KD5 A;  1QKA A;  1A8E A;  4P0G A;  3OO7 A;  1R1N A;  3LSX A;  1SD3 A;  1RKM A;  4DXB A;  4OQO A;  3MZ1 A;  3P7I A;  2RCA A;  1FTJ A;  3HHG A;  3IOV A;  4Q8R A;  2I0C A;  1US5 A;  4IB2 A;  2ANJ A;  1IXG A;  4ISU A;  1MPD A;  4R9F A;  2F97 A;  1BLF A;  1MRP A;  3TCF A;  1M5F A;  5I57 A;  1LB9 A;  4QFL A;  5DTB A;  1MPC A;  1DMB A;  3HO7 A;  1N7X A;  3FAT A;  3U94 A;  5KDT B;  4OTE A;  1MXY A;  1IUD A;  1JQF A;  2Q9T A;  1QUJ A;  3DP8 A;  3FXR A;  3PUZ E;  3R26 A;  4I8C A;  4OFJ A;  4OZ9 A;  1UTH B;  4R73 A;  4XKQ A;  4MLQ A;  3RQT A;  1EZO A;  4X9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...