3RUMA

New strategy to analyze structures of glycopeptide antibiotic-target complexes
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
376
structure length
375
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAAAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/antibiotic
molecule keywords Maltose-binding periplasmic protein
publication title A carrier protein strategy yields the structure of dalbavancin.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 118
structure length 375
sequence length 376
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3rumA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3rumA01
3PPNA 1TFDA 4NTLA 3RN8A 3TFLA 3UIFA 4DCXA 5CMMA 2DXRA 3THIA 3EPEA 1Q1KA 4YAHX 5I2KB 4IO7A 3C32A 1UIVA 5AA2B 1Y1ZA 2XXRA 1B7HA 4QSCA 4O3BA 4MLVA 4QFLA 2M8CA 5I84A 4NWDA 3S2VA 1MH4A 3C9HA 1Y9UA 2QS4A 1OMPA 2Q2AA 3L6HA 3QUFA 4F3GA 3TCFA 2I0CA 2HQ0A 3DELB 5AA2D 2NOOA 1MXXA 1B05A 5FTIA 4I1DA 4POWA 1SW1A 4OWDA 3V89B 1Y4CA 1IXGA 3SEYA 3TZAA 3VE1B 3O2AA 3IB2A 2OWSA 3PD8A 5I2NA 1QVSA 2RCBA 1B4ZA 5HBCA 4U4SA 4GIZA 2PBWA 3OO6A 2XXQA 4R72A 3V83A 3E4RA 3T66A 3U93A 5KZTA 4FATA 2QS3A 1BKAA 2B3BA 3SEUA 2PX1A 4RJZA 5L9MA 1SW5A 5TPAB 1N04A 1P1QA 1SQYA 4KCCA 4DLDA 1MXZA 1OQHA 3O28A 2DVCA 3D4CA 5H8NB 5H8HB 5AA4B 2RF1A 4OTEA 1OQGA 4RY1A 1VSOA 3IOUA 3ODBA 3OENA 3FZVA 3S9LC 3FASA 1EU8A 2DYXA 4YKJA 5I59A 4WXJA 4F2OA 4AQ4A 4ZECA 3BFTA 4DCYA 3PUVE 1T0KA 5K2XA 1S50A 4YB6A 5DVFA 5FHMA 4BDMA 5CRYA 2I58A 4EXKA 2REGA 4EQBA 1B7UA 4TOZA 2ZYNA 3KEIA 3PPOA 2R71A 1P1NA 1AOVA 5FTHA 2Q2CA 3O6GA 3VXBA 3T9UA 4ZEIA 1QW0A 1MQIA 3KN7A 3UA8A 3O6HA 4POXA 3TDJA 3PMWA 3FXQA 3T9XB 1B3LA 3OMBA 2HFBA 3IJXB 2KLFA 4E0WA 3O66A 3RLFE 1LFHA 3GXAA 3U92A 1JNFA 4P0IA 1SYIA 4MFIA 2FA7A 3PUZE 3B6TA 4HTGA 3DP6A 1B5JA 4XTCQ 5CI5A 3TTKA 1NFTA 1H76A 4IO3A 1B3HA 1QKBA 3N5LA 2V25A 2CMOA 1NNPA 3EN3A 3M3LA 2I3WA 2AL4A 3Q28A 2I6EA 4G4PA 1RKMA 1POY1 2I48A 4YB7A 1BIYA 1FQCA 4GL8A 4R6KA 1GGGA 5I2KA 3FD3A 1A40A 1O7TA 2XD3A 2HAUA 5AA2A 3FVGA 2YPNA 3FIRA 5ISUA 1QJMA 4F3SA 5ELVA 2F97A 1MDP1 5HPQA 3OO9A 3TKDA 4OFJA 3KZGA 3R7XA 1B3EA 1Q35A 4N6PA 1HSEA 3V5AA 3I5OA 2WKYA 1BP5A 3CIJA 2I49A 4L17A 1NKXA 2ZMBA 4IO4A 4G2ZA 1FTJA 1YTVA 2Q88A 1D3KA 2NUVA 3QSLA 4XKNA 4OXVA 3C31A 3CVGA 3K6VA 3IX1A 3FXUA 2O51A 1TT1A 1Z7NE 4IY5A 2ESNA 2ABHA 2I3VA 2VHAA 4ESXA 4M4GA 1LSTA 3MC2A 4MF3A 2A5TB 4BDQA 5TPAA 3KFMA 4GQOA 4EQ9A 5B70A 2Z22A 3BBRA 1OLCA 4R75A 4F1UA 1PBPA 3LSLA 2DXYA 4R73A 4LQ2A 5H8HA 4JDFA 3OSQA 5AA4A 2XXWA 1DSNA 3H6WA 4JWYA 4ZZAA 3LBSA 3GZGA 4LONB 1SW4A 4F19A 4NEDA 2ONKE 1USYE 4F2QA 4Z7EA 4X1DA 3IJOB 2X7QA 1GTKA 4KFQA 2HEUA 3PU5A 5L9SA 3MW0A 1UIUA 4ELQA 3QIMA 4N13A 4ELOA 1FTOA 4FJPA 3H7MA 1NH7A 3O29A 2X7PA 4G8MA 4OYVA 3SERA 4RNSA 2QL3A 4BDOA 1YAEA 4KYEA 3FATA 1IZ1A 3ZSFA 3EF7A 2RC7A 1N0TA 4F22A 4X1BA 4LP2B 2GHBA 1M5EA 4ESWA 3A09A 1GVCA 3K0VA 4U4XA 1FQDA 4X9TA 4IO2A 1FQAA 4KD5A 3DLNA 3K1MA 3VVEA 1OLAA 1BTJA 3K6XA 2DQVA 2DS9A 3IL1B 4JWOA 2RKMA 1OIBA 1VR5A 4U2RA 4G68C 2V3UA 2H99A 5IAIA 4RXLA 2FYIA 2W7YA 1P1WA 3HHFA 4G68B 3CSBA 4DXCA 2QS2A 3U72A 4NF8B 3KSXA 1Z7ME 4WEDA 1O64A 3DP4A 4KHZE 3KJTA 2P0SA 3TTRA 3U94A 1SVXB 3CSGA 4ZE9A 3DP8A 2XX7A 2XXYA 4DXBA 2Y7RA 3KGCA 1FCKA 4HCWA 3KBRA 4JSOA 2XXTA 1URGA 2F7BA 3H3GA 2PVUA 1B58A 2B65A 3BKIB 1MDQA 4YKIA 5H8QB 1WODA 1GR2A 3WAEA 4UACA 4BDLA 1FTMA 1DPPA 3TTMA 1PDAA 2DP8A 5I56B 5H8SA 3ILTB 4EF2A 5J1DA 4MLQA 4YKKA 5JEIA 4XXUA 2OCUA 2XD2A 2IEEA 4PFYA 1IUDA 4LATA 4F3BA 3CG3A 1FQBA 2RC9A 3B7DA 4KR5A 4R6YA 2NVUB 3BFUA 1WVJA 3UGWA 3FVOA 4PFTA 5F7VA 3RPWA 5FHNA 2ZNTA 5I57B 2Q89A 2R6GE 5IKBA 1EZPA 1ZTYA 4H8IA 2GHAA 2CZLA 3TQWA 2X26A 3MVWA 1DOTA 4XKRA 3OOAA 4PFWA 2Y7WA 1LB9A 4ELPA 1MM6A 4R6HA 2F36A 3E3KA 1NH8A 1GV8A 3TTNA 2IA4A 3T22A 4QFPA 3PPPA 1MG1A 4H6DA 2ZNSA 4KPTA 4NF5B 1P99A 1B7ZA 2YLNA 3C4MA 1JQFA 3PPRA 4U1OA 4ZZEA 4BDNA 2R9JA 1FTLA 5M2VA 3S9EA 5BWJA 3FGSA 3PUXE 1SI0A 3B6QA 1L5TA 5AA3A 2H25A 2DWIA 2QJEA 4XIGQ 4R74A 1I6AA 3C36A 3C35A 3FV1A 2ZYMA 4OETA 1QUIA 2ZYOA 3G3IA 3HHGA 2I4CA 4FORA 5FHOA 5L9OA 1XT8A 2GFEA 3IOVA 1MY2A 1SW2A 2F5XA 1PBQA 3IR1A 1UQWA 4FIMA 1Y1MA 4R9FA 1SI1A 2DWJA 1MXVA 4QSDA 5I58B 5EYFA 3MP8A 4G68A 3VFJA 4NF8A 3TTLA 5TU0A 1PC3A 3QK6A 1IIWA 3F11A 1MQJA 1MY0A 1MXWA 2VGQA 2DWAA 3KSJA 4KCDA 1US4A 1A8EA 1LCFA 3CRBA 2G29A 2VOZA 1QUJA 1FW0A 3USDA 1IXCA 1B1HA 2OZZA 4NF4A 2H5YA 4OHNA 1QUKA 3FJMA 1XVYA 5H8QA 4QHQA 4ZE8A 3VLUA 4EF1A 1A54A 3SEVA 3TEPA 4HCYA 4KYDA 5I56A 1JW1A 5LOMA 1N3XA 2REJA 2F7CA 1CB6A 3CG1A 3SEXA 1B4HA 4GD5A 5ITPA 3G3GA 3TYHA 1I6QA 5DTBA 3EHSA 2QMXA 2DE3A 1B6HA 1URSA 5CMBA 4Q5TA 3PMXA 1FTKA 4JSDA 2Z23A 2P1SA 3HSTA 2UVHA 4LUBA 2O1MA 2PT2A 1B9JA 1XOCA 1S7YA 3TMGA 1J1NA 4F3PA 4U21A 4QFNA 4QFKA 3TELA 2HZLA 1NMUA 1MM7A 4X48A 1A8FA 2E0SA 2O7IA 4N07A 3MZBA 1R9QA 4XKQA 5L8DA 3KJ7A 1EZ9A 2Y84A 3C33A 1P1OA 3P7IA 1ZKBA 3K01A 2XXPA 1D4NA 1ATGA 3MPLA 5CM6A 1ZBMA 1AH5A 3RQTA 1F9BA 2F8DA 3E13X 1LAHE 3WAFA 1VFEA 1CE2A 1TFAA 5HM4B 2AYSA 4C1TA 1R1NA 4NWCA 5H8NA 1B5IA 4R2BA 4OEUA 3EHTA 3MPKA 2RC8A 3K02A 3T9HB 1B46A 4FE8A 3RY3A 3OO7A 2UVGA 3IOTA 4Z0IA 4LZ8A 2ZXTA 1A7LA 4DIGA 4NE4A 2XX9A 3W9VA 2I0BA 3H6UA 2F34A 3VLVA 1D9YA 2ZNUA 3QAXA 2V3QA 4H67A 1TXFA 4GF8A 1UTBB 3RGYA 3K1PA 4P0GA 1EZOA 5ICTA 2XX8A 1ZU0A 1NL5A 1MXYA 5I58A 4H8JA 4JB7A 4FAJA 1ZMGA 4LQ5A 3M3KA 4RA1A 1MPCA 5JK4A 1AIVA 4XKPA 3PV0E 3JYRA 1OVBA 1DTGA 5AA1A 3VVDA 3KOTA 1B1XA 3TODA 2XXXA 1B32A 1B3FA 3TAJA 1A55A 4E0XA 3MJNA 2Z8DA 3T93B 3G3JA 3IB1A 1N76A 3W15C 2B3FA 3PUWE 4M1VA 2QS1A 2UVIA 4YZZA 4TLLB 3HO7A 4GXAA 5DEXB 2VD2A 4QF9A 4FEDA 1MS7A 5KCJB 1NNKA 1LGBC 3ZKLA 2D3IA 4F1YA 4DDDA 1I6BA 4U22A 3PGFA 1Y3PA 2Z8EA 5H8FB 5KDTB 5AE4A 3CFZA 1R6ZA 1B3GA 4LZ5A 1N3WA 2O84X 3T9VA 4ZEBA 4QFOA 1M5FA 3OSRA 4EXLA 4YICA 3FJ7A 2NWJA 3LC8A 3MP6A 2V84A 4ZEDA 5CMKA 3SETA 2Z8FA 3RT8A 1MQGA 3G3HA 4LZ7A 3RUMA 2V3TA 1B5HA 1JETA 1I69A 2V93A 4ZEKA 3UK4A 2OBGA 4RYAA 4ISUA 4ND9A 1UTHB 5K2YA 3QYTA 5CBRA 1XHYA 1B52A 3HPIA 1XC1A 1US5A 4IB2A 3SDFA 3ZS6A 1LFIA 3G3KA 3SESA 2DOJA 3SEWA 2D5WA 4R9GA 3IORA 2AL5A 4ELRA 4ONYA 2THIA 3N6TA 1SD3A 2A5TA 3N6UA 2H98A 2Y7IA 3N26A 2H9BA 3KN3A 4P11A 3L6GA 2FNCA 2D21A 1LLSA 2F6GA 3OEKA 2GRVA 4IO6A 2XXIA 3G3FA 2H4IA 2XXUA 1EH3A 3MZ1A 3TUSA 2VD3A 5CBSA 3CI8A 3FVKA 4LA9A 4OESA 1LCTA 3GLBA 2XXVA 1RYOA 4H1XA 1SDXA 2PMSA 1VE4A 4ZS9A 4Q0CA 2PT1A 2RCAA 3ZKKA 3IOWA 4GOTA 5TP9B 4G8HA 3A3CA 3S9NC 3MVZA 4H0WA 1B2HA 4ECFA 1D9VA 4YKPA 3IB0A 1UTBA 3LSWA 4BDRA 1TWYA 2O6AA 4TLMB 1IEJA 1M5DA 3C34A 4KI0E 1B0HA 4YB5A 1PB9A 4ZEFA 1II5A 1JVYA 4H65A 1JVXA 3UP9A 4MBPA 1NNTA 4GVOA 4IY6A 4F1VA 3VVFA 4QRZA 2E1SA 3O9PA 3H03A 4LVQA 3OEMA 4H5FA 4FEBA 1MH3A 4YU0A 1DMBA 4OMBA 2DE2A 4I9DA 4PQJA 5A5XB 3B6WA 3N94A 1JEVA 1VFDA 5B7DA 1M5BA 5DEXA 4EUOA 2DVZA 4F39A 3S9MC 1H43A 4EQ7A 5KCJA 4Q30B 4GWOA 1LAGE 2HCAA 2QSXA 3IK6B 4OERA 2OJTA 1URDA 1N7XA 4NF6B 2ANJA 1JEUA 3RTFB 5H8FA 1MPDA 2F78A 5KDTA 3RTWB 3HV1A 3QXMA 3K6WA 3Q27A 4R2FA 1HSJA 1MY1A 4F31B 3V8XB 1IXIA 1H45A 4ZDMA 4G77A 1QKAA 1LBBA 4IGTA 4DXUA 3UN6A 2LAOA 1FQFA 1JW4A 3TCHA 4U1ZA 4G8NA 4GXSB 2P2AA 5BUUA 4GFRA 4HW8A 3GBAA 1BLFA 3I6VA 1AMFA 1B0LA 2A5SA 3VLWA 1XVXA 4EDPA 2OK2A 1N84A 1IQ7A 3R26A 4HS7A 1UTHA 4WEPA 4Q8RA 4PE5B 3MUQA 1IXHA 4THIA 3PD9A 3PPQA 3M3FA 1H44A 2UYEA 1P1UA 3JV9A 3ECRA 5EHSA 4H5GA 2O7UA 5EHMA 4PFUA 3TPAA 4OVJA 3VXCA 4JXIA 1N7WA 2ZYKA 2G93A 1PEBA 3VDFA 2OLBA 1RYXA 1MQHA 3KG2A 4IGRA 3H4ZA 2Q9TA 3MVYA 2OWTA 5DVJA 4YMBA 5JTYB 3LSXA 2F35A 3OELA 4TQUQ 2UXAA 3ILUB 2DSFA 3IO6A 2Y7PA 3U1OA 1ZLQA 3IAZA 3U8QA 2RINA 5I57A 3K1NA 3R6UA 4RPNA 2BJJX 3RT6B 1LBCA 5ICQA 2F6PA 4MH5A 3MP1A 2I4BA 3I3VA 3FJGA 3UORA 1H3DA 1QULA 1Y3NA 4OFOA 3RNNA 4AB5A 4QSEA 4OQOA 5TP9A 1LB8A 3IO4A 4U23A 1ZJLA 3JZJA 3OO8A 4O3AA 1O63A 1SYHA 1IITA 4OZ9A 3LUYA 4I8CA 1B40A 4DZ1A 4FECA 1Y4TA 3K00A 3M8UA 4K3FA 1A99A 4NF5A 1NNFA 3MAMA 2HAVA 4UA8A 2HZKA 1FQEA 4C0RA 3PUYE 2PYYA 2AIXA 1B51A 3K2DA 1Y20A 3H06B 4YMAA 4I62A 3TQLA 1YPNA 1ELJA 1SBPA 3MBPA 1LAFE 3EHUA 4WKMA 1POTA 4GLIA 4PP0A 5A5XA 2Y7KA 1LFGA 4DE8A 2DWHA 3LSFB 4RPOA 3CFXA 5I2NB 3MQ9A 4O3CA 5F1QA 2XHDA 3KOSA 3MWBA 2O1LA 4BLAA 5ITOA 3K6UA 2VP1A 4F29A 2UVJA 4NF6A 5DT6A 3T96B 3CFLA 5CC2A 3W9WA 1MY4A 1USYH 1YCJA 2NXOA 1S9TA 3Q25A 2HXWA 1WDNA 3FV2A 3KN8A 3PMVA 2XXHA 4RK2A 3Q26A 3GBBA 3O97A 3FVNA 3EQ1A 3HN0A 4GL0A 4RK9A 3MZ9A 3A3UA 4JBZA 4NMYA 3FXRA 4C1UA 1MY3A 4OENA 4AB6A 4F18A 3FUZA 4IO5A 2Q8JA 4GRKA 1ZIUA 2O69A 2O68A 5I59B 3D4GA 2F7AA 3OD7A 1ANFA 2QPQA 3S4UA 1PB8A 3VV5A 4KQPA 4PETA 3E9XA 1R9LA 2QRYA 1DTZA 1HSLA 1LAXA 3H6TA 1MPBA 2ONRA 3AXFA 2ALUA 1MQDA 5DVIA 1DPEA 3CR9A 2YJPA 1MXUA 1Y3QA 5CMCA 3H6VA 1JW5A 1PB7A 1XS5A 1M5CA 4KYSA 1MRPA 4JWXA 3Q29A 1KWHA 3O6IA 1AL3A 5JTYA 3QUJA 5DYHA 2ONSA 1OVTA 3MVXA 3SKPA 2UYFA 4OFLA 3ONMA 3HCQA 2DE4A 3OXNA 3G7WA 4OEVA 3DM0A 4NF4B 3LR1A 3TCGA 2QMWA 3K4UA 2GH9A
chains in the Genus database with same CATH superfamily
3PPNA 1TFDA 4NTLA 3RN8A 3TFLA 3UIFA 4DCXA 5CMMA 2DXRA 3THIA 5I3SA 3EPEA 1Q1KA 4OVQA 4YAHX 5I2KB 4IO7A 3C32A 1UIVA 3U65A 5AA2B 1Y1ZA 1NV1A 2XXRA 1B7HA 4QSCA 4O3BA 4MLVA 4QFLA 2M8CA 5I84A 4NWDA 4N91A 3S2VA 1MH4A 3C9HA 1Y9UA 2QS4A 1OMPA 2Q2AA 3L6HA 3QUFA 4F3GA 3TCFA 2I0CA 2HQ0A 3DELB 5AA2D 3E79A 2NOOA 1MXXA 1FPFA 1B05A 5FTIA 4I1DA 4POWA 1SW1A 4OWDA 3V89B 1Y4CA 4MHFA 1IXGA 4PF8A 3SEYA 3TZAA 5LDZA 3VE1B 5J16A 3O2AA 3IB2A 2OWSA 3PD8A 5I2NA 1QVSA 2RCBA 1B4ZA 4HE2A 5HBCA 4U4SA 5ESYA 4GIZA 2V4CA 2PBWA 3OO6A 2XXQA 4P3LA 1FTAA 4R72A 2VPOA 3V83A 3E4RA 3T66A 3U93A 5KZTA 4FATA 2QS3A 1BKAA 2B3BA 3SEUA 2PX1A 4RJZA 5L9MA 1NUWA 1SW5A 5TPAB 1N04A 1P1QA 1SQYA 4N6DA 4KCCA 4DLDA 1MXZA 1OQHA 3O28A 2DVCA 3D4CA 5H8NB 5H8HB 5AA4B 4DI3D 2RF1A 4OTEA 1OQGA 4RY1A 2XA5A 1VSOA 3IOUA 3ODBA 3OENA 3FZVA 5DW8A 3S9LC 3FASA 1EU8A 2DYXA 4YKJA 5I59A 4WXJA 4F2OA 4AQ4A 4ZECA 3BFTA 4DCYA 3PUVE 1T0KA 5K2XA 1S50A 5T3JA 4YB6A 4MNIA 5DVFA 5FHMA 4BDMA 5CRYA 2I58A 1FSAA 4OVTA 4EXKA 2REGA 4EQBA 1B7UA 4TOZA 2ZYNA 3KEIA 1JP4A 2HXRA 3PPOA 2R71A 3SZPA 1P1NA 4NHBA 1AOVA 5FTHA 2Q2CA 3O6GA 4AS5A 3VXBA 3T9UA 4ZEIA 2PFZA 1QW0A 1MQIA 3KN7A 3UA8A 3O6HA 4POXA 3TDJA 3PMWA 3FXQA 3T9XB 1B3LA 2F3BA 3OMBA 2HFBA 3E78A 3IJXB 2KLFA 4E0WA 3O66A 4MNPA 3RLFE 1LFHA 3GXAA 1FPDA 3U92A 1JNFA 4MAGA 2QVUA 4P0IA 1SYIA 4MFIA 2FA7A 3PUZE 2FHYA 3B6TA 4HTGA 2CEYA 3DP6A 1B5JA 4XTCQ 5CI5A 3TTKA 1NFTA 1H76A 4IO3A 1B3HA 1QKBA 3N5LA 3T0JA 2V25A 2CMOA 1NNPA 3EN3A 3M3LA 2B4MA 2I3WA 2AL4A 3Q28A 2I6EA 4G4PA 2Q74A 1RKMA 1POY1 2I48A 4YB7A 1BIYA 1FQCA 4GL8A 4R6KA 1GGGA 1FPIA 5I2KA 3B50A 3FD3A 1A40A 1O7TA 2XD3A 2HAUA 5AA2A 3FVGA 2YPNA 3FIRA 2OX3A 5ISUA 1QJMA 4F3SA 5ELVA 1K9ZA 2F97A 1MDP1 5HPQA 3OO9A 3RYDA 3TKDA 4OFJA 3KZGA 3R7XA 1LBWA 1B3EA 1Q35A 2WBDA 4N6PA 1FBEA 1HSEA 1CNQA 3V5AA 3I5OA 4PBQA 2WKYA 4OVPA 4MCOA 1BP5A 3CIJA 2I49A 4IO4A 4L17A 1NKXA 2ZMBA 4NG7A 4G2ZA 1FTJA 5EQ9A 2Y5LA 1YTVA 2Q88A 4MMPA 1D3KA 2NUVA 3QSLA 4XKNA 4OXVA 3C31A 3CVGA 4PBHA 3K6VA 3IX1A 3FXUA 2O51A 1RDYA 1TT1A 1Z7NE 4IY5A 2ESNA 1NV7A 4DI4B 2FVZA 2Q8MA 2ABHA 2I3VA 2VHAA 4ESXA 4M4GA 1LSTA 3MC2A 4MF3A 2A5TB 4BDQA 5TPAA 3KFMA 5EQ8A 2QVVA 1FPLA 4GQOA 4EQ9A 5B70A 4P56A 2Z22A 3BBRA 1OLCA 4R75A 4F1UA 1PBPA 3LSLA 1DBZA 2DXYA 4R73A 4LQ2A 5H8HA 4JDFA 3OSQA 5AA4A 2XXWA 3QMFA 1LBVA 1DSNA 3H6WA 4JWYA 4ZZAA 3LBSA 3GZGA 4LONB 1SW4A 4F19A 4NEDA 2ONKE 1USYE 4F2QA 4Z7EA 2P3VA 4X1DA 3IJOB 3D1RA 2X7QA 4PAFA 1GTKA 4KFQA 2HEUA 3PU5A 5L9SA 3MW0A 1UIUA 4ELQA 1YXIA 3QIMA 4N13A 4ELOA 1FTOA 4FJPA 3H7MA 1NH7A 2JJKA 3O29A 2X7PA 4G8MA 4OYVA 4PDHA 3SERA 4RNSA 2QL3A 4BDOA 1YAEA 4KYEA 3FATA 2DDKA 3KBZA 1IZ1A 3ZSFA 1FJ6A 4N8GA 4PFRA 3EF7A 2HHMA 2RC7A 1N0TA 4F22A 1FPJA 4X1BA 4LP2B 2GHBA 4XFEA 1M5EA 4ESWA 3A09A 1GVCA 3K0VA 4U4XA 1FQDA 4X9TA 1FBGA 4IO2A 1FQAA 4N4UA 4KD5A 3DLNA 3K1MA 3VVEA 1OLAA 1BTJA 3K6XA 2DQVA 2DS9A 3IL1B 4JWOA 3IFCA 2RKMA 1OIBA 1VR5A 4U2RA 3A29A 4G68C 4PTKA 2V3UA 2H99A 5IAIA 4RXLA 2FYIA 2W7YA 3IFAA 1NUYA 1P1WA 3HHFA 4G68B 3CSBA 4DXCA 2QS2A 3U72A 4NF8B 3KSXA 1Z7ME 4WEDA 1O64A 3DP4A 5IZ3B 4KHZE 3KJTA 2P0SA 3NOHA 3TTRA 3U94A 1SVXB 3CSGA 5ET7A 4ZE9A 3DP8A 2XX7A 2XXYA 4DXBA 1NV3A 2Y7RA 3KGCA 1FCKA 4HCWA 1NUZA 3KBRA 4JSOA 2XXTA 1URGA 2F7BA 4N8YA 1NV0A 3H3GA 2PVUA 1B58A 4P1LA 2B65A 3BKIB 4OVRA 1MDQA 4YKIA 5H8QB 1WODA 1GR2A 4NX1A 3WAEA 4UACA 4N81A 4BDLA 1FTMA 1DPPA 3LV0A 3TTMA 1PDAA 2DP8A 5I56B 5H8SA 3ILTB 4EF2A 5J1DA 4MLQA 4YKKA 5JEIA 4XXUA 2OCUA 2XD2A 1KZ8A 3ISPA 2IEEA 4PFYA 1FBPA 1IUDA 4LATA 4F3BA 3CG3A 1FQBA 2RC9A 3B7DA 4KR5A 4R6YA 2NVUB 4GBVA 3BFUA 1WVJA 3UGWA 1K9YA 2CZHA 3FVOA 4PFTA 5F7VA 3RPWA 5FHNA 2ZNTA 4MJOA 5I57B 2Q89A 2R6GE 5IKBA 1EZPA 1ZTYA 4H8IA 2GHAA 2CZLA 3TQWA 2X26A 3MVWA 1DOTA 4XKRA 3OOAA 4PFWA 2Y7WA 1LB9A 4OANA 1MM6A 4R6HA 4ELPA 2F36A 5A5LA 1EYKA 3E3KA 1NH8A 1GV8A 3TTNA 3FBPA 4O7IA 2IA4A 2Y5KA 3T22A 4QFPA 3PPPA 4IR8A 1MG1A 1RDZA 2CEXA 4H6DA 4PE3A 5FBPA 2ZNSA 4KPTA 4NF5B 4I3EA 1P99A 1B7ZA 1RDXA 2YLNA 3C4MA 1JQFA 4X8RA 3PPRA 4U1OA 4JVCA 2P3NA 4ZZEA 4BDNA 2QVRA 2R9JA 5F24A 1FTLA 5M2VA 3S9EA 5BWJA 3FGSA 3PUXE 1SI0A 3B6QA 1L5TA 5AA3A 2H25A 2DWIA 2QJEA 2XXKA 4XIGQ 4R74A 1I6AA 3C36A 3C35A 1D9QA 3FV1A 2ZYMA 4MEVA 3RPLA 4OETA 1QUIA 5IZZA 2ZYOA 3G3IA 3HHGA 2I4CA 4FORA 5FHOA 5L9OA 4PGPA 2XWKA 1XT8A 2GFEA 3IOVA 1MY2A 1SW2A 2F5XA 1VDWA 1EYJA 1PBQA 3IR1A 2MKZA 1UQWA 4FIMA 1DCUA 1Y1MA 4R9FA 1SI1A 4NAPA 2DWJA 1MXVA 4QSDA 5I58B 5EYFA 3MP8A 4GWSA 4G68A 3MYUA 4GWXA 3VFJA 4NF8A 3TTLA 5TU0A 1PC3A 2ZZXA 3QK6A 1IIWA 3F11A 1MQJA 1MY0A 1MXWA 4I40A 2VGQA 2DWAA 3KSJA 4KCDA 5IZ3A 1US4A 4PCDA 3FXBA 1A8EA 1LCFA 3CRBA 2G29A 2VOZA 1QUJA 2HPGA 4O94A 1FW0A 3USDA 1IXCA 2XWOA 1B1HA 2OWZA 2OZZA 4NF4A 4NGUA 2H5YA 4OHNA 4GWWA 1QUKA 3FJMA 1XVYA 5H8QA 4QHQA 4ZE8A 3VLUA 4EF1A 1A54A 5I5PA 4NQ8A 3SEVA 3TEPA 4PAKA 4HCYA 1FPBA 4KYDA 1JW1A 5I56A 5LOMA 1N3XA 2REJA 2F7CA 1CB6A 3CG1A 3SEXA 1B4HA 4GD5A 2CZIA 5ITPA 3G3GA 3TYHA 1I6QA 5DTBA 3EHSA 2QMXA 2DE3A 1B6HA 1URSA 5CMBA 4Q5TA 3PMXA 1FTKA 4JSDA 2Z23A 2P1SA 3HSTA 1IMEA 2UVHA 5EYHA 4LUBA 2O1MA 4PC9A 2PT2A 1B9JA 1XOCA 1S7YA 3TMGA 3PTYA 1J1NA 4JVDA 4NF0A 4F3PA 4U21A 4QFNA 4QFKA 3TELA 2HZLA 1NMUA 1MM7A 1BK4A 4X48A 1A8FA 2E0SA 4H46A 5EYGA 2O7IA 4N07A 3MZBA 1R9QA 4XKQA 5L8DA 4HE0A 3KJ7A 2PCRA 1EZ9A 2KR0A 2Y84A 3C33A 1P1OA 3P7IA 1ZKBA 4PF6A 1FPKA 3K01A 2XXPA 1D4NA 1ATGA 3MPLA 5CM6A 1ZBMA 4PFIA 1AH5A 4N17A 3RQTA 2FIEA 1F9BA 2KQZA 2F8DA 3E13X 1LAHE 3WAFA 1VFEA 1CE2A 1TFAA 5HM4B 2AYSA 4C1TA 1R1NA 4NWCA 5H8NA 2VPNA 1B5IA 4R2BA 4OEUA 3EHTA 3MPKA 2RC8A 1KA1A 3K02A 3T9HB 1B46A 4FE8A 3RY3A 4H45A 3KC0A 1NV4A 3OO7A 2UVGA 3IOTA 4Z0IA 4LZ8A 2ZXTA 1A7LA 4DIGA 4NE4A 2XX9A 1LBYA 4N6KA 4O8MA 3W9VA 4GX4A 2I0BA 3H6UA 3KC1A 2F34A 2ZZWA 3VLVA 1D9YA 2ZNUA 3QAXA 2V3QA 4H67A 1TXFA 4GF8A 1UTBB 3RGYA 3K1PA 4P0GA 1EZOA 5ICTA 2XX8A 4MX6A 1ZU0A 2FBPA 1NL5A 1MXYA 5I58A 4H8JA 4JB7A 4FAJA 1ZMGA 4LQ5A 3M3KA 4RA1A 1MPCA 5JK4A 1AIVA 4XKPA 1IMDA 3PV0E 1QGXA 3JYRA 1OVBA 1DTGA 5AA1A 3VVDA 3KOTA 1B1XA 3TODA 2XXXA 1B32A 1B3FA 3TAJA 1A55A 4E0XA 3MJNA 2Z8DA 3T93B 3G3JA 3IB1A 1N76A 1YZ0A 4G61A 3W15C 2B3FA 3PUWE 4M1VA 2QS1A 2UVIA 4YZZA 4TLLB 3HO7A 4GXAA 1NV6A 5DEXB 2VD2A 4QF9A 4FEDA 1MS7A 5KCJB 1NNKA 1LGBC 3ZKLA 2D3IA 4F1YA 4DDDA 1I6BA 4U22A 3PGFA 1Y3PA 3LUZA 2Z8EA 5H8FB 5ET5A 5KDTB 5AE4A 3CFZA 1R6ZA 5ET6A 1LBXA 1B3GA 1INPA 2GQ1A 4LZ5A 1N3WA 2O84X 3T9VA 4ZEBA 4QFOA 1M5FA 3OSRA 3T1BA 4EXLA 4YICA 3FJ7A 2NWJA 3LC8A 3MP6A 2V84A 4ZEDA 5CMKA 3SETA 2Z8FA 3RT8A 1MQGA 3G3HA 4LZ7A 3RUMA 2V3TA 1B5HA 1JETA 1I69A 2V93A 4ZEKA 3UK4A 3EKIA 2OBGA 4RYAA 1FBHA 4ISUA 4ND9A 1UTHB 3GYYA 1NV5A 5K2YA 3QYTA 5CBRA 1XHYA 1B52A 3HPIA 1G0IA 1XC1A 1US5A 4IB2A 3SDFA 3ZS6A 4P9KA 1LFIA 3G3KA 3SESA 2DOJA 3SEWA 2D5WA 4R9GA 3IORA 2AL5A 4ELRA 4ONYA 2THIA 3N6TA 1SD3A 2A5TA 3N6UA 2H98A 2Y7IA 3N26A 4QXDA 2H9BA 3KN3A 4P11A 3L6GA 2FNCA 2D21A 1LLSA 2F6GA 3OEKA 2GRVA 4IO6A 1FBCA 2XXIA 5IZ1A 3G3FA 2H4IA 2XXUA 1EH3A 3MZ1A 3TUSA 2VD3A 5CBSA 3CI8A 3FVKA 4LA9A 4OESA 1LCTA 3GLBA 2XXVA 1RYOA 4H1XA 1SDXA 2PMSA 1VE4A 4ZS9A 4Q0CA 2PT1A 2L5VA 2RCAA 4GX6A 1KA0A 3B8BA 3ZKKA 3IOWA 4GOTA 5TP9B 4G8HA 3A3CA 3S9NC 3MVZA 2ZZVA 4H0WA 1B2HA 4ECFA 1D9VA 4YKPA 3IB0A 1UTBA 3LSWA 4BDRA 1TWYA 2O6AA 4TLMB 1IEJA 4GX3A 1M5DA 3C34A 4KI0E 1B0HA 4YB5A 1PB9A 4ZEFA 1II5A 1JVYA 4H65A 1JVXA 3UP9A 4MBPA 1IMFA 1NNTA 4OA4A 4GVOA 4IY6A 1LBZA 2FIXA 3BIGA 4F1VA 3VVFA 4QRZA 2E1SA 3MSTA 2WX9A 3O9PA 4PFBA 3H03A 4LVQA 2BJIA 1FRPA 3OEMA 2QFLA 4H5FA 4FEBA 1MH3A 4YU0A 1DMBA 4OMBA 2DE2A 4I9DA 1FJ9A 4JVIA 4PQJA 2F3DA 5A5XB 3B6WA 3N94A 1JEVA 1VFDA 1FPEA 5B7DA 1M5BA 5DEXA 4EUOA 2DVZA 4F39A 3S9MC 1H43A 4EQ7A 5KCJA 4Q30B 4GWOA 1LAGE 2HCAA 5IGAA 1G0HA 2QSXA 3IK6B 4OERA 2OJTA 4GWYA 1URDA 1AWBA 1N7XA 4NF6B 2ANJA 1JEUA 4QBAA 4UABA 3RTFB 5H8FA 1MPDA 2F78A 5KDTA 3RTWB 3HV1A 3QXMA 3K6WA 3Q27A 1DK4A 4R2FA 1HSJA 2WEFA 1MY1A 4F31B 3V8XB 1IXIA 1H45A 4ZDMA 4G77A 5LTCA 1QKAA 1LBBA 4IGTA 4DXUA 3UN6A 2LAOA 1FQFA 1JW4A 4PGNA 2B4LA 4KXPA 3TCHA 4U1ZA 2WYPA 4G8NA 4GXSB 2P2AA 5BUUA 4GFRA 4HW8A 4P47A 3GBAA 1BLFA 3I6VA 1AMFA 1B0LA 2A5SA 3VLWA 1XVXA 4EDPA 1IMCA 2OK2A 1N84A 1IQ7A 3R26A 4HS7A 1UTHA 4GWUA 4WEPA 4Q8RA 4PE5B 3MUQA 1EYIA 1IXHA 4FBPA 4THIA 3PD9A 3PPQA 3M3FA 1H44A 2UYEA 1P1UA 3JV9A 3ECRA 5EHSA 4H5GA 2O7UA 5EHMA 4PFUA 3TPAA 4OVJA 3VXCA 4JXIA 1N7WA 2ZYKA 2G93A 1PEBA 3VDFA 2OLBA 1RYXA 1MQHA 3KG2A 4IGRA 3H4ZA 2Q9TA 3MVYA 2OWTA 5DVJA 4YMBA 5JTYB 4GWZA 3LSXA 2F35A 3OELA 4TQUQ 2UXAA 3ILUB 2DSFA 3IO6A 2Y7PA 2VT5A 3U1OA 1ZLQA 3BIHA 3IAZA 4GBWA 3U8QA 5IM2A 2RINA 5I57A 3K1NA 3HFUA 3R6UA 4XF5A 4RPNA 2BJJX 3RT6B 1LBCA 1NUXA 4XEQA 5ICQA 2F6PA 4MH5A 3MP1A 2I4BA 3I3VA 1NI9A 3FJGA 3UORA 1H3DA 1QULA 1Y3NA 2WYKA 1IMAA 4OFOA 3RNNA 4AB5A 4QSEA 4OQOA 5TP9A 1LB8A 3IO4A 4U23A 1ZJLA 3JZJA 4PDDA 3OO8A 4O3AA 1O63A 1SYHA 1IITA 4OZ9A 3LUYA 4I8CA 1B40A 4DZ1A 4FECA 1Y4TA 3K00A 3M8UA 4K3FA 1A99A 4NF5A 1NNFA 3MAMA 2HAVA 4UA8A 2HZKA 1FQEA 4C0RA 3PUYE 2PYYA 1LEVA 2AIXA 1B51A 3K2DA 1Y20A 4HE1A 4PAIA 3H06B 4YMAA 4I62A 3TQLA 1YPNA 1ELJA 1FPGA 2XWIA 1SBPA 3MBPA 1LAFE 3EHUA 4WKMA 1POTA 4GLIA 4PP0A 5A5XA 2Y7KA 1LFGA 4DE8A 2DWHA 3LSFB 4RPOA 3CFXA 5EQ7A 5I2NB 3MQ9A 4O3CA 5EQAA 5F1QA 2XHDA 3KOSA 3MWBA 2O1LA 5ITOA 4BLAA 3K6UA 2VP1A 4F29A 2UVJA 4NF6A 5DT6A 3T96B 3CFLA 5CC2A 3W9WA 1MY4A 1USYH 1YCJA 2NXOA 1S9TA 2PFYA 3Q25A 2HXWA 4P8BA 1WDNA 3FV2A 3KN8A 3PMVA 5ET8A 2XXHA 4RK2A 3Q26A 3GBBA 3O97A 3FVNA 3EQ1A 3HN0A 4GL0A 3ROJA 4RK9A 3MZ9A 3A3UA 4JBZA 4NMYA 3FXRA 4C1UA 1MY3A 4OENA 4AB6A 4F18A 3FUZA 4IO5A 2R8TA 3CHGA 2Q8JA 4GRKA 1ZIUA 2O69A 2O68A 1NV2A 5I59B 3D4GA 2F7AA 4OVSA 3OD7A 1ANFA 2QPQA 3S4UA 3RPLB 1PB8A 3VV5A 4KQPA 4PETA 3E9XA 1R9LA 2QRYA 4MNCA 4O7MA 1DTZA 2XWVA 1HSLA 1LAXA 2CZKA 4LN5A 3H6TA 1MPBA 2ONRA 3AXFA 2ALUA 4AS4A 1MQDA 5I7IA 5DVIA 1DPEA 3CR9A 2YJPA 1MXUA 1Y3QA 4NN3A 5CMCA 3H6VA 1JW5A 1PB7A 1XS5A 1M5CA 4KYSA 1MRPA 4JWXA 1IMBA 3Q29A 1KWHA 3O6IA 2WBBA 1AL3A 5JTYA 3QUJA 4I3YA 5DYHA 2ONSA 1OVTA 3MVXA 3SKPA 2UYFA 4OFLA 1Q9DA 1FBFA 4X04A 3ONMA 1XI6A 3HCQA 2DE4A 4P1EA 1FBDA 3OXNA 3G7WA 4OEVA 1YYZA 3DM0A 4HXVA 4NF4B 3LR1A 4N15A 3TCGA 2QMWA 3K4UA 2GH9A 1SPIA 4MIJA
chains in the Genus database with same CATH topology
3PPNA 1TFDA 4NTLA 3RN8A 3TFLA 3UIFA 4DCXA 5CMMA 2DXRA 3THIA 3EPEA 1Q1KA 4YAHX 5I2KB 4IO7A 3C32A 1UIVA 5AA2B 1Y1ZA 2XXRA 1B7HA 4QSCA 4O3BA 4MLVA 4QFLA 2M8CA 5I84A 4NWDA 3S2VA 1MH4A 3C9HA 1Y9UA 2QS4A 1OMPA 2Q2AA 3L6HA 3QUFA 4F3GA 3TCFA 2I0CA 2HQ0A 3DELB 5AA2D 2NOOA 1MXXA 1B05A 5FTIA 4I1DA 4POWA 1SW1A 4OWDA 3V89B 1Y4CA 1IXGA 3SEYA 3TZAA 3VE1B 3O2AA 3IB2A 2OWSA 3PD8A 5I2NA 1QVSA 2RCBA 1B4ZA 5HBCA 4U4SA 4GIZA 2PBWA 3OO6A 2XXQA 4R72A 3V83A 3E4RA 3T66A 3U93A 5KZTA 4FATA 2QS3A 1BKAA 2B3BA 3SEUA 2PX1A 4RJZA 5L9MA 1SW5A 5TPAB 1N04A 1P1QA 1SQYA 4KCCA 4DLDA 1MXZA 1OQHA 3O28A 2DVCA 3D4CA 5H8NB 5H8HB 5AA4B 2RF1A 4OTEA 1OQGA 4RY1A 1VSOA 3IOUA 3ODBA 3OENA 3FZVA 3S9LC 3FASA 1EU8A 2DYXA 4YKJA 5I59A 4WXJA 4F2OA 4AQ4A 4ZECA 3BFTA 4DCYA 3PUVE 1T0KA 5K2XA 1S50A 4YB6A 5DVFA 5FHMA 4BDMA 5CRYA 2I58A 4EXKA 2REGA 4EQBA 1B7UA 4TOZA 2ZYNA 3KEIA 3PPOA 2R71A 1P1NA 1AOVA 5FTHA 2Q2CA 3O6GA 3VXBA 3T9UA 4ZEIA 1QW0A 1MQIA 3KN7A 3UA8A 3O6HA 4POXA 3TDJA 3PMWA 3FXQA 3T9XB 1B3LA 3OMBA 2HFBA 3IJXB 2KLFA 4E0WA 3O66A 3RLFE 1LFHA 3GXAA 3U92A 1JNFA 4P0IA 1SYIA 4MFIA 2FA7A 3PUZE 3B6TA 4HTGA 3DP6A 1B5JA 4XTCQ 5CI5A 3TTKA 1NFTA 1H76A 4IO3A 1B3HA 1QKBA 3N5LA 2V25A 2CMOA 1NNPA 3EN3A 3M3LA 2I3WA 2AL4A 3Q28A 2I6EA 4G4PA 1RKMA 1POY1 2I48A 4YB7A 1BIYA 1FQCA 4GL8A 4R6KA 1GGGA 5I2KA 3FD3A 1A40A 1O7TA 2XD3A 2HAUA 5AA2A 3FVGA 2YPNA 3FIRA 5ISUA 1QJMA 4F3SA 5ELVA 2F97A 1MDP1 5HPQA 3OO9A 3TKDA 4OFJA 3KZGA 3R7XA 1B3EA 1Q35A 4N6PA 1HSEA 3V5AA 3I5OA 2WKYA 1BP5A 3CIJA 2I49A 4L17A 1NKXA 2ZMBA 4IO4A 4G2ZA 1FTJA 1YTVA 2Q88A 1D3KA 2NUVA 3QSLA 4XKNA 4OXVA 3C31A 3CVGA 3K6VA 3IX1A 3FXUA 2O51A 1TT1A 1Z7NE 4IY5A 2ESNA 2ABHA 2I3VA 2VHAA 4ESXA 4M4GA 1LSTA 3MC2A 4MF3A 2A5TB 4BDQA 5TPAA 3KFMA 4GQOA 4EQ9A 5B70A 2Z22A 3BBRA 1OLCA 4R75A 4F1UA 1PBPA 3LSLA 2DXYA 4R73A 4LQ2A 5H8HA 4JDFA 3OSQA 5AA4A 2XXWA 1DSNA 3H6WA 4JWYA 4ZZAA 3LBSA 3GZGA 4LONB 1SW4A 4F19A 4NEDA 2ONKE 1USYE 4F2QA 4Z7EA 4X1DA 3IJOB 2X7QA 1GTKA 4KFQA 2HEUA 3PU5A 5L9SA 3MW0A 1UIUA 4ELQA 3QIMA 4N13A 4ELOA 1FTOA 4FJPA 3H7MA 1NH7A 3O29A 2X7PA 4G8MA 4OYVA 3SERA 4RNSA 2QL3A 4BDOA 1YAEA 4KYEA 3FATA 1IZ1A 3ZSFA 3EF7A 2RC7A 1N0TA 4F22A 4X1BA 4LP2B 2GHBA 1M5EA 4ESWA 3A09A 1GVCA 3K0VA 4U4XA 1FQDA 4X9TA 4IO2A 1FQAA 4KD5A 3DLNA 3K1MA 3VVEA 1OLAA 1BTJA 3K6XA 2DQVA 2DS9A 3IL1B 4JWOA 2RKMA 1OIBA 1VR5A 4U2RA 4G68C 2V3UA 2H99A 5IAIA 4RXLA 2FYIA 2W7YA 1P1WA 3HHFA 4G68B 3CSBA 4DXCA 2QS2A 3U72A 4NF8B 3KSXA 1Z7ME 4WEDA 1O64A 3DP4A 4KHZE 3KJTA 2P0SA 3TTRA 3U94A 1SVXB 3CSGA 4ZE9A 3DP8A 2XX7A 2XXYA 4DXBA 2Y7RA 3KGCA 1FCKA 4HCWA 3KBRA 4JSOA 2XXTA 1URGA 2F7BA 3H3GA 2PVUA 1B58A 2B65A 3BKIB 1MDQA 4YKIA 5H8QB 1WODA 1GR2A 3WAEA 4UACA 4BDLA 1FTMA 1DPPA 3TTMA 1PDAA 2DP8A 5I56B 5H8SA 3ILTB 4EF2A 5J1DA 4MLQA 4YKKA 5JEIA 4XXUA 2OCUA 2XD2A 2IEEA 4PFYA 1IUDA 4LATA 4F3BA 3CG3A 1FQBA 2RC9A 3B7DA 4KR5A 4R6YA 2NVUB 3BFUA 1WVJA 3UGWA 3FVOA 4PFTA 5F7VA 3RPWA 5FHNA 2ZNTA 5I57B 2Q89A 2R6GE 5IKBA 1EZPA 1ZTYA 4H8IA 2GHAA 2CZLA 3TQWA 2X26A 3MVWA 1DOTA 4XKRA 3OOAA 4PFWA 2Y7WA 1LB9A 4ELPA 1MM6A 4R6HA 2F36A 3E3KA 1NH8A 1GV8A 3TTNA 2IA4A 3T22A 4QFPA 3PPPA 1MG1A 4H6DA 2ZNSA 4KPTA 4NF5B 1P99A 1B7ZA 2YLNA 3C4MA 1JQFA 3PPRA 4U1OA 4ZZEA 4BDNA 2R9JA 1FTLA 5M2VA 3S9EA 5BWJA 3FGSA 3PUXE 1SI0A 3B6QA 1L5TA 5AA3A 2H25A 2DWIA 2QJEA 4XIGQ 4R74A 1I6AA 3C36A 3C35A 3FV1A 2ZYMA 4OETA 1QUIA 2ZYOA 3G3IA 3HHGA 2I4CA 4FORA 5FHOA 5L9OA 1XT8A 2GFEA 3IOVA 1MY2A 1SW2A 2F5XA 1PBQA 3IR1A 1UQWA 4FIMA 1Y1MA 4R9FA 1SI1A 2DWJA 1MXVA 4QSDA 5I58B 5EYFA 3MP8A 4G68A 3VFJA 4NF8A 3TTLA 5TU0A 1PC3A 3QK6A 1IIWA 3F11A 1MQJA 1MY0A 1MXWA 2VGQA 2DWAA 3KSJA 4KCDA 1US4A 1A8EA 1LCFA 3CRBA 2G29A 2VOZA 1QUJA 1FW0A 3USDA 1IXCA 1B1HA 2OZZA 4NF4A 2H5YA 4OHNA 1QUKA 3FJMA 1XVYA 5H8QA 4QHQA 4ZE8A 3VLUA 4EF1A 1A54A 3SEVA 3TEPA 4HCYA 4KYDA 5I56A 1JW1A 5LOMA 1N3XA 2REJA 2F7CA 1CB6A 3CG1A 3SEXA 1B4HA 4GD5A 5ITPA 3G3GA 3TYHA 1I6QA 5DTBA 3EHSA 2QMXA 2DE3A 1B6HA 1URSA 5CMBA 4Q5TA 3PMXA 1FTKA 4JSDA 2Z23A 2P1SA 3HSTA 2UVHA 4LUBA 2O1MA 2PT2A 1B9JA 1XOCA 1S7YA 3TMGA 1J1NA 4F3PA 4U21A 4QFNA 4QFKA 3TELA 2HZLA 1NMUA 1MM7A 4X48A 1A8FA 2E0SA 2O7IA 4N07A 3MZBA 1R9QA 4XKQA 5L8DA 3KJ7A 1EZ9A 2Y84A 3C33A 1P1OA 3P7IA 1ZKBA 3K01A 2XXPA 1D4NA 1ATGA 3MPLA 5CM6A 1ZBMA 1AH5A 3RQTA 1F9BA 2F8DA 3E13X 1LAHE 3WAFA 1VFEA 1CE2A 1TFAA 5HM4B 2AYSA 4C1TA 1R1NA 4NWCA 5H8NA 1B5IA 4R2BA 4OEUA 3EHTA 3MPKA 2RC8A 3K02A 3T9HB 1B46A 4FE8A 3RY3A 3OO7A 2UVGA 3IOTA 4Z0IA 4LZ8A 2ZXTA 1A7LA 4DIGA 4NE4A 2XX9A 3W9VA 2I0BA 3H6UA 2F34A 3VLVA 1D9YA 2ZNUA 3QAXA 2V3QA 4H67A 1TXFA 4GF8A 1UTBB 3RGYA 3K1PA 4P0GA 1EZOA 5ICTA 2XX8A 1ZU0A 1NL5A 1MXYA 5I58A 4H8JA 4JB7A 4FAJA 1ZMGA 4LQ5A 3M3KA 4RA1A 1MPCA 5JK4A 1AIVA 4XKPA 3PV0E 3JYRA 1OVBA 1DTGA 5AA1A 3VVDA 3KOTA 1B1XA 3TODA 2XXXA 1B32A 1B3FA 3TAJA 1A55A 4E0XA 3MJNA 2Z8DA 3T93B 3G3JA 3IB1A 1N76A 3W15C 2B3FA 3PUWE 4M1VA 2QS1A 2UVIA 4YZZA 4TLLB 3HO7A 4GXAA 5DEXB 2VD2A 4QF9A 4FEDA 1MS7A 5KCJB 1NNKA 1LGBC 3ZKLA 2D3IA 4F1YA 4DDDA 1I6BA 4U22A 3PGFA 1Y3PA 2Z8EA 5H8FB 5KDTB 5AE4A 3CFZA 1R6ZA 1B3GA 4LZ5A 1N3WA 2O84X 3T9VA 4ZEBA 4QFOA 1M5FA 3OSRA 4EXLA 4YICA 3FJ7A 2NWJA 3LC8A 3MP6A 2V84A 4ZEDA 5CMKA 3SETA 2Z8FA 3RT8A 1MQGA 3G3HA 4LZ7A 3RUMA 2V3TA 1B5HA 1JETA 1I69A 2V93A 4ZEKA 3UK4A 2OBGA 4RYAA 4ISUA 4ND9A 1UTHB 5K2YA 3QYTA 5CBRA 1XHYA 1B52A 3HPIA 1XC1A 1US5A 4IB2A 3SDFA 3ZS6A 1LFIA 3G3KA 3SESA 2DOJA 3SEWA 2D5WA 4R9GA 3IORA 2AL5A 4ELRA 4ONYA 2THIA 3N6TA 1SD3A 2A5TA 3N6UA 2H98A 2Y7IA 3N26A 2H9BA 3KN3A 4P11A 3L6GA 2FNCA 2D21A 1LLSA 2F6GA 3OEKA 2GRVA 4IO6A 2XXIA 3G3FA 2H4IA 2XXUA 1EH3A 3MZ1A 3TUSA 2VD3A 5CBSA 3CI8A 3FVKA 4LA9A 4OESA 1LCTA 3GLBA 2XXVA 1RYOA 4H1XA 1SDXA 2PMSA 1VE4A 4ZS9A 4Q0CA 2PT1A 2RCAA 3ZKKA 3IOWA 4GOTA 5TP9B 4G8HA 3A3CA 3S9NC 3MVZA 4H0WA 1B2HA 4ECFA 1D9VA 4YKPA 3IB0A 1UTBA 3LSWA 4BDRA 1TWYA 2O6AA 4TLMB 1IEJA 1M5DA 3C34A 4KI0E 1B0HA 4YB5A 1PB9A 4ZEFA 1II5A 1JVYA 4H65A 1JVXA 3UP9A 4MBPA 1NNTA 4GVOA 4IY6A 4F1VA 3VVFA 4QRZA 2E1SA 3O9PA 3H03A 4LVQA 3OEMA 4H5FA 4FEBA 1MH3A 4YU0A 1DMBA 4OMBA 2DE2A 4I9DA 4PQJA 5A5XB 3B6WA 3N94A 1JEVA 1VFDA 5B7DA 1M5BA 5DEXA 4EUOA 2DVZA 4F39A 3S9MC 1H43A 4EQ7A 5KCJA 4Q30B 4GWOA 1LAGE 2HCAA 2QSXA 3IK6B 4OERA 2OJTA 1URDA 1N7XA 4NF6B 2ANJA 1JEUA 3RTFB 5H8FA 1MPDA 2F78A 5KDTA 3RTWB 3HV1A 3QXMA 3K6WA 3Q27A 4R2FA 1HSJA 1MY1A 4F31B 3V8XB 1IXIA 1H45A 4ZDMA 4G77A 1QKAA 1LBBA 4IGTA 4DXUA 3UN6A 2LAOA 1FQFA 1JW4A 3TCHA 4U1ZA 4G8NA 4GXSB 2P2AA 5BUUA 4GFRA 4HW8A 3GBAA 1BLFA 3I6VA 1AMFA 1B0LA 2A5SA 3VLWA 1XVXA 4EDPA 2OK2A 1N84A 1IQ7A 3R26A 4HS7A 1UTHA 4WEPA 4Q8RA 4PE5B 3MUQA 1IXHA 4THIA 3PD9A 3PPQA 3M3FA 1H44A 2UYEA 1P1UA 3JV9A 3ECRA 5EHSA 4H5GA 2O7UA 5EHMA 4PFUA 3TPAA 4OVJA 3VXCA 4JXIA 1N7WA 2ZYKA 2G93A 1PEBA 3VDFA 2OLBA 1RYXA 1MQHA 3KG2A 4IGRA 3H4ZA 2Q9TA 3MVYA 2OWTA 5DVJA 4YMBA 5JTYB 3LSXA 2F35A 3OELA 4TQUQ 2UXAA 3ILUB 2DSFA 3IO6A 2Y7PA 3U1OA 1ZLQA 3IAZA 3U8QA 2RINA 5I57A 3K1NA 3R6UA 4RPNA 2BJJX 3RT6B 1LBCA 5ICQA 2F6PA 4MH5A 3MP1A 2I4BA 3I3VA 3FJGA 3UORA 1H3DA 1QULA 1Y3NA 4OFOA 3RNNA 4AB5A 4QSEA 4OQOA 5TP9A 1LB8A 3IO4A 4U23A 1ZJLA 3JZJA 3OO8A 4O3AA 1O63A 1SYHA 1IITA 4OZ9A 3LUYA 4I8CA 1B40A 4DZ1A 4FECA 1Y4TA 3K00A 3M8UA 4K3FA 1A99A 4NF5A 1NNFA 3MAMA 2HAVA 4UA8A 2HZKA 1FQEA 4C0RA 3PUYE 2PYYA 2AIXA 1B51A 3K2DA 1Y20A 3H06B 4YMAA 4I62A 3TQLA 1YPNA 1ELJA 1SBPA 3MBPA 1LAFE 3EHUA 4WKMA 1POTA 4GLIA 4PP0A 5A5XA 2Y7KA 1LFGA 4DE8A 2DWHA 3LSFB 4RPOA 3CFXA 5I2NB 3MQ9A 4O3CA 5F1QA 2XHDA 3KOSA 3MWBA 2O1LA 4BLAA 5ITOA 3K6UA 2VP1A 4F29A 2UVJA 4NF6A 5DT6A 3T96B 3CFLA 5CC2A 3W9WA 1MY4A 1USYH 1YCJA 2NXOA 1S9TA 3Q25A 2HXWA 1WDNA 3FV2A 3KN8A 3PMVA 2XXHA 4RK2A 3Q26A 3GBBA 3O97A 3FVNA 3EQ1A 3HN0A 4GL0A 4RK9A 3MZ9A 3A3UA 4JBZA 4NMYA 3FXRA 4C1UA 1MY3A 4OENA 4AB6A 4F18A 3FUZA 4IO5A 2Q8JA 4GRKA 1ZIUA 2O69A 2O68A 5I59B 3D4GA 2F7AA 3OD7A 1ANFA 2QPQA 3S4UA 1PB8A 3VV5A 4KQPA 4PETA 3E9XA 1R9LA 2QRYA 1DTZA 1HSLA 1LAXA 3H6TA 1MPBA 2ONRA 3AXFA 2ALUA 1MQDA 5DVIA 1DPEA 3CR9A 2YJPA 1MXUA 1Y3QA 5CMCA 3H6VA 1JW5A 1PB7A 1XS5A 1M5CA 4KYSA 1MRPA 4JWXA 3Q29A 1KWHA 3O6IA 1AL3A 5JTYA 3QUJA 5DYHA 2ONSA 1OVTA 3MVXA 3SKPA 2UYFA 4OFLA 3ONMA 3HCQA 2DE4A 3OXNA 3G7WA 4OEVA 3DM0A 4NF4B 3LR1A 3TCGA 2QMWA 3K4UA 2GH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PPN A;  1TFD A;  4NTL A;  3RN8 A;  3TFL A;  3UIF A;  4DCX A;  5CMM A;  2DXR A;  3THI A;  3EPE A;  1Q1K A;  4YAH X;  5I2K B;  4IO7 A;  3C32 A;  1UIV A;  5AA2 B;  1Y1Z A;  2XXR A;  1B7H A;  4QSC A;  4O3B A;  4MLV A;  4QFL A;  2M8C A;  5I84 A;  4NWD A;  3S2V A;  1MH4 A;  3C9H A;  1Y9U A;  2QS4 A;  1OMP A;  2Q2A A;  3L6H A;  3QUF A;  4F3G A;  3TCF A;  2I0C A;  2HQ0 A;  3DEL B;  5AA2 D;  2NOO A;  1MXX A;  1B05 A;  5FTI A;  4I1D A;  4POW A;  1SW1 A;  4OWD A;  3V89 B;  1Y4C A;  1IXG A;  3SEY A;  3TZA A;  3VE1 B;  3O2A A;  3IB2 A;  2OWS A;  3PD8 A;  5I2N A;  1QVS A;  2RCB A;  1B4Z A;  5HBC A;  4U4S A;  4GIZ A;  2PBW A;  3OO6 A;  2XXQ A;  4R72 A;  3V83 A;  3E4R A;  3T66 A;  3U93 A;  5KZT A;  4FAT A;  2QS3 A;  1BKA A;  2B3B A;  3SEU A;  2PX1 A;  4RJZ A;  5L9M A;  1SW5 A;  5TPA B;  1N04 A;  1P1Q A;  1SQY A;  4KCC A;  4DLD A;  1MXZ A;  1OQH A;  3O28 A;  2DVC A;  3D4C A;  5H8N B;  5H8H B;  5AA4 B;  2RF1 A;  4OTE A;  1OQG A;  4RY1 A;  1VSO A;  3IOU A;  3ODB A;  3OEN A;  3FZV A;  3S9L C;  3FAS A;  1EU8 A;  2DYX A;  4YKJ A;  5I59 A;  4WXJ A;  4F2O A;  4AQ4 A;  4ZEC A;  3BFT A;  4DCY A;  3PUV E;  1T0K A;  5K2X A;  1S50 A;  4YB6 A;  5DVF A;  5FHM A;  4BDM A;  5CRY A;  2I58 A;  4EXK A;  2REG A;  4EQB A;  1B7U A;  4TOZ A;  2ZYN A;  3KEI A;  3PPO A;  2R71 A;  1P1N A;  1AOV A;  5FTH A;  2Q2C A;  3O6G A;  3VXB A;  3T9U A;  4ZEI A;  1QW0 A;  1MQI A;  3KN7 A;  3UA8 A;  3O6H A;  4POX A;  3TDJ A;  3PMW A;  3FXQ A;  3T9X B;  1B3L A;  3OMB A;  2HFB A;  3IJX B;  2KLF A;  4E0W A;  3O66 A;  3RLF E;  1LFH A;  3GXA A;  3U92 A;  1JNF A;  4P0I A;  1SYI A;  4MFI A;  2FA7 A;  3PUZ E;  3B6T A;  4HTG A;  3DP6 A;  1B5J A;  4XTC Q;  5CI5 A;  3TTK A;  1NFT A;  1H76 A;  4IO3 A;  1B3H A;  1QKB A;  3N5L A;  2V25 A;  2CMO A;  1NNP A;  3EN3 A;  3M3L A;  2I3W A;  2AL4 A;  3Q28 A;  2I6E A;  4G4P A;  1RKM A;  1POY 1;  2I48 A;  4YB7 A;  1BIY A;  1FQC A;  4GL8 A;  4R6K A;  1GGG A;  5I2K A;  3FD3 A;  1A40 A;  1O7T A;  2XD3 A;  2HAU A;  5AA2 A;  3FVG A;  2YPN A;  3FIR A;  5ISU A;  1QJM A;  4F3S A;  5ELV A;  2F97 A;  1MDP 1;  5HPQ A;  3OO9 A;  3TKD A;  4OFJ A;  3KZG A;  3R7X A;  1B3E A;  1Q35 A;  4N6P A;  1HSE A;  3V5A A;  3I5O A;  2WKY A;  1BP5 A;  3CIJ A;  2I49 A;  4L17 A;  1NKX A;  2ZMB A;  4IO4 A;  4G2Z A;  1FTJ A;  1YTV A;  2Q88 A;  1D3K A;  2NUV A;  3QSL A;  4XKN A;  4OXV A;  3C31 A;  3CVG A;  3K6V A;  3IX1 A;  3FXU A;  2O51 A;  1TT1 A;  1Z7N E;  4IY5 A;  2ESN A;  2ABH A;  2I3V A;  2VHA A;  4ESX A;  4M4G A;  1LST A;  3MC2 A;  4MF3 A;  2A5T B;  4BDQ A;  5TPA A;  3KFM A;  4GQO A;  4EQ9 A;  5B70 A;  2Z22 A;  3BBR A;  1OLC A;  4R75 A;  4F1U A;  1PBP A;  3LSL A;  2DXY A;  4R73 A;  4LQ2 A;  5H8H A;  4JDF A;  3OSQ A;  5AA4 A;  2XXW A;  1DSN A;  3H6W A;  4JWY A;  4ZZA A;  3LBS A;  3GZG A;  4LON B;  1SW4 A;  4F19 A;  4NED A;  2ONK E;  1USY E;  4F2Q A;  4Z7E A;  4X1D A;  3IJO B;  2X7Q A;  1GTK A;  4KFQ A;  2HEU A;  3PU5 A;  5L9S A;  3MW0 A;  1UIU A;  4ELQ A;  3QIM A;  4N13 A;  4ELO A;  1FTO A;  4FJP A;  3H7M A;  1NH7 A;  3O29 A;  2X7P A;  4G8M A;  4OYV A;  3SER A;  4RNS A;  2QL3 A;  4BDO A;  1YAE A;  4KYE A;  3FAT A;  1IZ1 A;  3ZSF A;  3EF7 A;  2RC7 A;  1N0T A;  4F22 A;  4X1B A;  4LP2 B;  2GHB A;  1M5E A;  4ESW A;  3A09 A;  1GVC A;  3K0V A;  4U4X A;  1FQD A;  4X9T A;  4IO2 A;  1FQA A;  4KD5 A;  3DLN A;  3K1M A;  3VVE A;  1OLA A;  1BTJ A;  3K6X A;  2DQV A;  2DS9 A;  3IL1 B;  4JWO A;  2RKM A;  1OIB A;  1VR5 A;  4U2R A;  4G68 C;  2V3U A;  2H99 A;  5IAI A;  4RXL A;  2FYI A;  2W7Y A;  1P1W A;  3HHF A;  4G68 B;  3CSB A;  4DXC A;  2QS2 A;  3U72 A;  4NF8 B;  3KSX A;  1Z7M E;  4WED A;  1O64 A;  3DP4 A;  4KHZ E;  3KJT A;  2P0S A;  3TTR A;  3U94 A;  1SVX B;  3CSG A;  4ZE9 A;  3DP8 A;  2XX7 A;  2XXY A;  4DXB A;  2Y7R A;  3KGC A;  1FCK A;  4HCW A;  3KBR A;  4JSO A;  2XXT A;  1URG A;  2F7B A;  3H3G A;  2PVU A;  1B58 A;  2B65 A;  3BKI B;  1MDQ A;  4YKI A;  5H8Q B;  1WOD A;  1GR2 A;  3WAE A;  4UAC A;  4BDL A;  1FTM A;  1DPP A;  3TTM A;  1PDA A;  2DP8 A;  5I56 B;  5H8S A;  3ILT B;  4EF2 A;  5J1D A;  4MLQ A;  4YKK A;  5JEI A;  4XXU A;  2OCU A;  2XD2 A;  2IEE A;  4PFY A;  1IUD A;  4LAT A;  4F3B A;  3CG3 A;  1FQB A;  2RC9 A;  3B7D A;  4KR5 A;  4R6Y A;  2NVU B;  3BFU A;  1WVJ A;  3UGW A;  3FVO A;  4PFT A;  5F7V A;  3RPW A;  5FHN A;  2ZNT A;  5I57 B;  2Q89 A;  2R6G E;  5IKB A;  1EZP A;  1ZTY A;  4H8I A;  2GHA A;  2CZL A;  3TQW A;  2X26 A;  3MVW A;  1DOT A;  4XKR A;  3OOA A;  4PFW A;  2Y7W A;  1LB9 A;  4ELP A;  1MM6 A;  4R6H A;  2F36 A;  3E3K A;  1NH8 A;  1GV8 A;  3TTN A;  2IA4 A;  3T22 A;  4QFP A;  3PPP A;  1MG1 A;  4H6D A;  2ZNS A;  4KPT A;  4NF5 B;  1P99 A;  1B7Z A;  2YLN A;  3C4M A;  1JQF A;  3PPR A;  4U1O A;  4ZZE A;  4BDN A;  2R9J A;  1FTL A;  5M2V A;  3S9E A;  5BWJ A;  3FGS A;  3PUX E;  1SI0 A;  3B6Q A;  1L5T A;  5AA3 A;  2H25 A;  2DWI A;  2QJE A;  4XIG Q;  4R74 A;  1I6A A;  3C36 A;  3C35 A;  3FV1 A;  2ZYM A;  4OET A;  1QUI A;  2ZYO A;  3G3I A;  3HHG A;  2I4C A;  4FOR A;  5FHO A;  5L9O A;  1XT8 A;  2GFE A;  3IOV A;  1MY2 A;  1SW2 A;  2F5X A;  1PBQ A;  3IR1 A;  1UQW A;  4FIM A;  1Y1M A;  4R9F A;  1SI1 A;  2DWJ A;  1MXV A;  4QSD A;  5I58 B;  5EYF A;  3MP8 A;  4G68 A;  3VFJ A;  4NF8 A;  3TTL A;  5TU0 A;  1PC3 A;  3QK6 A;  1IIW A;  3F11 A;  1MQJ A;  1MY0 A;  1MXW A;  2VGQ A;  2DWA A;  3KSJ A;  4KCD A;  1US4 A;  1A8E A;  1LCF A;  3CRB A;  2G29 A;  2VOZ A;  1QUJ A;  1FW0 A;  3USD A;  1IXC A;  1B1H A;  2OZZ A;  4NF4 A;  2H5Y A;  4OHN A;  1QUK A;  3FJM A;  1XVY A;  5H8Q A;  4QHQ A;  4ZE8 A;  3VLU A;  4EF1 A;  1A54 A;  3SEV A;  3TEP A;  4HCY A;  4KYD A;  5I56 A;  1JW1 A;  5LOM A;  1N3X A;  2REJ A;  2F7C A;  1CB6 A;  3CG1 A;  3SEX A;  1B4H A;  4GD5 A;  5ITP A;  3G3G A;  3TYH A;  1I6Q A;  5DTB A;  3EHS A;  2QMX A;  2DE3 A;  1B6H A;  1URS A;  5CMB A;  4Q5T A;  3PMX A;  1FTK A;  4JSD A;  2Z23 A;  2P1S A;  3HST A;  2UVH A;  4LUB A;  2O1M A;  2PT2 A;  1B9J A;  1XOC A;  1S7Y A;  3TMG A;  1J1N A;  4F3P A;  4U21 A;  4QFN A;  4QFK A;  3TEL A;  2HZL A;  1NMU A;  1MM7 A;  4X48 A;  1A8F A;  2E0S A;  2O7I A;  4N07 A;  3MZB A;  1R9Q A;  4XKQ A;  5L8D A;  3KJ7 A;  1EZ9 A;  2Y84 A;  3C33 A;  1P1O A;  3P7I A;  1ZKB A;  3K01 A;  2XXP A;  1D4N A;  1ATG A;  3MPL A;  5CM6 A;  1ZBM A;  1AH5 A;  3RQT A;  1F9B A;  2F8D A;  3E13 X;  1LAH E;  3WAF A;  1VFE A;  1CE2 A;  1TFA A;  5HM4 B;  2AYS A;  4C1T A;  1R1N A;  4NWC A;  5H8N A;  1B5I A;  4R2B A;  4OEU A;  3EHT A;  3MPK A;  2RC8 A;  3K02 A;  3T9H B;  1B46 A;  4FE8 A;  3RY3 A;  3OO7 A;  2UVG A;  3IOT A;  4Z0I A;  4LZ8 A;  2ZXT A;  1A7L A;  4DIG A;  4NE4 A;  2XX9 A;  3W9V A;  2I0B A;  3H6U A;  2F34 A;  3VLV A;  1D9Y A;  2ZNU A;  3QAX A;  2V3Q A;  4H67 A;  1TXF A;  4GF8 A;  1UTB B;  3RGY A;  3K1P A;  4P0G A;  1EZO A;  5ICT A;  2XX8 A;  1ZU0 A;  1NL5 A;  1MXY A;  5I58 A;  4H8J A;  4JB7 A;  4FAJ A;  1ZMG A;  4LQ5 A;  3M3K A;  4RA1 A;  1MPC A;  5JK4 A;  1AIV A;  4XKP A;  3PV0 E;  3JYR A;  1OVB A;  1DTG A;  5AA1 A;  3VVD A;  3KOT A;  1B1X A;  3TOD A;  2XXX A;  1B32 A;  1B3F A;  3TAJ A;  1A55 A;  4E0X A;  3MJN A;  2Z8D A;  3T93 B;  3G3J A;  3IB1 A;  1N76 A;  3W15 C;  2B3F A;  3PUW E;  4M1V A;  2QS1 A;  2UVI A;  4YZZ A;  4TLL B;  3HO7 A;  4GXA A;  5DEX B;  2VD2 A;  4QF9 A;  4FED A;  1MS7 A;  5KCJ B;  1NNK A;  1LGB C;  3ZKL A;  2D3I A;  4F1Y A;  4DDD A;  1I6B A;  4U22 A;  3PGF A;  1Y3P A;  2Z8E A;  5H8F B;  5KDT B;  5AE4 A;  3CFZ A;  1R6Z A;  1B3G A;  4LZ5 A;  1N3W A;  2O84 X;  3T9V A;  4ZEB A;  4QFO A;  1M5F A;  3OSR A;  4EXL A;  4YIC A;  3FJ7 A;  2NWJ A;  3LC8 A;  3MP6 A;  2V84 A;  4ZED A;  5CMK A;  3SET A;  2Z8F A;  3RT8 A;  1MQG A;  3G3H A;  4LZ7 A;  3RUM A;  2V3T A;  1B5H A;  1JET A;  1I69 A;  2V93 A;  4ZEK A;  3UK4 A;  2OBG A;  4RYA A;  4ISU A;  4ND9 A;  1UTH B;  5K2Y A;  3QYT A;  5CBR A;  1XHY A;  1B52 A;  3HPI A;  1XC1 A;  1US5 A;  4IB2 A;  3SDF A;  3ZS6 A;  1LFI A;  3G3K A;  3SES A;  2DOJ A;  3SEW A;  2D5W A;  4R9G A;  3IOR A;  2AL5 A;  4ELR A;  4ONY A;  2THI A;  3N6T A;  1SD3 A;  2A5T A;  3N6U A;  2H98 A;  2Y7I A;  3N26 A;  2H9B A;  3KN3 A;  4P11 A;  3L6G A;  2FNC A;  2D21 A;  1LLS A;  2F6G A;  3OEK A;  2GRV A;  4IO6 A;  2XXI A;  3G3F A;  2H4I A;  2XXU A;  1EH3 A;  3MZ1 A;  3TUS A;  2VD3 A;  5CBS A;  3CI8 A;  3FVK A;  4LA9 A;  4OES A;  1LCT A;  3GLB A;  2XXV A;  1RYO A;  4H1X A;  1SDX A;  2PMS A;  1VE4 A;  4ZS9 A;  4Q0C A;  2PT1 A;  2RCA A;  3ZKK A;  3IOW A;  4GOT A;  5TP9 B;  4G8H A;  3A3C A;  3S9N C;  3MVZ A;  4H0W A;  1B2H A;  4ECF A;  1D9V A;  4YKP A;  3IB0 A;  1UTB A;  3LSW A;  4BDR A;  1TWY A;  2O6A A;  4TLM B;  1IEJ A;  1M5D A;  3C34 A;  4KI0 E;  1B0H A;  4YB5 A;  1PB9 A;  4ZEF A;  1II5 A;  1JVY A;  4H65 A;  1JVX A;  3UP9 A;  4MBP A;  1NNT A;  4GVO A;  4IY6 A;  4F1V A;  3VVF A;  4QRZ A;  2E1S A;  3O9P A;  3H03 A;  4LVQ A;  3OEM A;  4H5F A;  4FEB A;  1MH3 A;  4YU0 A;  1DMB A;  4OMB A;  2DE2 A;  4I9D A;  4PQJ A;  5A5X B;  3B6W A;  3N94 A;  1JEV A;  1VFD A;  5B7D A;  1M5B A;  5DEX A;  4EUO A;  2DVZ A;  4F39 A;  3S9M C;  1H43 A;  4EQ7 A;  5KCJ A;  4Q30 B;  4GWO A;  1LAG E;  2HCA A;  2QSX A;  3IK6 B;  4OER A;  2OJT A;  1URD A;  1N7X A;  4NF6 B;  2ANJ A;  1JEU A;  3RTF B;  5H8F A;  1MPD A;  2F78 A;  5KDT A;  3RTW B;  3HV1 A;  3QXM A;  3K6W A;  3Q27 A;  4R2F A;  1HSJ A;  1MY1 A;  4F31 B;  3V8X B;  1IXI A;  1H45 A;  4ZDM A;  4G77 A;  1QKA A;  1LBB A;  4IGT A;  4DXU A;  3UN6 A;  2LAO A;  1FQF A;  1JW4 A;  3TCH A;  4U1Z A;  4G8N A;  4GXS B;  2P2A A;  5BUU A;  4GFR A;  4HW8 A;  3GBA A;  1BLF A;  3I6V A;  1AMF A;  1B0L A;  2A5S A;  3VLW A;  1XVX A;  4EDP A;  2OK2 A;  1N84 A;  1IQ7 A;  3R26 A;  4HS7 A;  1UTH A;  4WEP A;  4Q8R A;  4PE5 B;  3MUQ A;  1IXH A;  4THI A;  3PD9 A;  3PPQ A;  3M3F A;  1H44 A;  2UYE A;  1P1U A;  3JV9 A;  3ECR A;  5EHS A;  4H5G A;  2O7U A;  5EHM A;  4PFU A;  3TPA A;  4OVJ A;  3VXC A;  4JXI A;  1N7W A;  2ZYK A;  2G93 A;  1PEB A;  3VDF A;  2OLB A;  1RYX A;  1MQH A;  3KG2 A;  4IGR A;  3H4Z A;  2Q9T A;  3MVY A;  2OWT A;  5DVJ A;  4YMB A;  5JTY B;  3LSX A;  2F35 A;  3OEL A;  4TQU Q;  2UXA A;  3ILU B;  2DSF A;  3IO6 A;  2Y7P A;  3U1O A;  1ZLQ A;  3IAZ A;  3U8Q A;  2RIN A;  5I57 A;  3K1N A;  3R6U A;  4RPN A;  2BJJ X;  3RT6 B;  1LBC A;  5ICQ A;  2F6P A;  4MH5 A;  3MP1 A;  2I4B A;  3I3V A;  3FJG A;  3UOR A;  1H3D A;  1QUL A;  1Y3N A;  4OFO A;  3RNN A;  4AB5 A;  4QSE A;  4OQO A;  5TP9 A;  1LB8 A;  3IO4 A;  4U23 A;  1ZJL A;  3JZJ A;  3OO8 A;  4O3A A;  1O63 A;  1SYH A;  1IIT A;  4OZ9 A;  3LUY A;  4I8C A;  1B40 A;  4DZ1 A;  4FEC A;  1Y4T A;  3K00 A;  3M8U A;  4K3F A;  1A99 A;  4NF5 A;  1NNF A;  3MAM A;  2HAV A;  4UA8 A;  2HZK A;  1FQE A;  4C0R A;  3PUY E;  2PYY A;  2AIX A;  1B51 A;  3K2D A;  1Y20 A;  3H06 B;  4YMA A;  4I62 A;  3TQL A;  1YPN A;  1ELJ A;  1SBP A;  3MBP A;  1LAF E;  3EHU A;  4WKM A;  1POT A;  4GLI A;  4PP0 A;  5A5X A;  2Y7K A;  1LFG A;  4DE8 A;  2DWH A;  3LSF B;  4RPO A;  3CFX A;  5I2N B;  3MQ9 A;  4O3C A;  5F1Q A;  2XHD A;  3KOS A;  3MWB A;  2O1L A;  4BLA A;  5ITO A;  3K6U A;  2VP1 A;  4F29 A;  2UVJ A;  4NF6 A;  5DT6 A;  3T96 B;  3CFL A;  5CC2 A;  3W9W A;  1MY4 A;  1USY H;  1YCJ A;  2NXO A;  1S9T A;  3Q25 A;  2HXW A;  1WDN A;  3FV2 A;  3KN8 A;  3PMV A;  2XXH A;  4RK2 A;  3Q26 A;  3GBB A;  3O97 A;  3FVN A;  3EQ1 A;  3HN0 A;  4GL0 A;  4RK9 A;  3MZ9 A;  3A3U A;  4JBZ A;  4NMY A;  3FXR A;  4C1U A;  1MY3 A;  4OEN A;  4AB6 A;  4F18 A;  3FUZ A;  4IO5 A;  2Q8J A;  4GRK A;  1ZIU A;  2O69 A;  2O68 A;  5I59 B;  3D4G A;  2F7A A;  3OD7 A;  1ANF A;  2QPQ A;  3S4U A;  1PB8 A;  3VV5 A;  4KQP A;  4PET A;  3E9X A;  1R9L A;  2QRY A;  1DTZ A;  1HSL A;  1LAX A;  3H6T A;  1MPB A;  2ONR A;  3AXF A;  2ALU A;  1MQD A;  5DVI A;  1DPE A;  3CR9 A;  2YJP A;  1MXU A;  1Y3Q A;  5CMC A;  3H6V A;  1JW5 A;  1PB7 A;  1XS5 A;  1M5C A;  4KYS A;  1MRP A;  4JWX A;  3Q29 A;  1KWH A;  3O6I A;  1AL3 A;  5JTY A;  3QUJ A;  5DYH A;  2ONS A;  1OVT A;  3MVX A;  3SKP A;  2UYF A;  4OFL A;  3ONM A;  3HCQ A;  2DE4 A;  3OXN A;  3G7W A;  4OEV A;  3DM0 A;  4NF4 B;  3LR1 A;  3TCG A;  2QMW A;  3K4U A;  2GH9 A; 
#chains in the Genus database with same CATH topology
 3PPN A;  1TFD A;  4NTL A;  3RN8 A;  3TFL A;  3UIF A;  4DCX A;  5CMM A;  2DXR A;  3THI A;  5I3S A;  3EPE A;  1Q1K A;  4OVQ A;  4YAH X;  5I2K B;  4IO7 A;  3C32 A;  1UIV A;  3U65 A;  5AA2 B;  1Y1Z A;  1NV1 A;  2XXR A;  1B7H A;  4QSC A;  4O3B A;  4MLV A;  4QFL A;  2M8C A;  5I84 A;  4NWD A;  4N91 A;  3S2V A;  1MH4 A;  3C9H A;  1Y9U A;  2QS4 A;  1OMP A;  2Q2A A;  3L6H A;  3QUF A;  4F3G A;  3TCF A;  2I0C A;  2HQ0 A;  3DEL B;  5AA2 D;  3E79 A;  2NOO A;  1MXX A;  1FPF A;  1B05 A;  5FTI A;  4I1D A;  4POW A;  1SW1 A;  4OWD A;  3V89 B;  1Y4C A;  4MHF A;  1IXG A;  4PF8 A;  3SEY A;  3TZA A;  5LDZ A;  3VE1 B;  5J16 A;  3O2A A;  3IB2 A;  2OWS A;  3PD8 A;  5I2N A;  1QVS A;  2RCB A;  1B4Z A;  4HE2 A;  5HBC A;  4U4S A;  5ESY A;  4GIZ A;  2V4C A;  2PBW A;  3OO6 A;  2XXQ A;  4P3L A;  1FTA A;  4R72 A;  2VPO A;  3V83 A;  3E4R A;  3T66 A;  3U93 A;  5KZT A;  4FAT A;  2QS3 A;  1BKA A;  2B3B A;  3SEU A;  2PX1 A;  4RJZ A;  5L9M A;  1NUW A;  1SW5 A;  5TPA B;  1N04 A;  1P1Q A;  1SQY A;  4N6D A;  4KCC A;  4DLD A;  1MXZ A;  1OQH A;  3O28 A;  2DVC A;  3D4C A;  5H8N B;  5H8H B;  5AA4 B;  4DI3 D;  2RF1 A;  4OTE A;  1OQG A;  4RY1 A;  2XA5 A;  1VSO A;  3IOU A;  3ODB A;  3OEN A;  3FZV A;  5DW8 A;  3S9L C;  3FAS A;  1EU8 A;  2DYX A;  4YKJ A;  5I59 A;  4WXJ A;  4F2O A;  4AQ4 A;  4ZEC A;  3BFT A;  4DCY A;  3PUV E;  1T0K A;  5K2X A;  1S50 A;  5T3J A;  4YB6 A;  4MNI A;  5DVF A;  5FHM A;  4BDM A;  5CRY A;  2I58 A;  1FSA A;  4OVT A;  4EXK A;  2REG A;  4EQB A;  1B7U A;  4TOZ A;  2ZYN A;  3KEI A;  1JP4 A;  2HXR A;  3PPO A;  2R71 A;  3SZP A;  1P1N A;  4NHB A;  1AOV A;  5FTH A;  2Q2C A;  3O6G A;  4AS5 A;  3VXB A;  3T9U A;  4ZEI A;  2PFZ A;  1QW0 A;  1MQI A;  3KN7 A;  3UA8 A;  3O6H A;  4POX A;  3TDJ A;  3PMW A;  3FXQ A;  3T9X B;  1B3L A;  2F3B A;  3OMB A;  2HFB A;  3E78 A;  3IJX B;  2KLF A;  4E0W A;  3O66 A;  4MNP A;  3RLF E;  1LFH A;  3GXA A;  1FPD A;  3U92 A;  1JNF A;  4MAG A;  2QVU A;  4P0I A;  1SYI A;  4MFI A;  2FA7 A;  3PUZ E;  2FHY A;  3B6T A;  4HTG A;  2CEY A;  3DP6 A;  1B5J A;  4XTC Q;  5CI5 A;  3TTK A;  1NFT A;  1H76 A;  4IO3 A;  1B3H A;  1QKB A;  3N5L A;  3T0J A;  2V25 A;  2CMO A;  1NNP A;  3EN3 A;  3M3L A;  2B4M A;  2I3W A;  2AL4 A;  3Q28 A;  2I6E A;  4G4P A;  2Q74 A;  1RKM A;  1POY 1;  2I48 A;  4YB7 A;  1BIY A;  1FQC A;  4GL8 A;  4R6K A;  1GGG A;  1FPI A;  5I2K A;  3B50 A;  3FD3 A;  1A40 A;  1O7T A;  2XD3 A;  2HAU A;  5AA2 A;  3FVG A;  2YPN A;  3FIR A;  2OX3 A;  5ISU A;  1QJM A;  4F3S A;  5ELV A;  1K9Z A;  2F97 A;  1MDP 1;  5HPQ A;  3OO9 A;  3RYD A;  3TKD A;  4OFJ A;  3KZG A;  3R7X A;  1LBW A;  1B3E A;  1Q35 A;  2WBD A;  4N6P A;  1FBE A;  1HSE A;  1CNQ A;  3V5A A;  3I5O A;  4PBQ A;  2WKY A;  4OVP A;  4MCO A;  1BP5 A;  3CIJ A;  2I49 A;  4IO4 A;  4L17 A;  1NKX A;  2ZMB A;  4NG7 A;  4G2Z A;  1FTJ A;  5EQ9 A;  2Y5L A;  1YTV A;  2Q88 A;  4MMP A;  1D3K A;  2NUV A;  3QSL A;  4XKN A;  4OXV A;  3C31 A;  3CVG A;  4PBH A;  3K6V A;  3IX1 A;  3FXU A;  2O51 A;  1RDY A;  1TT1 A;  1Z7N E;  4IY5 A;  2ESN A;  1NV7 A;  4DI4 B;  2FVZ A;  2Q8M A;  2ABH A;  2I3V A;  2VHA A;  4ESX A;  4M4G A;  1LST A;  3MC2 A;  4MF3 A;  2A5T B;  4BDQ A;  5TPA A;  3KFM A;  5EQ8 A;  2QVV A;  1FPL A;  4GQO A;  4EQ9 A;  5B70 A;  4P56 A;  2Z22 A;  3BBR A;  1OLC A;  4R75 A;  4F1U A;  1PBP A;  3LSL A;  1DBZ A;  2DXY A;  4R73 A;  4LQ2 A;  5H8H A;  4JDF A;  3OSQ A;  5AA4 A;  2XXW A;  3QMF A;  1LBV A;  1DSN A;  3H6W A;  4JWY A;  4ZZA A;  3LBS A;  3GZG A;  4LON B;  1SW4 A;  4F19 A;  4NED A;  2ONK E;  1USY E;  4F2Q A;  4Z7E A;  2P3V A;  4X1D A;  3IJO B;  3D1R A;  2X7Q A;  4PAF A;  1GTK A;  4KFQ A;  2HEU A;  3PU5 A;  5L9S A;  3MW0 A;  1UIU A;  4ELQ A;  1YXI A;  3QIM A;  4N13 A;  4ELO A;  1FTO A;  4FJP A;  3H7M A;  1NH7 A;  2JJK A;  3O29 A;  2X7P A;  4G8M A;  4OYV A;  4PDH A;  3SER A;  4RNS A;  2QL3 A;  4BDO A;  1YAE A;  4KYE A;  3FAT A;  2DDK A;  3KBZ A;  1IZ1 A;  3ZSF A;  1FJ6 A;  4N8G A;  4PFR A;  3EF7 A;  2HHM A;  2RC7 A;  1N0T A;  4F22 A;  1FPJ A;  4X1B A;  4LP2 B;  2GHB A;  4XFE A;  1M5E A;  4ESW A;  3A09 A;  1GVC A;  3K0V A;  4U4X A;  1FQD A;  4X9T A;  1FBG A;  4IO2 A;  1FQA A;  4N4U A;  4KD5 A;  3DLN A;  3K1M A;  3VVE A;  1OLA A;  1BTJ A;  3K6X A;  2DQV A;  2DS9 A;  3IL1 B;  4JWO A;  3IFC A;  2RKM A;  1OIB A;  1VR5 A;  4U2R A;  3A29 A;  4G68 C;  4PTK A;  2V3U A;  2H99 A;  5IAI A;  4RXL A;  2FYI A;  2W7Y A;  3IFA A;  1NUY A;  1P1W A;  3HHF A;  4G68 B;  3CSB A;  4DXC A;  2QS2 A;  3U72 A;  4NF8 B;  3KSX A;  1Z7M E;  4WED A;  1O64 A;  3DP4 A;  5IZ3 B;  4KHZ E;  3KJT A;  2P0S A;  3NOH A;  3TTR A;  3U94 A;  1SVX B;  3CSG A;  5ET7 A;  4ZE9 A;  3DP8 A;  2XX7 A;  2XXY A;  4DXB A;  1NV3 A;  2Y7R A;  3KGC A;  1FCK A;  4HCW A;  1NUZ A;  3KBR A;  4JSO A;  2XXT A;  1URG A;  2F7B A;  4N8Y A;  1NV0 A;  3H3G A;  2PVU A;  1B58 A;  4P1L A;  2B65 A;  3BKI B;  4OVR A;  1MDQ A;  4YKI A;  5H8Q B;  1WOD A;  1GR2 A;  4NX1 A;  3WAE A;  4UAC A;  4N81 A;  4BDL A;  1FTM A;  1DPP A;  3LV0 A;  3TTM A;  1PDA A;  2DP8 A;  5I56 B;  5H8S A;  3ILT B;  4EF2 A;  5J1D A;  4MLQ A;  4YKK A;  5JEI A;  4XXU A;  2OCU A;  2XD2 A;  1KZ8 A;  3ISP A;  2IEE A;  4PFY A;  1FBP A;  1IUD A;  4LAT A;  4F3B A;  3CG3 A;  1FQB A;  2RC9 A;  3B7D A;  4KR5 A;  4R6Y A;  2NVU B;  4GBV A;  3BFU A;  1WVJ A;  3UGW A;  1K9Y A;  2CZH A;  3FVO A;  4PFT A;  5F7V A;  3RPW A;  5FHN A;  2ZNT A;  4MJO A;  5I57 B;  2Q89 A;  2R6G E;  5IKB A;  1EZP A;  1ZTY A;  4H8I A;  2GHA A;  2CZL A;  3TQW A;  2X26 A;  3MVW A;  1DOT A;  4XKR A;  3OOA A;  4PFW A;  2Y7W A;  1LB9 A;  4OAN A;  1MM6 A;  4R6H A;  4ELP A;  2F36 A;  5A5L A;  1EYK A;  3E3K A;  1NH8 A;  1GV8 A;  3TTN A;  3FBP A;  4O7I A;  2IA4 A;  2Y5K A;  3T22 A;  4QFP A;  3PPP A;  4IR8 A;  1MG1 A;  1RDZ A;  2CEX A;  4H6D A;  4PE3 A;  5FBP A;  2ZNS A;  4KPT A;  4NF5 B;  4I3E A;  1P99 A;  1B7Z A;  1RDX A;  2YLN A;  3C4M A;  1JQF A;  4X8R A;  3PPR A;  4U1O A;  4JVC A;  2P3N A;  4ZZE A;  4BDN A;  2QVR A;  2R9J A;  5F24 A;  1FTL A;  5M2V A;  3S9E A;  5BWJ A;  3FGS A;  3PUX E;  1SI0 A;  3B6Q A;  1L5T A;  5AA3 A;  2H25 A;  2DWI A;  2QJE A;  2XXK A;  4XIG Q;  4R74 A;  1I6A A;  3C36 A;  3C35 A;  1D9Q A;  3FV1 A;  2ZYM A;  4MEV A;  3RPL A;  4OET A;  1QUI A;  5IZZ A;  2ZYO A;  3G3I A;  3HHG A;  2I4C A;  4FOR A;  5FHO A;  5L9O A;  4PGP A;  2XWK A;  1XT8 A;  2GFE A;  3IOV A;  1MY2 A;  1SW2 A;  2F5X A;  1VDW A;  1EYJ A;  1PBQ A;  3IR1 A;  2MKZ A;  1UQW A;  4FIM A;  1DCU A;  1Y1M A;  4R9F A;  1SI1 A;  4NAP A;  2DWJ A;  1MXV A;  4QSD A;  5I58 B;  5EYF A;  3MP8 A;  4GWS A;  4G68 A;  3MYU A;  4GWX A;  3VFJ A;  4NF8 A;  3TTL A;  5TU0 A;  1PC3 A;  2ZZX A;  3QK6 A;  1IIW A;  3F11 A;  1MQJ A;  1MY0 A;  1MXW A;  4I40 A;  2VGQ A;  2DWA A;  3KSJ A;  4KCD A;  5IZ3 A;  1US4 A;  4PCD A;  3FXB A;  1A8E A;  1LCF A;  3CRB A;  2G29 A;  2VOZ A;  1QUJ A;  2HPG A;  4O94 A;  1FW0 A;  3USD A;  1IXC A;  2XWO A;  1B1H A;  2OWZ A;  2OZZ A;  4NF4 A;  4NGU A;  2H5Y A;  4OHN A;  4GWW A;  1QUK A;  3FJM A;  1XVY A;  5H8Q A;  4QHQ A;  4ZE8 A;  3VLU A;  4EF1 A;  1A54 A;  5I5P A;  4NQ8 A;  3SEV A;  3TEP A;  4PAK A;  4HCY A;  1FPB A;  4KYD A;  1JW1 A;  5I56 A;  5LOM A;  1N3X A;  2REJ A;  2F7C A;  1CB6 A;  3CG1 A;  3SEX A;  1B4H A;  4GD5 A;  2CZI A;  5ITP A;  3G3G A;  3TYH A;  1I6Q A;  5DTB A;  3EHS A;  2QMX A;  2DE3 A;  1B6H A;  1URS A;  5CMB A;  4Q5T A;  3PMX A;  1FTK A;  4JSD A;  2Z23 A;  2P1S A;  3HST A;  1IME A;  2UVH A;  5EYH A;  4LUB A;  2O1M A;  4PC9 A;  2PT2 A;  1B9J A;  1XOC A;  1S7Y A;  3TMG A;  3PTY A;  1J1N A;  4JVD A;  4NF0 A;  4F3P A;  4U21 A;  4QFN A;  4QFK A;  3TEL A;  2HZL A;  1NMU A;  1MM7 A;  1BK4 A;  4X48 A;  1A8F A;  2E0S A;  4H46 A;  5EYG A;  2O7I A;  4N07 A;  3MZB A;  1R9Q A;  4XKQ A;  5L8D A;  4HE0 A;  3KJ7 A;  2PCR A;  1EZ9 A;  2KR0 A;  2Y84 A;  3C33 A;  1P1O A;  3P7I A;  1ZKB A;  4PF6 A;  1FPK A;  3K01 A;  2XXP A;  1D4N A;  1ATG A;  3MPL A;  5CM6 A;  1ZBM A;  4PFI A;  1AH5 A;  4N17 A;  3RQT A;  2FIE A;  1F9B A;  2KQZ A;  2F8D A;  3E13 X;  1LAH E;  3WAF A;  1VFE A;  1CE2 A;  1TFA A;  5HM4 B;  2AYS A;  4C1T A;  1R1N A;  4NWC A;  5H8N A;  2VPN A;  1B5I A;  4R2B A;  4OEU A;  3EHT A;  3MPK A;  2RC8 A;  1KA1 A;  3K02 A;  3T9H B;  1B46 A;  4FE8 A;  3RY3 A;  4H45 A;  3KC0 A;  1NV4 A;  3OO7 A;  2UVG A;  3IOT A;  4Z0I A;  4LZ8 A;  2ZXT A;  1A7L A;  4DIG A;  4NE4 A;  2XX9 A;  1LBY A;  4N6K A;  4O8M A;  3W9V A;  4GX4 A;  2I0B A;  3H6U A;  3KC1 A;  2F34 A;  2ZZW A;  3VLV A;  1D9Y A;  2ZNU A;  3QAX A;  2V3Q A;  4H67 A;  1TXF A;  4GF8 A;  1UTB B;  3RGY A;  3K1P A;  4P0G A;  1EZO A;  5ICT A;  2XX8 A;  4MX6 A;  1ZU0 A;  2FBP A;  1NL5 A;  1MXY A;  5I58 A;  4H8J A;  4JB7 A;  4FAJ A;  1ZMG A;  4LQ5 A;  3M3K A;  4RA1 A;  1MPC A;  5JK4 A;  1AIV A;  4XKP A;  1IMD A;  3PV0 E;  1QGX A;  3JYR A;  1OVB A;  1DTG A;  5AA1 A;  3VVD A;  3KOT A;  1B1X A;  3TOD A;  2XXX A;  1B32 A;  1B3F A;  3TAJ A;  1A55 A;  4E0X A;  3MJN A;  2Z8D A;  3T93 B;  3G3J A;  3IB1 A;  1N76 A;  1YZ0 A;  4G61 A;  3W15 C;  2B3F A;  3PUW E;  4M1V A;  2QS1 A;  2UVI A;  4YZZ A;  4TLL B;  3HO7 A;  4GXA A;  1NV6 A;  5DEX B;  2VD2 A;  4QF9 A;  4FED A;  1MS7 A;  5KCJ B;  1NNK A;  1LGB C;  3ZKL A;  2D3I A;  4F1Y A;  4DDD A;  1I6B A;  4U22 A;  3PGF A;  1Y3P A;  3LUZ A;  2Z8E A;  5H8F B;  5ET5 A;  5KDT B;  5AE4 A;  3CFZ A;  1R6Z A;  5ET6 A;  1LBX A;  1B3G A;  1INP A;  2GQ1 A;  4LZ5 A;  1N3W A;  2O84 X;  3T9V A;  4ZEB A;  4QFO A;  1M5F A;  3OSR A;  3T1B A;  4EXL A;  4YIC A;  3FJ7 A;  2NWJ A;  3LC8 A;  3MP6 A;  2V84 A;  4ZED A;  5CMK A;  3SET A;  2Z8F A;  3RT8 A;  1MQG A;  3G3H A;  4LZ7 A;  3RUM A;  2V3T A;  1B5H A;  1JET A;  1I69 A;  2V93 A;  4ZEK A;  3UK4 A;  3EKI A;  2OBG A;  4RYA A;  1FBH A;  4ISU A;  4ND9 A;  1UTH B;  3GYY A;  1NV5 A;  5K2Y A;  3QYT A;  5CBR A;  1XHY A;  1B52 A;  3HPI A;  1G0I A;  1XC1 A;  1US5 A;  4IB2 A;  3SDF A;  3ZS6 A;  4P9K A;  1LFI A;  3G3K A;  3SES A;  2DOJ A;  3SEW A;  2D5W A;  4R9G A;  3IOR A;  2AL5 A;  4ELR A;  4ONY A;  2THI A;  3N6T A;  1SD3 A;  2A5T A;  3N6U A;  2H98 A;  2Y7I A;  3N26 A;  4QXD A;  2H9B A;  3KN3 A;  4P11 A;  3L6G A;  2FNC A;  2D21 A;  1LLS A;  2F6G A;  3OEK A;  2GRV A;  4IO6 A;  1FBC A;  2XXI A;  5IZ1 A;  3G3F A;  2H4I A;  2XXU A;  1EH3 A;  3MZ1 A;  3TUS A;  2VD3 A;  5CBS A;  3CI8 A;  3FVK A;  4LA9 A;  4OES A;  1LCT A;  3GLB A;  2XXV A;  1RYO A;  4H1X A;  1SDX A;  2PMS A;  1VE4 A;  4ZS9 A;  4Q0C A;  2PT1 A;  2L5V A;  2RCA A;  4GX6 A;  1KA0 A;  3B8B A;  3ZKK A;  3IOW A;  4GOT A;  5TP9 B;  4G8H A;  3A3C A;  3S9N C;  3MVZ A;  2ZZV A;  4H0W A;  1B2H A;  4ECF A;  1D9V A;  4YKP A;  3IB0 A;  1UTB A;  3LSW A;  4BDR A;  1TWY A;  2O6A A;  4TLM B;  1IEJ A;  4GX3 A;  1M5D A;  3C34 A;  4KI0 E;  1B0H A;  4YB5 A;  1PB9 A;  4ZEF A;  1II5 A;  1JVY A;  4H65 A;  1JVX A;  3UP9 A;  4MBP A;  1IMF A;  1NNT A;  4OA4 A;  4GVO A;  4IY6 A;  1LBZ A;  2FIX A;  3BIG A;  4F1V A;  3VVF A;  4QRZ A;  2E1S A;  3MST A;  2WX9 A;  3O9P A;  4PFB A;  3H03 A;  4LVQ A;  2BJI A;  1FRP A;  3OEM A;  2QFL A;  4H5F A;  4FEB A;  1MH3 A;  4YU0 A;  1DMB A;  4OMB A;  2DE2 A;  4I9D A;  1FJ9 A;  4JVI A;  4PQJ A;  2F3D A;  5A5X B;  3B6W A;  3N94 A;  1JEV A;  1VFD A;  1FPE A;  5B7D A;  1M5B A;  5DEX A;  4EUO A;  2DVZ A;  4F39 A;  3S9M C;  1H43 A;  4EQ7 A;  5KCJ A;  4Q30 B;  4GWO A;  1LAG E;  2HCA A;  5IGA A;  1G0H A;  2QSX A;  3IK6 B;  4OER A;  2OJT A;  4GWY A;  1URD A;  1AWB A;  1N7X A;  4NF6 B;  2ANJ A;  1JEU A;  4QBA A;  4UAB A;  3RTF B;  5H8F A;  1MPD A;  2F78 A;  5KDT A;  3RTW B;  3HV1 A;  3QXM A;  3K6W A;  3Q27 A;  1DK4 A;  4R2F A;  1HSJ A;  2WEF A;  1MY1 A;  4F31 B;  3V8X B;  1IXI A;  1H45 A;  4ZDM A;  4G77 A;  5LTC A;  1QKA A;  1LBB A;  4IGT A;  4DXU A;  3UN6 A;  2LAO A;  1FQF A;  1JW4 A;  4PGN A;  2B4L A;  4KXP A;  3TCH A;  4U1Z A;  2WYP A;  4G8N A;  4GXS B;  2P2A A;  5BUU A;  4GFR A;  4HW8 A;  4P47 A;  3GBA A;  1BLF A;  3I6V A;  1AMF A;  1B0L A;  2A5S A;  3VLW A;  1XVX A;  4EDP A;  1IMC A;  2OK2 A;  1N84 A;  1IQ7 A;  3R26 A;  4HS7 A;  1UTH A;  4GWU A;  4WEP A;  4Q8R A;  4PE5 B;  3MUQ A;  1EYI A;  1IXH A;  4FBP A;  4THI A;  3PD9 A;  3PPQ A;  3M3F A;  1H44 A;  2UYE A;  1P1U A;  3JV9 A;  3ECR A;  5EHS A;  4H5G A;  2O7U A;  5EHM A;  4PFU A;  3TPA A;  4OVJ A;  3VXC A;  4JXI A;  1N7W A;  2ZYK A;  2G93 A;  1PEB A;  3VDF A;  2OLB A;  1RYX A;  1MQH A;  3KG2 A;  4IGR A;  3H4Z A;  2Q9T A;  3MVY A;  2OWT A;  5DVJ A;  4YMB A;  5JTY B;  4GWZ A;  3LSX A;  2F35 A;  3OEL A;  4TQU Q;  2UXA A;  3ILU B;  2DSF A;  3IO6 A;  2Y7P A;  2VT5 A;  3U1O A;  1ZLQ A;  3BIH A;  3IAZ A;  4GBW A;  3U8Q A;  5IM2 A;  2RIN A;  5I57 A;  3K1N A;  3HFU A;  3R6U A;  4XF5 A;  4RPN A;  2BJJ X;  3RT6 B;  1LBC A;  1NUX A;  4XEQ A;  5ICQ A;  2F6P A;  4MH5 A;  3MP1 A;  2I4B A;  3I3V A;  1NI9 A;  3FJG A;  3UOR A;  1H3D A;  1QUL A;  1Y3N A;  2WYK A;  1IMA A;  4OFO A;  3RNN A;  4AB5 A;  4QSE A;  4OQO A;  5TP9 A;  1LB8 A;  3IO4 A;  4U23 A;  1ZJL A;  3JZJ A;  4PDD A;  3OO8 A;  4O3A A;  1O63 A;  1SYH A;  1IIT A;  4OZ9 A;  3LUY A;  4I8C A;  1B40 A;  4DZ1 A;  4FEC A;  1Y4T A;  3K00 A;  3M8U A;  4K3F A;  1A99 A;  4NF5 A;  1NNF A;  3MAM A;  2HAV A;  4UA8 A;  2HZK A;  1FQE A;  4C0R A;  3PUY E;  2PYY A;  1LEV A;  2AIX A;  1B51 A;  3K2D A;  1Y20 A;  4HE1 A;  4PAI A;  3H06 B;  4YMA A;  4I62 A;  3TQL A;  1YPN A;  1ELJ A;  1FPG A;  2XWI A;  1SBP A;  3MBP A;  1LAF E;  3EHU A;  4WKM A;  1POT A;  4GLI A;  4PP0 A;  5A5X A;  2Y7K A;  1LFG A;  4DE8 A;  2DWH A;  3LSF B;  4RPO A;  3CFX A;  5EQ7 A;  5I2N B;  3MQ9 A;  4O3C A;  5EQA A;  5F1Q A;  2XHD A;  3KOS A;  3MWB A;  2O1L A;  5ITO A;  4BLA A;  3K6U A;  2VP1 A;  4F29 A;  2UVJ A;  4NF6 A;  5DT6 A;  3T96 B;  3CFL A;  5CC2 A;  3W9W A;  1MY4 A;  1USY H;  1YCJ A;  2NXO A;  1S9T A;  2PFY A;  3Q25 A;  2HXW A;  4P8B A;  1WDN A;  3FV2 A;  3KN8 A;  3PMV A;  5ET8 A;  2XXH A;  4RK2 A;  3Q26 A;  3GBB A;  3O97 A;  3FVN A;  3EQ1 A;  3HN0 A;  4GL0 A;  3ROJ A;  4RK9 A;  3MZ9 A;  3A3U A;  4JBZ A;  4NMY A;  3FXR A;  4C1U A;  1MY3 A;  4OEN A;  4AB6 A;  4F18 A;  3FUZ A;  4IO5 A;  2R8T A;  3CHG A;  2Q8J A;  4GRK A;  1ZIU A;  2O69 A;  2O68 A;  1NV2 A;  5I59 B;  3D4G A;  2F7A A;  4OVS A;  3OD7 A;  1ANF A;  2QPQ A;  3S4U A;  3RPL B;  1PB8 A;  3VV5 A;  4KQP A;  4PET A;  3E9X A;  1R9L A;  2QRY A;  4MNC A;  4O7M A;  1DTZ A;  2XWV A;  1HSL A;  1LAX A;  2CZK A;  4LN5 A;  3H6T A;  1MPB A;  2ONR A;  3AXF A;  2ALU A;  4AS4 A;  1MQD A;  5I7I A;  5DVI A;  1DPE A;  3CR9 A;  2YJP A;  1MXU A;  1Y3Q A;  4NN3 A;  5CMC A;  3H6V A;  1JW5 A;  1PB7 A;  1XS5 A;  1M5C A;  4KYS A;  1MRP A;  4JWX A;  1IMB A;  3Q29 A;  1KWH A;  3O6I A;  2WBB A;  1AL3 A;  5JTY A;  3QUJ A;  4I3Y A;  5DYH A;  2ONS A;  1OVT A;  3MVX A;  3SKP A;  2UYF A;  4OFL A;  1Q9D A;  1FBF A;  4X04 A;  3ONM A;  1XI6 A;  3HCQ A;  2DE4 A;  4P1E A;  1FBD A;  3OXN A;  3G7W A;  4OEV A;  1YYZ A;  3DM0 A;  4HXV A;  4NF4 B;  3LR1 A;  4N15 A;  3TCG A;  2QMW A;  3K4U A;  2GH9 A;  1SPI A;  4MIJ A; 
#chains in the Genus database with same CATH homology
 3PPN A;  1TFD A;  4NTL A;  3RN8 A;  3TFL A;  3UIF A;  4DCX A;  5CMM A;  2DXR A;  3THI A;  3EPE A;  1Q1K A;  4YAH X;  5I2K B;  4IO7 A;  3C32 A;  1UIV A;  5AA2 B;  1Y1Z A;  2XXR A;  1B7H A;  4QSC A;  4O3B A;  4MLV A;  4QFL A;  2M8C A;  5I84 A;  4NWD A;  3S2V A;  1MH4 A;  3C9H A;  1Y9U A;  2QS4 A;  1OMP A;  2Q2A A;  3L6H A;  3QUF A;  4F3G A;  3TCF A;  2I0C A;  2HQ0 A;  3DEL B;  5AA2 D;  2NOO A;  1MXX A;  1B05 A;  5FTI A;  4I1D A;  4POW A;  1SW1 A;  4OWD A;  3V89 B;  1Y4C A;  1IXG A;  3SEY A;  3TZA A;  3VE1 B;  3O2A A;  3IB2 A;  2OWS A;  3PD8 A;  5I2N A;  1QVS A;  2RCB A;  1B4Z A;  5HBC A;  4U4S A;  4GIZ A;  2PBW A;  3OO6 A;  2XXQ A;  4R72 A;  3V83 A;  3E4R A;  3T66 A;  3U93 A;  5KZT A;  4FAT A;  2QS3 A;  1BKA A;  2B3B A;  3SEU A;  2PX1 A;  4RJZ A;  5L9M A;  1SW5 A;  5TPA B;  1N04 A;  1P1Q A;  1SQY A;  4KCC A;  4DLD A;  1MXZ A;  1OQH A;  3O28 A;  2DVC A;  3D4C A;  5H8N B;  5H8H B;  5AA4 B;  2RF1 A;  4OTE A;  1OQG A;  4RY1 A;  1VSO A;  3IOU A;  3ODB A;  3OEN A;  3FZV A;  3S9L C;  3FAS A;  1EU8 A;  2DYX A;  4YKJ A;  5I59 A;  4WXJ A;  4F2O A;  4AQ4 A;  4ZEC A;  3BFT A;  4DCY A;  3PUV E;  1T0K A;  5K2X A;  1S50 A;  4YB6 A;  5DVF A;  5FHM A;  4BDM A;  5CRY A;  2I58 A;  4EXK A;  2REG A;  4EQB A;  1B7U A;  4TOZ A;  2ZYN A;  3KEI A;  3PPO A;  2R71 A;  1P1N A;  1AOV A;  5FTH A;  2Q2C A;  3O6G A;  3VXB A;  3T9U A;  4ZEI A;  1QW0 A;  1MQI A;  3KN7 A;  3UA8 A;  3O6H A;  4POX A;  3TDJ A;  3PMW A;  3FXQ A;  3T9X B;  1B3L A;  3OMB A;  2HFB A;  3IJX B;  2KLF A;  4E0W A;  3O66 A;  3RLF E;  1LFH A;  3GXA A;  3U92 A;  1JNF A;  4P0I A;  1SYI A;  4MFI A;  2FA7 A;  3PUZ E;  3B6T A;  4HTG A;  3DP6 A;  1B5J A;  4XTC Q;  5CI5 A;  3TTK A;  1NFT A;  1H76 A;  4IO3 A;  1B3H A;  1QKB A;  3N5L A;  2V25 A;  2CMO A;  1NNP A;  3EN3 A;  3M3L A;  2I3W A;  2AL4 A;  3Q28 A;  2I6E A;  4G4P A;  1RKM A;  1POY 1;  2I48 A;  4YB7 A;  1BIY A;  1FQC A;  4GL8 A;  4R6K A;  1GGG A;  5I2K A;  3FD3 A;  1A40 A;  1O7T A;  2XD3 A;  2HAU A;  5AA2 A;  3FVG A;  2YPN A;  3FIR A;  5ISU A;  1QJM A;  4F3S A;  5ELV A;  2F97 A;  1MDP 1;  5HPQ A;  3OO9 A;  3TKD A;  4OFJ A;  3KZG A;  3R7X A;  1B3E A;  1Q35 A;  4N6P A;  1HSE A;  3V5A A;  3I5O A;  2WKY A;  1BP5 A;  3CIJ A;  2I49 A;  4L17 A;  1NKX A;  2ZMB A;  4IO4 A;  4G2Z A;  1FTJ A;  1YTV A;  2Q88 A;  1D3K A;  2NUV A;  3QSL A;  4XKN A;  4OXV A;  3C31 A;  3CVG A;  3K6V A;  3IX1 A;  3FXU A;  2O51 A;  1TT1 A;  1Z7N E;  4IY5 A;  2ESN A;  2ABH A;  2I3V A;  2VHA A;  4ESX A;  4M4G A;  1LST A;  3MC2 A;  4MF3 A;  2A5T B;  4BDQ A;  5TPA A;  3KFM A;  4GQO A;  4EQ9 A;  5B70 A;  2Z22 A;  3BBR A;  1OLC A;  4R75 A;  4F1U A;  1PBP A;  3LSL A;  2DXY A;  4R73 A;  4LQ2 A;  5H8H A;  4JDF A;  3OSQ A;  5AA4 A;  2XXW A;  1DSN A;  3H6W A;  4JWY A;  4ZZA A;  3LBS A;  3GZG A;  4LON B;  1SW4 A;  4F19 A;  4NED A;  2ONK E;  1USY E;  4F2Q A;  4Z7E A;  4X1D A;  3IJO B;  2X7Q A;  1GTK A;  4KFQ A;  2HEU A;  3PU5 A;  5L9S A;  3MW0 A;  1UIU A;  4ELQ A;  3QIM A;  4N13 A;  4ELO A;  1FTO A;  4FJP A;  3H7M A;  1NH7 A;  3O29 A;  2X7P A;  4G8M A;  4OYV A;  3SER A;  4RNS A;  2QL3 A;  4BDO A;  1YAE A;  4KYE A;  3FAT A;  1IZ1 A;  3ZSF A;  3EF7 A;  2RC7 A;  1N0T A;  4F22 A;  4X1B A;  4LP2 B;  2GHB A;  1M5E A;  4ESW A;  3A09 A;  1GVC A;  3K0V A;  4U4X A;  1FQD A;  4X9T A;  4IO2 A;  1FQA A;  4KD5 A;  3DLN A;  3K1M A;  3VVE A;  1OLA A;  1BTJ A;  3K6X A;  2DQV A;  2DS9 A;  3IL1 B;  4JWO A;  2RKM A;  1OIB A;  1VR5 A;  4U2R A;  4G68 C;  2V3U A;  2H99 A;  5IAI A;  4RXL A;  2FYI A;  2W7Y A;  1P1W A;  3HHF A;  4G68 B;  3CSB A;  4DXC A;  2QS2 A;  3U72 A;  4NF8 B;  3KSX A;  1Z7M E;  4WED A;  1O64 A;  3DP4 A;  4KHZ E;  3KJT A;  2P0S A;  3TTR A;  3U94 A;  1SVX B;  3CSG A;  4ZE9 A;  3DP8 A;  2XX7 A;  2XXY A;  4DXB A;  2Y7R A;  3KGC A;  1FCK A;  4HCW A;  3KBR A;  4JSO A;  2XXT A;  1URG A;  2F7B A;  3H3G A;  2PVU A;  1B58 A;  2B65 A;  3BKI B;  1MDQ A;  4YKI A;  5H8Q B;  1WOD A;  1GR2 A;  3WAE A;  4UAC A;  4BDL A;  1FTM A;  1DPP A;  3TTM A;  1PDA A;  2DP8 A;  5I56 B;  5H8S A;  3ILT B;  4EF2 A;  5J1D A;  4MLQ A;  4YKK A;  5JEI A;  4XXU A;  2OCU A;  2XD2 A;  2IEE A;  4PFY A;  1IUD A;  4LAT A;  4F3B A;  3CG3 A;  1FQB A;  2RC9 A;  3B7D A;  4KR5 A;  4R6Y A;  2NVU B;  3BFU A;  1WVJ A;  3UGW A;  3FVO A;  4PFT A;  5F7V A;  3RPW A;  5FHN A;  2ZNT A;  5I57 B;  2Q89 A;  2R6G E;  5IKB A;  1EZP A;  1ZTY A;  4H8I A;  2GHA A;  2CZL A;  3TQW A;  2X26 A;  3MVW A;  1DOT A;  4XKR A;  3OOA A;  4PFW A;  2Y7W A;  1LB9 A;  4ELP A;  1MM6 A;  4R6H A;  2F36 A;  3E3K A;  1NH8 A;  1GV8 A;  3TTN A;  2IA4 A;  3T22 A;  4QFP A;  3PPP A;  1MG1 A;  4H6D A;  2ZNS A;  4KPT A;  4NF5 B;  1P99 A;  1B7Z A;  2YLN A;  3C4M A;  1JQF A;  3PPR A;  4U1O A;  4ZZE A;  4BDN A;  2R9J A;  1FTL A;  5M2V A;  3S9E A;  5BWJ A;  3FGS A;  3PUX E;  1SI0 A;  3B6Q A;  1L5T A;  5AA3 A;  2H25 A;  2DWI A;  2QJE A;  4XIG Q;  4R74 A;  1I6A A;  3C36 A;  3C35 A;  3FV1 A;  2ZYM A;  4OET A;  1QUI A;  2ZYO A;  3G3I A;  3HHG A;  2I4C A;  4FOR A;  5FHO A;  5L9O A;  1XT8 A;  2GFE A;  3IOV A;  1MY2 A;  1SW2 A;  2F5X A;  1PBQ A;  3IR1 A;  1UQW A;  4FIM A;  1Y1M A;  4R9F A;  1SI1 A;  2DWJ A;  1MXV A;  4QSD A;  5I58 B;  5EYF A;  3MP8 A;  4G68 A;  3VFJ A;  4NF8 A;  3TTL A;  5TU0 A;  1PC3 A;  3QK6 A;  1IIW A;  3F11 A;  1MQJ A;  1MY0 A;  1MXW A;  2VGQ A;  2DWA A;  3KSJ A;  4KCD A;  1US4 A;  1A8E A;  1LCF A;  3CRB A;  2G29 A;  2VOZ A;  1QUJ A;  1FW0 A;  3USD A;  1IXC A;  1B1H A;  2OZZ A;  4NF4 A;  2H5Y A;  4OHN A;  1QUK A;  3FJM A;  1XVY A;  5H8Q A;  4QHQ A;  4ZE8 A;  3VLU A;  4EF1 A;  1A54 A;  3SEV A;  3TEP A;  4HCY A;  4KYD A;  5I56 A;  1JW1 A;  5LOM A;  1N3X A;  2REJ A;  2F7C A;  1CB6 A;  3CG1 A;  3SEX A;  1B4H A;  4GD5 A;  5ITP A;  3G3G A;  3TYH A;  1I6Q A;  5DTB A;  3EHS A;  2QMX A;  2DE3 A;  1B6H A;  1URS A;  5CMB A;  4Q5T A;  3PMX A;  1FTK A;  4JSD A;  2Z23 A;  2P1S A;  3HST A;  2UVH A;  4LUB A;  2O1M A;  2PT2 A;  1B9J A;  1XOC A;  1S7Y A;  3TMG A;  1J1N A;  4F3P A;  4U21 A;  4QFN A;  4QFK A;  3TEL A;  2HZL A;  1NMU A;  1MM7 A;  4X48 A;  1A8F A;  2E0S A;  2O7I A;  4N07 A;  3MZB A;  1R9Q A;  4XKQ A;  5L8D A;  3KJ7 A;  1EZ9 A;  2Y84 A;  3C33 A;  1P1O A;  3P7I A;  1ZKB A;  3K01 A;  2XXP A;  1D4N A;  1ATG A;  3MPL A;  5CM6 A;  1ZBM A;  1AH5 A;  3RQT A;  1F9B A;  2F8D A;  3E13 X;  1LAH E;  3WAF A;  1VFE A;  1CE2 A;  1TFA A;  5HM4 B;  2AYS A;  4C1T A;  1R1N A;  4NWC A;  5H8N A;  1B5I A;  4R2B A;  4OEU A;  3EHT A;  3MPK A;  2RC8 A;  3K02 A;  3T9H B;  1B46 A;  4FE8 A;  3RY3 A;  3OO7 A;  2UVG A;  3IOT A;  4Z0I A;  4LZ8 A;  2ZXT A;  1A7L A;  4DIG A;  4NE4 A;  2XX9 A;  3W9V A;  2I0B A;  3H6U A;  2F34 A;  3VLV A;  1D9Y A;  2ZNU A;  3QAX A;  2V3Q A;  4H67 A;  1TXF A;  4GF8 A;  1UTB B;  3RGY A;  3K1P A;  4P0G A;  1EZO A;  5ICT A;  2XX8 A;  1ZU0 A;  1NL5 A;  1MXY A;  5I58 A;  4H8J A;  4JB7 A;  4FAJ A;  1ZMG A;  4LQ5 A;  3M3K A;  4RA1 A;  1MPC A;  5JK4 A;  1AIV A;  4XKP A;  3PV0 E;  3JYR A;  1OVB A;  1DTG A;  5AA1 A;  3VVD A;  3KOT A;  1B1X A;  3TOD A;  2XXX A;  1B32 A;  1B3F A;  3TAJ A;  1A55 A;  4E0X A;  3MJN A;  2Z8D A;  3T93 B;  3G3J A;  3IB1 A;  1N76 A;  3W15 C;  2B3F A;  3PUW E;  4M1V A;  2QS1 A;  2UVI A;  4YZZ A;  4TLL B;  3HO7 A;  4GXA A;  5DEX B;  2VD2 A;  4QF9 A;  4FED A;  1MS7 A;  5KCJ B;  1NNK A;  1LGB C;  3ZKL A;  2D3I A;  4F1Y A;  4DDD A;  1I6B A;  4U22 A;  3PGF A;  1Y3P A;  2Z8E A;  5H8F B;  5KDT B;  5AE4 A;  3CFZ A;  1R6Z A;  1B3G A;  4LZ5 A;  1N3W A;  2O84 X;  3T9V A;  4ZEB A;  4QFO A;  1M5F A;  3OSR A;  4EXL A;  4YIC A;  3FJ7 A;  2NWJ A;  3LC8 A;  3MP6 A;  2V84 A;  4ZED A;  5CMK A;  3SET A;  2Z8F A;  3RT8 A;  1MQG A;  3G3H A;  4LZ7 A;  3RUM A;  2V3T A;  1B5H A;  1JET A;  1I69 A;  2V93 A;  4ZEK A;  3UK4 A;  2OBG A;  4RYA A;  4ISU A;  4ND9 A;  1UTH B;  5K2Y A;  3QYT A;  5CBR A;  1XHY A;  1B52 A;  3HPI A;  1XC1 A;  1US5 A;  4IB2 A;  3SDF A;  3ZS6 A;  1LFI A;  3G3K A;  3SES A;  2DOJ A;  3SEW A;  2D5W A;  4R9G A;  3IOR A;  2AL5 A;  4ELR A;  4ONY A;  2THI A;  3N6T A;  1SD3 A;  2A5T A;  3N6U A;  2H98 A;  2Y7I A;  3N26 A;  2H9B A;  3KN3 A;  4P11 A;  3L6G A;  2FNC A;  2D21 A;  1LLS A;  2F6G A;  3OEK A;  2GRV A;  4IO6 A;  2XXI A;  3G3F A;  2H4I A;  2XXU A;  1EH3 A;  3MZ1 A;  3TUS A;  2VD3 A;  5CBS A;  3CI8 A;  3FVK A;  4LA9 A;  4OES A;  1LCT A;  3GLB A;  2XXV A;  1RYO A;  4H1X A;  1SDX A;  2PMS A;  1VE4 A;  4ZS9 A;  4Q0C A;  2PT1 A;  2RCA A;  3ZKK A;  3IOW A;  4GOT A;  5TP9 B;  4G8H A;  3A3C A;  3S9N C;  3MVZ A;  4H0W A;  1B2H A;  4ECF A;  1D9V A;  4YKP A;  3IB0 A;  1UTB A;  3LSW A;  4BDR A;  1TWY A;  2O6A A;  4TLM B;  1IEJ A;  1M5D A;  3C34 A;  4KI0 E;  1B0H A;  4YB5 A;  1PB9 A;  4ZEF A;  1II5 A;  1JVY A;  4H65 A;  1JVX A;  3UP9 A;  4MBP A;  1NNT A;  4GVO A;  4IY6 A;  4F1V A;  3VVF A;  4QRZ A;  2E1S A;  3O9P A;  3H03 A;  4LVQ A;  3OEM A;  4H5F A;  4FEB A;  1MH3 A;  4YU0 A;  1DMB A;  4OMB A;  2DE2 A;  4I9D A;  4PQJ A;  5A5X B;  3B6W A;  3N94 A;  1JEV A;  1VFD A;  5B7D A;  1M5B A;  5DEX A;  4EUO A;  2DVZ A;  4F39 A;  3S9M C;  1H43 A;  4EQ7 A;  5KCJ A;  4Q30 B;  4GWO A;  1LAG E;  2HCA A;  2QSX A;  3IK6 B;  4OER A;  2OJT A;  1URD A;  1N7X A;  4NF6 B;  2ANJ A;  1JEU A;  3RTF B;  5H8F A;  1MPD A;  2F78 A;  5KDT A;  3RTW B;  3HV1 A;  3QXM A;  3K6W A;  3Q27 A;  4R2F A;  1HSJ A;  1MY1 A;  4F31 B;  3V8X B;  1IXI A;  1H45 A;  4ZDM A;  4G77 A;  1QKA A;  1LBB A;  4IGT A;  4DXU A;  3UN6 A;  2LAO A;  1FQF A;  1JW4 A;  3TCH A;  4U1Z A;  4G8N A;  4GXS B;  2P2A A;  5BUU A;  4GFR A;  4HW8 A;  3GBA A;  1BLF A;  3I6V A;  1AMF A;  1B0L A;  2A5S A;  3VLW A;  1XVX A;  4EDP A;  2OK2 A;  1N84 A;  1IQ7 A;  3R26 A;  4HS7 A;  1UTH A;  4WEP A;  4Q8R A;  4PE5 B;  3MUQ A;  1IXH A;  4THI A;  3PD9 A;  3PPQ A;  3M3F A;  1H44 A;  2UYE A;  1P1U A;  3JV9 A;  3ECR A;  5EHS A;  4H5G A;  2O7U A;  5EHM A;  4PFU A;  3TPA A;  4OVJ A;  3VXC A;  4JXI A;  1N7W A;  2ZYK A;  2G93 A;  1PEB A;  3VDF A;  2OLB A;  1RYX A;  1MQH A;  3KG2 A;  4IGR A;  3H4Z A;  2Q9T A;  3MVY A;  2OWT A;  5DVJ A;  4YMB A;  5JTY B;  3LSX A;  2F35 A;  3OEL A;  4TQU Q;  2UXA A;  3ILU B;  2DSF A;  3IO6 A;  2Y7P A;  3U1O A;  1ZLQ A;  3IAZ A;  3U8Q A;  2RIN A;  5I57 A;  3K1N A;  3R6U A;  4RPN A;  2BJJ X;  3RT6 B;  1LBC A;  5ICQ A;  2F6P A;  4MH5 A;  3MP1 A;  2I4B A;  3I3V A;  3FJG A;  3UOR A;  1H3D A;  1QUL A;  1Y3N A;  4OFO A;  3RNN A;  4AB5 A;  4QSE A;  4OQO A;  5TP9 A;  1LB8 A;  3IO4 A;  4U23 A;  1ZJL A;  3JZJ A;  3OO8 A;  4O3A A;  1O63 A;  1SYH A;  1IIT A;  4OZ9 A;  3LUY A;  4I8C A;  1B40 A;  4DZ1 A;  4FEC A;  1Y4T A;  3K00 A;  3M8U A;  4K3F A;  1A99 A;  4NF5 A;  1NNF A;  3MAM A;  2HAV A;  4UA8 A;  2HZK A;  1FQE A;  4C0R A;  3PUY E;  2PYY A;  2AIX A;  1B51 A;  3K2D A;  1Y20 A;  3H06 B;  4YMA A;  4I62 A;  3TQL A;  1YPN A;  1ELJ A;  1SBP A;  3MBP A;  1LAF E;  3EHU A;  4WKM A;  1POT A;  4GLI A;  4PP0 A;  5A5X A;  2Y7K A;  1LFG A;  4DE8 A;  2DWH A;  3LSF B;  4RPO A;  3CFX A;  5I2N B;  3MQ9 A;  4O3C A;  5F1Q A;  2XHD A;  3KOS A;  3MWB A;  2O1L A;  4BLA A;  5ITO A;  3K6U A;  2VP1 A;  4F29 A;  2UVJ A;  4NF6 A;  5DT6 A;  3T96 B;  3CFL A;  5CC2 A;  3W9W A;  1MY4 A;  1USY H;  1YCJ A;  2NXO A;  1S9T A;  3Q25 A;  2HXW A;  1WDN A;  3FV2 A;  3KN8 A;  3PMV A;  2XXH A;  4RK2 A;  3Q26 A;  3GBB A;  3O97 A;  3FVN A;  3EQ1 A;  3HN0 A;  4GL0 A;  4RK9 A;  3MZ9 A;  3A3U A;  4JBZ A;  4NMY A;  3FXR A;  4C1U A;  1MY3 A;  4OEN A;  4AB6 A;  4F18 A;  3FUZ A;  4IO5 A;  2Q8J A;  4GRK A;  1ZIU A;  2O69 A;  2O68 A;  5I59 B;  3D4G A;  2F7A A;  3OD7 A;  1ANF A;  2QPQ A;  3S4U A;  1PB8 A;  3VV5 A;  4KQP A;  4PET A;  3E9X A;  1R9L A;  2QRY A;  1DTZ A;  1HSL A;  1LAX A;  3H6T A;  1MPB A;  2ONR A;  3AXF A;  2ALU A;  1MQD A;  5DVI A;  1DPE A;  3CR9 A;  2YJP A;  1MXU A;  1Y3Q A;  5CMC A;  3H6V A;  1JW5 A;  1PB7 A;  1XS5 A;  1M5C A;  4KYS A;  1MRP A;  4JWX A;  3Q29 A;  1KWH A;  3O6I A;  1AL3 A;  5JTY A;  3QUJ A;  5DYH A;  2ONS A;  1OVT A;  3MVX A;  3SKP A;  2UYF A;  4OFL A;  3ONM A;  3HCQ A;  2DE4 A;  3OXN A;  3G7W A;  4OEV A;  3DM0 A;  4NF4 B;  3LR1 A;  3TCG A;  2QMW A;  3K4U A;  2GH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...