4C1TA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with arabinoxylotriose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Transport protein
molecule keywords SUGAR TRANSPORTER SOLUTE-BINDING PROTEIN
total genus 132
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1tA02
3TUSA 2DWAA 3PMVA 4G8NA 4JWXA 1QULA 4NF8A 4FECA 3TTNA 5F1QA 4M1VA 4R75A 4R6HA 4LZ8A 4F18A 1Y3QA 3SDFA 5B7DA 5H8NB 2Y7KA 2XHDA 3PGFA 4XKRA 4RYAA 4KYEA 2YPNA 4H8IA 3QYTA 2I4BA 1AMFA 4NF4B 3LUYA 5DVIA 1ANFA 1SDXA 1Z7ME 2F8DA 1FTLA 1NH8A 5HPQA 2AIXA 3VXBA 3S4UA 4AB5A 1BTJA 4F2OA 1PB9A 1Y4TA 3EF7A 4JWYA 2ALUA 3UIFA 4TQUQ 4F22A 4ZE8A 4N6PA 1YCJA 5I57A 5CMMA 1B52A 2VHAA 4BDOA 4YMBA 2QPQA 3CRBA 3GBAA 2XX8A 2ZYMA 5AA3A 4F3PA 5ELVA 5JEIA 2UVJA 3OD7A 3RPWA 1FTMA 1Q1KA 1MY1A 1PDAA 2W7YA 1J1NA 4G68C 4I1DA 3G3KA 5K2XA 2P2AA 3RT8A 3HHGA 1B5IA 4P0GA 2GHAA 2O7UA 4Q0CA 1OVTA 2XD2A 4PETA 4QFLA 3EPEA 4H0WA 2PX1A 4X1BA 4EQ9A 4JSDA 2F7BA 3S9EA 2I0BA 3FZVA 2ZYKA 3PUZE 3JZJA 4LZ7A 2AYSA 3SESA 1LB8A 2QS3A 4LONB 2Z22A 3JV9A 1B1XA 1A54A 2PBWA 2DS9A 3MVXA 5L8DA 3VXCA 4C1TA 4ZEFA 1SW1A 1MG1A 3CIJA 4QSDA 5H8FB 5AE4A 1P1WA 2QL3A 4QFNA 2M8CA 4IO3A 1S9TA 1PB8A 1ZLQA 2V84A 2F7AA 3RTFB 1FQCA 1R9QA 4I8CA 1B3GA 4OENA 5AA4A 4KR5A 3LSXA 1XT8A 2Q9TA 5H8QA 3S2VA 4EQ7A 3D4CA 4DDDA 4F29A 4QFPA 3LSFB 3D4GA 4JDFA 1B40A 4R9GA 4KCDA 3C4MA 1FQDA 4OVJA 3ILUB 3SEXA 1FQFA 4M4GA 3KN8A 1LAHE 2DQVA 2Z8EA 1OQGA 1YAEA 1SQYA 4WXJA 3OXNA 4YU0A 1I6BA 3TFLA 3K00A 2OWSA 1FCKA 1QUJA 1NMUA 5TU0A 4XTCQ 3KOTA 5AA1A 3LSWA 3QK6A 2PMSA 1NNTA 3ILTB 4DE8A 3C31A 2G93A 3KN7A 3OSQA 3QAXA 2F5XA 4OESA 1NNKA 1PBQA 1XS5A 2QJEA 2RKMA 4R73A 4WEPA 1DTGA 2RF1A 1Y3NA 5FTIA 4LVQA 3UP9A 5I59A 4NE4A 4R74A 2I49A 4U4XA 4QSEA 1MS7A 5EHMA 1N3WA 2FA7A 2IA4A 4QRZA 1I6AA 2HQ0A 2P1SA 4FE8A 1MPDA 2THIA 1SI0A 1RYXA 3FVNA 3IO6A 3TMGA 3FV2A 3N5LA 1LGBC 4JB7A 5KDTA 2O7IA 2DE4A 2OZZA 1DTZA 4K3FA 3TTRA 1Y1ZA 1A7LA 5CMKA 2D5WA 3IJOB 5K2YA 3IJXB 3E13X 1PBPA 3MJNA 4EXKA 1JVXA 1OMPA 5DT6A 3C9HA 4JXIA 1MQGA 2QSXA 1DPPA 2X7PA 4F1VA 3CFXA 1L5TA 1HSJA 4ZEDA 3SERA 3QSLA 1TT1A 3UA8A 3GLBA 2A5TA 2XX9A 1MH3A 4POXA 2UYFA 4NMYA 5L9OA 1MY4A 2LAOA 4RNSA 5AA2A 3PV0E 3CR9A 4RPOA 2E0SA 3M8UA 1MPBA 3LR1A 4H8JA 3FJ7A 3OELA 5I58B 3UN6A 3T66A 5J1DA 1B9JA 1QUKA 1WVJA 2DVCA 2P0SA 3BBRA 3OO7A 4JBZA 4L17A 4GLIA 4O3AA 3VLUA 4OFOA 2XXPA 3TKDA 1AIVA 1NL5A 1GTKA 2XD3A 3IOUA 3PMWA 3PPRA 3CFLA 1R9LA 4PFTA 5CBSA 1B7UA 3A3UA 3G3FA 4QFOA 3V83A 1SYHA 4YKKA 4ZECA 1TFAA 5I57B 1O7TA 2Q8JA 3B7DA 4YKPA 3E4RA 5AA4B 1TFDA 3AXFA 2B3BA 2F34A 3CVGA 3QIMA 3ZKKA 5H8QB 3FVOA 2FNCA 2QS4A 3T22A 3W9VA 1F9BA 1DPEA 2QS1A 3PUXE 2QRYA 2XXRA 4IO7A 4H1XA 4RA1A 2FYIA 5EHSA 4YMAA 4XKNA 2ESNA 3MZ1A 2VD3A 1FQBA 3VVEA 3S9LC 1MH4A 1MDP1 1OLAA 4IO2A 1MQJA 3TDJA 3R7XA 4KQPA 5L9MA 4F39A 4BDLA 1UTBA 4KYSA 3TQWA 1LB9A 5AA2D 3L6GA 2Y7WA 3QUJA 1QKAA 2F6PA 3EHTA 5IKBA 1SI1A 3GXAA 1EH3A 4MLQA 5FTHA 2QMXA 2Q2AA 2XXVA 3HN0A 3Q26A 3R6UA 1N04A 4KFQA 3FIRA 4EF1A 5BWJA 1QKBA 1TXFA 3VLWA 5DTBA 4ZEIA 1IQ7A 4PFYA 3MVZA 2DWHA 4LATA 1EZ9A 1N3XA 3OENA 4OEVA 4FEBA 3OEMA 2CZLA 2D21A 2O51A 2XXQA 4AQ4A 4X9TA 1SYIA 3MAMA 4EUOA 2V3TA 2ZNTA 2AL5A 2VD2A 2DE2A 3H4ZA 1P1UA 3H06B 3K6XA 5CRYA 1R1NA 3IO4A 3PUYE 1LFHA 3GBBA 5EYFA 5DEXA 3MBPA 2ONRA 3VLVA 1IXGA 1ZU0A 1IXCA 3MQ9A 1A55A 3PPOA 4U2RA 1JQFA 1Y20A 4PQJA 1O64A 4KI0E 3U93A 3O6GA 3I6VA 3SEYA 3IK6B 3K1PA 3O2AA 1QJMA 4LA9A 5TP9B 3T96B 4R9FA 4YZZA 4OMBA 4DCXA 4G77A 1B6HA 1B5JA 1OVBA 1B58A 3SKPA 4NF5A 1H45A 3IX1A 2RCBA 1A8FA 1PB7A 4GFRA 4O3CA 2DP8A 2Y84A 4RK2A 5I2KB 3TYHA 1ZBMA 2NVUB 2DSFA 3DP4A 1JW5A 3RN8A 3RUMA 2ABHA 3M3KA 4GIZA 5KCJB 3N6UA 5I56A 1IZ1A 1VSOA 4YB6A 4KD5A 5BUUA 1JW1A 1NKXA 4HW8A 2Q89A 1LFIA 3L6HA 5JTYB 4GL0A 5H8SA 3N26A 3C33A 3IB1A 1LFGA 2ZNSA 3KFMA 3T9XB 1MRPA 4FIMA 3O28A 5I2NA 1MXVA 4PE5B 4ELOA 5FHNA 1H43A 4N07A 4R6YA 1SBPA 2X7QA 4MBPA 2I6EA 1LAFE 4POWA 4FAJA 3MZBA 4Z7EA 1MY0A 3FUZA 1MQIA 4U4SA 5KCJA 2O1MA 2RC8A 4EQBA 2DOJA 1ZKBA 1JVYA 4KHZE 4OQOA 1P1NA 5DVFA 1B3LA 3C32A 3FD3A 3RT6B 4OHNA 3W9WA 1M5CA 2RC9A 3TELA 2OLBA 3FVGA 5H8FA 3KG2A 3VVDA 3OOAA 1B3HA 2AL4A 3MP1A 3O6IA 1NH7A 3B6WA 2RINA 3IOWA 2HCAA 1IIWA 1NFTA 3PPNA 1JEVA 2I0CA 4ND9A 3PU5A 3CSBA 1EU8A 1S7YA 1II5A 3RQTA 2REGA 3IORA 4TLMB 3BKIB 3H6VA 3MP6A 1MY2A 4RXLA 1PEBA 5FHOA 2O84X 1SD3A 1MXWA 2HZKA 3CSGA 2DXRA 1LAGE 3KEIA 1SW5A 4QSCA 1B51A 2O1LA 3Q28A 4G8HA 2NWJA 4P0IA 1IITA 1MXYA 2H9BA 1VE4A 2F35A 1B1HA 4QHQA 1B05A 4U22A 1JETA 1ZIUA 2Y7PA 2H98A 1FW0A 3IOVA 4NF6B 3U72A 1VFEA 1TWYA 2XXHA 4HCYA 4UA8A 4DLDA 5ITPA 1GGGA 3PD9A 5HBCA 3TTMA 3K6VA 4NTLA 1D9YA 3FV1A 3WAEA 2GH9A 4BLAA 1URGA 3KZGA 4C1UA 5AA2B 2XX7A 4ZE9A 4LUBA 1M5EA 1WDNA 3DELB 4FJPA 4F1YA 5I2NB 2DWIA 4AB6A 1T0KA 2O6AA 1MQHA 1D9VA 3MUQA 4IGRA 4IY5A 1R6ZA 3T9HB 5JTYA 1SVXB 1UIUA 1N0TA 4HCWA 4OZ9A 4OTEA 1LAXA 2OBGA 2UVGA 5CMBA 4YAHX 3TCHA 3KSJA 2H5YA 3O97A 4TOZA 1QVSA 1RYOA 1FQAA 4XIGQ 1M5DA 5I84A 3C36A 2GFEA 4OETA 4XXUA 3HCQA 4WEDA 3WAFA 2ZNUA 4GOTA 3FXQA 4NF4A 3EQ1A 2H4IA 2X26A 2XXXA 4G8MA 1POY1 3HSTA 3H03A 3T9VA 5I56B 1O63A 2F36A 3K02A 2DE3A 4Z0IA 1DMBA 2Z23A 4F3BA 4Q8RA 5ICTA 3TQLA 3HO7A 4GXAA 5I2KA 2XXIA 1UQWA 5I59B 2NXOA 3PPQA 4IGTA 3TPAA 4XKQA 1SW2A 3CG3A 3S9NC 1GVCA 4QFKA 5CMCA 3VE1B 2DYXA 1UIVA 2I48A 1VFDA 1XHYA 2XXWA 3KGCA 3LSLA 4NWDA 1B3EA 1FTJA 2V3QA 4YICA 4DCYA 1IXHA 1FQEA 3A09A 3OEKA 4JSOA 4IO5A 4LZ5A 4MFIA 1MPCA 4P11A 1AL3A 4FEDA 2VGQA 3KJ7A 3MVYA 1ZMGA 3DP6A 5DVJA 4C0RA 3VDFA 4OEUA 3HV1A 1IEJA 3G3JA 4ESWA 1I6QA 3IR1A 5TPAB 3TTKA 3H6TA 3C34A 3MWBA 4OFLA 4GVOA 4DIGA 1D4NA 1FTKA 1ELJA 2ZMBA 5FHMA 4ZZAA 2WKYA 3FGSA 3U1OA 1IUDA 3EHSA 5CM6A 4WKMA 1B3FA 4F3SA 4OERA 3FATA 4UACA 5A5XA 3FASA 3MC2A 4GL8A 1B7ZA 1BP5A 1URDA 1MQDA 3HPIA 4QF9A 3F11A 2IEEA 1M5FA 3B6QA 3CG1A 2RCAA 3I3VA 1LBCA 1NNPA 4G4PA 2HXWA 1H76A 3O66A 2F6GA 3TCFA 2PT2A 3U94A 2QS2A 4LP2B 3PD8A 3RLFE 5CBRA 2UYEA 3K4UA 3MP8A 4O3BA 3VV5A 3O9PA 4R2FA 3EHUA 1YPNA 4H65A 3ZSFA 4DXBA 4EF2A 2V25A 3CI8A 3B6TA 3PPPA 4GXSB 4NEDA 2HZLA 2GRVA 4RPNA 4THIA 4F1UA 5A5XB 1XVYA 4Q30B 2H25A 3QUFA 4BDRA 4KPTA 2A5SA 4FATA 2PYYA 4KCCA 4F19A 3VFJA 3MZ9A 2YLNA 4ELRA 1MXXA 1Y1MA 2HAVA 2B65A 3KSXA 5DYHA 5H8NA 3O6HA 2UXAA 4LQ2A 4DZ1A 2F7CA 2PVUA 3IOTA 5KDTB 3MPLA 1CE2A 1A99A 1UTHB 3IAZA 4ZEKA 1JEUA 3E3KA 3FXRA 3K0VA 4OWDA 4U23A 3FJMA 3TODA 4BDQA 4YKJA 1USYH 1POTA 3K1NA 3RNNA 4IB2A 1B0HA 4MH5A 3DLNA 3USDA 4EDPA 3V89B 4EXLA 5HM4B 3UK4A 2NUVA 3TZAA 4ELPA 3TTLA 3VVFA 1USYE 2UVIA 4IY6A 2H99A 2DXYA 3A3CA 1LCTA 3FJGA 3LBSA 3H7MA 4FORA 1ATGA 4H5GA 5TPAA 3RTWB 1IXIA 3KOSA 2HEUA 1Y4CA 2ONKE 2OWTA 3FVKA 1N76A 1BIYA 2Z8FA 3M3FA 4KYDA 1I69A 4X48A 3Q27A 3W15C 3ONMA 1WODA 3G3IA 3H6WA 4G68B 4IO6A 3K1MA 1Z7NE 4RY1A 4YB7A 4DXUA 4ELQA 5ICQA 2REJA 1CB6A 3EN3A 4OFJA 1HSLA 2QMWA 3DP8A 2XXUA 2ZYOA 3MW0A 4F31B 1US4A 5DEXB 5LOMA 5ISUA 4X1DA 1Q35A 3OO8A 4BDNA 5H8HA 1RKMA 2NOOA 3OSRA 4GF8A 1A40A 1AH5A 2OK2A 2CMOA 4ONYA 1P99A 2I3WA 3KJTA 1EZOA 4H67A 1H44A 1MY3A 4HS7A 1B7HA 1D3KA 1N84A 2BJJX 4ZDMA 4U21A 4BDMA 2DWJA 2XXTA 4Q5TA 1FTOA 1XC1A 2F97A 4IO4A 3IB0A 2I4CA 2VP1A 4ZZEA 1UTHA 3KBRA 4NWCA 1ZTYA 2Y7RA 2R71A 1KWHA 4H5FA 1OLCA 2HAUA 3ECRA 4U1OA 4PFUA 5M2VA 4N13A 4H6DA 4MF3A 3U92A 3OO6A 1YTVA 2Z8DA 4MLVA 3RGYA 4PFWA 4R2BA 4ECFA 4F3GA 4ZS9A 3HHFA 3LC8A 1VR5A 2KLFA 4RK9A 1XOCA 5B70A 2R9JA 2ZXTA 3H3GA 2V3UA 1DOTA 1EZPA 1M5BA 2Y7IA 1OIBA 1LLSA 2D3IA 4NF6A 3E9XA 4PP0A 3K2DA 3SETA 1AOVA 1B2HA 2XXYA 1B0LA 1MXUA 2B3FA 3H6UA 5F7VA 1HSEA 3ZS6A 1H3DA 2Q2CA 1BLFA 4TLLB 3SEWA 1N7XA 5CC2A 1SW4A 4JWOA 2UVHA 1GR2A 2ANJA 1XVXA 4GRKA 5CI5A 1US5A 4E0WA 5I58A 1UTBB 3RY3A 3TEPA 3P7IA 2Q88A 3V5AA 5L9SA 5JK4A 3T93B 5ITOA 3T9UA 1NNFA 3R26A 3UORA 3OMBA 2OJTA 1B32A 5IAIA 2GHBA 3JYRA 2PT1A 2I58A 4RJZA 4XKPA 3U8QA 3G3HA 3QXMA 4G2ZA 4ZEBA 1GV8A 3IB2A 3I5OA 3Q25A 3THIA 1Y9UA 1BKAA 1OQHA 2O68A 1QW0A 1URSA 2I3VA 4GWOA 3K6WA 3MVWA 1P1OA 2E1SA 2F78A 2G29A 4LQ5A 2V93A 4ESXA 5KZTA 1MXZA 2R6GE 5H8HB 2A5TB 4HTGA 4R6KA 2ONSA 1JW4A 3O29A 3DM0A 3PUWE 4OYVA 3S9MC 3TCGA 1MDQA 1QUIA 1LBBA 3OO9A 3KN3A 3Q29A 1A8EA 4YB5A 4NF8B 3GZGA 1PC3A 3K6UA 4R72A 2VOZA 3SEUA 3IL1B 1B4ZA 4DXCA 2O69A 3PMXA 3V8XB 4GQOA 1B46A 3CFZA 3BFUA 1MM6A 1ZJLA 2YJPA 1B4HA 1DSNA 3BFTA 2RC7A 3G3GA 3SEVA 4ISUA 3MPKA 4YKIA 4F2QA 4OXVA 4I62A 3K01A 4U1ZA 4I9DA 2DVZA 3PUVE 4GD5A 4E0XA 3FXUA 3ODBA 3M3LA 3N94A 2OCUA 1LSTA 3G7WA 4NF5B 3TAJA 3N6TA 1B5HA 1Y3PA 2ZYNA 3UGWA 1LCFA 1S50A 1JNFA 2HFBA 4G68A 5TP9A 3ZKLA 1N7WA 1P1QA 3C35A 1MM7A
chains in the Genus database with same CATH superfamily
3TUSA 2R8TA 4R6HA 4AS4A 2B4LA 4H46A 2I4BA 1SDXA 1Z7ME 1FTLA 3VXBA 4F2OA 3UIFA 4F22A 4N6PA 2QPQA 4P9KA 3CRBA 2XX8A 2ZYMA 4G68C 5AA2D 1MY1A 1PDAA 1J1NA 3G3KA 2O7UA 4EQ9A 2PX1A 2F7BA 2I0BA 3SESA 2AYSA 1LB8A 4LONB 3JV9A 4ZEFA 1MG1A 2QL3A 4QFNA 2M8CA 1S9TA 3RTFB 2F7AA 4I8CA 3E78A 1XT8A 5H8QA 3D4CA 4OVJA 3SEXA 1FQFA 2Z8EA 1SQYA 3TFLA 1I6BA 2OWSA 5TU0A 3KOTA 5AA1A 3LSWA 2PMSA 1NNTA 3PTYA 2G93A 3OSQA 4PBHA 4OESA 1NNKA 1PBQA 3UP9A 4QSEA 1MS7A 4OVPA 4QRZA 2P1SA 4FE8A 1SI0A 3IO6A 3N5LA 4JB7A 1K9YA 5CMKA 3E13X 1PBPA 1FBCA 3RPLA 1JVXA 5I7IA 5DT6A 2X7PA 3CFXA 1HSJA 3SERA 4POXA 1MH3A 5L9OA 1MY4A 5AA2A 4RPOA 3M8UA 3LR1A 1B9JA 2DVCA 3BBRA 4GWZA 4L17A 1AIVA 1KZ8A 3IOUA 1GTKA 3CFLA 1R9LA 1B7UA 3A3UA 3G3FA 4QFOA 5I57B 4ZECA 3E4RA 5AA4B 3AXFA 2B3BA 2FNCA 4IO7A 2QRYA 4XKNA 1FQBA 1MH4A 3TDJA 4BDLA 4KYSA 3ROJA 1QKAA 2F6PA 3EHTA 1BK4A 1SI1A 5ET7A 3Q26A 1QKBA 3VLWA 3QMFA 3MVZA 4IR8A 2DWHA 4LATA 4OEVA 2O51A 4AQ4A 2ZNTA 2VD2A 1ZU0A 1A55A 1Y20A 1O64A 4KI0E 5TP9B 4LA9A 3SKPA 4GWWA 4GFRA 4O3CA 4RK2A 1ZBMA 2NVUB 1FPBA 1JW5A 1G0HA 3RUMA 5KCJB 1Q9DA 5IGAA 1IZ1A 1VSOA 4HW8A 3KFMA 1MRPA 3O28A 1MXVA 4PE5B 4ELOA 5FHNA 1H43A 4N07A 4R6YA 1NUXA 4Z7EA 2DDKA 5KCJA 3KC0A 4EQBA 4KHZE 1P1NA 3RT6B 3W9WA 4OHNA 1M5CA 1DK4A 1B3HA 2AL4A 3PPNA 1JEVA 2I0CA 4ND9A 3BKIB 3MP6A 2Y5KA 1D9QA 3Q28A 4HXVA 1MXYA 1FW0A 4DI3D 2XXHA 5ITPA 2L5VA 3KZGA 4ZE9A 4LUBA 1WDNA 5I2NB 1T0KA 2DWIA 3T9HB 1R6ZA 1N0TA 4OZ9A 4OTEA 2OBGA 4YAHX 3TCHA 1IMFA 1QVSA 1RYOA 1FQAA 4XIGQ 3HCQA 3FXQA 3HSTA 3FBPA 1O63A 1DMBA 3HO7A 2XXIA 3PPQA 3S9NC 3D1RA 4GX3A 4NWDA 5J16A 1XHYA 3LSLA 1B3EA 1FTJA 2V3QA 1IXHA 4MFIA 4JSOA 3MVYA 1ZMGA 5ET6A 3G3JA 3TTKA 3C34A 4DIGA 1FTKA 5CM6A 4WKMA 5A5XA 3MC2A 1M5FA 3I3VA 3CG1A 2RCAA 1LBCA 4G4PA 2QS2A 5CBRA 2UYEA 4O3BA 3VV5A 4R2FA 3EHUA 3B6TA 4RPNA 4F1UA 5A5XB 3QUFA 2VPOA 4FATA 4KCCA 3VFJA 3MZ9A 4ELRA 5A5LA 2HAVA 2B65A 3KSXA 3O6HA 1AWBA 2PVUA 3IOTA 5KDTB 3MPLA 3FXRA 3FJMA 1DBZA 4BDQA 1POTA 3K1NA 4IB2A 4MH5A 4EXLA 2NUVA 1QGXA 2H99A 2DXYA 3LBSA 4FORA 3RTWB 1Y4CA 2ONKE 1I69A 3ONMA 4DXUA 1JP4A 4PTKA 3DP8A 5ISUA 1US4A 1FBPA 2OK2A 1FBGA 4ONYA 1P99A 2I3WA 4F19A 1H44A 2DWJA 1UTHA 3KBRA 4NWCA 1ZTYA 2Y7RA 1KWHA 1OLCA 2HAUA 3ECRA 4U1OA 4PFUA 5M2VA 4GWXA 4N13A 2WBBA 4H45A 3RGYA 2KR0A 4ECFA 4ZS9A 3LC8A 1FPFA 5B70A 4PBQA 1EZPA 1M5BA 1OIBA 3E9XA 3K2DA 2Q8MA 3SETA 1AOVA 5F7VA 4NHBA 1H3DA 4TLLB 1GR2A 4E0WA 1US5A 4GWUA 2GQ1A 4N91A 5ITOA 2OJTA 5IAIA 5EQ9A 2I58A 3G3HA 4ZEBA 3IB2A 3Q25A 3RPLB 1OQHA 4GWOA 2I3VA 2V4CA 2F78A 1FPDA 5KZTA 5H8HB 2ONSA 3DM0A 4YB5A 1EYKA 3SEUA 4DXCA 4P56A 1B46A 3BFUA 1DSNA 3BFTA 3SEVA 4ISUA 4U1ZA 3PUVE 4NAPA 4PDDA 3N94A 1SPIA 3G7WA 3N6TA 1NUYA 5ESYA 2CZHA 3ZKLA 3C35A 2F8DA 1MM7A 4NF8A 3TTNA 5H8NB 4M1VA 4R75A 1VDWA 2XHDA 4RYAA 2YPNA 1ANFA 5HPQA 2AIXA 4AB5A 3EF7A 4TQUQ 4ZE8A 1B52A 4BDOA 4F3PA 3RYDA 4I1DA 2P2AA 3HHGA 1B5IA 4QFLA 4PETA 2PCRA 2B4MA 4P1EA 2KQZA 3VXCA 2DS9A 5AE4A 3CIJA 1P1WA 1ZLQA 1PB8A 2PFZA 2V84A 1FQCA 4OENA 5AA4A 2Q9TA 3LSFB 1B40A 3C4MA 3ILUB 4M4GA 5T3JA 4WXJA 4NX1A 4YU0A 3K00A 4XTCQ 4N6KA 2WYKA 1XS5A 1G0IA 1N3WA 1FBHA 1I6AA 1MPDA 4LN5A 3FVNA 3TMGA 2O7IA 2DE4A 4K3FA 3TTRA 1Y1ZA 3IJXB 4EXKA 4JXIA 2QSXA 1DPPA 1TT1A 3UA8A 3GLBA 2A5TA 4N4UA 2UYFA 4NMYA 1RDXA 4MAGA 4OVRA 3CR9A 4NGUA 4H8JA 1MPBA 5J1DA 1QUKA 2P0SA 3OO7A 4GLIA 4OFOA 2XXPA 4NQ8A 2XD3A 5CBSA 3V83A 1SYHA 1FSAA 4YKPA 3NOHA 3CVGA 3QIMA 3MYUA 5H8QB 2QS4A 3T22A 1F9BA 2QS1A 4RA1A 3MZ1A 2VD3A 3S9LC 1FRPA 1MQJA 3R7XA 3TQWA 1LB9A 4N15A 5ET5A 1XI6A 4N8YA 4MLQA 5FTHA 3HN0A 5DTBA 1IQ7A 1EZ9A 1N3XA 3OEMA 4N8GA 4X9TA 3K6XA 5CRYA 1R1NA 3PUYE 1LFHA 2XA5A 3MBPA 1INPA 4XFEA 4PQJA 3IK6B 3K1PA 3T96B 4YZZA 4OMBA 4G77A 1B6HA 1B58A 5DW8A 2XWVA 1YXIA 1A8FA 3DP4A 2ABHA 4HE1A 1JW1A 1NKXA 5H8SA 3IB1A 2I6EA 1MY0A 2QFLA 2O1MA 2DOJA 5DVFA 1B3LA 3C32A 3B8BA 3OOAA 3IOWA 3B6WA 1II5A 4RXLA 1PEBA 5FHOA 2O84X 2NWJA 4P0IA 1VE4A 4QHQA 1B05A 4U22A 1ZIUA 2FVZA 3IOVA 3U72A 1VFEA 1TWYA 5HBCA 3K6VA 4X8RA 3FV1A 4P47A 4BLAA 5AA2B 4C1UA 3DELB 4FJPA 2O6AA 3MUQA 1D9VA 4IGRA 5JTYA 1NV5A 4NF0A 1UIUA 4HCWA 3KSJA 2H5YA 1M5DA 4OETA 4XXUA 2ZNUA 4GOTA 2H4IA 2X26A 4OVQA 4XF5A 3H03A 5I5PA 2Z23A 4Q8RA 5ICTA 3TQLA 4GXAA 4XKQA 3CG3A 4MEVA 4PFBA 3KGCA 4OERA 4DCYA 1AL3A 3KJ7A 4C0RA 2QVVA 3HV1A 4ESWA 4OFLA 1ELJA 2ZMBA 4ZZAA 3EHSA 2FBPA 4GL8A 1MQDA 3HPIA 4QF9A 2IEEA 2HXWA 1H76A 3O66A 1FBDA 3MP8A 4PF6A 1FPLA 3ZSFA 2FIEA 4DI4B 3PPPA 2WEFA 1XVYA 4PF8A 1A99A 3IAZA 4ZEKA 4NG7A 3E3KA 4OWDA 4U23A 4GBWA 1B0HA 2ZZVA 3UK4A 3TZAA 4ELPA 2CEYA 3FJGA 1IXIA 3KOSA 3FVKA 1N76A 1BIYA 3LUZA 4KYDA 1CNQA 3G3IA 4RY1A 3H6WA 3K1MA 1Z7NE 1FPJA 4ELQA 2REJA 5IZZA 1CB6A 4OFJA 2XXUA 2ZYOA 5LOMA 4I3YA 4X1DA 3OO8A 2CEXA 4HS7A 1B7HA 1D3KA 2BJJX 4ZDMA 2F97A 3IB0A 2VP1A 5IZ1A 4H5FA 3KBZA 4F3GA 2KLFA 2ZXTA 3H3GA 4PP0A 2B3FA 3ZS6A 1HSEA 2Q2CA 3SEWA 5CC2A 1N7XA 1XVXA 2ANJA 5I58A 1UTBB 3TEPA 3P7IA 2Q88A 1NV2A 1NNFA 3UORA 3OMBA 1K9ZA 2PT1A 3U8QA 4G2ZA 3THIA 1BKAA 2WX9A 1QW0A 1URSA 1P1OA 4LQ5A 4R6KA 1JW4A 1KA0A 3PUWE 4OYVA 3S9MC 1MDQA 3KN3A 1PC3A 2VOZA 2O69A 3V8XB 4PC9A 2RC7A 3G3GA 4OXVA 2DVZA 2OCUA 1LSTA 1IMAA 2ZZXA 2ZYNA 1JNFA 2RF1A 2HFBA 5TP9A 4POWA 2DWAA 5EYGA 4G8NA 4JWXA 5F1QA 4F18A 5B7DA 1Y3QA 3SDFA 1NUWA 2Y7KA 4GWSA 3U65A 4XKRA 4MCOA 4H8IA 4NF4B 1RDZA 3LUYA 5DVIA 4PDHA 1BTJA 1Y4TA 5I57A 5CMMA 3GBAA 3GYYA 5ELVA 2UVJA 5K2XA 3RT8A 4P0GA 2GHAA 4GX6A 1OVTA 4X1BA 3EPEA 4H0WA 4JSDA 3JZJA 4I3EA 1A54A 2HXRA 4C1TA 5H8FB 3LSXA 4MHFA 4DDDA 4F29A 4QFPA 4R9GA 4KCDA 1FQDA 5HM4B 3OXNA 1DCUA 1FCKA 1NMUA 3QK6A 4DE8A 5EQ8A 5EYHA 2F5XA 2QJEA 2RKMA 4WEPA 1Y3NA 4LVQA 4NE4A 4R74A 2WYPA 2I49A 5EHMA 2FA7A 2HQ0A 2THIA 5KDTA 1DTZA 1A7LA 5K2YA 3C9HA 1MQGA 5IZ3A 3QSLA 3BIHA 4RNSA 2LAOA 3FJ7A 3OELA 5I58B 4MJOA 3T66A 4JBZA 3VLUA 1NL5A 3PMWA 3PPRA 5F24A 4OANA 4MNCA 2F34A 2XXRA 5IZ3B 4H1XA 4O8MA 5EHSA 3T1BA 4YMAA 3VVEA 1UTBA 1FPIA 3L6GA 2Y7WA 3KC1A 2XXVA 3R6UA 1N04A 4KFQA 3FIRA 4EF1A 1TXFA 4O94A 4FEBA 2XXQA 3MAMA 4EUOA 2DE2A 3H4ZA 4HE0A 3FXBA 3IO4A 1FBEA 3GBBA 5EYFA 5ET8A 1IXGA 1IXCA 3MQ9A 3PPOA 4U2RA 3O6GA 3I6VA 3SEYA 3O2AA 1QJMA 4MNPA 4R9FA 4DCXA 1B5JA 2RCBA 1NUZA 1PB7A 3TYHA 5I2KB 2DSFA 3RN8A 4PGPA 3M3KA 4GIZA 3N6UA 4PAKA 4I40A 2WBDA 4YB6A 4GBVA 4NN3A 1LFIA 1NV4A 5JTYB 1LFGA 4FIMA 1SBPA 2X7QA 4FAJA 3MZBA 3BIGA 1MQIA 2RC8A 2XWKA 1ZKBA 4OQOA 2RC9A 2OLBA 3FVGA 5H8FA 3VVDA 3PU5A 3CSBA 1EU8A 2REGA 4TLMB 3H6VA 1MY2A 1MXWA 3CSGA 1SW5A 4G8HA 2F35A 1B1HA 1JETA 4NF6B 4UA8A 4HCYA 1GGGA 3PD9A 3TTMA 4NTLA 2CZIA 2GH9A 1M5EA 4F1YA 1LAXA 2UVGA 5CMBA 4XEQA 3O97A 4MIJA 1FPGA 5I84A 1NV1A 3C36A 2P3NA 3WAFA 4NF4A 4G8MA 2XXXA 3T9VA 1POY1 5I56B 4PFRA 2F36A 2DE3A 4F3BA 5I2KA 1UQWA 5I59B 3TPAA 4N17A 1NV0A 4QFKA 2DYXA 4YICA 2XXWA 3A09A 3OEKA 4P11A 4LZ5A 1MPCA 4FEDA 4GWYA 3A29A 5DVJA 3VDFA 4OEUA 5FBPA 1IEJA 3IR1A 4PAIA 1D4NA 1NV3A 3FGSA 3U1OA 1IUDA 1B3FA 4F3SA 3FATA 1URDA 1LBXA 3B6QA 3TCFA 3K4UA 1YPNA 2V25A 3CI8A 4THIA 2GRVA 2H25A 3IFCA 3MSTA 1MXXA 1Y1MA 5DYHA 5BWJA 2UXAA 4DZ1A 4JVDA 4JVIA 1CE2A 1UTHB 3TODA 3RNNA 4EDPA 3V89B 3VVFA 3E79A 2UVIA 3A3CA 3H7MA 4H5GA 1ATGA 5TPAA 2HEUA 2Z8FA 3M3FA 4QBAA 3W15C 1GVCA 1WODA 4IO6A 4G68B 3EN3A 4F31B 3MW0A 5DEXB 2PFYA 4PE3A 2NOOA 3OSRA 4GF8A 1AH5A 2CMOA 1EZOA 3KJTA 4U21A 2XXTA 4Q5TA 1FTOA 1XC1A 4IO4A 4MF3A 3U92A 1YTVA 4PFWA 4R2BA 1FPEA 4RK9A 1XOCA 2R9JA 2V3UA 1DOTA 2Y7IA 2D3IA 4NF6A 3IFAA 3H6UA 2FIXA 1BLFA 4JWOA 2UVHA 4GRKA 3RY3A 5JK4A 3T9UA 3R26A 1B32A 2GHBA 2XWOA 4RJZA 5EQ7A 3QXMA 1GV8A 3I5OA 3CHGA 3SZPA 3MVWA 2G29A 2R6GE 2FHYA 1LBWA 4HTGA 3O29A 1NV6A 3OO9A 2BJIA 1A8EA 4BDMA 4NF8B 4R72A 3IL1B 4GQOA 3CFZA 1MM6A 4MNIA 1ZJLA 2YJPA 4F2QA 5LDZA 4I9DA 4O7MA 3ODBA 3M3LA 3TAJA 4NF5B 1Y3PA 4G68A 1N7WA 1P1QA 3PMVA 1QULA 4FECA 4KXPA 4LZ8A 4N6DA 3PGFA 4KYEA 1FTAA 3QYTA 1AMFA 1NH8A 3S4UA 5LTCA 1PB9A 4JWYA 2ALUA 2Y5LA 1YCJA 2VHAA 4YMBA 5AA3A 5JEIA 3RPWA 3OD7A 1FTMA 1Q1KA 2W7YA 4Q0CA 2XD2A 3ISPA 3S9EA 3FZVA 2ZYKA 3PUZE 4LZ7A 2QS3A 2Z22A 1B1XA 2PBWA 2QVUA 3MVXA 5L8DA 2Q74A 1SW1A 4QSDA 4IO3A 1R9QA 1B3GA 4KR5A 3S2VA 3D4GA 3EKIA 4JDFA 2F3BA 3KN8A 1LAHE 2DQVA 1OQGA 1YAEA 2P3VA 1QUJA 3ILTB 3C31A 3KN7A 3QAXA 4R73A 1FBFA 1DTGA 5FTIA 5I59A 4U4XA 4PAFA 2IA4A 1RYXA 3FV2A 1LGBC 2OZZA 2MKZA 4O7IA 2D5WA 3IJOB 3MJNA 1OMPA 4F1VA 3LV0A 1L5TA 4ZEDA 2XX9A 1LEVA 3PV0E 2E0SA 4UABA 3UN6A 1WVJA 4XKPA 4O3AA 3TKDA 4PFTA 4YKKA 1TFAA 1O7TA 2Q8JA 3B7DA 1TFDA 3ZKKA 3FVOA 3W9VA 2F3DA 1DPEA 3PUXE 2FYIA 2ESNA 1MDP1 1OLAA 4IO2A 4F39A 4KQPA 5L9MA 4QXDA 3QUJA 4GX4A 5IKBA 3GXAA 1EH3A 2QMXA 2Q2AA 1NI9A 4ZEIA 1LBZA 4PFYA 3OENA 2CZKA 2CZLA 2D21A 1SYIA 1IMBA 2V3TA 2AL5A 1P1UA 3H06B 2JJKA 5DEXA 2ONRA 3VLVA 1JQFA 1IMCA 3U93A 1OVBA 4NF5A 1H45A 3IX1A 4BDNA 2DP8A 2Y84A 4HE2A 5I56A 4KD5A 5BUUA 2Q89A 3L6HA 4GL0A 3N26A 3C33A 3T9XB 2ZNSA 5I2NA 4P3LA 4MBPA 1LAFE 3FUZA 4U4SA 1JVYA 4OA4A 4MX6A 3FD3A 3TELA 3KG2A 3MP1A 3O6IA 4OVSA 1NH7A 2RINA 2HCAA 1IIWA 1NFTA 1IMDA 1S7YA 3RQTA 3IORA 1SD3A 2HZKA 2DXRA 1LAGE 3KEIA 4QSCA 1B51A 2O1LA 4N81A 1KA1A 1RDYA 1IITA 2HPGA 2H9BA 4PGNA 2Y7PA 2H98A 4DLDA 1D9YA 3WAEA 1YZ0A 1URGA 2XX7A 4OVTA 4AB6A 1MQHA 4IY5A 1SVXB 2XXKA 1FJ9A 4TOZA 2GFEA 4WEDA 5EQAA 3EQ1A 1NV7A 4PFIA 4X04A 3K02A 4Z0IA 2NXOA 4IGTA 1SW2A 3B50A 5CMCA 4PCDA 5IM2A 3VE1B 1UIVA 2I48A 1VFDA 1FQEA 4IO5A 2VGQA 3DP6A 4JVCA 1I6QA 1EYJA 5TPAB 3H6TA 3MWBA 4GVOA 5FHMA 2WKYA 4UACA 3FASA 1B7ZA 1BP5A 2HHMA 3F11A 1NNPA 3T0JA 2F6GA 4G61A 2PT2A 3U94A 4LP2B 3PD8A 3RLFE 3O9PA 4H65A 4DXBA 4EQ7A 4EF2A 4GXSB 4NEDA 2HZLA 4Q30B 4BDRA 4KPTA 2A5SA 2PYYA 2YLNA 1LBVA 5H8NA 4LQ2A 2F7CA 1FJ6A 1IMEA 1JEUA 3K0VA 4YKJA 1USYH 3USDA 3DLNA 3TTLA 1USYE 4IY6A 1LCTA 2OWTA 4X48A 3Q27A 4YB7A 5ICQA 1HSLA 2QMWA 1FPKA 1Q35A 5H8HA 1RKMA 1A40A 3HFUA 5I3SA 4H67A 1MY3A 1N84A 1EYIA 2I4CA 4ZZEA 4P8BA 2R71A 4AS5A 2ZZWA 4H6DA 3OO6A 2Z8DA 4MLVA 3HHFA 1VR5A 2VT5A 1YYZA 2OX3A 1LLSA 2OWZA 1B2HA 2XXYA 1B0LA 1MXUA 1LBYA 1SW4A 5CI5A 3V5AA 5L9SA 3T93B 3JYRA 1Y9UA 4P1LA 2O68A 3K6WA 2E1SA 4ESXA 2VPNA 2V93A 1MXZA 4FBPA 2A5TB 2QVRA 3TCGA 1QUIA 1LBBA 3Q29A 3GZGA 3K6UA 2XWIA 1B4ZA 3PMXA 1B4HA 3MPKA 4YKIA 4I62A 3K01A 4GD5A 4E0XA 3FXUA 4MMPA 1B5HA 3UGWA 1LCFA 1S50A
chains in the Genus database with same CATH topology
3TUSA 2DWAA 3PMVA 4G8NA 4JWXA 1QULA 4NF8A 4FECA 3TTNA 5F1QA 4M1VA 4R75A 4R6HA 4LZ8A 4F18A 1Y3QA 3SDFA 5B7DA 5H8NB 2Y7KA 2XHDA 3PGFA 4XKRA 4RYAA 4KYEA 2YPNA 4H8IA 3QYTA 2I4BA 1AMFA 4NF4B 3LUYA 5DVIA 1ANFA 1SDXA 1Z7ME 2F8DA 1FTLA 1NH8A 5HPQA 2AIXA 3VXBA 3S4UA 4AB5A 1BTJA 4F2OA 1PB9A 1Y4TA 3EF7A 4JWYA 2ALUA 3UIFA 4TQUQ 4F22A 4ZE8A 4N6PA 1YCJA 5I57A 5CMMA 1B52A 2VHAA 4BDOA 4YMBA 2QPQA 3CRBA 3GBAA 2XX8A 2ZYMA 5AA3A 4F3PA 5ELVA 5JEIA 2UVJA 3OD7A 3RPWA 1FTMA 1Q1KA 1MY1A 1PDAA 2W7YA 1J1NA 4G68C 4I1DA 3G3KA 5K2XA 2P2AA 3RT8A 3HHGA 1B5IA 4P0GA 2GHAA 2O7UA 4Q0CA 1OVTA 2XD2A 4PETA 4QFLA 3EPEA 4H0WA 2PX1A 4X1BA 4EQ9A 4JSDA 2F7BA 3S9EA 2I0BA 3FZVA 2ZYKA 3PUZE 3JZJA 4LZ7A 2AYSA 3SESA 1LB8A 2QS3A 4LONB 2Z22A 3JV9A 1B1XA 1A54A 2PBWA 2DS9A 3MVXA 5L8DA 3VXCA 4C1TA 4ZEFA 1SW1A 1MG1A 3CIJA 4QSDA 5H8FB 5AE4A 1P1WA 2QL3A 4QFNA 2M8CA 4IO3A 1S9TA 1PB8A 1ZLQA 2V84A 2F7AA 3RTFB 1FQCA 1R9QA 4I8CA 1B3GA 4OENA 5AA4A 4KR5A 3LSXA 1XT8A 2Q9TA 5H8QA 3S2VA 4EQ7A 3D4CA 4DDDA 4F29A 4QFPA 3LSFB 3D4GA 4JDFA 1B40A 4R9GA 4KCDA 3C4MA 1FQDA 4OVJA 3ILUB 3SEXA 1FQFA 4M4GA 3KN8A 1LAHE 2DQVA 2Z8EA 1OQGA 1YAEA 1SQYA 4WXJA 3OXNA 4YU0A 1I6BA 3TFLA 3K00A 2OWSA 1FCKA 1QUJA 1NMUA 5TU0A 4XTCQ 3KOTA 5AA1A 3LSWA 3QK6A 2PMSA 1NNTA 3ILTB 4DE8A 3C31A 2G93A 3KN7A 3OSQA 3QAXA 2F5XA 4OESA 1NNKA 1PBQA 1XS5A 2QJEA 2RKMA 4R73A 4WEPA 1DTGA 2RF1A 1Y3NA 5FTIA 4LVQA 3UP9A 5I59A 4NE4A 4R74A 2I49A 4U4XA 4QSEA 1MS7A 5EHMA 1N3WA 2FA7A 2IA4A 4QRZA 1I6AA 2HQ0A 2P1SA 4FE8A 1MPDA 2THIA 1SI0A 1RYXA 3FVNA 3IO6A 3TMGA 3FV2A 3N5LA 1LGBC 4JB7A 5KDTA 2O7IA 2DE4A 2OZZA 1DTZA 4K3FA 3TTRA 1Y1ZA 1A7LA 5CMKA 2D5WA 3IJOB 5K2YA 3IJXB 3E13X 1PBPA 3MJNA 4EXKA 1JVXA 1OMPA 5DT6A 3C9HA 4JXIA 1MQGA 2QSXA 1DPPA 2X7PA 4F1VA 3CFXA 1L5TA 1HSJA 4ZEDA 3SERA 3QSLA 1TT1A 3UA8A 3GLBA 2A5TA 2XX9A 1MH3A 4POXA 2UYFA 4NMYA 5L9OA 1MY4A 2LAOA 4RNSA 5AA2A 3PV0E 3CR9A 4RPOA 2E0SA 3M8UA 1MPBA 3LR1A 4H8JA 3FJ7A 3OELA 5I58B 3UN6A 3T66A 5J1DA 1B9JA 1QUKA 1WVJA 2DVCA 2P0SA 3BBRA 3OO7A 4JBZA 4L17A 4GLIA 4O3AA 3VLUA 4OFOA 2XXPA 3TKDA 1AIVA 1NL5A 1GTKA 2XD3A 3IOUA 3PMWA 3PPRA 3CFLA 1R9LA 4PFTA 5CBSA 1B7UA 3A3UA 3G3FA 4QFOA 3V83A 1SYHA 4YKKA 4ZECA 1TFAA 5I57B 1O7TA 2Q8JA 3B7DA 4YKPA 3E4RA 5AA4B 1TFDA 3AXFA 2B3BA 2F34A 3CVGA 3QIMA 3ZKKA 5H8QB 3FVOA 2FNCA 2QS4A 3T22A 3W9VA 1F9BA 1DPEA 2QS1A 3PUXE 2QRYA 2XXRA 4IO7A 4H1XA 4RA1A 2FYIA 5EHSA 4YMAA 4XKNA 2ESNA 3MZ1A 2VD3A 1FQBA 3VVEA 3S9LC 1MH4A 1MDP1 1OLAA 4IO2A 1MQJA 3TDJA 3R7XA 4KQPA 5L9MA 4F39A 4BDLA 1UTBA 4KYSA 3TQWA 1LB9A 5AA2D 3L6GA 2Y7WA 3QUJA 1QKAA 2F6PA 3EHTA 5IKBA 1SI1A 3GXAA 1EH3A 4MLQA 5FTHA 2QMXA 2Q2AA 2XXVA 3HN0A 3Q26A 3R6UA 1N04A 4KFQA 3FIRA 4EF1A 5BWJA 1QKBA 1TXFA 3VLWA 5DTBA 4ZEIA 1IQ7A 4PFYA 3MVZA 2DWHA 4LATA 1EZ9A 1N3XA 3OENA 4OEVA 4FEBA 3OEMA 2CZLA 2D21A 2O51A 2XXQA 4AQ4A 4X9TA 1SYIA 3MAMA 4EUOA 2V3TA 2ZNTA 2AL5A 2VD2A 2DE2A 3H4ZA 1P1UA 3H06B 3K6XA 5CRYA 1R1NA 3IO4A 3PUYE 1LFHA 3GBBA 5EYFA 5DEXA 3MBPA 2ONRA 3VLVA 1IXGA 1ZU0A 1IXCA 3MQ9A 1A55A 3PPOA 4U2RA 1JQFA 1Y20A 4PQJA 1O64A 4KI0E 3U93A 3O6GA 3I6VA 3SEYA 3IK6B 3K1PA 3O2AA 1QJMA 4LA9A 5TP9B 3T96B 4R9FA 4YZZA 4OMBA 4DCXA 4G77A 1B6HA 1B5JA 1OVBA 1B58A 3SKPA 4NF5A 1H45A 3IX1A 2RCBA 1A8FA 1PB7A 4GFRA 4O3CA 2DP8A 2Y84A 4RK2A 5I2KB 3TYHA 1ZBMA 2NVUB 2DSFA 3DP4A 1JW5A 3RN8A 3RUMA 2ABHA 3M3KA 4GIZA 5KCJB 3N6UA 5I56A 1IZ1A 1VSOA 4YB6A 4KD5A 5BUUA 1JW1A 1NKXA 4HW8A 2Q89A 1LFIA 3L6HA 5JTYB 4GL0A 5H8SA 3N26A 3C33A 3IB1A 1LFGA 2ZNSA 3KFMA 3T9XB 1MRPA 4FIMA 3O28A 5I2NA 1MXVA 4PE5B 4ELOA 5FHNA 1H43A 4N07A 4R6YA 1SBPA 2X7QA 4MBPA 2I6EA 1LAFE 4POWA 4FAJA 3MZBA 4Z7EA 1MY0A 3FUZA 1MQIA 4U4SA 5KCJA 2O1MA 2RC8A 4EQBA 2DOJA 1ZKBA 1JVYA 4KHZE 4OQOA 1P1NA 5DVFA 1B3LA 3C32A 3FD3A 3RT6B 4OHNA 3W9WA 1M5CA 2RC9A 3TELA 2OLBA 3FVGA 5H8FA 3KG2A 3VVDA 3OOAA 1B3HA 2AL4A 3MP1A 3O6IA 1NH7A 3B6WA 2RINA 3IOWA 2HCAA 1IIWA 1NFTA 3PPNA 1JEVA 2I0CA 4ND9A 3PU5A 3CSBA 1EU8A 1S7YA 1II5A 3RQTA 2REGA 3IORA 4TLMB 3BKIB 3H6VA 3MP6A 1MY2A 4RXLA 1PEBA 5FHOA 2O84X 1SD3A 1MXWA 2HZKA 3CSGA 2DXRA 1LAGE 3KEIA 1SW5A 4QSCA 1B51A 2O1LA 3Q28A 4G8HA 2NWJA 4P0IA 1IITA 1MXYA 2H9BA 1VE4A 2F35A 1B1HA 4QHQA 1B05A 4U22A 1JETA 1ZIUA 2Y7PA 2H98A 1FW0A 3IOVA 4NF6B 3U72A 1VFEA 1TWYA 2XXHA 4HCYA 4UA8A 4DLDA 5ITPA 1GGGA 3PD9A 5HBCA 3TTMA 3K6VA 4NTLA 1D9YA 3FV1A 3WAEA 2GH9A 4BLAA 1URGA 3KZGA 4C1UA 5AA2B 2XX7A 4ZE9A 4LUBA 1M5EA 1WDNA 3DELB 4FJPA 4F1YA 5I2NB 2DWIA 4AB6A 1T0KA 2O6AA 1MQHA 1D9VA 3MUQA 4IGRA 4IY5A 1R6ZA 3T9HB 5JTYA 1SVXB 1UIUA 1N0TA 4HCWA 4OZ9A 4OTEA 1LAXA 2OBGA 2UVGA 5CMBA 4YAHX 3TCHA 3KSJA 2H5YA 3O97A 4TOZA 1QVSA 1RYOA 1FQAA 4XIGQ 1M5DA 5I84A 3C36A 2GFEA 4OETA 4XXUA 3HCQA 4WEDA 3WAFA 2ZNUA 4GOTA 3FXQA 4NF4A 3EQ1A 2H4IA 2X26A 2XXXA 4G8MA 1POY1 3HSTA 3H03A 3T9VA 5I56B 1O63A 2F36A 3K02A 2DE3A 4Z0IA 1DMBA 2Z23A 4F3BA 4Q8RA 5ICTA 3TQLA 3HO7A 4GXAA 5I2KA 2XXIA 1UQWA 5I59B 2NXOA 3PPQA 4IGTA 3TPAA 4XKQA 1SW2A 3CG3A 3S9NC 1GVCA 4QFKA 5CMCA 3VE1B 2DYXA 1UIVA 2I48A 1VFDA 1XHYA 2XXWA 3KGCA 3LSLA 4NWDA 1B3EA 1FTJA 2V3QA 4YICA 4DCYA 1IXHA 1FQEA 3A09A 3OEKA 4JSOA 4IO5A 4LZ5A 4MFIA 1MPCA 4P11A 1AL3A 4FEDA 2VGQA 3KJ7A 3MVYA 1ZMGA 3DP6A 5DVJA 4C0RA 3VDFA 4OEUA 3HV1A 1IEJA 3G3JA 4ESWA 1I6QA 3IR1A 5TPAB 3TTKA 3H6TA 3C34A 3MWBA 4OFLA 4GVOA 4DIGA 1D4NA 1FTKA 1ELJA 2ZMBA 5FHMA 4ZZAA 2WKYA 3FGSA 3U1OA 1IUDA 3EHSA 5CM6A 4WKMA 1B3FA 4F3SA 4OERA 3FATA 4UACA 5A5XA 3FASA 3MC2A 4GL8A 1B7ZA 1BP5A 1URDA 1MQDA 3HPIA 4QF9A 3F11A 2IEEA 1M5FA 3B6QA 3CG1A 2RCAA 3I3VA 1LBCA 1NNPA 4G4PA 2HXWA 1H76A 3O66A 2F6GA 3TCFA 2PT2A 3U94A 2QS2A 4LP2B 3PD8A 3RLFE 5CBRA 2UYEA 3K4UA 3MP8A 4O3BA 3VV5A 3O9PA 4R2FA 3EHUA 1YPNA 4H65A 3ZSFA 4DXBA 4EF2A 2V25A 3CI8A 3B6TA 3PPPA 4GXSB 4NEDA 2HZLA 2GRVA 4RPNA 4THIA 4F1UA 5A5XB 1XVYA 4Q30B 2H25A 3QUFA 4BDRA 4KPTA 2A5SA 4FATA 2PYYA 4KCCA 4F19A 3VFJA 3MZ9A 2YLNA 4ELRA 1MXXA 1Y1MA 2HAVA 2B65A 3KSXA 5DYHA 5H8NA 3O6HA 2UXAA 4LQ2A 4DZ1A 2F7CA 2PVUA 3IOTA 5KDTB 3MPLA 1CE2A 1A99A 1UTHB 3IAZA 4ZEKA 1JEUA 3E3KA 3FXRA 3K0VA 4OWDA 4U23A 3FJMA 3TODA 4BDQA 4YKJA 1USYH 1POTA 3K1NA 3RNNA 4IB2A 1B0HA 4MH5A 3DLNA 3USDA 4EDPA 3V89B 4EXLA 5HM4B 3UK4A 2NUVA 3TZAA 4ELPA 3TTLA 3VVFA 1USYE 2UVIA 4IY6A 2H99A 2DXYA 3A3CA 1LCTA 3FJGA 3LBSA 3H7MA 4FORA 1ATGA 4H5GA 5TPAA 3RTWB 1IXIA 3KOSA 2HEUA 1Y4CA 2ONKE 2OWTA 3FVKA 1N76A 1BIYA 2Z8FA 3M3FA 4KYDA 1I69A 4X48A 3Q27A 3W15C 3ONMA 1WODA 3G3IA 3H6WA 4G68B 4IO6A 3K1MA 1Z7NE 4RY1A 4YB7A 4DXUA 4ELQA 5ICQA 2REJA 1CB6A 3EN3A 4OFJA 1HSLA 2QMWA 3DP8A 2XXUA 2ZYOA 3MW0A 4F31B 1US4A 5DEXB 5LOMA 5ISUA 4X1DA 1Q35A 3OO8A 4BDNA 5H8HA 1RKMA 2NOOA 3OSRA 4GF8A 1A40A 1AH5A 2OK2A 2CMOA 4ONYA 1P99A 2I3WA 3KJTA 1EZOA 4H67A 1H44A 1MY3A 4HS7A 1B7HA 1D3KA 1N84A 2BJJX 4ZDMA 4U21A 4BDMA 2DWJA 2XXTA 4Q5TA 1FTOA 1XC1A 2F97A 4IO4A 3IB0A 2I4CA 2VP1A 4ZZEA 1UTHA 3KBRA 4NWCA 1ZTYA 2Y7RA 2R71A 1KWHA 4H5FA 1OLCA 2HAUA 3ECRA 4U1OA 4PFUA 5M2VA 4N13A 4H6DA 4MF3A 3U92A 3OO6A 1YTVA 2Z8DA 4MLVA 3RGYA 4PFWA 4R2BA 4ECFA 4F3GA 4ZS9A 3HHFA 3LC8A 1VR5A 2KLFA 4RK9A 1XOCA 5B70A 2R9JA 2ZXTA 3H3GA 2V3UA 1DOTA 1EZPA 1M5BA 2Y7IA 1OIBA 1LLSA 2D3IA 4NF6A 3E9XA 4PP0A 3K2DA 3SETA 1AOVA 1B2HA 2XXYA 1B0LA 1MXUA 2B3FA 3H6UA 5F7VA 1HSEA 3ZS6A 1H3DA 2Q2CA 1BLFA 4TLLB 3SEWA 1N7XA 5CC2A 1SW4A 4JWOA 2UVHA 1GR2A 2ANJA 1XVXA 4GRKA 5CI5A 1US5A 4E0WA 5I58A 1UTBB 3RY3A 3TEPA 3P7IA 2Q88A 3V5AA 5L9SA 5JK4A 3T93B 5ITOA 3T9UA 1NNFA 3R26A 3UORA 3OMBA 2OJTA 1B32A 5IAIA 2GHBA 3JYRA 2PT1A 2I58A 4RJZA 4XKPA 3U8QA 3G3HA 3QXMA 4G2ZA 4ZEBA 1GV8A 3IB2A 3I5OA 3Q25A 3THIA 1Y9UA 1BKAA 1OQHA 2O68A 1QW0A 1URSA 2I3VA 4GWOA 3K6WA 3MVWA 1P1OA 2E1SA 2F78A 2G29A 4LQ5A 2V93A 4ESXA 5KZTA 1MXZA 2R6GE 5H8HB 2A5TB 4HTGA 4R6KA 2ONSA 1JW4A 3O29A 3DM0A 3PUWE 4OYVA 3S9MC 3TCGA 1MDQA 1QUIA 1LBBA 3OO9A 3KN3A 3Q29A 1A8EA 4YB5A 4NF8B 3GZGA 1PC3A 3K6UA 4R72A 2VOZA 3SEUA 3IL1B 1B4ZA 4DXCA 2O69A 3PMXA 3V8XB 4GQOA 1B46A 3CFZA 3BFUA 1MM6A 1ZJLA 2YJPA 1B4HA 1DSNA 3BFTA 2RC7A 3G3GA 3SEVA 4ISUA 3MPKA 4YKIA 4F2QA 4OXVA 4I62A 3K01A 4U1ZA 4I9DA 2DVZA 3PUVE 4GD5A 4E0XA 3FXUA 3ODBA 3M3LA 3N94A 2OCUA 1LSTA 3G7WA 4NF5B 3TAJA 3N6TA 1B5HA 1Y3PA 2ZYNA 3UGWA 1LCFA 1S50A 1JNFA 2HFBA 4G68A 5TP9A 3ZKLA 1N7WA 1P1QA 3C35A 1MM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUS A;  2DWA A;  3PMV A;  4G8N A;  4JWX A;  1QUL A;  4NF8 A;  4FEC A;  3TTN A;  5F1Q A;  4M1V A;  4R75 A;  4R6H A;  4LZ8 A;  4F18 A;  1Y3Q A;  3SDF A;  5B7D A;  5H8N B;  2Y7K A;  2XHD A;  3PGF A;  4XKR A;  4RYA A;  4KYE A;  2YPN A;  4H8I A;  3QYT A;  2I4B A;  1AMF A;  4NF4 B;  3LUY A;  5DVI A;  1ANF A;  1SDX A;  1Z7M E;  2F8D A;  1FTL A;  1NH8 A;  5HPQ A;  2AIX A;  3VXB A;  3S4U A;  4AB5 A;  1BTJ A;  4F2O A;  1PB9 A;  1Y4T A;  3EF7 A;  4JWY A;  2ALU A;  3UIF A;  4TQU Q;  4F22 A;  4ZE8 A;  4N6P A;  1YCJ A;  5I57 A;  5CMM A;  1B52 A;  2VHA A;  4BDO A;  4YMB A;  2QPQ A;  3CRB A;  3GBA A;  2XX8 A;  2ZYM A;  5AA3 A;  4F3P A;  5ELV A;  5JEI A;  2UVJ A;  3OD7 A;  3RPW A;  1FTM A;  1Q1K A;  1MY1 A;  1PDA A;  2W7Y A;  1J1N A;  4G68 C;  4I1D A;  3G3K A;  5K2X A;  2P2A A;  3RT8 A;  3HHG A;  1B5I A;  4P0G A;  2GHA A;  2O7U A;  4Q0C A;  1OVT A;  2XD2 A;  4PET A;  4QFL A;  3EPE A;  4H0W A;  2PX1 A;  4X1B A;  4EQ9 A;  4JSD A;  2F7B A;  3S9E A;  2I0B A;  3FZV A;  2ZYK A;  3PUZ E;  3JZJ A;  4LZ7 A;  2AYS A;  3SES A;  1LB8 A;  2QS3 A;  4LON B;  2Z22 A;  3JV9 A;  1B1X A;  1A54 A;  2PBW A;  2DS9 A;  3MVX A;  5L8D A;  3VXC A;  4C1T A;  4ZEF A;  1SW1 A;  1MG1 A;  3CIJ A;  4QSD A;  5H8F B;  5AE4 A;  1P1W A;  2QL3 A;  4QFN A;  2M8C A;  4IO3 A;  1S9T A;  1PB8 A;  1ZLQ A;  2V84 A;  2F7A A;  3RTF B;  1FQC A;  1R9Q A;  4I8C A;  1B3G A;  4OEN A;  5AA4 A;  4KR5 A;  3LSX A;  1XT8 A;  2Q9T A;  5H8Q A;  3S2V A;  4EQ7 A;  3D4C A;  4DDD A;  4F29 A;  4QFP A;  3LSF B;  3D4G A;  4JDF A;  1B40 A;  4R9G A;  4KCD A;  3C4M A;  1FQD A;  4OVJ A;  3ILU B;  3SEX A;  1FQF A;  4M4G A;  3KN8 A;  1LAH E;  2DQV A;  2Z8E A;  1OQG A;  1YAE A;  1SQY A;  4WXJ A;  3OXN A;  4YU0 A;  1I6B A;  3TFL A;  3K00 A;  2OWS A;  1FCK A;  1QUJ A;  1NMU A;  5TU0 A;  4XTC Q;  3KOT A;  5AA1 A;  3LSW A;  3QK6 A;  2PMS A;  1NNT A;  3ILT B;  4DE8 A;  3C31 A;  2G93 A;  3KN7 A;  3OSQ A;  3QAX A;  2F5X A;  4OES A;  1NNK A;  1PBQ A;  1XS5 A;  2QJE A;  2RKM A;  4R73 A;  4WEP A;  1DTG A;  2RF1 A;  1Y3N A;  5FTI A;  4LVQ A;  3UP9 A;  5I59 A;  4NE4 A;  4R74 A;  2I49 A;  4U4X A;  4QSE A;  1MS7 A;  5EHM A;  1N3W A;  2FA7 A;  2IA4 A;  4QRZ A;  1I6A A;  2HQ0 A;  2P1S A;  4FE8 A;  1MPD A;  2THI A;  1SI0 A;  1RYX A;  3FVN A;  3IO6 A;  3TMG A;  3FV2 A;  3N5L A;  1LGB C;  4JB7 A;  5KDT A;  2O7I A;  2DE4 A;  2OZZ A;  1DTZ A;  4K3F A;  3TTR A;  1Y1Z A;  1A7L A;  5CMK A;  2D5W A;  3IJO B;  5K2Y A;  3IJX B;  3E13 X;  1PBP A;  3MJN A;  4EXK A;  1JVX A;  1OMP A;  5DT6 A;  3C9H A;  4JXI A;  1MQG A;  2QSX A;  1DPP A;  2X7P A;  4F1V A;  3CFX A;  1L5T A;  1HSJ A;  4ZED A;  3SER A;  3QSL A;  1TT1 A;  3UA8 A;  3GLB A;  2A5T A;  2XX9 A;  1MH3 A;  4POX A;  2UYF A;  4NMY A;  5L9O A;  1MY4 A;  2LAO A;  4RNS A;  5AA2 A;  3PV0 E;  3CR9 A;  4RPO A;  2E0S A;  3M8U A;  1MPB A;  3LR1 A;  4H8J A;  3FJ7 A;  3OEL A;  5I58 B;  3UN6 A;  3T66 A;  5J1D A;  1B9J A;  1QUK A;  1WVJ A;  2DVC A;  2P0S A;  3BBR A;  3OO7 A;  4JBZ A;  4L17 A;  4GLI A;  4O3A A;  3VLU A;  4OFO A;  2XXP A;  3TKD A;  1AIV A;  1NL5 A;  1GTK A;  2XD3 A;  3IOU A;  3PMW A;  3PPR A;  3CFL A;  1R9L A;  4PFT A;  5CBS A;  1B7U A;  3A3U A;  3G3F A;  4QFO A;  3V83 A;  1SYH A;  4YKK A;  4ZEC A;  1TFA A;  5I57 B;  1O7T A;  2Q8J A;  3B7D A;  4YKP A;  3E4R A;  5AA4 B;  1TFD A;  3AXF A;  2B3B A;  2F34 A;  3CVG A;  3QIM A;  3ZKK A;  5H8Q B;  3FVO A;  2FNC A;  2QS4 A;  3T22 A;  3W9V A;  1F9B A;  1DPE A;  2QS1 A;  3PUX E;  2QRY A;  2XXR A;  4IO7 A;  4H1X A;  4RA1 A;  2FYI A;  5EHS A;  4YMA A;  4XKN A;  2ESN A;  3MZ1 A;  2VD3 A;  1FQB A;  3VVE A;  3S9L C;  1MH4 A;  1MDP 1;  1OLA A;  4IO2 A;  1MQJ A;  3TDJ A;  3R7X A;  4KQP A;  5L9M A;  4F39 A;  4BDL A;  1UTB A;  4KYS A;  3TQW A;  1LB9 A;  5AA2 D;  3L6G A;  2Y7W A;  3QUJ A;  1QKA A;  2F6P A;  3EHT A;  5IKB A;  1SI1 A;  3GXA A;  1EH3 A;  4MLQ A;  5FTH A;  2QMX A;  2Q2A A;  2XXV A;  3HN0 A;  3Q26 A;  3R6U A;  1N04 A;  4KFQ A;  3FIR A;  4EF1 A;  5BWJ A;  1QKB A;  1TXF A;  3VLW A;  5DTB A;  4ZEI A;  1IQ7 A;  4PFY A;  3MVZ A;  2DWH A;  4LAT A;  1EZ9 A;  1N3X A;  3OEN A;  4OEV A;  4FEB A;  3OEM A;  2CZL A;  2D21 A;  2O51 A;  2XXQ A;  4AQ4 A;  4X9T A;  1SYI A;  3MAM A;  4EUO A;  2V3T A;  2ZNT A;  2AL5 A;  2VD2 A;  2DE2 A;  3H4Z A;  1P1U A;  3H06 B;  3K6X A;  5CRY A;  1R1N A;  3IO4 A;  3PUY E;  1LFH A;  3GBB A;  5EYF A;  5DEX A;  3MBP A;  2ONR A;  3VLV A;  1IXG A;  1ZU0 A;  1IXC A;  3MQ9 A;  1A55 A;  3PPO A;  4U2R A;  1JQF A;  1Y20 A;  4PQJ A;  1O64 A;  4KI0 E;  3U93 A;  3O6G A;  3I6V A;  3SEY A;  3IK6 B;  3K1P A;  3O2A A;  1QJM A;  4LA9 A;  5TP9 B;  3T96 B;  4R9F A;  4YZZ A;  4OMB A;  4DCX A;  4G77 A;  1B6H A;  1B5J A;  1OVB A;  1B58 A;  3SKP A;  4NF5 A;  1H45 A;  3IX1 A;  2RCB A;  1A8F A;  1PB7 A;  4GFR A;  4O3C A;  2DP8 A;  2Y84 A;  4RK2 A;  5I2K B;  3TYH A;  1ZBM A;  2NVU B;  2DSF A;  3DP4 A;  1JW5 A;  3RN8 A;  3RUM A;  2ABH A;  3M3K A;  4GIZ A;  5KCJ B;  3N6U A;  5I56 A;  1IZ1 A;  1VSO A;  4YB6 A;  4KD5 A;  5BUU A;  1JW1 A;  1NKX A;  4HW8 A;  2Q89 A;  1LFI A;  3L6H A;  5JTY B;  4GL0 A;  5H8S A;  3N26 A;  3C33 A;  3IB1 A;  1LFG A;  2ZNS A;  3KFM A;  3T9X B;  1MRP A;  4FIM A;  3O28 A;  5I2N A;  1MXV A;  4PE5 B;  4ELO A;  5FHN A;  1H43 A;  4N07 A;  4R6Y A;  1SBP A;  2X7Q A;  4MBP A;  2I6E A;  1LAF E;  4POW A;  4FAJ A;  3MZB A;  4Z7E A;  1MY0 A;  3FUZ A;  1MQI A;  4U4S A;  5KCJ A;  2O1M A;  2RC8 A;  4EQB A;  2DOJ A;  1ZKB A;  1JVY A;  4KHZ E;  4OQO A;  1P1N A;  5DVF A;  1B3L A;  3C32 A;  3FD3 A;  3RT6 B;  4OHN A;  3W9W A;  1M5C A;  2RC9 A;  3TEL A;  2OLB A;  3FVG A;  5H8F A;  3KG2 A;  3VVD A;  3OOA A;  1B3H A;  2AL4 A;  3MP1 A;  3O6I A;  1NH7 A;  3B6W A;  2RIN A;  3IOW A;  2HCA A;  1IIW A;  1NFT A;  3PPN A;  1JEV A;  2I0C A;  4ND9 A;  3PU5 A;  3CSB A;  1EU8 A;  1S7Y A;  1II5 A;  3RQT A;  2REG A;  3IOR A;  4TLM B;  3BKI B;  3H6V A;  3MP6 A;  1MY2 A;  4RXL A;  1PEB A;  5FHO A;  2O84 X;  1SD3 A;  1MXW A;  2HZK A;  3CSG A;  2DXR A;  1LAG E;  3KEI A;  1SW5 A;  4QSC A;  1B51 A;  2O1L A;  3Q28 A;  4G8H A;  2NWJ A;  4P0I A;  1IIT A;  1MXY A;  2H9B A;  1VE4 A;  2F35 A;  1B1H A;  4QHQ A;  1B05 A;  4U22 A;  1JET A;  1ZIU A;  2Y7P A;  2H98 A;  1FW0 A;  3IOV A;  4NF6 B;  3U72 A;  1VFE A;  1TWY A;  2XXH A;  4HCY A;  4UA8 A;  4DLD A;  5ITP A;  1GGG A;  3PD9 A;  5HBC A;  3TTM A;  3K6V A;  4NTL A;  1D9Y A;  3FV1 A;  3WAE A;  2GH9 A;  4BLA A;  1URG A;  3KZG A;  4C1U A;  5AA2 B;  2XX7 A;  4ZE9 A;  4LUB A;  1M5E A;  1WDN A;  3DEL B;  4FJP A;  4F1Y A;  5I2N B;  2DWI A;  4AB6 A;  1T0K A;  2O6A A;  1MQH A;  1D9V A;  3MUQ A;  4IGR A;  4IY5 A;  1R6Z A;  3T9H B;  5JTY A;  1SVX B;  1UIU A;  1N0T A;  4HCW A;  4OZ9 A;  4OTE A;  1LAX A;  2OBG A;  2UVG A;  5CMB A;  4YAH X;  3TCH A;  3KSJ A;  2H5Y A;  3O97 A;  4TOZ A;  1QVS A;  1RYO A;  1FQA A;  4XIG Q;  1M5D A;  5I84 A;  3C36 A;  2GFE A;  4OET A;  4XXU A;  3HCQ A;  4WED A;  3WAF A;  2ZNU A;  4GOT A;  3FXQ A;  4NF4 A;  3EQ1 A;  2H4I A;  2X26 A;  2XXX A;  4G8M A;  1POY 1;  3HST A;  3H03 A;  3T9V A;  5I56 B;  1O63 A;  2F36 A;  3K02 A;  2DE3 A;  4Z0I A;  1DMB A;  2Z23 A;  4F3B A;  4Q8R A;  5ICT A;  3TQL A;  3HO7 A;  4GXA A;  5I2K A;  2XXI A;  1UQW A;  5I59 B;  2NXO A;  3PPQ A;  4IGT A;  3TPA A;  4XKQ A;  1SW2 A;  3CG3 A;  3S9N C;  1GVC A;  4QFK A;  5CMC A;  3VE1 B;  2DYX A;  1UIV A;  2I48 A;  1VFD A;  1XHY A;  2XXW A;  3KGC A;  3LSL A;  4NWD A;  1B3E A;  1FTJ A;  2V3Q A;  4YIC A;  4DCY A;  1IXH A;  1FQE A;  3A09 A;  3OEK A;  4JSO A;  4IO5 A;  4LZ5 A;  4MFI A;  1MPC A;  4P11 A;  1AL3 A;  4FED A;  2VGQ A;  3KJ7 A;  3MVY A;  1ZMG A;  3DP6 A;  5DVJ A;  4C0R A;  3VDF A;  4OEU A;  3HV1 A;  1IEJ A;  3G3J A;  4ESW A;  1I6Q A;  3IR1 A;  5TPA B;  3TTK A;  3H6T A;  3C34 A;  3MWB A;  4OFL A;  4GVO A;  4DIG A;  1D4N A;  1FTK A;  1ELJ A;  2ZMB A;  5FHM A;  4ZZA A;  2WKY A;  3FGS A;  3U1O A;  1IUD A;  3EHS A;  5CM6 A;  4WKM A;  1B3F A;  4F3S A;  4OER A;  3FAT A;  4UAC A;  5A5X A;  3FAS A;  3MC2 A;  4GL8 A;  1B7Z A;  1BP5 A;  1URD A;  1MQD A;  3HPI A;  4QF9 A;  3F11 A;  2IEE A;  1M5F A;  3B6Q A;  3CG1 A;  2RCA A;  3I3V A;  1LBC A;  1NNP A;  4G4P A;  2HXW A;  1H76 A;  3O66 A;  2F6G A;  3TCF A;  2PT2 A;  3U94 A;  2QS2 A;  4LP2 B;  3PD8 A;  3RLF E;  5CBR A;  2UYE A;  3K4U A;  3MP8 A;  4O3B A;  3VV5 A;  3O9P A;  4R2F A;  3EHU A;  1YPN A;  4H65 A;  3ZSF A;  4DXB A;  4EF2 A;  2V25 A;  3CI8 A;  3B6T A;  3PPP A;  4GXS B;  4NED A;  2HZL A;  2GRV A;  4RPN A;  4THI A;  4F1U A;  5A5X B;  1XVY A;  4Q30 B;  2H25 A;  3QUF A;  4BDR A;  4KPT A;  2A5S A;  4FAT A;  2PYY A;  4KCC A;  4F19 A;  3VFJ A;  3MZ9 A;  2YLN A;  4ELR A;  1MXX A;  1Y1M A;  2HAV A;  2B65 A;  3KSX A;  5DYH A;  5H8N A;  3O6H A;  2UXA A;  4LQ2 A;  4DZ1 A;  2F7C A;  2PVU A;  3IOT A;  5KDT B;  3MPL A;  1CE2 A;  1A99 A;  1UTH B;  3IAZ A;  4ZEK A;  1JEU A;  3E3K A;  3FXR A;  3K0V A;  4OWD A;  4U23 A;  3FJM A;  3TOD A;  4BDQ A;  4YKJ A;  1USY H;  1POT A;  3K1N A;  3RNN A;  4IB2 A;  1B0H A;  4MH5 A;  3DLN A;  3USD A;  4EDP A;  3V89 B;  4EXL A;  5HM4 B;  3UK4 A;  2NUV A;  3TZA A;  4ELP A;  3TTL A;  3VVF A;  1USY E;  2UVI A;  4IY6 A;  2H99 A;  2DXY A;  3A3C A;  1LCT A;  3FJG A;  3LBS A;  3H7M A;  4FOR A;  1ATG A;  4H5G A;  5TPA A;  3RTW B;  1IXI A;  3KOS A;  2HEU A;  1Y4C A;  2ONK E;  2OWT A;  3FVK A;  1N76 A;  1BIY A;  2Z8F A;  3M3F A;  4KYD A;  1I69 A;  4X48 A;  3Q27 A;  3W15 C;  3ONM A;  1WOD A;  3G3I A;  3H6W A;  4G68 B;  4IO6 A;  3K1M A;  1Z7N E;  4RY1 A;  4YB7 A;  4DXU A;  4ELQ A;  5ICQ A;  2REJ A;  1CB6 A;  3EN3 A;  4OFJ A;  1HSL A;  2QMW A;  3DP8 A;  2XXU A;  2ZYO A;  3MW0 A;  4F31 B;  1US4 A;  5DEX B;  5LOM A;  5ISU A;  4X1D A;  1Q35 A;  3OO8 A;  4BDN A;  5H8H A;  1RKM A;  2NOO A;  3OSR A;  4GF8 A;  1A40 A;  1AH5 A;  2OK2 A;  2CMO A;  4ONY A;  1P99 A;  2I3W A;  3KJT A;  1EZO A;  4H67 A;  1H44 A;  1MY3 A;  4HS7 A;  1B7H A;  1D3K A;  1N84 A;  2BJJ X;  4ZDM A;  4U21 A;  4BDM A;  2DWJ A;  2XXT A;  4Q5T A;  1FTO A;  1XC1 A;  2F97 A;  4IO4 A;  3IB0 A;  2I4C A;  2VP1 A;  4ZZE A;  1UTH A;  3KBR A;  4NWC A;  1ZTY A;  2Y7R A;  2R71 A;  1KWH A;  4H5F A;  1OLC A;  2HAU A;  3ECR A;  4U1O A;  4PFU A;  5M2V A;  4N13 A;  4H6D A;  4MF3 A;  3U92 A;  3OO6 A;  1YTV A;  2Z8D A;  4MLV A;  3RGY A;  4PFW A;  4R2B A;  4ECF A;  4F3G A;  4ZS9 A;  3HHF A;  3LC8 A;  1VR5 A;  2KLF A;  4RK9 A;  1XOC A;  5B70 A;  2R9J A;  2ZXT A;  3H3G A;  2V3U A;  1DOT A;  1EZP A;  1M5B A;  2Y7I A;  1OIB A;  1LLS A;  2D3I A;  4NF6 A;  3E9X A;  4PP0 A;  3K2D A;  3SET A;  1AOV A;  1B2H A;  2XXY A;  1B0L A;  1MXU A;  2B3F A;  3H6U A;  5F7V A;  1HSE A;  3ZS6 A;  1H3D A;  2Q2C A;  1BLF A;  4TLL B;  3SEW A;  1N7X A;  5CC2 A;  1SW4 A;  4JWO A;  2UVH A;  1GR2 A;  2ANJ A;  1XVX A;  4GRK A;  5CI5 A;  1US5 A;  4E0W A;  5I58 A;  1UTB B;  3RY3 A;  3TEP A;  3P7I A;  2Q88 A;  3V5A A;  5L9S A;  5JK4 A;  3T93 B;  5ITO A;  3T9U A;  1NNF A;  3R26 A;  3UOR A;  3OMB A;  2OJT A;  1B32 A;  5IAI A;  2GHB A;  3JYR A;  2PT1 A;  2I58 A;  4RJZ A;  4XKP A;  3U8Q A;  3G3H A;  3QXM A;  4G2Z A;  4ZEB A;  1GV8 A;  3IB2 A;  3I5O A;  3Q25 A;  3THI A;  1Y9U A;  1BKA A;  1OQH A;  2O68 A;  1QW0 A;  1URS A;  2I3V A;  4GWO A;  3K6W A;  3MVW A;  1P1O A;  2E1S A;  2F78 A;  2G29 A;  4LQ5 A;  2V93 A;  4ESX A;  5KZT A;  1MXZ A;  2R6G E;  5H8H B;  2A5T B;  4HTG A;  4R6K A;  2ONS A;  1JW4 A;  3O29 A;  3DM0 A;  3PUW E;  4OYV A;  3S9M C;  3TCG A;  1MDQ A;  1QUI A;  1LBB A;  3OO9 A;  3KN3 A;  3Q29 A;  1A8E A;  4YB5 A;  4NF8 B;  3GZG A;  1PC3 A;  3K6U A;  4R72 A;  2VOZ A;  3SEU A;  3IL1 B;  1B4Z A;  4DXC A;  2O69 A;  3PMX A;  3V8X B;  4GQO A;  1B46 A;  3CFZ A;  3BFU A;  1MM6 A;  1ZJL A;  2YJP A;  1B4H A;  1DSN A;  3BFT A;  2RC7 A;  3G3G A;  3SEV A;  4ISU A;  3MPK A;  4YKI A;  4F2Q A;  4OXV A;  4I62 A;  3K01 A;  4U1Z A;  4I9D A;  2DVZ A;  3PUV E;  4GD5 A;  4E0X A;  3FXU A;  3ODB A;  3M3L A;  3N94 A;  2OCU A;  1LST A;  3G7W A;  4NF5 B;  3TAJ A;  3N6T A;  1B5H A;  1Y3P A;  2ZYN A;  3UGW A;  1LCF A;  1S50 A;  1JNF A;  2HFB A;  4G68 A;  5TP9 A;  3ZKL A;  1N7W A;  1P1Q A;  3C35 A;  1MM7 A; 
#chains in the Genus database with same CATH topology
 3TUS A;  2R8T A;  4R6H A;  4AS4 A;  2B4L A;  4H46 A;  2I4B A;  1SDX A;  1Z7M E;  1FTL A;  3VXB A;  4F2O A;  3UIF A;  4F22 A;  4N6P A;  2QPQ A;  4P9K A;  3CRB A;  2XX8 A;  2ZYM A;  4G68 C;  5AA2 D;  1MY1 A;  1PDA A;  1J1N A;  3G3K A;  2O7U A;  4EQ9 A;  2PX1 A;  2F7B A;  2I0B A;  3SES A;  2AYS A;  1LB8 A;  4LON B;  3JV9 A;  4ZEF A;  1MG1 A;  2QL3 A;  4QFN A;  2M8C A;  1S9T A;  3RTF B;  2F7A A;  4I8C A;  3E78 A;  1XT8 A;  5H8Q A;  3D4C A;  4OVJ A;  3SEX A;  1FQF A;  2Z8E A;  1SQY A;  3TFL A;  1I6B A;  2OWS A;  5TU0 A;  3KOT A;  5AA1 A;  3LSW A;  2PMS A;  1NNT A;  3PTY A;  2G93 A;  3OSQ A;  4PBH A;  4OES A;  1NNK A;  1PBQ A;  3UP9 A;  4QSE A;  1MS7 A;  4OVP A;  4QRZ A;  2P1S A;  4FE8 A;  1SI0 A;  3IO6 A;  3N5L A;  4JB7 A;  1K9Y A;  5CMK A;  3E13 X;  1PBP A;  1FBC A;  3RPL A;  1JVX A;  5I7I A;  5DT6 A;  2X7P A;  3CFX A;  1HSJ A;  3SER A;  4POX A;  1MH3 A;  5L9O A;  1MY4 A;  5AA2 A;  4RPO A;  3M8U A;  3LR1 A;  1B9J A;  2DVC A;  3BBR A;  4GWZ A;  4L17 A;  1AIV A;  1KZ8 A;  3IOU A;  1GTK A;  3CFL A;  1R9L A;  1B7U A;  3A3U A;  3G3F A;  4QFO A;  5I57 B;  4ZEC A;  3E4R A;  5AA4 B;  3AXF A;  2B3B A;  2FNC A;  4IO7 A;  2QRY A;  4XKN A;  1FQB A;  1MH4 A;  3TDJ A;  4BDL A;  4KYS A;  3ROJ A;  1QKA A;  2F6P A;  3EHT A;  1BK4 A;  1SI1 A;  5ET7 A;  3Q26 A;  1QKB A;  3VLW A;  3QMF A;  3MVZ A;  4IR8 A;  2DWH A;  4LAT A;  4OEV A;  2O51 A;  4AQ4 A;  2ZNT A;  2VD2 A;  1ZU0 A;  1A55 A;  1Y20 A;  1O64 A;  4KI0 E;  5TP9 B;  4LA9 A;  3SKP A;  4GWW A;  4GFR A;  4O3C A;  4RK2 A;  1ZBM A;  2NVU B;  1FPB A;  1JW5 A;  1G0H A;  3RUM A;  5KCJ B;  1Q9D A;  5IGA A;  1IZ1 A;  1VSO A;  4HW8 A;  3KFM A;  1MRP A;  3O28 A;  1MXV A;  4PE5 B;  4ELO A;  5FHN A;  1H43 A;  4N07 A;  4R6Y A;  1NUX A;  4Z7E A;  2DDK A;  5KCJ A;  3KC0 A;  4EQB A;  4KHZ E;  1P1N A;  3RT6 B;  3W9W A;  4OHN A;  1M5C A;  1DK4 A;  1B3H A;  2AL4 A;  3PPN A;  1JEV A;  2I0C A;  4ND9 A;  3BKI B;  3MP6 A;  2Y5K A;  1D9Q A;  3Q28 A;  4HXV A;  1MXY A;  1FW0 A;  4DI3 D;  2XXH A;  5ITP A;  2L5V A;  3KZG A;  4ZE9 A;  4LUB A;  1WDN A;  5I2N B;  1T0K A;  2DWI A;  3T9H B;  1R6Z A;  1N0T A;  4OZ9 A;  4OTE A;  2OBG A;  4YAH X;  3TCH A;  1IMF A;  1QVS A;  1RYO A;  1FQA A;  4XIG Q;  3HCQ A;  3FXQ A;  3HST A;  3FBP A;  1O63 A;  1DMB A;  3HO7 A;  2XXI A;  3PPQ A;  3S9N C;  3D1R A;  4GX3 A;  4NWD A;  5J16 A;  1XHY A;  3LSL A;  1B3E A;  1FTJ A;  2V3Q A;  1IXH A;  4MFI A;  4JSO A;  3MVY A;  1ZMG A;  5ET6 A;  3G3J A;  3TTK A;  3C34 A;  4DIG A;  1FTK A;  5CM6 A;  4WKM A;  5A5X A;  3MC2 A;  1M5F A;  3I3V A;  3CG1 A;  2RCA A;  1LBC A;  4G4P A;  2QS2 A;  5CBR A;  2UYE A;  4O3B A;  3VV5 A;  4R2F A;  3EHU A;  3B6T A;  4RPN A;  4F1U A;  5A5X B;  3QUF A;  2VPO A;  4FAT A;  4KCC A;  3VFJ A;  3MZ9 A;  4ELR A;  5A5L A;  2HAV A;  2B65 A;  3KSX A;  3O6H A;  1AWB A;  2PVU A;  3IOT A;  5KDT B;  3MPL A;  3FXR A;  3FJM A;  1DBZ A;  4BDQ A;  1POT A;  3K1N A;  4IB2 A;  4MH5 A;  4EXL A;  2NUV A;  1QGX A;  2H99 A;  2DXY A;  3LBS A;  4FOR A;  3RTW B;  1Y4C A;  2ONK E;  1I69 A;  3ONM A;  4DXU A;  1JP4 A;  4PTK A;  3DP8 A;  5ISU A;  1US4 A;  1FBP A;  2OK2 A;  1FBG A;  4ONY A;  1P99 A;  2I3W A;  4F19 A;  1H44 A;  2DWJ A;  1UTH A;  3KBR A;  4NWC A;  1ZTY A;  2Y7R A;  1KWH A;  1OLC A;  2HAU A;  3ECR A;  4U1O A;  4PFU A;  5M2V A;  4GWX A;  4N13 A;  2WBB A;  4H45 A;  3RGY A;  2KR0 A;  4ECF A;  4ZS9 A;  3LC8 A;  1FPF A;  5B70 A;  4PBQ A;  1EZP A;  1M5B A;  1OIB A;  3E9X A;  3K2D A;  2Q8M A;  3SET A;  1AOV A;  5F7V A;  4NHB A;  1H3D A;  4TLL B;  1GR2 A;  4E0W A;  1US5 A;  4GWU A;  2GQ1 A;  4N91 A;  5ITO A;  2OJT A;  5IAI A;  5EQ9 A;  2I58 A;  3G3H A;  4ZEB A;  3IB2 A;  3Q25 A;  3RPL B;  1OQH A;  4GWO A;  2I3V A;  2V4C A;  2F78 A;  1FPD A;  5KZT A;  5H8H B;  2ONS A;  3DM0 A;  4YB5 A;  1EYK A;  3SEU A;  4DXC A;  4P56 A;  1B46 A;  3BFU A;  1DSN A;  3BFT A;  3SEV A;  4ISU A;  4U1Z A;  3PUV E;  4NAP A;  4PDD A;  3N94 A;  1SPI A;  3G7W A;  3N6T A;  1NUY A;  5ESY A;  2CZH A;  3ZKL A;  3C35 A;  2F8D A;  1MM7 A;  4NF8 A;  3TTN A;  5H8N B;  4M1V A;  4R75 A;  1VDW A;  2XHD A;  4RYA A;  2YPN A;  1ANF A;  5HPQ A;  2AIX A;  4AB5 A;  3EF7 A;  4TQU Q;  4ZE8 A;  1B52 A;  4BDO A;  4F3P A;  3RYD A;  4I1D A;  2P2A A;  3HHG A;  1B5I A;  4QFL A;  4PET A;  2PCR A;  2B4M A;  4P1E A;  2KQZ A;  3VXC A;  2DS9 A;  5AE4 A;  3CIJ A;  1P1W A;  1ZLQ A;  1PB8 A;  2PFZ A;  2V84 A;  1FQC A;  4OEN A;  5AA4 A;  2Q9T A;  3LSF B;  1B40 A;  3C4M A;  3ILU B;  4M4G A;  5T3J A;  4WXJ A;  4NX1 A;  4YU0 A;  3K00 A;  4XTC Q;  4N6K A;  2WYK A;  1XS5 A;  1G0I A;  1N3W A;  1FBH A;  1I6A A;  1MPD A;  4LN5 A;  3FVN A;  3TMG A;  2O7I A;  2DE4 A;  4K3F A;  3TTR A;  1Y1Z A;  3IJX B;  4EXK A;  4JXI A;  2QSX A;  1DPP A;  1TT1 A;  3UA8 A;  3GLB A;  2A5T A;  4N4U A;  2UYF A;  4NMY A;  1RDX A;  4MAG A;  4OVR A;  3CR9 A;  4NGU A;  4H8J A;  1MPB A;  5J1D A;  1QUK A;  2P0S A;  3OO7 A;  4GLI A;  4OFO A;  2XXP A;  4NQ8 A;  2XD3 A;  5CBS A;  3V83 A;  1SYH A;  1FSA A;  4YKP A;  3NOH A;  3CVG A;  3QIM A;  3MYU A;  5H8Q B;  2QS4 A;  3T22 A;  1F9B A;  2QS1 A;  4RA1 A;  3MZ1 A;  2VD3 A;  3S9L C;  1FRP A;  1MQJ A;  3R7X A;  3TQW A;  1LB9 A;  4N15 A;  5ET5 A;  1XI6 A;  4N8Y A;  4MLQ A;  5FTH A;  3HN0 A;  5DTB A;  1IQ7 A;  1EZ9 A;  1N3X A;  3OEM A;  4N8G A;  4X9T A;  3K6X A;  5CRY A;  1R1N A;  3PUY E;  1LFH A;  2XA5 A;  3MBP A;  1INP A;  4XFE A;  4PQJ A;  3IK6 B;  3K1P A;  3T96 B;  4YZZ A;  4OMB A;  4G77 A;  1B6H A;  1B58 A;  5DW8 A;  2XWV A;  1YXI A;  1A8F A;  3DP4 A;  2ABH A;  4HE1 A;  1JW1 A;  1NKX A;  5H8S A;  3IB1 A;  2I6E A;  1MY0 A;  2QFL A;  2O1M A;  2DOJ A;  5DVF A;  1B3L A;  3C32 A;  3B8B A;  3OOA A;  3IOW A;  3B6W A;  1II5 A;  4RXL A;  1PEB A;  5FHO A;  2O84 X;  2NWJ A;  4P0I A;  1VE4 A;  4QHQ A;  1B05 A;  4U22 A;  1ZIU A;  2FVZ A;  3IOV A;  3U72 A;  1VFE A;  1TWY A;  5HBC A;  3K6V A;  4X8R A;  3FV1 A;  4P47 A;  4BLA A;  5AA2 B;  4C1U A;  3DEL B;  4FJP A;  2O6A A;  3MUQ A;  1D9V A;  4IGR A;  5JTY A;  1NV5 A;  4NF0 A;  1UIU A;  4HCW A;  3KSJ A;  2H5Y A;  1M5D A;  4OET A;  4XXU A;  2ZNU A;  4GOT A;  2H4I A;  2X26 A;  4OVQ A;  4XF5 A;  3H03 A;  5I5P A;  2Z23 A;  4Q8R A;  5ICT A;  3TQL A;  4GXA A;  4XKQ A;  3CG3 A;  4MEV A;  4PFB A;  3KGC A;  4OER A;  4DCY A;  1AL3 A;  3KJ7 A;  4C0R A;  2QVV A;  3HV1 A;  4ESW A;  4OFL A;  1ELJ A;  2ZMB A;  4ZZA A;  3EHS A;  2FBP A;  4GL8 A;  1MQD A;  3HPI A;  4QF9 A;  2IEE A;  2HXW A;  1H76 A;  3O66 A;  1FBD A;  3MP8 A;  4PF6 A;  1FPL A;  3ZSF A;  2FIE A;  4DI4 B;  3PPP A;  2WEF A;  1XVY A;  4PF8 A;  1A99 A;  3IAZ A;  4ZEK A;  4NG7 A;  3E3K A;  4OWD A;  4U23 A;  4GBW A;  1B0H A;  2ZZV A;  3UK4 A;  3TZA A;  4ELP A;  2CEY A;  3FJG A;  1IXI A;  3KOS A;  3FVK A;  1N76 A;  1BIY A;  3LUZ A;  4KYD A;  1CNQ A;  3G3I A;  4RY1 A;  3H6W A;  3K1M A;  1Z7N E;  1FPJ A;  4ELQ A;  2REJ A;  5IZZ A;  1CB6 A;  4OFJ A;  2XXU A;  2ZYO A;  5LOM A;  4I3Y A;  4X1D A;  3OO8 A;  2CEX A;  4HS7 A;  1B7H A;  1D3K A;  2BJJ X;  4ZDM A;  2F97 A;  3IB0 A;  2VP1 A;  5IZ1 A;  4H5F A;  3KBZ A;  4F3G A;  2KLF A;  2ZXT A;  3H3G A;  4PP0 A;  2B3F A;  3ZS6 A;  1HSE A;  2Q2C A;  3SEW A;  5CC2 A;  1N7X A;  1XVX A;  2ANJ A;  5I58 A;  1UTB B;  3TEP A;  3P7I A;  2Q88 A;  1NV2 A;  1NNF A;  3UOR A;  3OMB A;  1K9Z A;  2PT1 A;  3U8Q A;  4G2Z A;  3THI A;  1BKA A;  2WX9 A;  1QW0 A;  1URS A;  1P1O A;  4LQ5 A;  4R6K A;  1JW4 A;  1KA0 A;  3PUW E;  4OYV A;  3S9M C;  1MDQ A;  3KN3 A;  1PC3 A;  2VOZ A;  2O69 A;  3V8X B;  4PC9 A;  2RC7 A;  3G3G A;  4OXV A;  2DVZ A;  2OCU A;  1LST A;  1IMA A;  2ZZX A;  2ZYN A;  1JNF A;  2RF1 A;  2HFB A;  5TP9 A;  4POW A;  2DWA A;  5EYG A;  4G8N A;  4JWX A;  5F1Q A;  4F18 A;  5B7D A;  1Y3Q A;  3SDF A;  1NUW A;  2Y7K A;  4GWS A;  3U65 A;  4XKR A;  4MCO A;  4H8I A;  4NF4 B;  1RDZ A;  3LUY A;  5DVI A;  4PDH A;  1BTJ A;  1Y4T A;  5I57 A;  5CMM A;  3GBA A;  3GYY A;  5ELV A;  2UVJ A;  5K2X A;  3RT8 A;  4P0G A;  2GHA A;  4GX6 A;  1OVT A;  4X1B A;  3EPE A;  4H0W A;  4JSD A;  3JZJ A;  4I3E A;  1A54 A;  2HXR A;  4C1T A;  5H8F B;  3LSX A;  4MHF A;  4DDD A;  4F29 A;  4QFP A;  4R9G A;  4KCD A;  1FQD A;  5HM4 B;  3OXN A;  1DCU A;  1FCK A;  1NMU A;  3QK6 A;  4DE8 A;  5EQ8 A;  5EYH A;  2F5X A;  2QJE A;  2RKM A;  4WEP A;  1Y3N A;  4LVQ A;  4NE4 A;  4R74 A;  2WYP A;  2I49 A;  5EHM A;  2FA7 A;  2HQ0 A;  2THI A;  5KDT A;  1DTZ A;  1A7L A;  5K2Y A;  3C9H A;  1MQG A;  5IZ3 A;  3QSL A;  3BIH A;  4RNS A;  2LAO A;  3FJ7 A;  3OEL A;  5I58 B;  4MJO A;  3T66 A;  4JBZ A;  3VLU A;  1NL5 A;  3PMW A;  3PPR A;  5F24 A;  4OAN A;  4MNC A;  2F34 A;  2XXR A;  5IZ3 B;  4H1X A;  4O8M A;  5EHS A;  3T1B A;  4YMA A;  3VVE A;  1UTB A;  1FPI A;  3L6G A;  2Y7W A;  3KC1 A;  2XXV A;  3R6U A;  1N04 A;  4KFQ A;  3FIR A;  4EF1 A;  1TXF A;  4O94 A;  4FEB A;  2XXQ A;  3MAM A;  4EUO A;  2DE2 A;  3H4Z A;  4HE0 A;  3FXB A;  3IO4 A;  1FBE A;  3GBB A;  5EYF A;  5ET8 A;  1IXG A;  1IXC A;  3MQ9 A;  3PPO A;  4U2R A;  3O6G A;  3I6V A;  3SEY A;  3O2A A;  1QJM A;  4MNP A;  4R9F A;  4DCX A;  1B5J A;  2RCB A;  1NUZ A;  1PB7 A;  3TYH A;  5I2K B;  2DSF A;  3RN8 A;  4PGP A;  3M3K A;  4GIZ A;  3N6U A;  4PAK A;  4I40 A;  2WBD A;  4YB6 A;  4GBV A;  4NN3 A;  1LFI A;  1NV4 A;  5JTY B;  1LFG A;  4FIM A;  1SBP A;  2X7Q A;  4FAJ A;  3MZB A;  3BIG A;  1MQI A;  2RC8 A;  2XWK A;  1ZKB A;  4OQO A;  2RC9 A;  2OLB A;  3FVG A;  5H8F A;  3VVD A;  3PU5 A;  3CSB A;  1EU8 A;  2REG A;  4TLM B;  3H6V A;  1MY2 A;  1MXW A;  3CSG A;  1SW5 A;  4G8H A;  2F35 A;  1B1H A;  1JET A;  4NF6 B;  4UA8 A;  4HCY A;  1GGG A;  3PD9 A;  3TTM A;  4NTL A;  2CZI A;  2GH9 A;  1M5E A;  4F1Y A;  1LAX A;  2UVG A;  5CMB A;  4XEQ A;  3O97 A;  4MIJ A;  1FPG A;  5I84 A;  1NV1 A;  3C36 A;  2P3N A;  3WAF A;  4NF4 A;  4G8M A;  2XXX A;  3T9V A;  1POY 1;  5I56 B;  4PFR A;  2F36 A;  2DE3 A;  4F3B A;  5I2K A;  1UQW A;  5I59 B;  3TPA A;  4N17 A;  1NV0 A;  4QFK A;  2DYX A;  4YIC A;  2XXW A;  3A09 A;  3OEK A;  4P11 A;  4LZ5 A;  1MPC A;  4FED A;  4GWY A;  3A29 A;  5DVJ A;  3VDF A;  4OEU A;  5FBP A;  1IEJ A;  3IR1 A;  4PAI A;  1D4N A;  1NV3 A;  3FGS A;  3U1O A;  1IUD A;  1B3F A;  4F3S A;  3FAT A;  1URD A;  1LBX A;  3B6Q A;  3TCF A;  3K4U A;  1YPN A;  2V25 A;  3CI8 A;  4THI A;  2GRV A;  2H25 A;  3IFC A;  3MST A;  1MXX A;  1Y1M A;  5DYH A;  5BWJ A;  2UXA A;  4DZ1 A;  4JVD A;  4JVI A;  1CE2 A;  1UTH B;  3TOD A;  3RNN A;  4EDP A;  3V89 B;  3VVF A;  3E79 A;  2UVI A;  3A3C A;  3H7M A;  4H5G A;  1ATG A;  5TPA A;  2HEU A;  2Z8F A;  3M3F A;  4QBA A;  3W15 C;  1GVC A;  1WOD A;  4IO6 A;  4G68 B;  3EN3 A;  4F31 B;  3MW0 A;  5DEX B;  2PFY A;  4PE3 A;  2NOO A;  3OSR A;  4GF8 A;  1AH5 A;  2CMO A;  1EZO A;  3KJT A;  4U21 A;  2XXT A;  4Q5T A;  1FTO A;  1XC1 A;  4IO4 A;  4MF3 A;  3U92 A;  1YTV A;  4PFW A;  4R2B A;  1FPE A;  4RK9 A;  1XOC A;  2R9J A;  2V3U A;  1DOT A;  2Y7I A;  2D3I A;  4NF6 A;  3IFA A;  3H6U A;  2FIX A;  1BLF A;  4JWO A;  2UVH A;  4GRK A;  3RY3 A;  5JK4 A;  3T9U A;  3R26 A;  1B32 A;  2GHB A;  2XWO A;  4RJZ A;  5EQ7 A;  3QXM A;  1GV8 A;  3I5O A;  3CHG A;  3SZP A;  3MVW A;  2G29 A;  2R6G E;  2FHY A;  1LBW A;  4HTG A;  3O29 A;  1NV6 A;  3OO9 A;  2BJI A;  1A8E A;  4BDM A;  4NF8 B;  4R72 A;  3IL1 B;  4GQO A;  3CFZ A;  1MM6 A;  4MNI A;  1ZJL A;  2YJP A;  4F2Q A;  5LDZ A;  4I9D A;  4O7M A;  3ODB A;  3M3L A;  3TAJ A;  4NF5 B;  1Y3P A;  4G68 A;  1N7W A;  1P1Q A;  3PMV A;  1QUL A;  4FEC A;  4KXP A;  4LZ8 A;  4N6D A;  3PGF A;  4KYE A;  1FTA A;  3QYT A;  1AMF A;  1NH8 A;  3S4U A;  5LTC A;  1PB9 A;  4JWY A;  2ALU A;  2Y5L A;  1YCJ A;  2VHA A;  4YMB A;  5AA3 A;  5JEI A;  3RPW A;  3OD7 A;  1FTM A;  1Q1K A;  2W7Y A;  4Q0C A;  2XD2 A;  3ISP A;  3S9E A;  3FZV A;  2ZYK A;  3PUZ E;  4LZ7 A;  2QS3 A;  2Z22 A;  1B1X A;  2PBW A;  2QVU A;  3MVX A;  5L8D A;  2Q74 A;  1SW1 A;  4QSD A;  4IO3 A;  1R9Q A;  1B3G A;  4KR5 A;  3S2V A;  3D4G A;  3EKI A;  4JDF A;  2F3B A;  3KN8 A;  1LAH E;  2DQV A;  1OQG A;  1YAE A;  2P3V A;  1QUJ A;  3ILT B;  3C31 A;  3KN7 A;  3QAX A;  4R73 A;  1FBF A;  1DTG A;  5FTI A;  5I59 A;  4U4X A;  4PAF A;  2IA4 A;  1RYX A;  3FV2 A;  1LGB C;  2OZZ A;  2MKZ A;  4O7I A;  2D5W A;  3IJO B;  3MJN A;  1OMP A;  4F1V A;  3LV0 A;  1L5T A;  4ZED A;  2XX9 A;  1LEV A;  3PV0 E;  2E0S A;  4UAB A;  3UN6 A;  1WVJ A;  4XKP A;  4O3A A;  3TKD A;  4PFT A;  4YKK A;  1TFA A;  1O7T A;  2Q8J A;  3B7D A;  1TFD A;  3ZKK A;  3FVO A;  3W9V A;  2F3D A;  1DPE A;  3PUX E;  2FYI A;  2ESN A;  1MDP 1;  1OLA A;  4IO2 A;  4F39 A;  4KQP A;  5L9M A;  4QXD A;  3QUJ A;  4GX4 A;  5IKB A;  3GXA A;  1EH3 A;  2QMX A;  2Q2A A;  1NI9 A;  4ZEI A;  1LBZ A;  4PFY A;  3OEN A;  2CZK A;  2CZL A;  2D21 A;  1SYI A;  1IMB A;  2V3T A;  2AL5 A;  1P1U A;  3H06 B;  2JJK A;  5DEX A;  2ONR A;  3VLV A;  1JQF A;  1IMC A;  3U93 A;  1OVB A;  4NF5 A;  1H45 A;  3IX1 A;  4BDN A;  2DP8 A;  2Y84 A;  4HE2 A;  5I56 A;  4KD5 A;  5BUU A;  2Q89 A;  3L6H A;  4GL0 A;  3N26 A;  3C33 A;  3T9X B;  2ZNS A;  5I2N A;  4P3L A;  4MBP A;  1LAF E;  3FUZ A;  4U4S A;  1JVY A;  4OA4 A;  4MX6 A;  3FD3 A;  3TEL A;  3KG2 A;  3MP1 A;  3O6I A;  4OVS A;  1NH7 A;  2RIN A;  2HCA A;  1IIW A;  1NFT A;  1IMD A;  1S7Y A;  3RQT A;  3IOR A;  1SD3 A;  2HZK A;  2DXR A;  1LAG E;  3KEI A;  4QSC A;  1B51 A;  2O1L A;  4N81 A;  1KA1 A;  1RDY A;  1IIT A;  2HPG A;  2H9B A;  4PGN A;  2Y7P A;  2H98 A;  4DLD A;  1D9Y A;  3WAE A;  1YZ0 A;  1URG A;  2XX7 A;  4OVT A;  4AB6 A;  1MQH A;  4IY5 A;  1SVX B;  2XXK A;  1FJ9 A;  4TOZ A;  2GFE A;  4WED A;  5EQA A;  3EQ1 A;  1NV7 A;  4PFI A;  4X04 A;  3K02 A;  4Z0I A;  2NXO A;  4IGT A;  1SW2 A;  3B50 A;  5CMC A;  4PCD A;  5IM2 A;  3VE1 B;  1UIV A;  2I48 A;  1VFD A;  1FQE A;  4IO5 A;  2VGQ A;  3DP6 A;  4JVC A;  1I6Q A;  1EYJ A;  5TPA B;  3H6T A;  3MWB A;  4GVO A;  5FHM A;  2WKY A;  4UAC A;  3FAS A;  1B7Z A;  1BP5 A;  2HHM A;  3F11 A;  1NNP A;  3T0J A;  2F6G A;  4G61 A;  2PT2 A;  3U94 A;  4LP2 B;  3PD8 A;  3RLF E;  3O9P A;  4H65 A;  4DXB A;  4EQ7 A;  4EF2 A;  4GXS B;  4NED A;  2HZL A;  4Q30 B;  4BDR A;  4KPT A;  2A5S A;  2PYY A;  2YLN A;  1LBV A;  5H8N A;  4LQ2 A;  2F7C A;  1FJ6 A;  1IME A;  1JEU A;  3K0V A;  4YKJ A;  1USY H;  3USD A;  3DLN A;  3TTL A;  1USY E;  4IY6 A;  1LCT A;  2OWT A;  4X48 A;  3Q27 A;  4YB7 A;  5ICQ A;  1HSL A;  2QMW A;  1FPK A;  1Q35 A;  5H8H A;  1RKM A;  1A40 A;  3HFU A;  5I3S A;  4H67 A;  1MY3 A;  1N84 A;  1EYI A;  2I4C A;  4ZZE A;  4P8B A;  2R71 A;  4AS5 A;  2ZZW A;  4H6D A;  3OO6 A;  2Z8D A;  4MLV A;  3HHF A;  1VR5 A;  2VT5 A;  1YYZ A;  2OX3 A;  1LLS A;  2OWZ A;  1B2H A;  2XXY A;  1B0L A;  1MXU A;  1LBY A;  1SW4 A;  5CI5 A;  3V5A A;  5L9S A;  3T93 B;  3JYR A;  1Y9U A;  4P1L A;  2O68 A;  3K6W A;  2E1S A;  4ESX A;  2VPN A;  2V93 A;  1MXZ A;  4FBP A;  2A5T B;  2QVR A;  3TCG A;  1QUI A;  1LBB A;  3Q29 A;  3GZG A;  3K6U A;  2XWI A;  1B4Z A;  3PMX A;  1B4H A;  3MPK A;  4YKI A;  4I62 A;  3K01 A;  4GD5 A;  4E0X A;  3FXU A;  4MMP A;  1B5H A;  3UGW A;  1LCF A;  1S50 A; 
#chains in the Genus database with same CATH homology
 3TUS A;  2DWA A;  3PMV A;  4G8N A;  4JWX A;  1QUL A;  4NF8 A;  4FEC A;  3TTN A;  5F1Q A;  4M1V A;  4R75 A;  4R6H A;  4LZ8 A;  4F18 A;  1Y3Q A;  3SDF A;  5B7D A;  5H8N B;  2Y7K A;  2XHD A;  3PGF A;  4XKR A;  4RYA A;  4KYE A;  2YPN A;  4H8I A;  3QYT A;  2I4B A;  1AMF A;  4NF4 B;  3LUY A;  5DVI A;  1ANF A;  1SDX A;  1Z7M E;  2F8D A;  1FTL A;  1NH8 A;  5HPQ A;  2AIX A;  3VXB A;  3S4U A;  4AB5 A;  1BTJ A;  4F2O A;  1PB9 A;  1Y4T A;  3EF7 A;  4JWY A;  2ALU A;  3UIF A;  4TQU Q;  4F22 A;  4ZE8 A;  4N6P A;  1YCJ A;  5I57 A;  5CMM A;  1B52 A;  2VHA A;  4BDO A;  4YMB A;  2QPQ A;  3CRB A;  3GBA A;  2XX8 A;  2ZYM A;  5AA3 A;  4F3P A;  5ELV A;  5JEI A;  2UVJ A;  3OD7 A;  3RPW A;  1FTM A;  1Q1K A;  1MY1 A;  1PDA A;  2W7Y A;  1J1N A;  4G68 C;  4I1D A;  3G3K A;  5K2X A;  2P2A A;  3RT8 A;  3HHG A;  1B5I A;  4P0G A;  2GHA A;  2O7U A;  4Q0C A;  1OVT A;  2XD2 A;  4PET A;  4QFL A;  3EPE A;  4H0W A;  2PX1 A;  4X1B A;  4EQ9 A;  4JSD A;  2F7B A;  3S9E A;  2I0B A;  3FZV A;  2ZYK A;  3PUZ E;  3JZJ A;  4LZ7 A;  2AYS A;  3SES A;  1LB8 A;  2QS3 A;  4LON B;  2Z22 A;  3JV9 A;  1B1X A;  1A54 A;  2PBW A;  2DS9 A;  3MVX A;  5L8D A;  3VXC A;  4C1T A;  4ZEF A;  1SW1 A;  1MG1 A;  3CIJ A;  4QSD A;  5H8F B;  5AE4 A;  1P1W A;  2QL3 A;  4QFN A;  2M8C A;  4IO3 A;  1S9T A;  1PB8 A;  1ZLQ A;  2V84 A;  2F7A A;  3RTF B;  1FQC A;  1R9Q A;  4I8C A;  1B3G A;  4OEN A;  5AA4 A;  4KR5 A;  3LSX A;  1XT8 A;  2Q9T A;  5H8Q A;  3S2V A;  4EQ7 A;  3D4C A;  4DDD A;  4F29 A;  4QFP A;  3LSF B;  3D4G A;  4JDF A;  1B40 A;  4R9G A;  4KCD A;  3C4M A;  1FQD A;  4OVJ A;  3ILU B;  3SEX A;  1FQF A;  4M4G A;  3KN8 A;  1LAH E;  2DQV A;  2Z8E A;  1OQG A;  1YAE A;  1SQY A;  4WXJ A;  3OXN A;  4YU0 A;  1I6B A;  3TFL A;  3K00 A;  2OWS A;  1FCK A;  1QUJ A;  1NMU A;  5TU0 A;  4XTC Q;  3KOT A;  5AA1 A;  3LSW A;  3QK6 A;  2PMS A;  1NNT A;  3ILT B;  4DE8 A;  3C31 A;  2G93 A;  3KN7 A;  3OSQ A;  3QAX A;  2F5X A;  4OES A;  1NNK A;  1PBQ A;  1XS5 A;  2QJE A;  2RKM A;  4R73 A;  4WEP A;  1DTG A;  2RF1 A;  1Y3N A;  5FTI A;  4LVQ A;  3UP9 A;  5I59 A;  4NE4 A;  4R74 A;  2I49 A;  4U4X A;  4QSE A;  1MS7 A;  5EHM A;  1N3W A;  2FA7 A;  2IA4 A;  4QRZ A;  1I6A A;  2HQ0 A;  2P1S A;  4FE8 A;  1MPD A;  2THI A;  1SI0 A;  1RYX A;  3FVN A;  3IO6 A;  3TMG A;  3FV2 A;  3N5L A;  1LGB C;  4JB7 A;  5KDT A;  2O7I A;  2DE4 A;  2OZZ A;  1DTZ A;  4K3F A;  3TTR A;  1Y1Z A;  1A7L A;  5CMK A;  2D5W A;  3IJO B;  5K2Y A;  3IJX B;  3E13 X;  1PBP A;  3MJN A;  4EXK A;  1JVX A;  1OMP A;  5DT6 A;  3C9H A;  4JXI A;  1MQG A;  2QSX A;  1DPP A;  2X7P A;  4F1V A;  3CFX A;  1L5T A;  1HSJ A;  4ZED A;  3SER A;  3QSL A;  1TT1 A;  3UA8 A;  3GLB A;  2A5T A;  2XX9 A;  1MH3 A;  4POX A;  2UYF A;  4NMY A;  5L9O A;  1MY4 A;  2LAO A;  4RNS A;  5AA2 A;  3PV0 E;  3CR9 A;  4RPO A;  2E0S A;  3M8U A;  1MPB A;  3LR1 A;  4H8J A;  3FJ7 A;  3OEL A;  5I58 B;  3UN6 A;  3T66 A;  5J1D A;  1B9J A;  1QUK A;  1WVJ A;  2DVC A;  2P0S A;  3BBR A;  3OO7 A;  4JBZ A;  4L17 A;  4GLI A;  4O3A A;  3VLU A;  4OFO A;  2XXP A;  3TKD A;  1AIV A;  1NL5 A;  1GTK A;  2XD3 A;  3IOU A;  3PMW A;  3PPR A;  3CFL A;  1R9L A;  4PFT A;  5CBS A;  1B7U A;  3A3U A;  3G3F A;  4QFO A;  3V83 A;  1SYH A;  4YKK A;  4ZEC A;  1TFA A;  5I57 B;  1O7T A;  2Q8J A;  3B7D A;  4YKP A;  3E4R A;  5AA4 B;  1TFD A;  3AXF A;  2B3B A;  2F34 A;  3CVG A;  3QIM A;  3ZKK A;  5H8Q B;  3FVO A;  2FNC A;  2QS4 A;  3T22 A;  3W9V A;  1F9B A;  1DPE A;  2QS1 A;  3PUX E;  2QRY A;  2XXR A;  4IO7 A;  4H1X A;  4RA1 A;  2FYI A;  5EHS A;  4YMA A;  4XKN A;  2ESN A;  3MZ1 A;  2VD3 A;  1FQB A;  3VVE A;  3S9L C;  1MH4 A;  1MDP 1;  1OLA A;  4IO2 A;  1MQJ A;  3TDJ A;  3R7X A;  4KQP A;  5L9M A;  4F39 A;  4BDL A;  1UTB A;  4KYS A;  3TQW A;  1LB9 A;  5AA2 D;  3L6G A;  2Y7W A;  3QUJ A;  1QKA A;  2F6P A;  3EHT A;  5IKB A;  1SI1 A;  3GXA A;  1EH3 A;  4MLQ A;  5FTH A;  2QMX A;  2Q2A A;  2XXV A;  3HN0 A;  3Q26 A;  3R6U A;  1N04 A;  4KFQ A;  3FIR A;  4EF1 A;  5BWJ A;  1QKB A;  1TXF A;  3VLW A;  5DTB A;  4ZEI A;  1IQ7 A;  4PFY A;  3MVZ A;  2DWH A;  4LAT A;  1EZ9 A;  1N3X A;  3OEN A;  4OEV A;  4FEB A;  3OEM A;  2CZL A;  2D21 A;  2O51 A;  2XXQ A;  4AQ4 A;  4X9T A;  1SYI A;  3MAM A;  4EUO A;  2V3T A;  2ZNT A;  2AL5 A;  2VD2 A;  2DE2 A;  3H4Z A;  1P1U A;  3H06 B;  3K6X A;  5CRY A;  1R1N A;  3IO4 A;  3PUY E;  1LFH A;  3GBB A;  5EYF A;  5DEX A;  3MBP A;  2ONR A;  3VLV A;  1IXG A;  1ZU0 A;  1IXC A;  3MQ9 A;  1A55 A;  3PPO A;  4U2R A;  1JQF A;  1Y20 A;  4PQJ A;  1O64 A;  4KI0 E;  3U93 A;  3O6G A;  3I6V A;  3SEY A;  3IK6 B;  3K1P A;  3O2A A;  1QJM A;  4LA9 A;  5TP9 B;  3T96 B;  4R9F A;  4YZZ A;  4OMB A;  4DCX A;  4G77 A;  1B6H A;  1B5J A;  1OVB A;  1B58 A;  3SKP A;  4NF5 A;  1H45 A;  3IX1 A;  2RCB A;  1A8F A;  1PB7 A;  4GFR A;  4O3C A;  2DP8 A;  2Y84 A;  4RK2 A;  5I2K B;  3TYH A;  1ZBM A;  2NVU B;  2DSF A;  3DP4 A;  1JW5 A;  3RN8 A;  3RUM A;  2ABH A;  3M3K A;  4GIZ A;  5KCJ B;  3N6U A;  5I56 A;  1IZ1 A;  1VSO A;  4YB6 A;  4KD5 A;  5BUU A;  1JW1 A;  1NKX A;  4HW8 A;  2Q89 A;  1LFI A;  3L6H A;  5JTY B;  4GL0 A;  5H8S A;  3N26 A;  3C33 A;  3IB1 A;  1LFG A;  2ZNS A;  3KFM A;  3T9X B;  1MRP A;  4FIM A;  3O28 A;  5I2N A;  1MXV A;  4PE5 B;  4ELO A;  5FHN A;  1H43 A;  4N07 A;  4R6Y A;  1SBP A;  2X7Q A;  4MBP A;  2I6E A;  1LAF E;  4POW A;  4FAJ A;  3MZB A;  4Z7E A;  1MY0 A;  3FUZ A;  1MQI A;  4U4S A;  5KCJ A;  2O1M A;  2RC8 A;  4EQB A;  2DOJ A;  1ZKB A;  1JVY A;  4KHZ E;  4OQO A;  1P1N A;  5DVF A;  1B3L A;  3C32 A;  3FD3 A;  3RT6 B;  4OHN A;  3W9W A;  1M5C A;  2RC9 A;  3TEL A;  2OLB A;  3FVG A;  5H8F A;  3KG2 A;  3VVD A;  3OOA A;  1B3H A;  2AL4 A;  3MP1 A;  3O6I A;  1NH7 A;  3B6W A;  2RIN A;  3IOW A;  2HCA A;  1IIW A;  1NFT A;  3PPN A;  1JEV A;  2I0C A;  4ND9 A;  3PU5 A;  3CSB A;  1EU8 A;  1S7Y A;  1II5 A;  3RQT A;  2REG A;  3IOR A;  4TLM B;  3BKI B;  3H6V A;  3MP6 A;  1MY2 A;  4RXL A;  1PEB A;  5FHO A;  2O84 X;  1SD3 A;  1MXW A;  2HZK A;  3CSG A;  2DXR A;  1LAG E;  3KEI A;  1SW5 A;  4QSC A;  1B51 A;  2O1L A;  3Q28 A;  4G8H A;  2NWJ A;  4P0I A;  1IIT A;  1MXY A;  2H9B A;  1VE4 A;  2F35 A;  1B1H A;  4QHQ A;  1B05 A;  4U22 A;  1JET A;  1ZIU A;  2Y7P A;  2H98 A;  1FW0 A;  3IOV A;  4NF6 B;  3U72 A;  1VFE A;  1TWY A;  2XXH A;  4HCY A;  4UA8 A;  4DLD A;  5ITP A;  1GGG A;  3PD9 A;  5HBC A;  3TTM A;  3K6V A;  4NTL A;  1D9Y A;  3FV1 A;  3WAE A;  2GH9 A;  4BLA A;  1URG A;  3KZG A;  4C1U A;  5AA2 B;  2XX7 A;  4ZE9 A;  4LUB A;  1M5E A;  1WDN A;  3DEL B;  4FJP A;  4F1Y A;  5I2N B;  2DWI A;  4AB6 A;  1T0K A;  2O6A A;  1MQH A;  1D9V A;  3MUQ A;  4IGR A;  4IY5 A;  1R6Z A;  3T9H B;  5JTY A;  1SVX B;  1UIU A;  1N0T A;  4HCW A;  4OZ9 A;  4OTE A;  1LAX A;  2OBG A;  2UVG A;  5CMB A;  4YAH X;  3TCH A;  3KSJ A;  2H5Y A;  3O97 A;  4TOZ A;  1QVS A;  1RYO A;  1FQA A;  4XIG Q;  1M5D A;  5I84 A;  3C36 A;  2GFE A;  4OET A;  4XXU A;  3HCQ A;  4WED A;  3WAF A;  2ZNU A;  4GOT A;  3FXQ A;  4NF4 A;  3EQ1 A;  2H4I A;  2X26 A;  2XXX A;  4G8M A;  1POY 1;  3HST A;  3H03 A;  3T9V A;  5I56 B;  1O63 A;  2F36 A;  3K02 A;  2DE3 A;  4Z0I A;  1DMB A;  2Z23 A;  4F3B A;  4Q8R A;  5ICT A;  3TQL A;  3HO7 A;  4GXA A;  5I2K A;  2XXI A;  1UQW A;  5I59 B;  2NXO A;  3PPQ A;  4IGT A;  3TPA A;  4XKQ A;  1SW2 A;  3CG3 A;  3S9N C;  1GVC A;  4QFK A;  5CMC A;  3VE1 B;  2DYX A;  1UIV A;  2I48 A;  1VFD A;  1XHY A;  2XXW A;  3KGC A;  3LSL A;  4NWD A;  1B3E A;  1FTJ A;  2V3Q A;  4YIC A;  4DCY A;  1IXH A;  1FQE A;  3A09 A;  3OEK A;  4JSO A;  4IO5 A;  4LZ5 A;  4MFI A;  1MPC A;  4P11 A;  1AL3 A;  4FED A;  2VGQ A;  3KJ7 A;  3MVY A;  1ZMG A;  3DP6 A;  5DVJ A;  4C0R A;  3VDF A;  4OEU A;  3HV1 A;  1IEJ A;  3G3J A;  4ESW A;  1I6Q A;  3IR1 A;  5TPA B;  3TTK A;  3H6T A;  3C34 A;  3MWB A;  4OFL A;  4GVO A;  4DIG A;  1D4N A;  1FTK A;  1ELJ A;  2ZMB A;  5FHM A;  4ZZA A;  2WKY A;  3FGS A;  3U1O A;  1IUD A;  3EHS A;  5CM6 A;  4WKM A;  1B3F A;  4F3S A;  4OER A;  3FAT A;  4UAC A;  5A5X A;  3FAS A;  3MC2 A;  4GL8 A;  1B7Z A;  1BP5 A;  1URD A;  1MQD A;  3HPI A;  4QF9 A;  3F11 A;  2IEE A;  1M5F A;  3B6Q A;  3CG1 A;  2RCA A;  3I3V A;  1LBC A;  1NNP A;  4G4P A;  2HXW A;  1H76 A;  3O66 A;  2F6G A;  3TCF A;  2PT2 A;  3U94 A;  2QS2 A;  4LP2 B;  3PD8 A;  3RLF E;  5CBR A;  2UYE A;  3K4U A;  3MP8 A;  4O3B A;  3VV5 A;  3O9P A;  4R2F A;  3EHU A;  1YPN A;  4H65 A;  3ZSF A;  4DXB A;  4EF2 A;  2V25 A;  3CI8 A;  3B6T A;  3PPP A;  4GXS B;  4NED A;  2HZL A;  2GRV A;  4RPN A;  4THI A;  4F1U A;  5A5X B;  1XVY A;  4Q30 B;  2H25 A;  3QUF A;  4BDR A;  4KPT A;  2A5S A;  4FAT A;  2PYY A;  4KCC A;  4F19 A;  3VFJ A;  3MZ9 A;  2YLN A;  4ELR A;  1MXX A;  1Y1M A;  2HAV A;  2B65 A;  3KSX A;  5DYH A;  5H8N A;  3O6H A;  2UXA A;  4LQ2 A;  4DZ1 A;  2F7C A;  2PVU A;  3IOT A;  5KDT B;  3MPL A;  1CE2 A;  1A99 A;  1UTH B;  3IAZ A;  4ZEK A;  1JEU A;  3E3K A;  3FXR A;  3K0V A;  4OWD A;  4U23 A;  3FJM A;  3TOD A;  4BDQ A;  4YKJ A;  1USY H;  1POT A;  3K1N A;  3RNN A;  4IB2 A;  1B0H A;  4MH5 A;  3DLN A;  3USD A;  4EDP A;  3V89 B;  4EXL A;  5HM4 B;  3UK4 A;  2NUV A;  3TZA A;  4ELP A;  3TTL A;  3VVF A;  1USY E;  2UVI A;  4IY6 A;  2H99 A;  2DXY A;  3A3C A;  1LCT A;  3FJG A;  3LBS A;  3H7M A;  4FOR A;  1ATG A;  4H5G A;  5TPA A;  3RTW B;  1IXI A;  3KOS A;  2HEU A;  1Y4C A;  2ONK E;  2OWT A;  3FVK A;  1N76 A;  1BIY A;  2Z8F A;  3M3F A;  4KYD A;  1I69 A;  4X48 A;  3Q27 A;  3W15 C;  3ONM A;  1WOD A;  3G3I A;  3H6W A;  4G68 B;  4IO6 A;  3K1M A;  1Z7N E;  4RY1 A;  4YB7 A;  4DXU A;  4ELQ A;  5ICQ A;  2REJ A;  1CB6 A;  3EN3 A;  4OFJ A;  1HSL A;  2QMW A;  3DP8 A;  2XXU A;  2ZYO A;  3MW0 A;  4F31 B;  1US4 A;  5DEX B;  5LOM A;  5ISU A;  4X1D A;  1Q35 A;  3OO8 A;  4BDN A;  5H8H A;  1RKM A;  2NOO A;  3OSR A;  4GF8 A;  1A40 A;  1AH5 A;  2OK2 A;  2CMO A;  4ONY A;  1P99 A;  2I3W A;  3KJT A;  1EZO A;  4H67 A;  1H44 A;  1MY3 A;  4HS7 A;  1B7H A;  1D3K A;  1N84 A;  2BJJ X;  4ZDM A;  4U21 A;  4BDM A;  2DWJ A;  2XXT A;  4Q5T A;  1FTO A;  1XC1 A;  2F97 A;  4IO4 A;  3IB0 A;  2I4C A;  2VP1 A;  4ZZE A;  1UTH A;  3KBR A;  4NWC A;  1ZTY A;  2Y7R A;  2R71 A;  1KWH A;  4H5F A;  1OLC A;  2HAU A;  3ECR A;  4U1O A;  4PFU A;  5M2V A;  4N13 A;  4H6D A;  4MF3 A;  3U92 A;  3OO6 A;  1YTV A;  2Z8D A;  4MLV A;  3RGY A;  4PFW A;  4R2B A;  4ECF A;  4F3G A;  4ZS9 A;  3HHF A;  3LC8 A;  1VR5 A;  2KLF A;  4RK9 A;  1XOC A;  5B70 A;  2R9J A;  2ZXT A;  3H3G A;  2V3U A;  1DOT A;  1EZP A;  1M5B A;  2Y7I A;  1OIB A;  1LLS A;  2D3I A;  4NF6 A;  3E9X A;  4PP0 A;  3K2D A;  3SET A;  1AOV A;  1B2H A;  2XXY A;  1B0L A;  1MXU A;  2B3F A;  3H6U A;  5F7V A;  1HSE A;  3ZS6 A;  1H3D A;  2Q2C A;  1BLF A;  4TLL B;  3SEW A;  1N7X A;  5CC2 A;  1SW4 A;  4JWO A;  2UVH A;  1GR2 A;  2ANJ A;  1XVX A;  4GRK A;  5CI5 A;  1US5 A;  4E0W A;  5I58 A;  1UTB B;  3RY3 A;  3TEP A;  3P7I A;  2Q88 A;  3V5A A;  5L9S A;  5JK4 A;  3T93 B;  5ITO A;  3T9U A;  1NNF A;  3R26 A;  3UOR A;  3OMB A;  2OJT A;  1B32 A;  5IAI A;  2GHB A;  3JYR A;  2PT1 A;  2I58 A;  4RJZ A;  4XKP A;  3U8Q A;  3G3H A;  3QXM A;  4G2Z A;  4ZEB A;  1GV8 A;  3IB2 A;  3I5O A;  3Q25 A;  3THI A;  1Y9U A;  1BKA A;  1OQH A;  2O68 A;  1QW0 A;  1URS A;  2I3V A;  4GWO A;  3K6W A;  3MVW A;  1P1O A;  2E1S A;  2F78 A;  2G29 A;  4LQ5 A;  2V93 A;  4ESX A;  5KZT A;  1MXZ A;  2R6G E;  5H8H B;  2A5T B;  4HTG A;  4R6K A;  2ONS A;  1JW4 A;  3O29 A;  3DM0 A;  3PUW E;  4OYV A;  3S9M C;  3TCG A;  1MDQ A;  1QUI A;  1LBB A;  3OO9 A;  3KN3 A;  3Q29 A;  1A8E A;  4YB5 A;  4NF8 B;  3GZG A;  1PC3 A;  3K6U A;  4R72 A;  2VOZ A;  3SEU A;  3IL1 B;  1B4Z A;  4DXC A;  2O69 A;  3PMX A;  3V8X B;  4GQO A;  1B46 A;  3CFZ A;  3BFU A;  1MM6 A;  1ZJL A;  2YJP A;  1B4H A;  1DSN A;  3BFT A;  2RC7 A;  3G3G A;  3SEV A;  4ISU A;  3MPK A;  4YKI A;  4F2Q A;  4OXV A;  4I62 A;  3K01 A;  4U1Z A;  4I9D A;  2DVZ A;  3PUV E;  4GD5 A;  4E0X A;  3FXU A;  3ODB A;  3M3L A;  3N94 A;  2OCU A;  1LST A;  3G7W A;  4NF5 B;  3TAJ A;  3N6T A;  1B5H A;  1Y3P A;  2ZYN A;  3UGW A;  1LCF A;  1S50 A;  1JNF A;  2HFB A;  4G68 A;  5TP9 A;  3ZKL A;  1N7W A;  1P1Q A;  3C35 A;  1MM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...