4C1TA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with arabinoxylotriose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SUGAR TRANSPORTER SOLUTE-BINDING PROTEIN
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
total genus 132
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1tA02
3TTLA 3IAZA 2XXPA 5B70A 2QPQA 4I62A 1LFIA 1OLCA 2QS1A 3OSQA 5EYFA 2D21A 1T0KA 1QW0A 4F3GA 4FJPA 1LAGE 5EHSA 1Z7ME 3TTNA 3IO6A 4QSDA 3MBPA 5I84A 3CRBA 2I49A 1LSTA 1S9TA 2I4CA 2V93A 4JSDA 2HFBA 1H45A 1GVCA 3V8XB 2NXOA 5DT6A 3SETA 3MWBA 4R6YA 3I3VA 4Q5TA 3E4RA 3V89B 3UGWA 4R73A 2VOZA 3VXBA 3SEWA 2HQ0A 3PUYE 2F78A 4GIZA 2M8CA 1S7YA 2P0SA 4DCYA 1PDAA 1Y3NA 4OERA 2XXHA 5AA4B 1FQFA 4QFOA 4I8CA 5H8NA 3K01A 2F36A 4EF1A 3E13X 1OMPA 1SI0A 1PB9A 1Z7NE 4R75A 5ICTA 3FZVA 3MPKA 3HHFA 4NF8A 3CR9A 4KFQA 1B3HA 1IXIA 3O9PA 1JW1A 4KYSA 1M5DA 3PD8A 1B0HA 4OXVA 3IX1A 3ZKLA 4ELOA 2XXQA 1LB9A 2A5TA 3M8UA 4TLMB 3HV1A 3H4ZA 4H5FA 5HM4B 2DSFA 5CBRA 3F11A 3ONMA 1MQJA 3FVOA 3ILTB 3UIFA 1B05A 3KEIA 5I57A 3GBAA 4RXLA 4MH5A 3DLNA 2P1SA 4GD5A 4G68C 1POTA 2XXXA 1QKBA 4EDPA 4POWA 3FXRA 5CBSA 2DS9A 4F39A 3KSJA 4IGTA 4P0GA 4YB5A 2UYFA 4ND9A 2DXRA 3M3KA 1LCFA 4RK2A 3MVWA 5B7DA 3Q27A 3C9HA 3PV0E 5FHMA 2Q8JA 3UN6A 4I9DA 4YKIA 1B3EA 4H65A 2RINA 3RQTA 2HXWA 2I3WA 4U21A 1D4NA 4GOTA 3TPAA 5I59B 3AXFA 4DLDA 3SESA 1MDP1 1NNTA 1B9JA 4O3CA 5TP9B 4DIGA 4XKNA 5H8QA 2GFEA 5CC2A 3H3GA 1MXXA 2B65A 4TOZA 1QUJA 1M5CA 2DVCA 2I48A 4DDDA 1DOTA 2H25A 2DXYA 1QUIA 5FHOA 3JV9A 2B3BA 1H76A 4HCYA 1H44A 3FASA 2FNCA 3C32A 2XD3A 3K1NA 2D5WA 2Z22A 2ALUA 3IK6B 4F18A 3USDA 3RGYA 4HW8A 5KDTA 1NNPA 1VFEA 2XXWA 4IGRA 1A99A 4U22A 3CFLA 2Q2AA 1MY4A 1TFAA 3KN3A 2E1SA 4AQ4A 2ONSA 5FHNA 3OEMA 5EHMA 2X7QA 4XKPA 3K6VA 2H4IA 3N6TA 2XXTA 3QSLA 1PB7A 3MC2A 3FATA 2D3IA 3RPWA 4GXSB 2QMXA 1B40A 4KQPA 3T9UA 4NF4B 4MF3A 3PU5A 4BDLA 1SQYA 4WKMA 4ZEBA 2RC8A 4H8JA 3PPNA 2QL3A 4AB6A 5H8HB 3EHSA 3GXAA 4KCDA 4ZZEA 1MY3A 3FUZA 3PD9A 3VLUA 4U23A 4EXKA 3O6HA 1HSJA 1GV8A 4KPTA 3PGFA 2AIXA 1Q1KA 1EZ9A 1H43A 3EN3A 4ECFA 1I6AA 1FTOA 1NL5A 4R74A 1TWYA 3T9HB 3PMVA 1YTVA 3EHTA 3LSWA 1SW5A 3SEXA 3KBRA 1DTZA 3EPEA 1B4HA 2UYEA 3RY3A 4LATA 4BDQA 1FTLA 1POY1 3T96B 3IO4A 3VLVA 3KSXA 1UTHB 3OO6A 3CFXA 3FD3A 1NNFA 3W15C 3RTFB 3R7XA 1RYOA 3JYRA 3IB2A 1LLSA 2HEUA 3W9VA 4LZ7A 5L9SA 5I56A 3MPLA 4YKJA 2Z8EA 5TPAB 1MY0A 4F2OA 5KZTA 3FXUA 4PFYA 3Q25A 4LA9A 3R6UA 3QYTA 5I2NB 4FIMA 2UVIA 4O3BA 4F22A 3FVNA 4GF8A 2DYXA 3O2AA 2DE3A 4G2ZA 4G8MA 3OSRA 1B32A 3DELB 1HSLA 2O6AA 3HPIA 3FJMA 3QUJA 2Z23A 3SEUA 3TYHA 1O64A 3IB1A 1JEUA 5CM6A 4OFJA 3MVZA 1AOVA 2HZKA 2UVHA 4JSOA 3CFZA 2RF1A 1B2HA 3S9EA 1IZ1A 4ESXA 5A5XB 3VVDA 4RJZA 2XXYA 4XKQA 1A54A 5I2KB 4U1ZA 1PC3A 3MVXA 1EH3A 2ABHA 4X1BA 2NUVA 3H03A 2VD3A 4F31B 3FV2A 1P1QA 3UP9A 1Y9UA 4RNSA 2KLFA 3VVEA 2HAUA 2I4BA 4PFUA 2REGA 1LCTA 2ZYMA 3B6WA 3SDFA 2H98A 3EQ1A 4JBZA 4O3AA 3H6UA 3FVGA 2ZYNA 3K0VA 4Z7EA 4M4GA 1IITA 1HSEA 3TAJA 1N3XA 4KYEA 2O51A 1A40A 4THIA 3DP4A 1FCKA 3BFTA 1Q35A 4GQOA 2F6PA 3RUMA 3TUSA 1B3GA 1ELJA 2R71A 2XHDA 4FECA 4Q0CA 4LUBA 1SW2A 4DZ1A 3JZJA 1B5HA 3KN8A 5H8SA 3FGSA 4F3BA 5K2XA 2F97A 4PETA 4NEDA 3IOUA 4YICA 5JEIA 3TZAA 2W7YA 1YCJA 3HHGA 2RC9A 4LONB 3A3CA 2LAOA 2DQVA 5BUUA 3CVGA 4ZECA 4NWDA 3RT6B 4YB7A 4IY5A 1B6HA 1OLAA 1MPCA 2OBGA 2Z8FA 1R6ZA 4PP0A 1N04A 3CG1A 1ZLQA 2OZZA 4ZE9A 4R9FA 2NVUB 4RK9A 4E0WA 3G3HA 5CRYA 4DXCA 4G8NA 4ELPA 4R2FA 4DE8A 1MG1A 4F1YA 2X7PA 3RN8A 4BDNA 5KCJA 1O7TA 2OWSA 3KN7A 1JETA 1Y4CA 4MLVA 1Y1MA 1UTHA 4R6KA 1JVYA 3O29A 1CE2A 3RLFE 3CG3A 2O1LA 4BLAA 3IOTA 4G68A 1AL3A 3KJTA 4MLQA 3SKPA 1YPNA 3ZKKA 3TCHA 3A09A 3SERA 3TEPA 1FTJA 3LSLA 2QJEA 4OTEA 3TQLA 4H8IA 4U2RA 2Q9TA 2DWJA 4OESA 2XXIA 2ZYKA 3VV5A 3U72A 2P2AA 1II5A 1UTBB 2QMWA 1B3LA 2I58A 2THIA 4AB5A 1MXWA 4QSEA 3N5LA 3FIRA 3QIMA 3K1MA 1B52A 4NF5A 3VE1B 2RCBA 3TELA 3U8QA 2ANJA 4RA1A 4LP2B 2XXUA 5I58B 3TCGA 1A8EA 3T22A 4NMYA 4UACA 1MQDA 4WXJA 1US5A 2XX9A 1P1UA 1MRPA 1A55A 4P11A 1JNFA 4JDFA 1ANFA 1SD3A 2A5SA 3I5OA 4IB2A 4DXBA 5DEXA 3K2DA 2ZMBA 3IB0A 4F1UA 4NF6A 2PT2A 4C0RA 3C31A 3UORA 2AYSA 3KG2A 2VD2A 1S50A 1IQ7A 1N84A 5DVIA 2R9JA 3QK6A 4FEDA 2Q2CA 2O7IA 5FTIA 1LGBC 3DM0A 4F3SA 1D9YA 3B6QA 1LBCA 2HAVA 4IY6A 2PT1A 3EHUA 4G4PA 3T9VA 1UIVA 3FVKA 4GFRA 5M2VA 1EZOA 2PVUA 5ITPA 4XXUA 2DWHA 3VFJA 1GGGA 1Y3PA 5AA3A 2Y84A 3OMBA 3L6HA 1AMFA 1P1OA 3IORA 4JWOA 3CI8A 4GL8A 1XVXA 3MP6A 1A7LA 3K4UA 2Y7RA 4FATA 3O66A 1WDNA 1SYHA 1XS5A 2FYIA 1UQWA 3O97A 1EU8A 3MW0A 3TTMA 4ZEIA 5J1DA 2UVGA 3T9XB 4H67A 1O63A 3OELA 3O28A 1URSA 2O69A 3UA8A 3E9XA 3EF7A 4GLIA 1USYE 1XVYA 2XXVA 1CB6A 4QRZA 3PPRA 5DTBA 5AA1A 1IXCA 3C36A 4YU0A 5AA4A 3S9MC 1P99A 2O7UA 1VR5A 1B5JA 4H1XA 1M5BA 5TU0A 3OEKA 3TFLA 3WAFA 5IAIA 1PB8A 5AA2B 3KOTA 3UK4A 5H8NB 3PMXA 1YAEA 4GVOA 4OMBA 3CSBA 4OFOA 3KOSA 3C33A 1R9LA 4ZE8A 1MS7A 4JWYA 3N26A 2AL4A 3S9NC 3OXNA 3OD7A 3IOWA 4NE4A 4EXLA 4MBPA 3H6WA 3OENA 1AIVA 1FQEA 2ZNTA 3MZBA 4TQUQ 3PMWA 4FEBA 3K6XA 3H6VA 4QHQA 2A5TB 4BDMA 1I6BA 1UIUA 4JB7A 2V3UA 1Y20A 1MQIA 2QS2A 4PQJA 1B3FA 1IUDA 4PE5B 3BFUA 2QS4A 4MFIA 4TLLB 2Q88A 1UTBA 1B5IA 3IL1B 2QSXA 4QFLA 1A8FA 2QRYA 3TQWA 4HTGA 3BBRA 1L5TA 5LOMA 3U93A 4YMBA 4KR5A 1NKXA 4KYDA 1MXYA 4ZDMA 3C34A 1RKMA 4K3FA 4ELQA 3VLWA 3LC8A 3H7MA 4GXAA 5I58A 4ZEDA 3VDFA 2ONRA 3W9WA 4YB6A 1LFGA 4WEPA 1XC1A 5I59A 1VSOA 1MQHA 1OIBA 4OWDA 2GHAA 5ICQA 5TP9A 4BDRA 4OZ9A 4RPOA 3LR1A 2DWIA 2CZLA 2O68A 1TFDA 5JK4A 4ELRA 1ZMGA 2H99A 5CMKA 4RY1A 3LSXA 4OYVA 1MY2A 3PPPA 4GWOA 1TT1A 5H8QB 3TTKA 3V5AA 4OVJA 4ESWA 3N94A 5HBCA 5ISUA 1VFDA 1NFTA 3MQ9A 1ZBMA 4ISUA 2Z8DA 3MAMA 4PFTA 3ODBA 2O84X 1P1NA 5AE4A 1FQDA 1GTKA 4DCXA 4OFLA 2IEEA 2F6GA 3MP1A 3S2VA 3THIA 5KDTB 4Z0IA 2XX8A 4C1TA 2O1MA 4QFNA 4PFWA 4ZZAA 4FORA 4F29A 3IJXB 2V84A 2F5XA 1DPPA 1SDXA 4G8HA 1ZU0A 1I6QA 4NF4A 1LBBA 1ATGA 1MPDA 3HCQA 5CI5A 4F3PA 3S4UA 5JTYB 1B7HA 3O6GA 4F2QA 3PUZE 4P0IA 3O6IA 5H8HA 2AL5A 2OK2A 3U92A 4R9GA 1JQFA 3M3LA 1KWHA 4EUOA 3HSTA 1I69A 1MY1A 3P7IA 4QFPA 3OOAA 2F7AA 4H5GA 3QUFA 3K00A 2E0SA 4YMAA 3ECRA 2DE2A 3HO7A 4OHNA 3U1OA 1NNKA 3QXMA 3TDJA 4IO5A 4Q8RA 1DMBA 5BWJA 5AA2A 2QS3A 5L8DA 1MDQA 1B4ZA 1MM6A 4N07A 4U4SA 2UVJA 2YJPA 2I6EA 1LAFE 1BLFA 4ONYA 4C1UA 3B7DA 4F19A 5HPQA 2VGQA 3FJ7A 2GHBA 1QUKA 4L17A 4EF2A 4JXIA 3G3JA 5CMCA 2ZNSA 4XTCQ 2OWTA 3RT8A 4U4XA 5AA2D 3G3FA 2I0BA 3DP6A 3MZ9A 3TMGA 1OVBA 4LZ5A 3FXQA 3Q26A 5TPAA 4GRKA 3D4CA 2R6GE 1SI1A 2B3FA 2VP1A 1FTKA 5DVFA 3DP8A 3K6WA 5I2NA 3PPQA 5DYHA 4LQ5A 3Q28A 5I56B 4QF9A 1IEJA 3MUQA 1N7WA 4X48A 1USYH 1OVTA 4X1DA 1JW4A 2ESNA 1D3KA 4R6HA 2I0CA 3R26A 5CMMA 4IO7A 3RTWB 2ONKE 3OO7A 1RYXA 2Y7KA 3OO9A 3TTRA 1LFHA 3FV1A 2I3VA 3OO8A 4RPNA 4XIGQ 3VVFA 2GRVA 3BKIB 5H8FB 2F8DA 2V3QA 4I1DA 2Y7IA 5A5XA 1MPBA 4YKKA 2XX7A 3PUVE 3LSFB 1NMUA 1B7UA 5I2KA 1NH8A 3D4GA 4YAHX 2REJA 3Q29A 1Y4TA 2RCAA 2FA7A 1N7XA 1SYIA 2DE4A 1ZTYA 4NTLA 4YZZA 1GR2A 4EQ7A 5L9OA 3HN0A 2NOOA 1M5FA 5FTHA 1LAHE 3G3GA 2NWJA 1DSNA 3SEVA 1Y1ZA 4Q30B 2OLBA 4KD5A 3GZGA 1JEVA 3KJ7A 1IXGA 2PBWA 3PUWE 2ZNUA 4KCCA 3CSGA 1TXFA 4RYAA 1R1NA 1ZIUA 4R2BA 3S9LC 4FAJA 1FQAA 3H6TA 4IO3A 3B6TA 1DTGA 3H06B 1IXHA 3C4MA 1JW5A 3I6VA 3IJOB 1OQHA 2X26A 3LBSA 4UA8A 3RNNA 1IIWA 3IOVA 1MH3A 2F35A 4N13A 1SBPA 3K1PA 2DP8A 4X9TA 1QJMA 1Y3QA 4H6DA 3ILUB 4OEUA 3TCFA 2Q89A 3SEYA 1BTJA 1BIYA 5JTYA 4OEVA 4LVQA 1N76A 4QSCA 2DWAA 2BJJX 5K2YA 1FQCA 1FTMA 1N3WA 3WAEA 3TKDA 2F7BA 1QULA 3QAXA 1XHYA 2G29A 3KZGA 3A3UA 1VE4A 1URDA 1ZJLA 4R72A 1SVXB 1LAXA 2HZLA 1US4A 5F7VA 2OCUA 1B51A 1LB8A 2HCAA 1WODA 3M3FA 3GBBA 3ZSFA 3PUXE 2OJTA 2YLNA 4LZ8A 1URGA 1MXZA 2PX1A 1QVSA 1JVXA 4LQ2A 4OQOA 4OETA 4HCWA 5CMBA 4NF8B 5DVJA 1P1WA 1MQGA 3MZ1A 4FE8A 4ZS9A 2ZXTA 2UXAA 3N6UA 5KCJB 1SW1A 3TODA 3E3KA 1B58A 2GH9A 4EQ9A 3G7WA 4G68B 1SW4A 4QFKA 4POXA 1MXUA 4KHZE 2V3TA 5I57B 4YKPA 1EZPA 5ELVA 4JWXA 3MJNA 2DVZA 2CMOA 4G77A 2F34A 1MM7A 4OENA 1BKAA 1OQGA 2H5YA 2XXRA 5IKBA 2F7CA 4NWCA 3ZS6A 4H0WA 3K6UA 4EQBA 3L6GA 4N6PA 3GLBA 3U94A 1BP5A 1R9QA 4GL0A 1AH5A 3KGCA 4U1OA 3G3KA 1XOCA 2V25A 4NF5B 1F9BA 4BDOA 5H8FA 1B7ZA 3VXCA 1B46A 2VHAA 1PBPA 2WKYA 3CIJA 1J1NA 4IO4A 3MVYA 5F1QA 1NH7A 4IO6A 4IO2A 4KI0E 1MXVA 2ZYOA 3G3IA 2IA4A 2DOJA 1H3DA 3KFMA 4ZEFA 1XT8A 2XD2A 4ZEKA 1FQBA 1PBQA 1WVJA 4E0XA 5ITOA 1D9VA 5DEXB 2H9BA 2YPNA 2Y7WA 4NF6B 1B0LA 1N0TA 2G93A 1B1XA 3K02A 2Y7PA 1PEBA 3LUYA 3PPOA 3FJGA 2PYYA 3T66A 3C35A 3V83A 4M1VA 3MP8A 1MH4A 1DPEA 1B1HA 4HS7A 4DXUA 1FW0A 2RC7A 2RKMA 4F1VA 4WEDA 1ZKBA 3IR1A 3T93B 1M5EA 4XKRA 5L9MA 2PMSA 1QKAA
chains in the Genus database with same CATH superfamily
3TTLA 3IAZA 5EQ7A 2XXPA 5B70A 2QPQA 4I62A 1LBZA 1LFIA 1OLCA 2QS1A 3OSQA 5EYFA 2D21A 1T0KA 1QW0A 4F3GA 4FJPA 1LAGE 5EHSA 1Z7ME 5I3SA 3TTNA 3IO6A 4PGNA 4QSDA 3MBPA 5I84A 3CRBA 1KZ8A 2ZZVA 2I49A 1LSTA 1S9TA 2I4CA 2V93A 4JSDA 2HFBA 1H45A 1GVCA 3V8XB 2NXOA 5DT6A 3SETA 3MWBA 4R6YA 3I3VA 4Q5TA 3E4RA 3V89B 2GQ1A 3UGWA 4R73A 2VOZA 3VXBA 3CHGA 3SEWA 2HQ0A 3PUYE 2F78A 4GIZA 2M8CA 1LEVA 3E78A 1S7YA 2P0SA 4DCYA 1PDAA 1Y3NA 4MEVA 4OERA 3PTYA 2XXHA 5AA4B 1FQFA 2KQZA 5IZ3B 4QFOA 4I8CA 5H8NA 3K01A 2F36A 4EF1A 3E13X 1OMPA 1SI0A 1PB9A 1Z7NE 4R75A 5ICTA 2F3BA 3FZVA 3MPKA 3HHFA 4NF8A 3CR9A 4KFQA 1B3HA 1IXIA 3O9PA 1JW1A 4KYSA 1M5DA 2DDKA 3PD8A 1B0HA 4OXVA 3IX1A 3ZKLA 4DI4B 4N6KA 4ELOA 2XXQA 1LB9A 2A5TA 3M8UA 4TLMB 3HV1A 3H4ZA 4H5FA 3EKIA 5HM4B 2DSFA 5CBRA 3F11A 5DW8A 3ONMA 4XEQA 4MNPA 1MQJA 3FVOA 3ILTB 3UIFA 1B05A 1FPJA 3KEIA 4GWZA 5I57A 1NV5A 3GBAA 4RXLA 4MH5A 2VT5A 3DLNA 2P1SA 4GD5A 4G68C 1POTA 1INPA 2XXXA 4PDHA 4MAGA 1QKBA 4EDPA 4POWA 3FXRA 5CBSA 2DS9A 4F39A 3KSJA 4IGTA 4P0GA 4YB5A 2UYFA 4ND9A 2DXRA 3M3KA 1LCFA 4OVQA 4RK2A 3MVWA 5B7DA 3Q27A 3C9HA 1NV7A 3BIGA 3PV0E 5FHMA 2Q8JA 3UN6A 4I9DA 4YKIA 1B3EA 4H65A 2RINA 3RQTA 2HXWA 2I3WA 4U21A 1D4NA 4MCOA 4HE0A 3GYYA 4GOTA 4PC9A 3TPAA 3AXFA 4PBHA 5I59B 4DLDA 3SESA 1MDP1 1NNTA 1B9JA 4O3CA 5TP9B 2R8TA 4XKNA 4DIGA 5IZZA 5H8QA 5FBPA 4FBPA 2GFEA 5A5LA 5CC2A 3H3GA 1MXXA 2B65A 4TOZA 1QUJA 1M5CA 2DVCA 2I48A 4DDDA 1DOTA 4NF0A 4PAFA 2H25A 2DXYA 1QUIA 5FHOA 3JV9A 2B3BA 1H76A 4HCYA 2XWOA 1H44A 3FASA 2FNCA 3C32A 2XD3A 3K1NA 2D5WA 4MX6A 2Z22A 4X04A 2XA5A 2ALUA 3IK6B 4F18A 3USDA 4P56A 3RGYA 1XI6A 4HW8A 5KDTA 1NNPA 4XF5A 1VFEA 2XXWA 4IGRA 2HXRA 1A99A 4U22A 3CFLA 2Q2AA 1MY4A 1TFAA 3KN3A 2E1SA 4AQ4A 2ONSA 5EYGA 3SZPA 2CZKA 5FHNA 3OEMA 5EHMA 2X7QA 4XKPA 3K6VA 2H4IA 3N6TA 2XXTA 3QSLA 1PB7A 1FJ6A 3MC2A 3FATA 2D3IA 1FPFA 3RPWA 4GXSB 2QMXA 1B40A 4KQPA 3T9UA 4NF4B 2HHMA 4MF3A 4PFBA 3PU5A 4BDLA 1SQYA 4WKMA 4ZEBA 2RC8A 2P3NA 4H8JA 3PPNA 4N4UA 2QL3A 4AB6A 5H8HB 3EHSA 3A29A 3GXAA 4KCDA 4OVPA 4ZZEA 2PFZA 1DCUA 1MY3A 1FPDA 3FUZA 3PD9A 5IZ3A 3VLUA 4GBWA 5I5PA 4U23A 4EXKA 3O6HA 1HSJA 1GV8A 4KPTA 3PGFA 3U65A 2AIXA 1Q1KA 1EZ9A 1H43A 3EN3A 4ECFA 1I6AA 1FTOA 1NL5A 4R74A 1TWYA 3T9HB 3PMVA 1YTVA 3EHTA 3LSWA 1SW5A 3SEXA 3KBRA 1EYIA 1DTZA 3EPEA 1B4HA 1NV1A 2UYEA 3RY3A 4LATA 4BDQA 1NV2A 1FTLA 1POY1 3T96B 3IO4A 3VLVA 3KSXA 1IMFA 1UTHB 3OO6A 3CFXA 3FD3A 1NNFA 3W15C 3RTFB 3R7XA 1RYOA 3JYRA 3IB2A 1LLSA 2HEUA 1G0IA 5IZ1A 5EYHA 3W9VA 4LZ7A 5L9SA 5I56A 3MPLA 4YKJA 1FJ9A 2Z8EA 5TPAB 1MY0A 4F2OA 5KZTA 1RDYA 3FXUA 4PFYA 3Q25A 4LA9A 3R6UA 3QYTA 5I2NB 1IMCA 4FIMA 2UVIA 4O3BA 4F22A 3FVNA 4GF8A 2DYXA 3O2AA 2DE3A 4G2ZA 4G8MA 3OSRA 1B32A 3DELB 1HSLA 2O6AA 4PCDA 3HPIA 3FJMA 3QUJA 2Z23A 3SEUA 4GWYA 3TYHA 1O64A 3IB1A 1JEUA 1LBXA 5CM6A 4OFJA 4QBAA 3MVZA 2WEFA 1AOVA 1FBFA 2HZKA 2Q74A 2UVHA 4JSOA 3CFZA 4MMPA 2RF1A 1B2HA 4I3EA 3S9EA 2VPNA 1IZ1A 4ESXA 5A5XB 3VVDA 4RJZA 2HPGA 2XXYA 4MNCA 4GX4A 4N17A 4XKQA 1A54A 5I2KB 4U1ZA 1PC3A 2WBBA 3MVXA 1EH3A 3QMFA 2ABHA 4X1BA 2NUVA 3H03A 3B8BA 4JVDA 2VD3A 4F31B 3FV2A 1P1QA 3UP9A 1Y9UA 4RNSA 2KLFA 3VVEA 2HAUA 2I4BA 4PFUA 2REGA 1LCTA 2ZYMA 3B6WA 2CEXA 1NV6A 3SDFA 2H98A 3EQ1A 4JBZA 4O3AA 1FBPA 3H6UA 3FVGA 2ZYNA 3K0VA 4Z7EA 4M4GA 1IITA 1HSEA 3TAJA 4MHFA 4AS5A 1N3XA 4KYEA 1YXIA 2O51A 1A40A 4THIA 3DP4A 1FCKA 3BFTA 1NV3A 3FBPA 1Q35A 4GQOA 5ET6A 2F6PA 3RUMA 3TUSA 1B3GA 1ELJA 1FSAA 2R71A 2XHDA 4FECA 4Q0CA 4LUBA 1SW2A 3JZJA 2OX3A 4DZ1A 1B5HA 3KN8A 5H8SA 3D1RA 1DK4A 3FGSA 4F3BA 5K2XA 2F97A 4PETA 4NEDA 3IOUA 2FBPA 4YICA 5JEIA 3TZAA 2W7YA 1YCJA 3HHGA 2RC9A 4LONB 3A3CA 2LAOA 2DQVA 5BUUA 3CVGA 4ZECA 4NWDA 3RT6B 4YB7A 4IY5A 1B6HA 1OLAA 1MPCA 2OBGA 2Z8FA 1R6ZA 4PP0A 1N04A 3CG1A 1ZLQA 2OZZA 4ZE9A 4R9FA 1IMDA 2NVUB 4RK9A 4E0WA 3G3HA 3HFUA 5CRYA 1AWBA 4DXCA 4G8NA 4ELPA 4R2FA 4DE8A 1MG1A 4F1YA 2WYPA 2X7PA 3RN8A 4BDNA 5KCJA 1O7TA 2OWSA 3KN7A 1JETA 1Y4CA 4MLVA 3RPLB 1Y1MA 1UTHA 4R6KA 1JVYA 3O29A 5EQ8A 1CE2A 3RLFE 3CG3A 2O1LA 4BLAA 3IOTA 4G68A 1AL3A 3KJTA 4MLQA 3SKPA 1YPNA 3ZKKA 3TCHA 4NN3A 3A09A 3SERA 3TEPA 1FTJA 4NGUA 3LSLA 1KA0A 2QJEA 2CZIA 2XWKA 4MNIA 4OTEA 3TQLA 4H8IA 3MSTA 4U2RA 2Q9TA 2KR0A 2DWJA 2XXKA 4OESA 4OVRA 2XXIA 2ZYKA 3VV5A 3U72A 2P2AA 1II5A 1UTBB 2QMWA 1B3LA 2I58A 2THIA 4AB5A 1MXWA 4QSEA 4PAIA 3N5LA 3FIRA 3QIMA 3K1MA 1B52A 4NF5A 3VE1B 2RCBA 3TELA 3U8QA 4PF8A 2ANJA 4RA1A 3KC1A 4LP2B 2XXUA 5LDZA 5I58B 3TCGA 1A8EA 3T22A 4NMYA 4UACA 1LBYA 1MQDA 4WXJA 1US5A 4NAPA 2XX9A 1P1UA 1MRPA 1A55A 4P11A 1JNFA 4JDFA 1ANFA 1SD3A 2A5SA 3I5OA 4IB2A 4PAKA 4DXBA 5DEXA 3K2DA 2ZMBA 3IB0A 4F1UA 1K9ZA 4NF6A 2PT2A 4C0RA 3C31A 3UORA 2AYSA 3KG2A 2VD2A 1S50A 1FBDA 1IQ7A 1N84A 5DVIA 4OANA 4PDDA 2R9JA 3QK6A 4FEDA 2Q2CA 2O7IA 5FTIA 1LGBC 3DM0A 4F3SA 1D9YA 3B6QA 1NV0A 3MYUA 1LBCA 2ZZWA 2HAVA 4NHBA 3FXBA 4IY6A 2PT1A 3EHUA 4G4PA 3T9VA 2QVUA 1UIVA 3FVKA 4GFRA 5M2VA 1EZOA 2PVUA 3T0JA 5ITPA 4O8MA 4XXUA 2DWHA 2B4LA 1GGGA 3VFJA 1Y3PA 5AA3A 2Y84A 3OMBA 1NI9A 4XFEA 3L6HA 1AMFA 1P1OA 3IORA 4JWOA 3CI8A 4GL8A 4OA4A 1XVXA 4LN5A 3MP6A 4MJOA 1A7LA 3K4UA 2Y7RA 4FATA 3O66A 1WDNA 1SYHA 1XS5A 2FYIA 1UQWA 3O97A 1EU8A 3MW0A 3TTMA 4ZEIA 5J1DA 1IMEA 2UVGA 3T9XB 4PFIA 4H67A 1O63A 3OELA 3O28A 1URSA 2O69A 3UA8A 3E9XA 3EF7A 4GLIA 1USYE 2VPOA 1XVYA 2XXVA 4P1EA 1CB6A 4QRZA 3PPRA 5DTBA 3KC0A 5AA1A 1IXCA 3C36A 4YU0A 5AA4A 3S9MC 1P99A 2O7UA 3E79A 1VR5A 2FHYA 1B5JA 5ET5A 4H1XA 1D9QA 1M5BA 5TU0A 4H46A 3OEKA 3TFLA 3WAFA 5IAIA 4NQ8A 1PB8A 5AA2B 3KOTA 3UK4A 5H8NB 3PMXA 1YAEA 4GVOA 3ISPA 4P1LA 4OMBA 3CSBA 4OFOA 3KOSA 4PF6A 3C33A 1R9LA 4ZE8A 1MS7A 2F3DA 4JWYA 3N26A 4KXPA 2AL4A 5ESYA 3S9NC 3OXNA 3OD7A 3RPLA 3IOWA 4NE4A 4EXLA 4MBPA 3H6WA 3OENA 1AIVA 2MKZA 1FQEA 2ZNTA 3MZBA 4TQUQ 3PMWA 4FEBA 3K6XA 4OVSA 4O94A 3H6VA 4QHQA 1FPBA 2A5TB 4BDMA 1I6BA 1UIUA 4JB7A 2V3UA 1Y20A 1MQIA 2QS2A 4PQJA 1B3FA 1IUDA 4PE5B 3BFUA 2QS4A 4MFIA 4TLLB 4P8BA 2Q88A 1UTBA 1B5IA 3IL1B 2QSXA 1NUZA 4QFLA 1A8FA 2QRYA 2CEYA 3TQWA 4HTGA 3BBRA 1L5TA 5LOMA 3U93A 4YMBA 4KR5A 1BK4A 1NKXA 4KYDA 1MXYA 1YZ0A 4ZDMA 3C34A 4PFRA 4P3LA 1RKMA 4K3FA 4ELQA 3VLWA 3LC8A 3H7MA 4GXAA 5I58A 4ZEDA 3VDFA 2ONRA 3W9WA 1NV4A 4YB6A 3RYDA 1EYJA 1LFGA 2QVRA 4WEPA 2FVZA 1XC1A 5I59A 1VSOA 4PE3A 1FBCA 1MQHA 1OIBA 4OWDA 2GHAA 5ICQA 5TP9A 4BDRA 4OZ9A 5F24A 4RPOA 3LR1A 2DWIA 2CZLA 2O68A 2WX9A 1TFDA 1YYZA 5JK4A 4N8YA 4ELRA 4OVTA 5EQ9A 1ZMGA 2H99A 5CMKA 4RY1A 4P47A 3LSXA 4OYVA 1MY2A 3PPPA 4GWOA 3ROJA 1TT1A 5H8QB 3TTKA 3V5AA 4OVJA 4ESWA 3N94A 5HBCA 5ISUA 1VFDA 1NFTA 3MQ9A 1ZBMA 4ISUA 2Z8DA 4HE2A 3MAMA 4PFTA 3ODBA 2O84X 1P1NA 1SPIA 5AE4A 1FQDA 1GTKA 4AS4A 4DCXA 4OFLA 2IEEA 2F6GA 2QVVA 4GWSA 1FRPA 3MP1A 3S2VA 3THIA 1LBVA 3KBZA 5KDTB 4Z0IA 1NUXA 4JVCA 2XX8A 4C1TA 2O1MA 4QFNA 4PFWA 4ZZAA 4FORA 4H45A 4F29A 3IJXB 4PBQA 2V84A 2F5XA 1DPPA 1SDXA 4G8HA 1ZU0A 1I6QA 3LV0A 5T3JA 4NF4A 1LBBA 1ATGA 1MPDA 3HCQA 5CI5A 4F3PA 5LTCA 3S4UA 5JTYB 5I7IA 1B7HA 3O6GA 4F2QA 3PUZE 1FPIA 4P0IA 3O6IA 5H8HA 2AL5A 2OK2A 3U92A 4R9GA 1JQFA 3M3LA 1KWHA 4EUOA 3HSTA 1I69A 1MY1A 3P7IA 4QFPA 1FPGA 3OOAA 2F7AA 4H5GA 3QUFA 3K00A 4P9KA 2E0SA 4YMAA 3ECRA 2DE2A 3HO7A 4OHNA 3U1OA 2FIXA 1NNKA 3QXMA 3TDJA 4IO5A 4Q8RA 1DMBA 5BWJA 5AA2A 2QS3A 5L8DA 1MDQA 4GWWA 1B4ZA 1MM6A 4N07A 4U4SA 2UVJA 2YJPA 2I6EA 1LAFE 1BLFA 4N15A 4ONYA 4C1UA 3B7DA 4F19A 5HPQA 2VGQA 3FJ7A 2GHBA 5ET7A 2V4CA 1QUKA 4L17A 4EF2A 4JXIA 3G3JA 4N6DA 5CMCA 2ZNSA 4XTCQ 2OWTA 4O7IA 3RT8A 4U4XA 5AA2D 3G3FA 2I0BA 3DP6A 3MZ9A 3TMGA 3BIHA 1OVBA 4LZ5A 4PTKA 3FXQA 3Q26A 5TPAA 4GRKA 1RDXA 3D4CA 4NG7A 2R6GE 1SI1A 2B3FA 2VP1A 1FTKA 5DVFA 4HE1A 3DP8A 3K6WA 5I2NA 3PPQA 4IR8A 5DYHA 4LQ5A 3Q28A 5I56B 4QF9A 1IEJA 4N8GA 3MUQA 1N7WA 4X48A 1EYKA 1USYH 1OVTA 2BJIA 4X1DA 4QXDA 1JW4A 2ESNA 1D3KA 4N91A 4R6HA 2I0CA 4GBVA 3R26A 5CMMA 4IO7A 3RTWB 2ONKE 3OO7A 1FPLA 1RYXA 2Y7KA 3OO9A 2Y5LA 3TTRA 1LFHA 3FV1A 2I3VA 1RDZA 3OO8A 4RPNA 4XIGQ 1KA1A 3VVFA 2GRVA 3BKIB 5H8FB 2F8DA 2V3QA 4I1DA 2Y7IA 5A5XA 1MPBA 2PFYA 1K9YA 4YKKA 4G61A 2XX7A 3PUVE 3LSFB 1LBWA 1NMUA 1B7UA 5I2KA 1NH8A 3D4GA 4YAHX 2REJA 3Q29A 1Y4TA 2RCAA 1Q9DA 1NUYA 2FA7A 1N7XA 1SYIA 2DE4A 1ZTYA 2WBDA 4NTLA 4DI3D 4YZZA 1GR2A 4EQ7A 5L9OA 3HN0A 2NOOA 1M5FA 5FTHA 1LAHE 3G3GA 2NWJA 2CZHA 1DSNA 3SEVA 4I40A 1Y1ZA 4Q30B 4X8RA 2OLBA 4KD5A 3GZGA 1JEVA 3KJ7A 1IXGA 2PBWA 3PUWE 2ZNUA 4N81A 4KCCA 3CSGA 1TXFA 4RYAA 1R1NA 1IMAA 1FBGA 1ZIUA 4R2BA 3S9LC 4FAJA 1FQAA 3H6TA 4IO3A 3B6TA 1DTGA 3H06B 1IXHA 3C4MA 1JW5A 3I6VA 3IJOB 1OQHA 4GX6A 2X26A 2Y5KA 3LBSA 4UA8A 3RNNA 1IIWA 3IOVA 1MH3A 2F35A 4N13A 1SBPA 3K1PA 2DP8A 4X9TA 1QJMA 1Y3QA 4H6DA 3ILUB 4OEUA 3TCFA 2Q89A 3SEYA 1BTJA 2FIEA 5ET8A 1BIYA 5JTYA 1JP4A 4OEVA 4LVQA 1N76A 4QSCA 1VDWA 2QFLA 2DWAA 2BJJX 5K2YA 1FQCA 1FTMA 1N3WA 3WAEA 3TKDA 1NUWA 1FPEA 2F7BA 1QULA 5IGAA 3QAXA 3B50A 1XHYA 2JJKA 2G29A 2ZZXA 3KZGA 4GX3A 3A3UA 1VE4A 1URDA 1ZJLA 4R72A 1SVXB 1LAXA 2HZLA 2P3VA 1US4A 5F7VA 2OCUA 1B51A 1LB8A 2HCAA 1WODA 5EQAA 3M3FA 3GBBA 3ZSFA 3PUXE 2OJTA 2YLNA 4LZ8A 1URGA 3IFAA 1MXZA 2PX1A 1QVSA 1JVXA 3NOHA 4LQ2A 4OQOA 4OETA 4HCWA 5CMBA 4NF8B 5DVJA 1P1WA 1MQGA 3MZ1A 4FE8A 4ZS9A 2ZXTA 2UXAA 4HXVA 3N6UA 5KCJB 1SW1A 3TODA 3E3KA 1B58A 4GWXA 2GH9A 4EQ9A 3T1BA 3G7WA 4G68B 1SW4A 4QFKA 4POXA 1MXUA 4KHZE 2V3TA 5I57B 5J16A 4YKPA 1EZPA 5ELVA 4JWXA 3MJNA 2DVZA 2L5VA 4MIJA 2CMOA 4G77A 2F34A 1MM7A 4OENA 1BKAA 1OQGA 2H5YA 2XXRA 5IKBA 2F7CA 4NWCA 3IFCA 3ZS6A 1QGXA 4H0WA 3K6UA 4EQBA 3L6GA 4N6PA 3GLBA 1G0HA 1BP5A 1FBEA 1R9QA 4GL0A 1AH5A 3KGCA 4U1OA 3U94A 3G3KA 1XOCA 2V25A 4NF5B 1F9BA 4BDOA 5H8FA 1B7ZA 3VXCA 1B46A 2VHAA 1PBPA 2WKYA 2B4MA 1J1NA 3CIJA 4IO4A 3MVYA 1IMBA 5F1QA 1NH7A 1FTAA 4IO6A 4IO2A 5IM2A 4PGPA 2WYKA 4KI0E 1MXVA 2ZYOA 3G3IA 2IA4A 2DOJA 1H3DA 3KFMA 4ZEFA 1XT8A 4I3YA 2XWIA 2XD2A 4NX1A 4ZEKA 2Q8MA 1FQBA 1PBQA 1WVJA 4E0XA 5ITOA 1D9VA 5DEXB 2H9BA 2YPNA 2Y7WA 3LUZA 4NF6B 1B0LA 1N0TA 2G93A 1FPKA 1B1XA 3K02A 2Y7PA 1PEBA 1DBZA 3LUYA 3PPOA 3FJGA 2PYYA 4O7MA 3T66A 4GWUA 2OWZA 3C35A 3V83A 4M1VA 3MP8A 4UABA 1MH4A 1DPEA 4JVIA 1B1HA 4HS7A 4DXUA 1FW0A 2RC7A 1CNQA 1FBHA 2RKMA 4WEDA 4F1VA 2XWVA 1ZKBA 3IR1A 2PCRA 3T93B 1M5EA 4XKRA 5L9MA 2PMSA 1QKAA
chains in the Genus database with same CATH topology
3TTLA 3IAZA 2XXPA 5B70A 2QPQA 4I62A 1LFIA 1OLCA 2QS1A 3OSQA 5EYFA 2D21A 1T0KA 1QW0A 4F3GA 4FJPA 1LAGE 5EHSA 1Z7ME 3TTNA 3IO6A 4QSDA 3MBPA 5I84A 3CRBA 2I49A 1LSTA 1S9TA 2I4CA 2V93A 4JSDA 2HFBA 1H45A 1GVCA 3V8XB 2NXOA 5DT6A 3SETA 3MWBA 4R6YA 3I3VA 4Q5TA 3E4RA 3V89B 3UGWA 4R73A 2VOZA 3VXBA 3SEWA 2HQ0A 3PUYE 2F78A 4GIZA 2M8CA 1S7YA 2P0SA 4DCYA 1PDAA 1Y3NA 4OERA 2XXHA 5AA4B 1FQFA 4QFOA 4I8CA 5H8NA 3K01A 2F36A 4EF1A 3E13X 1OMPA 1SI0A 1PB9A 1Z7NE 4R75A 5ICTA 3FZVA 3MPKA 3HHFA 4NF8A 3CR9A 4KFQA 1B3HA 1IXIA 3O9PA 1JW1A 4KYSA 1M5DA 3PD8A 1B0HA 4OXVA 3IX1A 3ZKLA 4ELOA 2XXQA 1LB9A 2A5TA 3M8UA 4TLMB 3HV1A 3H4ZA 4H5FA 5HM4B 2DSFA 5CBRA 3F11A 3ONMA 1MQJA 3FVOA 3ILTB 3UIFA 1B05A 3KEIA 5I57A 3GBAA 4RXLA 4MH5A 3DLNA 2P1SA 4GD5A 4G68C 1POTA 2XXXA 1QKBA 4EDPA 4POWA 3FXRA 5CBSA 2DS9A 4F39A 3KSJA 4IGTA 4P0GA 4YB5A 2UYFA 4ND9A 2DXRA 3M3KA 1LCFA 4RK2A 3MVWA 5B7DA 3Q27A 3C9HA 3PV0E 5FHMA 2Q8JA 3UN6A 4I9DA 4YKIA 1B3EA 4H65A 2RINA 3RQTA 2HXWA 2I3WA 4U21A 1D4NA 4GOTA 3TPAA 5I59B 3AXFA 4DLDA 3SESA 1MDP1 1NNTA 1B9JA 4O3CA 5TP9B 4DIGA 4XKNA 5H8QA 2GFEA 5CC2A 3H3GA 1MXXA 2B65A 4TOZA 1QUJA 1M5CA 2DVCA 2I48A 4DDDA 1DOTA 2H25A 2DXYA 1QUIA 5FHOA 3JV9A 2B3BA 1H76A 4HCYA 1H44A 3FASA 2FNCA 3C32A 2XD3A 3K1NA 2D5WA 2Z22A 2ALUA 3IK6B 4F18A 3USDA 3RGYA 4HW8A 5KDTA 1NNPA 1VFEA 2XXWA 4IGRA 1A99A 4U22A 3CFLA 2Q2AA 1MY4A 1TFAA 3KN3A 2E1SA 4AQ4A 2ONSA 5FHNA 3OEMA 5EHMA 2X7QA 4XKPA 3K6VA 2H4IA 3N6TA 2XXTA 3QSLA 1PB7A 3MC2A 3FATA 2D3IA 3RPWA 4GXSB 2QMXA 1B40A 4KQPA 3T9UA 4NF4B 4MF3A 3PU5A 4BDLA 1SQYA 4WKMA 4ZEBA 2RC8A 4H8JA 3PPNA 2QL3A 4AB6A 5H8HB 3EHSA 3GXAA 4KCDA 4ZZEA 1MY3A 3FUZA 3PD9A 3VLUA 4U23A 4EXKA 3O6HA 1HSJA 1GV8A 4KPTA 3PGFA 2AIXA 1Q1KA 1EZ9A 1H43A 3EN3A 4ECFA 1I6AA 1FTOA 1NL5A 4R74A 1TWYA 3T9HB 3PMVA 1YTVA 3EHTA 3LSWA 1SW5A 3SEXA 3KBRA 1DTZA 3EPEA 1B4HA 2UYEA 3RY3A 4LATA 4BDQA 1FTLA 1POY1 3T96B 3IO4A 3VLVA 3KSXA 1UTHB 3OO6A 3CFXA 3FD3A 1NNFA 3W15C 3RTFB 3R7XA 1RYOA 3JYRA 3IB2A 1LLSA 2HEUA 3W9VA 4LZ7A 5L9SA 5I56A 3MPLA 4YKJA 2Z8EA 5TPAB 1MY0A 4F2OA 5KZTA 3FXUA 4PFYA 3Q25A 4LA9A 3R6UA 3QYTA 5I2NB 4FIMA 2UVIA 4O3BA 4F22A 3FVNA 4GF8A 2DYXA 3O2AA 2DE3A 4G2ZA 4G8MA 3OSRA 1B32A 3DELB 1HSLA 2O6AA 3HPIA 3FJMA 3QUJA 2Z23A 3SEUA 3TYHA 1O64A 3IB1A 1JEUA 5CM6A 4OFJA 3MVZA 1AOVA 2HZKA 2UVHA 4JSOA 3CFZA 2RF1A 1B2HA 3S9EA 1IZ1A 4ESXA 5A5XB 3VVDA 4RJZA 2XXYA 4XKQA 1A54A 5I2KB 4U1ZA 1PC3A 3MVXA 1EH3A 2ABHA 4X1BA 2NUVA 3H03A 2VD3A 4F31B 3FV2A 1P1QA 3UP9A 1Y9UA 4RNSA 2KLFA 3VVEA 2HAUA 2I4BA 4PFUA 2REGA 1LCTA 2ZYMA 3B6WA 3SDFA 2H98A 3EQ1A 4JBZA 4O3AA 3H6UA 3FVGA 2ZYNA 3K0VA 4Z7EA 4M4GA 1IITA 1HSEA 3TAJA 1N3XA 4KYEA 2O51A 1A40A 4THIA 3DP4A 1FCKA 3BFTA 1Q35A 4GQOA 2F6PA 3RUMA 3TUSA 1B3GA 1ELJA 2R71A 2XHDA 4FECA 4Q0CA 4LUBA 1SW2A 4DZ1A 3JZJA 1B5HA 3KN8A 5H8SA 3FGSA 4F3BA 5K2XA 2F97A 4PETA 4NEDA 3IOUA 4YICA 5JEIA 3TZAA 2W7YA 1YCJA 3HHGA 2RC9A 4LONB 3A3CA 2LAOA 2DQVA 5BUUA 3CVGA 4ZECA 4NWDA 3RT6B 4YB7A 4IY5A 1B6HA 1OLAA 1MPCA 2OBGA 2Z8FA 1R6ZA 4PP0A 1N04A 3CG1A 1ZLQA 2OZZA 4ZE9A 4R9FA 2NVUB 4RK9A 4E0WA 3G3HA 5CRYA 4DXCA 4G8NA 4ELPA 4R2FA 4DE8A 1MG1A 4F1YA 2X7PA 3RN8A 4BDNA 5KCJA 1O7TA 2OWSA 3KN7A 1JETA 1Y4CA 4MLVA 1Y1MA 1UTHA 4R6KA 1JVYA 3O29A 1CE2A 3RLFE 3CG3A 2O1LA 4BLAA 3IOTA 4G68A 1AL3A 3KJTA 4MLQA 3SKPA 1YPNA 3ZKKA 3TCHA 3A09A 3SERA 3TEPA 1FTJA 3LSLA 2QJEA 4OTEA 3TQLA 4H8IA 4U2RA 2Q9TA 2DWJA 4OESA 2XXIA 2ZYKA 3VV5A 3U72A 2P2AA 1II5A 1UTBB 2QMWA 1B3LA 2I58A 2THIA 4AB5A 1MXWA 4QSEA 3N5LA 3FIRA 3QIMA 3K1MA 1B52A 4NF5A 3VE1B 2RCBA 3TELA 3U8QA 2ANJA 4RA1A 4LP2B 2XXUA 5I58B 3TCGA 1A8EA 3T22A 4NMYA 4UACA 1MQDA 4WXJA 1US5A 2XX9A 1P1UA 1MRPA 1A55A 4P11A 1JNFA 4JDFA 1ANFA 1SD3A 2A5SA 3I5OA 4IB2A 4DXBA 5DEXA 3K2DA 2ZMBA 3IB0A 4F1UA 4NF6A 2PT2A 4C0RA 3C31A 3UORA 2AYSA 3KG2A 2VD2A 1S50A 1IQ7A 1N84A 5DVIA 2R9JA 3QK6A 4FEDA 2Q2CA 2O7IA 5FTIA 1LGBC 3DM0A 4F3SA 1D9YA 3B6QA 1LBCA 2HAVA 4IY6A 2PT1A 3EHUA 4G4PA 3T9VA 1UIVA 3FVKA 4GFRA 5M2VA 1EZOA 2PVUA 5ITPA 4XXUA 2DWHA 3VFJA 1GGGA 1Y3PA 5AA3A 2Y84A 3OMBA 3L6HA 1AMFA 1P1OA 3IORA 4JWOA 3CI8A 4GL8A 1XVXA 3MP6A 1A7LA 3K4UA 2Y7RA 4FATA 3O66A 1WDNA 1SYHA 1XS5A 2FYIA 1UQWA 3O97A 1EU8A 3MW0A 3TTMA 4ZEIA 5J1DA 2UVGA 3T9XB 4H67A 1O63A 3OELA 3O28A 1URSA 2O69A 3UA8A 3E9XA 3EF7A 4GLIA 1USYE 1XVYA 2XXVA 1CB6A 4QRZA 3PPRA 5DTBA 5AA1A 1IXCA 3C36A 4YU0A 5AA4A 3S9MC 1P99A 2O7UA 1VR5A 1B5JA 4H1XA 1M5BA 5TU0A 3OEKA 3TFLA 3WAFA 5IAIA 1PB8A 5AA2B 3KOTA 3UK4A 5H8NB 3PMXA 1YAEA 4GVOA 4OMBA 3CSBA 4OFOA 3KOSA 3C33A 1R9LA 4ZE8A 1MS7A 4JWYA 3N26A 2AL4A 3S9NC 3OXNA 3OD7A 3IOWA 4NE4A 4EXLA 4MBPA 3H6WA 3OENA 1AIVA 1FQEA 2ZNTA 3MZBA 4TQUQ 3PMWA 4FEBA 3K6XA 3H6VA 4QHQA 2A5TB 4BDMA 1I6BA 1UIUA 4JB7A 2V3UA 1Y20A 1MQIA 2QS2A 4PQJA 1B3FA 1IUDA 4PE5B 3BFUA 2QS4A 4MFIA 4TLLB 2Q88A 1UTBA 1B5IA 3IL1B 2QSXA 4QFLA 1A8FA 2QRYA 3TQWA 4HTGA 3BBRA 1L5TA 5LOMA 3U93A 4YMBA 4KR5A 1NKXA 4KYDA 1MXYA 4ZDMA 3C34A 1RKMA 4K3FA 4ELQA 3VLWA 3LC8A 3H7MA 4GXAA 5I58A 4ZEDA 3VDFA 2ONRA 3W9WA 4YB6A 1LFGA 4WEPA 1XC1A 5I59A 1VSOA 1MQHA 1OIBA 4OWDA 2GHAA 5ICQA 5TP9A 4BDRA 4OZ9A 4RPOA 3LR1A 2DWIA 2CZLA 2O68A 1TFDA 5JK4A 4ELRA 1ZMGA 2H99A 5CMKA 4RY1A 3LSXA 4OYVA 1MY2A 3PPPA 4GWOA 1TT1A 5H8QB 3TTKA 3V5AA 4OVJA 4ESWA 3N94A 5HBCA 5ISUA 1VFDA 1NFTA 3MQ9A 1ZBMA 4ISUA 2Z8DA 3MAMA 4PFTA 3ODBA 2O84X 1P1NA 5AE4A 1FQDA 1GTKA 4DCXA 4OFLA 2IEEA 2F6GA 3MP1A 3S2VA 3THIA 5KDTB 4Z0IA 2XX8A 4C1TA 2O1MA 4QFNA 4PFWA 4ZZAA 4FORA 4F29A 3IJXB 2V84A 2F5XA 1DPPA 1SDXA 4G8HA 1ZU0A 1I6QA 4NF4A 1LBBA 1ATGA 1MPDA 3HCQA 5CI5A 4F3PA 3S4UA 5JTYB 1B7HA 3O6GA 4F2QA 3PUZE 4P0IA 3O6IA 5H8HA 2AL5A 2OK2A 3U92A 4R9GA 1JQFA 3M3LA 1KWHA 4EUOA 3HSTA 1I69A 1MY1A 3P7IA 4QFPA 3OOAA 2F7AA 4H5GA 3QUFA 3K00A 2E0SA 4YMAA 3ECRA 2DE2A 3HO7A 4OHNA 3U1OA 1NNKA 3QXMA 3TDJA 4IO5A 4Q8RA 1DMBA 5BWJA 5AA2A 2QS3A 5L8DA 1MDQA 1B4ZA 1MM6A 4N07A 4U4SA 2UVJA 2YJPA 2I6EA 1LAFE 1BLFA 4ONYA 4C1UA 3B7DA 4F19A 5HPQA 2VGQA 3FJ7A 2GHBA 1QUKA 4L17A 4EF2A 4JXIA 3G3JA 5CMCA 2ZNSA 4XTCQ 2OWTA 3RT8A 4U4XA 5AA2D 3G3FA 2I0BA 3DP6A 3MZ9A 3TMGA 1OVBA 4LZ5A 3FXQA 3Q26A 5TPAA 4GRKA 3D4CA 2R6GE 1SI1A 2B3FA 2VP1A 1FTKA 5DVFA 3DP8A 3K6WA 5I2NA 3PPQA 5DYHA 4LQ5A 3Q28A 5I56B 4QF9A 1IEJA 3MUQA 1N7WA 4X48A 1USYH 1OVTA 4X1DA 1JW4A 2ESNA 1D3KA 4R6HA 2I0CA 3R26A 5CMMA 4IO7A 3RTWB 2ONKE 3OO7A 1RYXA 2Y7KA 3OO9A 3TTRA 1LFHA 3FV1A 2I3VA 3OO8A 4RPNA 4XIGQ 3VVFA 2GRVA 3BKIB 5H8FB 2F8DA 2V3QA 4I1DA 2Y7IA 5A5XA 1MPBA 4YKKA 2XX7A 3PUVE 3LSFB 1NMUA 1B7UA 5I2KA 1NH8A 3D4GA 4YAHX 2REJA 3Q29A 1Y4TA 2RCAA 2FA7A 1N7XA 1SYIA 2DE4A 1ZTYA 4NTLA 4YZZA 1GR2A 4EQ7A 5L9OA 3HN0A 2NOOA 1M5FA 5FTHA 1LAHE 3G3GA 2NWJA 1DSNA 3SEVA 1Y1ZA 4Q30B 2OLBA 4KD5A 3GZGA 1JEVA 3KJ7A 1IXGA 2PBWA 3PUWE 2ZNUA 4KCCA 3CSGA 1TXFA 4RYAA 1R1NA 1ZIUA 4R2BA 3S9LC 4FAJA 1FQAA 3H6TA 4IO3A 3B6TA 1DTGA 3H06B 1IXHA 3C4MA 1JW5A 3I6VA 3IJOB 1OQHA 2X26A 3LBSA 4UA8A 3RNNA 1IIWA 3IOVA 1MH3A 2F35A 4N13A 1SBPA 3K1PA 2DP8A 4X9TA 1QJMA 1Y3QA 4H6DA 3ILUB 4OEUA 3TCFA 2Q89A 3SEYA 1BTJA 1BIYA 5JTYA 4OEVA 4LVQA 1N76A 4QSCA 2DWAA 2BJJX 5K2YA 1FQCA 1FTMA 1N3WA 3WAEA 3TKDA 2F7BA 1QULA 3QAXA 1XHYA 2G29A 3KZGA 3A3UA 1VE4A 1URDA 1ZJLA 4R72A 1SVXB 1LAXA 2HZLA 1US4A 5F7VA 2OCUA 1B51A 1LB8A 2HCAA 1WODA 3M3FA 3GBBA 3ZSFA 3PUXE 2OJTA 2YLNA 4LZ8A 1URGA 1MXZA 2PX1A 1QVSA 1JVXA 4LQ2A 4OQOA 4OETA 4HCWA 5CMBA 4NF8B 5DVJA 1P1WA 1MQGA 3MZ1A 4FE8A 4ZS9A 2ZXTA 2UXAA 3N6UA 5KCJB 1SW1A 3TODA 3E3KA 1B58A 2GH9A 4EQ9A 3G7WA 4G68B 1SW4A 4QFKA 4POXA 1MXUA 4KHZE 2V3TA 5I57B 4YKPA 1EZPA 5ELVA 4JWXA 3MJNA 2DVZA 2CMOA 4G77A 2F34A 1MM7A 4OENA 1BKAA 1OQGA 2H5YA 2XXRA 5IKBA 2F7CA 4NWCA 3ZS6A 4H0WA 3K6UA 4EQBA 3L6GA 4N6PA 3GLBA 3U94A 1BP5A 1R9QA 4GL0A 1AH5A 3KGCA 4U1OA 3G3KA 1XOCA 2V25A 4NF5B 1F9BA 4BDOA 5H8FA 1B7ZA 3VXCA 1B46A 2VHAA 1PBPA 2WKYA 3CIJA 1J1NA 4IO4A 3MVYA 5F1QA 1NH7A 4IO6A 4IO2A 4KI0E 1MXVA 2ZYOA 3G3IA 2IA4A 2DOJA 1H3DA 3KFMA 4ZEFA 1XT8A 2XD2A 4ZEKA 1FQBA 1PBQA 1WVJA 4E0XA 5ITOA 1D9VA 5DEXB 2H9BA 2YPNA 2Y7WA 4NF6B 1B0LA 1N0TA 2G93A 1B1XA 3K02A 2Y7PA 1PEBA 3LUYA 3PPOA 3FJGA 2PYYA 3T66A 3C35A 3V83A 4M1VA 3MP8A 1MH4A 1DPEA 1B1HA 4HS7A 4DXUA 1FW0A 2RC7A 2RKMA 4F1VA 4WEDA 1ZKBA 3IR1A 3T93B 1M5EA 4XKRA 5L9MA 2PMSA 1QKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTL A;  3IAZ A;  2XXP A;  5B70 A;  2QPQ A;  4I62 A;  1LFI A;  1OLC A;  2QS1 A;  3OSQ A;  5EYF A;  2D21 A;  1T0K A;  1QW0 A;  4F3G A;  4FJP A;  1LAG E;  5EHS A;  1Z7M E;  3TTN A;  3IO6 A;  4QSD A;  3MBP A;  5I84 A;  3CRB A;  2I49 A;  1LST A;  1S9T A;  2I4C A;  2V93 A;  4JSD A;  2HFB A;  1H45 A;  1GVC A;  3V8X B;  2NXO A;  5DT6 A;  3SET A;  3MWB A;  4R6Y A;  3I3V A;  4Q5T A;  3E4R A;  3V89 B;  3UGW A;  4R73 A;  2VOZ A;  3VXB A;  3SEW A;  2HQ0 A;  3PUY E;  2F78 A;  4GIZ A;  2M8C A;  1S7Y A;  2P0S A;  4DCY A;  1PDA A;  1Y3N A;  4OER A;  2XXH A;  5AA4 B;  1FQF A;  4QFO A;  4I8C A;  5H8N A;  3K01 A;  2F36 A;  4EF1 A;  3E13 X;  1OMP A;  1SI0 A;  1PB9 A;  1Z7N E;  4R75 A;  5ICT A;  3FZV A;  3MPK A;  3HHF A;  4NF8 A;  3CR9 A;  4KFQ A;  1B3H A;  1IXI A;  3O9P A;  1JW1 A;  4KYS A;  1M5D A;  3PD8 A;  1B0H A;  4OXV A;  3IX1 A;  3ZKL A;  4ELO A;  2XXQ A;  1LB9 A;  2A5T A;  3M8U A;  4TLM B;  3HV1 A;  3H4Z A;  4H5F A;  5HM4 B;  2DSF A;  5CBR A;  3F11 A;  3ONM A;  1MQJ A;  3FVO A;  3ILT B;  3UIF A;  1B05 A;  3KEI A;  5I57 A;  3GBA A;  4RXL A;  4MH5 A;  3DLN A;  2P1S A;  4GD5 A;  4G68 C;  1POT A;  2XXX A;  1QKB A;  4EDP A;  4POW A;  3FXR A;  5CBS A;  2DS9 A;  4F39 A;  3KSJ A;  4IGT A;  4P0G A;  4YB5 A;  2UYF A;  4ND9 A;  2DXR A;  3M3K A;  1LCF A;  4RK2 A;  3MVW A;  5B7D A;  3Q27 A;  3C9H A;  3PV0 E;  5FHM A;  2Q8J A;  3UN6 A;  4I9D A;  4YKI A;  1B3E A;  4H65 A;  2RIN A;  3RQT A;  2HXW A;  2I3W A;  4U21 A;  1D4N A;  4GOT A;  3TPA A;  5I59 B;  3AXF A;  4DLD A;  3SES A;  1MDP 1;  1NNT A;  1B9J A;  4O3C A;  5TP9 B;  4DIG A;  4XKN A;  5H8Q A;  2GFE A;  5CC2 A;  3H3G A;  1MXX A;  2B65 A;  4TOZ A;  1QUJ A;  1M5C A;  2DVC A;  2I48 A;  4DDD A;  1DOT A;  2H25 A;  2DXY A;  1QUI A;  5FHO A;  3JV9 A;  2B3B A;  1H76 A;  4HCY A;  1H44 A;  3FAS A;  2FNC A;  3C32 A;  2XD3 A;  3K1N A;  2D5W A;  2Z22 A;  2ALU A;  3IK6 B;  4F18 A;  3USD A;  3RGY A;  4HW8 A;  5KDT A;  1NNP A;  1VFE A;  2XXW A;  4IGR A;  1A99 A;  4U22 A;  3CFL A;  2Q2A A;  1MY4 A;  1TFA A;  3KN3 A;  2E1S A;  4AQ4 A;  2ONS A;  5FHN A;  3OEM A;  5EHM A;  2X7Q A;  4XKP A;  3K6V A;  2H4I A;  3N6T A;  2XXT A;  3QSL A;  1PB7 A;  3MC2 A;  3FAT A;  2D3I A;  3RPW A;  4GXS B;  2QMX A;  1B40 A;  4KQP A;  3T9U A;  4NF4 B;  4MF3 A;  3PU5 A;  4BDL A;  1SQY A;  4WKM A;  4ZEB A;  2RC8 A;  4H8J A;  3PPN A;  2QL3 A;  4AB6 A;  5H8H B;  3EHS A;  3GXA A;  4KCD A;  4ZZE A;  1MY3 A;  3FUZ A;  3PD9 A;  3VLU A;  4U23 A;  4EXK A;  3O6H A;  1HSJ A;  1GV8 A;  4KPT A;  3PGF A;  2AIX A;  1Q1K A;  1EZ9 A;  1H43 A;  3EN3 A;  4ECF A;  1I6A A;  1FTO A;  1NL5 A;  4R74 A;  1TWY A;  3T9H B;  3PMV A;  1YTV A;  3EHT A;  3LSW A;  1SW5 A;  3SEX A;  3KBR A;  1DTZ A;  3EPE A;  1B4H A;  2UYE A;  3RY3 A;  4LAT A;  4BDQ A;  1FTL A;  1POY 1;  3T96 B;  3IO4 A;  3VLV A;  3KSX A;  1UTH B;  3OO6 A;  3CFX A;  3FD3 A;  1NNF A;  3W15 C;  3RTF B;  3R7X A;  1RYO A;  3JYR A;  3IB2 A;  1LLS A;  2HEU A;  3W9V A;  4LZ7 A;  5L9S A;  5I56 A;  3MPL A;  4YKJ A;  2Z8E A;  5TPA B;  1MY0 A;  4F2O A;  5KZT A;  3FXU A;  4PFY A;  3Q25 A;  4LA9 A;  3R6U A;  3QYT A;  5I2N B;  4FIM A;  2UVI A;  4O3B A;  4F22 A;  3FVN A;  4GF8 A;  2DYX A;  3O2A A;  2DE3 A;  4G2Z A;  4G8M A;  3OSR A;  1B32 A;  3DEL B;  1HSL A;  2O6A A;  3HPI A;  3FJM A;  3QUJ A;  2Z23 A;  3SEU A;  3TYH A;  1O64 A;  3IB1 A;  1JEU A;  5CM6 A;  4OFJ A;  3MVZ A;  1AOV A;  2HZK A;  2UVH A;  4JSO A;  3CFZ A;  2RF1 A;  1B2H A;  3S9E A;  1IZ1 A;  4ESX A;  5A5X B;  3VVD A;  4RJZ A;  2XXY A;  4XKQ A;  1A54 A;  5I2K B;  4U1Z A;  1PC3 A;  3MVX A;  1EH3 A;  2ABH A;  4X1B A;  2NUV A;  3H03 A;  2VD3 A;  4F31 B;  3FV2 A;  1P1Q A;  3UP9 A;  1Y9U A;  4RNS A;  2KLF A;  3VVE A;  2HAU A;  2I4B A;  4PFU A;  2REG A;  1LCT A;  2ZYM A;  3B6W A;  3SDF A;  2H98 A;  3EQ1 A;  4JBZ A;  4O3A A;  3H6U A;  3FVG A;  2ZYN A;  3K0V A;  4Z7E A;  4M4G A;  1IIT A;  1HSE A;  3TAJ A;  1N3X A;  4KYE A;  2O51 A;  1A40 A;  4THI A;  3DP4 A;  1FCK A;  3BFT A;  1Q35 A;  4GQO A;  2F6P A;  3RUM A;  3TUS A;  1B3G A;  1ELJ A;  2R71 A;  2XHD A;  4FEC A;  4Q0C A;  4LUB A;  1SW2 A;  4DZ1 A;  3JZJ A;  1B5H A;  3KN8 A;  5H8S A;  3FGS A;  4F3B A;  5K2X A;  2F97 A;  4PET A;  4NED A;  3IOU A;  4YIC A;  5JEI A;  3TZA A;  2W7Y A;  1YCJ A;  3HHG A;  2RC9 A;  4LON B;  3A3C A;  2LAO A;  2DQV A;  5BUU A;  3CVG A;  4ZEC A;  4NWD A;  3RT6 B;  4YB7 A;  4IY5 A;  1B6H A;  1OLA A;  1MPC A;  2OBG A;  2Z8F A;  1R6Z A;  4PP0 A;  1N04 A;  3CG1 A;  1ZLQ A;  2OZZ A;  4ZE9 A;  4R9F A;  2NVU B;  4RK9 A;  4E0W A;  3G3H A;  5CRY A;  4DXC A;  4G8N A;  4ELP A;  4R2F A;  4DE8 A;  1MG1 A;  4F1Y A;  2X7P A;  3RN8 A;  4BDN A;  5KCJ A;  1O7T A;  2OWS A;  3KN7 A;  1JET A;  1Y4C A;  4MLV A;  1Y1M A;  1UTH A;  4R6K A;  1JVY A;  3O29 A;  1CE2 A;  3RLF E;  3CG3 A;  2O1L A;  4BLA A;  3IOT A;  4G68 A;  1AL3 A;  3KJT A;  4MLQ A;  3SKP A;  1YPN A;  3ZKK A;  3TCH A;  3A09 A;  3SER A;  3TEP A;  1FTJ A;  3LSL A;  2QJE A;  4OTE A;  3TQL A;  4H8I A;  4U2R A;  2Q9T A;  2DWJ A;  4OES A;  2XXI A;  2ZYK A;  3VV5 A;  3U72 A;  2P2A A;  1II5 A;  1UTB B;  2QMW A;  1B3L A;  2I58 A;  2THI A;  4AB5 A;  1MXW A;  4QSE A;  3N5L A;  3FIR A;  3QIM A;  3K1M A;  1B52 A;  4NF5 A;  3VE1 B;  2RCB A;  3TEL A;  3U8Q A;  2ANJ A;  4RA1 A;  4LP2 B;  2XXU A;  5I58 B;  3TCG A;  1A8E A;  3T22 A;  4NMY A;  4UAC A;  1MQD A;  4WXJ A;  1US5 A;  2XX9 A;  1P1U A;  1MRP A;  1A55 A;  4P11 A;  1JNF A;  4JDF A;  1ANF A;  1SD3 A;  2A5S A;  3I5O A;  4IB2 A;  4DXB A;  5DEX A;  3K2D A;  2ZMB A;  3IB0 A;  4F1U A;  4NF6 A;  2PT2 A;  4C0R A;  3C31 A;  3UOR A;  2AYS A;  3KG2 A;  2VD2 A;  1S50 A;  1IQ7 A;  1N84 A;  5DVI A;  2R9J A;  3QK6 A;  4FED A;  2Q2C A;  2O7I A;  5FTI A;  1LGB C;  3DM0 A;  4F3S A;  1D9Y A;  3B6Q A;  1LBC A;  2HAV A;  4IY6 A;  2PT1 A;  3EHU A;  4G4P A;  3T9V A;  1UIV A;  3FVK A;  4GFR A;  5M2V A;  1EZO A;  2PVU A;  5ITP A;  4XXU A;  2DWH A;  3VFJ A;  1GGG A;  1Y3P A;  5AA3 A;  2Y84 A;  3OMB A;  3L6H A;  1AMF A;  1P1O A;  3IOR A;  4JWO A;  3CI8 A;  4GL8 A;  1XVX A;  3MP6 A;  1A7L A;  3K4U A;  2Y7R A;  4FAT A;  3O66 A;  1WDN A;  1SYH A;  1XS5 A;  2FYI A;  1UQW A;  3O97 A;  1EU8 A;  3MW0 A;  3TTM A;  4ZEI A;  5J1D A;  2UVG A;  3T9X B;  4H67 A;  1O63 A;  3OEL A;  3O28 A;  1URS A;  2O69 A;  3UA8 A;  3E9X A;  3EF7 A;  4GLI A;  1USY E;  1XVY A;  2XXV A;  1CB6 A;  4QRZ A;  3PPR A;  5DTB A;  5AA1 A;  1IXC A;  3C36 A;  4YU0 A;  5AA4 A;  3S9M C;  1P99 A;  2O7U A;  1VR5 A;  1B5J A;  4H1X A;  1M5B A;  5TU0 A;  3OEK A;  3TFL A;  3WAF A;  5IAI A;  1PB8 A;  5AA2 B;  3KOT A;  3UK4 A;  5H8N B;  3PMX A;  1YAE A;  4GVO A;  4OMB A;  3CSB A;  4OFO A;  3KOS A;  3C33 A;  1R9L A;  4ZE8 A;  1MS7 A;  4JWY A;  3N26 A;  2AL4 A;  3S9N C;  3OXN A;  3OD7 A;  3IOW A;  4NE4 A;  4EXL A;  4MBP A;  3H6W A;  3OEN A;  1AIV A;  1FQE A;  2ZNT A;  3MZB A;  4TQU Q;  3PMW A;  4FEB A;  3K6X A;  3H6V A;  4QHQ A;  2A5T B;  4BDM A;  1I6B A;  1UIU A;  4JB7 A;  2V3U A;  1Y20 A;  1MQI A;  2QS2 A;  4PQJ A;  1B3F A;  1IUD A;  4PE5 B;  3BFU A;  2QS4 A;  4MFI A;  4TLL B;  2Q88 A;  1UTB A;  1B5I A;  3IL1 B;  2QSX A;  4QFL A;  1A8F A;  2QRY A;  3TQW A;  4HTG A;  3BBR A;  1L5T A;  5LOM A;  3U93 A;  4YMB A;  4KR5 A;  1NKX A;  4KYD A;  1MXY A;  4ZDM A;  3C34 A;  1RKM A;  4K3F A;  4ELQ A;  3VLW A;  3LC8 A;  3H7M A;  4GXA A;  5I58 A;  4ZED A;  3VDF A;  2ONR A;  3W9W A;  4YB6 A;  1LFG A;  4WEP A;  1XC1 A;  5I59 A;  1VSO A;  1MQH A;  1OIB A;  4OWD A;  2GHA A;  5ICQ A;  5TP9 A;  4BDR A;  4OZ9 A;  4RPO A;  3LR1 A;  2DWI A;  2CZL A;  2O68 A;  1TFD A;  5JK4 A;  4ELR A;  1ZMG A;  2H99 A;  5CMK A;  4RY1 A;  3LSX A;  4OYV A;  1MY2 A;  3PPP A;  4GWO A;  1TT1 A;  5H8Q B;  3TTK A;  3V5A A;  4OVJ A;  4ESW A;  3N94 A;  5HBC A;  5ISU A;  1VFD A;  1NFT A;  3MQ9 A;  1ZBM A;  4ISU A;  2Z8D A;  3MAM A;  4PFT A;  3ODB A;  2O84 X;  1P1N A;  5AE4 A;  1FQD A;  1GTK A;  4DCX A;  4OFL A;  2IEE A;  2F6G A;  3MP1 A;  3S2V A;  3THI A;  5KDT B;  4Z0I A;  2XX8 A;  4C1T A;  2O1M A;  4QFN A;  4PFW A;  4ZZA A;  4FOR A;  4F29 A;  3IJX B;  2V84 A;  2F5X A;  1DPP A;  1SDX A;  4G8H A;  1ZU0 A;  1I6Q A;  4NF4 A;  1LBB A;  1ATG A;  1MPD A;  3HCQ A;  5CI5 A;  4F3P A;  3S4U A;  5JTY B;  1B7H A;  3O6G A;  4F2Q A;  3PUZ E;  4P0I A;  3O6I A;  5H8H A;  2AL5 A;  2OK2 A;  3U92 A;  4R9G A;  1JQF A;  3M3L A;  1KWH A;  4EUO A;  3HST A;  1I69 A;  1MY1 A;  3P7I A;  4QFP A;  3OOA A;  2F7A A;  4H5G A;  3QUF A;  3K00 A;  2E0S A;  4YMA A;  3ECR A;  2DE2 A;  3HO7 A;  4OHN A;  3U1O A;  1NNK A;  3QXM A;  3TDJ A;  4IO5 A;  4Q8R A;  1DMB A;  5BWJ A;  5AA2 A;  2QS3 A;  5L8D A;  1MDQ A;  1B4Z A;  1MM6 A;  4N07 A;  4U4S A;  2UVJ A;  2YJP A;  2I6E A;  1LAF E;  1BLF A;  4ONY A;  4C1U A;  3B7D A;  4F19 A;  5HPQ A;  2VGQ A;  3FJ7 A;  2GHB A;  1QUK A;  4L17 A;  4EF2 A;  4JXI A;  3G3J A;  5CMC A;  2ZNS A;  4XTC Q;  2OWT A;  3RT8 A;  4U4X A;  5AA2 D;  3G3F A;  2I0B A;  3DP6 A;  3MZ9 A;  3TMG A;  1OVB A;  4LZ5 A;  3FXQ A;  3Q26 A;  5TPA A;  4GRK A;  3D4C A;  2R6G E;  1SI1 A;  2B3F A;  2VP1 A;  1FTK A;  5DVF A;  3DP8 A;  3K6W A;  5I2N A;  3PPQ A;  5DYH A;  4LQ5 A;  3Q28 A;  5I56 B;  4QF9 A;  1IEJ A;  3MUQ A;  1N7W A;  4X48 A;  1USY H;  1OVT A;  4X1D A;  1JW4 A;  2ESN A;  1D3K A;  4R6H A;  2I0C A;  3R26 A;  5CMM A;  4IO7 A;  3RTW B;  2ONK E;  3OO7 A;  1RYX A;  2Y7K A;  3OO9 A;  3TTR A;  1LFH A;  3FV1 A;  2I3V A;  3OO8 A;  4RPN A;  4XIG Q;  3VVF A;  2GRV A;  3BKI B;  5H8F B;  2F8D A;  2V3Q A;  4I1D A;  2Y7I A;  5A5X A;  1MPB A;  4YKK A;  2XX7 A;  3PUV E;  3LSF B;  1NMU A;  1B7U A;  5I2K A;  1NH8 A;  3D4G A;  4YAH X;  2REJ A;  3Q29 A;  1Y4T A;  2RCA A;  2FA7 A;  1N7X A;  1SYI A;  2DE4 A;  1ZTY A;  4NTL A;  4YZZ A;  1GR2 A;  4EQ7 A;  5L9O A;  3HN0 A;  2NOO A;  1M5F A;  5FTH A;  1LAH E;  3G3G A;  2NWJ A;  1DSN A;  3SEV A;  1Y1Z A;  4Q30 B;  2OLB A;  4KD5 A;  3GZG A;  1JEV A;  3KJ7 A;  1IXG A;  2PBW A;  3PUW E;  2ZNU A;  4KCC A;  3CSG A;  1TXF A;  4RYA A;  1R1N A;  1ZIU A;  4R2B A;  3S9L C;  4FAJ A;  1FQA A;  3H6T A;  4IO3 A;  3B6T A;  1DTG A;  3H06 B;  1IXH A;  3C4M A;  1JW5 A;  3I6V A;  3IJO B;  1OQH A;  2X26 A;  3LBS A;  4UA8 A;  3RNN A;  1IIW A;  3IOV A;  1MH3 A;  2F35 A;  4N13 A;  1SBP A;  3K1P A;  2DP8 A;  4X9T A;  1QJM A;  1Y3Q A;  4H6D A;  3ILU B;  4OEU A;  3TCF A;  2Q89 A;  3SEY A;  1BTJ A;  1BIY A;  5JTY A;  4OEV A;  4LVQ A;  1N76 A;  4QSC A;  2DWA A;  2BJJ X;  5K2Y A;  1FQC A;  1FTM A;  1N3W A;  3WAE A;  3TKD A;  2F7B A;  1QUL A;  3QAX A;  1XHY A;  2G29 A;  3KZG A;  3A3U A;  1VE4 A;  1URD A;  1ZJL A;  4R72 A;  1SVX B;  1LAX A;  2HZL A;  1US4 A;  5F7V A;  2OCU A;  1B51 A;  1LB8 A;  2HCA A;  1WOD A;  3M3F A;  3GBB A;  3ZSF A;  3PUX E;  2OJT A;  2YLN A;  4LZ8 A;  1URG A;  1MXZ A;  2PX1 A;  1QVS A;  1JVX A;  4LQ2 A;  4OQO A;  4OET A;  4HCW A;  5CMB A;  4NF8 B;  5DVJ A;  1P1W A;  1MQG A;  3MZ1 A;  4FE8 A;  4ZS9 A;  2ZXT A;  2UXA A;  3N6U A;  5KCJ B;  1SW1 A;  3TOD A;  3E3K A;  1B58 A;  2GH9 A;  4EQ9 A;  3G7W A;  4G68 B;  1SW4 A;  4QFK A;  4POX A;  1MXU A;  4KHZ E;  2V3T A;  5I57 B;  4YKP A;  1EZP A;  5ELV A;  4JWX A;  3MJN A;  2DVZ A;  2CMO A;  4G77 A;  2F34 A;  1MM7 A;  4OEN A;  1BKA A;  1OQG A;  2H5Y A;  2XXR A;  5IKB A;  2F7C A;  4NWC A;  3ZS6 A;  4H0W A;  3K6U A;  4EQB A;  3L6G A;  4N6P A;  3GLB A;  3U94 A;  1BP5 A;  1R9Q A;  4GL0 A;  1AH5 A;  3KGC A;  4U1O A;  3G3K A;  1XOC A;  2V25 A;  4NF5 B;  1F9B A;  4BDO A;  5H8F A;  1B7Z A;  3VXC A;  1B46 A;  2VHA A;  1PBP A;  2WKY A;  3CIJ A;  1J1N A;  4IO4 A;  3MVY A;  5F1Q A;  1NH7 A;  4IO6 A;  4IO2 A;  4KI0 E;  1MXV A;  2ZYO A;  3G3I A;  2IA4 A;  2DOJ A;  1H3D A;  3KFM A;  4ZEF A;  1XT8 A;  2XD2 A;  4ZEK A;  1FQB A;  1PBQ A;  1WVJ A;  4E0X A;  5ITO A;  1D9V A;  5DEX B;  2H9B A;  2YPN A;  2Y7W A;  4NF6 B;  1B0L A;  1N0T A;  2G93 A;  1B1X A;  3K02 A;  2Y7P A;  1PEB A;  3LUY A;  3PPO A;  3FJG A;  2PYY A;  3T66 A;  3C35 A;  3V83 A;  4M1V A;  3MP8 A;  1MH4 A;  1DPE A;  1B1H A;  4HS7 A;  4DXU A;  1FW0 A;  2RC7 A;  2RKM A;  4F1V A;  4WED A;  1ZKB A;  3IR1 A;  3T93 B;  1M5E A;  4XKR A;  5L9M A;  2PMS A;  1QKA A; 
#chains in the Genus database with same CATH topology
 3TTL A;  3IAZ A;  5EQ7 A;  2XXP A;  5B70 A;  2QPQ A;  4I62 A;  1LBZ A;  1LFI A;  1OLC A;  2QS1 A;  3OSQ A;  5EYF A;  2D21 A;  1T0K A;  1QW0 A;  4F3G A;  4FJP A;  1LAG E;  5EHS A;  1Z7M E;  5I3S A;  3TTN A;  3IO6 A;  4PGN A;  4QSD A;  3MBP A;  5I84 A;  3CRB A;  1KZ8 A;  2ZZV A;  2I49 A;  1LST A;  1S9T A;  2I4C A;  2V93 A;  4JSD A;  2HFB A;  1H45 A;  1GVC A;  3V8X B;  2NXO A;  5DT6 A;  3SET A;  3MWB A;  4R6Y A;  3I3V A;  4Q5T A;  3E4R A;  3V89 B;  2GQ1 A;  3UGW A;  4R73 A;  2VOZ A;  3VXB A;  3CHG A;  3SEW A;  2HQ0 A;  3PUY E;  2F78 A;  4GIZ A;  2M8C A;  1LEV A;  3E78 A;  1S7Y A;  2P0S A;  4DCY A;  1PDA A;  1Y3N A;  4MEV A;  4OER A;  3PTY A;  2XXH A;  5AA4 B;  1FQF A;  2KQZ A;  5IZ3 B;  4QFO A;  4I8C A;  5H8N A;  3K01 A;  2F36 A;  4EF1 A;  3E13 X;  1OMP A;  1SI0 A;  1PB9 A;  1Z7N E;  4R75 A;  5ICT A;  2F3B A;  3FZV A;  3MPK A;  3HHF A;  4NF8 A;  3CR9 A;  4KFQ A;  1B3H A;  1IXI A;  3O9P A;  1JW1 A;  4KYS A;  1M5D A;  2DDK A;  3PD8 A;  1B0H A;  4OXV A;  3IX1 A;  3ZKL A;  4DI4 B;  4N6K A;  4ELO A;  2XXQ A;  1LB9 A;  2A5T A;  3M8U A;  4TLM B;  3HV1 A;  3H4Z A;  4H5F A;  3EKI A;  5HM4 B;  2DSF A;  5CBR A;  3F11 A;  5DW8 A;  3ONM A;  4XEQ A;  4MNP A;  1MQJ A;  3FVO A;  3ILT B;  3UIF A;  1B05 A;  1FPJ A;  3KEI A;  4GWZ A;  5I57 A;  1NV5 A;  3GBA A;  4RXL A;  4MH5 A;  2VT5 A;  3DLN A;  2P1S A;  4GD5 A;  4G68 C;  1POT A;  1INP A;  2XXX A;  4PDH A;  4MAG A;  1QKB A;  4EDP A;  4POW A;  3FXR A;  5CBS A;  2DS9 A;  4F39 A;  3KSJ A;  4IGT A;  4P0G A;  4YB5 A;  2UYF A;  4ND9 A;  2DXR A;  3M3K A;  1LCF A;  4OVQ A;  4RK2 A;  3MVW A;  5B7D A;  3Q27 A;  3C9H A;  1NV7 A;  3BIG A;  3PV0 E;  5FHM A;  2Q8J A;  3UN6 A;  4I9D A;  4YKI A;  1B3E A;  4H65 A;  2RIN A;  3RQT A;  2HXW A;  2I3W A;  4U21 A;  1D4N A;  4MCO A;  4HE0 A;  3GYY A;  4GOT A;  4PC9 A;  3TPA A;  3AXF A;  4PBH A;  5I59 B;  4DLD A;  3SES A;  1MDP 1;  1NNT A;  1B9J A;  4O3C A;  5TP9 B;  2R8T A;  4XKN A;  4DIG A;  5IZZ A;  5H8Q A;  5FBP A;  4FBP A;  2GFE A;  5A5L A;  5CC2 A;  3H3G A;  1MXX A;  2B65 A;  4TOZ A;  1QUJ A;  1M5C A;  2DVC A;  2I48 A;  4DDD A;  1DOT A;  4NF0 A;  4PAF A;  2H25 A;  2DXY A;  1QUI A;  5FHO A;  3JV9 A;  2B3B A;  1H76 A;  4HCY A;  2XWO A;  1H44 A;  3FAS A;  2FNC A;  3C32 A;  2XD3 A;  3K1N A;  2D5W A;  4MX6 A;  2Z22 A;  4X04 A;  2XA5 A;  2ALU A;  3IK6 B;  4F18 A;  3USD A;  4P56 A;  3RGY A;  1XI6 A;  4HW8 A;  5KDT A;  1NNP A;  4XF5 A;  1VFE A;  2XXW A;  4IGR A;  2HXR A;  1A99 A;  4U22 A;  3CFL A;  2Q2A A;  1MY4 A;  1TFA A;  3KN3 A;  2E1S A;  4AQ4 A;  2ONS A;  5EYG A;  3SZP A;  2CZK A;  5FHN A;  3OEM A;  5EHM A;  2X7Q A;  4XKP A;  3K6V A;  2H4I A;  3N6T A;  2XXT A;  3QSL A;  1PB7 A;  1FJ6 A;  3MC2 A;  3FAT A;  2D3I A;  1FPF A;  3RPW A;  4GXS B;  2QMX A;  1B40 A;  4KQP A;  3T9U A;  4NF4 B;  2HHM A;  4MF3 A;  4PFB A;  3PU5 A;  4BDL A;  1SQY A;  4WKM A;  4ZEB A;  2RC8 A;  2P3N A;  4H8J A;  3PPN A;  4N4U A;  2QL3 A;  4AB6 A;  5H8H B;  3EHS A;  3A29 A;  3GXA A;  4KCD A;  4OVP A;  4ZZE A;  2PFZ A;  1DCU A;  1MY3 A;  1FPD A;  3FUZ A;  3PD9 A;  5IZ3 A;  3VLU A;  4GBW A;  5I5P A;  4U23 A;  4EXK A;  3O6H A;  1HSJ A;  1GV8 A;  4KPT A;  3PGF A;  3U65 A;  2AIX A;  1Q1K A;  1EZ9 A;  1H43 A;  3EN3 A;  4ECF A;  1I6A A;  1FTO A;  1NL5 A;  4R74 A;  1TWY A;  3T9H B;  3PMV A;  1YTV A;  3EHT A;  3LSW A;  1SW5 A;  3SEX A;  3KBR A;  1EYI A;  1DTZ A;  3EPE A;  1B4H A;  1NV1 A;  2UYE A;  3RY3 A;  4LAT A;  4BDQ A;  1NV2 A;  1FTL A;  1POY 1;  3T96 B;  3IO4 A;  3VLV A;  3KSX A;  1IMF A;  1UTH B;  3OO6 A;  3CFX A;  3FD3 A;  1NNF A;  3W15 C;  3RTF B;  3R7X A;  1RYO A;  3JYR A;  3IB2 A;  1LLS A;  2HEU A;  1G0I A;  5IZ1 A;  5EYH A;  3W9V A;  4LZ7 A;  5L9S A;  5I56 A;  3MPL A;  4YKJ A;  1FJ9 A;  2Z8E A;  5TPA B;  1MY0 A;  4F2O A;  5KZT A;  1RDY A;  3FXU A;  4PFY A;  3Q25 A;  4LA9 A;  3R6U A;  3QYT A;  5I2N B;  1IMC A;  4FIM A;  2UVI A;  4O3B A;  4F22 A;  3FVN A;  4GF8 A;  2DYX A;  3O2A A;  2DE3 A;  4G2Z A;  4G8M A;  3OSR A;  1B32 A;  3DEL B;  1HSL A;  2O6A A;  4PCD A;  3HPI A;  3FJM A;  3QUJ A;  2Z23 A;  3SEU A;  4GWY A;  3TYH A;  1O64 A;  3IB1 A;  1JEU A;  1LBX A;  5CM6 A;  4OFJ A;  4QBA A;  3MVZ A;  2WEF A;  1AOV A;  1FBF A;  2HZK A;  2Q74 A;  2UVH A;  4JSO A;  3CFZ A;  4MMP A;  2RF1 A;  1B2H A;  4I3E A;  3S9E A;  2VPN A;  1IZ1 A;  4ESX A;  5A5X B;  3VVD A;  4RJZ A;  2HPG A;  2XXY A;  4MNC A;  4GX4 A;  4N17 A;  4XKQ A;  1A54 A;  5I2K B;  4U1Z A;  1PC3 A;  2WBB A;  3MVX A;  1EH3 A;  3QMF A;  2ABH A;  4X1B A;  2NUV A;  3H03 A;  3B8B A;  4JVD A;  2VD3 A;  4F31 B;  3FV2 A;  1P1Q A;  3UP9 A;  1Y9U A;  4RNS A;  2KLF A;  3VVE A;  2HAU A;  2I4B A;  4PFU A;  2REG A;  1LCT A;  2ZYM A;  3B6W A;  2CEX A;  1NV6 A;  3SDF A;  2H98 A;  3EQ1 A;  4JBZ A;  4O3A A;  1FBP A;  3H6U A;  3FVG A;  2ZYN A;  3K0V A;  4Z7E A;  4M4G A;  1IIT A;  1HSE A;  3TAJ A;  4MHF A;  4AS5 A;  1N3X A;  4KYE A;  1YXI A;  2O51 A;  1A40 A;  4THI A;  3DP4 A;  1FCK A;  3BFT A;  1NV3 A;  3FBP A;  1Q35 A;  4GQO A;  5ET6 A;  2F6P A;  3RUM A;  3TUS A;  1B3G A;  1ELJ A;  1FSA A;  2R71 A;  2XHD A;  4FEC A;  4Q0C A;  4LUB A;  1SW2 A;  3JZJ A;  2OX3 A;  4DZ1 A;  1B5H A;  3KN8 A;  5H8S A;  3D1R A;  1DK4 A;  3FGS A;  4F3B A;  5K2X A;  2F97 A;  4PET A;  4NED A;  3IOU A;  2FBP A;  4YIC A;  5JEI A;  3TZA A;  2W7Y A;  1YCJ A;  3HHG A;  2RC9 A;  4LON B;  3A3C A;  2LAO A;  2DQV A;  5BUU A;  3CVG A;  4ZEC A;  4NWD A;  3RT6 B;  4YB7 A;  4IY5 A;  1B6H A;  1OLA A;  1MPC A;  2OBG A;  2Z8F A;  1R6Z A;  4PP0 A;  1N04 A;  3CG1 A;  1ZLQ A;  2OZZ A;  4ZE9 A;  4R9F A;  1IMD A;  2NVU B;  4RK9 A;  4E0W A;  3G3H A;  3HFU A;  5CRY A;  1AWB A;  4DXC A;  4G8N A;  4ELP A;  4R2F A;  4DE8 A;  1MG1 A;  4F1Y A;  2WYP A;  2X7P A;  3RN8 A;  4BDN A;  5KCJ A;  1O7T A;  2OWS A;  3KN7 A;  1JET A;  1Y4C A;  4MLV A;  3RPL B;  1Y1M A;  1UTH A;  4R6K A;  1JVY A;  3O29 A;  5EQ8 A;  1CE2 A;  3RLF E;  3CG3 A;  2O1L A;  4BLA A;  3IOT A;  4G68 A;  1AL3 A;  3KJT A;  4MLQ A;  3SKP A;  1YPN A;  3ZKK A;  3TCH A;  4NN3 A;  3A09 A;  3SER A;  3TEP A;  1FTJ A;  4NGU A;  3LSL A;  1KA0 A;  2QJE A;  2CZI A;  2XWK A;  4MNI A;  4OTE A;  3TQL A;  4H8I A;  3MST A;  4U2R A;  2Q9T A;  2KR0 A;  2DWJ A;  2XXK A;  4OES A;  4OVR A;  2XXI A;  2ZYK A;  3VV5 A;  3U72 A;  2P2A A;  1II5 A;  1UTB B;  2QMW A;  1B3L A;  2I58 A;  2THI A;  4AB5 A;  1MXW A;  4QSE A;  4PAI A;  3N5L A;  3FIR A;  3QIM A;  3K1M A;  1B52 A;  4NF5 A;  3VE1 B;  2RCB A;  3TEL A;  3U8Q A;  4PF8 A;  2ANJ A;  4RA1 A;  3KC1 A;  4LP2 B;  2XXU A;  5LDZ A;  5I58 B;  3TCG A;  1A8E A;  3T22 A;  4NMY A;  4UAC A;  1LBY A;  1MQD A;  4WXJ A;  1US5 A;  4NAP A;  2XX9 A;  1P1U A;  1MRP A;  1A55 A;  4P11 A;  1JNF A;  4JDF A;  1ANF A;  1SD3 A;  2A5S A;  3I5O A;  4IB2 A;  4PAK A;  4DXB A;  5DEX A;  3K2D A;  2ZMB A;  3IB0 A;  4F1U A;  1K9Z A;  4NF6 A;  2PT2 A;  4C0R A;  3C31 A;  3UOR A;  2AYS A;  3KG2 A;  2VD2 A;  1S50 A;  1FBD A;  1IQ7 A;  1N84 A;  5DVI A;  4OAN A;  4PDD A;  2R9J A;  3QK6 A;  4FED A;  2Q2C A;  2O7I A;  5FTI A;  1LGB C;  3DM0 A;  4F3S A;  1D9Y A;  3B6Q A;  1NV0 A;  3MYU A;  1LBC A;  2ZZW A;  2HAV A;  4NHB A;  3FXB A;  4IY6 A;  2PT1 A;  3EHU A;  4G4P A;  3T9V A;  2QVU A;  1UIV A;  3FVK A;  4GFR A;  5M2V A;  1EZO A;  2PVU A;  3T0J A;  5ITP A;  4O8M A;  4XXU A;  2DWH A;  2B4L A;  1GGG A;  3VFJ A;  1Y3P A;  5AA3 A;  2Y84 A;  3OMB A;  1NI9 A;  4XFE A;  3L6H A;  1AMF A;  1P1O A;  3IOR A;  4JWO A;  3CI8 A;  4GL8 A;  4OA4 A;  1XVX A;  4LN5 A;  3MP6 A;  4MJO A;  1A7L A;  3K4U A;  2Y7R A;  4FAT A;  3O66 A;  1WDN A;  1SYH A;  1XS5 A;  2FYI A;  1UQW A;  3O97 A;  1EU8 A;  3MW0 A;  3TTM A;  4ZEI A;  5J1D A;  1IME A;  2UVG A;  3T9X B;  4PFI A;  4H67 A;  1O63 A;  3OEL A;  3O28 A;  1URS A;  2O69 A;  3UA8 A;  3E9X A;  3EF7 A;  4GLI A;  1USY E;  2VPO A;  1XVY A;  2XXV A;  4P1E A;  1CB6 A;  4QRZ A;  3PPR A;  5DTB A;  3KC0 A;  5AA1 A;  1IXC A;  3C36 A;  4YU0 A;  5AA4 A;  3S9M C;  1P99 A;  2O7U A;  3E79 A;  1VR5 A;  2FHY A;  1B5J A;  5ET5 A;  4H1X A;  1D9Q A;  1M5B A;  5TU0 A;  4H46 A;  3OEK A;  3TFL A;  3WAF A;  5IAI A;  4NQ8 A;  1PB8 A;  5AA2 B;  3KOT A;  3UK4 A;  5H8N B;  3PMX A;  1YAE A;  4GVO A;  3ISP A;  4P1L A;  4OMB A;  3CSB A;  4OFO A;  3KOS A;  4PF6 A;  3C33 A;  1R9L A;  4ZE8 A;  1MS7 A;  2F3D A;  4JWY A;  3N26 A;  4KXP A;  2AL4 A;  5ESY A;  3S9N C;  3OXN A;  3OD7 A;  3RPL A;  3IOW A;  4NE4 A;  4EXL A;  4MBP A;  3H6W A;  3OEN A;  1AIV A;  2MKZ A;  1FQE A;  2ZNT A;  3MZB A;  4TQU Q;  3PMW A;  4FEB A;  3K6X A;  4OVS A;  4O94 A;  3H6V A;  4QHQ A;  1FPB A;  2A5T B;  4BDM A;  1I6B A;  1UIU A;  4JB7 A;  2V3U A;  1Y20 A;  1MQI A;  2QS2 A;  4PQJ A;  1B3F A;  1IUD A;  4PE5 B;  3BFU A;  2QS4 A;  4MFI A;  4TLL B;  4P8B A;  2Q88 A;  1UTB A;  1B5I A;  3IL1 B;  2QSX A;  1NUZ A;  4QFL A;  1A8F A;  2QRY A;  2CEY A;  3TQW A;  4HTG A;  3BBR A;  1L5T A;  5LOM A;  3U93 A;  4YMB A;  4KR5 A;  1BK4 A;  1NKX A;  4KYD A;  1MXY A;  1YZ0 A;  4ZDM A;  3C34 A;  4PFR A;  4P3L A;  1RKM A;  4K3F A;  4ELQ A;  3VLW A;  3LC8 A;  3H7M A;  4GXA A;  5I58 A;  4ZED A;  3VDF A;  2ONR A;  3W9W A;  1NV4 A;  4YB6 A;  3RYD A;  1EYJ A;  1LFG A;  2QVR A;  4WEP A;  2FVZ A;  1XC1 A;  5I59 A;  1VSO A;  4PE3 A;  1FBC A;  1MQH A;  1OIB A;  4OWD A;  2GHA A;  5ICQ A;  5TP9 A;  4BDR A;  4OZ9 A;  5F24 A;  4RPO A;  3LR1 A;  2DWI A;  2CZL A;  2O68 A;  2WX9 A;  1TFD A;  1YYZ A;  5JK4 A;  4N8Y A;  4ELR A;  4OVT A;  5EQ9 A;  1ZMG A;  2H99 A;  5CMK A;  4RY1 A;  4P47 A;  3LSX A;  4OYV A;  1MY2 A;  3PPP A;  4GWO A;  3ROJ A;  1TT1 A;  5H8Q B;  3TTK A;  3V5A A;  4OVJ A;  4ESW A;  3N94 A;  5HBC A;  5ISU A;  1VFD A;  1NFT A;  3MQ9 A;  1ZBM A;  4ISU A;  2Z8D A;  4HE2 A;  3MAM A;  4PFT A;  3ODB A;  2O84 X;  1P1N A;  1SPI A;  5AE4 A;  1FQD A;  1GTK A;  4AS4 A;  4DCX A;  4OFL A;  2IEE A;  2F6G A;  2QVV A;  4GWS A;  1FRP A;  3MP1 A;  3S2V A;  3THI A;  1LBV A;  3KBZ A;  5KDT B;  4Z0I A;  1NUX A;  4JVC A;  2XX8 A;  4C1T A;  2O1M A;  4QFN A;  4PFW A;  4ZZA A;  4FOR A;  4H45 A;  4F29 A;  3IJX B;  4PBQ A;  2V84 A;  2F5X A;  1DPP A;  1SDX A;  4G8H A;  1ZU0 A;  1I6Q A;  3LV0 A;  5T3J A;  4NF4 A;  1LBB A;  1ATG A;  1MPD A;  3HCQ A;  5CI5 A;  4F3P A;  5LTC A;  3S4U A;  5JTY B;  5I7I A;  1B7H A;  3O6G A;  4F2Q A;  3PUZ E;  1FPI A;  4P0I A;  3O6I A;  5H8H A;  2AL5 A;  2OK2 A;  3U92 A;  4R9G A;  1JQF A;  3M3L A;  1KWH A;  4EUO A;  3HST A;  1I69 A;  1MY1 A;  3P7I A;  4QFP A;  1FPG A;  3OOA A;  2F7A A;  4H5G A;  3QUF A;  3K00 A;  4P9K A;  2E0S A;  4YMA A;  3ECR A;  2DE2 A;  3HO7 A;  4OHN A;  3U1O A;  2FIX A;  1NNK A;  3QXM A;  3TDJ A;  4IO5 A;  4Q8R A;  1DMB A;  5BWJ A;  5AA2 A;  2QS3 A;  5L8D A;  1MDQ A;  4GWW A;  1B4Z A;  1MM6 A;  4N07 A;  4U4S A;  2UVJ A;  2YJP A;  2I6E A;  1LAF E;  1BLF A;  4N15 A;  4ONY A;  4C1U A;  3B7D A;  4F19 A;  5HPQ A;  2VGQ A;  3FJ7 A;  2GHB A;  5ET7 A;  2V4C A;  1QUK A;  4L17 A;  4EF2 A;  4JXI A;  3G3J A;  4N6D A;  5CMC A;  2ZNS A;  4XTC Q;  2OWT A;  4O7I A;  3RT8 A;  4U4X A;  5AA2 D;  3G3F A;  2I0B A;  3DP6 A;  3MZ9 A;  3TMG A;  3BIH A;  1OVB A;  4LZ5 A;  4PTK A;  3FXQ A;  3Q26 A;  5TPA A;  4GRK A;  1RDX A;  3D4C A;  4NG7 A;  2R6G E;  1SI1 A;  2B3F A;  2VP1 A;  1FTK A;  5DVF A;  4HE1 A;  3DP8 A;  3K6W A;  5I2N A;  3PPQ A;  4IR8 A;  5DYH A;  4LQ5 A;  3Q28 A;  5I56 B;  4QF9 A;  1IEJ A;  4N8G A;  3MUQ A;  1N7W A;  4X48 A;  1EYK A;  1USY H;  1OVT A;  2BJI A;  4X1D A;  4QXD A;  1JW4 A;  2ESN A;  1D3K A;  4N91 A;  4R6H A;  2I0C A;  4GBV A;  3R26 A;  5CMM A;  4IO7 A;  3RTW B;  2ONK E;  3OO7 A;  1FPL A;  1RYX A;  2Y7K A;  3OO9 A;  2Y5L A;  3TTR A;  1LFH A;  3FV1 A;  2I3V A;  1RDZ A;  3OO8 A;  4RPN A;  4XIG Q;  1KA1 A;  3VVF A;  2GRV A;  3BKI B;  5H8F B;  2F8D A;  2V3Q A;  4I1D A;  2Y7I A;  5A5X A;  1MPB A;  2PFY A;  1K9Y A;  4YKK A;  4G61 A;  2XX7 A;  3PUV E;  3LSF B;  1LBW A;  1NMU A;  1B7U A;  5I2K A;  1NH8 A;  3D4G A;  4YAH X;  2REJ A;  3Q29 A;  1Y4T A;  2RCA A;  1Q9D A;  1NUY A;  2FA7 A;  1N7X A;  1SYI A;  2DE4 A;  1ZTY A;  2WBD A;  4NTL A;  4DI3 D;  4YZZ A;  1GR2 A;  4EQ7 A;  5L9O A;  3HN0 A;  2NOO A;  1M5F A;  5FTH A;  1LAH E;  3G3G A;  2NWJ A;  2CZH A;  1DSN A;  3SEV A;  4I40 A;  1Y1Z A;  4Q30 B;  4X8R A;  2OLB A;  4KD5 A;  3GZG A;  1JEV A;  3KJ7 A;  1IXG A;  2PBW A;  3PUW E;  2ZNU A;  4N81 A;  4KCC A;  3CSG A;  1TXF A;  4RYA A;  1R1N A;  1IMA A;  1FBG A;  1ZIU A;  4R2B A;  3S9L C;  4FAJ A;  1FQA A;  3H6T A;  4IO3 A;  3B6T A;  1DTG A;  3H06 B;  1IXH A;  3C4M A;  1JW5 A;  3I6V A;  3IJO B;  1OQH A;  4GX6 A;  2X26 A;  2Y5K A;  3LBS A;  4UA8 A;  3RNN A;  1IIW A;  3IOV A;  1MH3 A;  2F35 A;  4N13 A;  1SBP A;  3K1P A;  2DP8 A;  4X9T A;  1QJM A;  1Y3Q A;  4H6D A;  3ILU B;  4OEU A;  3TCF A;  2Q89 A;  3SEY A;  1BTJ A;  2FIE A;  5ET8 A;  1BIY A;  5JTY A;  1JP4 A;  4OEV A;  4LVQ A;  1N76 A;  4QSC A;  1VDW A;  2QFL A;  2DWA A;  2BJJ X;  5K2Y A;  1FQC A;  1FTM A;  1N3W A;  3WAE A;  3TKD A;  1NUW A;  1FPE A;  2F7B A;  1QUL A;  5IGA A;  3QAX A;  3B50 A;  1XHY A;  2JJK A;  2G29 A;  2ZZX A;  3KZG A;  4GX3 A;  3A3U A;  1VE4 A;  1URD A;  1ZJL A;  4R72 A;  1SVX B;  1LAX A;  2HZL A;  2P3V A;  1US4 A;  5F7V A;  2OCU A;  1B51 A;  1LB8 A;  2HCA A;  1WOD A;  5EQA A;  3M3F A;  3GBB A;  3ZSF A;  3PUX E;  2OJT A;  2YLN A;  4LZ8 A;  1URG A;  3IFA A;  1MXZ A;  2PX1 A;  1QVS A;  1JVX A;  3NOH A;  4LQ2 A;  4OQO A;  4OET A;  4HCW A;  5CMB A;  4NF8 B;  5DVJ A;  1P1W A;  1MQG A;  3MZ1 A;  4FE8 A;  4ZS9 A;  2ZXT A;  2UXA A;  4HXV A;  3N6U A;  5KCJ B;  1SW1 A;  3TOD A;  3E3K A;  1B58 A;  4GWX A;  2GH9 A;  4EQ9 A;  3T1B A;  3G7W A;  4G68 B;  1SW4 A;  4QFK A;  4POX A;  1MXU A;  4KHZ E;  2V3T A;  5I57 B;  5J16 A;  4YKP A;  1EZP A;  5ELV A;  4JWX A;  3MJN A;  2DVZ A;  2L5V A;  4MIJ A;  2CMO A;  4G77 A;  2F34 A;  1MM7 A;  4OEN A;  1BKA A;  1OQG A;  2H5Y A;  2XXR A;  5IKB A;  2F7C A;  4NWC A;  3IFC A;  3ZS6 A;  1QGX A;  4H0W A;  3K6U A;  4EQB A;  3L6G A;  4N6P A;  3GLB A;  1G0H A;  1BP5 A;  1FBE A;  1R9Q A;  4GL0 A;  1AH5 A;  3KGC A;  4U1O A;  3U94 A;  3G3K A;  1XOC A;  2V25 A;  4NF5 B;  1F9B A;  4BDO A;  5H8F A;  1B7Z A;  3VXC A;  1B46 A;  2VHA A;  1PBP A;  2WKY A;  2B4M A;  1J1N A;  3CIJ A;  4IO4 A;  3MVY A;  1IMB A;  5F1Q A;  1NH7 A;  1FTA A;  4IO6 A;  4IO2 A;  5IM2 A;  4PGP A;  2WYK A;  4KI0 E;  1MXV A;  2ZYO A;  3G3I A;  2IA4 A;  2DOJ A;  1H3D A;  3KFM A;  4ZEF A;  1XT8 A;  4I3Y A;  2XWI A;  2XD2 A;  4NX1 A;  4ZEK A;  2Q8M A;  1FQB A;  1PBQ A;  1WVJ A;  4E0X A;  5ITO A;  1D9V A;  5DEX B;  2H9B A;  2YPN A;  2Y7W A;  3LUZ A;  4NF6 B;  1B0L A;  1N0T A;  2G93 A;  1FPK A;  1B1X A;  3K02 A;  2Y7P A;  1PEB A;  1DBZ A;  3LUY A;  3PPO A;  3FJG A;  2PYY A;  4O7M A;  3T66 A;  4GWU A;  2OWZ A;  3C35 A;  3V83 A;  4M1V A;  3MP8 A;  4UAB A;  1MH4 A;  1DPE A;  4JVI A;  1B1H A;  4HS7 A;  4DXU A;  1FW0 A;  2RC7 A;  1CNQ A;  1FBH A;  2RKM A;  4WED A;  4F1V A;  2XWV A;  1ZKB A;  3IR1 A;  2PCR A;  3T93 B;  1M5E A;  4XKR A;  5L9M A;  2PMS A;  1QKA A; 
#chains in the Genus database with same CATH homology
 3TTL A;  3IAZ A;  2XXP A;  5B70 A;  2QPQ A;  4I62 A;  1LFI A;  1OLC A;  2QS1 A;  3OSQ A;  5EYF A;  2D21 A;  1T0K A;  1QW0 A;  4F3G A;  4FJP A;  1LAG E;  5EHS A;  1Z7M E;  3TTN A;  3IO6 A;  4QSD A;  3MBP A;  5I84 A;  3CRB A;  2I49 A;  1LST A;  1S9T A;  2I4C A;  2V93 A;  4JSD A;  2HFB A;  1H45 A;  1GVC A;  3V8X B;  2NXO A;  5DT6 A;  3SET A;  3MWB A;  4R6Y A;  3I3V A;  4Q5T A;  3E4R A;  3V89 B;  3UGW A;  4R73 A;  2VOZ A;  3VXB A;  3SEW A;  2HQ0 A;  3PUY E;  2F78 A;  4GIZ A;  2M8C A;  1S7Y A;  2P0S A;  4DCY A;  1PDA A;  1Y3N A;  4OER A;  2XXH A;  5AA4 B;  1FQF A;  4QFO A;  4I8C A;  5H8N A;  3K01 A;  2F36 A;  4EF1 A;  3E13 X;  1OMP A;  1SI0 A;  1PB9 A;  1Z7N E;  4R75 A;  5ICT A;  3FZV A;  3MPK A;  3HHF A;  4NF8 A;  3CR9 A;  4KFQ A;  1B3H A;  1IXI A;  3O9P A;  1JW1 A;  4KYS A;  1M5D A;  3PD8 A;  1B0H A;  4OXV A;  3IX1 A;  3ZKL A;  4ELO A;  2XXQ A;  1LB9 A;  2A5T A;  3M8U A;  4TLM B;  3HV1 A;  3H4Z A;  4H5F A;  5HM4 B;  2DSF A;  5CBR A;  3F11 A;  3ONM A;  1MQJ A;  3FVO A;  3ILT B;  3UIF A;  1B05 A;  3KEI A;  5I57 A;  3GBA A;  4RXL A;  4MH5 A;  3DLN A;  2P1S A;  4GD5 A;  4G68 C;  1POT A;  2XXX A;  1QKB A;  4EDP A;  4POW A;  3FXR A;  5CBS A;  2DS9 A;  4F39 A;  3KSJ A;  4IGT A;  4P0G A;  4YB5 A;  2UYF A;  4ND9 A;  2DXR A;  3M3K A;  1LCF A;  4RK2 A;  3MVW A;  5B7D A;  3Q27 A;  3C9H A;  3PV0 E;  5FHM A;  2Q8J A;  3UN6 A;  4I9D A;  4YKI A;  1B3E A;  4H65 A;  2RIN A;  3RQT A;  2HXW A;  2I3W A;  4U21 A;  1D4N A;  4GOT A;  3TPA A;  5I59 B;  3AXF A;  4DLD A;  3SES A;  1MDP 1;  1NNT A;  1B9J A;  4O3C A;  5TP9 B;  4DIG A;  4XKN A;  5H8Q A;  2GFE A;  5CC2 A;  3H3G A;  1MXX A;  2B65 A;  4TOZ A;  1QUJ A;  1M5C A;  2DVC A;  2I48 A;  4DDD A;  1DOT A;  2H25 A;  2DXY A;  1QUI A;  5FHO A;  3JV9 A;  2B3B A;  1H76 A;  4HCY A;  1H44 A;  3FAS A;  2FNC A;  3C32 A;  2XD3 A;  3K1N A;  2D5W A;  2Z22 A;  2ALU A;  3IK6 B;  4F18 A;  3USD A;  3RGY A;  4HW8 A;  5KDT A;  1NNP A;  1VFE A;  2XXW A;  4IGR A;  1A99 A;  4U22 A;  3CFL A;  2Q2A A;  1MY4 A;  1TFA A;  3KN3 A;  2E1S A;  4AQ4 A;  2ONS A;  5FHN A;  3OEM A;  5EHM A;  2X7Q A;  4XKP A;  3K6V A;  2H4I A;  3N6T A;  2XXT A;  3QSL A;  1PB7 A;  3MC2 A;  3FAT A;  2D3I A;  3RPW A;  4GXS B;  2QMX A;  1B40 A;  4KQP A;  3T9U A;  4NF4 B;  4MF3 A;  3PU5 A;  4BDL A;  1SQY A;  4WKM A;  4ZEB A;  2RC8 A;  4H8J A;  3PPN A;  2QL3 A;  4AB6 A;  5H8H B;  3EHS A;  3GXA A;  4KCD A;  4ZZE A;  1MY3 A;  3FUZ A;  3PD9 A;  3VLU A;  4U23 A;  4EXK A;  3O6H A;  1HSJ A;  1GV8 A;  4KPT A;  3PGF A;  2AIX A;  1Q1K A;  1EZ9 A;  1H43 A;  3EN3 A;  4ECF A;  1I6A A;  1FTO A;  1NL5 A;  4R74 A;  1TWY A;  3T9H B;  3PMV A;  1YTV A;  3EHT A;  3LSW A;  1SW5 A;  3SEX A;  3KBR A;  1DTZ A;  3EPE A;  1B4H A;  2UYE A;  3RY3 A;  4LAT A;  4BDQ A;  1FTL A;  1POY 1;  3T96 B;  3IO4 A;  3VLV A;  3KSX A;  1UTH B;  3OO6 A;  3CFX A;  3FD3 A;  1NNF A;  3W15 C;  3RTF B;  3R7X A;  1RYO A;  3JYR A;  3IB2 A;  1LLS A;  2HEU A;  3W9V A;  4LZ7 A;  5L9S A;  5I56 A;  3MPL A;  4YKJ A;  2Z8E A;  5TPA B;  1MY0 A;  4F2O A;  5KZT A;  3FXU A;  4PFY A;  3Q25 A;  4LA9 A;  3R6U A;  3QYT A;  5I2N B;  4FIM A;  2UVI A;  4O3B A;  4F22 A;  3FVN A;  4GF8 A;  2DYX A;  3O2A A;  2DE3 A;  4G2Z A;  4G8M A;  3OSR A;  1B32 A;  3DEL B;  1HSL A;  2O6A A;  3HPI A;  3FJM A;  3QUJ A;  2Z23 A;  3SEU A;  3TYH A;  1O64 A;  3IB1 A;  1JEU A;  5CM6 A;  4OFJ A;  3MVZ A;  1AOV A;  2HZK A;  2UVH A;  4JSO A;  3CFZ A;  2RF1 A;  1B2H A;  3S9E A;  1IZ1 A;  4ESX A;  5A5X B;  3VVD A;  4RJZ A;  2XXY A;  4XKQ A;  1A54 A;  5I2K B;  4U1Z A;  1PC3 A;  3MVX A;  1EH3 A;  2ABH A;  4X1B A;  2NUV A;  3H03 A;  2VD3 A;  4F31 B;  3FV2 A;  1P1Q A;  3UP9 A;  1Y9U A;  4RNS A;  2KLF A;  3VVE A;  2HAU A;  2I4B A;  4PFU A;  2REG A;  1LCT A;  2ZYM A;  3B6W A;  3SDF A;  2H98 A;  3EQ1 A;  4JBZ A;  4O3A A;  3H6U A;  3FVG A;  2ZYN A;  3K0V A;  4Z7E A;  4M4G A;  1IIT A;  1HSE A;  3TAJ A;  1N3X A;  4KYE A;  2O51 A;  1A40 A;  4THI A;  3DP4 A;  1FCK A;  3BFT A;  1Q35 A;  4GQO A;  2F6P A;  3RUM A;  3TUS A;  1B3G A;  1ELJ A;  2R71 A;  2XHD A;  4FEC A;  4Q0C A;  4LUB A;  1SW2 A;  4DZ1 A;  3JZJ A;  1B5H A;  3KN8 A;  5H8S A;  3FGS A;  4F3B A;  5K2X A;  2F97 A;  4PET A;  4NED A;  3IOU A;  4YIC A;  5JEI A;  3TZA A;  2W7Y A;  1YCJ A;  3HHG A;  2RC9 A;  4LON B;  3A3C A;  2LAO A;  2DQV A;  5BUU A;  3CVG A;  4ZEC A;  4NWD A;  3RT6 B;  4YB7 A;  4IY5 A;  1B6H A;  1OLA A;  1MPC A;  2OBG A;  2Z8F A;  1R6Z A;  4PP0 A;  1N04 A;  3CG1 A;  1ZLQ A;  2OZZ A;  4ZE9 A;  4R9F A;  2NVU B;  4RK9 A;  4E0W A;  3G3H A;  5CRY A;  4DXC A;  4G8N A;  4ELP A;  4R2F A;  4DE8 A;  1MG1 A;  4F1Y A;  2X7P A;  3RN8 A;  4BDN A;  5KCJ A;  1O7T A;  2OWS A;  3KN7 A;  1JET A;  1Y4C A;  4MLV A;  1Y1M A;  1UTH A;  4R6K A;  1JVY A;  3O29 A;  1CE2 A;  3RLF E;  3CG3 A;  2O1L A;  4BLA A;  3IOT A;  4G68 A;  1AL3 A;  3KJT A;  4MLQ A;  3SKP A;  1YPN A;  3ZKK A;  3TCH A;  3A09 A;  3SER A;  3TEP A;  1FTJ A;  3LSL A;  2QJE A;  4OTE A;  3TQL A;  4H8I A;  4U2R A;  2Q9T A;  2DWJ A;  4OES A;  2XXI A;  2ZYK A;  3VV5 A;  3U72 A;  2P2A A;  1II5 A;  1UTB B;  2QMW A;  1B3L A;  2I58 A;  2THI A;  4AB5 A;  1MXW A;  4QSE A;  3N5L A;  3FIR A;  3QIM A;  3K1M A;  1B52 A;  4NF5 A;  3VE1 B;  2RCB A;  3TEL A;  3U8Q A;  2ANJ A;  4RA1 A;  4LP2 B;  2XXU A;  5I58 B;  3TCG A;  1A8E A;  3T22 A;  4NMY A;  4UAC A;  1MQD A;  4WXJ A;  1US5 A;  2XX9 A;  1P1U A;  1MRP A;  1A55 A;  4P11 A;  1JNF A;  4JDF A;  1ANF A;  1SD3 A;  2A5S A;  3I5O A;  4IB2 A;  4DXB A;  5DEX A;  3K2D A;  2ZMB A;  3IB0 A;  4F1U A;  4NF6 A;  2PT2 A;  4C0R A;  3C31 A;  3UOR A;  2AYS A;  3KG2 A;  2VD2 A;  1S50 A;  1IQ7 A;  1N84 A;  5DVI A;  2R9J A;  3QK6 A;  4FED A;  2Q2C A;  2O7I A;  5FTI A;  1LGB C;  3DM0 A;  4F3S A;  1D9Y A;  3B6Q A;  1LBC A;  2HAV A;  4IY6 A;  2PT1 A;  3EHU A;  4G4P A;  3T9V A;  1UIV A;  3FVK A;  4GFR A;  5M2V A;  1EZO A;  2PVU A;  5ITP A;  4XXU A;  2DWH A;  3VFJ A;  1GGG A;  1Y3P A;  5AA3 A;  2Y84 A;  3OMB A;  3L6H A;  1AMF A;  1P1O A;  3IOR A;  4JWO A;  3CI8 A;  4GL8 A;  1XVX A;  3MP6 A;  1A7L A;  3K4U A;  2Y7R A;  4FAT A;  3O66 A;  1WDN A;  1SYH A;  1XS5 A;  2FYI A;  1UQW A;  3O97 A;  1EU8 A;  3MW0 A;  3TTM A;  4ZEI A;  5J1D A;  2UVG A;  3T9X B;  4H67 A;  1O63 A;  3OEL A;  3O28 A;  1URS A;  2O69 A;  3UA8 A;  3E9X A;  3EF7 A;  4GLI A;  1USY E;  1XVY A;  2XXV A;  1CB6 A;  4QRZ A;  3PPR A;  5DTB A;  5AA1 A;  1IXC A;  3C36 A;  4YU0 A;  5AA4 A;  3S9M C;  1P99 A;  2O7U A;  1VR5 A;  1B5J A;  4H1X A;  1M5B A;  5TU0 A;  3OEK A;  3TFL A;  3WAF A;  5IAI A;  1PB8 A;  5AA2 B;  3KOT A;  3UK4 A;  5H8N B;  3PMX A;  1YAE A;  4GVO A;  4OMB A;  3CSB A;  4OFO A;  3KOS A;  3C33 A;  1R9L A;  4ZE8 A;  1MS7 A;  4JWY A;  3N26 A;  2AL4 A;  3S9N C;  3OXN A;  3OD7 A;  3IOW A;  4NE4 A;  4EXL A;  4MBP A;  3H6W A;  3OEN A;  1AIV A;  1FQE A;  2ZNT A;  3MZB A;  4TQU Q;  3PMW A;  4FEB A;  3K6X A;  3H6V A;  4QHQ A;  2A5T B;  4BDM A;  1I6B A;  1UIU A;  4JB7 A;  2V3U A;  1Y20 A;  1MQI A;  2QS2 A;  4PQJ A;  1B3F A;  1IUD A;  4PE5 B;  3BFU A;  2QS4 A;  4MFI A;  4TLL B;  2Q88 A;  1UTB A;  1B5I A;  3IL1 B;  2QSX A;  4QFL A;  1A8F A;  2QRY A;  3TQW A;  4HTG A;  3BBR A;  1L5T A;  5LOM A;  3U93 A;  4YMB A;  4KR5 A;  1NKX A;  4KYD A;  1MXY A;  4ZDM A;  3C34 A;  1RKM A;  4K3F A;  4ELQ A;  3VLW A;  3LC8 A;  3H7M A;  4GXA A;  5I58 A;  4ZED A;  3VDF A;  2ONR A;  3W9W A;  4YB6 A;  1LFG A;  4WEP A;  1XC1 A;  5I59 A;  1VSO A;  1MQH A;  1OIB A;  4OWD A;  2GHA A;  5ICQ A;  5TP9 A;  4BDR A;  4OZ9 A;  4RPO A;  3LR1 A;  2DWI A;  2CZL A;  2O68 A;  1TFD A;  5JK4 A;  4ELR A;  1ZMG A;  2H99 A;  5CMK A;  4RY1 A;  3LSX A;  4OYV A;  1MY2 A;  3PPP A;  4GWO A;  1TT1 A;  5H8Q B;  3TTK A;  3V5A A;  4OVJ A;  4ESW A;  3N94 A;  5HBC A;  5ISU A;  1VFD A;  1NFT A;  3MQ9 A;  1ZBM A;  4ISU A;  2Z8D A;  3MAM A;  4PFT A;  3ODB A;  2O84 X;  1P1N A;  5AE4 A;  1FQD A;  1GTK A;  4DCX A;  4OFL A;  2IEE A;  2F6G A;  3MP1 A;  3S2V A;  3THI A;  5KDT B;  4Z0I A;  2XX8 A;  4C1T A;  2O1M A;  4QFN A;  4PFW A;  4ZZA A;  4FOR A;  4F29 A;  3IJX B;  2V84 A;  2F5X A;  1DPP A;  1SDX A;  4G8H A;  1ZU0 A;  1I6Q A;  4NF4 A;  1LBB A;  1ATG A;  1MPD A;  3HCQ A;  5CI5 A;  4F3P A;  3S4U A;  5JTY B;  1B7H A;  3O6G A;  4F2Q A;  3PUZ E;  4P0I A;  3O6I A;  5H8H A;  2AL5 A;  2OK2 A;  3U92 A;  4R9G A;  1JQF A;  3M3L A;  1KWH A;  4EUO A;  3HST A;  1I69 A;  1MY1 A;  3P7I A;  4QFP A;  3OOA A;  2F7A A;  4H5G A;  3QUF A;  3K00 A;  2E0S A;  4YMA A;  3ECR A;  2DE2 A;  3HO7 A;  4OHN A;  3U1O A;  1NNK A;  3QXM A;  3TDJ A;  4IO5 A;  4Q8R A;  1DMB A;  5BWJ A;  5AA2 A;  2QS3 A;  5L8D A;  1MDQ A;  1B4Z A;  1MM6 A;  4N07 A;  4U4S A;  2UVJ A;  2YJP A;  2I6E A;  1LAF E;  1BLF A;  4ONY A;  4C1U A;  3B7D A;  4F19 A;  5HPQ A;  2VGQ A;  3FJ7 A;  2GHB A;  1QUK A;  4L17 A;  4EF2 A;  4JXI A;  3G3J A;  5CMC A;  2ZNS A;  4XTC Q;  2OWT A;  3RT8 A;  4U4X A;  5AA2 D;  3G3F A;  2I0B A;  3DP6 A;  3MZ9 A;  3TMG A;  1OVB A;  4LZ5 A;  3FXQ A;  3Q26 A;  5TPA A;  4GRK A;  3D4C A;  2R6G E;  1SI1 A;  2B3F A;  2VP1 A;  1FTK A;  5DVF A;  3DP8 A;  3K6W A;  5I2N A;  3PPQ A;  5DYH A;  4LQ5 A;  3Q28 A;  5I56 B;  4QF9 A;  1IEJ A;  3MUQ A;  1N7W A;  4X48 A;  1USY H;  1OVT A;  4X1D A;  1JW4 A;  2ESN A;  1D3K A;  4R6H A;  2I0C A;  3R26 A;  5CMM A;  4IO7 A;  3RTW B;  2ONK E;  3OO7 A;  1RYX A;  2Y7K A;  3OO9 A;  3TTR A;  1LFH A;  3FV1 A;  2I3V A;  3OO8 A;  4RPN A;  4XIG Q;  3VVF A;  2GRV A;  3BKI B;  5H8F B;  2F8D A;  2V3Q A;  4I1D A;  2Y7I A;  5A5X A;  1MPB A;  4YKK A;  2XX7 A;  3PUV E;  3LSF B;  1NMU A;  1B7U A;  5I2K A;  1NH8 A;  3D4G A;  4YAH X;  2REJ A;  3Q29 A;  1Y4T A;  2RCA A;  2FA7 A;  1N7X A;  1SYI A;  2DE4 A;  1ZTY A;  4NTL A;  4YZZ A;  1GR2 A;  4EQ7 A;  5L9O A;  3HN0 A;  2NOO A;  1M5F A;  5FTH A;  1LAH E;  3G3G A;  2NWJ A;  1DSN A;  3SEV A;  1Y1Z A;  4Q30 B;  2OLB A;  4KD5 A;  3GZG A;  1JEV A;  3KJ7 A;  1IXG A;  2PBW A;  3PUW E;  2ZNU A;  4KCC A;  3CSG A;  1TXF A;  4RYA A;  1R1N A;  1ZIU A;  4R2B A;  3S9L C;  4FAJ A;  1FQA A;  3H6T A;  4IO3 A;  3B6T A;  1DTG A;  3H06 B;  1IXH A;  3C4M A;  1JW5 A;  3I6V A;  3IJO B;  1OQH A;  2X26 A;  3LBS A;  4UA8 A;  3RNN A;  1IIW A;  3IOV A;  1MH3 A;  2F35 A;  4N13 A;  1SBP A;  3K1P A;  2DP8 A;  4X9T A;  1QJM A;  1Y3Q A;  4H6D A;  3ILU B;  4OEU A;  3TCF A;  2Q89 A;  3SEY A;  1BTJ A;  1BIY A;  5JTY A;  4OEV A;  4LVQ A;  1N76 A;  4QSC A;  2DWA A;  2BJJ X;  5K2Y A;  1FQC A;  1FTM A;  1N3W A;  3WAE A;  3TKD A;  2F7B A;  1QUL A;  3QAX A;  1XHY A;  2G29 A;  3KZG A;  3A3U A;  1VE4 A;  1URD A;  1ZJL A;  4R72 A;  1SVX B;  1LAX A;  2HZL A;  1US4 A;  5F7V A;  2OCU A;  1B51 A;  1LB8 A;  2HCA A;  1WOD A;  3M3F A;  3GBB A;  3ZSF A;  3PUX E;  2OJT A;  2YLN A;  4LZ8 A;  1URG A;  1MXZ A;  2PX1 A;  1QVS A;  1JVX A;  4LQ2 A;  4OQO A;  4OET A;  4HCW A;  5CMB A;  4NF8 B;  5DVJ A;  1P1W A;  1MQG A;  3MZ1 A;  4FE8 A;  4ZS9 A;  2ZXT A;  2UXA A;  3N6U A;  5KCJ B;  1SW1 A;  3TOD A;  3E3K A;  1B58 A;  2GH9 A;  4EQ9 A;  3G7W A;  4G68 B;  1SW4 A;  4QFK A;  4POX A;  1MXU A;  4KHZ E;  2V3T A;  5I57 B;  4YKP A;  1EZP A;  5ELV A;  4JWX A;  3MJN A;  2DVZ A;  2CMO A;  4G77 A;  2F34 A;  1MM7 A;  4OEN A;  1BKA A;  1OQG A;  2H5Y A;  2XXR A;  5IKB A;  2F7C A;  4NWC A;  3ZS6 A;  4H0W A;  3K6U A;  4EQB A;  3L6G A;  4N6P A;  3GLB A;  3U94 A;  1BP5 A;  1R9Q A;  4GL0 A;  1AH5 A;  3KGC A;  4U1O A;  3G3K A;  1XOC A;  2V25 A;  4NF5 B;  1F9B A;  4BDO A;  5H8F A;  1B7Z A;  3VXC A;  1B46 A;  2VHA A;  1PBP A;  2WKY A;  3CIJ A;  1J1N A;  4IO4 A;  3MVY A;  5F1Q A;  1NH7 A;  4IO6 A;  4IO2 A;  4KI0 E;  1MXV A;  2ZYO A;  3G3I A;  2IA4 A;  2DOJ A;  1H3D A;  3KFM A;  4ZEF A;  1XT8 A;  2XD2 A;  4ZEK A;  1FQB A;  1PBQ A;  1WVJ A;  4E0X A;  5ITO A;  1D9V A;  5DEX B;  2H9B A;  2YPN A;  2Y7W A;  4NF6 B;  1B0L A;  1N0T A;  2G93 A;  1B1X A;  3K02 A;  2Y7P A;  1PEB A;  3LUY A;  3PPO A;  3FJG A;  2PYY A;  3T66 A;  3C35 A;  3V83 A;  4M1V A;  3MP8 A;  1MH4 A;  1DPE A;  1B1H A;  4HS7 A;  4DXU A;  1FW0 A;  2RC7 A;  2RKM A;  4F1V A;  4WED A;  1ZKB A;  3IR1 A;  3T93 B;  1M5E A;  4XKR A;  5L9M A;  2PMS A;  1QKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...