4C1TA

Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. lactis bl-04 in complex with arabinoxylotriose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
396
structure length
396
Chain Sequence
DDKTITFWHNASAGEGRQYWENLAKSFEEANPGTKVEIQAIQNEDFAGKLQTAMQDPASGPDVFMSLGGAKTKEMIDAGQVMDLTDKISDTVKTDMKTTLSAATFDGKVYGVPVSVEPGGMWYSKDLFKKAGVSDVPATYEELLADAKKLKDSGTDAIALGAKDAWPAAHWYYWLVLRECSPEVYDKSVQDHDFSNACWVNAGKKLQELKDLKVFNDGFLTTTAQQGANSSAGLLANHKAAMELMGAWEPGVLKDLTPDQKPMADLGFFAFPEVAGGEGEPGALMGGVTYFCVNPKASQTSIDFVNYMGEKKNQEDYAKAFSTIPASEPARAVVTDESLKQVIEYLDKAPSMQLWMDTALGTNIGNALNAAVVNMLSGQGSPEDIVKAMQDAAQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Arabinoxylo-Oligosaccharide Capture by the Probiotic Bifidobacterium Animalis Subsp. Lactis Bl-04
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Transport protein
molecule keywords SUGAR TRANSPORTER SOLUTE-BINDING PROTEIN
total genus 132
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4c1tA02
4H65A 4JWYA 1MY3A 2ONSA 4MLVA 2Q2CA 3C9HA 2I0BA 3FXUA 3IO4A 3BFUA 3K01A 1O7TA 4U2RA 4P0GA 4ELRA 1AOVA 3LUYA 2V3UA 4F1YA 1P1QA 3C35A 4PE5B 3N6TA 1T0KA 1O63A 3I3VA 3FUZA 3QSLA 1LCTA 2PT1A 1OQHA 3JYRA 3VDFA 1SW4A 4YAHX 3WAEA 5CBSA 2DE2A 5H8HB 4OWDA 2VD2A 5CBRA 3ECRA 3O29A 4E0XA 1IEJA 1B58A 4ESWA 3FZVA 3DP6A 3HPIA 4G8MA 5M2VA 1MDQA 1VE4A 2O1LA 3K2DA 2QS1A 2H5YA 1XOCA 1YAEA 1SYIA 3B7DA 3DLNA 3O28A 4NTLA 3P7IA 5L9SA 2THIA 3PV0E 4NF6A 5KDTA 3CVGA 3DP4A 1B46A 4LZ8A 1TWYA 3RT6B 3MBPA 4H6DA 1A7LA 3K1MA 3QUJA 4GL0A 3QUFA 4JXIA 1NH8A 5H8NA 1FTLA 3RLFE 1WVJA 3IOUA 3TUSA 2YPNA 3CG1A 3G3JA 4UACA 5A5XA 2FYIA 4OERA 4U4SA 1N7XA 3LBSA 3BBRA 4LONB 4G4PA 4XXUA 4ECFA 5I56B 1A8EA 1SW1A 1FQBA 3IORA 3D4GA 1URSA 2Q9TA 2A5TA 3FATA 3MZ1A 3PPQA 4GQOA 4RNSA 1H43A 4XKPA 3S2VA 3TCFA 5H8FA 5TPAB 1JNFA 4P11A 3G3GA 4THIA 5DVJA 1Y3QA 1OVTA 5L8DA 3TQWA 4Q30B 3E9XA 5KZTA 4IO6A 2OCUA 2FA7A 4Z7EA 2E0SA 1Y3PA 3M3FA 4OVJA 2X26A 4NE4A 1PB7A 4XKNA 4I62A 3JV9A 3PMXA 2VGQA 5I58B 5I59B 5JEIA 1DPEA 1N04A 1ZU0A 3I5OA 4LZ5A 4PQJA 1NNFA 1ZBMA 4YU0A 5TP9A 4EDPA 4OMBA 4PFYA 3PU5A 1MQGA 2I0CA 4F3GA 1MRPA 1URGA 4TQUQ 1MPBA 1MQIA 4TOZA 5H8QA 3RN8A 4DZ1A 2HCAA 2W7YA 1MY2A 4EQ7A 1YTVA 3MVZA 2QL3A 4KR5A 4IO4A 5DT6A 4ZEKA 3VVEA 2I48A 3GBBA 3Q25A 5I56A 1S9TA 1RYOA 3OOAA 1EH3A 1MM7A 3HSTA 1ATGA 4FIMA 3T66A 4OEVA 1S7YA 3OSRA 5L9OA 2GFEA 3O9PA 2Z23A 3K00A 3USDA 4R73A 3VE1B 2RC9A 4R9GA 4LA9A 2H9BA 3PD9A 5AA4B 3FJGA 2F36A 4DXBA 1MXXA 3MC2A 4H0WA 4RY1A 3TEPA 2V25A 1B6HA 1B9JA 1SVXB 3G3KA 3V5AA 3IAZA 3KFMA 1GTKA 1B1HA 2O51A 3RNNA 4FAJA 2HQ0A 4R6YA 3M8UA 4U1ZA 5DYHA 2NVUB 3RTWB 4U4XA 4N07A 1VR5A 2QRYA 4DCYA 2DWAA 3JZJA 3K1NA 3LSWA 3U92A 4NF8B 2ESNA 1JW5A 3MVXA 2QS4A 1GR2A 2ZNSA 4O3CA 3IB2A 1MM6A 1PDAA 1QKBA 1SYHA 3M3KA 4HW8A 5I2NB 5I58A 5I59A 1LAGE 3O66A 3GBAA 1MPDA 3FVNA 4YKKA 1XHYA 4WXJA 3HV1A 3O6HA 1R9QA 2H25A 2Y7KA 3TKDA 2ABHA 1MQDA 2F7BA 5IAIA 3PUYE 4KCCA 3QIMA 4JSDA 4IO7A 1B2HA 4ZE8A 4KYEA 5TPAA 1Y1ZA 3PMVA 3T9HB 2A5TB 3EHTA 3UA8A 4EUOA 2ALUA 1DTZA 2DVZA 4F2OA 2ZYOA 2P2AA 1BP5A 2XXXA 4YB6A 1AMFA 2V3QA 4BDOA 4YKPA 5CMMA 4DXCA 3LR1A 3Q26A 2Y7RA 1M5BA 1GGGA 2XXUA 3UORA 2ONRA 2HAVA 1Y4TA 1Y3NA 2DWJA 1LGBC 4OQOA 4U1OA 4GF8A 3SETA 3H6UA 1IUDA 2IA4A 1UTBB 1B40A 1DPPA 5HPQA 4HS7A 3VLVA 4TLMB 4YB5A 4YICA 1PC3A 3MP1A 2OWSA 5DEXA 1B05A 2WKYA 1QVSA 1R1NA 3MAMA 4FEDA 1NFTA 3FXRA 4WKMA 5AA4A 4PETA 5FTHA 4DE8A 4RPOA 4PP0A 5F1QA 2Y7IA 2DSFA 1WDNA 3IO6A 1MQHA 2RC8A 5H8HA 4ND9A 1F9BA 2Z8DA 2HZLA 3C36A 3L6GA 1FTJA 3H7MA 4PFWA 5FTIA 4BLAA 1IQ7A 4XKQA 2FNCA 4QSCA 3K6WA 5I2KA 4NWDA 1LB9A 3QAXA 3U1OA 4DDDA 1MS7A 2O7IA 3H6VA 2G29A 1H45A 2XXQA 2ZXTA 3CRBA 3PUXE 4GXSB 3TFLA 5ICTA 1LBBA 5I2KB 2QS3A 2DE3A 3EN3A 4Q5TA 3K4UA 3SEYA 1IITA 4UA8A 1B4ZA 2ZNUA 3SERA 2DVCA 2Y7PA 3EPEA 1IZ1A 1MG1A 1MXUA 4H67A 3IL1B 3KOSA 3FVOA 4EF1A 5KCJA 1SBPA 3QXMA 4FJPA 3OSQA 2DOJA 3OO9A 1LFIA 3OD7A 4NF8A 1AH5A 1A8FA 1LAXA 2O84X 3CSBA 4OESA 4X48A 4X9TA 3RTFB 4OEUA 3SEXA 4OXVA 1SQYA 1MXYA 4QF9A 1N3WA 1II5A 1FTMA 1JW4A 1NL5A 3GZGA 2AL5A 4G77A 4JSOA 3VXCA 1DSNA 1S50A 4QSEA 2XXVA 3MVYA 2AYSA 4C1UA 4P0IA 2F6GA 3RT8A 2XXYA 3R6UA 2REGA 1EZPA 3U93A 1LLSA 1N7WA 3UIFA 4DLDA 5EYFA 3V83A 1H44A 1UIVA 3PUZE 3ONMA 3O97A 3MQ9A 3T96B 2XXPA 2GHBA 2B65A 2F97A 4L17A 4NF4A 3TZAA 2PVUA 1OQGA 1P1OA 3A09A 3CSGA 4O3BA 1QW0A 2F35A 1JVYA 3G3IA 1FQAA 4KHZE 1B3EA 2NUVA 4KYSA 3E3KA 4IGRA 4NF6B 4F39A 2OK2A 1XC1A 2BJJX 3CG3A 4U21A 2RKMA 1H76A 1DOTA 1JVXA 2RINA 3F11A 3G7WA 2G93A 4GL8A 4H5GA 4IY5A 4R75A 1IXIA 4R9FA 4QRZA 4ZEBA 1GVCA 4RXLA 5EHMA 3H06B 3TTLA 1B1XA 4KD5A 4EXKA 4R2BA 1M5EA 3C33A 1PB9A 3H4ZA 4RK9A 5IKBA 5CMCA 4RJZA 1FW0A 3KOTA 3H3GA 2I4BA 1POY1 1XS5A 2DQVA 3MUQA 2RC7A 4MF3A 4BDRA 4ZZAA 1QUIA 1Z7NE 2XHDA 1QUKA 4ELOA 1P1UA 2XXWA 1CE2A 2V84A 2XX8A 3MP6A 4GFRA 4QFLA 5CRYA 3TMGA 4F1VA 4F3BA 3I6VA 4H1XA 3ZS6A 5A5XB 3IJOB 1N3XA 2RCAA 2ANJA 1SDXA 3W9VA 5H8NB 2DXRA 1LAFE 3OEMA 4FECA 4X1DA 4ESXA 1NNKA 3R26A 3EF7A 3FD3A 3SEWA 2Q8JA 3DM0A 4NWCA 1FTOA 3TYHA 4EXLA 5JTYA 3CIJA 2REJA 1ZJLA 5K2YA 3KJ7A 1EZ9A 4G68A 3N5LA 2DYXA 4M1VA 4OETA 2UXAA 1J1NA 2XXIA 1P1WA 4OYVA 5ICQA 3CFZA 4U22A 1EU8A 1YPNA 3E4RA 4KPTA 4NMYA 1I6QA 4OENA 4QHQA 5ELVA 1R6ZA 2VP1A 5AA2D 3IX1A 2DWIA 2OBGA 3MPLA 3V8XB 1ZLQA 3MW0A 4QFKA 4EQ9A 2F78A 1US4A 4QFPA 3UN6A 3VXBA 4JWOA 5I57B 2F7CA 4GOTA 2QSXA 2CMOA 3KBRA 3U94A 3W9WA 2PMSA 2QPQA 1MH3A 3PUWE 1CB6A 4LZ7A 4MFIA 4ONYA 4TLLB 1NKXA 3RGYA 3TELA 4QFOA 3FGSA 2M8CA 4MBPA 2VOZA 4PFTA 5CM6A 1FQEA 4I1DA 4OFOA 1B7ZA 1B5IA 1IXGA 2B3BA 1LFGA 1B32A 2R6GE 5B70A 2DS9A 1B5HA 1MXVA 1XVXA 4F18A 1N0TA 3SESA 3K1PA 4YZZA 4ZECA 2Y84A 1TT1A 3TDJA 2OLBA 5ITOA 1OLCA 1Y20A 2AIXA 3OO8A 2D5WA 2NXOA 4ZS9A 1B0LA 3O2AA 1MPCA 1B3GA 1BLFA 2XXHA 3D4CA 2GRVA 3PGFA 1JEVA 1P99A 5EHSA 2KLFA 3BKIB 3PD8A 3R7XA 5AA2B 1JETA 2I3VA 4IO5A 1HSJA 3UGWA 1D4NA 1B4HA 1PBPA 3O6GA 3Q27A 1VSOA 3WAFA 2XX7A 1PB8A 3FVKA 3UK4A 3ZKKA 5I84A 1JQFA 4F2QA 1FQFA 4YKJA 4OHNA 4POXA 1TFDA 4GRKA 3FVGA 4FORA 4U23A 1UIUA 4R2FA 1MY0A 1FTKA 4IO2A 1NMUA 5BUUA 3MZ9A 3TAJA 3CR9A 1B0HA 3CFXA 3KEIA 1DMBA 2P1SA 2OZZA 1ZTYA 1B3FA 3VVDA 4I9DA 3KSJA 2Z8FA 3FIRA 2F7AA 3FXQA 4ZZEA 3K02A 1AL3A 4AB5A 2NWJA 4ZDMA 2DXYA 2I4CA 1QJMA 2O1MA 3HN0A 3TODA 5JK4A 3IK6B 4FEBA 2R9JA 3Q28A 3PPRA 3TPAA 4YKIA 1B5JA 4HCWA 4JWXA 4KFQA 5CC2A 3A3UA 1HSEA 5LOMA 3N26A 3T9XB 1PEBA 4NF5A 3GXAA 2PX1A 3N94A 2GH9A 3MP8A 3VLUA 1AIVA 5FHOA 2Y7WA 3U72A 2UVJA 3C4MA 3U8QA 1Z7ME 2QS2A 2DE4A 3CI8A 1D9VA 4NEDA 3HHGA 3OXNA 2XXRA 3RUMA 5B7DA 5FHMA 3OEKA 1B51A 1SI1A 1US5A 3IB0A 3KZGA 1UTHB 3G3FA 4R72A 2R71A 3RQTA 1URDA 4RA1A 1MQJA 5ITPA 4FE8A 1SW2A 3IB1A 2Q88A 5J1DA 1OVBA 1VFDA 4F3SA 3KG2A 4F3PA 4YMAA 4X1BA 3OO7A 2O7UA 3KN8A 4I8CA 1R9LA 1B52A 3B6WA 2VHAA 1ZMGA 2DP8A 2F5XA 5CMBA 4LVQA 5AA1A 3IJXB 2YLNA 3ODBA 3KN7A 1Q35A 2UVIA 4RYAA 3S4UA 3TCHA 3B6QA 5DEXB 1LB8A 1IXCA 3T22A 4IGTA 1B7UA 5H8QB 4OZ9A 4BDLA 1MXWA 2I3WA 2I58A 4KQPA 5DVFA 1L5TA 3THIA 5BWJA 4GD5A 3VFJA 4GWOA 2UVHA 2Q2AA 2RCBA 4WEDA 1BIYA 2H98A 3K6VA 2ZYMA 3M3LA 3E13X 1UTHA 4G2ZA 4Q8RA 4JDFA 1FQCA 3OO6A 5KCJB 4R6KA 2H99A 1GV8A 1Q1KA 1JW1A 2P0SA 3S9NC 4OTEA 1JEUA 1B3LA 2ZYNA 1P1NA 3KJTA 4F19A 4Q0CA 4EF2A 1SD3A 1WODA 4PFUA 1IIWA 1RKMA 3VLWA 4ISUA 3FJMA 3SDFA 4DXUA 4NF5B 3MPKA 1LBCA 2RF1A 2OWTA 2DWHA 3TQLA 3B6TA 5ISUA 3ZSFA 3T9UA 4LQ2A 1I6AA 2B3FA 3T93B 5I2NA 5I57A 5HM4B 4OFJA 3VV5A 4YMBA 1LAHE 1HSLA 2D3IA 1A40A 2HZKA 4G8NA 2Z8EA 1Y4CA 2F6PA 3FV1A 1YCJA 1SI0A 4OFLA 1NNPA 1NH7A 1OLAA 2XD3A 3FJ7A 1ZIUA 4BDQA 2O6AA 3K6XA 2HAUA 2NOOA 4DIGA 3LC8A 3EQ1A 4Z0IA 3IOWA 2XD2A 1M5DA 2GHAA 1USYH 4G68C 4YB7A 3HHFA 3SEUA 2XX9A 3GLBA 1B3HA 3QYTA 3IOTA 4QSDA 2F8DA 2QMXA 2A5SA 1I69A 2UYFA 5JTYB 4ELQA 1UTBA 3C34A 3CFLA 1EZOA 1PBQA 3PUVE 4IB2A 4ZEDA 5DTBA 3SKPA 4ELPA 1BKAA 4NF4B 4AB6A 3C32A 4GLIA 3LSFB 4LP2B 2CZLA 2PBWA 1XT8A 4GVOA 3MJNA 3FV2A 5TU0A 4QFNA 3KN3A 2I6EA 3RY3A 1NNTA 4O3AA 1LSTA 1N76A 4H5FA 5F7VA 1MY1A 2QJEA 4KCDA 5FHNA 3MZBA 4GXAA 3IR1A 3KGCA 1D9YA 3HCQA 1Y9UA 3O6IA 3TTMA 3IOVA 4AQ4A 2H4IA 2ZMBA 3TTKA 3PMWA 4IO3A 5K2XA 5CMKA 3K6UA 3MVWA 1QUJA 4K3FA 5TP9B 4F22A 3UP9A 3QK6A 4G8HA 2O68A 3DP8A 3K0VA 4LQ5A 1MDP1 2E1SA 3RPWA 3N6UA 3OELA 4H8IA 4MH5A 2ONKE 2HXWA 1TFAA 3C31A 2D21A 2Q89A 2V93A 1I6BA 1A99A 2X7PA 1QKAA 3ILUB 1FQDA 3BFTA 3PPOA 4KI0E 3ILTB 3OENA 2XXTA 4F1UA 1VFEA 1ZKBA 5H8SA 2V3TA 1LCFA 1SW5A 1FCKA 3V89B 2ZYKA 4MLQA 1Y1MA 3L6HA 3OMBA 2Z22A 5H8FB 3TCGA 4LATA 4XIGQ 4DCXA 4FATA 3S9EA 1O64A 1MY4A 2YJPA 5HBCA 3W15C 4E0WA 3S9LC 2UVGA 2LAOA 3PPNA 1USYE 4XKRA 4ZE9A 1ANFA 1LFHA 4HTGA 1UQWA 1DTGA 3FASA 1D3KA 2UYEA 5CI5A 3EHSA 1QULA 3H6WA 3DELB 3T9VA 4BDNA 1M5CA 3MWBA 4GIZA 4ZEFA 3EHUA 4WEPA 4KYDA 4IY6A 4F29A 2IEEA 5AA3A 5KDTB 3H03A 3H6TA 3HO7A 4POWA 1POTA 3TTRA 4XTCQ 1OIBA 2VD3A 4G68B 3LSLA 4JB7A 4RK2A 5AE4A 1OMPA 2PYYA 3A3CA 5AA2A 3KSXA 3G3HA 2PT2A 4BDMA 1IXHA 3TTNA 4LUBA 1B7HA 2I49A 4EQBA 4C0RA 4N6PA 1XVYA 4N13A 4R74A 4RPNA 2O69A 4H8JA 5L9MA 4F31B 1ELJA 1M5FA 1N84A 1TXFA 2HFBA 2QMWA 4M4GA 1A54A 2HEUA 2OJTA 1MXZA 2F34A 2ZNTA 3Q29A 3AXFA 4JBZA 3LSXA 4R6HA 1BTJA 3PPPA 4ZEIA 3ZKLA 1MH4A 1H3DA 3SEVA 4C1TA 3S9MC 2X7QA 3VVFA 1KWHA 5DVIA 2AL4A 1A55A 4HCYA 1RYXA
chains in the Genus database with same CATH superfamily
2ONSA 4MLVA 2Q2CA 2I0BA 4U2RA 4ELRA 1AOVA 1T0KA 3FUZA 3QSLA 3JYRA 4OWDA 4PGPA 4ESWA 3DP6A 3HPIA 2O1LA 2H5YA 1XOCA 4N15A 2THIA 4NF6A 3CVGA 3FXBA 1TWYA 3QUJA 4GL0A 1FTLA 3TUSA 2YPNA 3G3JA 4OVTA 5A5XA 4XXUA 4OERA 4U4SA 1N7XA 4MNPA 4G4PA 4JVCA 1A8EA 3IORA 3D4GA 1URSA 2Q9TA 2OWZA 1Y3QA 2FA7A 3M3FA 4OVJA 2X26A 5I59B 1PB7A 2VGQA 3I5OA 4PQJA 1NV7A 3PU5A 1URGA 4TOZA 1MQIA 2OX3A 4DZ1A 2W7YA 1YTVA 3MVZA 2QL3A 4ZEKA 1EH3A 1MM7A 3HSTA 4OEVA 3OSRA 3B50A 1IMDA 2RC9A 3PD9A 3FJGA 4DXBA 1MXXA 4RY1A 2V25A 1B9JA 1B1HA 3RNNA 2HQ0A 3RTWB 2NVUB 2QRYA 2DWAA 1GR2A 1SYHA 1QKBA 3M3KA 5I2NB 5I59A 1LAGE 3FVNA 4GWSA 4WXJA 3O6HA 4H46A 2Y7KA 3TKDA 3PUYE 4KCCA 3QIMA 4JSDA 5TPAA 5I2KA 2ALUA 1DTZA 4F2OA 2V3QA 2DDKA 3Q26A 2Y7RA 1GGGA 2XXUA 1Y3NA 4OQOA 4GF8A 4X04A 3H6UA 4P1EA 1UTBB 1PC3A 2OWSA 1QVSA 1R1NA 3HFUA 4KXPA 2DSFA 5H8HA 4ND9A 1F9BA 3L6GA 4AS4A 5FTIA 3K6WA 1LB9A 4DDDA 1MS7A 4GWZA 3H6VA 4HXVA 1H45A 2ZXTA 3PUXE 4GXSB 5ET7A 5ICTA 1YXIA 3E79A 3SERA 2DVCA 4PCDA 1IZ1A 1MG1A 3OSQA 4GWXA 2O84X 3CSBA 4HE1A 3SEXA 1JP4A 1IMBA 1N3WA 1II5A 1FTMA 1EYIA 3BIGA 2REGA 4DLDA 3PUZE 2F97A 4QXDA 4NF4A 1P1OA 2QFLA 1JVYA 3G3IA 4KYSA 3E3KA 4IGRA 1XC1A 5T3JA 4H5GA 4R9FA 3TTLA 1RDZA 4RK9A 5CMCA 4DI4B 3MUQA 4BDRA 4ZZAA 2XHDA 1Z7NE 4QFLA 5CRYA 4F3BA 3E78A 1INPA 1NNKA 2Q8JA 4NWCA 1ZJLA 4M1VA 4OETA 5ICQA 5ELVA 4U22A 4NMYA 4QHQA 5AA2D 1RDYA 2Q74A 2VP1A 1ZLQA 4QFKA 3U94A 4ONYA 4TLLB 4MBPA 2M8CA 4OFOA 1DK4A 1IXGA 2B3BA 1LBVA 2R6GE 1B5HA 1MXVA 1XVXA 3BIHA 4F18A 2FIEA 4P3LA 4ZECA 2XXKA 5ITOA 1OLCA 2AIXA 3OO8A 2NXOA 4N6KA 3PGFA 1HSJA 5I3SA 2JJKA 1SPIA 3O6GA 3FVKA 4IO2A 1NMUA 1DMBA 2OZZA 4I9DA 3FXQA 5IM2A 4GX4A 2NWJA 4ZDMA 3SZPA 2O1MA 1QJMA 3IK6B 3Q28A 4JVIA 3T9XB 1PEBA 4NF5A 3VLUA 3RPLA 3U72A 3U8QA 5I7IA 1Z7ME 3CI8A 4N17A 3D1RA 3OEKA 2ZZWA 4R72A 4RA1A 1VFDA 4X1BA 2O7UA 1B52A 3B6WA 4JVDA 4N81A 5CMBA 2UVIA 3TCHA 4OA4A 3B6QA 2QVVA 1NV3A 1IMFA 5BWJA 2UVHA 2Q2AA 2H98A 1AWBA 4JDFA 3B8BA 1B3LA 1P1NA 3KJTA 1IMAA 4PFUA 4DXUA 1RKMA 3FJMA 4OVPA 2OWTA 4O7MA 4OFJA 4G8NA 1A40A 4GWUA 3FV1A 4PAFA 1NNPA 4MMPA 1OLAA 2XD3A 2O6AA 4Z0IA 2GHAA 4G68C 4OVRA 1FPLA 3QYTA 1B3HA 4ELQA 3CFLA 2WYKA 1PBQA 3PUVE 2BJIA 4ELPA 4QFNA 4PFBA 4G61A 2I6EA 4O3AA 4GXAA 4X8RA 2GQ1A 5LTCA 2H4IA 3PMWA 4GBWA 2HXWA 1TFAA 3ILUB 1FQDA 3BFTA 2V3TA 4QBAA 2ZYKA 5H8FB 1FPJA 3TCGA 4DCXA 4XIGQ 2LAOA 4XKRA 1LFHA 5CI5A 3H6WA 3T9VA 4GIZA 3MWBA 4ZEFA 2CZIA 4F29A 5AA3A 2IEEA 3H6TA 3TTRA 2VD3A 4G68B 1OMPA 2PT2A 4LUBA 1B7HA 1FBCA 4N6PA 1XVYA 4R74A 4H8JA 1ELJA 2QMWA 1N84A 1YZ0A 2HEUA 2OJTA 3Q29A 4JBZA 4MAGA 3VVFA 1KWHA 1B0HA 4HCYA 1FBFA 1RYXA 4H65A 3C9HA 3FXUA 3IO4A 1O7TA 4PGNA 4PAIA 1P1QA 4PE5B 4HE2A 3I3VA 1LCTA 1OQHA 4YAHX 1FTAA 2DE2A 5H8HB 3MYUA 3ECRA 3O29A 3FZVA 4G8MA 3K2DA 3KBZA 3KC0A 3O28A 4NTLA 5KDTA 1A7LA 3K1MA 5H8NA 3RLFE 2FYIA 3EKIA 3LBSA 1IMEA 2F3BA 3PPQA 3ZKKA 4XKPA 1H43A 5TPAB 1JNFA 4THIA 1OVTA 4Q30B 5KZTA 4Z7EA 2E0SA 1Y3PA 3PMXA 5JEIA 1N04A 4LZ5A 1ZBMA 4EDPA 4PFYA 2Y5LA 4TQUQ 1MPBA 5H8QA 4MX6A 1MY2A 5DT6A 1EYKA 4N6DA 1S9TA 1RYOA 4FIMA 4R9GA 4LA9A 2H9BA 5AA4B 3TEPA 1KA1A 4H0WA 4DI3D 1RDXA 1B6HA 1NV1A 3V5AA 2O51A 4R6YA 4U1ZA 4N07A 1VR5A 4DCYA 1G0IA 3MVXA 4O3CA 4GWYA 1K9YA 3IB2A 1PDAA 4HW8A 5I58A 1MPDA 3HV1A 2F7BA 2WX9A 1B2HA 3T9HB 1Y1ZA 2Q8MA 2P2AA 4YB6A 2PFZA 2F3DA 4YKPA 3UORA 2ONRA 2HAVA 4H45A 3SETA 2WEFA 1FRPA 3MP1A 2WKYA 5AA4A 5FTHA 4MNCA 2Y7IA 3IO6A 2Z8DA 1IQ7A 2FNCA 4UABA 4NWDA 3QAXA 3U1OA 2XXQA 1LBBA 2QS3A 2DE3A 3EN3A 5I5PA 3K4UA 3SEYA 1B4ZA 4O7IA 2MKZA 2ZNUA 2Y7PA 4H67A 3FVOA 4EF1A 4FJPA 1LFIA 1AH5A 1LAXA 4X9TA 4X48A 1MXYA 4JSOA 3VXCA 1JW4A 1FBHA 1DSNA 1S50A 4P0IA 1FPDA 1N7WA 5EYFA 3V83A 3MQ9A 2XXPA 4L17A 2KR0A 2PVUA 1QW0A 2F35A 4PF6A 4KHZE 1B3EA 3CG3A 1H76A 1DOTA 1JVXA 4IY5A 4ZEBA 5EHMA 1B1XA 4KD5A 4RJZA 3H3GA 1POY1 1XS5A 3MP6A 4F1VA 3TMGA 5A5XB 3IJOB 1N3XA 4FBPA 3W9VA 5H8NB 1FTOA 1NV4A 4EXLA 2REJA 4PBHA 5K2YA 3KJ7A 1EZ9A 3N5LA 2DYXA 2XXIA 4GX3A 3CFZA 5L8DA 3E4RA 4NGUA 1R6ZA 4QFPA 4P56A 4JWOA 2F7CA 4GOTA 2QSXA 4NHBA 2PMSA 2QPQA 5LDZA 1CB6A 5CM6A 4I1DA 1Q9DA 1B32A 5B70A 3K1PA 1TT1A 3TDJA 2D5WA 3O2AA 1MPCA 3D4CA 1BLFA 1BK4A 5EHSA 2XWVA 1JETA 3UGWA 5F24A 3WAFA 1PBPA 3Q27A 1VSOA 3UK4A 1JQFA 4POXA 4GRKA 4U23A 4MHFA 1UIUA 1FTKA 5BUUA 3KEIA 3CFXA 1B3FA 3VVDA 2F7AA 3K02A 3A29A 2I4CA 3GYYA 3TPAA 4HCWA 2FHYA 3A3UA 3N26A 3GXAA 3N94A 2GH9A 1D9VA 2XXRA 1B51A 3KZGA 3RQTA 5ITPA 5J1DA 4F3SA 4I8CA 1R9LA 2VHAA 5EQ8A 2F5XA 5AA1A 3KN7A 3S4UA 1FSAA 1IXCA 1B7UA 5H8QB 4BDLA 4KQPA 3THIA 4GD5A 3VFJA 2HHMA 4WEDA 2ZYMA 5A5LA 4PE3A 3OO6A 4PDHA 5KCJB 4R6KA 3KC1A 2P0SA 4F19A 3VLWA 4NF5B 1LBCA 3TQLA 3B6TA 1FBPA 3T9UA 4LQ2A 2WBDA 3T93B 3VV5A 4YMBA 2HZKA 2F6PA 1SI0A 4MIJA 4BDQA 3FJ7A 2NOOA 4YB7A 3SEUA 3HHFA 2F8DA 2UYFA 2XWIA 4IB2A 4NF4B 4GLIA 1XT8A 4GVOA 3MJNA 3KN3A 1NNTA 4AS5A 1MY1A 2P3NA 4KCDA 5FHNA 3MZBA 3IR1A 1D9YA 3HCQA 3TTMA 4MNIA 3K6UA 3MVWA 4K3FA 3T0JA 5TP9B 3QK6A 4G8HA 2O68A 3DP8A 3K0VA 3RPWA 2VPOA 3OELA 3C31A 1I6BA 1A99A 1YYZA 1VFEA 3L6HA 4LATA 4FATA 1IMCA 1O64A 1MY4A 2YJPA 3W15C 4ZE9A 4HTGA 4XF5A 3FASA 2UYEA 3DELB 1EYJA 4WEPA 4IY6A 3H03A 4RK2A 1FPGA 3TTNA 4C0RA 2CZHA 4F31B 5L9MA 1A54A 2F34A 3ZKLA 1BTJA 4P47A 1H3DA 1LBXA 2X7QA 5DVIA 3K01A 2R8TA 3LUYA 3C35A 3N6TA 1O63A 3WAEA 5CBRA 1IEJA 5EQAA 5M2VA 1VE4A 1YAEA 3DLNA 5L9SA 1B46A 4LZ8A 3RT6B 3MBPA 1XI6A 3QUFA 1WVJA 3IOUA 5AE4A 4NF0A 5I56B 3BBRA 4ECFA 3FATA 2A5TA 4RNSA 4P11A 3G3GA 5DVJA 3E9XA 4IO6A 1VDWA 4XKNA 3JV9A 1ZU0A 1NNFA 4OMBA 2I0CA 1MRPA 3LV0A 3RN8A 4EQ7A 3VVEA 4IO4A 4PFRA 2I48A 3GBBA 5J16A 3Q25A 3OOAA 1D9QA 1ATGA 1S7YA 5L9OA 2Z23A 3K00A 3NOHA 2P3VA 1K9ZA 3VE1B 3MC2A 4FAJA 3M8UA 5DYHA 3LSWA 3K1NA 1LBWA 2ESNA 1JW5A 2QS4A 2ZNSA 3O66A 4YKKA 1R9QA 2H25A 5IAIA 3PMVA 5ET5A 2A5TB 3UA8A 2ZYOA 2XXXA 1AMFA 5CMMA 1M5BA 1IUDA 1B40A 5HPQA 4HE0A 3VLVA 4YB5A 5DEXA 3MAMA 3FXRA 4PETA 4DE8A 5F1QA 1MQHA 4PFWA 3C36A 5IZ3B 4QSCA 2KQZA 3T1BA 2O7IA 1LBYA 5I2KB 4Q5TA 1FBGA 4UA8A 1FPIA 3EPEA 5KCJA 1MXUA 3KOSA 2DOJA 3OO9A 3OD7A 4NF8A 4OXVA 1SQYA 3TQWA 4QF9A 1NL5A 3GZGA 4XFEA 2AL5A 4G77A 4QSEA 2AYSA 4C1UA 2F6GA 2XXYA 1EZPA 2B4LA 5IGAA 3ONMA 3O97A 2GHBA 2B65A 3A09A 3CSGA 2NUVA 5ET8A 3F11A 3G7WA 2G93A 5IZZA 1IXIA 4RXLA 4EXKA 1M5EA 3C33A 1PB9A 2I4BA 5ESYA 2DQVA 1QUKA 4ELOA 2FVZA 2V84A 4GFRA 3I6VA 1LBZA 1SDXA 4PAKA 2DXRA 4X1DA 4ESXA 3FD3A 3SEWA 3DM0A 5JTYA 3CIJA 4G68A 1P1WA 1EU8A 1YPNA 4OENA 3MW0A 2F78A 3UN6A 5I57B 4GBVA 2CMOA 3PUWE 3RGYA 1NKXA 3TELA 3FGSA 2VOZA 1FQEA 1B7ZA 1LFGA 4I3YA 4PBQA 3SESA 2OLBA 1NUWA 4ZS9A 1QGXA 1B3GA 2GRVA 2KLFA 4IO5A 4PC9A 1D4NA 1B4HA 2XX7A 5I84A 1FQFA 4YKJA 3RYDA 3FVGA 4FORA 3ISPA 4R2FA 1MY0A 2XWKA 3MZ9A 3TAJA 1CNQA 4P9KA 2P1SA 2Z8FA 3FIRA 4ZZEA 2DXYA 5EQ7A 5JK4A 4FEBA 3PPRA 1B5JA 5CC2A 1HSEA 5LOMA 3MP8A 1FPKA 5FHOA 2DE4A 4NEDA 3OXNA 1SI1A 1US5A 3IB0A 3G3FA 2R71A 1URDA 1SW2A 2Q88A 1OVBA 3OO7A 1NV2A 3IJXB 2YLNA 3ODBA 1Q35A 5DEXB 1LB8A 3T22A 4OZ9A 1MXWA 2I58A 2QVRA 2XA5A 2CEYA 4GWOA 2RCBA 1BIYA 3M3LA 1NI9A 3E13X 1FQCA 1GV8A 5FBPA 4OTEA 1JEUA 4Q0CA 4EF2A 1SD3A 3RPLB 1WODA 4ISUA 3MPKA 5ISUA 2RF1A 3ZSFA 5I57A 5HM4B 1LAHE 1HSLA 2XWOA 4N8GA 1YCJA 4OFLA 1NH7A 2FBPA 3K6XA 2HAUA 2WBBA 3LC8A 3IOWA 2XD2A 1M5DA 1USYH 2VT5A 2XX9A 1FJ6A 3GLBA 5JTYB 3C34A 1EZOA 4ZEDA 5DTBA 1BKAA 4AB6A 3C32A 2CZLA 2PBWA 3FV2A 5TU0A 3RY3A 1LSTA 4AQ4A 3O6IA 3IOVA 2ZMBA 3TTKA 5CMKA 5K2XA 1NV5A 1QUJA 4F22A 3UP9A 4LQ5A 1MDP1 2E1SA 2QVUA 3N6UA 4H8IA 4MH5A 2D21A 2V93A 4ZE8A 3PPOA 1QKAA 2HXRA 2XXTA 5H8SA 3V89B 1FCKA 4MLQA 3S9EA 2UVGA 3PPNA 3EHSA 4BDNA 1M5CA 1G0HA 4KYDA 5KDTB 3HO7A 1POTA 1OIBA 5AA2A 3KSXA 4BDMA 1IXHA 4EQBA 4N13A 3IFCA 1M5FA 1TXFA 2ZNTA 4R6HA 3AXFA 4C1TA 2ZZXA 1MH4A 3SEVA 1A55A 4JWYA 1MY3A 3BFUA 4P0GA 2V3UA 4F1YA 5EYGA 2PT1A 3VDFA 1SW4A 5CBSA 2VD2A 4PTKA 4E0XA 1B58A 1MDQA 2QS1A 3B7DA 1SYIA 3P7IA 3PV0E 3DP4A 4H6DA 4JXIA 1NH8A 4N8YA 3CG1A 4UACA 4LONB 1SW1A 1FQBA 4GQOA 3MZ1A 3S2VA 5H8FA 3TCFA 4PDDA 2OCUA 5I58B 2CEXA 4NE4A 4I62A 1DPEA 4YU0A 5TP9A 1MQGA 4F3GA 2HCAA 4KR5A 4OANA 5I56A 4NQ8A 3T66A 2GFEA 3O9PA 3USDA 4R73A 2F36A 1FBDA 1SVXB 3G3KA 3IAZA 3KFMA 1GTKA 4I40A 4N4UA 4P8BA 1DBZA 4U4XA 5EYHA 3JZJA 3U92A 4NF8B 1MM6A 3GBAA 1XHYA 2ABHA 1MQDA 3V8XB 4IO7A 4KYEA 4EUOA 3EHTA 2DVZA 1BP5A 4BDOA 2L5VA 4DXCA 3LR1A 5IZ3A 1Y4TA 2DWJA 4U1OA 1LGBC 1NUXA 2IA4A 1DCUA 1DPPA 4HS7A 4TLMB 4YICA 1B05A 3PTYA 4FEDA 1NFTA 4WKMA 5IZ1A 4RPOA 4PP0A 4NN3A 1WDNA 2RC8A 2PCRA 4BLAA 2HZLA 1FTJA 3H7MA 4XKQA 4MCOA 2G29A 3CRBA 3CHGA 3TFLA 2PFYA 1IITA 3IL1B 1SBPA 3QXMA 4NX1A 3RTFB 1A8FA 4OESA 4OEUA 3UIFA 4O94A 1NV0A 2XXVA 3MVYA 3RT8A 3R6UA 2HPGA 3LUZA 3U93A 1LLSA 1H44A 1UIVA 3T96B 3TZAA 1OQGA 4MEVA 4O3BA 1FQAA 1FJ9A 4NF6B 4F39A 2OK2A 2BJJX 4U21A 2RKMA 2RINA 4R75A 4GL8A 1GVCA 4QRZA 3H06B 3QMFA 4R2BA 3H4ZA 4I3EA 5IKBA 1FW0A 3KOTA 2RC7A 4MF3A 1QUIA 1P1UA 2XXWA 1CE2A 2XX8A 4H1XA 3ZS6A 4PFIA 2RCAA 2ANJA 1LAFE 3OEMA 4FECA 3R26A 3EF7A 3TYHA 2UXAA 1J1NA 4OYVA 4KPTA 1I6QA 3IX1A 2DWIA 2OBGA 3MPLA 4EQ9A 3VXBA 1US4A 3KBRA 3W9WA 1MH3A 4LZ7A 4MFIA 4QFOA 4PFTA 1KA0A 3ROJA 1B5IA 2DS9A 1FPEA 1N0TA 4YZZA 2Y84A 1Y20A 1B0LA 2ZZVA 2XXHA 3R7XA 1JEVA 1P99A 3BKIB 3PD8A 5AA2B 2I3VA 2CZKA 1PB8A 3IFAA 4F2QA 4O8MA 4OHNA 1TFDA 3CR9A 1ZTYA 3FBPA 3KSJA 4NG7A 1AL3A 4AB5A 3HN0A 3TODA 2R9JA 4YKIA 3MSTA 4JWXA 4KFQA 4MJOA 4N91A 4GX6A 2PX1A 1AIVA 2Y7WA 2UVJA 3C4MA 2QS2A 3HHGA 3RUMA 5B7DA 5FHMA 4OVSA 1UTHB 1MQJA 4FE8A 3IB1A 4F3PA 3KG2A 4YMAA 5ET6A 4LN5A 3KN8A 1ZMGA 2DP8A 4LVQA 4RYAA 4IGTA 1L5TA 2I3WA 5DVFA 5DW8A 4GWWA 3K6VA 4G2ZA 1UTHA 4Q8RA 1FPFA 2H99A 1Q1KA 1JW1A 3S9NC 2ZYNA 2B4MA 1IIWA 3SDFA 2DWHA 1I6AA 2B3FA 2V4CA 5I2NA 2D3IA 2Z8EA 1Y4CA 1ZIUA 1FPBA 4DIGA 1NUYA 3EQ1A 3IOTA 4QSDA 2QMXA 2A5SA 1I69A 1UTBA 3SKPA 4LP2B 3LSFB 1N76A 4H5FA 5F7VA 2QJEA 3KGCA 1Y9UA 2VPNA 4IO3A 4XEQA 2WYPA 1LEVA 4IR8A 2ONKE 4PF8A 4P1LA 2Q89A 1FBEA 2X7PA 4KI0E 4F1UA 3ILTB 3OENA 1ZKBA 1LCFA 1SW5A 1NUZA 1Y1MA 3OMBA 2Z22A 2Y5KA 5HBCA 4OVQA 4E0WA 3S9LC 1USYE 1ANFA 2FIXA 1UQWA 1DTGA 1D3KA 1QULA 3EHUA 4POWA 4XTCQ 4JB7A 1KZ8A 3LSLA 2PYYA 3A3CA 3G3HA 2I49A 4RPNA 2O69A 2HFBA 4M4GA 3U65A 1MXZA 3LSXA 4ZEIA 3PPPA 3S9MC 4NAPA 5EQ9A 2AL4A 1NV6A
chains in the Genus database with same CATH topology
4H65A 4JWYA 1MY3A 2ONSA 4MLVA 2Q2CA 3C9HA 2I0BA 3FXUA 3IO4A 3BFUA 3K01A 1O7TA 4U2RA 4P0GA 4ELRA 1AOVA 3LUYA 2V3UA 4F1YA 1P1QA 3C35A 4PE5B 3N6TA 1T0KA 1O63A 3I3VA 3FUZA 3QSLA 1LCTA 2PT1A 1OQHA 3JYRA 3VDFA 1SW4A 4YAHX 3WAEA 5CBSA 2DE2A 5H8HB 4OWDA 2VD2A 5CBRA 3ECRA 3O29A 4E0XA 1IEJA 1B58A 4ESWA 3FZVA 3DP6A 3HPIA 4G8MA 5M2VA 1MDQA 1VE4A 2O1LA 3K2DA 2QS1A 2H5YA 1XOCA 1YAEA 1SYIA 3B7DA 3DLNA 3O28A 4NTLA 3P7IA 5L9SA 2THIA 3PV0E 4NF6A 5KDTA 3CVGA 3DP4A 1B46A 4LZ8A 1TWYA 3RT6B 3MBPA 4H6DA 1A7LA 3K1MA 3QUJA 4GL0A 3QUFA 4JXIA 1NH8A 5H8NA 1FTLA 3RLFE 1WVJA 3IOUA 3TUSA 2YPNA 3CG1A 3G3JA 4UACA 5A5XA 2FYIA 4OERA 4U4SA 1N7XA 3LBSA 3BBRA 4LONB 4G4PA 4XXUA 4ECFA 5I56B 1A8EA 1SW1A 1FQBA 3IORA 3D4GA 1URSA 2Q9TA 2A5TA 3FATA 3MZ1A 3PPQA 4GQOA 4RNSA 1H43A 4XKPA 3S2VA 3TCFA 5H8FA 5TPAB 1JNFA 4P11A 3G3GA 4THIA 5DVJA 1Y3QA 1OVTA 5L8DA 3TQWA 4Q30B 3E9XA 5KZTA 4IO6A 2OCUA 2FA7A 4Z7EA 2E0SA 1Y3PA 3M3FA 4OVJA 2X26A 4NE4A 1PB7A 4XKNA 4I62A 3JV9A 3PMXA 2VGQA 5I58B 5I59B 5JEIA 1DPEA 1N04A 1ZU0A 3I5OA 4LZ5A 4PQJA 1NNFA 1ZBMA 4YU0A 5TP9A 4EDPA 4OMBA 4PFYA 3PU5A 1MQGA 2I0CA 4F3GA 1MRPA 1URGA 4TQUQ 1MPBA 1MQIA 4TOZA 5H8QA 3RN8A 4DZ1A 2HCAA 2W7YA 1MY2A 4EQ7A 1YTVA 3MVZA 2QL3A 4KR5A 4IO4A 5DT6A 4ZEKA 3VVEA 2I48A 3GBBA 3Q25A 5I56A 1S9TA 1RYOA 3OOAA 1EH3A 1MM7A 3HSTA 1ATGA 4FIMA 3T66A 4OEVA 1S7YA 3OSRA 5L9OA 2GFEA 3O9PA 2Z23A 3K00A 3USDA 4R73A 3VE1B 2RC9A 4R9GA 4LA9A 2H9BA 3PD9A 5AA4B 3FJGA 2F36A 4DXBA 1MXXA 3MC2A 4H0WA 4RY1A 3TEPA 2V25A 1B6HA 1B9JA 1SVXB 3G3KA 3V5AA 3IAZA 3KFMA 1GTKA 1B1HA 2O51A 3RNNA 4FAJA 2HQ0A 4R6YA 3M8UA 4U1ZA 5DYHA 2NVUB 3RTWB 4U4XA 4N07A 1VR5A 2QRYA 4DCYA 2DWAA 3JZJA 3K1NA 3LSWA 3U92A 4NF8B 2ESNA 1JW5A 3MVXA 2QS4A 1GR2A 2ZNSA 4O3CA 3IB2A 1MM6A 1PDAA 1QKBA 1SYHA 3M3KA 4HW8A 5I2NB 5I58A 5I59A 1LAGE 3O66A 3GBAA 1MPDA 3FVNA 4YKKA 1XHYA 4WXJA 3HV1A 3O6HA 1R9QA 2H25A 2Y7KA 3TKDA 2ABHA 1MQDA 2F7BA 5IAIA 3PUYE 4KCCA 3QIMA 4JSDA 4IO7A 1B2HA 4ZE8A 4KYEA 5TPAA 1Y1ZA 3PMVA 3T9HB 2A5TB 3EHTA 3UA8A 4EUOA 2ALUA 1DTZA 2DVZA 4F2OA 2ZYOA 2P2AA 1BP5A 2XXXA 4YB6A 1AMFA 2V3QA 4BDOA 4YKPA 5CMMA 4DXCA 3LR1A 3Q26A 2Y7RA 1M5BA 1GGGA 2XXUA 3UORA 2ONRA 2HAVA 1Y4TA 1Y3NA 2DWJA 1LGBC 4OQOA 4U1OA 4GF8A 3SETA 3H6UA 1IUDA 2IA4A 1UTBB 1B40A 1DPPA 5HPQA 4HS7A 3VLVA 4TLMB 4YB5A 4YICA 1PC3A 3MP1A 2OWSA 5DEXA 1B05A 2WKYA 1QVSA 1R1NA 3MAMA 4FEDA 1NFTA 3FXRA 4WKMA 5AA4A 4PETA 5FTHA 4DE8A 4RPOA 4PP0A 5F1QA 2Y7IA 2DSFA 1WDNA 3IO6A 1MQHA 2RC8A 5H8HA 4ND9A 1F9BA 2Z8DA 2HZLA 3C36A 3L6GA 1FTJA 3H7MA 4PFWA 5FTIA 4BLAA 1IQ7A 4XKQA 2FNCA 4QSCA 3K6WA 5I2KA 4NWDA 1LB9A 3QAXA 3U1OA 4DDDA 1MS7A 2O7IA 3H6VA 2G29A 1H45A 2XXQA 2ZXTA 3CRBA 3PUXE 4GXSB 3TFLA 5ICTA 1LBBA 5I2KB 2QS3A 2DE3A 3EN3A 4Q5TA 3K4UA 3SEYA 1IITA 4UA8A 1B4ZA 2ZNUA 3SERA 2DVCA 2Y7PA 3EPEA 1IZ1A 1MG1A 1MXUA 4H67A 3IL1B 3KOSA 3FVOA 4EF1A 5KCJA 1SBPA 3QXMA 4FJPA 3OSQA 2DOJA 3OO9A 1LFIA 3OD7A 4NF8A 1AH5A 1A8FA 1LAXA 2O84X 3CSBA 4OESA 4X48A 4X9TA 3RTFB 4OEUA 3SEXA 4OXVA 1SQYA 1MXYA 4QF9A 1N3WA 1II5A 1FTMA 1JW4A 1NL5A 3GZGA 2AL5A 4G77A 4JSOA 3VXCA 1DSNA 1S50A 4QSEA 2XXVA 3MVYA 2AYSA 4C1UA 4P0IA 2F6GA 3RT8A 2XXYA 3R6UA 2REGA 1EZPA 3U93A 1LLSA 1N7WA 3UIFA 4DLDA 5EYFA 3V83A 1H44A 1UIVA 3PUZE 3ONMA 3O97A 3MQ9A 3T96B 2XXPA 2GHBA 2B65A 2F97A 4L17A 4NF4A 3TZAA 2PVUA 1OQGA 1P1OA 3A09A 3CSGA 4O3BA 1QW0A 2F35A 1JVYA 3G3IA 1FQAA 4KHZE 1B3EA 2NUVA 4KYSA 3E3KA 4IGRA 4NF6B 4F39A 2OK2A 1XC1A 2BJJX 3CG3A 4U21A 2RKMA 1H76A 1DOTA 1JVXA 2RINA 3F11A 3G7WA 2G93A 4GL8A 4H5GA 4IY5A 4R75A 1IXIA 4R9FA 4QRZA 4ZEBA 1GVCA 4RXLA 5EHMA 3H06B 3TTLA 1B1XA 4KD5A 4EXKA 4R2BA 1M5EA 3C33A 1PB9A 3H4ZA 4RK9A 5IKBA 5CMCA 4RJZA 1FW0A 3KOTA 3H3GA 2I4BA 1POY1 1XS5A 2DQVA 3MUQA 2RC7A 4MF3A 4BDRA 4ZZAA 1QUIA 1Z7NE 2XHDA 1QUKA 4ELOA 1P1UA 2XXWA 1CE2A 2V84A 2XX8A 3MP6A 4GFRA 4QFLA 5CRYA 3TMGA 4F1VA 4F3BA 3I6VA 4H1XA 3ZS6A 5A5XB 3IJOB 1N3XA 2RCAA 2ANJA 1SDXA 3W9VA 5H8NB 2DXRA 1LAFE 3OEMA 4FECA 4X1DA 4ESXA 1NNKA 3R26A 3EF7A 3FD3A 3SEWA 2Q8JA 3DM0A 4NWCA 1FTOA 3TYHA 4EXLA 5JTYA 3CIJA 2REJA 1ZJLA 5K2YA 3KJ7A 1EZ9A 4G68A 3N5LA 2DYXA 4M1VA 4OETA 2UXAA 1J1NA 2XXIA 1P1WA 4OYVA 5ICQA 3CFZA 4U22A 1EU8A 1YPNA 3E4RA 4KPTA 4NMYA 1I6QA 4OENA 4QHQA 5ELVA 1R6ZA 2VP1A 5AA2D 3IX1A 2DWIA 2OBGA 3MPLA 3V8XB 1ZLQA 3MW0A 4QFKA 4EQ9A 2F78A 1US4A 4QFPA 3UN6A 3VXBA 4JWOA 5I57B 2F7CA 4GOTA 2QSXA 2CMOA 3KBRA 3U94A 3W9WA 2PMSA 2QPQA 1MH3A 3PUWE 1CB6A 4LZ7A 4MFIA 4ONYA 4TLLB 1NKXA 3RGYA 3TELA 4QFOA 3FGSA 2M8CA 4MBPA 2VOZA 4PFTA 5CM6A 1FQEA 4I1DA 4OFOA 1B7ZA 1B5IA 1IXGA 2B3BA 1LFGA 1B32A 2R6GE 5B70A 2DS9A 1B5HA 1MXVA 1XVXA 4F18A 1N0TA 3SESA 3K1PA 4YZZA 4ZECA 2Y84A 1TT1A 3TDJA 2OLBA 5ITOA 1OLCA 1Y20A 2AIXA 3OO8A 2D5WA 2NXOA 4ZS9A 1B0LA 3O2AA 1MPCA 1B3GA 1BLFA 2XXHA 3D4CA 2GRVA 3PGFA 1JEVA 1P99A 5EHSA 2KLFA 3BKIB 3PD8A 3R7XA 5AA2B 1JETA 2I3VA 4IO5A 1HSJA 3UGWA 1D4NA 1B4HA 1PBPA 3O6GA 3Q27A 1VSOA 3WAFA 2XX7A 1PB8A 3FVKA 3UK4A 3ZKKA 5I84A 1JQFA 4F2QA 1FQFA 4YKJA 4OHNA 4POXA 1TFDA 4GRKA 3FVGA 4FORA 4U23A 1UIUA 4R2FA 1MY0A 1FTKA 4IO2A 1NMUA 5BUUA 3MZ9A 3TAJA 3CR9A 1B0HA 3CFXA 3KEIA 1DMBA 2P1SA 2OZZA 1ZTYA 1B3FA 3VVDA 4I9DA 3KSJA 2Z8FA 3FIRA 2F7AA 3FXQA 4ZZEA 3K02A 1AL3A 4AB5A 2NWJA 4ZDMA 2DXYA 2I4CA 1QJMA 2O1MA 3HN0A 3TODA 5JK4A 3IK6B 4FEBA 2R9JA 3Q28A 3PPRA 3TPAA 4YKIA 1B5JA 4HCWA 4JWXA 4KFQA 5CC2A 3A3UA 1HSEA 5LOMA 3N26A 3T9XB 1PEBA 4NF5A 3GXAA 2PX1A 3N94A 2GH9A 3MP8A 3VLUA 1AIVA 5FHOA 2Y7WA 3U72A 2UVJA 3C4MA 3U8QA 1Z7ME 2QS2A 2DE4A 3CI8A 1D9VA 4NEDA 3HHGA 3OXNA 2XXRA 3RUMA 5B7DA 5FHMA 3OEKA 1B51A 1SI1A 1US5A 3IB0A 3KZGA 1UTHB 3G3FA 4R72A 2R71A 3RQTA 1URDA 4RA1A 1MQJA 5ITPA 4FE8A 1SW2A 3IB1A 2Q88A 5J1DA 1OVBA 1VFDA 4F3SA 3KG2A 4F3PA 4YMAA 4X1BA 3OO7A 2O7UA 3KN8A 4I8CA 1R9LA 1B52A 3B6WA 2VHAA 1ZMGA 2DP8A 2F5XA 5CMBA 4LVQA 5AA1A 3IJXB 2YLNA 3ODBA 3KN7A 1Q35A 2UVIA 4RYAA 3S4UA 3TCHA 3B6QA 5DEXB 1LB8A 1IXCA 3T22A 4IGTA 1B7UA 5H8QB 4OZ9A 4BDLA 1MXWA 2I3WA 2I58A 4KQPA 5DVFA 1L5TA 3THIA 5BWJA 4GD5A 3VFJA 4GWOA 2UVHA 2Q2AA 2RCBA 4WEDA 1BIYA 2H98A 3K6VA 2ZYMA 3M3LA 3E13X 1UTHA 4G2ZA 4Q8RA 4JDFA 1FQCA 3OO6A 5KCJB 4R6KA 2H99A 1GV8A 1Q1KA 1JW1A 2P0SA 3S9NC 4OTEA 1JEUA 1B3LA 2ZYNA 1P1NA 3KJTA 4F19A 4Q0CA 4EF2A 1SD3A 1WODA 4PFUA 1IIWA 1RKMA 3VLWA 4ISUA 3FJMA 3SDFA 4DXUA 4NF5B 3MPKA 1LBCA 2RF1A 2OWTA 2DWHA 3TQLA 3B6TA 5ISUA 3ZSFA 3T9UA 4LQ2A 1I6AA 2B3FA 3T93B 5I2NA 5I57A 5HM4B 4OFJA 3VV5A 4YMBA 1LAHE 1HSLA 2D3IA 1A40A 2HZKA 4G8NA 2Z8EA 1Y4CA 2F6PA 3FV1A 1YCJA 1SI0A 4OFLA 1NNPA 1NH7A 1OLAA 2XD3A 3FJ7A 1ZIUA 4BDQA 2O6AA 3K6XA 2HAUA 2NOOA 4DIGA 3LC8A 3EQ1A 4Z0IA 3IOWA 2XD2A 1M5DA 2GHAA 1USYH 4G68C 4YB7A 3HHFA 3SEUA 2XX9A 3GLBA 1B3HA 3QYTA 3IOTA 4QSDA 2F8DA 2QMXA 2A5SA 1I69A 2UYFA 5JTYB 4ELQA 1UTBA 3C34A 3CFLA 1EZOA 1PBQA 3PUVE 4IB2A 4ZEDA 5DTBA 3SKPA 4ELPA 1BKAA 4NF4B 4AB6A 3C32A 4GLIA 3LSFB 4LP2B 2CZLA 2PBWA 1XT8A 4GVOA 3MJNA 3FV2A 5TU0A 4QFNA 3KN3A 2I6EA 3RY3A 1NNTA 4O3AA 1LSTA 1N76A 4H5FA 5F7VA 1MY1A 2QJEA 4KCDA 5FHNA 3MZBA 4GXAA 3IR1A 3KGCA 1D9YA 3HCQA 1Y9UA 3O6IA 3TTMA 3IOVA 4AQ4A 2H4IA 2ZMBA 3TTKA 3PMWA 4IO3A 5K2XA 5CMKA 3K6UA 3MVWA 1QUJA 4K3FA 5TP9B 4F22A 3UP9A 3QK6A 4G8HA 2O68A 3DP8A 3K0VA 4LQ5A 1MDP1 2E1SA 3RPWA 3N6UA 3OELA 4H8IA 4MH5A 2ONKE 2HXWA 1TFAA 3C31A 2D21A 2Q89A 2V93A 1I6BA 1A99A 2X7PA 1QKAA 3ILUB 1FQDA 3BFTA 3PPOA 4KI0E 3ILTB 3OENA 2XXTA 4F1UA 1VFEA 1ZKBA 5H8SA 2V3TA 1LCFA 1SW5A 1FCKA 3V89B 2ZYKA 4MLQA 1Y1MA 3L6HA 3OMBA 2Z22A 5H8FB 3TCGA 4LATA 4XIGQ 4DCXA 4FATA 3S9EA 1O64A 1MY4A 2YJPA 5HBCA 3W15C 4E0WA 3S9LC 2UVGA 2LAOA 3PPNA 1USYE 4XKRA 4ZE9A 1ANFA 1LFHA 4HTGA 1UQWA 1DTGA 3FASA 1D3KA 2UYEA 5CI5A 3EHSA 1QULA 3H6WA 3DELB 3T9VA 4BDNA 1M5CA 3MWBA 4GIZA 4ZEFA 3EHUA 4WEPA 4KYDA 4IY6A 4F29A 2IEEA 5AA3A 5KDTB 3H03A 3H6TA 3HO7A 4POWA 1POTA 3TTRA 4XTCQ 1OIBA 2VD3A 4G68B 3LSLA 4JB7A 4RK2A 5AE4A 1OMPA 2PYYA 3A3CA 5AA2A 3KSXA 3G3HA 2PT2A 4BDMA 1IXHA 3TTNA 4LUBA 1B7HA 2I49A 4EQBA 4C0RA 4N6PA 1XVYA 4N13A 4R74A 4RPNA 2O69A 4H8JA 5L9MA 4F31B 1ELJA 1M5FA 1N84A 1TXFA 2HFBA 2QMWA 4M4GA 1A54A 2HEUA 2OJTA 1MXZA 2F34A 2ZNTA 3Q29A 3AXFA 4JBZA 3LSXA 4R6HA 1BTJA 3PPPA 4ZEIA 3ZKLA 1MH4A 1H3DA 3SEVA 4C1TA 3S9MC 2X7QA 3VVFA 1KWHA 5DVIA 2AL4A 1A55A 4HCYA 1RYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H65 A;  4JWY A;  1MY3 A;  2ONS A;  4MLV A;  2Q2C A;  3C9H A;  2I0B A;  3FXU A;  3IO4 A;  3BFU A;  3K01 A;  1O7T A;  4U2R A;  4P0G A;  4ELR A;  1AOV A;  3LUY A;  2V3U A;  4F1Y A;  1P1Q A;  3C35 A;  4PE5 B;  3N6T A;  1T0K A;  1O63 A;  3I3V A;  3FUZ A;  3QSL A;  1LCT A;  2PT1 A;  1OQH A;  3JYR A;  3VDF A;  1SW4 A;  4YAH X;  3WAE A;  5CBS A;  2DE2 A;  5H8H B;  4OWD A;  2VD2 A;  5CBR A;  3ECR A;  3O29 A;  4E0X A;  1IEJ A;  1B58 A;  4ESW A;  3FZV A;  3DP6 A;  3HPI A;  4G8M A;  5M2V A;  1MDQ A;  1VE4 A;  2O1L A;  3K2D A;  2QS1 A;  2H5Y A;  1XOC A;  1YAE A;  1SYI A;  3B7D A;  3DLN A;  3O28 A;  4NTL A;  3P7I A;  5L9S A;  2THI A;  3PV0 E;  4NF6 A;  5KDT A;  3CVG A;  3DP4 A;  1B46 A;  4LZ8 A;  1TWY A;  3RT6 B;  3MBP A;  4H6D A;  1A7L A;  3K1M A;  3QUJ A;  4GL0 A;  3QUF A;  4JXI A;  1NH8 A;  5H8N A;  1FTL A;  3RLF E;  1WVJ A;  3IOU A;  3TUS A;  2YPN A;  3CG1 A;  3G3J A;  4UAC A;  5A5X A;  2FYI A;  4OER A;  4U4S A;  1N7X A;  3LBS A;  3BBR A;  4LON B;  4G4P A;  4XXU A;  4ECF A;  5I56 B;  1A8E A;  1SW1 A;  1FQB A;  3IOR A;  3D4G A;  1URS A;  2Q9T A;  2A5T A;  3FAT A;  3MZ1 A;  3PPQ A;  4GQO A;  4RNS A;  1H43 A;  4XKP A;  3S2V A;  3TCF A;  5H8F A;  5TPA B;  1JNF A;  4P11 A;  3G3G A;  4THI A;  5DVJ A;  1Y3Q A;  1OVT A;  5L8D A;  3TQW A;  4Q30 B;  3E9X A;  5KZT A;  4IO6 A;  2OCU A;  2FA7 A;  4Z7E A;  2E0S A;  1Y3P A;  3M3F A;  4OVJ A;  2X26 A;  4NE4 A;  1PB7 A;  4XKN A;  4I62 A;  3JV9 A;  3PMX A;  2VGQ A;  5I58 B;  5I59 B;  5JEI A;  1DPE A;  1N04 A;  1ZU0 A;  3I5O A;  4LZ5 A;  4PQJ A;  1NNF A;  1ZBM A;  4YU0 A;  5TP9 A;  4EDP A;  4OMB A;  4PFY A;  3PU5 A;  1MQG A;  2I0C A;  4F3G A;  1MRP A;  1URG A;  4TQU Q;  1MPB A;  1MQI A;  4TOZ A;  5H8Q A;  3RN8 A;  4DZ1 A;  2HCA A;  2W7Y A;  1MY2 A;  4EQ7 A;  1YTV A;  3MVZ A;  2QL3 A;  4KR5 A;  4IO4 A;  5DT6 A;  4ZEK A;  3VVE A;  2I48 A;  3GBB A;  3Q25 A;  5I56 A;  1S9T A;  1RYO A;  3OOA A;  1EH3 A;  1MM7 A;  3HST A;  1ATG A;  4FIM A;  3T66 A;  4OEV A;  1S7Y A;  3OSR A;  5L9O A;  2GFE A;  3O9P A;  2Z23 A;  3K00 A;  3USD A;  4R73 A;  3VE1 B;  2RC9 A;  4R9G A;  4LA9 A;  2H9B A;  3PD9 A;  5AA4 B;  3FJG A;  2F36 A;  4DXB A;  1MXX A;  3MC2 A;  4H0W A;  4RY1 A;  3TEP A;  2V25 A;  1B6H A;  1B9J A;  1SVX B;  3G3K A;  3V5A A;  3IAZ A;  3KFM A;  1GTK A;  1B1H A;  2O51 A;  3RNN A;  4FAJ A;  2HQ0 A;  4R6Y A;  3M8U A;  4U1Z A;  5DYH A;  2NVU B;  3RTW B;  4U4X A;  4N07 A;  1VR5 A;  2QRY A;  4DCY A;  2DWA A;  3JZJ A;  3K1N A;  3LSW A;  3U92 A;  4NF8 B;  2ESN A;  1JW5 A;  3MVX A;  2QS4 A;  1GR2 A;  2ZNS A;  4O3C A;  3IB2 A;  1MM6 A;  1PDA A;  1QKB A;  1SYH A;  3M3K A;  4HW8 A;  5I2N B;  5I58 A;  5I59 A;  1LAG E;  3O66 A;  3GBA A;  1MPD A;  3FVN A;  4YKK A;  1XHY A;  4WXJ A;  3HV1 A;  3O6H A;  1R9Q A;  2H25 A;  2Y7K A;  3TKD A;  2ABH A;  1MQD A;  2F7B A;  5IAI A;  3PUY E;  4KCC A;  3QIM A;  4JSD A;  4IO7 A;  1B2H A;  4ZE8 A;  4KYE A;  5TPA A;  1Y1Z A;  3PMV A;  3T9H B;  2A5T B;  3EHT A;  3UA8 A;  4EUO A;  2ALU A;  1DTZ A;  2DVZ A;  4F2O A;  2ZYO A;  2P2A A;  1BP5 A;  2XXX A;  4YB6 A;  1AMF A;  2V3Q A;  4BDO A;  4YKP A;  5CMM A;  4DXC A;  3LR1 A;  3Q26 A;  2Y7R A;  1M5B A;  1GGG A;  2XXU A;  3UOR A;  2ONR A;  2HAV A;  1Y4T A;  1Y3N A;  2DWJ A;  1LGB C;  4OQO A;  4U1O A;  4GF8 A;  3SET A;  3H6U A;  1IUD A;  2IA4 A;  1UTB B;  1B40 A;  1DPP A;  5HPQ A;  4HS7 A;  3VLV A;  4TLM B;  4YB5 A;  4YIC A;  1PC3 A;  3MP1 A;  2OWS A;  5DEX A;  1B05 A;  2WKY A;  1QVS A;  1R1N A;  3MAM A;  4FED A;  1NFT A;  3FXR A;  4WKM A;  5AA4 A;  4PET A;  5FTH A;  4DE8 A;  4RPO A;  4PP0 A;  5F1Q A;  2Y7I A;  2DSF A;  1WDN A;  3IO6 A;  1MQH A;  2RC8 A;  5H8H A;  4ND9 A;  1F9B A;  2Z8D A;  2HZL A;  3C36 A;  3L6G A;  1FTJ A;  3H7M A;  4PFW A;  5FTI A;  4BLA A;  1IQ7 A;  4XKQ A;  2FNC A;  4QSC A;  3K6W A;  5I2K A;  4NWD A;  1LB9 A;  3QAX A;  3U1O A;  4DDD A;  1MS7 A;  2O7I A;  3H6V A;  2G29 A;  1H45 A;  2XXQ A;  2ZXT A;  3CRB A;  3PUX E;  4GXS B;  3TFL A;  5ICT A;  1LBB A;  5I2K B;  2QS3 A;  2DE3 A;  3EN3 A;  4Q5T A;  3K4U A;  3SEY A;  1IIT A;  4UA8 A;  1B4Z A;  2ZNU A;  3SER A;  2DVC A;  2Y7P A;  3EPE A;  1IZ1 A;  1MG1 A;  1MXU A;  4H67 A;  3IL1 B;  3KOS A;  3FVO A;  4EF1 A;  5KCJ A;  1SBP A;  3QXM A;  4FJP A;  3OSQ A;  2DOJ A;  3OO9 A;  1LFI A;  3OD7 A;  4NF8 A;  1AH5 A;  1A8F A;  1LAX A;  2O84 X;  3CSB A;  4OES A;  4X48 A;  4X9T A;  3RTF B;  4OEU A;  3SEX A;  4OXV A;  1SQY A;  1MXY A;  4QF9 A;  1N3W A;  1II5 A;  1FTM A;  1JW4 A;  1NL5 A;  3GZG A;  2AL5 A;  4G77 A;  4JSO A;  3VXC A;  1DSN A;  1S50 A;  4QSE A;  2XXV A;  3MVY A;  2AYS A;  4C1U A;  4P0I A;  2F6G A;  3RT8 A;  2XXY A;  3R6U A;  2REG A;  1EZP A;  3U93 A;  1LLS A;  1N7W A;  3UIF A;  4DLD A;  5EYF A;  3V83 A;  1H44 A;  1UIV A;  3PUZ E;  3ONM A;  3O97 A;  3MQ9 A;  3T96 B;  2XXP A;  2GHB A;  2B65 A;  2F97 A;  4L17 A;  4NF4 A;  3TZA A;  2PVU A;  1OQG A;  1P1O A;  3A09 A;  3CSG A;  4O3B A;  1QW0 A;  2F35 A;  1JVY A;  3G3I A;  1FQA A;  4KHZ E;  1B3E A;  2NUV A;  4KYS A;  3E3K A;  4IGR A;  4NF6 B;  4F39 A;  2OK2 A;  1XC1 A;  2BJJ X;  3CG3 A;  4U21 A;  2RKM A;  1H76 A;  1DOT A;  1JVX A;  2RIN A;  3F11 A;  3G7W A;  2G93 A;  4GL8 A;  4H5G A;  4IY5 A;  4R75 A;  1IXI A;  4R9F A;  4QRZ A;  4ZEB A;  1GVC A;  4RXL A;  5EHM A;  3H06 B;  3TTL A;  1B1X A;  4KD5 A;  4EXK A;  4R2B A;  1M5E A;  3C33 A;  1PB9 A;  3H4Z A;  4RK9 A;  5IKB A;  5CMC A;  4RJZ A;  1FW0 A;  3KOT A;  3H3G A;  2I4B A;  1POY 1;  1XS5 A;  2DQV A;  3MUQ A;  2RC7 A;  4MF3 A;  4BDR A;  4ZZA A;  1QUI A;  1Z7N E;  2XHD A;  1QUK A;  4ELO A;  1P1U A;  2XXW A;  1CE2 A;  2V84 A;  2XX8 A;  3MP6 A;  4GFR A;  4QFL A;  5CRY A;  3TMG A;  4F1V A;  4F3B A;  3I6V A;  4H1X A;  3ZS6 A;  5A5X B;  3IJO B;  1N3X A;  2RCA A;  2ANJ A;  1SDX A;  3W9V A;  5H8N B;  2DXR A;  1LAF E;  3OEM A;  4FEC A;  4X1D A;  4ESX A;  1NNK A;  3R26 A;  3EF7 A;  3FD3 A;  3SEW A;  2Q8J A;  3DM0 A;  4NWC A;  1FTO A;  3TYH A;  4EXL A;  5JTY A;  3CIJ A;  2REJ A;  1ZJL A;  5K2Y A;  3KJ7 A;  1EZ9 A;  4G68 A;  3N5L A;  2DYX A;  4M1V A;  4OET A;  2UXA A;  1J1N A;  2XXI A;  1P1W A;  4OYV A;  5ICQ A;  3CFZ A;  4U22 A;  1EU8 A;  1YPN A;  3E4R A;  4KPT A;  4NMY A;  1I6Q A;  4OEN A;  4QHQ A;  5ELV A;  1R6Z A;  2VP1 A;  5AA2 D;  3IX1 A;  2DWI A;  2OBG A;  3MPL A;  3V8X B;  1ZLQ A;  3MW0 A;  4QFK A;  4EQ9 A;  2F78 A;  1US4 A;  4QFP A;  3UN6 A;  3VXB A;  4JWO A;  5I57 B;  2F7C A;  4GOT A;  2QSX A;  2CMO A;  3KBR A;  3U94 A;  3W9W A;  2PMS A;  2QPQ A;  1MH3 A;  3PUW E;  1CB6 A;  4LZ7 A;  4MFI A;  4ONY A;  4TLL B;  1NKX A;  3RGY A;  3TEL A;  4QFO A;  3FGS A;  2M8C A;  4MBP A;  2VOZ A;  4PFT A;  5CM6 A;  1FQE A;  4I1D A;  4OFO A;  1B7Z A;  1B5I A;  1IXG A;  2B3B A;  1LFG A;  1B32 A;  2R6G E;  5B70 A;  2DS9 A;  1B5H A;  1MXV A;  1XVX A;  4F18 A;  1N0T A;  3SES A;  3K1P A;  4YZZ A;  4ZEC A;  2Y84 A;  1TT1 A;  3TDJ A;  2OLB A;  5ITO A;  1OLC A;  1Y20 A;  2AIX A;  3OO8 A;  2D5W A;  2NXO A;  4ZS9 A;  1B0L A;  3O2A A;  1MPC A;  1B3G A;  1BLF A;  2XXH A;  3D4C A;  2GRV A;  3PGF A;  1JEV A;  1P99 A;  5EHS A;  2KLF A;  3BKI B;  3PD8 A;  3R7X A;  5AA2 B;  1JET A;  2I3V A;  4IO5 A;  1HSJ A;  3UGW A;  1D4N A;  1B4H A;  1PBP A;  3O6G A;  3Q27 A;  1VSO A;  3WAF A;  2XX7 A;  1PB8 A;  3FVK A;  3UK4 A;  3ZKK A;  5I84 A;  1JQF A;  4F2Q A;  1FQF A;  4YKJ A;  4OHN A;  4POX A;  1TFD A;  4GRK A;  3FVG A;  4FOR A;  4U23 A;  1UIU A;  4R2F A;  1MY0 A;  1FTK A;  4IO2 A;  1NMU A;  5BUU A;  3MZ9 A;  3TAJ A;  3CR9 A;  1B0H A;  3CFX A;  3KEI A;  1DMB A;  2P1S A;  2OZZ A;  1ZTY A;  1B3F A;  3VVD A;  4I9D A;  3KSJ A;  2Z8F A;  3FIR A;  2F7A A;  3FXQ A;  4ZZE A;  3K02 A;  1AL3 A;  4AB5 A;  2NWJ A;  4ZDM A;  2DXY A;  2I4C A;  1QJM A;  2O1M A;  3HN0 A;  3TOD A;  5JK4 A;  3IK6 B;  4FEB A;  2R9J A;  3Q28 A;  3PPR A;  3TPA A;  4YKI A;  1B5J A;  4HCW A;  4JWX A;  4KFQ A;  5CC2 A;  3A3U A;  1HSE A;  5LOM A;  3N26 A;  3T9X B;  1PEB A;  4NF5 A;  3GXA A;  2PX1 A;  3N94 A;  2GH9 A;  3MP8 A;  3VLU A;  1AIV A;  5FHO A;  2Y7W A;  3U72 A;  2UVJ A;  3C4M A;  3U8Q A;  1Z7M E;  2QS2 A;  2DE4 A;  3CI8 A;  1D9V A;  4NED A;  3HHG A;  3OXN A;  2XXR A;  3RUM A;  5B7D A;  5FHM A;  3OEK A;  1B51 A;  1SI1 A;  1US5 A;  3IB0 A;  3KZG A;  1UTH B;  3G3F A;  4R72 A;  2R71 A;  3RQT A;  1URD A;  4RA1 A;  1MQJ A;  5ITP A;  4FE8 A;  1SW2 A;  3IB1 A;  2Q88 A;  5J1D A;  1OVB A;  1VFD A;  4F3S A;  3KG2 A;  4F3P A;  4YMA A;  4X1B A;  3OO7 A;  2O7U A;  3KN8 A;  4I8C A;  1R9L A;  1B52 A;  3B6W A;  2VHA A;  1ZMG A;  2DP8 A;  2F5X A;  5CMB A;  4LVQ A;  5AA1 A;  3IJX B;  2YLN A;  3ODB A;  3KN7 A;  1Q35 A;  2UVI A;  4RYA A;  3S4U A;  3TCH A;  3B6Q A;  5DEX B;  1LB8 A;  1IXC A;  3T22 A;  4IGT A;  1B7U A;  5H8Q B;  4OZ9 A;  4BDL A;  1MXW A;  2I3W A;  2I58 A;  4KQP A;  5DVF A;  1L5T A;  3THI A;  5BWJ A;  4GD5 A;  3VFJ A;  4GWO A;  2UVH A;  2Q2A A;  2RCB A;  4WED A;  1BIY A;  2H98 A;  3K6V A;  2ZYM A;  3M3L A;  3E13 X;  1UTH A;  4G2Z A;  4Q8R A;  4JDF A;  1FQC A;  3OO6 A;  5KCJ B;  4R6K A;  2H99 A;  1GV8 A;  1Q1K A;  1JW1 A;  2P0S A;  3S9N C;  4OTE A;  1JEU A;  1B3L A;  2ZYN A;  1P1N A;  3KJT A;  4F19 A;  4Q0C A;  4EF2 A;  1SD3 A;  1WOD A;  4PFU A;  1IIW A;  1RKM A;  3VLW A;  4ISU A;  3FJM A;  3SDF A;  4DXU A;  4NF5 B;  3MPK A;  1LBC A;  2RF1 A;  2OWT A;  2DWH A;  3TQL A;  3B6T A;  5ISU A;  3ZSF A;  3T9U A;  4LQ2 A;  1I6A A;  2B3F A;  3T93 B;  5I2N A;  5I57 A;  5HM4 B;  4OFJ A;  3VV5 A;  4YMB A;  1LAH E;  1HSL A;  2D3I A;  1A40 A;  2HZK A;  4G8N A;  2Z8E A;  1Y4C A;  2F6P A;  3FV1 A;  1YCJ A;  1SI0 A;  4OFL A;  1NNP A;  1NH7 A;  1OLA A;  2XD3 A;  3FJ7 A;  1ZIU A;  4BDQ A;  2O6A A;  3K6X A;  2HAU A;  2NOO A;  4DIG A;  3LC8 A;  3EQ1 A;  4Z0I A;  3IOW A;  2XD2 A;  1M5D A;  2GHA A;  1USY H;  4G68 C;  4YB7 A;  3HHF A;  3SEU A;  2XX9 A;  3GLB A;  1B3H A;  3QYT A;  3IOT A;  4QSD A;  2F8D A;  2QMX A;  2A5S A;  1I69 A;  2UYF A;  5JTY B;  4ELQ A;  1UTB A;  3C34 A;  3CFL A;  1EZO A;  1PBQ A;  3PUV E;  4IB2 A;  4ZED A;  5DTB A;  3SKP A;  4ELP A;  1BKA A;  4NF4 B;  4AB6 A;  3C32 A;  4GLI A;  3LSF B;  4LP2 B;  2CZL A;  2PBW A;  1XT8 A;  4GVO A;  3MJN A;  3FV2 A;  5TU0 A;  4QFN A;  3KN3 A;  2I6E A;  3RY3 A;  1NNT A;  4O3A A;  1LST A;  1N76 A;  4H5F A;  5F7V A;  1MY1 A;  2QJE A;  4KCD A;  5FHN A;  3MZB A;  4GXA A;  3IR1 A;  3KGC A;  1D9Y A;  3HCQ A;  1Y9U A;  3O6I A;  3TTM A;  3IOV A;  4AQ4 A;  2H4I A;  2ZMB A;  3TTK A;  3PMW A;  4IO3 A;  5K2X A;  5CMK A;  3K6U A;  3MVW A;  1QUJ A;  4K3F A;  5TP9 B;  4F22 A;  3UP9 A;  3QK6 A;  4G8H A;  2O68 A;  3DP8 A;  3K0V A;  4LQ5 A;  1MDP 1;  2E1S A;  3RPW A;  3N6U A;  3OEL A;  4H8I A;  4MH5 A;  2ONK E;  2HXW A;  1TFA A;  3C31 A;  2D21 A;  2Q89 A;  2V93 A;  1I6B A;  1A99 A;  2X7P A;  1QKA A;  3ILU B;  1FQD A;  3BFT A;  3PPO A;  4KI0 E;  3ILT B;  3OEN A;  2XXT A;  4F1U A;  1VFE A;  1ZKB A;  5H8S A;  2V3T A;  1LCF A;  1SW5 A;  1FCK A;  3V89 B;  2ZYK A;  4MLQ A;  1Y1M A;  3L6H A;  3OMB A;  2Z22 A;  5H8F B;  3TCG A;  4LAT A;  4XIG Q;  4DCX A;  4FAT A;  3S9E A;  1O64 A;  1MY4 A;  2YJP A;  5HBC A;  3W15 C;  4E0W A;  3S9L C;  2UVG A;  2LAO A;  3PPN A;  1USY E;  4XKR A;  4ZE9 A;  1ANF A;  1LFH A;  4HTG A;  1UQW A;  1DTG A;  3FAS A;  1D3K A;  2UYE A;  5CI5 A;  3EHS A;  1QUL A;  3H6W A;  3DEL B;  3T9V A;  4BDN A;  1M5C A;  3MWB A;  4GIZ A;  4ZEF A;  3EHU A;  4WEP A;  4KYD A;  4IY6 A;  4F29 A;  2IEE A;  5AA3 A;  5KDT B;  3H03 A;  3H6T A;  3HO7 A;  4POW A;  1POT A;  3TTR A;  4XTC Q;  1OIB A;  2VD3 A;  4G68 B;  3LSL A;  4JB7 A;  4RK2 A;  5AE4 A;  1OMP A;  2PYY A;  3A3C A;  5AA2 A;  3KSX A;  3G3H A;  2PT2 A;  4BDM A;  1IXH A;  3TTN A;  4LUB A;  1B7H A;  2I49 A;  4EQB A;  4C0R A;  4N6P A;  1XVY A;  4N13 A;  4R74 A;  4RPN A;  2O69 A;  4H8J A;  5L9M A;  4F31 B;  1ELJ A;  1M5F A;  1N84 A;  1TXF A;  2HFB A;  2QMW A;  4M4G A;  1A54 A;  2HEU A;  2OJT A;  1MXZ A;  2F34 A;  2ZNT A;  3Q29 A;  3AXF A;  4JBZ A;  3LSX A;  4R6H A;  1BTJ A;  3PPP A;  4ZEI A;  3ZKL A;  1MH4 A;  1H3D A;  3SEV A;  4C1T A;  3S9M C;  2X7Q A;  3VVF A;  1KWH A;  5DVI A;  2AL4 A;  1A55 A;  4HCY A;  1RYX A; 
#chains in the Genus database with same CATH topology
 2ONS A;  4MLV A;  2Q2C A;  2I0B A;  4U2R A;  4ELR A;  1AOV A;  1T0K A;  3FUZ A;  3QSL A;  3JYR A;  4OWD A;  4PGP A;  4ESW A;  3DP6 A;  3HPI A;  2O1L A;  2H5Y A;  1XOC A;  4N15 A;  2THI A;  4NF6 A;  3CVG A;  3FXB A;  1TWY A;  3QUJ A;  4GL0 A;  1FTL A;  3TUS A;  2YPN A;  3G3J A;  4OVT A;  5A5X A;  4XXU A;  4OER A;  4U4S A;  1N7X A;  4MNP A;  4G4P A;  4JVC A;  1A8E A;  3IOR A;  3D4G A;  1URS A;  2Q9T A;  2OWZ A;  1Y3Q A;  2FA7 A;  3M3F A;  4OVJ A;  2X26 A;  5I59 B;  1PB7 A;  2VGQ A;  3I5O A;  4PQJ A;  1NV7 A;  3PU5 A;  1URG A;  4TOZ A;  1MQI A;  2OX3 A;  4DZ1 A;  2W7Y A;  1YTV A;  3MVZ A;  2QL3 A;  4ZEK A;  1EH3 A;  1MM7 A;  3HST A;  4OEV A;  3OSR A;  3B50 A;  1IMD A;  2RC9 A;  3PD9 A;  3FJG A;  4DXB A;  1MXX A;  4RY1 A;  2V25 A;  1B9J A;  1B1H A;  3RNN A;  2HQ0 A;  3RTW B;  2NVU B;  2QRY A;  2DWA A;  1GR2 A;  1SYH A;  1QKB A;  3M3K A;  5I2N B;  5I59 A;  1LAG E;  3FVN A;  4GWS A;  4WXJ A;  3O6H A;  4H46 A;  2Y7K A;  3TKD A;  3PUY E;  4KCC A;  3QIM A;  4JSD A;  5TPA A;  5I2K A;  2ALU A;  1DTZ A;  4F2O A;  2V3Q A;  2DDK A;  3Q26 A;  2Y7R A;  1GGG A;  2XXU A;  1Y3N A;  4OQO A;  4GF8 A;  4X04 A;  3H6U A;  4P1E A;  1UTB B;  1PC3 A;  2OWS A;  1QVS A;  1R1N A;  3HFU A;  4KXP A;  2DSF A;  5H8H A;  4ND9 A;  1F9B A;  3L6G A;  4AS4 A;  5FTI A;  3K6W A;  1LB9 A;  4DDD A;  1MS7 A;  4GWZ A;  3H6V A;  4HXV A;  1H45 A;  2ZXT A;  3PUX E;  4GXS B;  5ET7 A;  5ICT A;  1YXI A;  3E79 A;  3SER A;  2DVC A;  4PCD A;  1IZ1 A;  1MG1 A;  3OSQ A;  4GWX A;  2O84 X;  3CSB A;  4HE1 A;  3SEX A;  1JP4 A;  1IMB A;  1N3W A;  1II5 A;  1FTM A;  1EYI A;  3BIG A;  2REG A;  4DLD A;  3PUZ E;  2F97 A;  4QXD A;  4NF4 A;  1P1O A;  2QFL A;  1JVY A;  3G3I A;  4KYS A;  3E3K A;  4IGR A;  1XC1 A;  5T3J A;  4H5G A;  4R9F A;  3TTL A;  1RDZ A;  4RK9 A;  5CMC A;  4DI4 B;  3MUQ A;  4BDR A;  4ZZA A;  2XHD A;  1Z7N E;  4QFL A;  5CRY A;  4F3B A;  3E78 A;  1INP A;  1NNK A;  2Q8J A;  4NWC A;  1ZJL A;  4M1V A;  4OET A;  5ICQ A;  5ELV A;  4U22 A;  4NMY A;  4QHQ A;  5AA2 D;  1RDY A;  2Q74 A;  2VP1 A;  1ZLQ A;  4QFK A;  3U94 A;  4ONY A;  4TLL B;  4MBP A;  2M8C A;  4OFO A;  1DK4 A;  1IXG A;  2B3B A;  1LBV A;  2R6G E;  1B5H A;  1MXV A;  1XVX A;  3BIH A;  4F18 A;  2FIE A;  4P3L A;  4ZEC A;  2XXK A;  5ITO A;  1OLC A;  2AIX A;  3OO8 A;  2NXO A;  4N6K A;  3PGF A;  1HSJ A;  5I3S A;  2JJK A;  1SPI A;  3O6G A;  3FVK A;  4IO2 A;  1NMU A;  1DMB A;  2OZZ A;  4I9D A;  3FXQ A;  5IM2 A;  4GX4 A;  2NWJ A;  4ZDM A;  3SZP A;  2O1M A;  1QJM A;  3IK6 B;  3Q28 A;  4JVI A;  3T9X B;  1PEB A;  4NF5 A;  3VLU A;  3RPL A;  3U72 A;  3U8Q A;  5I7I A;  1Z7M E;  3CI8 A;  4N17 A;  3D1R A;  3OEK A;  2ZZW A;  4R72 A;  4RA1 A;  1VFD A;  4X1B A;  2O7U A;  1B52 A;  3B6W A;  4JVD A;  4N81 A;  5CMB A;  2UVI A;  3TCH A;  4OA4 A;  3B6Q A;  2QVV A;  1NV3 A;  1IMF A;  5BWJ A;  2UVH A;  2Q2A A;  2H98 A;  1AWB A;  4JDF A;  3B8B A;  1B3L A;  1P1N A;  3KJT A;  1IMA A;  4PFU A;  4DXU A;  1RKM A;  3FJM A;  4OVP A;  2OWT A;  4O7M A;  4OFJ A;  4G8N A;  1A40 A;  4GWU A;  3FV1 A;  4PAF A;  1NNP A;  4MMP A;  1OLA A;  2XD3 A;  2O6A A;  4Z0I A;  2GHA A;  4G68 C;  4OVR A;  1FPL A;  3QYT A;  1B3H A;  4ELQ A;  3CFL A;  2WYK A;  1PBQ A;  3PUV E;  2BJI A;  4ELP A;  4QFN A;  4PFB A;  4G61 A;  2I6E A;  4O3A A;  4GXA A;  4X8R A;  2GQ1 A;  5LTC A;  2H4I A;  3PMW A;  4GBW A;  2HXW A;  1TFA A;  3ILU B;  1FQD A;  3BFT A;  2V3T A;  4QBA A;  2ZYK A;  5H8F B;  1FPJ A;  3TCG A;  4DCX A;  4XIG Q;  2LAO A;  4XKR A;  1LFH A;  5CI5 A;  3H6W A;  3T9V A;  4GIZ A;  3MWB A;  4ZEF A;  2CZI A;  4F29 A;  5AA3 A;  2IEE A;  3H6T A;  3TTR A;  2VD3 A;  4G68 B;  1OMP A;  2PT2 A;  4LUB A;  1B7H A;  1FBC A;  4N6P A;  1XVY A;  4R74 A;  4H8J A;  1ELJ A;  2QMW A;  1N84 A;  1YZ0 A;  2HEU A;  2OJT A;  3Q29 A;  4JBZ A;  4MAG A;  3VVF A;  1KWH A;  1B0H A;  4HCY A;  1FBF A;  1RYX A;  4H65 A;  3C9H A;  3FXU A;  3IO4 A;  1O7T A;  4PGN A;  4PAI A;  1P1Q A;  4PE5 B;  4HE2 A;  3I3V A;  1LCT A;  1OQH A;  4YAH X;  1FTA A;  2DE2 A;  5H8H B;  3MYU A;  3ECR A;  3O29 A;  3FZV A;  4G8M A;  3K2D A;  3KBZ A;  3KC0 A;  3O28 A;  4NTL A;  5KDT A;  1A7L A;  3K1M A;  5H8N A;  3RLF E;  2FYI A;  3EKI A;  3LBS A;  1IME A;  2F3B A;  3PPQ A;  3ZKK A;  4XKP A;  1H43 A;  5TPA B;  1JNF A;  4THI A;  1OVT A;  4Q30 B;  5KZT A;  4Z7E A;  2E0S A;  1Y3P A;  3PMX A;  5JEI A;  1N04 A;  4LZ5 A;  1ZBM A;  4EDP A;  4PFY A;  2Y5L A;  4TQU Q;  1MPB A;  5H8Q A;  4MX6 A;  1MY2 A;  5DT6 A;  1EYK A;  4N6D A;  1S9T A;  1RYO A;  4FIM A;  4R9G A;  4LA9 A;  2H9B A;  5AA4 B;  3TEP A;  1KA1 A;  4H0W A;  4DI3 D;  1RDX A;  1B6H A;  1NV1 A;  3V5A A;  2O51 A;  4R6Y A;  4U1Z A;  4N07 A;  1VR5 A;  4DCY A;  1G0I A;  3MVX A;  4O3C A;  4GWY A;  1K9Y A;  3IB2 A;  1PDA A;  4HW8 A;  5I58 A;  1MPD A;  3HV1 A;  2F7B A;  2WX9 A;  1B2H A;  3T9H B;  1Y1Z A;  2Q8M A;  2P2A A;  4YB6 A;  2PFZ A;  2F3D A;  4YKP A;  3UOR A;  2ONR A;  2HAV A;  4H45 A;  3SET A;  2WEF A;  1FRP A;  3MP1 A;  2WKY A;  5AA4 A;  5FTH A;  4MNC A;  2Y7I A;  3IO6 A;  2Z8D A;  1IQ7 A;  2FNC A;  4UAB A;  4NWD A;  3QAX A;  3U1O A;  2XXQ A;  1LBB A;  2QS3 A;  2DE3 A;  3EN3 A;  5I5P A;  3K4U A;  3SEY A;  1B4Z A;  4O7I A;  2MKZ A;  2ZNU A;  2Y7P A;  4H67 A;  3FVO A;  4EF1 A;  4FJP A;  1LFI A;  1AH5 A;  1LAX A;  4X9T A;  4X48 A;  1MXY A;  4JSO A;  3VXC A;  1JW4 A;  1FBH A;  1DSN A;  1S50 A;  4P0I A;  1FPD A;  1N7W A;  5EYF A;  3V83 A;  3MQ9 A;  2XXP A;  4L17 A;  2KR0 A;  2PVU A;  1QW0 A;  2F35 A;  4PF6 A;  4KHZ E;  1B3E A;  3CG3 A;  1H76 A;  1DOT A;  1JVX A;  4IY5 A;  4ZEB A;  5EHM A;  1B1X A;  4KD5 A;  4RJZ A;  3H3G A;  1POY 1;  1XS5 A;  3MP6 A;  4F1V A;  3TMG A;  5A5X B;  3IJO B;  1N3X A;  4FBP A;  3W9V A;  5H8N B;  1FTO A;  1NV4 A;  4EXL A;  2REJ A;  4PBH A;  5K2Y A;  3KJ7 A;  1EZ9 A;  3N5L A;  2DYX A;  2XXI A;  4GX3 A;  3CFZ A;  5L8D A;  3E4R A;  4NGU A;  1R6Z A;  4QFP A;  4P56 A;  4JWO A;  2F7C A;  4GOT A;  2QSX A;  4NHB A;  2PMS A;  2QPQ A;  5LDZ A;  1CB6 A;  5CM6 A;  4I1D A;  1Q9D A;  1B32 A;  5B70 A;  3K1P A;  1TT1 A;  3TDJ A;  2D5W A;  3O2A A;  1MPC A;  3D4C A;  1BLF A;  1BK4 A;  5EHS A;  2XWV A;  1JET A;  3UGW A;  5F24 A;  3WAF A;  1PBP A;  3Q27 A;  1VSO A;  3UK4 A;  1JQF A;  4POX A;  4GRK A;  4U23 A;  4MHF A;  1UIU A;  1FTK A;  5BUU A;  3KEI A;  3CFX A;  1B3F A;  3VVD A;  2F7A A;  3K02 A;  3A29 A;  2I4C A;  3GYY A;  3TPA A;  4HCW A;  2FHY A;  3A3U A;  3N26 A;  3GXA A;  3N94 A;  2GH9 A;  1D9V A;  2XXR A;  1B51 A;  3KZG A;  3RQT A;  5ITP A;  5J1D A;  4F3S A;  4I8C A;  1R9L A;  2VHA A;  5EQ8 A;  2F5X A;  5AA1 A;  3KN7 A;  3S4U A;  1FSA A;  1IXC A;  1B7U A;  5H8Q B;  4BDL A;  4KQP A;  3THI A;  4GD5 A;  3VFJ A;  2HHM A;  4WED A;  2ZYM A;  5A5L A;  4PE3 A;  3OO6 A;  4PDH A;  5KCJ B;  4R6K A;  3KC1 A;  2P0S A;  4F19 A;  3VLW A;  4NF5 B;  1LBC A;  3TQL A;  3B6T A;  1FBP A;  3T9U A;  4LQ2 A;  2WBD A;  3T93 B;  3VV5 A;  4YMB A;  2HZK A;  2F6P A;  1SI0 A;  4MIJ A;  4BDQ A;  3FJ7 A;  2NOO A;  4YB7 A;  3SEU A;  3HHF A;  2F8D A;  2UYF A;  2XWI A;  4IB2 A;  4NF4 B;  4GLI A;  1XT8 A;  4GVO A;  3MJN A;  3KN3 A;  1NNT A;  4AS5 A;  1MY1 A;  2P3N A;  4KCD A;  5FHN A;  3MZB A;  3IR1 A;  1D9Y A;  3HCQ A;  3TTM A;  4MNI A;  3K6U A;  3MVW A;  4K3F A;  3T0J A;  5TP9 B;  3QK6 A;  4G8H A;  2O68 A;  3DP8 A;  3K0V A;  3RPW A;  2VPO A;  3OEL A;  3C31 A;  1I6B A;  1A99 A;  1YYZ A;  1VFE A;  3L6H A;  4LAT A;  4FAT A;  1IMC A;  1O64 A;  1MY4 A;  2YJP A;  3W15 C;  4ZE9 A;  4HTG A;  4XF5 A;  3FAS A;  2UYE A;  3DEL B;  1EYJ A;  4WEP A;  4IY6 A;  3H03 A;  4RK2 A;  1FPG A;  3TTN A;  4C0R A;  2CZH A;  4F31 B;  5L9M A;  1A54 A;  2F34 A;  3ZKL A;  1BTJ A;  4P47 A;  1H3D A;  1LBX A;  2X7Q A;  5DVI A;  3K01 A;  2R8T A;  3LUY A;  3C35 A;  3N6T A;  1O63 A;  3WAE A;  5CBR A;  1IEJ A;  5EQA A;  5M2V A;  1VE4 A;  1YAE A;  3DLN A;  5L9S A;  1B46 A;  4LZ8 A;  3RT6 B;  3MBP A;  1XI6 A;  3QUF A;  1WVJ A;  3IOU A;  5AE4 A;  4NF0 A;  5I56 B;  3BBR A;  4ECF A;  3FAT A;  2A5T A;  4RNS A;  4P11 A;  3G3G A;  5DVJ A;  3E9X A;  4IO6 A;  1VDW A;  4XKN A;  3JV9 A;  1ZU0 A;  1NNF A;  4OMB A;  2I0C A;  1MRP A;  3LV0 A;  3RN8 A;  4EQ7 A;  3VVE A;  4IO4 A;  4PFR A;  2I48 A;  3GBB A;  5J16 A;  3Q25 A;  3OOA A;  1D9Q A;  1ATG A;  1S7Y A;  5L9O A;  2Z23 A;  3K00 A;  3NOH A;  2P3V A;  1K9Z A;  3VE1 B;  3MC2 A;  4FAJ A;  3M8U A;  5DYH A;  3LSW A;  3K1N A;  1LBW A;  2ESN A;  1JW5 A;  2QS4 A;  2ZNS A;  3O66 A;  4YKK A;  1R9Q A;  2H25 A;  5IAI A;  3PMV A;  5ET5 A;  2A5T B;  3UA8 A;  2ZYO A;  2XXX A;  1AMF A;  5CMM A;  1M5B A;  1IUD A;  1B40 A;  5HPQ A;  4HE0 A;  3VLV A;  4YB5 A;  5DEX A;  3MAM A;  3FXR A;  4PET A;  4DE8 A;  5F1Q A;  1MQH A;  4PFW A;  3C36 A;  5IZ3 B;  4QSC A;  2KQZ A;  3T1B A;  2O7I A;  1LBY A;  5I2K B;  4Q5T A;  1FBG A;  4UA8 A;  1FPI A;  3EPE A;  5KCJ A;  1MXU A;  3KOS A;  2DOJ A;  3OO9 A;  3OD7 A;  4NF8 A;  4OXV A;  1SQY A;  3TQW A;  4QF9 A;  1NL5 A;  3GZG A;  4XFE A;  2AL5 A;  4G77 A;  4QSE A;  2AYS A;  4C1U A;  2F6G A;  2XXY A;  1EZP A;  2B4L A;  5IGA A;  3ONM A;  3O97 A;  2GHB A;  2B65 A;  3A09 A;  3CSG A;  2NUV A;  5ET8 A;  3F11 A;  3G7W A;  2G93 A;  5IZZ A;  1IXI A;  4RXL A;  4EXK A;  1M5E A;  3C33 A;  1PB9 A;  2I4B A;  5ESY A;  2DQV A;  1QUK A;  4ELO A;  2FVZ A;  2V84 A;  4GFR A;  3I6V A;  1LBZ A;  1SDX A;  4PAK A;  2DXR A;  4X1D A;  4ESX A;  3FD3 A;  3SEW A;  3DM0 A;  5JTY A;  3CIJ A;  4G68 A;  1P1W A;  1EU8 A;  1YPN A;  4OEN A;  3MW0 A;  2F78 A;  3UN6 A;  5I57 B;  4GBV A;  2CMO A;  3PUW E;  3RGY A;  1NKX A;  3TEL A;  3FGS A;  2VOZ A;  1FQE A;  1B7Z A;  1LFG A;  4I3Y A;  4PBQ A;  3SES A;  2OLB A;  1NUW A;  4ZS9 A;  1QGX A;  1B3G A;  2GRV A;  2KLF A;  4IO5 A;  4PC9 A;  1D4N A;  1B4H A;  2XX7 A;  5I84 A;  1FQF A;  4YKJ A;  3RYD A;  3FVG A;  4FOR A;  3ISP A;  4R2F A;  1MY0 A;  2XWK A;  3MZ9 A;  3TAJ A;  1CNQ A;  4P9K A;  2P1S A;  2Z8F A;  3FIR A;  4ZZE A;  2DXY A;  5EQ7 A;  5JK4 A;  4FEB A;  3PPR A;  1B5J A;  5CC2 A;  1HSE A;  5LOM A;  3MP8 A;  1FPK A;  5FHO A;  2DE4 A;  4NED A;  3OXN A;  1SI1 A;  1US5 A;  3IB0 A;  3G3F A;  2R71 A;  1URD A;  1SW2 A;  2Q88 A;  1OVB A;  3OO7 A;  1NV2 A;  3IJX B;  2YLN A;  3ODB A;  1Q35 A;  5DEX B;  1LB8 A;  3T22 A;  4OZ9 A;  1MXW A;  2I58 A;  2QVR A;  2XA5 A;  2CEY A;  4GWO A;  2RCB A;  1BIY A;  3M3L A;  1NI9 A;  3E13 X;  1FQC A;  1GV8 A;  5FBP A;  4OTE A;  1JEU A;  4Q0C A;  4EF2 A;  1SD3 A;  3RPL B;  1WOD A;  4ISU A;  3MPK A;  5ISU A;  2RF1 A;  3ZSF A;  5I57 A;  5HM4 B;  1LAH E;  1HSL A;  2XWO A;  4N8G A;  1YCJ A;  4OFL A;  1NH7 A;  2FBP A;  3K6X A;  2HAU A;  2WBB A;  3LC8 A;  3IOW A;  2XD2 A;  1M5D A;  1USY H;  2VT5 A;  2XX9 A;  1FJ6 A;  3GLB A;  5JTY B;  3C34 A;  1EZO A;  4ZED A;  5DTB A;  1BKA A;  4AB6 A;  3C32 A;  2CZL A;  2PBW A;  3FV2 A;  5TU0 A;  3RY3 A;  1LST A;  4AQ4 A;  3O6I A;  3IOV A;  2ZMB A;  3TTK A;  5CMK A;  5K2X A;  1NV5 A;  1QUJ A;  4F22 A;  3UP9 A;  4LQ5 A;  1MDP 1;  2E1S A;  2QVU A;  3N6U A;  4H8I A;  4MH5 A;  2D21 A;  2V93 A;  4ZE8 A;  3PPO A;  1QKA A;  2HXR A;  2XXT A;  5H8S A;  3V89 B;  1FCK A;  4MLQ A;  3S9E A;  2UVG A;  3PPN A;  3EHS A;  4BDN A;  1M5C A;  1G0H A;  4KYD A;  5KDT B;  3HO7 A;  1POT A;  1OIB A;  5AA2 A;  3KSX A;  4BDM A;  1IXH A;  4EQB A;  4N13 A;  3IFC A;  1M5F A;  1TXF A;  2ZNT A;  4R6H A;  3AXF A;  4C1T A;  2ZZX A;  1MH4 A;  3SEV A;  1A55 A;  4JWY A;  1MY3 A;  3BFU A;  4P0G A;  2V3U A;  4F1Y A;  5EYG A;  2PT1 A;  3VDF A;  1SW4 A;  5CBS A;  2VD2 A;  4PTK A;  4E0X A;  1B58 A;  1MDQ A;  2QS1 A;  3B7D A;  1SYI A;  3P7I A;  3PV0 E;  3DP4 A;  4H6D A;  4JXI A;  1NH8 A;  4N8Y A;  3CG1 A;  4UAC A;  4LON B;  1SW1 A;  1FQB A;  4GQO A;  3MZ1 A;  3S2V A;  5H8F A;  3TCF A;  4PDD A;  2OCU A;  5I58 B;  2CEX A;  4NE4 A;  4I62 A;  1DPE A;  4YU0 A;  5TP9 A;  1MQG A;  4F3G A;  2HCA A;  4KR5 A;  4OAN A;  5I56 A;  4NQ8 A;  3T66 A;  2GFE A;  3O9P A;  3USD A;  4R73 A;  2F36 A;  1FBD A;  1SVX B;  3G3K A;  3IAZ A;  3KFM A;  1GTK A;  4I40 A;  4N4U A;  4P8B A;  1DBZ A;  4U4X A;  5EYH A;  3JZJ A;  3U92 A;  4NF8 B;  1MM6 A;  3GBA A;  1XHY A;  2ABH A;  1MQD A;  3V8X B;  4IO7 A;  4KYE A;  4EUO A;  3EHT A;  2DVZ A;  1BP5 A;  4BDO A;  2L5V A;  4DXC A;  3LR1 A;  5IZ3 A;  1Y4T A;  2DWJ A;  4U1O A;  1LGB C;  1NUX A;  2IA4 A;  1DCU A;  1DPP A;  4HS7 A;  4TLM B;  4YIC A;  1B05 A;  3PTY A;  4FED A;  1NFT A;  4WKM A;  5IZ1 A;  4RPO A;  4PP0 A;  4NN3 A;  1WDN A;  2RC8 A;  2PCR A;  4BLA A;  2HZL A;  1FTJ A;  3H7M A;  4XKQ A;  4MCO A;  2G29 A;  3CRB A;  3CHG A;  3TFL A;  2PFY A;  1IIT A;  3IL1 B;  1SBP A;  3QXM A;  4NX1 A;  3RTF B;  1A8F A;  4OES A;  4OEU A;  3UIF A;  4O94 A;  1NV0 A;  2XXV A;  3MVY A;  3RT8 A;  3R6U A;  2HPG A;  3LUZ A;  3U93 A;  1LLS A;  1H44 A;  1UIV A;  3T96 B;  3TZA A;  1OQG A;  4MEV A;  4O3B A;  1FQA A;  1FJ9 A;  4NF6 B;  4F39 A;  2OK2 A;  2BJJ X;  4U21 A;  2RKM A;  2RIN A;  4R75 A;  4GL8 A;  1GVC A;  4QRZ A;  3H06 B;  3QMF A;  4R2B A;  3H4Z A;  4I3E A;  5IKB A;  1FW0 A;  3KOT A;  2RC7 A;  4MF3 A;  1QUI A;  1P1U A;  2XXW A;  1CE2 A;  2XX8 A;  4H1X A;  3ZS6 A;  4PFI A;  2RCA A;  2ANJ A;  1LAF E;  3OEM A;  4FEC A;  3R26 A;  3EF7 A;  3TYH A;  2UXA A;  1J1N A;  4OYV A;  4KPT A;  1I6Q A;  3IX1 A;  2DWI A;  2OBG A;  3MPL A;  4EQ9 A;  3VXB A;  1US4 A;  3KBR A;  3W9W A;  1MH3 A;  4LZ7 A;  4MFI A;  4QFO A;  4PFT A;  1KA0 A;  3ROJ A;  1B5I A;  2DS9 A;  1FPE A;  1N0T A;  4YZZ A;  2Y84 A;  1Y20 A;  1B0L A;  2ZZV A;  2XXH A;  3R7X A;  1JEV A;  1P99 A;  3BKI B;  3PD8 A;  5AA2 B;  2I3V A;  2CZK A;  1PB8 A;  3IFA A;  4F2Q A;  4O8M A;  4OHN A;  1TFD A;  3CR9 A;  1ZTY A;  3FBP A;  3KSJ A;  4NG7 A;  1AL3 A;  4AB5 A;  3HN0 A;  3TOD A;  2R9J A;  4YKI A;  3MST A;  4JWX A;  4KFQ A;  4MJO A;  4N91 A;  4GX6 A;  2PX1 A;  1AIV A;  2Y7W A;  2UVJ A;  3C4M A;  2QS2 A;  3HHG A;  3RUM A;  5B7D A;  5FHM A;  4OVS A;  1UTH B;  1MQJ A;  4FE8 A;  3IB1 A;  4F3P A;  3KG2 A;  4YMA A;  5ET6 A;  4LN5 A;  3KN8 A;  1ZMG A;  2DP8 A;  4LVQ A;  4RYA A;  4IGT A;  1L5T A;  2I3W A;  5DVF A;  5DW8 A;  4GWW A;  3K6V A;  4G2Z A;  1UTH A;  4Q8R A;  1FPF A;  2H99 A;  1Q1K A;  1JW1 A;  3S9N C;  2ZYN A;  2B4M A;  1IIW A;  3SDF A;  2DWH A;  1I6A A;  2B3F A;  2V4C A;  5I2N A;  2D3I A;  2Z8E A;  1Y4C A;  1ZIU A;  1FPB A;  4DIG A;  1NUY A;  3EQ1 A;  3IOT A;  4QSD A;  2QMX A;  2A5S A;  1I69 A;  1UTB A;  3SKP A;  4LP2 B;  3LSF B;  1N76 A;  4H5F A;  5F7V A;  2QJE A;  3KGC A;  1Y9U A;  2VPN A;  4IO3 A;  4XEQ A;  2WYP A;  1LEV A;  4IR8 A;  2ONK E;  4PF8 A;  4P1L A;  2Q89 A;  1FBE A;  2X7P A;  4KI0 E;  4F1U A;  3ILT B;  3OEN A;  1ZKB A;  1LCF A;  1SW5 A;  1NUZ A;  1Y1M A;  3OMB A;  2Z22 A;  2Y5K A;  5HBC A;  4OVQ A;  4E0W A;  3S9L C;  1USY E;  1ANF A;  2FIX A;  1UQW A;  1DTG A;  1D3K A;  1QUL A;  3EHU A;  4POW A;  4XTC Q;  4JB7 A;  1KZ8 A;  3LSL A;  2PYY A;  3A3C A;  3G3H A;  2I49 A;  4RPN A;  2O69 A;  2HFB A;  4M4G A;  3U65 A;  1MXZ A;  3LSX A;  4ZEI A;  3PPP A;  3S9M C;  4NAP A;  5EQ9 A;  2AL4 A;  1NV6 A; 
#chains in the Genus database with same CATH homology
 4H65 A;  4JWY A;  1MY3 A;  2ONS A;  4MLV A;  2Q2C A;  3C9H A;  2I0B A;  3FXU A;  3IO4 A;  3BFU A;  3K01 A;  1O7T A;  4U2R A;  4P0G A;  4ELR A;  1AOV A;  3LUY A;  2V3U A;  4F1Y A;  1P1Q A;  3C35 A;  4PE5 B;  3N6T A;  1T0K A;  1O63 A;  3I3V A;  3FUZ A;  3QSL A;  1LCT A;  2PT1 A;  1OQH A;  3JYR A;  3VDF A;  1SW4 A;  4YAH X;  3WAE A;  5CBS A;  2DE2 A;  5H8H B;  4OWD A;  2VD2 A;  5CBR A;  3ECR A;  3O29 A;  4E0X A;  1IEJ A;  1B58 A;  4ESW A;  3FZV A;  3DP6 A;  3HPI A;  4G8M A;  5M2V A;  1MDQ A;  1VE4 A;  2O1L A;  3K2D A;  2QS1 A;  2H5Y A;  1XOC A;  1YAE A;  1SYI A;  3B7D A;  3DLN A;  3O28 A;  4NTL A;  3P7I A;  5L9S A;  2THI A;  3PV0 E;  4NF6 A;  5KDT A;  3CVG A;  3DP4 A;  1B46 A;  4LZ8 A;  1TWY A;  3RT6 B;  3MBP A;  4H6D A;  1A7L A;  3K1M A;  3QUJ A;  4GL0 A;  3QUF A;  4JXI A;  1NH8 A;  5H8N A;  1FTL A;  3RLF E;  1WVJ A;  3IOU A;  3TUS A;  2YPN A;  3CG1 A;  3G3J A;  4UAC A;  5A5X A;  2FYI A;  4OER A;  4U4S A;  1N7X A;  3LBS A;  3BBR A;  4LON B;  4G4P A;  4XXU A;  4ECF A;  5I56 B;  1A8E A;  1SW1 A;  1FQB A;  3IOR A;  3D4G A;  1URS A;  2Q9T A;  2A5T A;  3FAT A;  3MZ1 A;  3PPQ A;  4GQO A;  4RNS A;  1H43 A;  4XKP A;  3S2V A;  3TCF A;  5H8F A;  5TPA B;  1JNF A;  4P11 A;  3G3G A;  4THI A;  5DVJ A;  1Y3Q A;  1OVT A;  5L8D A;  3TQW A;  4Q30 B;  3E9X A;  5KZT A;  4IO6 A;  2OCU A;  2FA7 A;  4Z7E A;  2E0S A;  1Y3P A;  3M3F A;  4OVJ A;  2X26 A;  4NE4 A;  1PB7 A;  4XKN A;  4I62 A;  3JV9 A;  3PMX A;  2VGQ A;  5I58 B;  5I59 B;  5JEI A;  1DPE A;  1N04 A;  1ZU0 A;  3I5O A;  4LZ5 A;  4PQJ A;  1NNF A;  1ZBM A;  4YU0 A;  5TP9 A;  4EDP A;  4OMB A;  4PFY A;  3PU5 A;  1MQG A;  2I0C A;  4F3G A;  1MRP A;  1URG A;  4TQU Q;  1MPB A;  1MQI A;  4TOZ A;  5H8Q A;  3RN8 A;  4DZ1 A;  2HCA A;  2W7Y A;  1MY2 A;  4EQ7 A;  1YTV A;  3MVZ A;  2QL3 A;  4KR5 A;  4IO4 A;  5DT6 A;  4ZEK A;  3VVE A;  2I48 A;  3GBB A;  3Q25 A;  5I56 A;  1S9T A;  1RYO A;  3OOA A;  1EH3 A;  1MM7 A;  3HST A;  1ATG A;  4FIM A;  3T66 A;  4OEV A;  1S7Y A;  3OSR A;  5L9O A;  2GFE A;  3O9P A;  2Z23 A;  3K00 A;  3USD A;  4R73 A;  3VE1 B;  2RC9 A;  4R9G A;  4LA9 A;  2H9B A;  3PD9 A;  5AA4 B;  3FJG A;  2F36 A;  4DXB A;  1MXX A;  3MC2 A;  4H0W A;  4RY1 A;  3TEP A;  2V25 A;  1B6H A;  1B9J A;  1SVX B;  3G3K A;  3V5A A;  3IAZ A;  3KFM A;  1GTK A;  1B1H A;  2O51 A;  3RNN A;  4FAJ A;  2HQ0 A;  4R6Y A;  3M8U A;  4U1Z A;  5DYH A;  2NVU B;  3RTW B;  4U4X A;  4N07 A;  1VR5 A;  2QRY A;  4DCY A;  2DWA A;  3JZJ A;  3K1N A;  3LSW A;  3U92 A;  4NF8 B;  2ESN A;  1JW5 A;  3MVX A;  2QS4 A;  1GR2 A;  2ZNS A;  4O3C A;  3IB2 A;  1MM6 A;  1PDA A;  1QKB A;  1SYH A;  3M3K A;  4HW8 A;  5I2N B;  5I58 A;  5I59 A;  1LAG E;  3O66 A;  3GBA A;  1MPD A;  3FVN A;  4YKK A;  1XHY A;  4WXJ A;  3HV1 A;  3O6H A;  1R9Q A;  2H25 A;  2Y7K A;  3TKD A;  2ABH A;  1MQD A;  2F7B A;  5IAI A;  3PUY E;  4KCC A;  3QIM A;  4JSD A;  4IO7 A;  1B2H A;  4ZE8 A;  4KYE A;  5TPA A;  1Y1Z A;  3PMV A;  3T9H B;  2A5T B;  3EHT A;  3UA8 A;  4EUO A;  2ALU A;  1DTZ A;  2DVZ A;  4F2O A;  2ZYO A;  2P2A A;  1BP5 A;  2XXX A;  4YB6 A;  1AMF A;  2V3Q A;  4BDO A;  4YKP A;  5CMM A;  4DXC A;  3LR1 A;  3Q26 A;  2Y7R A;  1M5B A;  1GGG A;  2XXU A;  3UOR A;  2ONR A;  2HAV A;  1Y4T A;  1Y3N A;  2DWJ A;  1LGB C;  4OQO A;  4U1O A;  4GF8 A;  3SET A;  3H6U A;  1IUD A;  2IA4 A;  1UTB B;  1B40 A;  1DPP A;  5HPQ A;  4HS7 A;  3VLV A;  4TLM B;  4YB5 A;  4YIC A;  1PC3 A;  3MP1 A;  2OWS A;  5DEX A;  1B05 A;  2WKY A;  1QVS A;  1R1N A;  3MAM A;  4FED A;  1NFT A;  3FXR A;  4WKM A;  5AA4 A;  4PET A;  5FTH A;  4DE8 A;  4RPO A;  4PP0 A;  5F1Q A;  2Y7I A;  2DSF A;  1WDN A;  3IO6 A;  1MQH A;  2RC8 A;  5H8H A;  4ND9 A;  1F9B A;  2Z8D A;  2HZL A;  3C36 A;  3L6G A;  1FTJ A;  3H7M A;  4PFW A;  5FTI A;  4BLA A;  1IQ7 A;  4XKQ A;  2FNC A;  4QSC A;  3K6W A;  5I2K A;  4NWD A;  1LB9 A;  3QAX A;  3U1O A;  4DDD A;  1MS7 A;  2O7I A;  3H6V A;  2G29 A;  1H45 A;  2XXQ A;  2ZXT A;  3CRB A;  3PUX E;  4GXS B;  3TFL A;  5ICT A;  1LBB A;  5I2K B;  2QS3 A;  2DE3 A;  3EN3 A;  4Q5T A;  3K4U A;  3SEY A;  1IIT A;  4UA8 A;  1B4Z A;  2ZNU A;  3SER A;  2DVC A;  2Y7P A;  3EPE A;  1IZ1 A;  1MG1 A;  1MXU A;  4H67 A;  3IL1 B;  3KOS A;  3FVO A;  4EF1 A;  5KCJ A;  1SBP A;  3QXM A;  4FJP A;  3OSQ A;  2DOJ A;  3OO9 A;  1LFI A;  3OD7 A;  4NF8 A;  1AH5 A;  1A8F A;  1LAX A;  2O84 X;  3CSB A;  4OES A;  4X48 A;  4X9T A;  3RTF B;  4OEU A;  3SEX A;  4OXV A;  1SQY A;  1MXY A;  4QF9 A;  1N3W A;  1II5 A;  1FTM A;  1JW4 A;  1NL5 A;  3GZG A;  2AL5 A;  4G77 A;  4JSO A;  3VXC A;  1DSN A;  1S50 A;  4QSE A;  2XXV A;  3MVY A;  2AYS A;  4C1U A;  4P0I A;  2F6G A;  3RT8 A;  2XXY A;  3R6U A;  2REG A;  1EZP A;  3U93 A;  1LLS A;  1N7W A;  3UIF A;  4DLD A;  5EYF A;  3V83 A;  1H44 A;  1UIV A;  3PUZ E;  3ONM A;  3O97 A;  3MQ9 A;  3T96 B;  2XXP A;  2GHB A;  2B65 A;  2F97 A;  4L17 A;  4NF4 A;  3TZA A;  2PVU A;  1OQG A;  1P1O A;  3A09 A;  3CSG A;  4O3B A;  1QW0 A;  2F35 A;  1JVY A;  3G3I A;  1FQA A;  4KHZ E;  1B3E A;  2NUV A;  4KYS A;  3E3K A;  4IGR A;  4NF6 B;  4F39 A;  2OK2 A;  1XC1 A;  2BJJ X;  3CG3 A;  4U21 A;  2RKM A;  1H76 A;  1DOT A;  1JVX A;  2RIN A;  3F11 A;  3G7W A;  2G93 A;  4GL8 A;  4H5G A;  4IY5 A;  4R75 A;  1IXI A;  4R9F A;  4QRZ A;  4ZEB A;  1GVC A;  4RXL A;  5EHM A;  3H06 B;  3TTL A;  1B1X A;  4KD5 A;  4EXK A;  4R2B A;  1M5E A;  3C33 A;  1PB9 A;  3H4Z A;  4RK9 A;  5IKB A;  5CMC A;  4RJZ A;  1FW0 A;  3KOT A;  3H3G A;  2I4B A;  1POY 1;  1XS5 A;  2DQV A;  3MUQ A;  2RC7 A;  4MF3 A;  4BDR A;  4ZZA A;  1QUI A;  1Z7N E;  2XHD A;  1QUK A;  4ELO A;  1P1U A;  2XXW A;  1CE2 A;  2V84 A;  2XX8 A;  3MP6 A;  4GFR A;  4QFL A;  5CRY A;  3TMG A;  4F1V A;  4F3B A;  3I6V A;  4H1X A;  3ZS6 A;  5A5X B;  3IJO B;  1N3X A;  2RCA A;  2ANJ A;  1SDX A;  3W9V A;  5H8N B;  2DXR A;  1LAF E;  3OEM A;  4FEC A;  4X1D A;  4ESX A;  1NNK A;  3R26 A;  3EF7 A;  3FD3 A;  3SEW A;  2Q8J A;  3DM0 A;  4NWC A;  1FTO A;  3TYH A;  4EXL A;  5JTY A;  3CIJ A;  2REJ A;  1ZJL A;  5K2Y A;  3KJ7 A;  1EZ9 A;  4G68 A;  3N5L A;  2DYX A;  4M1V A;  4OET A;  2UXA A;  1J1N A;  2XXI A;  1P1W A;  4OYV A;  5ICQ A;  3CFZ A;  4U22 A;  1EU8 A;  1YPN A;  3E4R A;  4KPT A;  4NMY A;  1I6Q A;  4OEN A;  4QHQ A;  5ELV A;  1R6Z A;  2VP1 A;  5AA2 D;  3IX1 A;  2DWI A;  2OBG A;  3MPL A;  3V8X B;  1ZLQ A;  3MW0 A;  4QFK A;  4EQ9 A;  2F78 A;  1US4 A;  4QFP A;  3UN6 A;  3VXB A;  4JWO A;  5I57 B;  2F7C A;  4GOT A;  2QSX A;  2CMO A;  3KBR A;  3U94 A;  3W9W A;  2PMS A;  2QPQ A;  1MH3 A;  3PUW E;  1CB6 A;  4LZ7 A;  4MFI A;  4ONY A;  4TLL B;  1NKX A;  3RGY A;  3TEL A;  4QFO A;  3FGS A;  2M8C A;  4MBP A;  2VOZ A;  4PFT A;  5CM6 A;  1FQE A;  4I1D A;  4OFO A;  1B7Z A;  1B5I A;  1IXG A;  2B3B A;  1LFG A;  1B32 A;  2R6G E;  5B70 A;  2DS9 A;  1B5H A;  1MXV A;  1XVX A;  4F18 A;  1N0T A;  3SES A;  3K1P A;  4YZZ A;  4ZEC A;  2Y84 A;  1TT1 A;  3TDJ A;  2OLB A;  5ITO A;  1OLC A;  1Y20 A;  2AIX A;  3OO8 A;  2D5W A;  2NXO A;  4ZS9 A;  1B0L A;  3O2A A;  1MPC A;  1B3G A;  1BLF A;  2XXH A;  3D4C A;  2GRV A;  3PGF A;  1JEV A;  1P99 A;  5EHS A;  2KLF A;  3BKI B;  3PD8 A;  3R7X A;  5AA2 B;  1JET A;  2I3V A;  4IO5 A;  1HSJ A;  3UGW A;  1D4N A;  1B4H A;  1PBP A;  3O6G A;  3Q27 A;  1VSO A;  3WAF A;  2XX7 A;  1PB8 A;  3FVK A;  3UK4 A;  3ZKK A;  5I84 A;  1JQF A;  4F2Q A;  1FQF A;  4YKJ A;  4OHN A;  4POX A;  1TFD A;  4GRK A;  3FVG A;  4FOR A;  4U23 A;  1UIU A;  4R2F A;  1MY0 A;  1FTK A;  4IO2 A;  1NMU A;  5BUU A;  3MZ9 A;  3TAJ A;  3CR9 A;  1B0H A;  3CFX A;  3KEI A;  1DMB A;  2P1S A;  2OZZ A;  1ZTY A;  1B3F A;  3VVD A;  4I9D A;  3KSJ A;  2Z8F A;  3FIR A;  2F7A A;  3FXQ A;  4ZZE A;  3K02 A;  1AL3 A;  4AB5 A;  2NWJ A;  4ZDM A;  2DXY A;  2I4C A;  1QJM A;  2O1M A;  3HN0 A;  3TOD A;  5JK4 A;  3IK6 B;  4FEB A;  2R9J A;  3Q28 A;  3PPR A;  3TPA A;  4YKI A;  1B5J A;  4HCW A;  4JWX A;  4KFQ A;  5CC2 A;  3A3U A;  1HSE A;  5LOM A;  3N26 A;  3T9X B;  1PEB A;  4NF5 A;  3GXA A;  2PX1 A;  3N94 A;  2GH9 A;  3MP8 A;  3VLU A;  1AIV A;  5FHO A;  2Y7W A;  3U72 A;  2UVJ A;  3C4M A;  3U8Q A;  1Z7M E;  2QS2 A;  2DE4 A;  3CI8 A;  1D9V A;  4NED A;  3HHG A;  3OXN A;  2XXR A;  3RUM A;  5B7D A;  5FHM A;  3OEK A;  1B51 A;  1SI1 A;  1US5 A;  3IB0 A;  3KZG A;  1UTH B;  3G3F A;  4R72 A;  2R71 A;  3RQT A;  1URD A;  4RA1 A;  1MQJ A;  5ITP A;  4FE8 A;  1SW2 A;  3IB1 A;  2Q88 A;  5J1D A;  1OVB A;  1VFD A;  4F3S A;  3KG2 A;  4F3P A;  4YMA A;  4X1B A;  3OO7 A;  2O7U A;  3KN8 A;  4I8C A;  1R9L A;  1B52 A;  3B6W A;  2VHA A;  1ZMG A;  2DP8 A;  2F5X A;  5CMB A;  4LVQ A;  5AA1 A;  3IJX B;  2YLN A;  3ODB A;  3KN7 A;  1Q35 A;  2UVI A;  4RYA A;  3S4U A;  3TCH A;  3B6Q A;  5DEX B;  1LB8 A;  1IXC A;  3T22 A;  4IGT A;  1B7U A;  5H8Q B;  4OZ9 A;  4BDL A;  1MXW A;  2I3W A;  2I58 A;  4KQP A;  5DVF A;  1L5T A;  3THI A;  5BWJ A;  4GD5 A;  3VFJ A;  4GWO A;  2UVH A;  2Q2A A;  2RCB A;  4WED A;  1BIY A;  2H98 A;  3K6V A;  2ZYM A;  3M3L A;  3E13 X;  1UTH A;  4G2Z A;  4Q8R A;  4JDF A;  1FQC A;  3OO6 A;  5KCJ B;  4R6K A;  2H99 A;  1GV8 A;  1Q1K A;  1JW1 A;  2P0S A;  3S9N C;  4OTE A;  1JEU A;  1B3L A;  2ZYN A;  1P1N A;  3KJT A;  4F19 A;  4Q0C A;  4EF2 A;  1SD3 A;  1WOD A;  4PFU A;  1IIW A;  1RKM A;  3VLW A;  4ISU A;  3FJM A;  3SDF A;  4DXU A;  4NF5 B;  3MPK A;  1LBC A;  2RF1 A;  2OWT A;  2DWH A;  3TQL A;  3B6T A;  5ISU A;  3ZSF A;  3T9U A;  4LQ2 A;  1I6A A;  2B3F A;  3T93 B;  5I2N A;  5I57 A;  5HM4 B;  4OFJ A;  3VV5 A;  4YMB A;  1LAH E;  1HSL A;  2D3I A;  1A40 A;  2HZK A;  4G8N A;  2Z8E A;  1Y4C A;  2F6P A;  3FV1 A;  1YCJ A;  1SI0 A;  4OFL A;  1NNP A;  1NH7 A;  1OLA A;  2XD3 A;  3FJ7 A;  1ZIU A;  4BDQ A;  2O6A A;  3K6X A;  2HAU A;  2NOO A;  4DIG A;  3LC8 A;  3EQ1 A;  4Z0I A;  3IOW A;  2XD2 A;  1M5D A;  2GHA A;  1USY H;  4G68 C;  4YB7 A;  3HHF A;  3SEU A;  2XX9 A;  3GLB A;  1B3H A;  3QYT A;  3IOT A;  4QSD A;  2F8D A;  2QMX A;  2A5S A;  1I69 A;  2UYF A;  5JTY B;  4ELQ A;  1UTB A;  3C34 A;  3CFL A;  1EZO A;  1PBQ A;  3PUV E;  4IB2 A;  4ZED A;  5DTB A;  3SKP A;  4ELP A;  1BKA A;  4NF4 B;  4AB6 A;  3C32 A;  4GLI A;  3LSF B;  4LP2 B;  2CZL A;  2PBW A;  1XT8 A;  4GVO A;  3MJN A;  3FV2 A;  5TU0 A;  4QFN A;  3KN3 A;  2I6E A;  3RY3 A;  1NNT A;  4O3A A;  1LST A;  1N76 A;  4H5F A;  5F7V A;  1MY1 A;  2QJE A;  4KCD A;  5FHN A;  3MZB A;  4GXA A;  3IR1 A;  3KGC A;  1D9Y A;  3HCQ A;  1Y9U A;  3O6I A;  3TTM A;  3IOV A;  4AQ4 A;  2H4I A;  2ZMB A;  3TTK A;  3PMW A;  4IO3 A;  5K2X A;  5CMK A;  3K6U A;  3MVW A;  1QUJ A;  4K3F A;  5TP9 B;  4F22 A;  3UP9 A;  3QK6 A;  4G8H A;  2O68 A;  3DP8 A;  3K0V A;  4LQ5 A;  1MDP 1;  2E1S A;  3RPW A;  3N6U A;  3OEL A;  4H8I A;  4MH5 A;  2ONK E;  2HXW A;  1TFA A;  3C31 A;  2D21 A;  2Q89 A;  2V93 A;  1I6B A;  1A99 A;  2X7P A;  1QKA A;  3ILU B;  1FQD A;  3BFT A;  3PPO A;  4KI0 E;  3ILT B;  3OEN A;  2XXT A;  4F1U A;  1VFE A;  1ZKB A;  5H8S A;  2V3T A;  1LCF A;  1SW5 A;  1FCK A;  3V89 B;  2ZYK A;  4MLQ A;  1Y1M A;  3L6H A;  3OMB A;  2Z22 A;  5H8F B;  3TCG A;  4LAT A;  4XIG Q;  4DCX A;  4FAT A;  3S9E A;  1O64 A;  1MY4 A;  2YJP A;  5HBC A;  3W15 C;  4E0W A;  3S9L C;  2UVG A;  2LAO A;  3PPN A;  1USY E;  4XKR A;  4ZE9 A;  1ANF A;  1LFH A;  4HTG A;  1UQW A;  1DTG A;  3FAS A;  1D3K A;  2UYE A;  5CI5 A;  3EHS A;  1QUL A;  3H6W A;  3DEL B;  3T9V A;  4BDN A;  1M5C A;  3MWB A;  4GIZ A;  4ZEF A;  3EHU A;  4WEP A;  4KYD A;  4IY6 A;  4F29 A;  2IEE A;  5AA3 A;  5KDT B;  3H03 A;  3H6T A;  3HO7 A;  4POW A;  1POT A;  3TTR A;  4XTC Q;  1OIB A;  2VD3 A;  4G68 B;  3LSL A;  4JB7 A;  4RK2 A;  5AE4 A;  1OMP A;  2PYY A;  3A3C A;  5AA2 A;  3KSX A;  3G3H A;  2PT2 A;  4BDM A;  1IXH A;  3TTN A;  4LUB A;  1B7H A;  2I49 A;  4EQB A;  4C0R A;  4N6P A;  1XVY A;  4N13 A;  4R74 A;  4RPN A;  2O69 A;  4H8J A;  5L9M A;  4F31 B;  1ELJ A;  1M5F A;  1N84 A;  1TXF A;  2HFB A;  2QMW A;  4M4G A;  1A54 A;  2HEU A;  2OJT A;  1MXZ A;  2F34 A;  2ZNT A;  3Q29 A;  3AXF A;  4JBZ A;  3LSX A;  4R6H A;  1BTJ A;  3PPP A;  4ZEI A;  3ZKL A;  1MH4 A;  1H3D A;  3SEV A;  4C1T A;  3S9M C;  2X7Q A;  3VVF A;  1KWH A;  5DVI A;  2AL4 A;  1A55 A;  4HCY A;  1RYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...