4R6HA

Crystal structure of putative binding protein msme from bacillus subtilis subsp. subtilis str. 168, target efi-510764, an open conformation
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
394
structure length
394
Chain Sequence
ADTAKKTLTIYSTMSTDSERDTFRKLAAAFEKEHSDIHVSLHFPGNDYENMMRVRMAANDLPDLFDTHGWGKIRYGEYTADLRDMKWTQDLDPNLNSILKNKSGKVYAYPINQAKDGLAYNRNILDRYGIAPPETMDDFIKALRTIKEKSKGSIVPFWFAGYDKSSFAQYYDQFATPLLITDPAHNEKKQLINGTFQWSKFTYLSEILKQMQKEKLINIDAVTAKKSQLIELMAQNKIAFTMQGGTLGQDVAQINPNVKVGIIPTPAIHPGDDPIWIGGERYTLAAWKDSPQLKEAKDFIAFMARPANAKQMAEATSLPSGLTNVKADIFYANDYEYYQDVKVEPYFDRLYLPNGMWDVLGTVGQELAADILAPQDISQKLGREYKRLREQSET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Solute binding protein MsmE
publication title Crystal Structure of Transporter Msme from Bacillus Subtilis, Target Efi-510764
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 147
structure length 394
sequence length 394
ec nomenclature
pdb deposition date 2014-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r6hA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r6hA02
4Q5TA 4ZS9A 5H8FB 2GRVA 1L5TA 3RNNA 1H76A 4OENA 2B3BA 5ITPA 4EXLA 2X7QA 3AXFA 1IZ1A 4F2QA 4R2FA 1QUJA 3U93A 3K6UA 1N7WA 1IUDA 4LATA 2UVHA 3EPEA 5I2NB 1JW4A 4QFOA 2O1LA 4KCDA 4I62A 2OLBA 3ZKLA 2UVGA 1MXZA 2PBWA 3GBBA 3UN6A 4U21A 2F78A 3BFUA 2DE3A 1Z7ME 2THIA 3IK6B 3N26A 4H0WA 3TFLA 2P0SA 1FTLA 3CI8A 2DE4A 1Y4CA 4YB5A 1MPBA 3S9LC 2I3WA 3HHFA 3MC2A 1B5IA 3K6XA 4PFYA 4R74A 4XTCQ 3EHTA 5EHMA 1DTGA 3C34A 3MZ1A 3BKIB 3O97A 5ITOA 3IOWA 2HQ0A 3KFMA 4E0WA 5H8NB 3CVGA 1JW1A 3IOUA 4F1VA 4WEDA 3LC8A 4OFJA 2Q88A 1ELJA 3K01A 4Q30B 3IO4A 5I58B 2F34A 3IOTA 3M3KA 1J1NA 3K2DA 3H6WA 5I59B 2UYFA 2XXPA 1B4ZA 1FTMA 1IIWA 5AA2A 3VLWA 4YICA 5TU0A 4EUOA 4G4PA 4EXKA 3FJ7A 3KN3A 2F35A 4U4XA 4RPOA 1SI1A 1H45A 4OXVA 4R75A 2RKMA 1LGBC 1B46A 3U92A 4IO4A 3K1PA 5ELVA 4MH5A 1OIBA 4XIGQ 1QUKA 3MBPA 4DXBA 4H8IA 3FJGA 4THIA 4H8JA 4GWOA 2G29A 1MH3A 4GVOA 5AA4B 3OO6A 3OO7A 3IOVA 4QSCA 2CZLA 1GR2A 4OHNA 5ICTA 5JK4A 4U1OA 3T9VA 1D9VA 3K0VA 4YB6A 1NL5A 2H9BA 3MAMA 4KHZE 3SDFA 1LFGA 4QFLA 3UGWA 2UVIA 1R9LA 1PDAA 3RT8A 2DYXA 2I0BA 4GF8A 1QJMA 1IXCA 4R73A 1QULA 1FTKA 5CM6A 3G3GA 5JTYA 1N3WA 3T9HB 1CE2A 3HSTA 3P7IA 4OETA 4FJPA 3KSXA 3IJOB 4TLLB 3FGSA 4NF6B 3KZGA 3THIA 3OEKA 5CBSA 4YKIA 3H4ZA 4IB2A 3FD3A 4OMBA 4YMBA 1WODA 1XT8A 4YAHX 3PMVA 3CG3A 5HM4B 4FIMA 4Q8RA 4EDPA 4ISUA 4JSOA 3KJ7A 2GFEA 4GLIA 1DPPA 5BWJA 2B65A 4EQ9A 4I9DA 4NWDA 1OLCA 1EU8A 1FQCA 2M8CA 3C32A 1MQGA 2QRYA 3RTWB 4BLAA 1NFTA 5L9OA 1JEUA 1MY3A 4F1YA 1LCTA 4HW8A 1HSLA 3C33A 4TOZA 1IEJA 3G3IA 3MP1A 4O3BA 3L6HA 1O64A 3C36A 3PPPA 3TYHA 4PETA 2IA4A 3FV1A 4RXLA 1P1OA 1N84A 1US5A 2Z8DA 3ILTB 3VLVA 4F2OA 5H8QA 4OEVA 2DWAA 4F1UA 2ALUA 5B7DA 3W15C 2GHAA 5H8SA 2QSXA 4IGTA 2V84A 3FXQA 2XXVA 3OO9A 3PUWE 2HAUA 2DE2A 5H8HB 3FUZA 1SBPA 3RLFE 3DP8A 4ELRA 4NF4A 1ZBMA 3U94A 2F7BA 4XKPA 1P1UA 4DCYA 3ZS6A 1NKXA 2XXRA 2O7IA 3MWBA 1SYHA 5L9SA 4FORA 3SEUA 5AA2D 3TTMA 3HN0A 3Q26A 2DOJA 1A99A 1US4A 3A3UA 2NXOA 4O3AA 3FASA 1N76A 4C0RA 2QS4A 2Y84A 4LVQA 3S4UA 3IL1B 3A09A 3PPRA 4U4SA 1YTVA 4KYSA 1LAXA 2VP1A 3MQ9A 4NF8B 3FVNA 4MFIA 5LOMA 3HCQA 4U2RA 4QFNA 2ONKE 1ZU0A 2GHBA 3OEMA 2H98A 2OBGA 5IAIA 5EHSA 2QMXA 2VGQA 4BDNA 5FHNA 2V3TA 1Y9UA 3TTLA 4ECFA 1B3EA 3UP9A 1H3DA 3E3KA 1M5FA 1QUIA 1GV8A 1FQDA 1OLAA 2Z8FA 1Y20A 1RKMA 3EN3A 3T9UA 4QSEA 5ISUA 3MVXA 1R1NA 1M5BA 1MXYA 3VDFA 3EQ1A 4PP0A 1Y1ZA 2O6AA 4BDQA 3IR1A 4IO6A 3S9EA 4G68A 2REJA 4MF3A 4JDFA 4R6KA 4RK9A 5CC2A 2OWSA 2P2AA 3KN7A 1N3XA 4QFKA 3LSLA 2O84X 1D9YA 2QMWA 5DEXA 1URGA 3CIJA 1UTBB 2RCBA 1EZ9A 4FECA 3UA8A 2XXIA 1QW0A 4LQ5A 3TPAA 2ABHA 2PT1A 4ZEFA 3OOAA 1HSEA 1ZIUA 1A7LA 1FCKA 2R9JA 4KFQA 3TAJA 2ZYNA 3FVGA 3KGCA 3H6TA 3N5LA 4WKMA 3OD7A 3QIMA 2FNCA 4NEDA 1ANFA 3VXBA 3K1MA 4ELOA 3ZKKA 2UVJA 2G93A 2VD3A 4G77A 1GGGA 3FZVA 3DP4A 1LFIA 1OMPA 1PB7A 3TCHA 1GVCA 1JVYA 1IXHA 2I58A 4BDRA 1UIVA 3TEPA 5A5XB 3HHGA 1ZKBA 2NUVA 1MDQA 2Y7PA 3TDJA 3UIFA 3TELA 3GXAA 1B0HA 3FXUA 2X7PA 1RYOA 3IX1A 3KEIA 4L17A 1EZPA 4JWOA 3SKPA 1F9BA 3R7XA 2XD2A 3CFLA 3G3JA 4XKNA 3LBSA 2D5WA 5KDTA 2Y7KA 3O6GA 4ZEKA 1H43A 1MQJA 3PPNA 3IJXB 4ZECA 5I56A 4IY5A 2ZMBA 2F5XA 3QK6A 5H8FA 2ONRA 5L9MA 3VVDA 3K4UA 3S2VA 4I8CA 4ZZAA 1UTHA 5CMKA 4KYDA 4BDMA 1B9JA 1TFAA 1CB6A 2OZZA 4RJZA 4GD5A 2VHAA 2Z22A 4FEBA 4KR5A 3JZJA 2XXTA 5J1DA 1EH3A 3M3FA 3DELB 1S9TA 2DVCA 2VD2A 1LB8A 2H25A 2DSFA 5M2VA 4OESA 2H4IA 4NE4A 4H65A 4QSDA 1Y4TA 3TKDA 4HCWA 1P1QA 1M5CA 3TTKA 2V3UA 2XXYA 1AIVA 3IO6A 3OENA 3EF7A 3RTFB 1IITA 1NNTA 4N07A 2XX7A 4YZZA 3PGFA 1LBCA 3OSQA 1NNKA 3SERA 2B3FA 5H8NA 2QPQA 2XX8A 5CRYA 3SESA 3PMWA 2I6EA 4ESXA 3MP6A 3CFXA 1DTZA 4DXUA 1Y3QA 1BTJA 3SETA 5I58A 1Y1MA 1TT1A 2ZYMA 2X26A 5CBRA 1MDP1 1TFDA 4N6PA 2QJEA 5I59A 3H03A 3T9XB 1A8EA 3U72A 3GZGA 3RQTA 2I0CA 3TUSA 2XXXA 3Q25A 2F6GA 2I49A 3CRBA 3CFZA 4HS7A 3MVYA 4KYEA 1MH4A 1OVTA 1I6BA 1MY4A 4U23A 2DS9A 3TCGA 4R72A 4N13A 2HCAA 3KSJA 1N04A 1B1XA 2I3VA 2PYYA 2YPNA 5HPQA 2AL4A 3E9XA 3F11A 4FATA 1B7HA 4U22A 3SEXA 3KBRA 5TP9B 3SEVA 4ELPA 1VR5A 1MXUA 1LCFA 1D3KA 3TQLA 4WEPA 4LZ8A 3EHSA 1LAHE 1A40A 5AA4A 1B40A 2OK2A 4DDDA 1GTKA 1USYE 1DMBA 1PB9A 4IO2A 4F31B 1YCJA 4RY1A 1Z7NE 3ILUB 2O1MA 5I57A 1XS5A 2RC7A 4RA1A 3USDA 3PUYE 4OEUA 5FHMA 4DXCA 3T22A 3RPWA 2E0SA 3SEWA 1H44A 2Z8EA 3GLBA 3H06B 3U1OA 3TODA 4DCXA 1BKAA 3WAEA 3Q29A 4TLMB 3MJNA 1FW0A 2FYIA 2ONSA 5H8QB 3OXNA 3UK4A 1MY0A 4PE5B 3D4CA 3FXRA 4DLDA 3LSXA 1LBBA 4NF6A 2O7UA 5I2KB 2AYSA 4LZ5A 1SYIA 2PT2A 1QKAA 3MZ9A 2F7CA 5K2XA 2E1SA 3PUVE 3R26A 1B7ZA 4H5GA 3VFJA 4MBPA 3RGYA 1MXXA 1TWYA 5F1QA 1LLSA 4XKRA 1M5EA 4F19A 2FA7A 4NTLA 1MG1A 2KLFA 3PU5A 3T66A 4ZDMA 4R9FA 3TTRA 3MPLA 1B5HA 4F3PA 2Q2CA 2Y7RA 1R6ZA 2ZNTA 5DT6A 3KOTA 4NF5B 3MVWA 4QFPA 5KCJA 2D3IA 2DQVA 2XXUA 1B3LA 3MP8A 3CSGA 4QHQA 4ESWA 4JWYA 3H3GA 2UXAA 2Q89A 3C4MA 2D21A 3MW0A 3G3HA 2VOZA 2HXWA 1ATGA 4C1UA 2F6PA 1EZOA 1OQGA 4LONB 2Q8JA 4E0XA 2NVUB 2R71A 2O69A 3I5OA 1OQHA 3N94A 5TPAB 1FQAA 3K1NA 4YKPA 3TQWA 1Q1KA 3PUXE 4C1TA 3TZAA 3B6QA 1XOCA 2A5TB 3Q28A 3K02A 3BBRA 2XXQA 5H8HA 4R2BA 3VXCA 3QYTA 4PFUA 4G68B 2P1SA 1MM6A 1JQFA 1B4HA 3LR1A 4G68C 4X1DA 3HPIA 4POXA 3VLUA 5DEXB 4EF1A 4G8NA 3KG2A 4GXSB 4KPTA 4UA8A 4K3FA 3FIRA 1SW4A 4GIZA 3H7MA 3PUZE 4G2ZA 5HBCA 4LUBA 2H99A 4NF8A 4KCCA 4LP2B 3LUYA 1MXWA 2I4BA 1ZTYA 3FVKA 2Y7WA 4G8MA 4RPNA 3D4GA 2RC8A 2V3QA 4GQOA 1YAEA 4AB5A 5CMBA 1T0KA 3ECRA 2DXRA 3T96B 4F3BA 1QKBA 2WKYA 1II5A 1B3FA 5DVIA 1B6HA 4G8HA 4F3GA 1B1HA 2XD3A 4EQBA 4KQPA 4H67A 3DLNA 4F29A 4IGRA 4ZEIA 3PV0E 2ZYOA 4IO5A 3DP6A 4OWDA 3TTNA 1B32A 2XXWA 4FEDA 1AMFA 4LA9A 1B51A 3MVZA 4PFTA 1MM7A 3OELA 4YKJA 4P0GA 1TXFA 1UTHB 3RT6B 2O68A 2XX9A 1MQHA 4FAJA 3VVFA 1B05A 1DOTA 1UQWA 1O7TA 4KI0E 4F39A 1UTBA 3B6TA 5CMMA 5EYFA 1NH7A 3OO8A 1O63A 1PC3A 4Z7EA 5JEIA 3L6GA 1ZLQA 1B52A 3KOSA 3TMGA 4BDLA 1YPNA 1PBQA 1Y3PA 3I3VA 4EQ7A 3PD9A 3QUFA 5AA2B 2ZYKA 1URDA 1AH5A 4I1DA 5FHOA 3M3LA 3G3KA 5A5XA 5I2NA 4M4GA 2XXHA 3OSRA 5CMCA 1NNFA 2OWTA 5DVFA 1B58A 1SW5A 2ANJA 3W9WA 4ELQA 1VFEA 5ICQA 4JXIA 4MLQA 1MPDA 1SW2A 4QF9A 4GXAA 4AQ4A 4XXUA 3CG1A 3IB1A 1IQ7A 2RF1A 1P99A 4JBZA 3GBAA 3QUJA 1ZMGA 3CSBA 2GH9A 1P1NA 1XVYA 1MXVA 1POY1 1JETA 1S7YA 2F97A 2AL5A 5I84A 3O6IA 1NMUA 2RC9A 1BIYA 3HV1A 4BDOA 3CR9A 3VE1B 5FTHA 3V8XB 3OMBA 1BLFA 4OTEA 1B3GA 2OJTA 3QAXA 4H5FA 3ODBA 3WAFA 1I6QA 3V5AA 4AB6A 3B6WA 3C35A 3QSLA 4QRZA 1FQBA 5JTYB 1MY1A 2ZXTA 3MZBA 3KJTA 3O66A 1S50A 1I69A 5K2YA 2LAOA 4NMYA 3UORA 4UACA 4JWXA 1R9QA 3FATA 2I4CA 1SD3A 4OQOA 5AA1A 1JEVA 1N7XA 3H6UA 3E13X 5IKBA 2YJPA 3O9PA 4YU0A 1FQFA 1AL3A 2NOOA 1B7UA 4IO3A 3ONMA 3TCFA 4LQ2A 3EHUA 3PMXA 5I57B 1I6AA 2H5YA 3RN8A 3K00A 2ZNUA 3RUMA 4Z0IA 1RYXA 1MY2A 2AIXA 1XHYA 1PBPA 4U1ZA 4GL0A 4EF2A 4X1BA 3T93B 1VSOA 4IO7A 1LFHA 3IB0A 1KWHA 1JW5A 1PB8A 4RNSA 3HO7A 2DWIA 2CMOA 2QS2A 2DXYA 1FQEA 2A5SA 5DTBA 3S9NC 1OVBA 3K6WA 1Q35A 2OCUA 1Y3NA 3FJMA 3O6HA 1B5JA 2PMSA 3JYRA 5AE4A 1DPEA 1SVXB 3FV2A 2F8DA 3VV5A 4ZE9A 2RCAA 3LSWA 2IEEA 4JB7A 3C31A 4F3SA 1LB9A 4XKQA 2PVUA 1LSTA 4OYVA 3N6TA 1A55A 4YMAA 4GL8A 4MLVA 5TP9A 1AOVA 4R9GA 5KCJB 1NH8A 2YLNA 1ZJLA 3DM0A 4LZ7A 1B0LA 4NF4B 3G3FA 1VE4A 1B2HA 2ZNSA 4KD5A 1N0TA 1LAGE 4TQUQ 1P1WA 1MPCA 1PEBA 4H6DA 2O51A 5DVJA 5AA3A 3G7WA 1NNPA 4DIGA 4NWCA 1VFDA 1UIUA 3K6VA 1M5DA 1SI0A 4PFWA 2UYEA 4X48A 3A3CA 2HFBA 4RK2A 2F36A 4ONYA 3B7DA 5F7VA 4X9TA 3O28A 4FE8A 5B70A 3MPKA 4WXJA 1URSA 1POTA 4POWA 2NWJA 3O2AA 2V25A 1IXGA 5I2KA 5CI5A 5KZTA 4ZE8A 2F7AA 1LAFE 2Q2AA 5BUUA 4DE8A 2Z23A 4P0IA 4O3CA 1IXIA 1MS7A 2XHDA 4GRKA 5L8DA 3IORA 3VVEA 1DSNA 4ZZEA 3U8QA 1XC1A 2DVZA 2RINA 4P11A 1FTOA 1D4NA 3I6VA 3N6UA 5FTIA 3C9HA 4PQJA 1SW1A 4ND9A 1A54A 2QS3A 4GOTA 2HEUA 3M8UA 3Q27A 2ESNA 3V83A 5DYHA 1FTJA 1JVXA 4YKKA 4NF5A 2Y7IA 4DZ1A 2BJJX 1USYH 2QL3A 4OERA 1JNFA 1WDNA 2PX1A 2I48A 1WVJA 3PPOA 2HZLA 4RYAA 2V93A 3PPQA 1MQDA 2DP8A 4OFOA 4ZEDA 4HCYA 2R6GE 4IY6A 4YB7A 3IAZA 1SDXA 1MQIA 4R6HA 4F22A 3JV9A 3FVOA 2HAVA 1B3HA 2REGA 2QS1A 1SQYA 3PD8A 1XVXA 5TPAA 3O29A 1QVSA 3KN8A 1MRPA 3BFTA 3W9VA 2A5TA 3QXMA 1A8FA 3E4RA 4Q0CA 3MUQA 4M1VA 2DWHA 2DWJA 4HTGA 3LSFB 3SEYA 3RY3A 1HSJA 3V89B 2W7YA 3S9MC 2Q9TA 3R6UA 4ZEBA 4H1XA 4F18A 4OVJA 4OZ9A 4JSDA 5KDTB 3IB2A 3ZSFA 4OFLA 3H6VA 4R6YA 2HZKA 5I56B 4GFRA 1BP5A
chains in the Genus database with same CATH superfamily
4Q5TA 4ZS9A 5H8FB 2GRVA 1L5TA 3RNNA 1H76A 4OENA 2B3BA 5ITPA 4EXLA 2X7QA 3AXFA 1IZ1A 4F2QA 4R2FA 1QUJA 3U93A 3K6UA 1N7WA 1IUDA 4PF6A 4LATA 2UVHA 3EPEA 5I2NB 1JW4A 4QFOA 2O1LA 5I3SA 4KCDA 4O7IA 4I62A 2OLBA 3KBZA 3ZKLA 2UVGA 1MXZA 2PBWA 3GBBA 3UN6A 1KA1A 4U21A 2F78A 3BFUA 2DE3A 3IFCA 4NHBA 1Z7ME 2THIA 3IK6B 3N26A 4H0WA 3TFLA 2P0SA 1FTLA 3RPLA 3CI8A 2DE4A 1Y4CA 4YB5A 1MPBA 3S9LC 2I3WA 3HHFA 3MC2A 1B5IA 3K6XA 4PFYA 4R74A 4XTCQ 3B8BA 3EHTA 5EHMA 1DTGA 3C34A 3MZ1A 3BKIB 3O97A 5ITOA 3IOWA 2HPGA 2HQ0A 3KFMA 4E0WA 5H8NB 3CVGA 2WBDA 1JW1A 3IOUA 4F1VA 4WEDA 3LC8A 4OFJA 2Q88A 1FPJA 5J16A 2FIXA 1ELJA 2WBBA 3K01A 4Q30B 3IO4A 5I58B 2F34A 3IOTA 3M3KA 2PFZA 1J1NA 3K2DA 3H6WA 5I59B 2UYFA 2XXPA 1B4ZA 3ISPA 1FTMA 1IIWA 5AA2A 1FJ9A 3VLWA 5I5PA 4YICA 5TU0A 4EUOA 4G4PA 4EXKA 3FJ7A 3KN3A 2F35A 4U4XA 4RPOA 1SI1A 1H45A 4OXVA 2VPNA 4R75A 2RKMA 1LGBC 1B46A 3U92A 4IO4A 3K1PA 5ELVA 1DK4A 4MH5A 1OIBA 4XIGQ 1QUKA 3MBPA 4DXBA 4H8IA 3FJGA 4THIA 4H8JA 4GWOA 2G29A 1MH3A 4GVOA 5AA4B 3OO6A 3OO7A 3IOVA 4QSCA 2CZLA 1GR2A 4OHNA 5ICTA 1G0HA 5JK4A 4U1OA 3T9VA 1D9VA 3K0VA 4YB6A 3BIGA 1NL5A 2H9BA 3MAMA 4KHZE 3SDFA 1LFGA 4QFLA 4GBVA 1NI9A 1K9ZA 1LBXA 3UGWA 2UVIA 1R9LA 1PDAA 3RT8A 5EQ8A 2DYXA 2I0BA 4GF8A 1FBFA 4GWSA 1QJMA 1IXCA 4R73A 4GWZA 1QULA 1FTKA 5CM6A 3G3GA 5JTYA 2Y5LA 1N3WA 3T9HB 1CE2A 3HSTA 4O94A 4PC9A 3P7IA 4OETA 4PBHA 4FJPA 2Y5KA 3KSXA 4GWUA 3IJOB 4TLLB 3FGSA 4NF6B 5EYGA 3KZGA 3THIA 3OEKA 5CBSA 4I3EA 4YKIA 3H4ZA 4IB2A 3FD3A 4OMBA 4YMBA 1WODA 1XT8A 4YAHX 3PMVA 3CG3A 5HM4B 4FIMA 4Q8RA 4EDPA 4ISUA 4P8BA 4JSOA 3KJ7A 4N8GA 2GFEA 2GQ1A 4GLIA 1DPPA 4N6DA 4GWYA 4N17A 5BWJA 2B65A 4EQ9A 4I9DA 4NWDA 1OLCA 4FBPA 1EU8A 1FQCA 2M8CA 3C32A 1MQGA 2QRYA 3RTWB 4BLAA 1NFTA 5L9OA 2WEFA 1FPDA 1JEUA 1MY3A 4F1YA 1LCTA 4HW8A 1HSLA 3KC1A 3C33A 4TOZA 1IEJA 3G3IA 3MP1A 4O3BA 3L6HA 1O64A 4AS4A 3C36A 1FBEA 3PPPA 3TYHA 4PETA 2IA4A 3PTYA 3FV1A 2OX3A 4RXLA 1P1OA 1N84A 1US5A 2Z8DA 3ILTB 3VLVA 4F2OA 5H8QA 4OEVA 2DWAA 2Q74A 4F1UA 2ALUA 5B7DA 3W15C 2GHAA 5H8SA 1FBPA 2QSXA 4IGTA 2V84A 3FXQA 2XXVA 3OO9A 3PUWE 2HAUA 2DE2A 5H8HB 3FUZA 1SBPA 3RLFE 4NN3A 3DP8A 4ELRA 4NF4A 1ZBMA 3U94A 2F7BA 5IZZA 4XKPA 1P1UA 4DCYA 3ZS6A 1NKXA 2XXRA 2O7IA 3MWBA 1SYHA 5L9SA 4MX6A 4FORA 5IZ3A 3SEUA 5AA2D 3TTMA 3HN0A 3Q26A 2DOJA 1FPLA 1A99A 1US4A 3A3UA 2NXOA 2VPOA 4O3AA 3FASA 1N76A 4P47A 4C0RA 2QS4A 2Y84A 4LVQA 3S4UA 3IL1B 3A09A 1FJ6A 3PPRA 1YTVA 4U4SA 4KYSA 1LAXA 2VP1A 3MQ9A 4NF8B 3FVNA 4MFIA 5LOMA 3HCQA 4U2RA 2JJKA 4P1LA 4QFNA 2ONKE 1LBYA 1ZU0A 3KC0A 2GHBA 3OEMA 2L5VA 2H98A 4MAGA 2OBGA 5IAIA 5EHSA 2QMXA 4NGUA 1FTAA 2VGQA 4BDNA 1EYIA 5FHNA 2V3TA 1Y9UA 3TTLA 4ECFA 1B3EA 3UP9A 1H3DA 3E3KA 1M5FA 1QUIA 1GV8A 3SZPA 1FQDA 1OLAA 2Z8FA 1Y20A 1RKMA 1FPIA 4PFIA 3EN3A 3T9UA 4QSEA 5ISUA 3MVXA 1R1NA 1M5BA 1MXYA 3VDFA 3EQ1A 4PP0A 1Y1ZA 2O6AA 4BDQA 3IR1A 4PAFA 4IO6A 3S9EA 4G68A 2REJA 4MF3A 4JDFA 4PE3A 4R6KA 1RDYA 4DI3D 4RK9A 5CC2A 2OWSA 2P2AA 3KN7A 1N3XA 4QFKA 3LSLA 2O84X 1D9YA 2QFLA 1IMAA 2QMWA 5DEXA 1URGA 1XI6A 3CIJA 1UTBB 2RCBA 1EZ9A 4FECA 3UA8A 3HFUA 2XXIA 1QW0A 4LQ5A 3TPAA 2ABHA 2PT1A 3NOHA 3OOAA 4ZEFA 1HSEA 1ZIUA 4PF8A 1DBZA 1A7LA 1FCKA 2R9JA 1FBDA 4KFQA 1JP4A 3TAJA 2ZYNA 3FVGA 3KGCA 3H6TA 3N5LA 4WKMA 3OD7A 3QIMA 2FNCA 4NEDA 2Q8MA 1ANFA 3VXBA 3K1MA 4ELOA 3A29A 3CHGA 3ZKKA 2UVJA 4MNPA 2G93A 2VD3A 4G77A 5ET8A 1GGGA 3FZVA 3DP4A 1LFIA 1OMPA 1PB7A 3TCHA 1GVCA 1JVYA 1IXHA 2I58A 4BDRA 1UIVA 3TEPA 5A5XB 3HHGA 1ZKBA 2NUVA 1MDQA 2KQZA 2Y7PA 2CZHA 3TDJA 5A5LA 3UIFA 3TELA 3GXAA 4GWWA 1B0HA 3FXUA 2XA5A 3GYYA 2X7PA 1RYOA 3IX1A 3KEIA 4L17A 1EZPA 4JWOA 4GBWA 3SKPA 1F9BA 3R7XA 2XD2A 3CFLA 3G3JA 4H46A 4XKNA 3RYDA 3LBSA 2D5WA 5KDTA 2Y7KA 3O6GA 4ZEKA 1H43A 1MQJA 4G61A 3PPNA 3IJXB 4DI4B 2QVRA 1LBZA 4ZECA 5I56A 4IY5A 2ZMBA 2F5XA 3QK6A 5H8FA 2ONRA 2CZIA 5L9MA 3VVDA 5IZ1A 3K4UA 3S2VA 4AS5A 4I8CA 4ZZAA 1UTHA 5CMKA 4N6KA 4KYDA 4BDMA 1B9JA 1NV5A 1TFAA 1CB6A 2OZZA 4QXDA 4RJZA 1K9YA 4GD5A 2VHAA 2XWIA 2Z22A 4FEBA 4KR5A 3JZJA 2XXTA 5J1DA 2FBPA 1EH3A 3M3FA 3DELB 4XEQA 1S9TA 2DVCA 4N91A 2VD2A 1LB8A 2H25A 2DSFA 1FBHA 5M2VA 4OESA 4NG7A 1IMDA 1NV0A 2H4IA 4NE4A 4H65A 4QSDA 4I3YA 4MHFA 1Y4TA 3TKDA 4HCWA 1P1QA 1M5CA 3TTKA 2V3UA 2XXYA 1YXIA 1AIVA 1AWBA 4MCOA 3IO6A 3OENA 3EF7A 1IMFA 3RTFB 1IITA 1NNTA 4N07A 2XX7A 4YZZA 3PGFA 1LBCA 3OSQA 1NNKA 3SERA 2B3FA 5H8NA 2QPQA 2XX8A 5CRYA 3SESA 3PMWA 2I6EA 4ESXA 3MP6A 4P9KA 3CFXA 1DTZA 4PFBA 2FIEA 4DXUA 1Y3QA 1BTJA 3SETA 4MIJA 5I58A 1Y1MA 1TT1A 4PCDA 2ZYMA 3FXBA 3MYUA 2X26A 5CBRA 1MDP1 1TFDA 4N6PA 2QJEA 2VT5A 5I59A 3H03A 3T9XB 5DW8A 1A8EA 3U72A 3GZGA 3RQTA 2HXRA 2I0CA 3TUSA 5EQAA 2XXXA 3Q25A 2F6GA 2I49A 3CRBA 4PTKA 3CFZA 4HS7A 3MVYA 4KYEA 1MH4A 1OVTA 1I6BA 1MY4A 4U23A 4X8RA 2DS9A 3TCGA 3IFAA 4R72A 4N13A 2HCAA 3KSJA 1N04A 1B1XA 1Q9DA 4OVRA 2I3VA 2PYYA 1RDXA 2YPNA 5HPQA 2AL4A 3E9XA 3F11A 1B7HA 4U22A 3SEXA 4FATA 4MJOA 3KBRA 5TP9B 3SEVA 4ELPA 5FBPA 1VR5A 1MXUA 1LCFA 1D3KA 3TQLA 4WEPA 4LZ8A 3EHSA 1LAHE 1A40A 5AA4A 1B40A 4N81A 2OK2A 4DDDA 1GTKA 1USYE 1DMBA 1PB9A 4MMPA 4IO2A 4F31B 1YCJA 4RY1A 4HE1A 4GX3A 1Z7NE 2B4LA 3ILUB 2O1MA 2HHMA 3QMFA 5I57A 3EKIA 1XS5A 2RC7A 4RA1A 4P3LA 3USDA 3PUYE 4OEUA 5FHMA 1IMCA 4DXCA 3T22A 2E0SA 3RPWA 3SEWA 1H44A 2Z8EA 3GLBA 3H06B 3U1OA 3TODA 4DCXA 1BKAA 3WAEA 3Q29A 4TLMB 2WYPA 3MJNA 1FW0A 2FYIA 4OVTA 2ONSA 5I7IA 5H8QB 1FBCA 3OXNA 3UK4A 1MY0A 4PE5B 3D4CA 4NQ8A 1FPGA 3FXRA 4DLDA 3LSXA 1LBBA 4NF6A 2O7UA 5I2KB 2AYSA 4LZ5A 1SYIA 2PT2A 1QKAA 3MZ9A 5LDZA 2F7CA 5K2XA 2E1SA 4PDHA 1FSAA 3PUVE 3R26A 1FRPA 1B7ZA 4HE0A 4H5GA 3VFJA 4MBPA 3RGYA 1MXXA 5ET7A 1TWYA 5F1QA 1LLSA 4XKRA 2F3DA 1KA0A 1M5EA 4F19A 2FA7A 4NTLA 1SPIA 1MG1A 2KLFA 3PU5A 3T66A 4ZDMA 4R9FA 3TTRA 3MPLA 1B5HA 4P1EA 4F3PA 2Q2CA 2Y7RA 1R6ZA 2ZNTA 1FPKA 5DT6A 3KOTA 4NF5B 3MVWA 4QFPA 5KCJA 2D3IA 2DQVA 2P3VA 2XXUA 1B3LA 3BIHA 4N4UA 3MP8A 3CSGA 4QHQA 4ESWA 4JWYA 3H3GA 2UXAA 5ET6A 2Q89A 3C4MA 2D21A 3MW0A 3G3HA 2VOZA 2HXWA 1ATGA 4C1UA 2F6PA 1EZOA 1OQGA 4XFEA 4O8MA 4LONB 2Q8JA 4E0XA 2NVUB 2R71A 2O69A 3I5OA 1OQHA 3N94A 5TPAB 1FQAA 3K1NA 4YKPA 3TQWA 1Q1KA 3PUXE 4C1TA 3TZAA 4QBAA 3B6QA 1XOCA 2A5TB 3Q28A 3K02A 3BBRA 2QVVA 2XXQA 5H8HA 4R2BA 3VXCA 3QYTA 4PFUA 4G68B 2P1SA 3B50A 1MM6A 4OA4A 1JQFA 1B4HA 3LR1A 4G68C 4X1DA 3HPIA 4POXA 3VLUA 1DCUA 1QGXA 5DEXB 4EF1A 4G8NA 3KG2A 4GXSB 4KPTA 4UA8A 4NX1A 4K3FA 3FIRA 1EYJA 1SW4A 4GIZA 3H7MA 4UABA 3PUZE 4G2ZA 5HBCA 4LUBA 2H99A 4NF8A 4KCCA 4LP2B 3LUYA 1MXWA 2I4BA 1ZTYA 3FVKA 2Y7WA 3D1RA 4I40A 4G8MA 4RPNA 3D4GA 4OVSA 2RC8A 2V4CA 1NV1A 2V3QA 4GQOA 1YAEA 4AB5A 5CMBA 1LEVA 1T0KA 3ECRA 2DXRA 1D9QA 3T96B 4F3BA 2B4MA 1FPEA 1QKBA 1YYZA 2WKYA 1II5A 1B3FA 5DVIA 1G0IA 1B6HA 4JVIA 4G8HA 4F3GA 2KR0A 1B1HA 2XD3A 4EQBA 4KQPA 4H67A 3DLNA 4F29A 4IGRA 4ZEIA 3RPLB 3PV0E 3LV0A 1NUZA 2ZYOA 4IO5A 3DP6A 4OWDA 3TTNA 1B32A 2XXWA 4FEDA 1AMFA 4LA9A 3E79A 1B51A 1FPFA 3MVZA 4PFTA 1MM7A 3OELA 4YKJA 4P0GA 1TXFA 1UTHB 3RT6B 2BJIA 3E78A 2O68A 2XX9A 1MQHA 4FAJA 3VVFA 1B05A 1DOTA 1UQWA 1O7TA 4KI0E 4F39A 1UTBA 3B6TA 5CMMA 5EYFA 3LUZA 1NH7A 3OO8A 2WYKA 1LBWA 1O63A 1PC3A 4Z7EA 4PDDA 3U65A 1YZ0A 5JEIA 3L6GA 1ZLQA 1B52A 3KOSA 3TMGA 4BDLA 1YPNA 1PBQA 1Y3PA 3I3VA 4EQ7A 3PD9A 3QUFA 5AA2B 2ZYKA 1URDA 1AH5A 4I1DA 4IR8A 4MEVA 5FHOA 3M3LA 3G3KA 5A5XA 5I2NA 4H45A 2XXHA 4M4GA 2XWKA 3OSRA 5CMCA 1NNFA 2OWTA 3T0JA 5DVFA 1B58A 1SW5A 2ANJA 1RDZA 3W9WA 4ELQA 1VFEA 3MSTA 5ICQA 4JXIA 4MLQA 1MPDA 1SW2A 2R8TA 4QF9A 4GXAA 4AQ4A 4XXUA 4HXVA 3CG1A 3IB1A 4XF5A 1IQ7A 2RF1A 1P99A 4JBZA 3GBAA 3QUJA 1ZMGA 3CSBA 2GH9A 1P1NA 1XVYA 5EQ9A 1MXVA 1POY1 1JETA 1S7YA 2F97A 1NUYA 2AL5A 5I84A 3O6IA 1NMUA 2RC9A 1BIYA 3HV1A 4BDOA 3CR9A 3VE1B 5FTHA 1NV2A 4LN5A 3V8XB 3OMBA 1BLFA 4OTEA 1B3GA 2OJTA 3QAXA 4H5FA 3ODBA 3WAFA 1I6QA 3V5AA 4AB6A 4OVPA 4OANA 2FHYA 3B6WA 4PBQA 3C35A 3QSLA 4QRZA 1FQBA 5JTYB 1MY1A 2ZXTA 3MZBA 3KJTA 3O66A 1S50A 1I69A 5K2YA 2LAOA 4NMYA 3UORA 2ZZVA 4UACA 4JWXA 4O7MA 1R9QA 3FATA 2I4CA 1SD3A 4OQOA 5AA1A 1JEVA 1N7XA 4PGPA 3H6UA 3E13X 5IKBA 2YJPA 3O9PA 4YU0A 5EYHA 1FQFA 1AL3A 2CZKA 2NOOA 1B7UA 4IO3A 3ONMA 3TCFA 4LQ2A 3EHUA 3PMXA 5I57B 1NUWA 5ESYA 1I6AA 2H5YA 2PCRA 3RN8A 3K00A 3FBPA 3T1BA 2ZNUA 4PGNA 3RUMA 4Z0IA 1RYXA 1MY2A 4OVQA 2AIXA 1XHYA 1PBPA 4U1ZA 4GL0A 4EF2A 4X1BA 3T93B 1VSOA 4IO7A 1LFHA 3IB0A 1KWHA 1JW5A 1PB8A 4RNSA 3HO7A 2CEXA 2DWIA 2CMOA 2QS2A 2DXYA 1FQEA 2A5SA 5DTBA 3S9NC 1OVBA 3K6WA 1Q35A 4GX4A 2OCUA 1Y3NA 3FJMA 3O6HA 1B5JA 2PMSA 2XWVA 3JYRA 5AE4A 1DPEA 1SVXB 3FV2A 2F8DA 3VV5A 1NV7A 4ZE9A 2RCAA 3LSWA 2IEEA 4JB7A 4PFRA 3C31A 1IMEA 1LB9A 4F3SA 4XKQA 3ROJA 1FPBA 2PVUA 2F3BA 1LSTA 4OYVA 3N6TA 1A55A 4YMAA 4GL8A 5IM2A 4MLVA 5TP9A 1AOVA 4R9GA 5KCJB 1NH8A 2YLNA 1ZJLA 1FBGA 3DM0A 4LZ7A 1B0LA 1VDWA 4NF4B 3G3FA 4PAKA 1VE4A 1B2HA 2ZNSA 4KD5A 1N0TA 2XWOA 1LAGE 4KXPA 4TQUQ 1P1WA 1MPCA 1PEBA 4H6DA 2O51A 5DVJA 5IZ3B 2XXKA 5AA3A 3G7WA 1NNPA 4DIGA 4NWCA 1VFDA 1NUXA 1UIUA 3K6VA 1M5DA 1SI0A 1IMBA 2DDKA 4PFWA 2UYEA 2P3NA 4X48A 3A3CA 5ET5A 2HFBA 4RK2A 2F36A 4ONYA 1LBVA 3B7DA 5F7VA 4X9TA 2ZZWA 3O28A 4FE8A 5B70A 3MPKA 4WXJA 1URSA 1POTA 4POWA 2NWJA 1NV3A 2OWZA 3O2AA 2MKZA 2V25A 4X04A 1IXGA 5I2KA 5CI5A 5KZTA 4ZE8A 2F7AA 4N8YA 1LAFE 2Q2AA 5BUUA 4DE8A 4P56A 2Z23A 2ZZXA 4P0IA 4O3CA 1IXIA 1MS7A 2XHDA 4GRKA 5L8DA 3IORA 3VVEA 1DSNA 4ZZEA 3U8QA 1XC1A 2DVZA 2FVZA 2RINA 4P11A 1FTOA 1D4NA 3I6VA 3N6UA 5FTIA 3C9HA 1NV6A 4PQJA 1SW1A 4ND9A 1A54A 2QS3A 4GOTA 4HE2A 2HEUA 3M8UA 3Q27A 2ESNA 4N15A 1BK4A 3V83A 5DYHA 1FTJA 1JVXA 4YKKA 4NF5A 2Y7IA 4DZ1A 2BJJX 1USYH 2QL3A 4OERA 1JNFA 1WDNA 2PX1A 2I48A 2QVUA 5F24A 1WVJA 4GWXA 4NF0A 3PPOA 2HZLA 4RYAA 2V93A 3PPQA 1MQDA 2DP8A 4OFOA 4ZEDA 4HCYA 2CEYA 2R6GE 4IY6A 4YB7A 3IAZA 1SDXA 1MQIA 4R6HA 4JVCA 4F22A 3JV9A 3FVOA 4NAPA 2HAVA 1B3HA 2REGA 2QS1A 1SQYA 3PD8A 1XVXA 4GX6A 3O29A 1QVSA 5TPAA 3KN8A 1MRPA 4MNIA 3BFTA 3W9VA 2A5TA 3QXMA 5EQ7A 1A8FA 3E4RA 4Q0CA 2PFYA 3MUQA 4M1VA 2DWHA 2DWJA 5T3JA 5IGAA 4HTGA 1INPA 3LSFB 3SEYA 3RY3A 1NV4A 1HSJA 5LTCA 3V89B 2W7YA 4PAIA 2Q9TA 3R6UA 3S9MC 4ZEBA 2WX9A 4H1XA 4JVDA 4F18A 4OVJA 1CNQA 4OZ9A 4JSDA 5KDTB 3IB2A 3ZSFA 4OFLA 1EYKA 3H6VA 4R6YA 2HZKA 5I56B 4GFRA 1KZ8A 4MNCA 1BP5A
chains in the Genus database with same CATH topology
4Q5TA 4ZS9A 5H8FB 2GRVA 1L5TA 3RNNA 1H76A 4OENA 2B3BA 5ITPA 4EXLA 2X7QA 3AXFA 1IZ1A 4F2QA 4R2FA 1QUJA 3U93A 3K6UA 1N7WA 1IUDA 4LATA 2UVHA 3EPEA 5I2NB 1JW4A 4QFOA 2O1LA 4KCDA 4I62A 2OLBA 3ZKLA 2UVGA 1MXZA 2PBWA 3GBBA 3UN6A 4U21A 2F78A 3BFUA 2DE3A 1Z7ME 2THIA 3IK6B 3N26A 4H0WA 3TFLA 2P0SA 1FTLA 3CI8A 2DE4A 1Y4CA 4YB5A 1MPBA 3S9LC 2I3WA 3HHFA 3MC2A 1B5IA 3K6XA 4PFYA 4R74A 4XTCQ 3EHTA 5EHMA 1DTGA 3C34A 3MZ1A 3BKIB 3O97A 5ITOA 3IOWA 2HQ0A 3KFMA 4E0WA 5H8NB 3CVGA 1JW1A 3IOUA 4F1VA 4WEDA 3LC8A 4OFJA 2Q88A 1ELJA 3K01A 4Q30B 3IO4A 5I58B 2F34A 3IOTA 3M3KA 1J1NA 3K2DA 3H6WA 5I59B 2UYFA 2XXPA 1B4ZA 1FTMA 1IIWA 5AA2A 3VLWA 4YICA 5TU0A 4EUOA 4G4PA 4EXKA 3FJ7A 3KN3A 2F35A 4U4XA 4RPOA 1SI1A 1H45A 4OXVA 4R75A 2RKMA 1LGBC 1B46A 3U92A 4IO4A 3K1PA 5ELVA 4MH5A 1OIBA 4XIGQ 1QUKA 3MBPA 4DXBA 4H8IA 3FJGA 4THIA 4H8JA 4GWOA 2G29A 1MH3A 4GVOA 5AA4B 3OO6A 3OO7A 3IOVA 4QSCA 2CZLA 1GR2A 4OHNA 5ICTA 5JK4A 4U1OA 3T9VA 1D9VA 3K0VA 4YB6A 1NL5A 2H9BA 3MAMA 4KHZE 3SDFA 1LFGA 4QFLA 3UGWA 2UVIA 1R9LA 1PDAA 3RT8A 2DYXA 2I0BA 4GF8A 1QJMA 1IXCA 4R73A 1QULA 1FTKA 5CM6A 3G3GA 5JTYA 1N3WA 3T9HB 1CE2A 3HSTA 3P7IA 4OETA 4FJPA 3KSXA 3IJOB 4TLLB 3FGSA 4NF6B 3KZGA 3THIA 3OEKA 5CBSA 4YKIA 3H4ZA 4IB2A 3FD3A 4OMBA 4YMBA 1WODA 1XT8A 4YAHX 3PMVA 3CG3A 5HM4B 4FIMA 4Q8RA 4EDPA 4ISUA 4JSOA 3KJ7A 2GFEA 4GLIA 1DPPA 5BWJA 2B65A 4EQ9A 4I9DA 4NWDA 1OLCA 1EU8A 1FQCA 2M8CA 3C32A 1MQGA 2QRYA 3RTWB 4BLAA 1NFTA 5L9OA 1JEUA 1MY3A 4F1YA 1LCTA 4HW8A 1HSLA 3C33A 4TOZA 1IEJA 3G3IA 3MP1A 4O3BA 3L6HA 1O64A 3C36A 3PPPA 3TYHA 4PETA 2IA4A 3FV1A 4RXLA 1P1OA 1N84A 1US5A 2Z8DA 3ILTB 3VLVA 4F2OA 5H8QA 4OEVA 2DWAA 4F1UA 2ALUA 5B7DA 3W15C 2GHAA 5H8SA 2QSXA 4IGTA 2V84A 3FXQA 2XXVA 3OO9A 3PUWE 2HAUA 2DE2A 5H8HB 3FUZA 1SBPA 3RLFE 3DP8A 4ELRA 4NF4A 1ZBMA 3U94A 2F7BA 4XKPA 1P1UA 4DCYA 3ZS6A 1NKXA 2XXRA 2O7IA 3MWBA 1SYHA 5L9SA 4FORA 3SEUA 5AA2D 3TTMA 3HN0A 3Q26A 2DOJA 1A99A 1US4A 3A3UA 2NXOA 4O3AA 3FASA 1N76A 4C0RA 2QS4A 2Y84A 4LVQA 3S4UA 3IL1B 3A09A 3PPRA 4U4SA 1YTVA 4KYSA 1LAXA 2VP1A 3MQ9A 4NF8B 3FVNA 4MFIA 5LOMA 3HCQA 4U2RA 4QFNA 2ONKE 1ZU0A 2GHBA 3OEMA 2H98A 2OBGA 5IAIA 5EHSA 2QMXA 2VGQA 4BDNA 5FHNA 2V3TA 1Y9UA 3TTLA 4ECFA 1B3EA 3UP9A 1H3DA 3E3KA 1M5FA 1QUIA 1GV8A 1FQDA 1OLAA 2Z8FA 1Y20A 1RKMA 3EN3A 3T9UA 4QSEA 5ISUA 3MVXA 1R1NA 1M5BA 1MXYA 3VDFA 3EQ1A 4PP0A 1Y1ZA 2O6AA 4BDQA 3IR1A 4IO6A 3S9EA 4G68A 2REJA 4MF3A 4JDFA 4R6KA 4RK9A 5CC2A 2OWSA 2P2AA 3KN7A 1N3XA 4QFKA 3LSLA 2O84X 1D9YA 2QMWA 5DEXA 1URGA 3CIJA 1UTBB 2RCBA 1EZ9A 4FECA 3UA8A 2XXIA 1QW0A 4LQ5A 3TPAA 2ABHA 2PT1A 4ZEFA 3OOAA 1HSEA 1ZIUA 1A7LA 1FCKA 2R9JA 4KFQA 3TAJA 2ZYNA 3FVGA 3KGCA 3H6TA 3N5LA 4WKMA 3OD7A 3QIMA 2FNCA 4NEDA 1ANFA 3VXBA 3K1MA 4ELOA 3ZKKA 2UVJA 2G93A 2VD3A 4G77A 1GGGA 3FZVA 3DP4A 1LFIA 1OMPA 1PB7A 3TCHA 1GVCA 1JVYA 1IXHA 2I58A 4BDRA 1UIVA 3TEPA 5A5XB 3HHGA 1ZKBA 2NUVA 1MDQA 2Y7PA 3TDJA 3UIFA 3TELA 3GXAA 1B0HA 3FXUA 2X7PA 1RYOA 3IX1A 3KEIA 4L17A 1EZPA 4JWOA 3SKPA 1F9BA 3R7XA 2XD2A 3CFLA 3G3JA 4XKNA 3LBSA 2D5WA 5KDTA 2Y7KA 3O6GA 4ZEKA 1H43A 1MQJA 3PPNA 3IJXB 4ZECA 5I56A 4IY5A 2ZMBA 2F5XA 3QK6A 5H8FA 2ONRA 5L9MA 3VVDA 3K4UA 3S2VA 4I8CA 4ZZAA 1UTHA 5CMKA 4KYDA 4BDMA 1B9JA 1TFAA 1CB6A 2OZZA 4RJZA 4GD5A 2VHAA 2Z22A 4FEBA 4KR5A 3JZJA 2XXTA 5J1DA 1EH3A 3M3FA 3DELB 1S9TA 2DVCA 2VD2A 1LB8A 2H25A 2DSFA 5M2VA 4OESA 2H4IA 4NE4A 4H65A 4QSDA 1Y4TA 3TKDA 4HCWA 1P1QA 1M5CA 3TTKA 2V3UA 2XXYA 1AIVA 3IO6A 3OENA 3EF7A 3RTFB 1IITA 1NNTA 4N07A 2XX7A 4YZZA 3PGFA 1LBCA 3OSQA 1NNKA 3SERA 2B3FA 5H8NA 2QPQA 2XX8A 5CRYA 3SESA 3PMWA 2I6EA 4ESXA 3MP6A 3CFXA 1DTZA 4DXUA 1Y3QA 1BTJA 3SETA 5I58A 1Y1MA 1TT1A 2ZYMA 2X26A 5CBRA 1MDP1 1TFDA 4N6PA 2QJEA 5I59A 3H03A 3T9XB 1A8EA 3U72A 3GZGA 3RQTA 2I0CA 3TUSA 2XXXA 3Q25A 2F6GA 2I49A 3CRBA 3CFZA 4HS7A 3MVYA 4KYEA 1MH4A 1OVTA 1I6BA 1MY4A 4U23A 2DS9A 3TCGA 4R72A 4N13A 2HCAA 3KSJA 1N04A 1B1XA 2I3VA 2PYYA 2YPNA 5HPQA 2AL4A 3E9XA 3F11A 4FATA 1B7HA 4U22A 3SEXA 3KBRA 5TP9B 3SEVA 4ELPA 1VR5A 1MXUA 1LCFA 1D3KA 3TQLA 4WEPA 4LZ8A 3EHSA 1LAHE 1A40A 5AA4A 1B40A 2OK2A 4DDDA 1GTKA 1USYE 1DMBA 1PB9A 4IO2A 4F31B 1YCJA 4RY1A 1Z7NE 3ILUB 2O1MA 5I57A 1XS5A 2RC7A 4RA1A 3USDA 3PUYE 4OEUA 5FHMA 4DXCA 3T22A 3RPWA 2E0SA 3SEWA 1H44A 2Z8EA 3GLBA 3H06B 3U1OA 3TODA 4DCXA 1BKAA 3WAEA 3Q29A 4TLMB 3MJNA 1FW0A 2FYIA 2ONSA 5H8QB 3OXNA 3UK4A 1MY0A 4PE5B 3D4CA 3FXRA 4DLDA 3LSXA 1LBBA 4NF6A 2O7UA 5I2KB 2AYSA 4LZ5A 1SYIA 2PT2A 1QKAA 3MZ9A 2F7CA 5K2XA 2E1SA 3PUVE 3R26A 1B7ZA 4H5GA 3VFJA 4MBPA 3RGYA 1MXXA 1TWYA 5F1QA 1LLSA 4XKRA 1M5EA 4F19A 2FA7A 4NTLA 1MG1A 2KLFA 3PU5A 3T66A 4ZDMA 4R9FA 3TTRA 3MPLA 1B5HA 4F3PA 2Q2CA 2Y7RA 1R6ZA 2ZNTA 5DT6A 3KOTA 4NF5B 3MVWA 4QFPA 5KCJA 2D3IA 2DQVA 2XXUA 1B3LA 3MP8A 3CSGA 4QHQA 4ESWA 4JWYA 3H3GA 2UXAA 2Q89A 3C4MA 2D21A 3MW0A 3G3HA 2VOZA 2HXWA 1ATGA 4C1UA 2F6PA 1EZOA 1OQGA 4LONB 2Q8JA 4E0XA 2NVUB 2R71A 2O69A 3I5OA 1OQHA 3N94A 5TPAB 1FQAA 3K1NA 4YKPA 3TQWA 1Q1KA 3PUXE 4C1TA 3TZAA 3B6QA 1XOCA 2A5TB 3Q28A 3K02A 3BBRA 2XXQA 5H8HA 4R2BA 3VXCA 3QYTA 4PFUA 4G68B 2P1SA 1MM6A 1JQFA 1B4HA 3LR1A 4G68C 4X1DA 3HPIA 4POXA 3VLUA 5DEXB 4EF1A 4G8NA 3KG2A 4GXSB 4KPTA 4UA8A 4K3FA 3FIRA 1SW4A 4GIZA 3H7MA 3PUZE 4G2ZA 5HBCA 4LUBA 2H99A 4NF8A 4KCCA 4LP2B 3LUYA 1MXWA 2I4BA 1ZTYA 3FVKA 2Y7WA 4G8MA 4RPNA 3D4GA 2RC8A 2V3QA 4GQOA 1YAEA 4AB5A 5CMBA 1T0KA 3ECRA 2DXRA 3T96B 4F3BA 1QKBA 2WKYA 1II5A 1B3FA 5DVIA 1B6HA 4G8HA 4F3GA 1B1HA 2XD3A 4EQBA 4KQPA 4H67A 3DLNA 4F29A 4IGRA 4ZEIA 3PV0E 2ZYOA 4IO5A 3DP6A 4OWDA 3TTNA 1B32A 2XXWA 4FEDA 1AMFA 4LA9A 1B51A 3MVZA 4PFTA 1MM7A 3OELA 4YKJA 4P0GA 1TXFA 1UTHB 3RT6B 2O68A 2XX9A 1MQHA 4FAJA 3VVFA 1B05A 1DOTA 1UQWA 1O7TA 4KI0E 4F39A 1UTBA 3B6TA 5CMMA 5EYFA 1NH7A 3OO8A 1O63A 1PC3A 4Z7EA 5JEIA 3L6GA 1ZLQA 1B52A 3KOSA 3TMGA 4BDLA 1YPNA 1PBQA 1Y3PA 3I3VA 4EQ7A 3PD9A 3QUFA 5AA2B 2ZYKA 1URDA 1AH5A 4I1DA 5FHOA 3M3LA 3G3KA 5A5XA 5I2NA 4M4GA 2XXHA 3OSRA 5CMCA 1NNFA 2OWTA 5DVFA 1B58A 1SW5A 2ANJA 3W9WA 4ELQA 1VFEA 5ICQA 4JXIA 4MLQA 1MPDA 1SW2A 4QF9A 4GXAA 4AQ4A 4XXUA 3CG1A 3IB1A 1IQ7A 2RF1A 1P99A 4JBZA 3GBAA 3QUJA 1ZMGA 3CSBA 2GH9A 1P1NA 1XVYA 1MXVA 1POY1 1JETA 1S7YA 2F97A 2AL5A 5I84A 3O6IA 1NMUA 2RC9A 1BIYA 3HV1A 4BDOA 3CR9A 3VE1B 5FTHA 3V8XB 3OMBA 1BLFA 4OTEA 1B3GA 2OJTA 3QAXA 4H5FA 3ODBA 3WAFA 1I6QA 3V5AA 4AB6A 3B6WA 3C35A 3QSLA 4QRZA 1FQBA 5JTYB 1MY1A 2ZXTA 3MZBA 3KJTA 3O66A 1S50A 1I69A 5K2YA 2LAOA 4NMYA 3UORA 4UACA 4JWXA 1R9QA 3FATA 2I4CA 1SD3A 4OQOA 5AA1A 1JEVA 1N7XA 3H6UA 3E13X 5IKBA 2YJPA 3O9PA 4YU0A 1FQFA 1AL3A 2NOOA 1B7UA 4IO3A 3ONMA 3TCFA 4LQ2A 3EHUA 3PMXA 5I57B 1I6AA 2H5YA 3RN8A 3K00A 2ZNUA 3RUMA 4Z0IA 1RYXA 1MY2A 2AIXA 1XHYA 1PBPA 4U1ZA 4GL0A 4EF2A 4X1BA 3T93B 1VSOA 4IO7A 1LFHA 3IB0A 1KWHA 1JW5A 1PB8A 4RNSA 3HO7A 2DWIA 2CMOA 2QS2A 2DXYA 1FQEA 2A5SA 5DTBA 3S9NC 1OVBA 3K6WA 1Q35A 2OCUA 1Y3NA 3FJMA 3O6HA 1B5JA 2PMSA 3JYRA 5AE4A 1DPEA 1SVXB 3FV2A 2F8DA 3VV5A 4ZE9A 2RCAA 3LSWA 2IEEA 4JB7A 3C31A 4F3SA 1LB9A 4XKQA 2PVUA 1LSTA 4OYVA 3N6TA 1A55A 4YMAA 4GL8A 4MLVA 5TP9A 1AOVA 4R9GA 5KCJB 1NH8A 2YLNA 1ZJLA 3DM0A 4LZ7A 1B0LA 4NF4B 3G3FA 1VE4A 1B2HA 2ZNSA 4KD5A 1N0TA 1LAGE 4TQUQ 1P1WA 1MPCA 1PEBA 4H6DA 2O51A 5DVJA 5AA3A 3G7WA 1NNPA 4DIGA 4NWCA 1VFDA 1UIUA 3K6VA 1M5DA 1SI0A 4PFWA 2UYEA 4X48A 3A3CA 2HFBA 4RK2A 2F36A 4ONYA 3B7DA 5F7VA 4X9TA 3O28A 4FE8A 5B70A 3MPKA 4WXJA 1URSA 1POTA 4POWA 2NWJA 3O2AA 2V25A 1IXGA 5I2KA 5CI5A 5KZTA 4ZE8A 2F7AA 1LAFE 2Q2AA 5BUUA 4DE8A 2Z23A 4P0IA 4O3CA 1IXIA 1MS7A 2XHDA 4GRKA 5L8DA 3IORA 3VVEA 1DSNA 4ZZEA 3U8QA 1XC1A 2DVZA 2RINA 4P11A 1FTOA 1D4NA 3I6VA 3N6UA 5FTIA 3C9HA 4PQJA 1SW1A 4ND9A 1A54A 2QS3A 4GOTA 2HEUA 3M8UA 3Q27A 2ESNA 3V83A 5DYHA 1FTJA 1JVXA 4YKKA 4NF5A 2Y7IA 4DZ1A 2BJJX 1USYH 2QL3A 4OERA 1JNFA 1WDNA 2PX1A 2I48A 1WVJA 3PPOA 2HZLA 4RYAA 2V93A 3PPQA 1MQDA 2DP8A 4OFOA 4ZEDA 4HCYA 2R6GE 4IY6A 4YB7A 3IAZA 1SDXA 1MQIA 4R6HA 4F22A 3JV9A 3FVOA 2HAVA 1B3HA 2REGA 2QS1A 1SQYA 3PD8A 1XVXA 5TPAA 3O29A 1QVSA 3KN8A 1MRPA 3BFTA 3W9VA 2A5TA 3QXMA 1A8FA 3E4RA 4Q0CA 3MUQA 4M1VA 2DWHA 2DWJA 4HTGA 3LSFB 3SEYA 3RY3A 1HSJA 3V89B 2W7YA 3S9MC 2Q9TA 3R6UA 4ZEBA 4H1XA 4F18A 4OVJA 4OZ9A 4JSDA 5KDTB 3IB2A 3ZSFA 4OFLA 3H6VA 4R6YA 2HZKA 5I56B 4GFRA 1BP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5T A;  4ZS9 A;  5H8F B;  2GRV A;  1L5T A;  3RNN A;  1H76 A;  4OEN A;  2B3B A;  5ITP A;  4EXL A;  2X7Q A;  3AXF A;  1IZ1 A;  4F2Q A;  4R2F A;  1QUJ A;  3U93 A;  3K6U A;  1N7W A;  1IUD A;  4LAT A;  2UVH A;  3EPE A;  5I2N B;  1JW4 A;  4QFO A;  2O1L A;  4KCD A;  4I62 A;  2OLB A;  3ZKL A;  2UVG A;  1MXZ A;  2PBW A;  3GBB A;  3UN6 A;  4U21 A;  2F78 A;  3BFU A;  2DE3 A;  1Z7M E;  2THI A;  3IK6 B;  3N26 A;  4H0W A;  3TFL A;  2P0S A;  1FTL A;  3CI8 A;  2DE4 A;  1Y4C A;  4YB5 A;  1MPB A;  3S9L C;  2I3W A;  3HHF A;  3MC2 A;  1B5I A;  3K6X A;  4PFY A;  4R74 A;  4XTC Q;  3EHT A;  5EHM A;  1DTG A;  3C34 A;  3MZ1 A;  3BKI B;  3O97 A;  5ITO A;  3IOW A;  2HQ0 A;  3KFM A;  4E0W A;  5H8N B;  3CVG A;  1JW1 A;  3IOU A;  4F1V A;  4WED A;  3LC8 A;  4OFJ A;  2Q88 A;  1ELJ A;  3K01 A;  4Q30 B;  3IO4 A;  5I58 B;  2F34 A;  3IOT A;  3M3K A;  1J1N A;  3K2D A;  3H6W A;  5I59 B;  2UYF A;  2XXP A;  1B4Z A;  1FTM A;  1IIW A;  5AA2 A;  3VLW A;  4YIC A;  5TU0 A;  4EUO A;  4G4P A;  4EXK A;  3FJ7 A;  3KN3 A;  2F35 A;  4U4X A;  4RPO A;  1SI1 A;  1H45 A;  4OXV A;  4R75 A;  2RKM A;  1LGB C;  1B46 A;  3U92 A;  4IO4 A;  3K1P A;  5ELV A;  4MH5 A;  1OIB A;  4XIG Q;  1QUK A;  3MBP A;  4DXB A;  4H8I A;  3FJG A;  4THI A;  4H8J A;  4GWO A;  2G29 A;  1MH3 A;  4GVO A;  5AA4 B;  3OO6 A;  3OO7 A;  3IOV A;  4QSC A;  2CZL A;  1GR2 A;  4OHN A;  5ICT A;  5JK4 A;  4U1O A;  3T9V A;  1D9V A;  3K0V A;  4YB6 A;  1NL5 A;  2H9B A;  3MAM A;  4KHZ E;  3SDF A;  1LFG A;  4QFL A;  3UGW A;  2UVI A;  1R9L A;  1PDA A;  3RT8 A;  2DYX A;  2I0B A;  4GF8 A;  1QJM A;  1IXC A;  4R73 A;  1QUL A;  1FTK A;  5CM6 A;  3G3G A;  5JTY A;  1N3W A;  3T9H B;  1CE2 A;  3HST A;  3P7I A;  4OET A;  4FJP A;  3KSX A;  3IJO B;  4TLL B;  3FGS A;  4NF6 B;  3KZG A;  3THI A;  3OEK A;  5CBS A;  4YKI A;  3H4Z A;  4IB2 A;  3FD3 A;  4OMB A;  4YMB A;  1WOD A;  1XT8 A;  4YAH X;  3PMV A;  3CG3 A;  5HM4 B;  4FIM A;  4Q8R A;  4EDP A;  4ISU A;  4JSO A;  3KJ7 A;  2GFE A;  4GLI A;  1DPP A;  5BWJ A;  2B65 A;  4EQ9 A;  4I9D A;  4NWD A;  1OLC A;  1EU8 A;  1FQC A;  2M8C A;  3C32 A;  1MQG A;  2QRY A;  3RTW B;  4BLA A;  1NFT A;  5L9O A;  1JEU A;  1MY3 A;  4F1Y A;  1LCT A;  4HW8 A;  1HSL A;  3C33 A;  4TOZ A;  1IEJ A;  3G3I A;  3MP1 A;  4O3B A;  3L6H A;  1O64 A;  3C36 A;  3PPP A;  3TYH A;  4PET A;  2IA4 A;  3FV1 A;  4RXL A;  1P1O A;  1N84 A;  1US5 A;  2Z8D A;  3ILT B;  3VLV A;  4F2O A;  5H8Q A;  4OEV A;  2DWA A;  4F1U A;  2ALU A;  5B7D A;  3W15 C;  2GHA A;  5H8S A;  2QSX A;  4IGT A;  2V84 A;  3FXQ A;  2XXV A;  3OO9 A;  3PUW E;  2HAU A;  2DE2 A;  5H8H B;  3FUZ A;  1SBP A;  3RLF E;  3DP8 A;  4ELR A;  4NF4 A;  1ZBM A;  3U94 A;  2F7B A;  4XKP A;  1P1U A;  4DCY A;  3ZS6 A;  1NKX A;  2XXR A;  2O7I A;  3MWB A;  1SYH A;  5L9S A;  4FOR A;  3SEU A;  5AA2 D;  3TTM A;  3HN0 A;  3Q26 A;  2DOJ A;  1A99 A;  1US4 A;  3A3U A;  2NXO A;  4O3A A;  3FAS A;  1N76 A;  4C0R A;  2QS4 A;  2Y84 A;  4LVQ A;  3S4U A;  3IL1 B;  3A09 A;  3PPR A;  4U4S A;  1YTV A;  4KYS A;  1LAX A;  2VP1 A;  3MQ9 A;  4NF8 B;  3FVN A;  4MFI A;  5LOM A;  3HCQ A;  4U2R A;  4QFN A;  2ONK E;  1ZU0 A;  2GHB A;  3OEM A;  2H98 A;  2OBG A;  5IAI A;  5EHS A;  2QMX A;  2VGQ A;  4BDN A;  5FHN A;  2V3T A;  1Y9U A;  3TTL A;  4ECF A;  1B3E A;  3UP9 A;  1H3D A;  3E3K A;  1M5F A;  1QUI A;  1GV8 A;  1FQD A;  1OLA A;  2Z8F A;  1Y20 A;  1RKM A;  3EN3 A;  3T9U A;  4QSE A;  5ISU A;  3MVX A;  1R1N A;  1M5B A;  1MXY A;  3VDF A;  3EQ1 A;  4PP0 A;  1Y1Z A;  2O6A A;  4BDQ A;  3IR1 A;  4IO6 A;  3S9E A;  4G68 A;  2REJ A;  4MF3 A;  4JDF A;  4R6K A;  4RK9 A;  5CC2 A;  2OWS A;  2P2A A;  3KN7 A;  1N3X A;  4QFK A;  3LSL A;  2O84 X;  1D9Y A;  2QMW A;  5DEX A;  1URG A;  3CIJ A;  1UTB B;  2RCB A;  1EZ9 A;  4FEC A;  3UA8 A;  2XXI A;  1QW0 A;  4LQ5 A;  3TPA A;  2ABH A;  2PT1 A;  4ZEF A;  3OOA A;  1HSE A;  1ZIU A;  1A7L A;  1FCK A;  2R9J A;  4KFQ A;  3TAJ A;  2ZYN A;  3FVG A;  3KGC A;  3H6T A;  3N5L A;  4WKM A;  3OD7 A;  3QIM A;  2FNC A;  4NED A;  1ANF A;  3VXB A;  3K1M A;  4ELO A;  3ZKK A;  2UVJ A;  2G93 A;  2VD3 A;  4G77 A;  1GGG A;  3FZV A;  3DP4 A;  1LFI A;  1OMP A;  1PB7 A;  3TCH A;  1GVC A;  1JVY A;  1IXH A;  2I58 A;  4BDR A;  1UIV A;  3TEP A;  5A5X B;  3HHG A;  1ZKB A;  2NUV A;  1MDQ A;  2Y7P A;  3TDJ A;  3UIF A;  3TEL A;  3GXA A;  1B0H A;  3FXU A;  2X7P A;  1RYO A;  3IX1 A;  3KEI A;  4L17 A;  1EZP A;  4JWO A;  3SKP A;  1F9B A;  3R7X A;  2XD2 A;  3CFL A;  3G3J A;  4XKN A;  3LBS A;  2D5W A;  5KDT A;  2Y7K A;  3O6G A;  4ZEK A;  1H43 A;  1MQJ A;  3PPN A;  3IJX B;  4ZEC A;  5I56 A;  4IY5 A;  2ZMB A;  2F5X A;  3QK6 A;  5H8F A;  2ONR A;  5L9M A;  3VVD A;  3K4U A;  3S2V A;  4I8C A;  4ZZA A;  1UTH A;  5CMK A;  4KYD A;  4BDM A;  1B9J A;  1TFA A;  1CB6 A;  2OZZ A;  4RJZ A;  4GD5 A;  2VHA A;  2Z22 A;  4FEB A;  4KR5 A;  3JZJ A;  2XXT A;  5J1D A;  1EH3 A;  3M3F A;  3DEL B;  1S9T A;  2DVC A;  2VD2 A;  1LB8 A;  2H25 A;  2DSF A;  5M2V A;  4OES A;  2H4I A;  4NE4 A;  4H65 A;  4QSD A;  1Y4T A;  3TKD A;  4HCW A;  1P1Q A;  1M5C A;  3TTK A;  2V3U A;  2XXY A;  1AIV A;  3IO6 A;  3OEN A;  3EF7 A;  3RTF B;  1IIT A;  1NNT A;  4N07 A;  2XX7 A;  4YZZ A;  3PGF A;  1LBC A;  3OSQ A;  1NNK A;  3SER A;  2B3F A;  5H8N A;  2QPQ A;  2XX8 A;  5CRY A;  3SES A;  3PMW A;  2I6E A;  4ESX A;  3MP6 A;  3CFX A;  1DTZ A;  4DXU A;  1Y3Q A;  1BTJ A;  3SET A;  5I58 A;  1Y1M A;  1TT1 A;  2ZYM A;  2X26 A;  5CBR A;  1MDP 1;  1TFD A;  4N6P A;  2QJE A;  5I59 A;  3H03 A;  3T9X B;  1A8E A;  3U72 A;  3GZG A;  3RQT A;  2I0C A;  3TUS A;  2XXX A;  3Q25 A;  2F6G A;  2I49 A;  3CRB A;  3CFZ A;  4HS7 A;  3MVY A;  4KYE A;  1MH4 A;  1OVT A;  1I6B A;  1MY4 A;  4U23 A;  2DS9 A;  3TCG A;  4R72 A;  4N13 A;  2HCA A;  3KSJ A;  1N04 A;  1B1X A;  2I3V A;  2PYY A;  2YPN A;  5HPQ A;  2AL4 A;  3E9X A;  3F11 A;  4FAT A;  1B7H A;  4U22 A;  3SEX A;  3KBR A;  5TP9 B;  3SEV A;  4ELP A;  1VR5 A;  1MXU A;  1LCF A;  1D3K A;  3TQL A;  4WEP A;  4LZ8 A;  3EHS A;  1LAH E;  1A40 A;  5AA4 A;  1B40 A;  2OK2 A;  4DDD A;  1GTK A;  1USY E;  1DMB A;  1PB9 A;  4IO2 A;  4F31 B;  1YCJ A;  4RY1 A;  1Z7N E;  3ILU B;  2O1M A;  5I57 A;  1XS5 A;  2RC7 A;  4RA1 A;  3USD A;  3PUY E;  4OEU A;  5FHM A;  4DXC A;  3T22 A;  3RPW A;  2E0S A;  3SEW A;  1H44 A;  2Z8E A;  3GLB A;  3H06 B;  3U1O A;  3TOD A;  4DCX A;  1BKA A;  3WAE A;  3Q29 A;  4TLM B;  3MJN A;  1FW0 A;  2FYI A;  2ONS A;  5H8Q B;  3OXN A;  3UK4 A;  1MY0 A;  4PE5 B;  3D4C A;  3FXR A;  4DLD A;  3LSX A;  1LBB A;  4NF6 A;  2O7U A;  5I2K B;  2AYS A;  4LZ5 A;  1SYI A;  2PT2 A;  1QKA A;  3MZ9 A;  2F7C A;  5K2X A;  2E1S A;  3PUV E;  3R26 A;  1B7Z A;  4H5G A;  3VFJ A;  4MBP A;  3RGY A;  1MXX A;  1TWY A;  5F1Q A;  1LLS A;  4XKR A;  1M5E A;  4F19 A;  2FA7 A;  4NTL A;  1MG1 A;  2KLF A;  3PU5 A;  3T66 A;  4ZDM A;  4R9F A;  3TTR A;  3MPL A;  1B5H A;  4F3P A;  2Q2C A;  2Y7R A;  1R6Z A;  2ZNT A;  5DT6 A;  3KOT A;  4NF5 B;  3MVW A;  4QFP A;  5KCJ A;  2D3I A;  2DQV A;  2XXU A;  1B3L A;  3MP8 A;  3CSG A;  4QHQ A;  4ESW A;  4JWY A;  3H3G A;  2UXA A;  2Q89 A;  3C4M A;  2D21 A;  3MW0 A;  3G3H A;  2VOZ A;  2HXW A;  1ATG A;  4C1U A;  2F6P A;  1EZO A;  1OQG A;  4LON B;  2Q8J A;  4E0X A;  2NVU B;  2R71 A;  2O69 A;  3I5O A;  1OQH A;  3N94 A;  5TPA B;  1FQA A;  3K1N A;  4YKP A;  3TQW A;  1Q1K A;  3PUX E;  4C1T A;  3TZA A;  3B6Q A;  1XOC A;  2A5T B;  3Q28 A;  3K02 A;  3BBR A;  2XXQ A;  5H8H A;  4R2B A;  3VXC A;  3QYT A;  4PFU A;  4G68 B;  2P1S A;  1MM6 A;  1JQF A;  1B4H A;  3LR1 A;  4G68 C;  4X1D A;  3HPI A;  4POX A;  3VLU A;  5DEX B;  4EF1 A;  4G8N A;  3KG2 A;  4GXS B;  4KPT A;  4UA8 A;  4K3F A;  3FIR A;  1SW4 A;  4GIZ A;  3H7M A;  3PUZ E;  4G2Z A;  5HBC A;  4LUB A;  2H99 A;  4NF8 A;  4KCC A;  4LP2 B;  3LUY A;  1MXW A;  2I4B A;  1ZTY A;  3FVK A;  2Y7W A;  4G8M A;  4RPN A;  3D4G A;  2RC8 A;  2V3Q A;  4GQO A;  1YAE A;  4AB5 A;  5CMB A;  1T0K A;  3ECR A;  2DXR A;  3T96 B;  4F3B A;  1QKB A;  2WKY A;  1II5 A;  1B3F A;  5DVI A;  1B6H A;  4G8H A;  4F3G A;  1B1H A;  2XD3 A;  4EQB A;  4KQP A;  4H67 A;  3DLN A;  4F29 A;  4IGR A;  4ZEI A;  3PV0 E;  2ZYO A;  4IO5 A;  3DP6 A;  4OWD A;  3TTN A;  1B32 A;  2XXW A;  4FED A;  1AMF A;  4LA9 A;  1B51 A;  3MVZ A;  4PFT A;  1MM7 A;  3OEL A;  4YKJ A;  4P0G A;  1TXF A;  1UTH B;  3RT6 B;  2O68 A;  2XX9 A;  1MQH A;  4FAJ A;  3VVF A;  1B05 A;  1DOT A;  1UQW A;  1O7T A;  4KI0 E;  4F39 A;  1UTB A;  3B6T A;  5CMM A;  5EYF A;  1NH7 A;  3OO8 A;  1O63 A;  1PC3 A;  4Z7E A;  5JEI A;  3L6G A;  1ZLQ A;  1B52 A;  3KOS A;  3TMG A;  4BDL A;  1YPN A;  1PBQ A;  1Y3P A;  3I3V A;  4EQ7 A;  3PD9 A;  3QUF A;  5AA2 B;  2ZYK A;  1URD A;  1AH5 A;  4I1D A;  5FHO A;  3M3L A;  3G3K A;  5A5X A;  5I2N A;  4M4G A;  2XXH A;  3OSR A;  5CMC A;  1NNF A;  2OWT A;  5DVF A;  1B58 A;  1SW5 A;  2ANJ A;  3W9W A;  4ELQ A;  1VFE A;  5ICQ A;  4JXI A;  4MLQ A;  1MPD A;  1SW2 A;  4QF9 A;  4GXA A;  4AQ4 A;  4XXU A;  3CG1 A;  3IB1 A;  1IQ7 A;  2RF1 A;  1P99 A;  4JBZ A;  3GBA A;  3QUJ A;  1ZMG A;  3CSB A;  2GH9 A;  1P1N A;  1XVY A;  1MXV A;  1POY 1;  1JET A;  1S7Y A;  2F97 A;  2AL5 A;  5I84 A;  3O6I A;  1NMU A;  2RC9 A;  1BIY A;  3HV1 A;  4BDO A;  3CR9 A;  3VE1 B;  5FTH A;  3V8X B;  3OMB A;  1BLF A;  4OTE A;  1B3G A;  2OJT A;  3QAX A;  4H5F A;  3ODB A;  3WAF A;  1I6Q A;  3V5A A;  4AB6 A;  3B6W A;  3C35 A;  3QSL A;  4QRZ A;  1FQB A;  5JTY B;  1MY1 A;  2ZXT A;  3MZB A;  3KJT A;  3O66 A;  1S50 A;  1I69 A;  5K2Y A;  2LAO A;  4NMY A;  3UOR A;  4UAC A;  4JWX A;  1R9Q A;  3FAT A;  2I4C A;  1SD3 A;  4OQO A;  5AA1 A;  1JEV A;  1N7X A;  3H6U A;  3E13 X;  5IKB A;  2YJP A;  3O9P A;  4YU0 A;  1FQF A;  1AL3 A;  2NOO A;  1B7U A;  4IO3 A;  3ONM A;  3TCF A;  4LQ2 A;  3EHU A;  3PMX A;  5I57 B;  1I6A A;  2H5Y A;  3RN8 A;  3K00 A;  2ZNU A;  3RUM A;  4Z0I A;  1RYX A;  1MY2 A;  2AIX A;  1XHY A;  1PBP A;  4U1Z A;  4GL0 A;  4EF2 A;  4X1B A;  3T93 B;  1VSO A;  4IO7 A;  1LFH A;  3IB0 A;  1KWH A;  1JW5 A;  1PB8 A;  4RNS A;  3HO7 A;  2DWI A;  2CMO A;  2QS2 A;  2DXY A;  1FQE A;  2A5S A;  5DTB A;  3S9N C;  1OVB A;  3K6W A;  1Q35 A;  2OCU A;  1Y3N A;  3FJM A;  3O6H A;  1B5J A;  2PMS A;  3JYR A;  5AE4 A;  1DPE A;  1SVX B;  3FV2 A;  2F8D A;  3VV5 A;  4ZE9 A;  2RCA A;  3LSW A;  2IEE A;  4JB7 A;  3C31 A;  4F3S A;  1LB9 A;  4XKQ A;  2PVU A;  1LST A;  4OYV A;  3N6T A;  1A55 A;  4YMA A;  4GL8 A;  4MLV A;  5TP9 A;  1AOV A;  4R9G A;  5KCJ B;  1NH8 A;  2YLN A;  1ZJL A;  3DM0 A;  4LZ7 A;  1B0L A;  4NF4 B;  3G3F A;  1VE4 A;  1B2H A;  2ZNS A;  4KD5 A;  1N0T A;  1LAG E;  4TQU Q;  1P1W A;  1MPC A;  1PEB A;  4H6D A;  2O51 A;  5DVJ A;  5AA3 A;  3G7W A;  1NNP A;  4DIG A;  4NWC A;  1VFD A;  1UIU A;  3K6V A;  1M5D A;  1SI0 A;  4PFW A;  2UYE A;  4X48 A;  3A3C A;  2HFB A;  4RK2 A;  2F36 A;  4ONY A;  3B7D A;  5F7V A;  4X9T A;  3O28 A;  4FE8 A;  5B70 A;  3MPK A;  4WXJ A;  1URS A;  1POT A;  4POW A;  2NWJ A;  3O2A A;  2V25 A;  1IXG A;  5I2K A;  5CI5 A;  5KZT A;  4ZE8 A;  2F7A A;  1LAF E;  2Q2A A;  5BUU A;  4DE8 A;  2Z23 A;  4P0I A;  4O3C A;  1IXI A;  1MS7 A;  2XHD A;  4GRK A;  5L8D A;  3IOR A;  3VVE A;  1DSN A;  4ZZE A;  3U8Q A;  1XC1 A;  2DVZ A;  2RIN A;  4P11 A;  1FTO A;  1D4N A;  3I6V A;  3N6U A;  5FTI A;  3C9H A;  4PQJ A;  1SW1 A;  4ND9 A;  1A54 A;  2QS3 A;  4GOT A;  2HEU A;  3M8U A;  3Q27 A;  2ESN A;  3V83 A;  5DYH A;  1FTJ A;  1JVX A;  4YKK A;  4NF5 A;  2Y7I A;  4DZ1 A;  2BJJ X;  1USY H;  2QL3 A;  4OER A;  1JNF A;  1WDN A;  2PX1 A;  2I48 A;  1WVJ A;  3PPO A;  2HZL A;  4RYA A;  2V93 A;  3PPQ A;  1MQD A;  2DP8 A;  4OFO A;  4ZED A;  4HCY A;  2R6G E;  4IY6 A;  4YB7 A;  3IAZ A;  1SDX A;  1MQI A;  4R6H A;  4F22 A;  3JV9 A;  3FVO A;  2HAV A;  1B3H A;  2REG A;  2QS1 A;  1SQY A;  3PD8 A;  1XVX A;  5TPA A;  3O29 A;  1QVS A;  3KN8 A;  1MRP A;  3BFT A;  3W9V A;  2A5T A;  3QXM A;  1A8F A;  3E4R A;  4Q0C A;  3MUQ A;  4M1V A;  2DWH A;  2DWJ A;  4HTG A;  3LSF B;  3SEY A;  3RY3 A;  1HSJ A;  3V89 B;  2W7Y A;  3S9M C;  2Q9T A;  3R6U A;  4ZEB A;  4H1X A;  4F18 A;  4OVJ A;  4OZ9 A;  4JSD A;  5KDT B;  3IB2 A;  3ZSF A;  4OFL A;  3H6V A;  4R6Y A;  2HZK A;  5I56 B;  4GFR A;  1BP5 A; 
#chains in the Genus database with same CATH topology
 4Q5T A;  4ZS9 A;  5H8F B;  2GRV A;  1L5T A;  3RNN A;  1H76 A;  4OEN A;  2B3B A;  5ITP A;  4EXL A;  2X7Q A;  3AXF A;  1IZ1 A;  4F2Q A;  4R2F A;  1QUJ A;  3U93 A;  3K6U A;  1N7W A;  1IUD A;  4PF6 A;  4LAT A;  2UVH A;  3EPE A;  5I2N B;  1JW4 A;  4QFO A;  2O1L A;  5I3S A;  4KCD A;  4O7I A;  4I62 A;  2OLB A;  3KBZ A;  3ZKL A;  2UVG A;  1MXZ A;  2PBW A;  3GBB A;  3UN6 A;  1KA1 A;  4U21 A;  2F78 A;  3BFU A;  2DE3 A;  3IFC A;  4NHB A;  1Z7M E;  2THI A;  3IK6 B;  3N26 A;  4H0W A;  3TFL A;  2P0S A;  1FTL A;  3RPL A;  3CI8 A;  2DE4 A;  1Y4C A;  4YB5 A;  1MPB A;  3S9L C;  2I3W A;  3HHF A;  3MC2 A;  1B5I A;  3K6X A;  4PFY A;  4R74 A;  4XTC Q;  3B8B A;  3EHT A;  5EHM A;  1DTG A;  3C34 A;  3MZ1 A;  3BKI B;  3O97 A;  5ITO A;  3IOW A;  2HPG A;  2HQ0 A;  3KFM A;  4E0W A;  5H8N B;  3CVG A;  2WBD A;  1JW1 A;  3IOU A;  4F1V A;  4WED A;  3LC8 A;  4OFJ A;  2Q88 A;  1FPJ A;  5J16 A;  2FIX A;  1ELJ A;  2WBB A;  3K01 A;  4Q30 B;  3IO4 A;  5I58 B;  2F34 A;  3IOT A;  3M3K A;  2PFZ A;  1J1N A;  3K2D A;  3H6W A;  5I59 B;  2UYF A;  2XXP A;  1B4Z A;  3ISP A;  1FTM A;  1IIW A;  5AA2 A;  1FJ9 A;  3VLW A;  5I5P A;  4YIC A;  5TU0 A;  4EUO A;  4G4P A;  4EXK A;  3FJ7 A;  3KN3 A;  2F35 A;  4U4X A;  4RPO A;  1SI1 A;  1H45 A;  4OXV A;  2VPN A;  4R75 A;  2RKM A;  1LGB C;  1B46 A;  3U92 A;  4IO4 A;  3K1P A;  5ELV A;  1DK4 A;  4MH5 A;  1OIB A;  4XIG Q;  1QUK A;  3MBP A;  4DXB A;  4H8I A;  3FJG A;  4THI A;  4H8J A;  4GWO A;  2G29 A;  1MH3 A;  4GVO A;  5AA4 B;  3OO6 A;  3OO7 A;  3IOV A;  4QSC A;  2CZL A;  1GR2 A;  4OHN A;  5ICT A;  1G0H A;  5JK4 A;  4U1O A;  3T9V A;  1D9V A;  3K0V A;  4YB6 A;  3BIG A;  1NL5 A;  2H9B A;  3MAM A;  4KHZ E;  3SDF A;  1LFG A;  4QFL A;  4GBV A;  1NI9 A;  1K9Z A;  1LBX A;  3UGW A;  2UVI A;  1R9L A;  1PDA A;  3RT8 A;  5EQ8 A;  2DYX A;  2I0B A;  4GF8 A;  1FBF A;  4GWS A;  1QJM A;  1IXC A;  4R73 A;  4GWZ A;  1QUL A;  1FTK A;  5CM6 A;  3G3G A;  5JTY A;  2Y5L A;  1N3W A;  3T9H B;  1CE2 A;  3HST A;  4O94 A;  4PC9 A;  3P7I A;  4OET A;  4PBH A;  4FJP A;  2Y5K A;  3KSX A;  4GWU A;  3IJO B;  4TLL B;  3FGS A;  4NF6 B;  5EYG A;  3KZG A;  3THI A;  3OEK A;  5CBS A;  4I3E A;  4YKI A;  3H4Z A;  4IB2 A;  3FD3 A;  4OMB A;  4YMB A;  1WOD A;  1XT8 A;  4YAH X;  3PMV A;  3CG3 A;  5HM4 B;  4FIM A;  4Q8R A;  4EDP A;  4ISU A;  4P8B A;  4JSO A;  3KJ7 A;  4N8G A;  2GFE A;  2GQ1 A;  4GLI A;  1DPP A;  4N6D A;  4GWY A;  4N17 A;  5BWJ A;  2B65 A;  4EQ9 A;  4I9D A;  4NWD A;  1OLC A;  4FBP A;  1EU8 A;  1FQC A;  2M8C A;  3C32 A;  1MQG A;  2QRY A;  3RTW B;  4BLA A;  1NFT A;  5L9O A;  2WEF A;  1FPD A;  1JEU A;  1MY3 A;  4F1Y A;  1LCT A;  4HW8 A;  1HSL A;  3KC1 A;  3C33 A;  4TOZ A;  1IEJ A;  3G3I A;  3MP1 A;  4O3B A;  3L6H A;  1O64 A;  4AS4 A;  3C36 A;  1FBE A;  3PPP A;  3TYH A;  4PET A;  2IA4 A;  3PTY A;  3FV1 A;  2OX3 A;  4RXL A;  1P1O A;  1N84 A;  1US5 A;  2Z8D A;  3ILT B;  3VLV A;  4F2O A;  5H8Q A;  4OEV A;  2DWA A;  2Q74 A;  4F1U A;  2ALU A;  5B7D A;  3W15 C;  2GHA A;  5H8S A;  1FBP A;  2QSX A;  4IGT A;  2V84 A;  3FXQ A;  2XXV A;  3OO9 A;  3PUW E;  2HAU A;  2DE2 A;  5H8H B;  3FUZ A;  1SBP A;  3RLF E;  4NN3 A;  3DP8 A;  4ELR A;  4NF4 A;  1ZBM A;  3U94 A;  2F7B A;  5IZZ A;  4XKP A;  1P1U A;  4DCY A;  3ZS6 A;  1NKX A;  2XXR A;  2O7I A;  3MWB A;  1SYH A;  5L9S A;  4MX6 A;  4FOR A;  5IZ3 A;  3SEU A;  5AA2 D;  3TTM A;  3HN0 A;  3Q26 A;  2DOJ A;  1FPL A;  1A99 A;  1US4 A;  3A3U A;  2NXO A;  2VPO A;  4O3A A;  3FAS A;  1N76 A;  4P47 A;  4C0R A;  2QS4 A;  2Y84 A;  4LVQ A;  3S4U A;  3IL1 B;  3A09 A;  1FJ6 A;  3PPR A;  1YTV A;  4U4S A;  4KYS A;  1LAX A;  2VP1 A;  3MQ9 A;  4NF8 B;  3FVN A;  4MFI A;  5LOM A;  3HCQ A;  4U2R A;  2JJK A;  4P1L A;  4QFN A;  2ONK E;  1LBY A;  1ZU0 A;  3KC0 A;  2GHB A;  3OEM A;  2L5V A;  2H98 A;  4MAG A;  2OBG A;  5IAI A;  5EHS A;  2QMX A;  4NGU A;  1FTA A;  2VGQ A;  4BDN A;  1EYI A;  5FHN A;  2V3T A;  1Y9U A;  3TTL A;  4ECF A;  1B3E A;  3UP9 A;  1H3D A;  3E3K A;  1M5F A;  1QUI A;  1GV8 A;  3SZP A;  1FQD A;  1OLA A;  2Z8F A;  1Y20 A;  1RKM A;  1FPI A;  4PFI A;  3EN3 A;  3T9U A;  4QSE A;  5ISU A;  3MVX A;  1R1N A;  1M5B A;  1MXY A;  3VDF A;  3EQ1 A;  4PP0 A;  1Y1Z A;  2O6A A;  4BDQ A;  3IR1 A;  4PAF A;  4IO6 A;  3S9E A;  4G68 A;  2REJ A;  4MF3 A;  4JDF A;  4PE3 A;  4R6K A;  1RDY A;  4DI3 D;  4RK9 A;  5CC2 A;  2OWS A;  2P2A A;  3KN7 A;  1N3X A;  4QFK A;  3LSL A;  2O84 X;  1D9Y A;  2QFL A;  1IMA A;  2QMW A;  5DEX A;  1URG A;  1XI6 A;  3CIJ A;  1UTB B;  2RCB A;  1EZ9 A;  4FEC A;  3UA8 A;  3HFU A;  2XXI A;  1QW0 A;  4LQ5 A;  3TPA A;  2ABH A;  2PT1 A;  3NOH A;  3OOA A;  4ZEF A;  1HSE A;  1ZIU A;  4PF8 A;  1DBZ A;  1A7L A;  1FCK A;  2R9J A;  1FBD A;  4KFQ A;  1JP4 A;  3TAJ A;  2ZYN A;  3FVG A;  3KGC A;  3H6T A;  3N5L A;  4WKM A;  3OD7 A;  3QIM A;  2FNC A;  4NED A;  2Q8M A;  1ANF A;  3VXB A;  3K1M A;  4ELO A;  3A29 A;  3CHG A;  3ZKK A;  2UVJ A;  4MNP A;  2G93 A;  2VD3 A;  4G77 A;  5ET8 A;  1GGG A;  3FZV A;  3DP4 A;  1LFI A;  1OMP A;  1PB7 A;  3TCH A;  1GVC A;  1JVY A;  1IXH A;  2I58 A;  4BDR A;  1UIV A;  3TEP A;  5A5X B;  3HHG A;  1ZKB A;  2NUV A;  1MDQ A;  2KQZ A;  2Y7P A;  2CZH A;  3TDJ A;  5A5L A;  3UIF A;  3TEL A;  3GXA A;  4GWW A;  1B0H A;  3FXU A;  2XA5 A;  3GYY A;  2X7P A;  1RYO A;  3IX1 A;  3KEI A;  4L17 A;  1EZP A;  4JWO A;  4GBW A;  3SKP A;  1F9B A;  3R7X A;  2XD2 A;  3CFL A;  3G3J A;  4H46 A;  4XKN A;  3RYD A;  3LBS A;  2D5W A;  5KDT A;  2Y7K A;  3O6G A;  4ZEK A;  1H43 A;  1MQJ A;  4G61 A;  3PPN A;  3IJX B;  4DI4 B;  2QVR A;  1LBZ A;  4ZEC A;  5I56 A;  4IY5 A;  2ZMB A;  2F5X A;  3QK6 A;  5H8F A;  2ONR A;  2CZI A;  5L9M A;  3VVD A;  5IZ1 A;  3K4U A;  3S2V A;  4AS5 A;  4I8C A;  4ZZA A;  1UTH A;  5CMK A;  4N6K A;  4KYD A;  4BDM A;  1B9J A;  1NV5 A;  1TFA A;  1CB6 A;  2OZZ A;  4QXD A;  4RJZ A;  1K9Y A;  4GD5 A;  2VHA A;  2XWI A;  2Z22 A;  4FEB A;  4KR5 A;  3JZJ A;  2XXT A;  5J1D A;  2FBP A;  1EH3 A;  3M3F A;  3DEL B;  4XEQ A;  1S9T A;  2DVC A;  4N91 A;  2VD2 A;  1LB8 A;  2H25 A;  2DSF A;  1FBH A;  5M2V A;  4OES A;  4NG7 A;  1IMD A;  1NV0 A;  2H4I A;  4NE4 A;  4H65 A;  4QSD A;  4I3Y A;  4MHF A;  1Y4T A;  3TKD A;  4HCW A;  1P1Q A;  1M5C A;  3TTK A;  2V3U A;  2XXY A;  1YXI A;  1AIV A;  1AWB A;  4MCO A;  3IO6 A;  3OEN A;  3EF7 A;  1IMF A;  3RTF B;  1IIT A;  1NNT A;  4N07 A;  2XX7 A;  4YZZ A;  3PGF A;  1LBC A;  3OSQ A;  1NNK A;  3SER A;  2B3F A;  5H8N A;  2QPQ A;  2XX8 A;  5CRY A;  3SES A;  3PMW A;  2I6E A;  4ESX A;  3MP6 A;  4P9K A;  3CFX A;  1DTZ A;  4PFB A;  2FIE A;  4DXU A;  1Y3Q A;  1BTJ A;  3SET A;  4MIJ A;  5I58 A;  1Y1M A;  1TT1 A;  4PCD A;  2ZYM A;  3FXB A;  3MYU A;  2X26 A;  5CBR A;  1MDP 1;  1TFD A;  4N6P A;  2QJE A;  2VT5 A;  5I59 A;  3H03 A;  3T9X B;  5DW8 A;  1A8E A;  3U72 A;  3GZG A;  3RQT A;  2HXR A;  2I0C A;  3TUS A;  5EQA A;  2XXX A;  3Q25 A;  2F6G A;  2I49 A;  3CRB A;  4PTK A;  3CFZ A;  4HS7 A;  3MVY A;  4KYE A;  1MH4 A;  1OVT A;  1I6B A;  1MY4 A;  4U23 A;  4X8R A;  2DS9 A;  3TCG A;  3IFA A;  4R72 A;  4N13 A;  2HCA A;  3KSJ A;  1N04 A;  1B1X A;  1Q9D A;  4OVR A;  2I3V A;  2PYY A;  1RDX A;  2YPN A;  5HPQ A;  2AL4 A;  3E9X A;  3F11 A;  1B7H A;  4U22 A;  3SEX A;  4FAT A;  4MJO A;  3KBR A;  5TP9 B;  3SEV A;  4ELP A;  5FBP A;  1VR5 A;  1MXU A;  1LCF A;  1D3K A;  3TQL A;  4WEP A;  4LZ8 A;  3EHS A;  1LAH E;  1A40 A;  5AA4 A;  1B40 A;  4N81 A;  2OK2 A;  4DDD A;  1GTK A;  1USY E;  1DMB A;  1PB9 A;  4MMP A;  4IO2 A;  4F31 B;  1YCJ A;  4RY1 A;  4HE1 A;  4GX3 A;  1Z7N E;  2B4L A;  3ILU B;  2O1M A;  2HHM A;  3QMF A;  5I57 A;  3EKI A;  1XS5 A;  2RC7 A;  4RA1 A;  4P3L A;  3USD A;  3PUY E;  4OEU A;  5FHM A;  1IMC A;  4DXC A;  3T22 A;  2E0S A;  3RPW A;  3SEW A;  1H44 A;  2Z8E A;  3GLB A;  3H06 B;  3U1O A;  3TOD A;  4DCX A;  1BKA A;  3WAE A;  3Q29 A;  4TLM B;  2WYP A;  3MJN A;  1FW0 A;  2FYI A;  4OVT A;  2ONS A;  5I7I A;  5H8Q B;  1FBC A;  3OXN A;  3UK4 A;  1MY0 A;  4PE5 B;  3D4C A;  4NQ8 A;  1FPG A;  3FXR A;  4DLD A;  3LSX A;  1LBB A;  4NF6 A;  2O7U A;  5I2K B;  2AYS A;  4LZ5 A;  1SYI A;  2PT2 A;  1QKA A;  3MZ9 A;  5LDZ A;  2F7C A;  5K2X A;  2E1S A;  4PDH A;  1FSA A;  3PUV E;  3R26 A;  1FRP A;  1B7Z A;  4HE0 A;  4H5G A;  3VFJ A;  4MBP A;  3RGY A;  1MXX A;  5ET7 A;  1TWY A;  5F1Q A;  1LLS A;  4XKR A;  2F3D A;  1KA0 A;  1M5E A;  4F19 A;  2FA7 A;  4NTL A;  1SPI A;  1MG1 A;  2KLF A;  3PU5 A;  3T66 A;  4ZDM A;  4R9F A;  3TTR A;  3MPL A;  1B5H A;  4P1E A;  4F3P A;  2Q2C A;  2Y7R A;  1R6Z A;  2ZNT A;  1FPK A;  5DT6 A;  3KOT A;  4NF5 B;  3MVW A;  4QFP A;  5KCJ A;  2D3I A;  2DQV A;  2P3V A;  2XXU A;  1B3L A;  3BIH A;  4N4U A;  3MP8 A;  3CSG A;  4QHQ A;  4ESW A;  4JWY A;  3H3G A;  2UXA A;  5ET6 A;  2Q89 A;  3C4M A;  2D21 A;  3MW0 A;  3G3H A;  2VOZ A;  2HXW A;  1ATG A;  4C1U A;  2F6P A;  1EZO A;  1OQG A;  4XFE A;  4O8M A;  4LON B;  2Q8J A;  4E0X A;  2NVU B;  2R71 A;  2O69 A;  3I5O A;  1OQH A;  3N94 A;  5TPA B;  1FQA A;  3K1N A;  4YKP A;  3TQW A;  1Q1K A;  3PUX E;  4C1T A;  3TZA A;  4QBA A;  3B6Q A;  1XOC A;  2A5T B;  3Q28 A;  3K02 A;  3BBR A;  2QVV A;  2XXQ A;  5H8H A;  4R2B A;  3VXC A;  3QYT A;  4PFU A;  4G68 B;  2P1S A;  3B50 A;  1MM6 A;  4OA4 A;  1JQF A;  1B4H A;  3LR1 A;  4G68 C;  4X1D A;  3HPI A;  4POX A;  3VLU A;  1DCU A;  1QGX A;  5DEX B;  4EF1 A;  4G8N A;  3KG2 A;  4GXS B;  4KPT A;  4UA8 A;  4NX1 A;  4K3F A;  3FIR A;  1EYJ A;  1SW4 A;  4GIZ A;  3H7M A;  4UAB A;  3PUZ E;  4G2Z A;  5HBC A;  4LUB A;  2H99 A;  4NF8 A;  4KCC A;  4LP2 B;  3LUY A;  1MXW A;  2I4B A;  1ZTY A;  3FVK A;  2Y7W A;  3D1R A;  4I40 A;  4G8M A;  4RPN A;  3D4G A;  4OVS A;  2RC8 A;  2V4C A;  1NV1 A;  2V3Q A;  4GQO A;  1YAE A;  4AB5 A;  5CMB A;  1LEV A;  1T0K A;  3ECR A;  2DXR A;  1D9Q A;  3T96 B;  4F3B A;  2B4M A;  1FPE A;  1QKB A;  1YYZ A;  2WKY A;  1II5 A;  1B3F A;  5DVI A;  1G0I A;  1B6H A;  4JVI A;  4G8H A;  4F3G A;  2KR0 A;  1B1H A;  2XD3 A;  4EQB A;  4KQP A;  4H67 A;  3DLN A;  4F29 A;  4IGR A;  4ZEI A;  3RPL B;  3PV0 E;  3LV0 A;  1NUZ A;  2ZYO A;  4IO5 A;  3DP6 A;  4OWD A;  3TTN A;  1B32 A;  2XXW A;  4FED A;  1AMF A;  4LA9 A;  3E79 A;  1B51 A;  1FPF A;  3MVZ A;  4PFT A;  1MM7 A;  3OEL A;  4YKJ A;  4P0G A;  1TXF A;  1UTH B;  3RT6 B;  2BJI A;  3E78 A;  2O68 A;  2XX9 A;  1MQH A;  4FAJ A;  3VVF A;  1B05 A;  1DOT A;  1UQW A;  1O7T A;  4KI0 E;  4F39 A;  1UTB A;  3B6T A;  5CMM A;  5EYF A;  3LUZ A;  1NH7 A;  3OO8 A;  2WYK A;  1LBW A;  1O63 A;  1PC3 A;  4Z7E A;  4PDD A;  3U65 A;  1YZ0 A;  5JEI A;  3L6G A;  1ZLQ A;  1B52 A;  3KOS A;  3TMG A;  4BDL A;  1YPN A;  1PBQ A;  1Y3P A;  3I3V A;  4EQ7 A;  3PD9 A;  3QUF A;  5AA2 B;  2ZYK A;  1URD A;  1AH5 A;  4I1D A;  4IR8 A;  4MEV A;  5FHO A;  3M3L A;  3G3K A;  5A5X A;  5I2N A;  4H45 A;  2XXH A;  4M4G A;  2XWK A;  3OSR A;  5CMC A;  1NNF A;  2OWT A;  3T0J A;  5DVF A;  1B58 A;  1SW5 A;  2ANJ A;  1RDZ A;  3W9W A;  4ELQ A;  1VFE A;  3MST A;  5ICQ A;  4JXI A;  4MLQ A;  1MPD A;  1SW2 A;  2R8T A;  4QF9 A;  4GXA A;  4AQ4 A;  4XXU A;  4HXV A;  3CG1 A;  3IB1 A;  4XF5 A;  1IQ7 A;  2RF1 A;  1P99 A;  4JBZ A;  3GBA A;  3QUJ A;  1ZMG A;  3CSB A;  2GH9 A;  1P1N A;  1XVY A;  5EQ9 A;  1MXV A;  1POY 1;  1JET A;  1S7Y A;  2F97 A;  1NUY A;  2AL5 A;  5I84 A;  3O6I A;  1NMU A;  2RC9 A;  1BIY A;  3HV1 A;  4BDO A;  3CR9 A;  3VE1 B;  5FTH A;  1NV2 A;  4LN5 A;  3V8X B;  3OMB A;  1BLF A;  4OTE A;  1B3G A;  2OJT A;  3QAX A;  4H5F A;  3ODB A;  3WAF A;  1I6Q A;  3V5A A;  4AB6 A;  4OVP A;  4OAN A;  2FHY A;  3B6W A;  4PBQ A;  3C35 A;  3QSL A;  4QRZ A;  1FQB A;  5JTY B;  1MY1 A;  2ZXT A;  3MZB A;  3KJT A;  3O66 A;  1S50 A;  1I69 A;  5K2Y A;  2LAO A;  4NMY A;  3UOR A;  2ZZV A;  4UAC A;  4JWX A;  4O7M A;  1R9Q A;  3FAT A;  2I4C A;  1SD3 A;  4OQO A;  5AA1 A;  1JEV A;  1N7X A;  4PGP A;  3H6U A;  3E13 X;  5IKB A;  2YJP A;  3O9P A;  4YU0 A;  5EYH A;  1FQF A;  1AL3 A;  2CZK A;  2NOO A;  1B7U A;  4IO3 A;  3ONM A;  3TCF A;  4LQ2 A;  3EHU A;  3PMX A;  5I57 B;  1NUW A;  5ESY A;  1I6A A;  2H5Y A;  2PCR A;  3RN8 A;  3K00 A;  3FBP A;  3T1B A;  2ZNU A;  4PGN A;  3RUM A;  4Z0I A;  1RYX A;  1MY2 A;  4OVQ A;  2AIX A;  1XHY A;  1PBP A;  4U1Z A;  4GL0 A;  4EF2 A;  4X1B A;  3T93 B;  1VSO A;  4IO7 A;  1LFH A;  3IB0 A;  1KWH A;  1JW5 A;  1PB8 A;  4RNS A;  3HO7 A;  2CEX A;  2DWI A;  2CMO A;  2QS2 A;  2DXY A;  1FQE A;  2A5S A;  5DTB A;  3S9N C;  1OVB A;  3K6W A;  1Q35 A;  4GX4 A;  2OCU A;  1Y3N A;  3FJM A;  3O6H A;  1B5J A;  2PMS A;  2XWV A;  3JYR A;  5AE4 A;  1DPE A;  1SVX B;  3FV2 A;  2F8D A;  3VV5 A;  1NV7 A;  4ZE9 A;  2RCA A;  3LSW A;  2IEE A;  4JB7 A;  4PFR A;  3C31 A;  1IME A;  1LB9 A;  4F3S A;  4XKQ A;  3ROJ A;  1FPB A;  2PVU A;  2F3B A;  1LST A;  4OYV A;  3N6T A;  1A55 A;  4YMA A;  4GL8 A;  5IM2 A;  4MLV A;  5TP9 A;  1AOV A;  4R9G A;  5KCJ B;  1NH8 A;  2YLN A;  1ZJL A;  1FBG A;  3DM0 A;  4LZ7 A;  1B0L A;  1VDW A;  4NF4 B;  3G3F A;  4PAK A;  1VE4 A;  1B2H A;  2ZNS A;  4KD5 A;  1N0T A;  2XWO A;  1LAG E;  4KXP A;  4TQU Q;  1P1W A;  1MPC A;  1PEB A;  4H6D A;  2O51 A;  5DVJ A;  5IZ3 B;  2XXK A;  5AA3 A;  3G7W A;  1NNP A;  4DIG A;  4NWC A;  1VFD A;  1NUX A;  1UIU A;  3K6V A;  1M5D A;  1SI0 A;  1IMB A;  2DDK A;  4PFW A;  2UYE A;  2P3N A;  4X48 A;  3A3C A;  5ET5 A;  2HFB A;  4RK2 A;  2F36 A;  4ONY A;  1LBV A;  3B7D A;  5F7V A;  4X9T A;  2ZZW A;  3O28 A;  4FE8 A;  5B70 A;  3MPK A;  4WXJ A;  1URS A;  1POT A;  4POW A;  2NWJ A;  1NV3 A;  2OWZ A;  3O2A A;  2MKZ A;  2V25 A;  4X04 A;  1IXG A;  5I2K A;  5CI5 A;  5KZT A;  4ZE8 A;  2F7A A;  4N8Y A;  1LAF E;  2Q2A A;  5BUU A;  4DE8 A;  4P56 A;  2Z23 A;  2ZZX A;  4P0I A;  4O3C A;  1IXI A;  1MS7 A;  2XHD A;  4GRK A;  5L8D A;  3IOR A;  3VVE A;  1DSN A;  4ZZE A;  3U8Q A;  1XC1 A;  2DVZ A;  2FVZ A;  2RIN A;  4P11 A;  1FTO A;  1D4N A;  3I6V A;  3N6U A;  5FTI A;  3C9H A;  1NV6 A;  4PQJ A;  1SW1 A;  4ND9 A;  1A54 A;  2QS3 A;  4GOT A;  4HE2 A;  2HEU A;  3M8U A;  3Q27 A;  2ESN A;  4N15 A;  1BK4 A;  3V83 A;  5DYH A;  1FTJ A;  1JVX A;  4YKK A;  4NF5 A;  2Y7I A;  4DZ1 A;  2BJJ X;  1USY H;  2QL3 A;  4OER A;  1JNF A;  1WDN A;  2PX1 A;  2I48 A;  2QVU A;  5F24 A;  1WVJ A;  4GWX A;  4NF0 A;  3PPO A;  2HZL A;  4RYA A;  2V93 A;  3PPQ A;  1MQD A;  2DP8 A;  4OFO A;  4ZED A;  4HCY A;  2CEY A;  2R6G E;  4IY6 A;  4YB7 A;  3IAZ A;  1SDX A;  1MQI A;  4R6H A;  4JVC A;  4F22 A;  3JV9 A;  3FVO A;  4NAP A;  2HAV A;  1B3H A;  2REG A;  2QS1 A;  1SQY A;  3PD8 A;  1XVX A;  4GX6 A;  3O29 A;  1QVS A;  5TPA A;  3KN8 A;  1MRP A;  4MNI A;  3BFT A;  3W9V A;  2A5T A;  3QXM A;  5EQ7 A;  1A8F A;  3E4R A;  4Q0C A;  2PFY A;  3MUQ A;  4M1V A;  2DWH A;  2DWJ A;  5T3J A;  5IGA A;  4HTG A;  1INP A;  3LSF B;  3SEY A;  3RY3 A;  1NV4 A;  1HSJ A;  5LTC A;  3V89 B;  2W7Y A;  4PAI A;  2Q9T A;  3R6U A;  3S9M C;  4ZEB A;  2WX9 A;  4H1X A;  4JVD A;  4F18 A;  4OVJ A;  1CNQ A;  4OZ9 A;  4JSD A;  5KDT B;  3IB2 A;  3ZSF A;  4OFL A;  1EYK A;  3H6V A;  4R6Y A;  2HZK A;  5I56 B;  4GFR A;  1KZ8 A;  4MNC A;  1BP5 A; 
#chains in the Genus database with same CATH homology
 4Q5T A;  4ZS9 A;  5H8F B;  2GRV A;  1L5T A;  3RNN A;  1H76 A;  4OEN A;  2B3B A;  5ITP A;  4EXL A;  2X7Q A;  3AXF A;  1IZ1 A;  4F2Q A;  4R2F A;  1QUJ A;  3U93 A;  3K6U A;  1N7W A;  1IUD A;  4LAT A;  2UVH A;  3EPE A;  5I2N B;  1JW4 A;  4QFO A;  2O1L A;  4KCD A;  4I62 A;  2OLB A;  3ZKL A;  2UVG A;  1MXZ A;  2PBW A;  3GBB A;  3UN6 A;  4U21 A;  2F78 A;  3BFU A;  2DE3 A;  1Z7M E;  2THI A;  3IK6 B;  3N26 A;  4H0W A;  3TFL A;  2P0S A;  1FTL A;  3CI8 A;  2DE4 A;  1Y4C A;  4YB5 A;  1MPB A;  3S9L C;  2I3W A;  3HHF A;  3MC2 A;  1B5I A;  3K6X A;  4PFY A;  4R74 A;  4XTC Q;  3EHT A;  5EHM A;  1DTG A;  3C34 A;  3MZ1 A;  3BKI B;  3O97 A;  5ITO A;  3IOW A;  2HQ0 A;  3KFM A;  4E0W A;  5H8N B;  3CVG A;  1JW1 A;  3IOU A;  4F1V A;  4WED A;  3LC8 A;  4OFJ A;  2Q88 A;  1ELJ A;  3K01 A;  4Q30 B;  3IO4 A;  5I58 B;  2F34 A;  3IOT A;  3M3K A;  1J1N A;  3K2D A;  3H6W A;  5I59 B;  2UYF A;  2XXP A;  1B4Z A;  1FTM A;  1IIW A;  5AA2 A;  3VLW A;  4YIC A;  5TU0 A;  4EUO A;  4G4P A;  4EXK A;  3FJ7 A;  3KN3 A;  2F35 A;  4U4X A;  4RPO A;  1SI1 A;  1H45 A;  4OXV A;  4R75 A;  2RKM A;  1LGB C;  1B46 A;  3U92 A;  4IO4 A;  3K1P A;  5ELV A;  4MH5 A;  1OIB A;  4XIG Q;  1QUK A;  3MBP A;  4DXB A;  4H8I A;  3FJG A;  4THI A;  4H8J A;  4GWO A;  2G29 A;  1MH3 A;  4GVO A;  5AA4 B;  3OO6 A;  3OO7 A;  3IOV A;  4QSC A;  2CZL A;  1GR2 A;  4OHN A;  5ICT A;  5JK4 A;  4U1O A;  3T9V A;  1D9V A;  3K0V A;  4YB6 A;  1NL5 A;  2H9B A;  3MAM A;  4KHZ E;  3SDF A;  1LFG A;  4QFL A;  3UGW A;  2UVI A;  1R9L A;  1PDA A;  3RT8 A;  2DYX A;  2I0B A;  4GF8 A;  1QJM A;  1IXC A;  4R73 A;  1QUL A;  1FTK A;  5CM6 A;  3G3G A;  5JTY A;  1N3W A;  3T9H B;  1CE2 A;  3HST A;  3P7I A;  4OET A;  4FJP A;  3KSX A;  3IJO B;  4TLL B;  3FGS A;  4NF6 B;  3KZG A;  3THI A;  3OEK A;  5CBS A;  4YKI A;  3H4Z A;  4IB2 A;  3FD3 A;  4OMB A;  4YMB A;  1WOD A;  1XT8 A;  4YAH X;  3PMV A;  3CG3 A;  5HM4 B;  4FIM A;  4Q8R A;  4EDP A;  4ISU A;  4JSO A;  3KJ7 A;  2GFE A;  4GLI A;  1DPP A;  5BWJ A;  2B65 A;  4EQ9 A;  4I9D A;  4NWD A;  1OLC A;  1EU8 A;  1FQC A;  2M8C A;  3C32 A;  1MQG A;  2QRY A;  3RTW B;  4BLA A;  1NFT A;  5L9O A;  1JEU A;  1MY3 A;  4F1Y A;  1LCT A;  4HW8 A;  1HSL A;  3C33 A;  4TOZ A;  1IEJ A;  3G3I A;  3MP1 A;  4O3B A;  3L6H A;  1O64 A;  3C36 A;  3PPP A;  3TYH A;  4PET A;  2IA4 A;  3FV1 A;  4RXL A;  1P1O A;  1N84 A;  1US5 A;  2Z8D A;  3ILT B;  3VLV A;  4F2O A;  5H8Q A;  4OEV A;  2DWA A;  4F1U A;  2ALU A;  5B7D A;  3W15 C;  2GHA A;  5H8S A;  2QSX A;  4IGT A;  2V84 A;  3FXQ A;  2XXV A;  3OO9 A;  3PUW E;  2HAU A;  2DE2 A;  5H8H B;  3FUZ A;  1SBP A;  3RLF E;  3DP8 A;  4ELR A;  4NF4 A;  1ZBM A;  3U94 A;  2F7B A;  4XKP A;  1P1U A;  4DCY A;  3ZS6 A;  1NKX A;  2XXR A;  2O7I A;  3MWB A;  1SYH A;  5L9S A;  4FOR A;  3SEU A;  5AA2 D;  3TTM A;  3HN0 A;  3Q26 A;  2DOJ A;  1A99 A;  1US4 A;  3A3U A;  2NXO A;  4O3A A;  3FAS A;  1N76 A;  4C0R A;  2QS4 A;  2Y84 A;  4LVQ A;  3S4U A;  3IL1 B;  3A09 A;  3PPR A;  4U4S A;  1YTV A;  4KYS A;  1LAX A;  2VP1 A;  3MQ9 A;  4NF8 B;  3FVN A;  4MFI A;  5LOM A;  3HCQ A;  4U2R A;  4QFN A;  2ONK E;  1ZU0 A;  2GHB A;  3OEM A;  2H98 A;  2OBG A;  5IAI A;  5EHS A;  2QMX A;  2VGQ A;  4BDN A;  5FHN A;  2V3T A;  1Y9U A;  3TTL A;  4ECF A;  1B3E A;  3UP9 A;  1H3D A;  3E3K A;  1M5F A;  1QUI A;  1GV8 A;  1FQD A;  1OLA A;  2Z8F A;  1Y20 A;  1RKM A;  3EN3 A;  3T9U A;  4QSE A;  5ISU A;  3MVX A;  1R1N A;  1M5B A;  1MXY A;  3VDF A;  3EQ1 A;  4PP0 A;  1Y1Z A;  2O6A A;  4BDQ A;  3IR1 A;  4IO6 A;  3S9E A;  4G68 A;  2REJ A;  4MF3 A;  4JDF A;  4R6K A;  4RK9 A;  5CC2 A;  2OWS A;  2P2A A;  3KN7 A;  1N3X A;  4QFK A;  3LSL A;  2O84 X;  1D9Y A;  2QMW A;  5DEX A;  1URG A;  3CIJ A;  1UTB B;  2RCB A;  1EZ9 A;  4FEC A;  3UA8 A;  2XXI A;  1QW0 A;  4LQ5 A;  3TPA A;  2ABH A;  2PT1 A;  4ZEF A;  3OOA A;  1HSE A;  1ZIU A;  1A7L A;  1FCK A;  2R9J A;  4KFQ A;  3TAJ A;  2ZYN A;  3FVG A;  3KGC A;  3H6T A;  3N5L A;  4WKM A;  3OD7 A;  3QIM A;  2FNC A;  4NED A;  1ANF A;  3VXB A;  3K1M A;  4ELO A;  3ZKK A;  2UVJ A;  2G93 A;  2VD3 A;  4G77 A;  1GGG A;  3FZV A;  3DP4 A;  1LFI A;  1OMP A;  1PB7 A;  3TCH A;  1GVC A;  1JVY A;  1IXH A;  2I58 A;  4BDR A;  1UIV A;  3TEP A;  5A5X B;  3HHG A;  1ZKB A;  2NUV A;  1MDQ A;  2Y7P A;  3TDJ A;  3UIF A;  3TEL A;  3GXA A;  1B0H A;  3FXU A;  2X7P A;  1RYO A;  3IX1 A;  3KEI A;  4L17 A;  1EZP A;  4JWO A;  3SKP A;  1F9B A;  3R7X A;  2XD2 A;  3CFL A;  3G3J A;  4XKN A;  3LBS A;  2D5W A;  5KDT A;  2Y7K A;  3O6G A;  4ZEK A;  1H43 A;  1MQJ A;  3PPN A;  3IJX B;  4ZEC A;  5I56 A;  4IY5 A;  2ZMB A;  2F5X A;  3QK6 A;  5H8F A;  2ONR A;  5L9M A;  3VVD A;  3K4U A;  3S2V A;  4I8C A;  4ZZA A;  1UTH A;  5CMK A;  4KYD A;  4BDM A;  1B9J A;  1TFA A;  1CB6 A;  2OZZ A;  4RJZ A;  4GD5 A;  2VHA A;  2Z22 A;  4FEB A;  4KR5 A;  3JZJ A;  2XXT A;  5J1D A;  1EH3 A;  3M3F A;  3DEL B;  1S9T A;  2DVC A;  2VD2 A;  1LB8 A;  2H25 A;  2DSF A;  5M2V A;  4OES A;  2H4I A;  4NE4 A;  4H65 A;  4QSD A;  1Y4T A;  3TKD A;  4HCW A;  1P1Q A;  1M5C A;  3TTK A;  2V3U A;  2XXY A;  1AIV A;  3IO6 A;  3OEN A;  3EF7 A;  3RTF B;  1IIT A;  1NNT A;  4N07 A;  2XX7 A;  4YZZ A;  3PGF A;  1LBC A;  3OSQ A;  1NNK A;  3SER A;  2B3F A;  5H8N A;  2QPQ A;  2XX8 A;  5CRY A;  3SES A;  3PMW A;  2I6E A;  4ESX A;  3MP6 A;  3CFX A;  1DTZ A;  4DXU A;  1Y3Q A;  1BTJ A;  3SET A;  5I58 A;  1Y1M A;  1TT1 A;  2ZYM A;  2X26 A;  5CBR A;  1MDP 1;  1TFD A;  4N6P A;  2QJE A;  5I59 A;  3H03 A;  3T9X B;  1A8E A;  3U72 A;  3GZG A;  3RQT A;  2I0C A;  3TUS A;  2XXX A;  3Q25 A;  2F6G A;  2I49 A;  3CRB A;  3CFZ A;  4HS7 A;  3MVY A;  4KYE A;  1MH4 A;  1OVT A;  1I6B A;  1MY4 A;  4U23 A;  2DS9 A;  3TCG A;  4R72 A;  4N13 A;  2HCA A;  3KSJ A;  1N04 A;  1B1X A;  2I3V A;  2PYY A;  2YPN A;  5HPQ A;  2AL4 A;  3E9X A;  3F11 A;  4FAT A;  1B7H A;  4U22 A;  3SEX A;  3KBR A;  5TP9 B;  3SEV A;  4ELP A;  1VR5 A;  1MXU A;  1LCF A;  1D3K A;  3TQL A;  4WEP A;  4LZ8 A;  3EHS A;  1LAH E;  1A40 A;  5AA4 A;  1B40 A;  2OK2 A;  4DDD A;  1GTK A;  1USY E;  1DMB A;  1PB9 A;  4IO2 A;  4F31 B;  1YCJ A;  4RY1 A;  1Z7N E;  3ILU B;  2O1M A;  5I57 A;  1XS5 A;  2RC7 A;  4RA1 A;  3USD A;  3PUY E;  4OEU A;  5FHM A;  4DXC A;  3T22 A;  3RPW A;  2E0S A;  3SEW A;  1H44 A;  2Z8E A;  3GLB A;  3H06 B;  3U1O A;  3TOD A;  4DCX A;  1BKA A;  3WAE A;  3Q29 A;  4TLM B;  3MJN A;  1FW0 A;  2FYI A;  2ONS A;  5H8Q B;  3OXN A;  3UK4 A;  1MY0 A;  4PE5 B;  3D4C A;  3FXR A;  4DLD A;  3LSX A;  1LBB A;  4NF6 A;  2O7U A;  5I2K B;  2AYS A;  4LZ5 A;  1SYI A;  2PT2 A;  1QKA A;  3MZ9 A;  2F7C A;  5K2X A;  2E1S A;  3PUV E;  3R26 A;  1B7Z A;  4H5G A;  3VFJ A;  4MBP A;  3RGY A;  1MXX A;  1TWY A;  5F1Q A;  1LLS A;  4XKR A;  1M5E A;  4F19 A;  2FA7 A;  4NTL A;  1MG1 A;  2KLF A;  3PU5 A;  3T66 A;  4ZDM A;  4R9F A;  3TTR A;  3MPL A;  1B5H A;  4F3P A;  2Q2C A;  2Y7R A;  1R6Z A;  2ZNT A;  5DT6 A;  3KOT A;  4NF5 B;  3MVW A;  4QFP A;  5KCJ A;  2D3I A;  2DQV A;  2XXU A;  1B3L A;  3MP8 A;  3CSG A;  4QHQ A;  4ESW A;  4JWY A;  3H3G A;  2UXA A;  2Q89 A;  3C4M A;  2D21 A;  3MW0 A;  3G3H A;  2VOZ A;  2HXW A;  1ATG A;  4C1U A;  2F6P A;  1EZO A;  1OQG A;  4LON B;  2Q8J A;  4E0X A;  2NVU B;  2R71 A;  2O69 A;  3I5O A;  1OQH A;  3N94 A;  5TPA B;  1FQA A;  3K1N A;  4YKP A;  3TQW A;  1Q1K A;  3PUX E;  4C1T A;  3TZA A;  3B6Q A;  1XOC A;  2A5T B;  3Q28 A;  3K02 A;  3BBR A;  2XXQ A;  5H8H A;  4R2B A;  3VXC A;  3QYT A;  4PFU A;  4G68 B;  2P1S A;  1MM6 A;  1JQF A;  1B4H A;  3LR1 A;  4G68 C;  4X1D A;  3HPI A;  4POX A;  3VLU A;  5DEX B;  4EF1 A;  4G8N A;  3KG2 A;  4GXS B;  4KPT A;  4UA8 A;  4K3F A;  3FIR A;  1SW4 A;  4GIZ A;  3H7M A;  3PUZ E;  4G2Z A;  5HBC A;  4LUB A;  2H99 A;  4NF8 A;  4KCC A;  4LP2 B;  3LUY A;  1MXW A;  2I4B A;  1ZTY A;  3FVK A;  2Y7W A;  4G8M A;  4RPN A;  3D4G A;  2RC8 A;  2V3Q A;  4GQO A;  1YAE A;  4AB5 A;  5CMB A;  1T0K A;  3ECR A;  2DXR A;  3T96 B;  4F3B A;  1QKB A;  2WKY A;  1II5 A;  1B3F A;  5DVI A;  1B6H A;  4G8H A;  4F3G A;  1B1H A;  2XD3 A;  4EQB A;  4KQP A;  4H67 A;  3DLN A;  4F29 A;  4IGR A;  4ZEI A;  3PV0 E;  2ZYO A;  4IO5 A;  3DP6 A;  4OWD A;  3TTN A;  1B32 A;  2XXW A;  4FED A;  1AMF A;  4LA9 A;  1B51 A;  3MVZ A;  4PFT A;  1MM7 A;  3OEL A;  4YKJ A;  4P0G A;  1TXF A;  1UTH B;  3RT6 B;  2O68 A;  2XX9 A;  1MQH A;  4FAJ A;  3VVF A;  1B05 A;  1DOT A;  1UQW A;  1O7T A;  4KI0 E;  4F39 A;  1UTB A;  3B6T A;  5CMM A;  5EYF A;  1NH7 A;  3OO8 A;  1O63 A;  1PC3 A;  4Z7E A;  5JEI A;  3L6G A;  1ZLQ A;  1B52 A;  3KOS A;  3TMG A;  4BDL A;  1YPN A;  1PBQ A;  1Y3P A;  3I3V A;  4EQ7 A;  3PD9 A;  3QUF A;  5AA2 B;  2ZYK A;  1URD A;  1AH5 A;  4I1D A;  5FHO A;  3M3L A;  3G3K A;  5A5X A;  5I2N A;  4M4G A;  2XXH A;  3OSR A;  5CMC A;  1NNF A;  2OWT A;  5DVF A;  1B58 A;  1SW5 A;  2ANJ A;  3W9W A;  4ELQ A;  1VFE A;  5ICQ A;  4JXI A;  4MLQ A;  1MPD A;  1SW2 A;  4QF9 A;  4GXA A;  4AQ4 A;  4XXU A;  3CG1 A;  3IB1 A;  1IQ7 A;  2RF1 A;  1P99 A;  4JBZ A;  3GBA A;  3QUJ A;  1ZMG A;  3CSB A;  2GH9 A;  1P1N A;  1XVY A;  1MXV A;  1POY 1;  1JET A;  1S7Y A;  2F97 A;  2AL5 A;  5I84 A;  3O6I A;  1NMU A;  2RC9 A;  1BIY A;  3HV1 A;  4BDO A;  3CR9 A;  3VE1 B;  5FTH A;  3V8X B;  3OMB A;  1BLF A;  4OTE A;  1B3G A;  2OJT A;  3QAX A;  4H5F A;  3ODB A;  3WAF A;  1I6Q A;  3V5A A;  4AB6 A;  3B6W A;  3C35 A;  3QSL A;  4QRZ A;  1FQB A;  5JTY B;  1MY1 A;  2ZXT A;  3MZB A;  3KJT A;  3O66 A;  1S50 A;  1I69 A;  5K2Y A;  2LAO A;  4NMY A;  3UOR A;  4UAC A;  4JWX A;  1R9Q A;  3FAT A;  2I4C A;  1SD3 A;  4OQO A;  5AA1 A;  1JEV A;  1N7X A;  3H6U A;  3E13 X;  5IKB A;  2YJP A;  3O9P A;  4YU0 A;  1FQF A;  1AL3 A;  2NOO A;  1B7U A;  4IO3 A;  3ONM A;  3TCF A;  4LQ2 A;  3EHU A;  3PMX A;  5I57 B;  1I6A A;  2H5Y A;  3RN8 A;  3K00 A;  2ZNU A;  3RUM A;  4Z0I A;  1RYX A;  1MY2 A;  2AIX A;  1XHY A;  1PBP A;  4U1Z A;  4GL0 A;  4EF2 A;  4X1B A;  3T93 B;  1VSO A;  4IO7 A;  1LFH A;  3IB0 A;  1KWH A;  1JW5 A;  1PB8 A;  4RNS A;  3HO7 A;  2DWI A;  2CMO A;  2QS2 A;  2DXY A;  1FQE A;  2A5S A;  5DTB A;  3S9N C;  1OVB A;  3K6W A;  1Q35 A;  2OCU A;  1Y3N A;  3FJM A;  3O6H A;  1B5J A;  2PMS A;  3JYR A;  5AE4 A;  1DPE A;  1SVX B;  3FV2 A;  2F8D A;  3VV5 A;  4ZE9 A;  2RCA A;  3LSW A;  2IEE A;  4JB7 A;  3C31 A;  4F3S A;  1LB9 A;  4XKQ A;  2PVU A;  1LST A;  4OYV A;  3N6T A;  1A55 A;  4YMA A;  4GL8 A;  4MLV A;  5TP9 A;  1AOV A;  4R9G A;  5KCJ B;  1NH8 A;  2YLN A;  1ZJL A;  3DM0 A;  4LZ7 A;  1B0L A;  4NF4 B;  3G3F A;  1VE4 A;  1B2H A;  2ZNS A;  4KD5 A;  1N0T A;  1LAG E;  4TQU Q;  1P1W A;  1MPC A;  1PEB A;  4H6D A;  2O51 A;  5DVJ A;  5AA3 A;  3G7W A;  1NNP A;  4DIG A;  4NWC A;  1VFD A;  1UIU A;  3K6V A;  1M5D A;  1SI0 A;  4PFW A;  2UYE A;  4X48 A;  3A3C A;  2HFB A;  4RK2 A;  2F36 A;  4ONY A;  3B7D A;  5F7V A;  4X9T A;  3O28 A;  4FE8 A;  5B70 A;  3MPK A;  4WXJ A;  1URS A;  1POT A;  4POW A;  2NWJ A;  3O2A A;  2V25 A;  1IXG A;  5I2K A;  5CI5 A;  5KZT A;  4ZE8 A;  2F7A A;  1LAF E;  2Q2A A;  5BUU A;  4DE8 A;  2Z23 A;  4P0I A;  4O3C A;  1IXI A;  1MS7 A;  2XHD A;  4GRK A;  5L8D A;  3IOR A;  3VVE A;  1DSN A;  4ZZE A;  3U8Q A;  1XC1 A;  2DVZ A;  2RIN A;  4P11 A;  1FTO A;  1D4N A;  3I6V A;  3N6U A;  5FTI A;  3C9H A;  4PQJ A;  1SW1 A;  4ND9 A;  1A54 A;  2QS3 A;  4GOT A;  2HEU A;  3M8U A;  3Q27 A;  2ESN A;  3V83 A;  5DYH A;  1FTJ A;  1JVX A;  4YKK A;  4NF5 A;  2Y7I A;  4DZ1 A;  2BJJ X;  1USY H;  2QL3 A;  4OER A;  1JNF A;  1WDN A;  2PX1 A;  2I48 A;  1WVJ A;  3PPO A;  2HZL A;  4RYA A;  2V93 A;  3PPQ A;  1MQD A;  2DP8 A;  4OFO A;  4ZED A;  4HCY A;  2R6G E;  4IY6 A;  4YB7 A;  3IAZ A;  1SDX A;  1MQI A;  4R6H A;  4F22 A;  3JV9 A;  3FVO A;  2HAV A;  1B3H A;  2REG A;  2QS1 A;  1SQY A;  3PD8 A;  1XVX A;  5TPA A;  3O29 A;  1QVS A;  3KN8 A;  1MRP A;  3BFT A;  3W9V A;  2A5T A;  3QXM A;  1A8F A;  3E4R A;  4Q0C A;  3MUQ A;  4M1V A;  2DWH A;  2DWJ A;  4HTG A;  3LSF B;  3SEY A;  3RY3 A;  1HSJ A;  3V89 B;  2W7Y A;  3S9M C;  2Q9T A;  3R6U A;  4ZEB A;  4H1X A;  4F18 A;  4OVJ A;  4OZ9 A;  4JSD A;  5KDT B;  3IB2 A;  3ZSF A;  4OFL A;  3H6V A;  4R6Y A;  2HZK A;  5I56 B;  4GFR A;  1BP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...