4R6HA

Crystal structure of putative binding protein msme from bacillus subtilis subsp. subtilis str. 168, target efi-510764, an open conformation
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
394
structure length
394
Chain Sequence
ADTAKKTLTIYSTMSTDSERDTFRKLAAAFEKEHSDIHVSLHFPGNDYENMMRVRMAANDLPDLFDTHGWGKIRYGEYTADLRDMKWTQDLDPNLNSILKNKSGKVYAYPINQAKDGLAYNRNILDRYGIAPPETMDDFIKALRTIKEKSKGSIVPFWFAGYDKSSFAQYYDQFATPLLITDPAHNEKKQLINGTFQWSKFTYLSEILKQMQKEKLINIDAVTAKKSQLIELMAQNKIAFTMQGGTLGQDVAQINPNVKVGIIPTPAIHPGDDPIWIGGERYTLAAWKDSPQLKEAKDFIAFMARPANAKQMAEATSLPSGLTNVKADIFYANDYEYYQDVKVEPYFDRLYLPNGMWDVLGTVGQELAADILAPQDISQKLGREYKRLREQSET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Transporter Msme from Bacillus Subtilis, Target Efi-510764
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Transport protein
molecule keywords Solute binding protein MsmE
total genus 147
structure length 394
sequence length 394
ec nomenclature
pdb deposition date 2014-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r6hA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r6hA02
4I62A 4YMAA 4R75A 1B3FA 2F7CA 4H0WA 4NF4A 2RC8A 3RTWB 3IB2A 2ALUA 1DOTA 2H9BA 2XXHA 3K6UA 4OVJA 1N0TA 3E4RA 2F97A 4F18A 1OMPA 2YLNA 4G8MA 2W7YA 3G3GA 3LSLA 2OWTA 5BWJA 1DMBA 2F7BA 5L9MA 3OELA 4JWXA 5AA2A 3VLWA 1NH8A 3IOUA 2DSFA 1OVBA 2B3BA 3CSGA 4G77A 4IB2A 4U2RA 2Y7PA 4MF3A 4F3GA 4U22A 2ONKE 1QVSA 5HPQA 2IA4A 2F7AA 4C1TA 4LZ7A 5IKBA 4TLLB 4C0RA 1H44A 1B4HA 4OTEA 2HQ0A 5AA3A 4DXCA 3EF7A 2QRYA 4G68C 1PBQA 2GH9A 1M5CA 3CI8A 4Q8RA 5HBCA 5I58A 2AIXA 4ZZAA 1FW0A 3TDJA 2O1MA 1YPNA 2RC7A 3C34A 3ODBA 1H43A 5FHNA 5FTHA 4F29A 2QS4A 4ISUA 3SDFA 2B3FA 3H4ZA 4RY1A 4QSEA 4F2OA 3KBRA 1S9TA 2CZLA 4N07A 3H3GA 3N94A 4FIMA 1RKMA 2VD2A 4KCCA 3PUVE 4OXVA 2O68A 1GV8A 2ZYMA 2DOJA 1ZLQA 3K01A 2I4CA 3A09A 5ITOA 4IO4A 5H8SA 1TWYA 4ZS9A 1PC3A 1IEJA 1S7YA 3LSWA 1I6QA 3LUYA 1AL3A 3LBSA 4GWOA 3UORA 4I9DA 1VE4A 2XX9A 4IO7A 2R6GE 4YKKA 3CVGA 1ZKBA 3T9XB 3TPAA 1B7HA 4AB5A 4OETA 1B58A 3K02A 1P1WA 5JTYA 4GL0A 3O9PA 1RYXA 2DXRA 2QS1A 1JW1A 4U23A 4LQ2A 2ABHA 2DXYA 3DP8A 2UVHA 3EPEA 2R9JA 3IX1A 4R6HA 2ANJA 3G3FA 3B6WA 1US4A 3KFMA 3BFTA 3IJOB 3OO9A 4OZ9A 4XKRA 3K1MA 2P0SA 3FXUA 3U1OA 1MXWA 1MH4A 1FQEA 4JDFA 1BLFA 2D3IA 4ZEBA 2D21A 2UXAA 3I5OA 2UYEA 4G2ZA 2V84A 3T96B 4F1YA 5H8HB 3KN3A 2GHBA 4DZ1A 2VP1A 4H6DA 3PD8A 4R74A 2X7PA 2HAUA 4PETA 2V3UA 4WXJA 4FJPA 3EHUA 4JXIA 3K6XA 1B3GA 3IJXB 1MM6A 1YAEA 2HZLA 4O3CA 3IAZA 1US5A 5I84A 2AYSA 3R26A 3VFJA 3U94A 2NWJA 2DE2A 3TFLA 1LAGE 3MVYA 2ZNSA 3TCFA 4R9FA 1NNKA 3G3JA 4OENA 2A5TA 1MH3A 4ECFA 5ITPA 3QXMA 1B6HA 1OQGA 3O6GA 4H67A 3DP6A 4RXLA 4YKIA 3MP6A 1SD3A 5DVIA 2XX7A 4POXA 2ZXTA 2RC9A 2QJEA 1VR5A 4YU0A 1GVCA 3OSRA 3KN7A 3FATA 5A5XA 4GXAA 2DWIA 1SW5A 3MP1A 4NF6A 3UGWA 5CBRA 2GHAA 4XKQA 5TU0A 5ISUA 4EQ7A 1ZBMA 5DEXA 3O6IA 2NVUB 3TEPA 1MS7A 1LB9A 2Z22A 2FA7A 1Q1KA 3GBAA 3I6VA 4N6PA 3SEUA 3SEWA 1MPCA 2DWAA 3BFUA 2DE4A 2NOOA 1FTKA 1OLCA 4H8IA 4OESA 4PFWA 4F19A 1B3HA 4RJZA 4FORA 5JTYB 5I57A 4QFLA 1VFDA 5H8QA 2WKYA 1QJMA 4AQ4A 3H7MA 3S4UA 1LAXA 1SDXA 3Q27A 4BDQA 1JW5A 1XVYA 3IL1B 3TTLA 5ICTA 3S9EA 5L9OA 1XT8A 1NL5A 4YB7A 5F1QA 5KZTA 1MY2A 2F35A 1R9QA 1I69A 4ND9A 3PV0E 2THIA 2PBWA 3PU5A 5H8NB 1GTKA 3KJ7A 3V89B 4DE8A 1UIVA 3A3CA 2UYFA 3G7WA 3K00A 3PD9A 4FEBA 3JZJA 4DXUA 3N5LA 4ESWA 4YKPA 1N84A 1B1XA 3G3HA 4NF6B 3UP9A 1LCTA 1MQGA 2O6AA 1EZPA 2QSXA 3KJTA 2XXVA 3ONMA 3M3FA 2Q2AA 1HSJA 1JNFA 3HO7A 1B05A 4KQPA 1SW1A 1QUJA 5H8FA 3PUXE 1NNFA 3C4MA 3E13X 4ZZEA 4Q0CA 1UIUA 1ZIUA 3PGFA 2YPNA 4YICA 1AH5A 3OXNA 2I6EA 2PT2A 4PFTA 2I0CA 1TFDA 2VD3A 4F3BA 2ZYKA 1MXVA 2G93A 3PUWE 3O97A 4FEDA 3DM0A 3C9HA 1LFHA 4FAJA 3P7IA 4XTCQ 3RN8A 3FUZA 5HM4B 3ECRA 3O28A 1IZ1A 4GL8A 4H1XA 4PFUA 3Q26A 3RGYA 4H65A 1WODA 3EQ1A 3VV5A 1DTGA 5K2XA 1BP5A 4E0WA 5DVJA 4U1ZA 1XVXA 3MPKA 3MC2A 4JSOA 3C31A 3LSFB 4PP0A 5B70A 4ZEFA 1OLAA 1P1OA 2E1SA 2UVJA 1SI0A 2VHAA 3HV1A 3IR1A 3TUSA 1Y3QA 5TPAA 1B1HA 3FZVA 4EUOA 1LBCA 1P1NA 4ELOA 3N26A 3F11A 4XKNA 4IO3A 4MFIA 4WEPA 3IORA 3THIA 2Z8FA 2DVCA 3OO6A 1UTBB 3M3KA 4R9GA 4BDOA 1LBBA 1B3LA 3O6HA 1IITA 1Q35A 3Q28A 3PPRA 5KCJB 1MPDA 4UACA 4QSCA 1A54A 2XD2A 5FHMA 2ONSA 4ZEKA 3RTFB 1FQAA 4O3AA 2P2AA 4O3BA 3S9MC 4E0XA 1CE2A 2Q8JA 1FTLA 1LGBC 2V93A 2X7QA 2XXUA 4G68A 4GIZA 4UA8A 3T22A 5H8HA 2F8DA 3FVNA 4DCYA 2O69A 1B9JA 2NUVA 3C33A 1FTMA 2QL3A 2UVGA 4IY6A 4BDMA 4GLIA 3CG3A 1DSNA 1OQHA 1MG1A 2XXRA 4ESXA 4QFPA 1DPPA 2G29A 2I3VA 3TTRA 4Q5TA 4BDLA 1YTVA 2Q9TA 4YB6A 1B51A 3PMXA 4XKPA 2RF1A 4LA9A 4JBZA 1A40A 3H6WA 3Q25A 4KYSA 3S2VA 2OBGA 2HFBA 4NEDA 3K4UA 3PMWA 4OFLA 4HCWA 4L17A 5DVFA 4DXBA 2OWSA 3FD3A 1LCFA 4OFOA 3M8UA 3FXRA 4YKJA 2DP8A 2DS9A 4OWDA 4MH5A 4R6KA 1QKAA 2P1SA 2V25A 2HXWA 1IXGA 5AA2D 1MQIA 4JWYA 1B7UA 1USYH 2ZYOA 3HHFA 3M3LA 2PYYA 3OSQA 5I2NB 5JEIA 3H03A 1N7XA 3B7DA 3FIRA 1SYIA 3TKDA 4BLAA 1SQYA 3ZKLA 2PMSA 2I0BA 3MVXA 4YZZA 1J1NA 1PB9A 4EDPA 4F1VA 3KSXA 5TPAB 2HEUA 4IGTA 5I59A 1KWHA 2OZZA 1POY1 3CG1A 4GVOA 4KYEA 4MLVA 1R6ZA 1MRPA 1MDP1 3DLNA 3U8QA 4GXSB 2OCUA 2O51A 1ATGA 4LUBA 4RNSA 3V5AA 4F3SA 1AOVA 3IOWA 3IK6B 5KCJA 4QRZA 4GOTA 4WEDA 3VE1B 3K1NA 4N13A 1EZOA 3N6UA 3A3UA 3LC8A 2H98A 3HCQA 4LP2B 4EF1A 1FQFA 2ZNTA 3LSXA 1IQ7A 3E9XA 1B4ZA 2NXOA 3VLVA 4NF4B 3R7XA 4NF8B 4JSDA 2BJJX 3CSBA 4TOZA 4NWCA 4TLMB 3N6TA 4P11A 1SI1A 1PB8A 2DWJA 1EH3A 3WAEA 2AL5A 1S50A 1H45A 3MPLA 4H5GA 1FQDA 3VLUA 3OMBA 4NE4A 1LSTA 2UVIA 1M5EA 1GR2A 1MY4A 1QULA 4I8CA 4KYDA 4FATA 4HW8A 5B7DA 5L9SA 4R72A 4THIA 3RUMA 3CRBA 2QMXA 3K2DA 4LQ5A 4KI0E 3D4CA 1DPEA 3SEVA 3S9NC 1MQDA 1LAFE 4ELRA 4IO6A 3HHGA 5I56B 3GBBA 3QUFA 3OO8A 4XIGQ 1IXCA 1A8FA 2IEEA 3GLBA 3OEKA 4XXUA 3TTKA 3VDFA 2ZMBA 4F3PA 3VXCA 5ICQA 3MAMA 4PE5B 3SEYA 1LFGA 3BBRA 3SERA 4KPTA 2Y7IA 3PPQA 3VXBA 1AIVA 2H25A 3PPPA 4BDRA 1NNTA 3VVEA 3QYTA 1IXIA 2RCBA 1JQFA 2ONRA 1FCKA 3CIJA 3BKIB 3GXAA 4JWOA 4AB6A 3RQTA 2F34A 1TXFA 5I2NA 2KLFA 3PMVA 3TQLA 1Z7ME 4RA1A 4LONB 4M1VA 3C32A 5K2YA 1SW4A 2HZKA 1A8EA 2DQVA 2I3WA 3TCHA 1A7LA 5DYHA 4ZECA 2I4BA 3AXFA 3CFLA 1ELJA 1UQWA 3L6GA 5AA4A 5CM6A 1IIWA 4HCYA 4NF5A 3TZAA 1JVXA 4ZDMA 3MZBA 3TYHA 1EZ9A 1I6AA 1IXHA 1OIBA 2DWHA 4KR5A 1Y3PA 1B40A 5L8DA 3TELA 3W9VA 3MVWA 2XHDA 3V83A 4EF2A 1JEUA 2D5WA 3FVGA 3K0VA 4G68B 1BKAA 4FE8A 3TAJA 3EHSA 1R1NA 3FVKA 3FJ7A 1EU8A 3HSTA 3IO6A 1O64A 3DELB 1QW0A 1TFAA 4ELQA 3TCGA 4DDDA 1ZJLA 1JEVA 3K1PA 1NFTA 1LB8A 1B3EA 4QF9A 2Y7KA 1B0LA 1JETA 1MXUA 2ESNA 4OQOA 3DP4A 2F78A 2XXWA 1QUKA 2RKMA 4RYAA 2F6PA 3KN8A 1UTBA 4G8HA 3TTNA 2Y7WA 3HN0A 1PDAA 1FTJA 1URSA 1D4NA 4JB7A 3PPOA 1USYE 2XXQA 4U4XA 2XXIA 4R2FA 4X48A 4WKMA 5JK4A 1M5DA 1D3KA 3OENA 3MQ9A 3B6TA 4GRKA 4QFKA 1MXXA 1FQBA 2HCAA 2Q2CA 3GZGA 2F36A 2H99A 1MQHA 3OO7A 3QIMA 4X9TA 4YB5A 2GFEA 2A5TB 3FASA 1UTHB 1B0HA 1O7TA 1XOCA 3QK6A 4MLQA 3OOAA 5DTBA 3RLFE 5TP9B 1B46A 1FTOA 1NNPA 4RPNA 1MQJA 3CFXA 3K6VA 3ILUB 4EXKA 1NKXA 4G4PA 2YJPA 1Y3NA 4QHQA 5AA2B 2O7UA 4GQOA 1MY0A 1B52A 1B5IA 3KSJA 3FJGA 4ELPA 4ZEDA 3OEMA 5CBSA 3UA8A 1O63A 2ZYNA 5J1DA 3MZ1A 4C1UA 2O1LA 1TT1A 3MP8A 2FNCA 4KCDA 1N04A 1QUIA 3FV1A 1Y1ZA 4FECA 3RNNA 1URDA 1MXZA 4LVQA 4PFYA 3MZ9A 5I57B 4KD5A 1MPBA 1R9LA 2FYIA 5H8NA 3ILTB 3FXQA 1URGA 2RINA 3MBPA 3JV9A 3T93B 1ZMGA 3HPIA 4YMBA 1HSEA 1XC1A 3D4GA 5CMMA 4GF8A 3H6TA 5TP9A 2GRVA 4K3FA 3C36A 3UK4A 1XHYA 3C35A 4NF8A 3T9UA 1MM7A 2OLBA 3T66A 4OMBA 3EN3A 3O66A 4M4GA 4QFOA 2QMWA 2OK2A 2I49A 4H5FA 3UN6A 1B5HA 1RYOA 1VFEA 3L6HA 3QAXA 4OERA 3W15C 2R71A 3MWBA 4QSDA 1POTA 4EQ9A 1MY3A 5F7VA 5H8FB 4F22A 1P1QA 1Y4CA 4HS7A 4OFJA 3SETA 1A99A 3E3KA 1LAHE 2B65A 1BTJA 3IB1A 3IO4A 1M5FA 3MUQA 4IY5A 5EHSA 5I59B 5I56A 1M5BA 3O29A 3T9VA 3USDA 1D9VA 2M8CA 3VVDA 2QPQA 1BIYA 1PEBA 5AE4A 1T0KA 4U21A 1NMUA 2X26A 5CRYA 3FV2A 1UTHA 2REJA 3KEIA 1GGGA 3S9LC 2O7IA 2A5SA 3QSLA 3VVFA 5I58B 3G3IA 4EQBA 4IO2A 3FJMA 1WVJA 3JYRA 3KG2A 3MVZA 4TQUQ 3U92A 2O84X 3B6QA 4GD5A 2Z8EA 3KZGA 2V3QA 2I58A 3ZSFA 1F9BA 1OVTA 1Y20A 1QKBA 1Y4TA 3MJNA 2PVUA 2XXPA 4KHZE 4Q30B 5EHMA 4Z0IA 3V8XB 4ZEIA 1VSOA 3QUJA 4LZ8A 3TQWA 4OEVA 3W9WA 1ZU0A 3WAFA 4Z7EA 1ZTYA 1N7WA 2Q88A 4NMYA 3PPNA 1H3DA 4R6YA 2LAOA 3RY3A 2RCAA 3PUYE 3IOVA 3Q29A 3H6UA 3ZKKA 2CMOA 4IO5A 5BUUA 3FGSA 4LZ5A 4U4SA 3RPWA 5LOMA 2XX8A 3H06B 3O2AA 4YAHX 2Y84A 3IB0A 1N3XA 1NH7A 3UIFA 3LR1A 3PUZE 4EXLA 4GFRA 1P99A 1P1UA 3TMGA 1PB7A 2F6GA 3I3VA 4MBPA 5I2KA 4BDNA 3EHTA 2OJTA 4P0IA 3SEXA 1MY1A 2H4IA 4RK9A 1N76A 2F5XA 4F2QA 1SW2A 4I1DA 2ZNUA 2PX1A 1D9YA 1Z7NE 1B7ZA 1Y1MA 4U1OA 1SBPA 4H8JA 1AMFA 2VOZA 4POWA 5FTIA 3K6WA 4X1DA 5CI5A 5A5XB 2Z23A 5DT6A 1L5TA 3TTMA 3KGCA 5CMKA 5IAIA 2VGQA 3U72A 4RK2A 1XS5A 4P0GA 1JVYA 1N3WA 2AL4A 4IGRA 5AA4B 2Z8DA 1YCJA 4NF5B 4ZE9A 1CB6A 2XXYA 2Y7RA 4ONYA 1II5A 2V3TA 3KOTA 4F1UA 1I6BA 5H8QB 2H5YA 5FHOA 1H76A 4X1BA 3SESA 3H6VA 5I2KB 1IUDA 4R2BA 5AA1A 1LFIA 1SYHA 4F31B 5ELVA 1B5JA 4QFNA 1Y9UA 5EYFA 1SVXB 2XXTA 4OEUA 3T9HB 2Q89A 2HAVA 4RPOA 3G3KA 5CMBA 4DIGA 4OHNA 3TODA 1DTZA 2E0SA 5M2VA 3RT6B 4LATA 2I48A 2PT1A 1A55A 3CFZA 4DCXA 2QS3A 3IOTA 1FQCA 3FVOA 4HTGA 4OYVA 4ZE8A 3U93A 5DEXB 1PBPA 3OD7A 4KFQA 5KDTB 2QS2A 4NTLA 2DE3A 2REGA 3KOSA 5KDTA 2DVZA 1LLSA 3ZS6A 1MDQA 1MXYA 3CR9A 4NWDA 1WDNA 1B32A 1B2HA 4PQJA 1HSLA 4F39A 5CC2A 3MW0A 3SKPA 1JW4A 2XXXA 3R6UA 4R73A 2DYXA 1ANFA 2XD3A 3RT8A 5CMCA 4DLDA 4G8NA
chains in the Genus database with same CATH superfamily
4YMAA 4H0WA 4NF4A 2RC8A 3IB2A 2ALUA 1NUYA 4F18A 1OMPA 2YLNA 2QVVA 3G3GA 2OWTA 5AA2A 3OELA 5A5LA 1FJ9A 4U22A 4LZ7A 4C0RA 2HQ0A 4DXCA 4N15A 2GH9A 1M5CA 4Q8RA 5I58A 1IMBA 1FW0A 5EQ7A 3TDJA 4F29A 1H43A 2QS4A 3KBRA 1S9TA 1FPKA 4FIMA 1LBVA 2ZYMA 1ZLQA 4IO4A 5H8SA 1IEJA 3LSWA 4I9DA 1VE4A 2XX9A 4YKKA 3T9XB 1B7HA 1P1WA 1JW1A 2UVHA 1KA1A 1NV2A 3G3FA 3B6WA 3KFMA 4OZ9A 4XKRA 3K1MA 2P0SA 4ZEBA 3I5OA 2KQZA 2V84A 3T96B 3PD8A 4R74A 3EHUA 3K6XA 5I84A 3U94A 2DE2A 4PFBA 1FPEA 3G3JA 4OENA 2A5TA 4ECFA 3DP6A 2XX7A 4POXA 2ZXTA 5A5XA 3KN7A 3FATA 4GXAA 3MP1A 1SW5A 2GHAA 4XKQA 4EQ7A 1ZBMA 2NVUB 1LB9A 2FIEA 4PFWA 4OESA 1B3HA 5JTYB 5H8QA 4AQ4A 1LAXA 4MCOA 4BDQA 1XVYA 3IL1B 3S9EA 1XT8A 5F1QA 1R9QA 3PV0E 1GTKA 2UYFA 4ESWA 1LCTA 2WBBA 3RPLA 3KC1A 1JNFA 1SW1A 3E13X 1ZIUA 5EQ8A 3OXNA 2PT2A 3O97A 1LFHA 4XTCQ 3RN8A 4PFUA 3Q26A 3RGYA 4O94A 4E0WA 4JSOA 3MC2A 2FHYA 3TUSA 5TPAA 3T0JA 1NV0A 1B1HA 4EUOA 1LBCA 1P1NA 4OVRA 3F11A 4XKNA 4WEPA 3THIA 2Z8FA 3OO6A 3M3KA 2WX9A 1Q35A 4ZEKA 4QSCA 1A54A 1FQAA 4O3BA 2V93A 2X7QA 2XXUA 4HXVA 1EYKA 4P47A 2NUVA 1DPPA 2G29A 4Q5TA 3GYYA 2RF1A 4N6KA 4LA9A 3H6WA 2OBGA 4NEDA 3K4UA 3PMWA 4YKJA 3FD3A 2DP8A 4NHBA 4OWDA 2P1SA 2V25A 2PFYA 4PDHA 3M3LA 3OSQA 3H03A 4PCDA 4BLAA 2PMSA 4F1VA 5TPAB 3CG1A 1BK4A 1FTAA 3DLNA 4GXSB 2OCUA 5KCJA 3N6UA 3LC8A 2H98A 4PF8A 2QFLA 2ZNTA 3LSXA 4GBVA 2NXOA 4GWXA 3VLVA 4NF4B 3R7XA 1IMEA 1PB8A 3MPLA 4NE4A 1LSTA 2UVIA 4I8CA 1MY4A 5ESYA 4R72A 3CRBA 2QMXA 3SEVA 3GBBA 4XXUA 3OEKA 1AIVA 2H25A 3PPPA 4BDRA 3VVEA 3CIJA 3BKIB 4OANA 4MAGA 3TCHA 3AXFA 4P3LA 1ELJA 5AA4A 5CM6A 1JVXA 4ZDMA 1EZ9A 1I6AA 1OIBA 5L8DA 3TELA 2Y5LA 3W9VA 1EU8A 3DELB 1TFAA 1JEVA 1YZ0A 3K1PA 1NFTA 1LB8A 4QF9A 5LTCA 2RKMA 4NF0A 3TTNA 1FTJA 1URSA 3UP9A 1M5DA 3B6TA 5IZZA 3D1RA 1MXXA 2Q2CA 2F36A 1NV7A 2H99A 2GFEA 2A5TB 3ROJA 1O7TA 1XOCA 3RLFE 3OOAA 2XWKA 1MQJA 3CFXA 4GX6A 4GQOA 1B5IA 5CBSA 4KCDA 1QUIA 4GX4A 4FECA 3RNNA 1URDA 4KD5A 1MPBA 2FYIA 3ILTB 3FXQA 2RINA 3D4GA 5TP9A 2GRVA 4N8YA 2QMWA 2OK2A 2I49A 4H5FA 3B50A 1B5HA 3RPLB 3L6HA 4OERA 5F7VA 1Y4CA 4HS7A 3SETA 1A99A 3E3KA 1LAHE 2B65A 3MUQA 5EHSA 5I59B 1M5BA 1D9VA 2QPQA 1BIYA 1PEBA 4O7MA 1NUXA 5CRYA 3FV2A 4MNPA 4HE1A 2O7IA 3G3IA 4IO2A 1WVJA 2Z8EA 1Y20A 3MJNA 1QKBA 5EHMA 1G0HA 4ZEIA 4NG7A 1ZTYA 1N7WA 2Q88A 2OWZA 2RCAA 5ET7A 3H6UA 4IO5A 5BUUA 2XWIA 3FGSA 4XEQA 5LOMA 1IMCA 2XX8A 2Y84A 3IB0A 1NUWA 1P99A 3TMGA 1PB7A 4MBPA 3SEXA 2H4IA 4H8JA 1AMFA 4POWA 4X1DA 2Z23A 1L5TA 3TTMA 1XS5A 1JVYA 4NF5B 4ZE9A 3BIHA 4F1UA 3RYDA 5FHOA 1FPFA 3SESA 3H6VA 2GQ1A 4QFNA 1Y9UA 2Q89A 5CMBA 4OHNA 3TODA 1DTZA 3RT6B 2I48A 2PT1A 3CFZA 4ZE8A 3U93A 3OD7A 4GWYA 3KOSA 5KDTA 2DVZA 1LLSA 4PQJA 4XFEA 1KA0A 2DYXA 4I62A 4R75A 4PGNA 3RTWB 2XXHA 4JVCA 2R8TA 4OVJA 2QVUA 1LBXA 3E4RA 2F97A 3U65A 5I5PA 4JWXA 2B4MA 3IOUA 1RDXA 5HPQA 2FVZA 2F7AA 4TLLB 1B4HA 5AA3A 4G68C 3CI8A 5HBCA 4ZZAA 4GWSA 3ODBA 5FHNA 3C34A 3H4ZA 4RY1A 1AWBA 4P9KA 4N07A 3H3GA 1RKMA 2VD2A 4KCCA 3PUVE 4OXVA 2O68A 4MHFA 1GV8A 2DOJA 2I4CA 3ISPA 1PC3A 3LUYA 1S7YA 1I6QA 4GWOA 3TPAA 3CVGA 1ZKBA 4AB5A 5JTYA 2CZHA 1RYXA 2QS1A 4N17A 2ABHA 3DP8A 3EPEA 4R6HA 1US4A 3OO9A 4JDFA 1FQEA 5ET6A 2UXAA 4G2ZA 5H8HB 3KN3A 2X7PA 4WXJA 4FJPA 4JXIA 3IJXB 1MM6A 1YAEA 2HZLA 2AYSA 3VFJA 2NWJA 3TFLA 2ZNSA 5F24A 3QXMA 1SD3A 5DVIA 2QJEA 1VR5A 1GVCA 3S9LC 4NF6A 1SPIA 5TU0A 3O6IA 4N6PA 4PFIA 3SEUA 1MPCA 1OLCA 4H8IA 5I57A 2WKYA 3H7MA 4PDDA 1JW5A 5L9OA 5KZTA 2F35A 3PU5A 3V89B 4DE8A 1UIVA 3G7WA 3PD9A 1FJ6A 4FEBA 3JZJA 4JVIA 4YKPA 1EZPA 2QSXA 2XXVA 3M3FA 3PTYA 2WBDA 5H8FA 5I3SA 3PGFA 4YICA 4OVQA 2I0CA 1MXVA 2G93A 3PUWE 1EYIA 4FEDA 3C9HA 3P7IA 5HM4B 3FUZA 4H65A 1DTGA 5K2XA 4N81A 1LBZA 4U1ZA 4ZEFA 1P1OA 2VHAA 3HV1A 1CNQA 3FZVA 4ELOA 1D9QA 2B4LA 1IITA 1EYJA 3KC0A 4H45A 5KCJB 1MPDA 5FHMA 1RDYA 3RTFB 4O3AA 2P2AA 1CE2A 3T22A 5H8HA 2F8DA 4DXUA 4DCYA 1B9JA 4BDMA 2QL3A 3CG3A 1DSNA 4QFPA 2I3VA 4JBZA 1A40A 4L17A 5DVFA 4OFOA 1LCFA 3FXRA 4MH5A 1RDZA 1MQIA 4IR8A 5JEIA 1N7XA 3B7DA 3FIRA 2VPOA 3ZKLA 4MNCA 4YZZA 3KSXA 4IGTA 2OZZA 1R6ZA 5KDTB 2XWVA 4LUBA 1ATGA 4RNSA 3IOWA 4QRZA 4GOTA 3VE1B 4N13A 1EZOA 3HCQA 1FRPA 2BJJX 4TLMB 3N6TA 4P11A 1SI1A 1EH3A 3WAEA 4H5GA 1FQDA 1M5EA 1GR2A 4HW8A 4KI0E 1DPEA 1MQDA 1YYZA 5I56B 4XIGQ 1A8FA 2ZMBA 4AS5A 3VXCA 3MAMA 4QXDA 4PE5B 2F3BA 3SEYA 1LFGA 3BBRA 2ONRA 1FCKA 2F34A 4LONB 3C32A 2DQVA 5DYHA 4ZECA 4DI3D 3CFLA 1IIWA 4HCYA 3TYHA 1IMDA 3MVWA 1JEUA 2D5WA 1BKAA 4FE8A 3EHSA 1R1NA 3IO6A 4DDDA 4PGPA 4OQOA 1MXUA 2F78A 1QUKA 5FBPA 2F6PA 1NV4A 1LBYA 2Y7WA 1PDAA 4PC9A 5IM2A 1D4NA 4U4XA 2XXIA 1D3KA 2HCAA 4X9TA 5IZ1A 3OO7A 4YB5A 1B0HA 1KZ8A 4MLQA 1NNPA 4RPNA 1G0IA 5AA2B 4QHQA 1Y3NA 2O7UA 1O63A 5J1DA 3MZ1A 3MP8A 2P3VA 1N04A 4LVQA 5I57B 3MZ9A 2VPNA 1URGA 1FBEA 4I40A 1HSEA 1XC1A 4GF8A 3UK4A 1NV6A 2ZZXA 4QFOA 1FBFA 1FPJA 1VFEA 3QAXA 4P1EA 4EQ9A 5H8FB 5IGAA 4OFJA 3IO4A 3IB1A 5I56A 1JP4A 5AE4A 1NMUA 1UTHA 2REJA 5IZ3A 1NV3A 3QSLA 2A5SA 3VVFA 4EQBA 3KG2A 3U92A 2CEYA 4TQUQ 2O84X 3B6QA 3BIGA 4GD5A 3KZGA 1FPLA 2V3QA 4KHZE 4Q30B 2OX3A 1VSOA 4OEVA 1ZU0A 4Z7EA 1H3DA 2LAOA 1Q9DA 3PUYE 3IOVA 2CMOA 3RPWA 4YAHX 1NH7A 4EXLA 3PUZE 4GFRA 1P1UA 5I2KA 2OJTA 4P0IA 1MY1A 1NUZA 4F2QA 1SW2A 4I1DA 1Y1MA 1SBPA 5EQAA 2VOZA 5DT6A 5CMKA 4PE3A 3U72A 4RK2A 4IGRA 5AA4B 2Z8DA 1YCJA 5J16A 1H76A 4F31B 4UABA 5ELVA 2PCRA 4OEUA 2HAVA 4DIGA 3G3KA 4NAPA 4LATA 3FVOA 4OYVA 5DEXB 1PBPA 2QS2A 2REGA 3ZS6A 1MDQA 4NWDA 1B32A 4R73A 4G8NA 1B3FA 2F7CA 4NN3A 1FPIA 3IFAA 2H9BA 1DOTA 1N0TA 4G8MA 2W7YA 4I3EA 3LSLA 1DMBA 5L9MA 3VLWA 2DSFA 3CSGA 2B3BA 4U2RA 2Y7PA 4MF3A 3E79A 4F3GA 1QVSA 2IA4A 4O8MA 4C1TA 1FPDA 1H44A 3EF7A 2QRYA 1PBQA 2AIXA 2O1MA 5FTHA 4GWWA 2B3FA 4QSEA 2CZLA 1DK4A 3A09A 5ITOA 4ZS9A 1FBCA 4IO7A 2R6GE 5I7IA 3O9PA 2DXRA 3IX1A 4HE0A 3IJOB 3FXUA 1MXWA 1MH4A 1BLFA 2D3IA 2D21A 2UYEA 4F1YA 2GHBA 4DZ1A 2VP1A 4H6DA 4PETA 4O3CA 4NQ8A 3IAZA 5EQ9A 3R26A 3MVYA 3TCFA 1NNKA 1OQGA 4RXLA 3O6GA 4H67A 4YKIA 4LN5A 4YU0A 2DWIA 5ISUA 5DEXA 3TEPA 2FA7A 2NOOA 1FTKA 4FORA 4QFLA 1VFDA 2V4CA 1QJMA 3S4UA 3TTLA 4YB7A 4ND9A 1I69A 3KJ7A 3K00A 2O6AA 1MQGA 3KJTA 2Q2AA 3HO7A 1B05A 3PUXE 1AH5A 2WYKA 4PFTA 1QGXA 4F3BA 2ZYKA 3DM0A 4H1XA 1IZ1A 4GL8A 1FBHA 1WODA 1BP5A 1XVXA 4NX1A 4PP0A 1OLAA 3IR1A 2UVJA 1Y3QA 4GBWA 3N26A 4I3YA 2DVCA 1UTBB 5ET8A 4BDOA 1LBBA 1B3LA 3Q28A 3PPRA 4UACA 2XD2A 2ONSA 4O7IA 2Q8JA 1FTLA 4UA8A 4G68A 3FVNA 4ESXA 2XXRA 3EKIA 4NGUA 4YB6A 4PTKA 1B51A 1YXIA 4P1LA 3Q25A 2OWSA 4MMPA 3M8UA 3LUZA 2DS9A 4R6KA 1QKAA 5ET5A 4JWYA 1SYIA 1SQYA 2I0BA 5I59A 1KWHA 4KYEA 1POY1 2KR0A 1MRPA 3U8QA 2O51A 4WEDA 3A3UA 4LP2B 1FQFA 1IQ7A 3A29A 4NF8B 1DBZA 4JSDA 4TOZA 2AL5A 1S50A 1H45A 3VLUA 3OMBA 5L9SA 4THIA 1VDWA 4LQ5A 4N6DA 3D4CA 3S9NC 1FBGA 4ELRA 3QUFA 3OO8A 3TTKA 4GX3A 4KPTA 2Y7IA 3VXBA 1NNTA 3QYTA 1IXIA 3GXAA 4AB6A 3RQTA 4M1VA 2HZKA 1A7LA 2I4BA 3KBZA 2MKZA 3MZBA 4KR5A 1B40A 2XHDA 4EF2A 3FVGA 3K0VA 4G68B 3FJ7A 3HSTA 1QW0A 3TCGA 1ZJLA 2Y7KA 1JETA 2XXWA 4RYAA 4MX6A 3KN8A 5EYGA 3HN0A 4F2OA 3PPOA 4X48A 4WKMA 3OENA 3MQ9A 4FBPA 3HFUA 4QFKA 1FQBA 3GZGA 3QIMA 1MQHA 3FASA 1UTHB 5DTBA 2XXKA 5IZ3B 5TP9B 1FTOA 3KSJA 3FJGA 3OEMA 3UA8A 2ZYNA 2O1LA 1TT1A 4GWUA 2XA5A 3FV1A 1MXZA 1FSAA 1R9LA 5H8NA 3MBPA 3T93B 3HPIA 4YMBA 4K3FA 3C35A 4NF8A 3T9UA 2WEFA 4OMBA 3O66A 4M4GA 3UN6A 4MEVA 1RYOA 2R71A 3MWBA 4F22A 1P1QA 1BTJA 2JJKA 1M5FA 3O29A 3T9VA 3VVDA 2M8CA 4U21A 2X26A 3KEIA 3FJMA 3JYRA 2I58A 1F9BA 2PVUA 3QUJA 3TQWA 3W9WA 3WAFA 4NMYA 4R6YA 3Q29A 4LZ5A 4OVTA 3H06B 3O2AA 4PF6A 1INPA 3QMFA 3UIFA 2DDKA 2F6GA 4BDNA 4RK9A 1N76A 2F5XA 2HHMA 2ZNUA 1D9YA 4U1OA 1B7ZA 1FBDA 5A5XB 3KGCA 1FBPA 2Q74A 4P0GA 1N3WA 1CB6A 2Y7RA 2V3TA 5H8QB 1LFIA 1B5JA 1SVXB 2XXTA 4OA4A 4PAIA 3T9HB 4RPOA 2E0SA 3LV0A 1DCUA 3IOTA 4PAKA 4NTLA 4OVSA 1MXYA 3IFCA 3MYUA 4P8BA 5CC2A 1JW4A 2XD3A 3RT8A 4DLDA 3K6UA 5BWJA 2F7BA 1NH8A 1OVBA 4G77A 4X04A 4IB2A 2ONKE 5IKBA 4OTEA 2PFZA 1YPNA 2RC7A 4ISUA 3SDFA 3N94A 3K01A 1TWYA 3UORA 1AL3A 3LBSA 4OETA 4KXPA 1B58A 3K02A 4P56A 4GL0A 4U23A 4LQ2A 2DXYA 2R9JA 2ANJA 3BFTA 2BJIA 3U1OA 3E78A 2HAUA 2V3UA 1B3GA 1US5A 1FPBA 1NV1A 1LAGE 2L5VA 4R9FA 1MH3A 5ITPA 1B6HA 3MP6A 1FPGA 2RC9A 3OSRA 3UGWA 5CBRA 1MS7A 2Z22A 3GBAA 1Q1KA 3I6VA 3SEWA 2DWAA 3BFUA 2DE4A 4F19A 4RJZA 2CZIA 3CHGA 3Q27A 1SDXA 5ICTA 1NL5A 1MY2A 4PBHA 2THIA 2PBWA 5H8NB 3A3CA 3N5LA 4MJOA 1N84A 1B1XA 3G3HA 4NF6B 3ONMA 4KQPA 1HSJA 1QUJA 1NNFA 3C4MA 4ZZEA 4Q0CA 1UIUA 4N91A 2YPNA 1XI6A 2I6EA 1TFDA 2VD3A 4FAJA 3B8BA 3ECRA 3O28A 3EQ1A 3VV5A 5DVJA 3MPKA 3C31A 3LSFB 5B70A 2E1SA 1SI0A 4IO3A 4MFIA 2CEXA 3IORA 4R9GA 3O6HA 2HPGA 3S9MC 4E0XA 1LGBC 2WYPA 4GIZA 1T0KA 2O69A 3C33A 4IY6A 1FTMA 2UVGA 4GLIA 1OQHA 1MG1A 3TTRA 4BDLA 1YTVA 2Q9TA 4XKPA 3PMXA 4KYSA 3S2VA 4MNIA 2HFBA 4OFLA 4HCWA 4DXBA 2HXWA 1IXGA 5AA2D 4X8RA 1B7UA 1USYH 2ZYOA 3HHFA 2PYYA 5I2NB 3TKDA 3MVXA 1J1NA 1PB9A 4EDPA 2HEUA 4GVOA 4MLVA 1MDP1 1AOVA 3V5AA 4F3SA 3IK6B 3K1NA 1IMAA 4N8GA 2Y5KA 4EF1A 2Q8MA 3E9XA 1B4ZA 3CSBA 4NWCA 2DWJA 4H46A 4DI4B 4FATA 5B7DA 1QULA 4KYDA 3RUMA 3K2DA 1LAFE 4IO6A 3HHGA 1IXCA 2IEEA 3GLBA 5ICQA 3VDFA 4F3PA 1IMFA 3SERA 3PPQA 2RCBA 1JQFA 4JWOA 1TXFA 5I2NA 2KLFA 3PMVA 3TQLA 1Z7ME 4RA1A 5K2YA 1SW4A 1A8EA 2I3WA 1K9YA 1UQWA 3L6GA 4JVDA 5EYHA 4NF5A 3TZAA 1IXHA 2DWHA 1Y3PA 3V83A 3FBPA 3TAJA 3FVKA 1O64A 4ELQA 4PFRA 4MIJA 2XWOA 1B3EA 1B0LA 2ESNA 3DP4A 1NV5A 3T1BA 1UTBA 4G8HA 4PAFA 4JB7A 1USYE 2XXQA 5JK4A 4R2FA 2QVRA 4GRKA 5DW8A 1K9ZA 3QK6A 1B46A 4XF5A 3K6VA 4EXKA 3ILUB 1NKXA 4G4PA 2YJPA 3FXBA 1MY0A 3SZPA 1B52A 4ELPA 4ZEDA 4C1UA 4HE2A 2FNCA 3MSTA 1Y1ZA 2VT5A 4PFYA 4OVPA 3JV9A 1ZMGA 5CMMA 3H6TA 3C36A 1XHYA 2FIXA 1MM7A 2OLBA 3T66A 3EN3A 2CZKA 3W15C 4QSDA 1POTA 1MY3A 5T3JA 2FBPA 5LDZA 4IY5A 3USDA 1GGGA 5I58B 3MVZA 4PBQA 3ZSFA 1Y4TA 1OVTA 3NOHA 2XXPA 4Z0IA 3V8XB 2HXRA 4LZ8A 3PPNA 3RY3A 3ZKKA 4U4SA 1N3XA 3LR1A 3I3VA 2F3DA 3EHTA 4AS4A 2PX1A 1Z7NE 4G61A 1LBWA 3K6WA 5CI5A 5FTIA 1LEVA 5IAIA 2VGQA 2P3NA 4GWZA 2AL4A 2XXYA 4ONYA 1II5A 3KOTA 1I6BA 2ZZWA 2H5YA 4N4UA 4X1BA 5I2KB 1IUDA 4R2BA 5AA1A 1SYHA 5EYFA 1NI9A 5M2VA 4DCXA 1A55A 2QS3A 1FQCA 2ZZVA 4HTGA 4KFQA 2DE3A 3CR9A 4QBAA 1WDNA 1B2HA 4F39A 1HSLA 3MW0A 3SKPA 2XXXA 3R6UA 1ANFA 5CMCA
chains in the Genus database with same CATH topology
4I62A 4YMAA 4R75A 1B3FA 2F7CA 4H0WA 4NF4A 2RC8A 3RTWB 3IB2A 2ALUA 1DOTA 2H9BA 2XXHA 3K6UA 4OVJA 1N0TA 3E4RA 2F97A 4F18A 1OMPA 2YLNA 4G8MA 2W7YA 3G3GA 3LSLA 2OWTA 5BWJA 1DMBA 2F7BA 5L9MA 3OELA 4JWXA 5AA2A 3VLWA 1NH8A 3IOUA 2DSFA 1OVBA 2B3BA 3CSGA 4G77A 4IB2A 4U2RA 2Y7PA 4MF3A 4F3GA 4U22A 2ONKE 1QVSA 5HPQA 2IA4A 2F7AA 4C1TA 4LZ7A 5IKBA 4TLLB 4C0RA 1H44A 1B4HA 4OTEA 2HQ0A 5AA3A 4DXCA 3EF7A 2QRYA 4G68C 1PBQA 2GH9A 1M5CA 3CI8A 4Q8RA 5HBCA 5I58A 2AIXA 4ZZAA 1FW0A 3TDJA 2O1MA 1YPNA 2RC7A 3C34A 3ODBA 1H43A 5FHNA 5FTHA 4F29A 2QS4A 4ISUA 3SDFA 2B3FA 3H4ZA 4RY1A 4QSEA 4F2OA 3KBRA 1S9TA 2CZLA 4N07A 3H3GA 3N94A 4FIMA 1RKMA 2VD2A 4KCCA 3PUVE 4OXVA 2O68A 1GV8A 2ZYMA 2DOJA 1ZLQA 3K01A 2I4CA 3A09A 5ITOA 4IO4A 5H8SA 1TWYA 4ZS9A 1PC3A 1IEJA 1S7YA 3LSWA 1I6QA 3LUYA 1AL3A 3LBSA 4GWOA 3UORA 4I9DA 1VE4A 2XX9A 4IO7A 2R6GE 4YKKA 3CVGA 1ZKBA 3T9XB 3TPAA 1B7HA 4AB5A 4OETA 1B58A 3K02A 1P1WA 5JTYA 4GL0A 3O9PA 1RYXA 2DXRA 2QS1A 1JW1A 4U23A 4LQ2A 2ABHA 2DXYA 3DP8A 2UVHA 3EPEA 2R9JA 3IX1A 4R6HA 2ANJA 3G3FA 3B6WA 1US4A 3KFMA 3BFTA 3IJOB 3OO9A 4OZ9A 4XKRA 3K1MA 2P0SA 3FXUA 3U1OA 1MXWA 1MH4A 1FQEA 4JDFA 1BLFA 2D3IA 4ZEBA 2D21A 2UXAA 3I5OA 2UYEA 4G2ZA 2V84A 3T96B 4F1YA 5H8HB 3KN3A 2GHBA 4DZ1A 2VP1A 4H6DA 3PD8A 4R74A 2X7PA 2HAUA 4PETA 2V3UA 4WXJA 4FJPA 3EHUA 4JXIA 3K6XA 1B3GA 3IJXB 1MM6A 1YAEA 2HZLA 4O3CA 3IAZA 1US5A 5I84A 2AYSA 3R26A 3VFJA 3U94A 2NWJA 2DE2A 3TFLA 1LAGE 3MVYA 2ZNSA 3TCFA 4R9FA 1NNKA 3G3JA 4OENA 2A5TA 1MH3A 4ECFA 5ITPA 3QXMA 1B6HA 1OQGA 3O6GA 4H67A 3DP6A 4RXLA 4YKIA 3MP6A 1SD3A 5DVIA 2XX7A 4POXA 2ZXTA 2RC9A 2QJEA 1VR5A 4YU0A 1GVCA 3OSRA 3KN7A 3FATA 5A5XA 4GXAA 2DWIA 1SW5A 3MP1A 4NF6A 3UGWA 5CBRA 2GHAA 4XKQA 5TU0A 5ISUA 4EQ7A 1ZBMA 5DEXA 3O6IA 2NVUB 3TEPA 1MS7A 1LB9A 2Z22A 2FA7A 1Q1KA 3GBAA 3I6VA 4N6PA 3SEUA 3SEWA 1MPCA 2DWAA 3BFUA 2DE4A 2NOOA 1FTKA 1OLCA 4H8IA 4OESA 4PFWA 4F19A 1B3HA 4RJZA 4FORA 5JTYB 5I57A 4QFLA 1VFDA 5H8QA 2WKYA 1QJMA 4AQ4A 3H7MA 3S4UA 1LAXA 1SDXA 3Q27A 4BDQA 1JW5A 1XVYA 3IL1B 3TTLA 5ICTA 3S9EA 5L9OA 1XT8A 1NL5A 4YB7A 5F1QA 5KZTA 1MY2A 2F35A 1R9QA 1I69A 4ND9A 3PV0E 2THIA 2PBWA 3PU5A 5H8NB 1GTKA 3KJ7A 3V89B 4DE8A 1UIVA 3A3CA 2UYFA 3G7WA 3K00A 3PD9A 4FEBA 3JZJA 4DXUA 3N5LA 4ESWA 4YKPA 1N84A 1B1XA 3G3HA 4NF6B 3UP9A 1LCTA 1MQGA 2O6AA 1EZPA 2QSXA 3KJTA 2XXVA 3ONMA 3M3FA 2Q2AA 1HSJA 1JNFA 3HO7A 1B05A 4KQPA 1SW1A 1QUJA 5H8FA 3PUXE 1NNFA 3C4MA 3E13X 4ZZEA 4Q0CA 1UIUA 1ZIUA 3PGFA 2YPNA 4YICA 1AH5A 3OXNA 2I6EA 2PT2A 4PFTA 2I0CA 1TFDA 2VD3A 4F3BA 2ZYKA 1MXVA 2G93A 3PUWE 3O97A 4FEDA 3DM0A 3C9HA 1LFHA 4FAJA 3P7IA 4XTCQ 3RN8A 3FUZA 5HM4B 3ECRA 3O28A 1IZ1A 4GL8A 4H1XA 4PFUA 3Q26A 3RGYA 4H65A 1WODA 3EQ1A 3VV5A 1DTGA 5K2XA 1BP5A 4E0WA 5DVJA 4U1ZA 1XVXA 3MPKA 3MC2A 4JSOA 3C31A 3LSFB 4PP0A 5B70A 4ZEFA 1OLAA 1P1OA 2E1SA 2UVJA 1SI0A 2VHAA 3HV1A 3IR1A 3TUSA 1Y3QA 5TPAA 1B1HA 3FZVA 4EUOA 1LBCA 1P1NA 4ELOA 3N26A 3F11A 4XKNA 4IO3A 4MFIA 4WEPA 3IORA 3THIA 2Z8FA 2DVCA 3OO6A 1UTBB 3M3KA 4R9GA 4BDOA 1LBBA 1B3LA 3O6HA 1IITA 1Q35A 3Q28A 3PPRA 5KCJB 1MPDA 4UACA 4QSCA 1A54A 2XD2A 5FHMA 2ONSA 4ZEKA 3RTFB 1FQAA 4O3AA 2P2AA 4O3BA 3S9MC 4E0XA 1CE2A 2Q8JA 1FTLA 1LGBC 2V93A 2X7QA 2XXUA 4G68A 4GIZA 4UA8A 3T22A 5H8HA 2F8DA 3FVNA 4DCYA 2O69A 1B9JA 2NUVA 3C33A 1FTMA 2QL3A 2UVGA 4IY6A 4BDMA 4GLIA 3CG3A 1DSNA 1OQHA 1MG1A 2XXRA 4ESXA 4QFPA 1DPPA 2G29A 2I3VA 3TTRA 4Q5TA 4BDLA 1YTVA 2Q9TA 4YB6A 1B51A 3PMXA 4XKPA 2RF1A 4LA9A 4JBZA 1A40A 3H6WA 3Q25A 4KYSA 3S2VA 2OBGA 2HFBA 4NEDA 3K4UA 3PMWA 4OFLA 4HCWA 4L17A 5DVFA 4DXBA 2OWSA 3FD3A 1LCFA 4OFOA 3M8UA 3FXRA 4YKJA 2DP8A 2DS9A 4OWDA 4MH5A 4R6KA 1QKAA 2P1SA 2V25A 2HXWA 1IXGA 5AA2D 1MQIA 4JWYA 1B7UA 1USYH 2ZYOA 3HHFA 3M3LA 2PYYA 3OSQA 5I2NB 5JEIA 3H03A 1N7XA 3B7DA 3FIRA 1SYIA 3TKDA 4BLAA 1SQYA 3ZKLA 2PMSA 2I0BA 3MVXA 4YZZA 1J1NA 1PB9A 4EDPA 4F1VA 3KSXA 5TPAB 2HEUA 4IGTA 5I59A 1KWHA 2OZZA 1POY1 3CG1A 4GVOA 4KYEA 4MLVA 1R6ZA 1MRPA 1MDP1 3DLNA 3U8QA 4GXSB 2OCUA 2O51A 1ATGA 4LUBA 4RNSA 3V5AA 4F3SA 1AOVA 3IOWA 3IK6B 5KCJA 4QRZA 4GOTA 4WEDA 3VE1B 3K1NA 4N13A 1EZOA 3N6UA 3A3UA 3LC8A 2H98A 3HCQA 4LP2B 4EF1A 1FQFA 2ZNTA 3LSXA 1IQ7A 3E9XA 1B4ZA 2NXOA 3VLVA 4NF4B 3R7XA 4NF8B 4JSDA 2BJJX 3CSBA 4TOZA 4NWCA 4TLMB 3N6TA 4P11A 1SI1A 1PB8A 2DWJA 1EH3A 3WAEA 2AL5A 1S50A 1H45A 3MPLA 4H5GA 1FQDA 3VLUA 3OMBA 4NE4A 1LSTA 2UVIA 1M5EA 1GR2A 1MY4A 1QULA 4I8CA 4KYDA 4FATA 4HW8A 5B7DA 5L9SA 4R72A 4THIA 3RUMA 3CRBA 2QMXA 3K2DA 4LQ5A 4KI0E 3D4CA 1DPEA 3SEVA 3S9NC 1MQDA 1LAFE 4ELRA 4IO6A 3HHGA 5I56B 3GBBA 3QUFA 3OO8A 4XIGQ 1IXCA 1A8FA 2IEEA 3GLBA 3OEKA 4XXUA 3TTKA 3VDFA 2ZMBA 4F3PA 3VXCA 5ICQA 3MAMA 4PE5B 3SEYA 1LFGA 3BBRA 3SERA 4KPTA 2Y7IA 3PPQA 3VXBA 1AIVA 2H25A 3PPPA 4BDRA 1NNTA 3VVEA 3QYTA 1IXIA 2RCBA 1JQFA 2ONRA 1FCKA 3CIJA 3BKIB 3GXAA 4JWOA 4AB6A 3RQTA 2F34A 1TXFA 5I2NA 2KLFA 3PMVA 3TQLA 1Z7ME 4RA1A 4LONB 4M1VA 3C32A 5K2YA 1SW4A 2HZKA 1A8EA 2DQVA 2I3WA 3TCHA 1A7LA 5DYHA 4ZECA 2I4BA 3AXFA 3CFLA 1ELJA 1UQWA 3L6GA 5AA4A 5CM6A 1IIWA 4HCYA 4NF5A 3TZAA 1JVXA 4ZDMA 3MZBA 3TYHA 1EZ9A 1I6AA 1IXHA 1OIBA 2DWHA 4KR5A 1Y3PA 1B40A 5L8DA 3TELA 3W9VA 3MVWA 2XHDA 3V83A 4EF2A 1JEUA 2D5WA 3FVGA 3K0VA 4G68B 1BKAA 4FE8A 3TAJA 3EHSA 1R1NA 3FVKA 3FJ7A 1EU8A 3HSTA 3IO6A 1O64A 3DELB 1QW0A 1TFAA 4ELQA 3TCGA 4DDDA 1ZJLA 1JEVA 3K1PA 1NFTA 1LB8A 1B3EA 4QF9A 2Y7KA 1B0LA 1JETA 1MXUA 2ESNA 4OQOA 3DP4A 2F78A 2XXWA 1QUKA 2RKMA 4RYAA 2F6PA 3KN8A 1UTBA 4G8HA 3TTNA 2Y7WA 3HN0A 1PDAA 1FTJA 1URSA 1D4NA 4JB7A 3PPOA 1USYE 2XXQA 4U4XA 2XXIA 4R2FA 4X48A 4WKMA 5JK4A 1M5DA 1D3KA 3OENA 3MQ9A 3B6TA 4GRKA 4QFKA 1MXXA 1FQBA 2HCAA 2Q2CA 3GZGA 2F36A 2H99A 1MQHA 3OO7A 3QIMA 4X9TA 4YB5A 2GFEA 2A5TB 3FASA 1UTHB 1B0HA 1O7TA 1XOCA 3QK6A 4MLQA 3OOAA 5DTBA 3RLFE 5TP9B 1B46A 1FTOA 1NNPA 4RPNA 1MQJA 3CFXA 3K6VA 3ILUB 4EXKA 1NKXA 4G4PA 2YJPA 1Y3NA 4QHQA 5AA2B 2O7UA 4GQOA 1MY0A 1B52A 1B5IA 3KSJA 3FJGA 4ELPA 4ZEDA 3OEMA 5CBSA 3UA8A 1O63A 2ZYNA 5J1DA 3MZ1A 4C1UA 2O1LA 1TT1A 3MP8A 2FNCA 4KCDA 1N04A 1QUIA 3FV1A 1Y1ZA 4FECA 3RNNA 1URDA 1MXZA 4LVQA 4PFYA 3MZ9A 5I57B 4KD5A 1MPBA 1R9LA 2FYIA 5H8NA 3ILTB 3FXQA 1URGA 2RINA 3MBPA 3JV9A 3T93B 1ZMGA 3HPIA 4YMBA 1HSEA 1XC1A 3D4GA 5CMMA 4GF8A 3H6TA 5TP9A 2GRVA 4K3FA 3C36A 3UK4A 1XHYA 3C35A 4NF8A 3T9UA 1MM7A 2OLBA 3T66A 4OMBA 3EN3A 3O66A 4M4GA 4QFOA 2QMWA 2OK2A 2I49A 4H5FA 3UN6A 1B5HA 1RYOA 1VFEA 3L6HA 3QAXA 4OERA 3W15C 2R71A 3MWBA 4QSDA 1POTA 4EQ9A 1MY3A 5F7VA 5H8FB 4F22A 1P1QA 1Y4CA 4HS7A 4OFJA 3SETA 1A99A 3E3KA 1LAHE 2B65A 1BTJA 3IB1A 3IO4A 1M5FA 3MUQA 4IY5A 5EHSA 5I59B 5I56A 1M5BA 3O29A 3T9VA 3USDA 1D9VA 2M8CA 3VVDA 2QPQA 1BIYA 1PEBA 5AE4A 1T0KA 4U21A 1NMUA 2X26A 5CRYA 3FV2A 1UTHA 2REJA 3KEIA 1GGGA 3S9LC 2O7IA 2A5SA 3QSLA 3VVFA 5I58B 3G3IA 4EQBA 4IO2A 3FJMA 1WVJA 3JYRA 3KG2A 3MVZA 4TQUQ 3U92A 2O84X 3B6QA 4GD5A 2Z8EA 3KZGA 2V3QA 2I58A 3ZSFA 1F9BA 1OVTA 1Y20A 1QKBA 1Y4TA 3MJNA 2PVUA 2XXPA 4KHZE 4Q30B 5EHMA 4Z0IA 3V8XB 4ZEIA 1VSOA 3QUJA 4LZ8A 3TQWA 4OEVA 3W9WA 1ZU0A 3WAFA 4Z7EA 1ZTYA 1N7WA 2Q88A 4NMYA 3PPNA 1H3DA 4R6YA 2LAOA 3RY3A 2RCAA 3PUYE 3IOVA 3Q29A 3H6UA 3ZKKA 2CMOA 4IO5A 5BUUA 3FGSA 4LZ5A 4U4SA 3RPWA 5LOMA 2XX8A 3H06B 3O2AA 4YAHX 2Y84A 3IB0A 1N3XA 1NH7A 3UIFA 3LR1A 3PUZE 4EXLA 4GFRA 1P99A 1P1UA 3TMGA 1PB7A 2F6GA 3I3VA 4MBPA 5I2KA 4BDNA 3EHTA 2OJTA 4P0IA 3SEXA 1MY1A 2H4IA 4RK9A 1N76A 2F5XA 4F2QA 1SW2A 4I1DA 2ZNUA 2PX1A 1D9YA 1Z7NE 1B7ZA 1Y1MA 4U1OA 1SBPA 4H8JA 1AMFA 2VOZA 4POWA 5FTIA 3K6WA 4X1DA 5CI5A 5A5XB 2Z23A 5DT6A 1L5TA 3TTMA 3KGCA 5CMKA 5IAIA 2VGQA 3U72A 4RK2A 1XS5A 4P0GA 1JVYA 1N3WA 2AL4A 4IGRA 5AA4B 2Z8DA 1YCJA 4NF5B 4ZE9A 1CB6A 2XXYA 2Y7RA 4ONYA 1II5A 2V3TA 3KOTA 4F1UA 1I6BA 5H8QB 2H5YA 5FHOA 1H76A 4X1BA 3SESA 3H6VA 5I2KB 1IUDA 4R2BA 5AA1A 1LFIA 1SYHA 4F31B 5ELVA 1B5JA 4QFNA 1Y9UA 5EYFA 1SVXB 2XXTA 4OEUA 3T9HB 2Q89A 2HAVA 4RPOA 3G3KA 5CMBA 4DIGA 4OHNA 3TODA 1DTZA 2E0SA 5M2VA 3RT6B 4LATA 2I48A 2PT1A 1A55A 3CFZA 4DCXA 2QS3A 3IOTA 1FQCA 3FVOA 4HTGA 4OYVA 4ZE8A 3U93A 5DEXB 1PBPA 3OD7A 4KFQA 5KDTB 2QS2A 4NTLA 2DE3A 2REGA 3KOSA 5KDTA 2DVZA 1LLSA 3ZS6A 1MDQA 1MXYA 3CR9A 4NWDA 1WDNA 1B32A 1B2HA 4PQJA 1HSLA 4F39A 5CC2A 3MW0A 3SKPA 1JW4A 2XXXA 3R6UA 4R73A 2DYXA 1ANFA 2XD3A 3RT8A 5CMCA 4DLDA 4G8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I62 A;  4YMA A;  4R75 A;  1B3F A;  2F7C A;  4H0W A;  4NF4 A;  2RC8 A;  3RTW B;  3IB2 A;  2ALU A;  1DOT A;  2H9B A;  2XXH A;  3K6U A;  4OVJ A;  1N0T A;  3E4R A;  2F97 A;  4F18 A;  1OMP A;  2YLN A;  4G8M A;  2W7Y A;  3G3G A;  3LSL A;  2OWT A;  5BWJ A;  1DMB A;  2F7B A;  5L9M A;  3OEL A;  4JWX A;  5AA2 A;  3VLW A;  1NH8 A;  3IOU A;  2DSF A;  1OVB A;  2B3B A;  3CSG A;  4G77 A;  4IB2 A;  4U2R A;  2Y7P A;  4MF3 A;  4F3G A;  4U22 A;  2ONK E;  1QVS A;  5HPQ A;  2IA4 A;  2F7A A;  4C1T A;  4LZ7 A;  5IKB A;  4TLL B;  4C0R A;  1H44 A;  1B4H A;  4OTE A;  2HQ0 A;  5AA3 A;  4DXC A;  3EF7 A;  2QRY A;  4G68 C;  1PBQ A;  2GH9 A;  1M5C A;  3CI8 A;  4Q8R A;  5HBC A;  5I58 A;  2AIX A;  4ZZA A;  1FW0 A;  3TDJ A;  2O1M A;  1YPN A;  2RC7 A;  3C34 A;  3ODB A;  1H43 A;  5FHN A;  5FTH A;  4F29 A;  2QS4 A;  4ISU A;  3SDF A;  2B3F A;  3H4Z A;  4RY1 A;  4QSE A;  4F2O A;  3KBR A;  1S9T A;  2CZL A;  4N07 A;  3H3G A;  3N94 A;  4FIM A;  1RKM A;  2VD2 A;  4KCC A;  3PUV E;  4OXV A;  2O68 A;  1GV8 A;  2ZYM A;  2DOJ A;  1ZLQ A;  3K01 A;  2I4C A;  3A09 A;  5ITO A;  4IO4 A;  5H8S A;  1TWY A;  4ZS9 A;  1PC3 A;  1IEJ A;  1S7Y A;  3LSW A;  1I6Q A;  3LUY A;  1AL3 A;  3LBS A;  4GWO A;  3UOR A;  4I9D A;  1VE4 A;  2XX9 A;  4IO7 A;  2R6G E;  4YKK A;  3CVG A;  1ZKB A;  3T9X B;  3TPA A;  1B7H A;  4AB5 A;  4OET A;  1B58 A;  3K02 A;  1P1W A;  5JTY A;  4GL0 A;  3O9P A;  1RYX A;  2DXR A;  2QS1 A;  1JW1 A;  4U23 A;  4LQ2 A;  2ABH A;  2DXY A;  3DP8 A;  2UVH A;  3EPE A;  2R9J A;  3IX1 A;  4R6H A;  2ANJ A;  3G3F A;  3B6W A;  1US4 A;  3KFM A;  3BFT A;  3IJO B;  3OO9 A;  4OZ9 A;  4XKR A;  3K1M A;  2P0S A;  3FXU A;  3U1O A;  1MXW A;  1MH4 A;  1FQE A;  4JDF A;  1BLF A;  2D3I A;  4ZEB A;  2D21 A;  2UXA A;  3I5O A;  2UYE A;  4G2Z A;  2V84 A;  3T96 B;  4F1Y A;  5H8H B;  3KN3 A;  2GHB A;  4DZ1 A;  2VP1 A;  4H6D A;  3PD8 A;  4R74 A;  2X7P A;  2HAU A;  4PET A;  2V3U A;  4WXJ A;  4FJP A;  3EHU A;  4JXI A;  3K6X A;  1B3G A;  3IJX B;  1MM6 A;  1YAE A;  2HZL A;  4O3C A;  3IAZ A;  1US5 A;  5I84 A;  2AYS A;  3R26 A;  3VFJ A;  3U94 A;  2NWJ A;  2DE2 A;  3TFL A;  1LAG E;  3MVY A;  2ZNS A;  3TCF A;  4R9F A;  1NNK A;  3G3J A;  4OEN A;  2A5T A;  1MH3 A;  4ECF A;  5ITP A;  3QXM A;  1B6H A;  1OQG A;  3O6G A;  4H67 A;  3DP6 A;  4RXL A;  4YKI A;  3MP6 A;  1SD3 A;  5DVI A;  2XX7 A;  4POX A;  2ZXT A;  2RC9 A;  2QJE A;  1VR5 A;  4YU0 A;  1GVC A;  3OSR A;  3KN7 A;  3FAT A;  5A5X A;  4GXA A;  2DWI A;  1SW5 A;  3MP1 A;  4NF6 A;  3UGW A;  5CBR A;  2GHA A;  4XKQ A;  5TU0 A;  5ISU A;  4EQ7 A;  1ZBM A;  5DEX A;  3O6I A;  2NVU B;  3TEP A;  1MS7 A;  1LB9 A;  2Z22 A;  2FA7 A;  1Q1K A;  3GBA A;  3I6V A;  4N6P A;  3SEU A;  3SEW A;  1MPC A;  2DWA A;  3BFU A;  2DE4 A;  2NOO A;  1FTK A;  1OLC A;  4H8I A;  4OES A;  4PFW A;  4F19 A;  1B3H A;  4RJZ A;  4FOR A;  5JTY B;  5I57 A;  4QFL A;  1VFD A;  5H8Q A;  2WKY A;  1QJM A;  4AQ4 A;  3H7M A;  3S4U A;  1LAX A;  1SDX A;  3Q27 A;  4BDQ A;  1JW5 A;  1XVY A;  3IL1 B;  3TTL A;  5ICT A;  3S9E A;  5L9O A;  1XT8 A;  1NL5 A;  4YB7 A;  5F1Q A;  5KZT A;  1MY2 A;  2F35 A;  1R9Q A;  1I69 A;  4ND9 A;  3PV0 E;  2THI A;  2PBW A;  3PU5 A;  5H8N B;  1GTK A;  3KJ7 A;  3V89 B;  4DE8 A;  1UIV A;  3A3C A;  2UYF A;  3G7W A;  3K00 A;  3PD9 A;  4FEB A;  3JZJ A;  4DXU A;  3N5L A;  4ESW A;  4YKP A;  1N84 A;  1B1X A;  3G3H A;  4NF6 B;  3UP9 A;  1LCT A;  1MQG A;  2O6A A;  1EZP A;  2QSX A;  3KJT A;  2XXV A;  3ONM A;  3M3F A;  2Q2A A;  1HSJ A;  1JNF A;  3HO7 A;  1B05 A;  4KQP A;  1SW1 A;  1QUJ A;  5H8F A;  3PUX E;  1NNF A;  3C4M A;  3E13 X;  4ZZE A;  4Q0C A;  1UIU A;  1ZIU A;  3PGF A;  2YPN A;  4YIC A;  1AH5 A;  3OXN A;  2I6E A;  2PT2 A;  4PFT A;  2I0C A;  1TFD A;  2VD3 A;  4F3B A;  2ZYK A;  1MXV A;  2G93 A;  3PUW E;  3O97 A;  4FED A;  3DM0 A;  3C9H A;  1LFH A;  4FAJ A;  3P7I A;  4XTC Q;  3RN8 A;  3FUZ A;  5HM4 B;  3ECR A;  3O28 A;  1IZ1 A;  4GL8 A;  4H1X A;  4PFU A;  3Q26 A;  3RGY A;  4H65 A;  1WOD A;  3EQ1 A;  3VV5 A;  1DTG A;  5K2X A;  1BP5 A;  4E0W A;  5DVJ A;  4U1Z A;  1XVX A;  3MPK A;  3MC2 A;  4JSO A;  3C31 A;  3LSF B;  4PP0 A;  5B70 A;  4ZEF A;  1OLA A;  1P1O A;  2E1S A;  2UVJ A;  1SI0 A;  2VHA A;  3HV1 A;  3IR1 A;  3TUS A;  1Y3Q A;  5TPA A;  1B1H A;  3FZV A;  4EUO A;  1LBC A;  1P1N A;  4ELO A;  3N26 A;  3F11 A;  4XKN A;  4IO3 A;  4MFI A;  4WEP A;  3IOR A;  3THI A;  2Z8F A;  2DVC A;  3OO6 A;  1UTB B;  3M3K A;  4R9G A;  4BDO A;  1LBB A;  1B3L A;  3O6H A;  1IIT A;  1Q35 A;  3Q28 A;  3PPR A;  5KCJ B;  1MPD A;  4UAC A;  4QSC A;  1A54 A;  2XD2 A;  5FHM A;  2ONS A;  4ZEK A;  3RTF B;  1FQA A;  4O3A A;  2P2A A;  4O3B A;  3S9M C;  4E0X A;  1CE2 A;  2Q8J A;  1FTL A;  1LGB C;  2V93 A;  2X7Q A;  2XXU A;  4G68 A;  4GIZ A;  4UA8 A;  3T22 A;  5H8H A;  2F8D A;  3FVN A;  4DCY A;  2O69 A;  1B9J A;  2NUV A;  3C33 A;  1FTM A;  2QL3 A;  2UVG A;  4IY6 A;  4BDM A;  4GLI A;  3CG3 A;  1DSN A;  1OQH A;  1MG1 A;  2XXR A;  4ESX A;  4QFP A;  1DPP A;  2G29 A;  2I3V A;  3TTR A;  4Q5T A;  4BDL A;  1YTV A;  2Q9T A;  4YB6 A;  1B51 A;  3PMX A;  4XKP A;  2RF1 A;  4LA9 A;  4JBZ A;  1A40 A;  3H6W A;  3Q25 A;  4KYS A;  3S2V A;  2OBG A;  2HFB A;  4NED A;  3K4U A;  3PMW A;  4OFL A;  4HCW A;  4L17 A;  5DVF A;  4DXB A;  2OWS A;  3FD3 A;  1LCF A;  4OFO A;  3M8U A;  3FXR A;  4YKJ A;  2DP8 A;  2DS9 A;  4OWD A;  4MH5 A;  4R6K A;  1QKA A;  2P1S A;  2V25 A;  2HXW A;  1IXG A;  5AA2 D;  1MQI A;  4JWY A;  1B7U A;  1USY H;  2ZYO A;  3HHF A;  3M3L A;  2PYY A;  3OSQ A;  5I2N B;  5JEI A;  3H03 A;  1N7X A;  3B7D A;  3FIR A;  1SYI A;  3TKD A;  4BLA A;  1SQY A;  3ZKL A;  2PMS A;  2I0B A;  3MVX A;  4YZZ A;  1J1N A;  1PB9 A;  4EDP A;  4F1V A;  3KSX A;  5TPA B;  2HEU A;  4IGT A;  5I59 A;  1KWH A;  2OZZ A;  1POY 1;  3CG1 A;  4GVO A;  4KYE A;  4MLV A;  1R6Z A;  1MRP A;  1MDP 1;  3DLN A;  3U8Q A;  4GXS B;  2OCU A;  2O51 A;  1ATG A;  4LUB A;  4RNS A;  3V5A A;  4F3S A;  1AOV A;  3IOW A;  3IK6 B;  5KCJ A;  4QRZ A;  4GOT A;  4WED A;  3VE1 B;  3K1N A;  4N13 A;  1EZO A;  3N6U A;  3A3U A;  3LC8 A;  2H98 A;  3HCQ A;  4LP2 B;  4EF1 A;  1FQF A;  2ZNT A;  3LSX A;  1IQ7 A;  3E9X A;  1B4Z A;  2NXO A;  3VLV A;  4NF4 B;  3R7X A;  4NF8 B;  4JSD A;  2BJJ X;  3CSB A;  4TOZ A;  4NWC A;  4TLM B;  3N6T A;  4P11 A;  1SI1 A;  1PB8 A;  2DWJ A;  1EH3 A;  3WAE A;  2AL5 A;  1S50 A;  1H45 A;  3MPL A;  4H5G A;  1FQD A;  3VLU A;  3OMB A;  4NE4 A;  1LST A;  2UVI A;  1M5E A;  1GR2 A;  1MY4 A;  1QUL A;  4I8C A;  4KYD A;  4FAT A;  4HW8 A;  5B7D A;  5L9S A;  4R72 A;  4THI A;  3RUM A;  3CRB A;  2QMX A;  3K2D A;  4LQ5 A;  4KI0 E;  3D4C A;  1DPE A;  3SEV A;  3S9N C;  1MQD A;  1LAF E;  4ELR A;  4IO6 A;  3HHG A;  5I56 B;  3GBB A;  3QUF A;  3OO8 A;  4XIG Q;  1IXC A;  1A8F A;  2IEE A;  3GLB A;  3OEK A;  4XXU A;  3TTK A;  3VDF A;  2ZMB A;  4F3P A;  3VXC A;  5ICQ A;  3MAM A;  4PE5 B;  3SEY A;  1LFG A;  3BBR A;  3SER A;  4KPT A;  2Y7I A;  3PPQ A;  3VXB A;  1AIV A;  2H25 A;  3PPP A;  4BDR A;  1NNT A;  3VVE A;  3QYT A;  1IXI A;  2RCB A;  1JQF A;  2ONR A;  1FCK A;  3CIJ A;  3BKI B;  3GXA A;  4JWO A;  4AB6 A;  3RQT A;  2F34 A;  1TXF A;  5I2N A;  2KLF A;  3PMV A;  3TQL A;  1Z7M E;  4RA1 A;  4LON B;  4M1V A;  3C32 A;  5K2Y A;  1SW4 A;  2HZK A;  1A8E A;  2DQV A;  2I3W A;  3TCH A;  1A7L A;  5DYH A;  4ZEC A;  2I4B A;  3AXF A;  3CFL A;  1ELJ A;  1UQW A;  3L6G A;  5AA4 A;  5CM6 A;  1IIW A;  4HCY A;  4NF5 A;  3TZA A;  1JVX A;  4ZDM A;  3MZB A;  3TYH A;  1EZ9 A;  1I6A A;  1IXH A;  1OIB A;  2DWH A;  4KR5 A;  1Y3P A;  1B40 A;  5L8D A;  3TEL A;  3W9V A;  3MVW A;  2XHD A;  3V83 A;  4EF2 A;  1JEU A;  2D5W A;  3FVG A;  3K0V A;  4G68 B;  1BKA A;  4FE8 A;  3TAJ A;  3EHS A;  1R1N A;  3FVK A;  3FJ7 A;  1EU8 A;  3HST A;  3IO6 A;  1O64 A;  3DEL B;  1QW0 A;  1TFA A;  4ELQ A;  3TCG A;  4DDD A;  1ZJL A;  1JEV A;  3K1P A;  1NFT A;  1LB8 A;  1B3E A;  4QF9 A;  2Y7K A;  1B0L A;  1JET A;  1MXU A;  2ESN A;  4OQO A;  3DP4 A;  2F78 A;  2XXW A;  1QUK A;  2RKM A;  4RYA A;  2F6P A;  3KN8 A;  1UTB A;  4G8H A;  3TTN A;  2Y7W A;  3HN0 A;  1PDA A;  1FTJ A;  1URS A;  1D4N A;  4JB7 A;  3PPO A;  1USY E;  2XXQ A;  4U4X A;  2XXI A;  4R2F A;  4X48 A;  4WKM A;  5JK4 A;  1M5D A;  1D3K A;  3OEN A;  3MQ9 A;  3B6T A;  4GRK A;  4QFK A;  1MXX A;  1FQB A;  2HCA A;  2Q2C A;  3GZG A;  2F36 A;  2H99 A;  1MQH A;  3OO7 A;  3QIM A;  4X9T A;  4YB5 A;  2GFE A;  2A5T B;  3FAS A;  1UTH B;  1B0H A;  1O7T A;  1XOC A;  3QK6 A;  4MLQ A;  3OOA A;  5DTB A;  3RLF E;  5TP9 B;  1B46 A;  1FTO A;  1NNP A;  4RPN A;  1MQJ A;  3CFX A;  3K6V A;  3ILU B;  4EXK A;  1NKX A;  4G4P A;  2YJP A;  1Y3N A;  4QHQ A;  5AA2 B;  2O7U A;  4GQO A;  1MY0 A;  1B52 A;  1B5I A;  3KSJ A;  3FJG A;  4ELP A;  4ZED A;  3OEM A;  5CBS A;  3UA8 A;  1O63 A;  2ZYN A;  5J1D A;  3MZ1 A;  4C1U A;  2O1L A;  1TT1 A;  3MP8 A;  2FNC A;  4KCD A;  1N04 A;  1QUI A;  3FV1 A;  1Y1Z A;  4FEC A;  3RNN A;  1URD A;  1MXZ A;  4LVQ A;  4PFY A;  3MZ9 A;  5I57 B;  4KD5 A;  1MPB A;  1R9L A;  2FYI A;  5H8N A;  3ILT B;  3FXQ A;  1URG A;  2RIN A;  3MBP A;  3JV9 A;  3T93 B;  1ZMG A;  3HPI A;  4YMB A;  1HSE A;  1XC1 A;  3D4G A;  5CMM A;  4GF8 A;  3H6T A;  5TP9 A;  2GRV A;  4K3F A;  3C36 A;  3UK4 A;  1XHY A;  3C35 A;  4NF8 A;  3T9U A;  1MM7 A;  2OLB A;  3T66 A;  4OMB A;  3EN3 A;  3O66 A;  4M4G A;  4QFO A;  2QMW A;  2OK2 A;  2I49 A;  4H5F A;  3UN6 A;  1B5H A;  1RYO A;  1VFE A;  3L6H A;  3QAX A;  4OER A;  3W15 C;  2R71 A;  3MWB A;  4QSD A;  1POT A;  4EQ9 A;  1MY3 A;  5F7V A;  5H8F B;  4F22 A;  1P1Q A;  1Y4C A;  4HS7 A;  4OFJ A;  3SET A;  1A99 A;  3E3K A;  1LAH E;  2B65 A;  1BTJ A;  3IB1 A;  3IO4 A;  1M5F A;  3MUQ A;  4IY5 A;  5EHS A;  5I59 B;  5I56 A;  1M5B A;  3O29 A;  3T9V A;  3USD A;  1D9V A;  2M8C A;  3VVD A;  2QPQ A;  1BIY A;  1PEB A;  5AE4 A;  1T0K A;  4U21 A;  1NMU A;  2X26 A;  5CRY A;  3FV2 A;  1UTH A;  2REJ A;  3KEI A;  1GGG A;  3S9L C;  2O7I A;  2A5S A;  3QSL A;  3VVF A;  5I58 B;  3G3I A;  4EQB A;  4IO2 A;  3FJM A;  1WVJ A;  3JYR A;  3KG2 A;  3MVZ A;  4TQU Q;  3U92 A;  2O84 X;  3B6Q A;  4GD5 A;  2Z8E A;  3KZG A;  2V3Q A;  2I58 A;  3ZSF A;  1F9B A;  1OVT A;  1Y20 A;  1QKB A;  1Y4T A;  3MJN A;  2PVU A;  2XXP A;  4KHZ E;  4Q30 B;  5EHM A;  4Z0I A;  3V8X B;  4ZEI A;  1VSO A;  3QUJ A;  4LZ8 A;  3TQW A;  4OEV A;  3W9W A;  1ZU0 A;  3WAF A;  4Z7E A;  1ZTY A;  1N7W A;  2Q88 A;  4NMY A;  3PPN A;  1H3D A;  4R6Y A;  2LAO A;  3RY3 A;  2RCA A;  3PUY E;  3IOV A;  3Q29 A;  3H6U A;  3ZKK A;  2CMO A;  4IO5 A;  5BUU A;  3FGS A;  4LZ5 A;  4U4S A;  3RPW A;  5LOM A;  2XX8 A;  3H06 B;  3O2A A;  4YAH X;  2Y84 A;  3IB0 A;  1N3X A;  1NH7 A;  3UIF A;  3LR1 A;  3PUZ E;  4EXL A;  4GFR A;  1P99 A;  1P1U A;  3TMG A;  1PB7 A;  2F6G A;  3I3V A;  4MBP A;  5I2K A;  4BDN A;  3EHT A;  2OJT A;  4P0I A;  3SEX A;  1MY1 A;  2H4I A;  4RK9 A;  1N76 A;  2F5X A;  4F2Q A;  1SW2 A;  4I1D A;  2ZNU A;  2PX1 A;  1D9Y A;  1Z7N E;  1B7Z A;  1Y1M A;  4U1O A;  1SBP A;  4H8J A;  1AMF A;  2VOZ A;  4POW A;  5FTI A;  3K6W A;  4X1D A;  5CI5 A;  5A5X B;  2Z23 A;  5DT6 A;  1L5T A;  3TTM A;  3KGC A;  5CMK A;  5IAI A;  2VGQ A;  3U72 A;  4RK2 A;  1XS5 A;  4P0G A;  1JVY A;  1N3W A;  2AL4 A;  4IGR A;  5AA4 B;  2Z8D A;  1YCJ A;  4NF5 B;  4ZE9 A;  1CB6 A;  2XXY A;  2Y7R A;  4ONY A;  1II5 A;  2V3T A;  3KOT A;  4F1U A;  1I6B A;  5H8Q B;  2H5Y A;  5FHO A;  1H76 A;  4X1B A;  3SES A;  3H6V A;  5I2K B;  1IUD A;  4R2B A;  5AA1 A;  1LFI A;  1SYH A;  4F31 B;  5ELV A;  1B5J A;  4QFN A;  1Y9U A;  5EYF A;  1SVX B;  2XXT A;  4OEU A;  3T9H B;  2Q89 A;  2HAV A;  4RPO A;  3G3K A;  5CMB A;  4DIG A;  4OHN A;  3TOD A;  1DTZ A;  2E0S A;  5M2V A;  3RT6 B;  4LAT A;  2I48 A;  2PT1 A;  1A55 A;  3CFZ A;  4DCX A;  2QS3 A;  3IOT A;  1FQC A;  3FVO A;  4HTG A;  4OYV A;  4ZE8 A;  3U93 A;  5DEX B;  1PBP A;  3OD7 A;  4KFQ A;  5KDT B;  2QS2 A;  4NTL A;  2DE3 A;  2REG A;  3KOS A;  5KDT A;  2DVZ A;  1LLS A;  3ZS6 A;  1MDQ A;  1MXY A;  3CR9 A;  4NWD A;  1WDN A;  1B32 A;  1B2H A;  4PQJ A;  1HSL A;  4F39 A;  5CC2 A;  3MW0 A;  3SKP A;  1JW4 A;  2XXX A;  3R6U A;  4R73 A;  2DYX A;  1ANF A;  2XD3 A;  3RT8 A;  5CMC A;  4DLD A;  4G8N A; 
#chains in the Genus database with same CATH topology
 4YMA A;  4H0W A;  4NF4 A;  2RC8 A;  3IB2 A;  2ALU A;  1NUY A;  4F18 A;  1OMP A;  2YLN A;  2QVV A;  3G3G A;  2OWT A;  5AA2 A;  3OEL A;  5A5L A;  1FJ9 A;  4U22 A;  4LZ7 A;  4C0R A;  2HQ0 A;  4DXC A;  4N15 A;  2GH9 A;  1M5C A;  4Q8R A;  5I58 A;  1IMB A;  1FW0 A;  5EQ7 A;  3TDJ A;  4F29 A;  1H43 A;  2QS4 A;  3KBR A;  1S9T A;  1FPK A;  4FIM A;  1LBV A;  2ZYM A;  1ZLQ A;  4IO4 A;  5H8S A;  1IEJ A;  3LSW A;  4I9D A;  1VE4 A;  2XX9 A;  4YKK A;  3T9X B;  1B7H A;  1P1W A;  1JW1 A;  2UVH A;  1KA1 A;  1NV2 A;  3G3F A;  3B6W A;  3KFM A;  4OZ9 A;  4XKR A;  3K1M A;  2P0S A;  4ZEB A;  3I5O A;  2KQZ A;  2V84 A;  3T96 B;  3PD8 A;  4R74 A;  3EHU A;  3K6X A;  5I84 A;  3U94 A;  2DE2 A;  4PFB A;  1FPE A;  3G3J A;  4OEN A;  2A5T A;  4ECF A;  3DP6 A;  2XX7 A;  4POX A;  2ZXT A;  5A5X A;  3KN7 A;  3FAT A;  4GXA A;  3MP1 A;  1SW5 A;  2GHA A;  4XKQ A;  4EQ7 A;  1ZBM A;  2NVU B;  1LB9 A;  2FIE A;  4PFW A;  4OES A;  1B3H A;  5JTY B;  5H8Q A;  4AQ4 A;  1LAX A;  4MCO A;  4BDQ A;  1XVY A;  3IL1 B;  3S9E A;  1XT8 A;  5F1Q A;  1R9Q A;  3PV0 E;  1GTK A;  2UYF A;  4ESW A;  1LCT A;  2WBB A;  3RPL A;  3KC1 A;  1JNF A;  1SW1 A;  3E13 X;  1ZIU A;  5EQ8 A;  3OXN A;  2PT2 A;  3O97 A;  1LFH A;  4XTC Q;  3RN8 A;  4PFU A;  3Q26 A;  3RGY A;  4O94 A;  4E0W A;  4JSO A;  3MC2 A;  2FHY A;  3TUS A;  5TPA A;  3T0J A;  1NV0 A;  1B1H A;  4EUO A;  1LBC A;  1P1N A;  4OVR A;  3F11 A;  4XKN A;  4WEP A;  3THI A;  2Z8F A;  3OO6 A;  3M3K A;  2WX9 A;  1Q35 A;  4ZEK A;  4QSC A;  1A54 A;  1FQA A;  4O3B A;  2V93 A;  2X7Q A;  2XXU A;  4HXV A;  1EYK A;  4P47 A;  2NUV A;  1DPP A;  2G29 A;  4Q5T A;  3GYY A;  2RF1 A;  4N6K A;  4LA9 A;  3H6W A;  2OBG A;  4NED A;  3K4U A;  3PMW A;  4YKJ A;  3FD3 A;  2DP8 A;  4NHB A;  4OWD A;  2P1S A;  2V25 A;  2PFY A;  4PDH A;  3M3L A;  3OSQ A;  3H03 A;  4PCD A;  4BLA A;  2PMS A;  4F1V A;  5TPA B;  3CG1 A;  1BK4 A;  1FTA A;  3DLN A;  4GXS B;  2OCU A;  5KCJ A;  3N6U A;  3LC8 A;  2H98 A;  4PF8 A;  2QFL A;  2ZNT A;  3LSX A;  4GBV A;  2NXO A;  4GWX A;  3VLV A;  4NF4 B;  3R7X A;  1IME A;  1PB8 A;  3MPL A;  4NE4 A;  1LST A;  2UVI A;  4I8C A;  1MY4 A;  5ESY A;  4R72 A;  3CRB A;  2QMX A;  3SEV A;  3GBB A;  4XXU A;  3OEK A;  1AIV A;  2H25 A;  3PPP A;  4BDR A;  3VVE A;  3CIJ A;  3BKI B;  4OAN A;  4MAG A;  3TCH A;  3AXF A;  4P3L A;  1ELJ A;  5AA4 A;  5CM6 A;  1JVX A;  4ZDM A;  1EZ9 A;  1I6A A;  1OIB A;  5L8D A;  3TEL A;  2Y5L A;  3W9V A;  1EU8 A;  3DEL B;  1TFA A;  1JEV A;  1YZ0 A;  3K1P A;  1NFT A;  1LB8 A;  4QF9 A;  5LTC A;  2RKM A;  4NF0 A;  3TTN A;  1FTJ A;  1URS A;  3UP9 A;  1M5D A;  3B6T A;  5IZZ A;  3D1R A;  1MXX A;  2Q2C A;  2F36 A;  1NV7 A;  2H99 A;  2GFE A;  2A5T B;  3ROJ A;  1O7T A;  1XOC A;  3RLF E;  3OOA A;  2XWK A;  1MQJ A;  3CFX A;  4GX6 A;  4GQO A;  1B5I A;  5CBS A;  4KCD A;  1QUI A;  4GX4 A;  4FEC A;  3RNN A;  1URD A;  4KD5 A;  1MPB A;  2FYI A;  3ILT B;  3FXQ A;  2RIN A;  3D4G A;  5TP9 A;  2GRV A;  4N8Y A;  2QMW A;  2OK2 A;  2I49 A;  4H5F A;  3B50 A;  1B5H A;  3RPL B;  3L6H A;  4OER A;  5F7V A;  1Y4C A;  4HS7 A;  3SET A;  1A99 A;  3E3K A;  1LAH E;  2B65 A;  3MUQ A;  5EHS A;  5I59 B;  1M5B A;  1D9V A;  2QPQ A;  1BIY A;  1PEB A;  4O7M A;  1NUX A;  5CRY A;  3FV2 A;  4MNP A;  4HE1 A;  2O7I A;  3G3I A;  4IO2 A;  1WVJ A;  2Z8E A;  1Y20 A;  3MJN A;  1QKB A;  5EHM A;  1G0H A;  4ZEI A;  4NG7 A;  1ZTY A;  1N7W A;  2Q88 A;  2OWZ A;  2RCA A;  5ET7 A;  3H6U A;  4IO5 A;  5BUU A;  2XWI A;  3FGS A;  4XEQ A;  5LOM A;  1IMC A;  2XX8 A;  2Y84 A;  3IB0 A;  1NUW A;  1P99 A;  3TMG A;  1PB7 A;  4MBP A;  3SEX A;  2H4I A;  4H8J A;  1AMF A;  4POW A;  4X1D A;  2Z23 A;  1L5T A;  3TTM A;  1XS5 A;  1JVY A;  4NF5 B;  4ZE9 A;  3BIH A;  4F1U A;  3RYD A;  5FHO A;  1FPF A;  3SES A;  3H6V A;  2GQ1 A;  4QFN A;  1Y9U A;  2Q89 A;  5CMB A;  4OHN A;  3TOD A;  1DTZ A;  3RT6 B;  2I48 A;  2PT1 A;  3CFZ A;  4ZE8 A;  3U93 A;  3OD7 A;  4GWY A;  3KOS A;  5KDT A;  2DVZ A;  1LLS A;  4PQJ A;  4XFE A;  1KA0 A;  2DYX A;  4I62 A;  4R75 A;  4PGN A;  3RTW B;  2XXH A;  4JVC A;  2R8T A;  4OVJ A;  2QVU A;  1LBX A;  3E4R A;  2F97 A;  3U65 A;  5I5P A;  4JWX A;  2B4M A;  3IOU A;  1RDX A;  5HPQ A;  2FVZ A;  2F7A A;  4TLL B;  1B4H A;  5AA3 A;  4G68 C;  3CI8 A;  5HBC A;  4ZZA A;  4GWS A;  3ODB A;  5FHN A;  3C34 A;  3H4Z A;  4RY1 A;  1AWB A;  4P9K A;  4N07 A;  3H3G A;  1RKM A;  2VD2 A;  4KCC A;  3PUV E;  4OXV A;  2O68 A;  4MHF A;  1GV8 A;  2DOJ A;  2I4C A;  3ISP A;  1PC3 A;  3LUY A;  1S7Y A;  1I6Q A;  4GWO A;  3TPA A;  3CVG A;  1ZKB A;  4AB5 A;  5JTY A;  2CZH A;  1RYX A;  2QS1 A;  4N17 A;  2ABH A;  3DP8 A;  3EPE A;  4R6H A;  1US4 A;  3OO9 A;  4JDF A;  1FQE A;  5ET6 A;  2UXA A;  4G2Z A;  5H8H B;  3KN3 A;  2X7P A;  4WXJ A;  4FJP A;  4JXI A;  3IJX B;  1MM6 A;  1YAE A;  2HZL A;  2AYS A;  3VFJ A;  2NWJ A;  3TFL A;  2ZNS A;  5F24 A;  3QXM A;  1SD3 A;  5DVI A;  2QJE A;  1VR5 A;  1GVC A;  3S9L C;  4NF6 A;  1SPI A;  5TU0 A;  3O6I A;  4N6P A;  4PFI A;  3SEU A;  1MPC A;  1OLC A;  4H8I A;  5I57 A;  2WKY A;  3H7M A;  4PDD A;  1JW5 A;  5L9O A;  5KZT A;  2F35 A;  3PU5 A;  3V89 B;  4DE8 A;  1UIV A;  3G7W A;  3PD9 A;  1FJ6 A;  4FEB A;  3JZJ A;  4JVI A;  4YKP A;  1EZP A;  2QSX A;  2XXV A;  3M3F A;  3PTY A;  2WBD A;  5H8F A;  5I3S A;  3PGF A;  4YIC A;  4OVQ A;  2I0C A;  1MXV A;  2G93 A;  3PUW E;  1EYI A;  4FED A;  3C9H A;  3P7I A;  5HM4 B;  3FUZ A;  4H65 A;  1DTG A;  5K2X A;  4N81 A;  1LBZ A;  4U1Z A;  4ZEF A;  1P1O A;  2VHA A;  3HV1 A;  1CNQ A;  3FZV A;  4ELO A;  1D9Q A;  2B4L A;  1IIT A;  1EYJ A;  3KC0 A;  4H45 A;  5KCJ B;  1MPD A;  5FHM A;  1RDY A;  3RTF B;  4O3A A;  2P2A A;  1CE2 A;  3T22 A;  5H8H A;  2F8D A;  4DXU A;  4DCY A;  1B9J A;  4BDM A;  2QL3 A;  3CG3 A;  1DSN A;  4QFP A;  2I3V A;  4JBZ A;  1A40 A;  4L17 A;  5DVF A;  4OFO A;  1LCF A;  3FXR A;  4MH5 A;  1RDZ A;  1MQI A;  4IR8 A;  5JEI A;  1N7X A;  3B7D A;  3FIR A;  2VPO A;  3ZKL A;  4MNC A;  4YZZ A;  3KSX A;  4IGT A;  2OZZ A;  1R6Z A;  5KDT B;  2XWV A;  4LUB A;  1ATG A;  4RNS A;  3IOW A;  4QRZ A;  4GOT A;  3VE1 B;  4N13 A;  1EZO A;  3HCQ A;  1FRP A;  2BJJ X;  4TLM B;  3N6T A;  4P11 A;  1SI1 A;  1EH3 A;  3WAE A;  4H5G A;  1FQD A;  1M5E A;  1GR2 A;  4HW8 A;  4KI0 E;  1DPE A;  1MQD A;  1YYZ A;  5I56 B;  4XIG Q;  1A8F A;  2ZMB A;  4AS5 A;  3VXC A;  3MAM A;  4QXD A;  4PE5 B;  2F3B A;  3SEY A;  1LFG A;  3BBR A;  2ONR A;  1FCK A;  2F34 A;  4LON B;  3C32 A;  2DQV A;  5DYH A;  4ZEC A;  4DI3 D;  3CFL A;  1IIW A;  4HCY A;  3TYH A;  1IMD A;  3MVW A;  1JEU A;  2D5W A;  1BKA A;  4FE8 A;  3EHS A;  1R1N A;  3IO6 A;  4DDD A;  4PGP A;  4OQO A;  1MXU A;  2F78 A;  1QUK A;  5FBP A;  2F6P A;  1NV4 A;  1LBY A;  2Y7W A;  1PDA A;  4PC9 A;  5IM2 A;  1D4N A;  4U4X A;  2XXI A;  1D3K A;  2HCA A;  4X9T A;  5IZ1 A;  3OO7 A;  4YB5 A;  1B0H A;  1KZ8 A;  4MLQ A;  1NNP A;  4RPN A;  1G0I A;  5AA2 B;  4QHQ A;  1Y3N A;  2O7U A;  1O63 A;  5J1D A;  3MZ1 A;  3MP8 A;  2P3V A;  1N04 A;  4LVQ A;  5I57 B;  3MZ9 A;  2VPN A;  1URG A;  1FBE A;  4I40 A;  1HSE A;  1XC1 A;  4GF8 A;  3UK4 A;  1NV6 A;  2ZZX A;  4QFO A;  1FBF A;  1FPJ A;  1VFE A;  3QAX A;  4P1E A;  4EQ9 A;  5H8F B;  5IGA A;  4OFJ A;  3IO4 A;  3IB1 A;  5I56 A;  1JP4 A;  5AE4 A;  1NMU A;  1UTH A;  2REJ A;  5IZ3 A;  1NV3 A;  3QSL A;  2A5S A;  3VVF A;  4EQB A;  3KG2 A;  3U92 A;  2CEY A;  4TQU Q;  2O84 X;  3B6Q A;  3BIG A;  4GD5 A;  3KZG A;  1FPL A;  2V3Q A;  4KHZ E;  4Q30 B;  2OX3 A;  1VSO A;  4OEV A;  1ZU0 A;  4Z7E A;  1H3D A;  2LAO A;  1Q9D A;  3PUY E;  3IOV A;  2CMO A;  3RPW A;  4YAH X;  1NH7 A;  4EXL A;  3PUZ E;  4GFR A;  1P1U A;  5I2K A;  2OJT A;  4P0I A;  1MY1 A;  1NUZ A;  4F2Q A;  1SW2 A;  4I1D A;  1Y1M A;  1SBP A;  5EQA A;  2VOZ A;  5DT6 A;  5CMK A;  4PE3 A;  3U72 A;  4RK2 A;  4IGR A;  5AA4 B;  2Z8D A;  1YCJ A;  5J16 A;  1H76 A;  4F31 B;  4UAB A;  5ELV A;  2PCR A;  4OEU A;  2HAV A;  4DIG A;  3G3K A;  4NAP A;  4LAT A;  3FVO A;  4OYV A;  5DEX B;  1PBP A;  2QS2 A;  2REG A;  3ZS6 A;  1MDQ A;  4NWD A;  1B32 A;  4R73 A;  4G8N A;  1B3F A;  2F7C A;  4NN3 A;  1FPI A;  3IFA A;  2H9B A;  1DOT A;  1N0T A;  4G8M A;  2W7Y A;  4I3E A;  3LSL A;  1DMB A;  5L9M A;  3VLW A;  2DSF A;  3CSG A;  2B3B A;  4U2R A;  2Y7P A;  4MF3 A;  3E79 A;  4F3G A;  1QVS A;  2IA4 A;  4O8M A;  4C1T A;  1FPD A;  1H44 A;  3EF7 A;  2QRY A;  1PBQ A;  2AIX A;  2O1M A;  5FTH A;  4GWW A;  2B3F A;  4QSE A;  2CZL A;  1DK4 A;  3A09 A;  5ITO A;  4ZS9 A;  1FBC A;  4IO7 A;  2R6G E;  5I7I A;  3O9P A;  2DXR A;  3IX1 A;  4HE0 A;  3IJO B;  3FXU A;  1MXW A;  1MH4 A;  1BLF A;  2D3I A;  2D21 A;  2UYE A;  4F1Y A;  2GHB A;  4DZ1 A;  2VP1 A;  4H6D A;  4PET A;  4O3C A;  4NQ8 A;  3IAZ A;  5EQ9 A;  3R26 A;  3MVY A;  3TCF A;  1NNK A;  1OQG A;  4RXL A;  3O6G A;  4H67 A;  4YKI A;  4LN5 A;  4YU0 A;  2DWI A;  5ISU A;  5DEX A;  3TEP A;  2FA7 A;  2NOO A;  1FTK A;  4FOR A;  4QFL A;  1VFD A;  2V4C A;  1QJM A;  3S4U A;  3TTL A;  4YB7 A;  4ND9 A;  1I69 A;  3KJ7 A;  3K00 A;  2O6A A;  1MQG A;  3KJT A;  2Q2A A;  3HO7 A;  1B05 A;  3PUX E;  1AH5 A;  2WYK A;  4PFT A;  1QGX A;  4F3B A;  2ZYK A;  3DM0 A;  4H1X A;  1IZ1 A;  4GL8 A;  1FBH A;  1WOD A;  1BP5 A;  1XVX A;  4NX1 A;  4PP0 A;  1OLA A;  3IR1 A;  2UVJ A;  1Y3Q A;  4GBW A;  3N26 A;  4I3Y A;  2DVC A;  1UTB B;  5ET8 A;  4BDO A;  1LBB A;  1B3L A;  3Q28 A;  3PPR A;  4UAC A;  2XD2 A;  2ONS A;  4O7I A;  2Q8J A;  1FTL A;  4UA8 A;  4G68 A;  3FVN A;  4ESX A;  2XXR A;  3EKI A;  4NGU A;  4YB6 A;  4PTK A;  1B51 A;  1YXI A;  4P1L A;  3Q25 A;  2OWS A;  4MMP A;  3M8U A;  3LUZ A;  2DS9 A;  4R6K A;  1QKA A;  5ET5 A;  4JWY A;  1SYI A;  1SQY A;  2I0B A;  5I59 A;  1KWH A;  4KYE A;  1POY 1;  2KR0 A;  1MRP A;  3U8Q A;  2O51 A;  4WED A;  3A3U A;  4LP2 B;  1FQF A;  1IQ7 A;  3A29 A;  4NF8 B;  1DBZ A;  4JSD A;  4TOZ A;  2AL5 A;  1S50 A;  1H45 A;  3VLU A;  3OMB A;  5L9S A;  4THI A;  1VDW A;  4LQ5 A;  4N6D A;  3D4C A;  3S9N C;  1FBG A;  4ELR A;  3QUF A;  3OO8 A;  3TTK A;  4GX3 A;  4KPT A;  2Y7I A;  3VXB A;  1NNT A;  3QYT A;  1IXI A;  3GXA A;  4AB6 A;  3RQT A;  4M1V A;  2HZK A;  1A7L A;  2I4B A;  3KBZ A;  2MKZ A;  3MZB A;  4KR5 A;  1B40 A;  2XHD A;  4EF2 A;  3FVG A;  3K0V A;  4G68 B;  3FJ7 A;  3HST A;  1QW0 A;  3TCG A;  1ZJL A;  2Y7K A;  1JET A;  2XXW A;  4RYA A;  4MX6 A;  3KN8 A;  5EYG A;  3HN0 A;  4F2O A;  3PPO A;  4X48 A;  4WKM A;  3OEN A;  3MQ9 A;  4FBP A;  3HFU A;  4QFK A;  1FQB A;  3GZG A;  3QIM A;  1MQH A;  3FAS A;  1UTH B;  5DTB A;  2XXK A;  5IZ3 B;  5TP9 B;  1FTO A;  3KSJ A;  3FJG A;  3OEM A;  3UA8 A;  2ZYN A;  2O1L A;  1TT1 A;  4GWU A;  2XA5 A;  3FV1 A;  1MXZ A;  1FSA A;  1R9L A;  5H8N A;  3MBP A;  3T93 B;  3HPI A;  4YMB A;  4K3F A;  3C35 A;  4NF8 A;  3T9U A;  2WEF A;  4OMB A;  3O66 A;  4M4G A;  3UN6 A;  4MEV A;  1RYO A;  2R71 A;  3MWB A;  4F22 A;  1P1Q A;  1BTJ A;  2JJK A;  1M5F A;  3O29 A;  3T9V A;  3VVD A;  2M8C A;  4U21 A;  2X26 A;  3KEI A;  3FJM A;  3JYR A;  2I58 A;  1F9B A;  2PVU A;  3QUJ A;  3TQW A;  3W9W A;  3WAF A;  4NMY A;  4R6Y A;  3Q29 A;  4LZ5 A;  4OVT A;  3H06 B;  3O2A A;  4PF6 A;  1INP A;  3QMF A;  3UIF A;  2DDK A;  2F6G A;  4BDN A;  4RK9 A;  1N76 A;  2F5X A;  2HHM A;  2ZNU A;  1D9Y A;  4U1O A;  1B7Z A;  1FBD A;  5A5X B;  3KGC A;  1FBP A;  2Q74 A;  4P0G A;  1N3W A;  1CB6 A;  2Y7R A;  2V3T A;  5H8Q B;  1LFI A;  1B5J A;  1SVX B;  2XXT A;  4OA4 A;  4PAI A;  3T9H B;  4RPO A;  2E0S A;  3LV0 A;  1DCU A;  3IOT A;  4PAK A;  4NTL A;  4OVS A;  1MXY A;  3IFC A;  3MYU A;  4P8B A;  5CC2 A;  1JW4 A;  2XD3 A;  3RT8 A;  4DLD A;  3K6U A;  5BWJ A;  2F7B A;  1NH8 A;  1OVB A;  4G77 A;  4X04 A;  4IB2 A;  2ONK E;  5IKB A;  4OTE A;  2PFZ A;  1YPN A;  2RC7 A;  4ISU A;  3SDF A;  3N94 A;  3K01 A;  1TWY A;  3UOR A;  1AL3 A;  3LBS A;  4OET A;  4KXP A;  1B58 A;  3K02 A;  4P56 A;  4GL0 A;  4U23 A;  4LQ2 A;  2DXY A;  2R9J A;  2ANJ A;  3BFT A;  2BJI A;  3U1O A;  3E78 A;  2HAU A;  2V3U A;  1B3G A;  1US5 A;  1FPB A;  1NV1 A;  1LAG E;  2L5V A;  4R9F A;  1MH3 A;  5ITP A;  1B6H A;  3MP6 A;  1FPG A;  2RC9 A;  3OSR A;  3UGW A;  5CBR A;  1MS7 A;  2Z22 A;  3GBA A;  1Q1K A;  3I6V A;  3SEW A;  2DWA A;  3BFU A;  2DE4 A;  4F19 A;  4RJZ A;  2CZI A;  3CHG A;  3Q27 A;  1SDX A;  5ICT A;  1NL5 A;  1MY2 A;  4PBH A;  2THI A;  2PBW A;  5H8N B;  3A3C A;  3N5L A;  4MJO A;  1N84 A;  1B1X A;  3G3H A;  4NF6 B;  3ONM A;  4KQP A;  1HSJ A;  1QUJ A;  1NNF A;  3C4M A;  4ZZE A;  4Q0C A;  1UIU A;  4N91 A;  2YPN A;  1XI6 A;  2I6E A;  1TFD A;  2VD3 A;  4FAJ A;  3B8B A;  3ECR A;  3O28 A;  3EQ1 A;  3VV5 A;  5DVJ A;  3MPK A;  3C31 A;  3LSF B;  5B70 A;  2E1S A;  1SI0 A;  4IO3 A;  4MFI A;  2CEX A;  3IOR A;  4R9G A;  3O6H A;  2HPG A;  3S9M C;  4E0X A;  1LGB C;  2WYP A;  4GIZ A;  1T0K A;  2O69 A;  3C33 A;  4IY6 A;  1FTM A;  2UVG A;  4GLI A;  1OQH A;  1MG1 A;  3TTR A;  4BDL A;  1YTV A;  2Q9T A;  4XKP A;  3PMX A;  4KYS A;  3S2V A;  4MNI A;  2HFB A;  4OFL A;  4HCW A;  4DXB A;  2HXW A;  1IXG A;  5AA2 D;  4X8R A;  1B7U A;  1USY H;  2ZYO A;  3HHF A;  2PYY A;  5I2N B;  3TKD A;  3MVX A;  1J1N A;  1PB9 A;  4EDP A;  2HEU A;  4GVO A;  4MLV A;  1MDP 1;  1AOV A;  3V5A A;  4F3S A;  3IK6 B;  3K1N A;  1IMA A;  4N8G A;  2Y5K A;  4EF1 A;  2Q8M A;  3E9X A;  1B4Z A;  3CSB A;  4NWC A;  2DWJ A;  4H46 A;  4DI4 B;  4FAT A;  5B7D A;  1QUL A;  4KYD A;  3RUM A;  3K2D A;  1LAF E;  4IO6 A;  3HHG A;  1IXC A;  2IEE A;  3GLB A;  5ICQ A;  3VDF A;  4F3P A;  1IMF A;  3SER A;  3PPQ A;  2RCB A;  1JQF A;  4JWO A;  1TXF A;  5I2N A;  2KLF A;  3PMV A;  3TQL A;  1Z7M E;  4RA1 A;  5K2Y A;  1SW4 A;  1A8E A;  2I3W A;  1K9Y A;  1UQW A;  3L6G A;  4JVD A;  5EYH A;  4NF5 A;  3TZA A;  1IXH A;  2DWH A;  1Y3P A;  3V83 A;  3FBP A;  3TAJ A;  3FVK A;  1O64 A;  4ELQ A;  4PFR A;  4MIJ A;  2XWO A;  1B3E A;  1B0L A;  2ESN A;  3DP4 A;  1NV5 A;  3T1B A;  1UTB A;  4G8H A;  4PAF A;  4JB7 A;  1USY E;  2XXQ A;  5JK4 A;  4R2F A;  2QVR A;  4GRK A;  5DW8 A;  1K9Z A;  3QK6 A;  1B46 A;  4XF5 A;  3K6V A;  4EXK A;  3ILU B;  1NKX A;  4G4P A;  2YJP A;  3FXB A;  1MY0 A;  3SZP A;  1B52 A;  4ELP A;  4ZED A;  4C1U A;  4HE2 A;  2FNC A;  3MST A;  1Y1Z A;  2VT5 A;  4PFY A;  4OVP A;  3JV9 A;  1ZMG A;  5CMM A;  3H6T A;  3C36 A;  1XHY A;  2FIX A;  1MM7 A;  2OLB A;  3T66 A;  3EN3 A;  2CZK A;  3W15 C;  4QSD A;  1POT A;  1MY3 A;  5T3J A;  2FBP A;  5LDZ A;  4IY5 A;  3USD A;  1GGG A;  5I58 B;  3MVZ A;  4PBQ A;  3ZSF A;  1Y4T A;  1OVT A;  3NOH A;  2XXP A;  4Z0I A;  3V8X B;  2HXR A;  4LZ8 A;  3PPN A;  3RY3 A;  3ZKK A;  4U4S A;  1N3X A;  3LR1 A;  3I3V A;  2F3D A;  3EHT A;  4AS4 A;  2PX1 A;  1Z7N E;  4G61 A;  1LBW A;  3K6W A;  5CI5 A;  5FTI A;  1LEV A;  5IAI A;  2VGQ A;  2P3N A;  4GWZ A;  2AL4 A;  2XXY A;  4ONY A;  1II5 A;  3KOT A;  1I6B A;  2ZZW A;  2H5Y A;  4N4U A;  4X1B A;  5I2K B;  1IUD A;  4R2B A;  5AA1 A;  1SYH A;  5EYF A;  1NI9 A;  5M2V A;  4DCX A;  1A55 A;  2QS3 A;  1FQC A;  2ZZV A;  4HTG A;  4KFQ A;  2DE3 A;  3CR9 A;  4QBA A;  1WDN A;  1B2H A;  4F39 A;  1HSL A;  3MW0 A;  3SKP A;  2XXX A;  3R6U A;  1ANF A;  5CMC A; 
#chains in the Genus database with same CATH homology
 4I62 A;  4YMA A;  4R75 A;  1B3F A;  2F7C A;  4H0W A;  4NF4 A;  2RC8 A;  3RTW B;  3IB2 A;  2ALU A;  1DOT A;  2H9B A;  2XXH A;  3K6U A;  4OVJ A;  1N0T A;  3E4R A;  2F97 A;  4F18 A;  1OMP A;  2YLN A;  4G8M A;  2W7Y A;  3G3G A;  3LSL A;  2OWT A;  5BWJ A;  1DMB A;  2F7B A;  5L9M A;  3OEL A;  4JWX A;  5AA2 A;  3VLW A;  1NH8 A;  3IOU A;  2DSF A;  1OVB A;  2B3B A;  3CSG A;  4G77 A;  4IB2 A;  4U2R A;  2Y7P A;  4MF3 A;  4F3G A;  4U22 A;  2ONK E;  1QVS A;  5HPQ A;  2IA4 A;  2F7A A;  4C1T A;  4LZ7 A;  5IKB A;  4TLL B;  4C0R A;  1H44 A;  1B4H A;  4OTE A;  2HQ0 A;  5AA3 A;  4DXC A;  3EF7 A;  2QRY A;  4G68 C;  1PBQ A;  2GH9 A;  1M5C A;  3CI8 A;  4Q8R A;  5HBC A;  5I58 A;  2AIX A;  4ZZA A;  1FW0 A;  3TDJ A;  2O1M A;  1YPN A;  2RC7 A;  3C34 A;  3ODB A;  1H43 A;  5FHN A;  5FTH A;  4F29 A;  2QS4 A;  4ISU A;  3SDF A;  2B3F A;  3H4Z A;  4RY1 A;  4QSE A;  4F2O A;  3KBR A;  1S9T A;  2CZL A;  4N07 A;  3H3G A;  3N94 A;  4FIM A;  1RKM A;  2VD2 A;  4KCC A;  3PUV E;  4OXV A;  2O68 A;  1GV8 A;  2ZYM A;  2DOJ A;  1ZLQ A;  3K01 A;  2I4C A;  3A09 A;  5ITO A;  4IO4 A;  5H8S A;  1TWY A;  4ZS9 A;  1PC3 A;  1IEJ A;  1S7Y A;  3LSW A;  1I6Q A;  3LUY A;  1AL3 A;  3LBS A;  4GWO A;  3UOR A;  4I9D A;  1VE4 A;  2XX9 A;  4IO7 A;  2R6G E;  4YKK A;  3CVG A;  1ZKB A;  3T9X B;  3TPA A;  1B7H A;  4AB5 A;  4OET A;  1B58 A;  3K02 A;  1P1W A;  5JTY A;  4GL0 A;  3O9P A;  1RYX A;  2DXR A;  2QS1 A;  1JW1 A;  4U23 A;  4LQ2 A;  2ABH A;  2DXY A;  3DP8 A;  2UVH A;  3EPE A;  2R9J A;  3IX1 A;  4R6H A;  2ANJ A;  3G3F A;  3B6W A;  1US4 A;  3KFM A;  3BFT A;  3IJO B;  3OO9 A;  4OZ9 A;  4XKR A;  3K1M A;  2P0S A;  3FXU A;  3U1O A;  1MXW A;  1MH4 A;  1FQE A;  4JDF A;  1BLF A;  2D3I A;  4ZEB A;  2D21 A;  2UXA A;  3I5O A;  2UYE A;  4G2Z A;  2V84 A;  3T96 B;  4F1Y A;  5H8H B;  3KN3 A;  2GHB A;  4DZ1 A;  2VP1 A;  4H6D A;  3PD8 A;  4R74 A;  2X7P A;  2HAU A;  4PET A;  2V3U A;  4WXJ A;  4FJP A;  3EHU A;  4JXI A;  3K6X A;  1B3G A;  3IJX B;  1MM6 A;  1YAE A;  2HZL A;  4O3C A;  3IAZ A;  1US5 A;  5I84 A;  2AYS A;  3R26 A;  3VFJ A;  3U94 A;  2NWJ A;  2DE2 A;  3TFL A;  1LAG E;  3MVY A;  2ZNS A;  3TCF A;  4R9F A;  1NNK A;  3G3J A;  4OEN A;  2A5T A;  1MH3 A;  4ECF A;  5ITP A;  3QXM A;  1B6H A;  1OQG A;  3O6G A;  4H67 A;  3DP6 A;  4RXL A;  4YKI A;  3MP6 A;  1SD3 A;  5DVI A;  2XX7 A;  4POX A;  2ZXT A;  2RC9 A;  2QJE A;  1VR5 A;  4YU0 A;  1GVC A;  3OSR A;  3KN7 A;  3FAT A;  5A5X A;  4GXA A;  2DWI A;  1SW5 A;  3MP1 A;  4NF6 A;  3UGW A;  5CBR A;  2GHA A;  4XKQ A;  5TU0 A;  5ISU A;  4EQ7 A;  1ZBM A;  5DEX A;  3O6I A;  2NVU B;  3TEP A;  1MS7 A;  1LB9 A;  2Z22 A;  2FA7 A;  1Q1K A;  3GBA A;  3I6V A;  4N6P A;  3SEU A;  3SEW A;  1MPC A;  2DWA A;  3BFU A;  2DE4 A;  2NOO A;  1FTK A;  1OLC A;  4H8I A;  4OES A;  4PFW A;  4F19 A;  1B3H A;  4RJZ A;  4FOR A;  5JTY B;  5I57 A;  4QFL A;  1VFD A;  5H8Q A;  2WKY A;  1QJM A;  4AQ4 A;  3H7M A;  3S4U A;  1LAX A;  1SDX A;  3Q27 A;  4BDQ A;  1JW5 A;  1XVY A;  3IL1 B;  3TTL A;  5ICT A;  3S9E A;  5L9O A;  1XT8 A;  1NL5 A;  4YB7 A;  5F1Q A;  5KZT A;  1MY2 A;  2F35 A;  1R9Q A;  1I69 A;  4ND9 A;  3PV0 E;  2THI A;  2PBW A;  3PU5 A;  5H8N B;  1GTK A;  3KJ7 A;  3V89 B;  4DE8 A;  1UIV A;  3A3C A;  2UYF A;  3G7W A;  3K00 A;  3PD9 A;  4FEB A;  3JZJ A;  4DXU A;  3N5L A;  4ESW A;  4YKP A;  1N84 A;  1B1X A;  3G3H A;  4NF6 B;  3UP9 A;  1LCT A;  1MQG A;  2O6A A;  1EZP A;  2QSX A;  3KJT A;  2XXV A;  3ONM A;  3M3F A;  2Q2A A;  1HSJ A;  1JNF A;  3HO7 A;  1B05 A;  4KQP A;  1SW1 A;  1QUJ A;  5H8F A;  3PUX E;  1NNF A;  3C4M A;  3E13 X;  4ZZE A;  4Q0C A;  1UIU A;  1ZIU A;  3PGF A;  2YPN A;  4YIC A;  1AH5 A;  3OXN A;  2I6E A;  2PT2 A;  4PFT A;  2I0C A;  1TFD A;  2VD3 A;  4F3B A;  2ZYK A;  1MXV A;  2G93 A;  3PUW E;  3O97 A;  4FED A;  3DM0 A;  3C9H A;  1LFH A;  4FAJ A;  3P7I A;  4XTC Q;  3RN8 A;  3FUZ A;  5HM4 B;  3ECR A;  3O28 A;  1IZ1 A;  4GL8 A;  4H1X A;  4PFU A;  3Q26 A;  3RGY A;  4H65 A;  1WOD A;  3EQ1 A;  3VV5 A;  1DTG A;  5K2X A;  1BP5 A;  4E0W A;  5DVJ A;  4U1Z A;  1XVX A;  3MPK A;  3MC2 A;  4JSO A;  3C31 A;  3LSF B;  4PP0 A;  5B70 A;  4ZEF A;  1OLA A;  1P1O A;  2E1S A;  2UVJ A;  1SI0 A;  2VHA A;  3HV1 A;  3IR1 A;  3TUS A;  1Y3Q A;  5TPA A;  1B1H A;  3FZV A;  4EUO A;  1LBC A;  1P1N A;  4ELO A;  3N26 A;  3F11 A;  4XKN A;  4IO3 A;  4MFI A;  4WEP A;  3IOR A;  3THI A;  2Z8F A;  2DVC A;  3OO6 A;  1UTB B;  3M3K A;  4R9G A;  4BDO A;  1LBB A;  1B3L A;  3O6H A;  1IIT A;  1Q35 A;  3Q28 A;  3PPR A;  5KCJ B;  1MPD A;  4UAC A;  4QSC A;  1A54 A;  2XD2 A;  5FHM A;  2ONS A;  4ZEK A;  3RTF B;  1FQA A;  4O3A A;  2P2A A;  4O3B A;  3S9M C;  4E0X A;  1CE2 A;  2Q8J A;  1FTL A;  1LGB C;  2V93 A;  2X7Q A;  2XXU A;  4G68 A;  4GIZ A;  4UA8 A;  3T22 A;  5H8H A;  2F8D A;  3FVN A;  4DCY A;  2O69 A;  1B9J A;  2NUV A;  3C33 A;  1FTM A;  2QL3 A;  2UVG A;  4IY6 A;  4BDM A;  4GLI A;  3CG3 A;  1DSN A;  1OQH A;  1MG1 A;  2XXR A;  4ESX A;  4QFP A;  1DPP A;  2G29 A;  2I3V A;  3TTR A;  4Q5T A;  4BDL A;  1YTV A;  2Q9T A;  4YB6 A;  1B51 A;  3PMX A;  4XKP A;  2RF1 A;  4LA9 A;  4JBZ A;  1A40 A;  3H6W A;  3Q25 A;  4KYS A;  3S2V A;  2OBG A;  2HFB A;  4NED A;  3K4U A;  3PMW A;  4OFL A;  4HCW A;  4L17 A;  5DVF A;  4DXB A;  2OWS A;  3FD3 A;  1LCF A;  4OFO A;  3M8U A;  3FXR A;  4YKJ A;  2DP8 A;  2DS9 A;  4OWD A;  4MH5 A;  4R6K A;  1QKA A;  2P1S A;  2V25 A;  2HXW A;  1IXG A;  5AA2 D;  1MQI A;  4JWY A;  1B7U A;  1USY H;  2ZYO A;  3HHF A;  3M3L A;  2PYY A;  3OSQ A;  5I2N B;  5JEI A;  3H03 A;  1N7X A;  3B7D A;  3FIR A;  1SYI A;  3TKD A;  4BLA A;  1SQY A;  3ZKL A;  2PMS A;  2I0B A;  3MVX A;  4YZZ A;  1J1N A;  1PB9 A;  4EDP A;  4F1V A;  3KSX A;  5TPA B;  2HEU A;  4IGT A;  5I59 A;  1KWH A;  2OZZ A;  1POY 1;  3CG1 A;  4GVO A;  4KYE A;  4MLV A;  1R6Z A;  1MRP A;  1MDP 1;  3DLN A;  3U8Q A;  4GXS B;  2OCU A;  2O51 A;  1ATG A;  4LUB A;  4RNS A;  3V5A A;  4F3S A;  1AOV A;  3IOW A;  3IK6 B;  5KCJ A;  4QRZ A;  4GOT A;  4WED A;  3VE1 B;  3K1N A;  4N13 A;  1EZO A;  3N6U A;  3A3U A;  3LC8 A;  2H98 A;  3HCQ A;  4LP2 B;  4EF1 A;  1FQF A;  2ZNT A;  3LSX A;  1IQ7 A;  3E9X A;  1B4Z A;  2NXO A;  3VLV A;  4NF4 B;  3R7X A;  4NF8 B;  4JSD A;  2BJJ X;  3CSB A;  4TOZ A;  4NWC A;  4TLM B;  3N6T A;  4P11 A;  1SI1 A;  1PB8 A;  2DWJ A;  1EH3 A;  3WAE A;  2AL5 A;  1S50 A;  1H45 A;  3MPL A;  4H5G A;  1FQD A;  3VLU A;  3OMB A;  4NE4 A;  1LST A;  2UVI A;  1M5E A;  1GR2 A;  1MY4 A;  1QUL A;  4I8C A;  4KYD A;  4FAT A;  4HW8 A;  5B7D A;  5L9S A;  4R72 A;  4THI A;  3RUM A;  3CRB A;  2QMX A;  3K2D A;  4LQ5 A;  4KI0 E;  3D4C A;  1DPE A;  3SEV A;  3S9N C;  1MQD A;  1LAF E;  4ELR A;  4IO6 A;  3HHG A;  5I56 B;  3GBB A;  3QUF A;  3OO8 A;  4XIG Q;  1IXC A;  1A8F A;  2IEE A;  3GLB A;  3OEK A;  4XXU A;  3TTK A;  3VDF A;  2ZMB A;  4F3P A;  3VXC A;  5ICQ A;  3MAM A;  4PE5 B;  3SEY A;  1LFG A;  3BBR A;  3SER A;  4KPT A;  2Y7I A;  3PPQ A;  3VXB A;  1AIV A;  2H25 A;  3PPP A;  4BDR A;  1NNT A;  3VVE A;  3QYT A;  1IXI A;  2RCB A;  1JQF A;  2ONR A;  1FCK A;  3CIJ A;  3BKI B;  3GXA A;  4JWO A;  4AB6 A;  3RQT A;  2F34 A;  1TXF A;  5I2N A;  2KLF A;  3PMV A;  3TQL A;  1Z7M E;  4RA1 A;  4LON B;  4M1V A;  3C32 A;  5K2Y A;  1SW4 A;  2HZK A;  1A8E A;  2DQV A;  2I3W A;  3TCH A;  1A7L A;  5DYH A;  4ZEC A;  2I4B A;  3AXF A;  3CFL A;  1ELJ A;  1UQW A;  3L6G A;  5AA4 A;  5CM6 A;  1IIW A;  4HCY A;  4NF5 A;  3TZA A;  1JVX A;  4ZDM A;  3MZB A;  3TYH A;  1EZ9 A;  1I6A A;  1IXH A;  1OIB A;  2DWH A;  4KR5 A;  1Y3P A;  1B40 A;  5L8D A;  3TEL A;  3W9V A;  3MVW A;  2XHD A;  3V83 A;  4EF2 A;  1JEU A;  2D5W A;  3FVG A;  3K0V A;  4G68 B;  1BKA A;  4FE8 A;  3TAJ A;  3EHS A;  1R1N A;  3FVK A;  3FJ7 A;  1EU8 A;  3HST A;  3IO6 A;  1O64 A;  3DEL B;  1QW0 A;  1TFA A;  4ELQ A;  3TCG A;  4DDD A;  1ZJL A;  1JEV A;  3K1P A;  1NFT A;  1LB8 A;  1B3E A;  4QF9 A;  2Y7K A;  1B0L A;  1JET A;  1MXU A;  2ESN A;  4OQO A;  3DP4 A;  2F78 A;  2XXW A;  1QUK A;  2RKM A;  4RYA A;  2F6P A;  3KN8 A;  1UTB A;  4G8H A;  3TTN A;  2Y7W A;  3HN0 A;  1PDA A;  1FTJ A;  1URS A;  1D4N A;  4JB7 A;  3PPO A;  1USY E;  2XXQ A;  4U4X A;  2XXI A;  4R2F A;  4X48 A;  4WKM A;  5JK4 A;  1M5D A;  1D3K A;  3OEN A;  3MQ9 A;  3B6T A;  4GRK A;  4QFK A;  1MXX A;  1FQB A;  2HCA A;  2Q2C A;  3GZG A;  2F36 A;  2H99 A;  1MQH A;  3OO7 A;  3QIM A;  4X9T A;  4YB5 A;  2GFE A;  2A5T B;  3FAS A;  1UTH B;  1B0H A;  1O7T A;  1XOC A;  3QK6 A;  4MLQ A;  3OOA A;  5DTB A;  3RLF E;  5TP9 B;  1B46 A;  1FTO A;  1NNP A;  4RPN A;  1MQJ A;  3CFX A;  3K6V A;  3ILU B;  4EXK A;  1NKX A;  4G4P A;  2YJP A;  1Y3N A;  4QHQ A;  5AA2 B;  2O7U A;  4GQO A;  1MY0 A;  1B52 A;  1B5I A;  3KSJ A;  3FJG A;  4ELP A;  4ZED A;  3OEM A;  5CBS A;  3UA8 A;  1O63 A;  2ZYN A;  5J1D A;  3MZ1 A;  4C1U A;  2O1L A;  1TT1 A;  3MP8 A;  2FNC A;  4KCD A;  1N04 A;  1QUI A;  3FV1 A;  1Y1Z A;  4FEC A;  3RNN A;  1URD A;  1MXZ A;  4LVQ A;  4PFY A;  3MZ9 A;  5I57 B;  4KD5 A;  1MPB A;  1R9L A;  2FYI A;  5H8N A;  3ILT B;  3FXQ A;  1URG A;  2RIN A;  3MBP A;  3JV9 A;  3T93 B;  1ZMG A;  3HPI A;  4YMB A;  1HSE A;  1XC1 A;  3D4G A;  5CMM A;  4GF8 A;  3H6T A;  5TP9 A;  2GRV A;  4K3F A;  3C36 A;  3UK4 A;  1XHY A;  3C35 A;  4NF8 A;  3T9U A;  1MM7 A;  2OLB A;  3T66 A;  4OMB A;  3EN3 A;  3O66 A;  4M4G A;  4QFO A;  2QMW A;  2OK2 A;  2I49 A;  4H5F A;  3UN6 A;  1B5H A;  1RYO A;  1VFE A;  3L6H A;  3QAX A;  4OER A;  3W15 C;  2R71 A;  3MWB A;  4QSD A;  1POT A;  4EQ9 A;  1MY3 A;  5F7V A;  5H8F B;  4F22 A;  1P1Q A;  1Y4C A;  4HS7 A;  4OFJ A;  3SET A;  1A99 A;  3E3K A;  1LAH E;  2B65 A;  1BTJ A;  3IB1 A;  3IO4 A;  1M5F A;  3MUQ A;  4IY5 A;  5EHS A;  5I59 B;  5I56 A;  1M5B A;  3O29 A;  3T9V A;  3USD A;  1D9V A;  2M8C A;  3VVD A;  2QPQ A;  1BIY A;  1PEB A;  5AE4 A;  1T0K A;  4U21 A;  1NMU A;  2X26 A;  5CRY A;  3FV2 A;  1UTH A;  2REJ A;  3KEI A;  1GGG A;  3S9L C;  2O7I A;  2A5S A;  3QSL A;  3VVF A;  5I58 B;  3G3I A;  4EQB A;  4IO2 A;  3FJM A;  1WVJ A;  3JYR A;  3KG2 A;  3MVZ A;  4TQU Q;  3U92 A;  2O84 X;  3B6Q A;  4GD5 A;  2Z8E A;  3KZG A;  2V3Q A;  2I58 A;  3ZSF A;  1F9B A;  1OVT A;  1Y20 A;  1QKB A;  1Y4T A;  3MJN A;  2PVU A;  2XXP A;  4KHZ E;  4Q30 B;  5EHM A;  4Z0I A;  3V8X B;  4ZEI A;  1VSO A;  3QUJ A;  4LZ8 A;  3TQW A;  4OEV A;  3W9W A;  1ZU0 A;  3WAF A;  4Z7E A;  1ZTY A;  1N7W A;  2Q88 A;  4NMY A;  3PPN A;  1H3D A;  4R6Y A;  2LAO A;  3RY3 A;  2RCA A;  3PUY E;  3IOV A;  3Q29 A;  3H6U A;  3ZKK A;  2CMO A;  4IO5 A;  5BUU A;  3FGS A;  4LZ5 A;  4U4S A;  3RPW A;  5LOM A;  2XX8 A;  3H06 B;  3O2A A;  4YAH X;  2Y84 A;  3IB0 A;  1N3X A;  1NH7 A;  3UIF A;  3LR1 A;  3PUZ E;  4EXL A;  4GFR A;  1P99 A;  1P1U A;  3TMG A;  1PB7 A;  2F6G A;  3I3V A;  4MBP A;  5I2K A;  4BDN A;  3EHT A;  2OJT A;  4P0I A;  3SEX A;  1MY1 A;  2H4I A;  4RK9 A;  1N76 A;  2F5X A;  4F2Q A;  1SW2 A;  4I1D A;  2ZNU A;  2PX1 A;  1D9Y A;  1Z7N E;  1B7Z A;  1Y1M A;  4U1O A;  1SBP A;  4H8J A;  1AMF A;  2VOZ A;  4POW A;  5FTI A;  3K6W A;  4X1D A;  5CI5 A;  5A5X B;  2Z23 A;  5DT6 A;  1L5T A;  3TTM A;  3KGC A;  5CMK A;  5IAI A;  2VGQ A;  3U72 A;  4RK2 A;  1XS5 A;  4P0G A;  1JVY A;  1N3W A;  2AL4 A;  4IGR A;  5AA4 B;  2Z8D A;  1YCJ A;  4NF5 B;  4ZE9 A;  1CB6 A;  2XXY A;  2Y7R A;  4ONY A;  1II5 A;  2V3T A;  3KOT A;  4F1U A;  1I6B A;  5H8Q B;  2H5Y A;  5FHO A;  1H76 A;  4X1B A;  3SES A;  3H6V A;  5I2K B;  1IUD A;  4R2B A;  5AA1 A;  1LFI A;  1SYH A;  4F31 B;  5ELV A;  1B5J A;  4QFN A;  1Y9U A;  5EYF A;  1SVX B;  2XXT A;  4OEU A;  3T9H B;  2Q89 A;  2HAV A;  4RPO A;  3G3K A;  5CMB A;  4DIG A;  4OHN A;  3TOD A;  1DTZ A;  2E0S A;  5M2V A;  3RT6 B;  4LAT A;  2I48 A;  2PT1 A;  1A55 A;  3CFZ A;  4DCX A;  2QS3 A;  3IOT A;  1FQC A;  3FVO A;  4HTG A;  4OYV A;  4ZE8 A;  3U93 A;  5DEX B;  1PBP A;  3OD7 A;  4KFQ A;  5KDT B;  2QS2 A;  4NTL A;  2DE3 A;  2REG A;  3KOS A;  5KDT A;  2DVZ A;  1LLS A;  3ZS6 A;  1MDQ A;  1MXY A;  3CR9 A;  4NWD A;  1WDN A;  1B32 A;  1B2H A;  4PQJ A;  1HSL A;  4F39 A;  5CC2 A;  3MW0 A;  3SKP A;  1JW4 A;  2XXX A;  3R6U A;  4R73 A;  2DYX A;  1ANF A;  2XD3 A;  3RT8 A;  5CMC A;  4DLD A;  4G8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...