1B1XA

Structure of diferric mare lactoferrin at 2.62a resolution
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-dimensional structure of mare diferric lactoferrin at 2.6 A resolution.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords LACTOFERRIN
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA03
1AH5A 1O7TA 5H8QB 3H4ZA 1LAXA 3L6GA 4GD5A 2PBWA 4R9GA 5HPQA 1SW4A 3VLWA 3BBRA 4MLQA 4EQ7A 3PGFA 4EXLA 3IB2A 5JK4A 1P99A 1ZMGA 1A8FA 1YAEA 1A54A 5EYFA 4YB5A 4BLAA 2QS4A 4YMBA 2XD3A 4TLLB 5FHNA 3TTRA 2I4BA 1R6ZA 3OO9A 3K02A 4AB5A 3MVZA 4NEDA 3RT6B 4Q8RA 1QULA 1F9BA 1IXIA 3L6HA 4QSDA 4OWDA 4WEDA 1M5FA 5FHMA 3TPAA 2DXYA 1B3LA 1LFHA 2O1LA 2DS9A 4YKJA 4EDPA 2Q2AA 3LUYA 3TEPA 5I58A 1XHYA 2F78A 1IXCA 2QJEA 2XXUA 3MZ9A 1FQAA 2WKYA 4H6DA 4I8CA 1MH4A 1MQJA 3IOTA 4JSDA 4M4GA 4R2BA 4DXBA 5B70A 5L9SA 4PFTA 3CG1A 2KLFA 2PMSA 4QFLA 1MDP1 4M1VA 4PQJA 1PBQA 2F5XA 2F7BA 4U4XA 4XIGQ 5HBCA 3VE1B 4DE8A 4FECA 1FTKA 3HCQA 3SEVA 1O63A 3CRBA 4H8JA 2OLBA 5DEXA 1DTZA 3O6IA 3FIRA 4IGTA 1IXGA 3GZGA 3D4CA 4IO7A 5I59A 2Q2CA 1GVCA 4LZ5A 4F1UA 3CG3A 3S2VA 2YLNA 3T22A 3MPLA 3DP4A 1MQHA 2Q89A 1R9QA 1Y1ZA 2XXIA 3MW0A 1B9JA 3T9UA 4BDQA 3DELB 3CVGA 3UK4A 4L17A 3ODBA 4KYEA 3E9XA 4WEPA 1ZBMA 1VFEA 2F7CA 4F2OA 2DVZA 4ELOA 3GXAA 1DMBA 1SW1A 4HS7A 2R9JA 3GLBA 1XOCA 4OMBA 3R7XA 4LQ2A 2QMXA 2XXYA 4F3PA 3CFLA 1UTHB 3CSGA 3G7WA 4POWA 1FCKA 2H98A 3C31A 1QKBA 1B51A 1HSLA 1MQGA 3EHSA 5H8FA 1AOVA 1B0LA 1LAFE 2I49A 1XVYA 4R72A 3H6UA 4R75A 3R26A 1EZPA 3IL1B 2RC7A 3FXRA 2F34A 2PX1A 2Q9TA 3PU5A 3PUWE 2XXXA 1FW0A 5L8DA 3MVWA 1MXWA 3MUQA 3PPRA 1B58A 2DSFA 4DZ1A 4GFRA 3T9HB 4U21A 2NWJA 2ZYKA 2PT2A 2VD3A 2F7AA 3IOVA 1PC3A 4YB7A 1MS7A 3CFZA 4KR5A 4NF6A 4ZZAA 4QFOA 1UTBA 1TFDA 1P1QA 3RLFE 4C1UA 1I69A 2V84A 2X7QA 3U92A 1T0KA 4QFPA 5AA4B 1DPEA 3O6GA 1DOTA 1M5BA 4R73A 2CMOA 3OO7A 4G68A 1LAGE 3OSRA 4HCWA 1JVYA 1OLCA 4YAHX 2Q88A 4O3CA 3S9MC 3M3LA 3BFUA 1MQDA 4I62A 4IO3A 1IIWA 4LZ7A 4IO6A 1I6BA 3LSWA 1B4ZA 4BDNA 4XKQA 1SBPA 3V89B 4LUBA 1S9TA 1L5TA 4H5FA 5ICQA 2ZMBA 1PBPA 2D3IA 3VVDA 1MG1A 3QXMA 3C9HA 1XT8A 2P0SA 3OMBA 1B0HA 4DIGA 5AA2B 5CMKA 5ISUA 3QUJA 4OESA 1FTJA 3C34A 3KJTA 4F3GA 1N84A 5K2YA 4IGRA 3LC8A 1ZTYA 3TKDA 2HFBA 5L9OA 3PUVE 5J1DA 1PDAA 4IO5A 4GL0A 1MRPA 4G2ZA 3G3KA 4G4PA 4ELRA 3OELA 1MPCA 3EF7A 1MXYA 1CB6A 2UYFA 3PD8A 3LSLA 2O51A 2P2AA 4O3BA 3TQWA 4EXKA 4H65A 1R1NA 2O7UA 1M5CA 1UIUA 3IK6B 3PUYE 4FEBA 4JXIA 3RNNA 3VDFA 2OCUA 3T93B 5FHOA 4I9DA 1NNKA 3KGCA 3KOTA 5AA2A 1B5IA 1P1NA 4XKNA 1MXUA 4TQUQ 5A5XB 4DLDA 4Z0IA 2V3QA 2Z8EA 1SDXA 2NXOA 3G3GA 1UTBB 3MP8A 3OEMA 4NF5A 3G3FA 4PP0A 3MQ9A 3V83A 1LB8A 2XXTA 3DLNA 1JEUA 3V5AA 2H4IA 1RYXA 1H76A 2NVUB 3TFLA 4E0WA 3IORA 4BDLA 1ZLQA 2F6GA 3M3KA 1B40A 5I56A 3A09A 2RKMA 2V25A 4PFWA 4H8IA 5CMBA 3OO8A 3H6WA 1URSA 3B6QA 3VLUA 4X9TA 3OXNA 2O7IA 4O3AA 1QVSA 2O84X 3BKIB 1P1UA 3KOSA 1LCFA 4NF4A 4PE5B 3O29A 4U1ZA 5TU0A 2QS1A 4ZEFA 2V3TA 3TQLA 5KDTB 2G93A 1MPDA 1TWYA 1UQWA 2F97A 3HHGA 1SW5A 5DVIA 4EF1A 2A5TA 4HTGA 2FA7A 1B32A 1IQ7A 3K0VA 3O2AA 3MBPA 4I1DA 4KI0E 2ZNSA 4R74A 2FNCA 3FASA 4NTLA 5DYHA 3MAMA 2I58A 4C1TA 1GR2A 1ANFA 5HM4B 4ZS9A 4QRZA 2A5TB 3KZGA 4F1YA 4F1VA 4RJZA 5TPAA 1MH3A 2XD2A 1J1NA 1NNPA 3PPQA 4ESXA 2F36A 1D4NA 1NL5A 2HZLA 1MQIA 4EQBA 2H5YA 3I3VA 2I3VA 1LGBC 3FATA 3H7MA 3N6UA 1N7WA 3PV0E 2QS2A 4IY5A 4OXVA 5KZTA 3CIJA 1PB7A 1ZJLA 3TAJA 2LAOA 4OEVA 5H8NB 3H3GA 1PB9A 1QUKA 1VE4A 2DWJA 1P1WA 3GBBA 1B46A 1Y9UA 2OWTA 3TCGA 2YPNA 2DE2A 5DVFA 4OQOA 4FAJA 4RPNA 4ZEDA 1NNTA 3KG2A 2UXAA 3ONMA 2DWIA 4P11A 5L9MA 3V8XB 4EF2A 5FTIA 2V3UA 3N5LA 2XXVA 2DE3A 1JQFA 2E1SA 1AMFA 2UVIA 4YICA 1SD3A 3PUZE 4NF6B 2QL3A 3ILUB 3CSBA 5TPAB 1LB9A 3IOWA 3G3IA 3IR1A 2DYXA 4G68C 1Q35A 4ZECA 4F39A 1IITA 3FJGA 1PB8A 2F6PA 1MM7A 2VP1A 3OSQA 3P7IA 4GXSB 4MF3A 3S4UA 3VVEA 5I58B 3FVGA 2IEEA 2DWAA 3LR1A 4KCDA 5AA3A 3SEYA 5DVJA 3B7DA 3B6TA 1RKMA 3LBSA 4H0WA 3I5OA 4XTCQ 1YPNA 5H8HA 5I59B 4NF4B 2QPQA 3S9LC 2G29A 1LCTA 1A8EA 1MXXA 4LP2B 3MWBA 2B65A 1D9YA 3IX1A 1M5DA 3K1NA 3O9PA 4ECFA 5AA2D 3MP6A 4BDMA 4OFOA 5I56B 1SI1A 1LAHE 2DP8A 2VGQA 3PMVA 3W15C 1HSJA 3N6TA 3TDJA 2F35A 3BFTA 3HHFA 3H06B 3QUFA 2I0CA 3WAFA 4GVOA 1B7HA 1SYIA 4OERA 4OYVA 1MY0A 5EHMA 2ESNA 4UACA 3SESA 5KDTA 2Z22A 3U94A 3S9EA 2XHDA 3K1PA 4R2FA 3UGWA 5I2NA 1NMUA 4LATA 3QAXA 3ZSFA 4F19A 4F3BA 5AA1A 3MJNA 2IA4A 2VHAA 3H03A 3K6VA 3EN3A 4G68B 1MXZA 4LZ8A 4OENA 3T9VA 2Z23A 2HEUA 3K00A 2GHBA 2XX9A 3K2DA 4GF8A 4IY6A 4NF8B 4R6KA 4ZE8A 5H8FB 1SYHA 3EQ1A 3PUXE 5CRYA 3VVFA 2Y7KA 3FVOA 4X1DA 3H6TA 2O69A 2RCBA 3LSXA 1XS5A 2ZYNA 3OD7A 4F18A 1FTMA 1FQCA 3VLVA 1US4A 4NF5B 4RY1A 1LLSA 4KHZE 3ZKLA 2V93A 4QFNA 5DEXB 4R6YA 5ITPA 1AIVA 5A5XA 3TODA 1XVXA 1Q1KA 1B3FA 3O6HA 4ZE9A 1US5A 1B2HA 3I6VA 3FV1A 3FVNA 4P0IA 4AQ4A 3TTLA 1H3DA 1URDA 1D9VA 2AL4A 1A40A 2REGA 4OETA 4QFKA 4OHNA 5TP9A 3K6XA 3UN6A 1ZU0A 4E0XA 2Y7RA 1OMPA 4QSEA 3IJXB 2I0BA 2I3WA 1Y20A 1Z7ME 1YTVA 4IO2A 4FE8A 2B3BA 3CFXA 3FVKA 4JWXA 4OTEA 1Y4CA 4RK9A 3SERA 3KN8A 4XKRA 1SVXB 2P1SA 4OEUA 2A5SA 3QYTA 4GLIA 5ELVA 4FJPA 2OBGA 3RN8A 4F22A 3U1OA 3DP6A 1B1XA 3KJ7A 1S7YA 1MPBA 1B7ZA 1FQEA 4OFJA 4Q0CA 1Z7NE 1ATGA 2QRYA 4YKPA 1ZIUA 2GHAA 2NOOA 3M8UA 3O97A 3SEUA 3T9XB 3IOUA 4GL8A 3T96B 3RTWB 2DE4A 5BWJA 2GH9A 3A3CA 4GXAA 4YB6A 3SEXA 4F29A 1JVXA 2OK2A 3IAZA 3F11A 4RPOA 3SKPA 3MP1A 1LSTA 2H99A 3JYRA 3TZAA 5KCJA 4YKIA 2B3FA 3PD9A 1TXFA 1II5A 4JWYA 1SI0A 2I48A 1MY3A 5I57B 2ZNTA 1WDNA 2DVCA 2R6GE 3HPIA 4JB7A 2I6EA 4ND9A 4RYAA 3MZBA 1BTJA 2PT1A 2XXPA 2XX7A 3U72A 5AA4A 4FATA 3QK6A 3RTFB 4XXUA 3WAEA 2Q8JA 5AE4A 2RF1A 2ONSA 3W9VA 4G8HA 1QJMA 4KYDA 4NWCA 3RGYA 3O66A 1H43A 1H44A 2OZZA 3RQTA 3CR9A 5JEIA 2Z8DA 2HXWA 1Y3PA 2RINA 5F7VA 3PPPA 3RY3A 3Q26A 3FJ7A 5CM6A 3AXFA 1JNFA 2BJJX 3KN7A 3MZ1A 4P0GA 1B3GA 3PMWA 2YJPA 3HSTA 1SW2A 3FUZA 3FGSA 3IB1A 3THIA 3FJMA 1WVJA 5KCJB 2THIA 5LOMA 1Y4TA 2D5WA 4ISUA 1N7XA 4MBPA 4OFLA 1B05A 4N13A 4PFYA 3SDFA 1NKXA 1B52A 3TELA 4ELPA 1QUJA 3C33A 4JWOA 4OVJA 5CMMA 4LONB 1N76A 1LFGA 3PPNA 5FTHA 4ZEIA 1N0TA 3VXBA 5CC2A 4U22A 4IB2A 3CI8A 1GGGA 3JV9A 1EZ9A 1M5EA 2GRVA 1URGA 2HZKA 3C32A 1JEVA 5JTYB 4F2QA 1A99A 2QSXA 3EHUA 1NH7A 5H8QA 1OIBA 1DTGA 4H67A 3OEKA 4AB6A 4EQ9A 1SQYA 1DPPA 1ELJA 1JW1A 1FTOA 1MY2A 2Z8FA 3DM0A 2ZNUA 3G3JA 3M3FA 4ELQA 2H25A 4EUOA 4JBZA 4RK2A 3VV5A 4JDFA 3KBRA 3N94A 1VR5A 1BLFA 3IO6A 3EHTA 2H9BA 2NUVA 3IJOB 2AYSA 1IEJA 2HAVA 1B7UA 2UYEA 2XXWA 4FORA 4U1OA 3TCHA 4U4SA 5K2XA 1DSNA 2PVUA 3HV1A 2ALUA 2X7PA 3VFJA 3K01A 1QKAA 4PETA 1OLAA 2I4CA 3ZS6A 4KPTA 2DQVA 3PPOA 3RUMA 3UORA 5I84A 3KEIA 4KD5A 2GFEA 1I6QA 1OQHA 1Y3QA 3GBAA 4F31B 2ONKE 4X48A 3UP9A 4G77A 4HW8A 1B3HA 2XX8A 4C0RA 2O1MA 4N6PA 1N04A 4FEDA 1A7LA 5M2VA 5ICTA 1OQGA 4LQ5A 4ONYA 1IUDA 4U23A 1FTLA 2X26A 3DP8A 3FZVA 4NE4A 3MVXA 4ZZEA 2Y7IA 1PEBA 1B5HA 3C4MA 4OZ9A 4Q5TA 1H45A 2VOZA 4RNSA 4UA8A 2XXRA 4THIA 4DCXA 4DXCA 2AL5A 1Y1MA 2E0SA 2Y7PA 4KFQA 5I2NB 2UVHA 3E3KA 3A3UA 4MFIA 3IO4A 1D3KA 1IXHA 4ZEBA 3K4UA 5F1QA 1NNFA 1ZKBA 3U93A 3K1MA 3B6WA 3JZJA 4DCYA 1POY1 4GIZA 2UVJA 1B6HA 4WXJA 3UIFA 5IKBA 5JTYA 1B1HA 1JW4A 4BDRA 3RPWA 2O6AA 1QUIA 3UA8A 2ANJA 2VD2A 3U8QA 1RYOA 1MDQA 3KSXA 2HAUA 3OO6A 4TOZA 4HCYA 3MVYA 4U2RA 2UVGA 4Z7EA 1NH8A 3KFMA 1XC1A 1B5JA 3Q25A 1Y3NA 1LBBA 3USDA 5BUUA 1JW5A 1MM6A 3HN0A 5H8HB 1BP5A 3Q27A 2RCAA 2ZXTA 2DOJA 4R6HA 4GQOA 1KWHA 3O28A 4ZEKA 5CI5A 1MY1A 1EH3A 1P1OA 3TTNA 1TFAA 5I2KB 1I6AA 1LBCA 3LSFB 2XXQA 2AIXA 3ECRA 4N07A 3ILTB 2HCAA 2PYYA 4YKKA 4JSOA 4YZZA 3OOAA 2XXHA 4RXLA 5CMCA 4QHQA 1GTKA 2D21A 4LA9A 3TTMA 5CBRA 1MY4A 3C36A 4DDDA 2Y84A 5DT6A 1B3EA 2QS3A 2F8DA 4ESWA 1A55A 4Q30B 2DWHA 3G3HA 4NWDA 1NFTA 4POXA 5EHSA 3VXCA 4DXUA 5I57A 4H5GA 3Q29A 1UTHA 4TLMB 2W7YA 1USYE 4G8NA 3TMGA 2QMWA 3R6UA 4YMAA 1FQBA 4PFUA 3SETA 3QIMA 5H8NA 1VSOA 5H8SA 2ABHA 3HO7A 4NMYA 4YU0A 1BKAA 3C35A 2M8CA 2OWSA 1B4HA 3FV2A 3N26A 4GWOA 4FIMA 4ZDMA 1GV8A 1YCJA 2ZYOA 1LFIA 1FQDA 3E4RA 1AL3A 1N3XA 1TT1A 3MPKA 3IB0A 3KN3A 3MC2A 1HSEA 1POTA 1N3WA 1OVBA 1R9LA 1USYH 4QF9A 1VFDA 5TP9B 3Q28A 3TUSA 1EU8A 3FD3A 2RC8A 1BIYA 1MXVA 4WKMA 4LVQA 3W9WA 1QW0A 1UIVA 1S50A 5IAIA 2CZLA 3EPEA 1WODA 3QSLA 4X1BA 2ONRA 3TYHA 4MLVA 3K6UA 3D4GA 3FXUA 1CE2A 4BDOA 5B7DA 1EZOA 4GRKA 4K3FA 3FXQA 3OENA 1JETA 2RC9A 3H6VA 5DTBA 1OVTA 2REJA 4H1XA 3ZKKA 4F3SA 4R9FA 2Y7WA 3E13X 1O64A 3TCFA 4NF8A 4IO4A 5I2KA 3S9NC 3PMXA 3RT8A 2R71A 1FQFA 2OJTA 3KSJA 4KYSA 4G8MA 2HQ0A 4KQPA 4KCCA 1IZ1A 2FYIA 2ZYMA 3K6WA 4RA1A 5CBSA 4XKPA 4GOTA 4MH5A 2DXRA 3T66A 2O68A 4QSCA 5ITOA 3TTKA 3SEWA
chains in the Genus database with same CATH superfamily
1AH5A 2PCRA 1A54A 3TTRA 2QVUA 5FHNA 1R6ZA 3OO9A 4AB5A 1FBEA 4OWDA 4QSDA 5FHMA 2DXYA 1LFHA 1G0HA 3TEPA 4I8CA 2QJEA 3MZ9A 4OMBA 2WKYA 2BJIA 4M4GA 5L9SA 4DXBA 3VE1B 1PBQA 2MKZA 4U4XA 5HBCA 1FBCA 2OLBA 1IXGA 4I40A 3MPLA 2Q89A 1Y1ZA 2XXIA 1B9JA 3CVGA 3U65A 3ODBA 4NGUA 1VFEA 1SW1A 2V4CA 5T3JA 3R7XA 4F3PA 2QMXA 2F3DA 3CFLA 1UTHB 1KA0A 1HSLA 2B4LA 5H8FA 1LAFE 1XVYA 4AS4A 4PC9A 3FXRA 2PX1A 3PUWE 5L8DA 5EYHA 3PPRA 2DSFA 4PFRA 3T9HB 2ZYKA 2PT2A 4QBAA 4YB7A 5IZ1A 4NF6A 3RLFE 2X7QA 4PBHA 4QFPA 5AA4B 4HCWA 1JVYA 4YAHX 2Q88A 4IO3A 4JVDA 1K9YA 1S9TA 3QXMA 3C9HA 5ISUA 3OMBA 1FPLA 3C34A 2HFBA 5L9OA 4IO5A 4GL0A 1MRPA 4HE2A 3OELA 1MXYA 4O3BA 1R1NA 1M5CA 4JXIA 3T93B 5ET5A 1NNKA 3KOTA 5AA2A 1EYIA 1P1NA 1MXUA 4TQUQ 2V3QA 1SDXA 4NF5A 3OEMA 3MQ9A 3V83A 1JEUA 2H4IA 1FPJA 1RDYA 2NVUB 3IORA 5I56A 3A09A 3OO8A 4X9TA 4G61A 2O7IA 3BKIB 1LCFA 5KDTB 1TWYA 2F97A 3HHGA 1SW5A 4EF1A 3D1RA 1B32A 3K0VA 4NTLA 2A5TB 1LBVA 4RJZA 1MH3A 2XD2A 4ESXA 3PPQA 1RDZA 2F36A 1NL5A 2I3VA 3FATA 3H7MA 4NF0A 4PE3A 3CIJA 1PB7A 1QUKA 3GBBA 3BIHA 2QVVA 4FAJA 3KG2A 2DE3A 4NF6B 5TPAB 1LB9A 3IOWA 1Q35A 4ZECA 3FJGA 3P7IA 5I58B 3FVGA 2IEEA 2QFLA 2DWAA 4XTCQ 1YPNA 2QPQA 1A8EA 1MXXA 1D9QA 3MWBA 4PAKA 2ZZWA 1D9YA 3K1NA 1M5DA 1IMFA 1FBGA 3A29A 5I56B 3W15C 1HSJA 3BFTA 3QUFA 2I0CA 4NX1A 3U94A 3S9EA 2XHDA 3K1PA 4R2FA 4LATA 3ZSFA 4F3BA 5AA1A 2IA4A 3EN3A 2Z23A 3K00A 2XX9A 3K2DA 4NF8B 4ZE8A 1SYHA 2Y7KA 3FVOA 3H6TA 2ZYNA 1FTMA 1DBZA 4NF5B 1FBFA 1XVXA 3I6VA 4P0IA 3TTLA 1URDA 1D9VA 3UN6A 1FJ9A 5TP9A 4QFKA 2Y7RA 1NV3A 1OMPA 4QSEA 3E79A 4PF6A 2CZIA 3FVKA 4UABA 4XKRA 4OEUA 5ELVA 3QYTA 4N4UA 4AS5A 2OBGA 4F22A 1B1XA 1S7YA 1MPBA 4YKPA 1Z7NE 3IOUA 4GL8A 3T96B 3SKPA 2H99A 5KCJA 4N15A 3PD9A 1VDWA 1SI0A 3HPIA 1WDNA 4JB7A 4RYAA 2XXPA 3RTFB 4XXUA 3WAEA 2ONSA 2VPNA 4G8HA 4NWCA 5JEIA 2OZZA 5F7VA 3FJ7A 3AXFA 3MZ1A 4P0GA 4O8MA 3HSTA 1SW2A 3IB1A 5LOMA 1Y4TA 4ISUA 4OFLA 5ICQA 4PFYA 3C33A 4GWZA 4JWOA 3SZPA 4LONB 1N0TA 3VXBA 4U22A 1FPBA 3C32A 5JTYB 1JEVA 1NH7A 1OIBA 3OEKA 1ELJA 5IM2A 5I5PA 2ZNUA 4XEQA 4EUOA 3N94A 1IMCA 3IO6A 3IJOB 2AYSA 3TCHA 1DSNA 2X7PA 3VFJA 2FHYA 2WBDA 3K01A 3PPOA 2Y5KA 5I84A 3T1BA 1Y3QA 3GBAA 1EYKA 4F31B 2ONKE 4HW8A 1N04A 4LQ5A 4U23A 2X26A 3FZVA 3ROJA 2Y7IA 2WX9A 4UA8A 4DCXA 4THIA 5I2NB 4DXCA 2E0SA 4I3EA 3E3KA 4MFIA 1D3KA 4ZEBA 4OVPA 5F1QA 1POY1 4GIZA 1B6HA 1JW4A 5EQ9A 1LEVA 2VD2A 1RYOA 3KSXA 2HAUA 3OO6A 4TOZA 4HCYA 3MVYA 2R8TA 4Z7EA 4XFEA 4GX6A 1XC1A 3Q25A 1JW5A 1KWHA 3TTNA 1TFAA 1LBCA 4JSOA 4YZZA 2D21A 4LA9A 4DDDA 2QS3A 1NV2A 4POXA 1NFTA 3VXCA 4H5GA 3Q29A 1UTHA 1FQBA 2HHMA 1IMEA 3QIMA 5H8SA 4YU0A 1BKAA 3FV2A 4GWOA 4FIMA 1LFIA 1FQDA 1HSEA 1POTA 1R9LA 1OVBA 5TP9B 3TUSA 3FD3A 2RC8A 4WKMA 1QW0A 1S50A 2CZLA 4H46A 2HPGA 1CE2A 4GRKA 5DTBA 2REJA 3PMXA 2R71A 1FQFA 3KSJA 4KYSA 2FYIA 2ZYMA 3T66A 4MH5A 4QSCA 5ITOA 3E78A 3TTKA 5H8QB 1O7TA 3L6GA 4GD5A 4R9GA 3VLWA 3PGFA 5JK4A 1ZMGA 1YAEA 4YMBA 3K02A 3MVZA 4NEDA 1IXIA 3TPAA 1B3LA 3T0JA 2O1LA 2DS9A 5I58A 1FQAA 1MH4A 1MQJA 4JSDA 4QFLA 1MDP1 4M1VA 4MIJA 2F5XA 3ISPA 4FECA 2Q74A 4H8JA 1DTZA 3O6IA 3FIRA 3GZGA 3S2VA 3T22A 3DP4A 4BDQA 1R9QA 4KYEA 4ELOA 4NHBA 1DMBA 4IR8A 2R9JA 3GLBA 2XXYA 3CSGA 1FCKA 1AOVA 3LUZA 3R26A 3IL1B 2Q9TA 1NV7A 3PU5A 2XXXA 1FW0A 5LDZA 3MVWA 4MNCA 2F7AA 4ZZAA 1FPKA 1UTBA 1P1QA 1I69A 2OWZA 3U92A 2CMOA 3OO7A 4G68A 5LTCA 1OLCA 4O3CA 1IIWA 3V89B 1YXIA 4QXDA 1PBPA 1MG1A 3LV0A 5AA2B 5IGAA 4OESA 1N84A 1ZTYA 1PDAA 4G4PA 4ELRA 1CB6A 3LSLA 3RNNA 3MYUA 3VDFA 2OCUA 4Z0IA 2XXKA 1UTBB 5I7IA 4PP0A 3V5AA 2CZHA 3M3KA 4X04A 3HFUA 2V25A 5CMBA 3OXNA 3KOSA 1P1UA 4NF4A 2Q8MA 1FSAA 5TU0A 4ZEFA 3TQLA 2G93A 1MPDA 1UQWA 5DVIA 5ET8A 4OVSA 1IQ7A 3U8QA 4R74A 3VLUA 1NV0A 4KI0E 2ZNSA 4C1TA 2FNCA 3MAMA 2I58A 1GR2A 4F1VA 2H5YA 3N6UA 4OXVA 4IY5A 4OEVA 1P1WA 2QVRA 4HXVA 5DVFA 4P11A 3RPLB 2V3UA 4N81A 1AMFA 3MSTA 4YICA 2QL3A 3ILUB 3CSBA 4LN5A 4NQ8A 4MX6A 3IR1A 4F39A 4MF3A 2F6PA 1MM7A 2VP1A 5AE4A 3RYDA 3S4UA 3VVEA 4KCDA 5AA3A 3B7DA 3LBSA 2WBBA 5I59B 1LCTA 2B65A 4PFBA 5AA2D 4OFOA 3HHFA 4OYVA 5EHMA 3SESA 5KDTA 1LBWA 2VHAA 3K6VA 2L5VA 4LZ8A 1MXZA 3IFCA 4GF8A 2HEUA 4IY6A 2GHBA 2KQZA 3LSXA 2RCBA 1XS5A 1US4A 4HE0A 1IMDA 1LLSA 2V93A 5DEXB 4R6YA 5ITPA 3TODA 1Q1KA 2VPOA 3NOHA 1US5A 1B2HA 3FVNA 4AQ4A 1H3DA 1BK4A 1A40A 3K6XA 4N91A 2I0BA 2I3WA 1Y20A 1Z7ME 1YTVA 4RK9A 4Q8RA 2B3BA 4GLIA 3IFAA 3RN8A 3DP6A 3KJ7A 4N6DA 1FQEA 4OFJA 1ATGA 1Q9DA 2GHAA 3O97A 3T9XB 2GH9A 4YB6A 2OK2A 3TZAA 4GWUA 1FPIA 2B3FA 1II5A 5I57B 2I48A 1LBZA 2ZNTA 2DVCA 2I6EA 1BTJA 4FATA 3QK6A 1NUZA 2Q8JA 3RGYA 3O66A 1H44A 3CR9A 4KXPA 1Y3PA 2RINA 3PPPA 3Q26A 5CM6A 2GQ1A 2BJJX 3THIA 1WVJA 1N7XA 3ZS6A 4ELPA 1LBXA 4OVJA 4ZEIA 5CC2A 5ESYA 4IB2A 1URGA 1A99A 5H8QA 4PDHA 1DTGA 1G0IA 4H67A 4AB6A 2P3NA 1SQYA 1DPPA 1JW1A 2Z8FA 2H25A 4JBZA 1VR5A 2NUVA 2HAVA 4U1OA 2CZKA 4PETA 1OLAA 3KEIA 4KD5A 2GFEA 2XWVA 2KR0A 4X48A 1B3HA 3FBPA 4FEDA 4N6PA 1A7LA 1FTLA 3MVXA 4ZZEA 3C4MA 1Y1MA 2UVHA 3IO4A 3K1MA 3B6WA 3JZJA 4WXJA 3UA8A 2ANJA 1MDQA 2CEYA 2UVGA 3KFMA 1B5JA 3USDA 1BP5A 4R6HA 3O28A 1P1OA 5I2KB 3LSFB 3ILTB 3OOAA 2XXHA 4RXLA 5CMCA 3TTMA 5DT6A 2F8DA 4Q30B 2DWHA 2CEXA 4DXUA 2W7YA 1USYE 5EYGA 3R6UA 1FBHA 5FBPA 4NMYA 3C35A 1B4HA 3N26A 4ZDMA 1FBDA 1AL3A 3MC2A 4GBVA 1USYH 1VFDA 1FBPA 3Q28A 1BIYA 1MXVA 4N8YA 3W9WA 4DI3D 2ZZVA 3EPEA 1WODA 3TYHA 4MLVA 3FXUA 5B7DA 5EQ8A 1RDXA 3OENA 3ZKKA 5ET6A 4PDDA 3E13X 1O64A 3RT8A 2OJTA 2Y5LA 1NUXA 4KQPA 4O7MA 3K6WA 4RA1A 5CBSA 4XKPA 2O68A 2PBWA 1SW4A 4EQ7A 3IB2A 1P99A 1A8FA 4BLAA 5EYFA 2XD3A 1FPFA 1QULA 1F9BA 3L6HA 4WEDA 1M5FA 4YKJA 4EDPA 1NV4A 2Q2AA 3LUYA 5IZ3B 2F78A 1IXCA 4H6DA 4PFTA 2KLFA 2PMSA 2F7BA 1O63A 3CRBA 4MMPA 4IO7A 5I59A 1GVCA 4LZ5A 3B50A 1XI6A 2YLNA 4I3YA 3GYYA 3E9XA 4WEPA 1ZBMA 2DVZA 4GWWA 4HS7A 1XOCA 1SPIA 4POWA 2H98A 1B51A 3EHSA 1B0LA 2I49A 3H6UA 4P8BA 4R75A 2RC7A 2F34A 1YYZA 1MXWA 3MUQA 4MNIA 1B58A 4GFRA 2VD3A 3IOVA 4C1UA 1T0KA 1DPEA 1DOTA 1M5BA 3OSRA 3S9MC 3M3LA 3BFUA 1MQDA 4IO6A 1I6BA 3KBZA 2ZMBA 2D3IA 3VVDA 4DIGA 1FTJA 3KJTA 4F3GA 5K2YA 3TKDA 1FRPA 5EQ7A 4G2ZA 3G3KA 3PD8A 2P2AA 4H65A 1FTAA 2O7UA 4FEBA 3PUYE 4P1EA 5FHOA 4I9DA 3KGCA 1B5IA 4XKNA 2JJKA 2Z8EA 3G3GA 3MP8A 1LB8A 2XXTA 3DLNA 3TFLA 4BDLA 1ZLQA 1B40A 3H6WA 4NAPA 4O3AA 4PE5B 3O29A 4U1ZA 2WEFA 2FA7A 3FASA 1ANFA 5HM4B 3KZGA 5TPAA 1J1NA 1KZ8A 1NNPA 2HXRA 2HZLA 2PFYA 4EQBA 3I3VA 1LGBC 1ZJLA 3TAJA 5H8NB 1PB9A 1VE4A 1B46A 2OWTA 2YPNA 4OQOA 1NNTA 5FTIA 1K9ZA 1SD3A 3PUZE 3RPLA 1FPDA 4G68C 4GXSB 3LR1A 5H8HA 3B6TA 1RKMA 3S9LC 2G29A 4LP2B 3MP6A 1EYJA 1SI1A 2DP8A 2VGQA 3PMVA 1NI9A 3TDJA 1B7HA 4OERA 1MY0A 1DK4A 2ZZXA 4UACA 4GWYA 3UGWA 5I2NA 1NMUA 4F19A 4G68B 2VT5A 4O94A 3T9VA 4R6KA 3EQ1A 5CRYA 4X1DA 4PF8A 1FQCA 3VLVA 4RY1A 4QFNA 5A5XA 3O6HA 3FV1A 2AL4A 2REGA 4OETA 4OHNA 3IJXB 1IMAA 4FE8A 3CFXA 1AWBA 1Y4CA 3SERA 3KN8A 4FJPA 3U1OA 4MNPA 1B7ZA 2NOOA 3SEUA 3RTWB 2DE4A 5BWJA 3A3CA 4GXAA 3IAZA 3F11A 4RPOA 1LSTA 4PGNA 3FXBA 4YKIA 1TXFA 4JWYA 4ND9A 2RF1A 1QJMA 4KYDA 1H43A 2Z8DA 2HXWA 3B8BA 3RY3A 1JNFA 1NV5A 3FUZA 3FGSA 3FJMA 2FIXA 2D5WA 3SDFA 1B05A 4N13A 1NKXA 3BIGA 1LFGA 3PPNA 5FTHA 3CI8A 1GGGA 3JV9A 1EZ9A 1M5EA 2QSXA 5A5LA 4EQ9A 1MY2A 3G3JA 4O7IA 3VV5A 4JDFA 1BLFA 1IEJA 4FORA 2XXWA 4U4SA 5K2XA 1QKAA 2I4CA 2DQVA 3UORA 4XF5A 4N17A 4G77A 2XX8A 2O1MA 1DCUA 5M2VA 1OQGA 4PBQA 1IUDA 3DP8A 1PEBA 4OZ9A 2VOZA 4RNSA 2Y7PA 3K4UA 1ZKBA 3U93A 4DCYA 2UVJA 3UIFA 5JTYA 1B1HA 3RPWA 1QUIA 4FBPA 4U2RA 1Y3NA 1MM6A 3Q27A 4GQOA 4ZEKA 1MY1A 2AIXA 3ECRA 4N07A 2HCAA 2PYYA 4YKKA 2FBPA 4QHQA 3C36A 4GWSA 2Y84A 4ESWA 4GBWA 1A55A 3G3HA 4NWDA 5EHSA 4G8NA 4HE1A 3TMGA 2QMWA 4YMAA 4PFUA 1VSOA 4JVCA 3HO7A 2M8CA 1GV8A 2ZYOA 3E4RA 3MPKA 4F1YA 3IB0A 3KN3A 4QF9A 1EU8A 4LVQA 5IAIA 4X1BA 2ONRA 3D4GA 1EZOA 4K3FA 3FXQA 3H6VA 1OVTA 4H1XA 4OVTA 1NUYA 3TCFA 4NF8A 2HQ0A 4KCCA 1IZ1A 2DXRA 4PFIA 3SEWA 3H4ZA 1LAXA 5HPQA 3BBRA 4MLQA 4EXLA 2WYKA 4YB5A 2QS4A 4TLLB 2I4BA 3RT6B 3PTYA 4X8RA 1XHYA 2XXUA 4R2BA 3IOTA 5B70A 3CG1A 4P1LA 4PQJA 4XIGQ 4DE8A 1FJ6A 1FTKA 3HCQA 3SEVA 5DEXA 4IGTA 3D4CA 2Q2CA 4F1UA 3CG3A 5DW8A 1MQHA 3T9UA 3MW0A 3DELB 3UK4A 4L17A 4F2OA 2F7CA 4NN3A 3GXAA 4LQ2A 4PAFA 3G7WA 3C31A 1QKBA 1MQGA 4R72A 1EZPA 4P3LA 2XWOA 2WYPA 4DZ1A 4U21A 2NWJA 1PC3A 1MS7A 3CFZA 4KR5A 4MCOA 4QFOA 4GWXA 1TFDA 2V84A 4OVQA 1INPA 3O6GA 4R73A 1LAGE 5F24A 4I62A 4LZ7A 3CHGA 3LSWA 1B4ZA 4BDNA 4XKQA 1SBPA 4LUBA 1L5TA 4H5FA 1XT8A 2P0SA 5CMKA 1B0HA 3QUJA 4IGRA 3KC0A 3LC8A 3PUVE 5J1DA 1MPCA 3EF7A 3QMFA 2UYFA 3TQWA 2O51A 4EXKA 3IK6B 1UIUA 5A5XB 4N6KA 4DLDA 2NXOA 3G3FA 4GX4A 1RYXA 1H76A 4E0WA 2F6GA 4PAIA 2RKMA 4PFWA 4H8IA 2DDKA 1URSA 3B6QA 1QVSA 2O84X 2QS1A 1NV1A 2V3TA 2A5TA 4HTGA 2PFZA 3O2AA 3MBPA 4I1DA 5H8FB 5DYHA 4NG7A 3EKIA 4ZS9A 4QRZA 1D4NA 1MQIA 3PV0E 1N7WA 2QS2A 4OVRA 5KZTA 2LAOA 3H3GA 2DWJA 1Y9UA 3TCGA 2DE2A 4RPNA 4ZEDA 2OX3A 5L9MA 2UXAA 3ONMA 2DWIA 4EF2A 3N5LA 2XXVA 1JQFA 2E1SA 2UVIA 2B4MA 3G3IA 2DYXA 1IITA 1PB8A 3OSQA 3KC1A 4P9KA 3SEYA 5DVJA 4H0WA 3I5OA 4NF4B 3IX1A 4ECFA 3O9PA 4BDMA 1LAHE 4P56A 3N6TA 2F35A 3H06B 3WAFA 4GVOA 1SYIA 2ESNA 2Z22A 3QAXA 4OANA 3MJNA 3H03A 4OENA 3VVFA 3PUXE 5ET7A 2O69A 3OD7A 4F18A 4KHZE 3ZKLA 1AIVA 2XWIA 2XA5A 1B3FA 4ZE9A 4E0XA 1ZU0A 1FPGA 4IO2A 4OTEA 5IZ3A 4JWXA 1SVXB 5I3SA 2P1SA 2A5SA 1YZ0A 2FVZA 4Q0CA 2QRYA 1ZIUA 3M8UA 5IZZA 4F29A 3SEXA 1JVXA 3MP1A 3JYRA 5EQAA 1LBYA 1MY3A 2F3BA 2R6GE 3MZBA 5AA4A 2PT1A 2XX7A 3U72A 1CNQA 4GX3A 3W9VA 3RQTA 4MHFA 3KN7A 1B3GA 3PMWA 2YJPA 2XWKA 5KCJB 2THIA 4MAGA 4MBPA 3TELA 1B52A 1QUJA 4H45A 5CMMA 1IMBA 4MJOA 1N76A 2GRVA 2HZKA 4F2QA 3EHUA 1JP4A 2FIEA 1FTOA 4ELQA 3DM0A 3M3FA 4OA4A 4MEVA 4RK2A 3KBRA 3EHTA 2H9BA 1B7UA 2UYEA 2PVUA 3HV1A 2ALUA 4KPTA 3RUMA 1NV6A 1I6QA 1OQHA 1NUWA 3UP9A 4C0RA 5ICTA 4ONYA 4NE4A 5J16A 1B5HA 4Q5TA 1H45A 2XXRA 2AL5A 4KFQA 3A3UA 1IXHA 1NNFA 4PTKA 5IKBA 1QGXA 4BDRA 2O6AA 1NH8A 5BUUA 1LBBA 3HN0A 4PGPA 5H8HB 2RCAA 2ZXTA 2DOJA 5CI5A 1EH3A 1I6AA 1KA1A 2XXQA 2P3VA 1FPEA 1GTKA 5CBRA 4JVIA 1MY4A 1B3EA 5I57A 4TLMB 3SETA 5H8NA 2ABHA 2OWSA 1YCJA 1TT1A 1N3XA 3V8XB 1N3WA 1UIVA 3QSLA 3K6UA 4BDOA 1JETA 2RC9A 4F3SA 4R9FA 2Y7WA 4P47A 5I2KA 4IO4A 3S9NC 4G8MA 4N8GA 4PCDA 4GOTA 4DI4B
chains in the Genus database with same CATH topology
1AH5A 1O7TA 5H8QB 3H4ZA 1LAXA 3L6GA 4GD5A 2PBWA 4R9GA 5HPQA 1SW4A 3VLWA 3BBRA 4MLQA 4EQ7A 3PGFA 4EXLA 3IB2A 5JK4A 1P99A 1ZMGA 1A8FA 1YAEA 1A54A 5EYFA 4YB5A 4BLAA 2QS4A 4YMBA 2XD3A 4TLLB 5FHNA 3TTRA 2I4BA 1R6ZA 3OO9A 3K02A 4AB5A 3MVZA 4NEDA 3RT6B 4Q8RA 1QULA 1F9BA 1IXIA 3L6HA 4QSDA 4OWDA 4WEDA 1M5FA 5FHMA 3TPAA 2DXYA 1B3LA 1LFHA 2O1LA 2DS9A 4YKJA 4EDPA 2Q2AA 3LUYA 3TEPA 5I58A 1XHYA 2F78A 1IXCA 2QJEA 2XXUA 3MZ9A 1FQAA 2WKYA 4H6DA 4I8CA 1MH4A 1MQJA 3IOTA 4JSDA 4M4GA 4R2BA 4DXBA 5B70A 5L9SA 4PFTA 3CG1A 2KLFA 2PMSA 4QFLA 1MDP1 4M1VA 4PQJA 1PBQA 2F5XA 2F7BA 4U4XA 4XIGQ 5HBCA 3VE1B 4DE8A 4FECA 1FTKA 3HCQA 3SEVA 1O63A 3CRBA 4H8JA 2OLBA 5DEXA 1DTZA 3O6IA 3FIRA 4IGTA 1IXGA 3GZGA 3D4CA 4IO7A 5I59A 2Q2CA 1GVCA 4LZ5A 4F1UA 3CG3A 3S2VA 2YLNA 3T22A 3MPLA 3DP4A 1MQHA 2Q89A 1R9QA 1Y1ZA 2XXIA 3MW0A 1B9JA 3T9UA 4BDQA 3DELB 3CVGA 3UK4A 4L17A 3ODBA 4KYEA 3E9XA 4WEPA 1ZBMA 1VFEA 2F7CA 4F2OA 2DVZA 4ELOA 3GXAA 1DMBA 1SW1A 4HS7A 2R9JA 3GLBA 1XOCA 4OMBA 3R7XA 4LQ2A 2QMXA 2XXYA 4F3PA 3CFLA 1UTHB 3CSGA 3G7WA 4POWA 1FCKA 2H98A 3C31A 1QKBA 1B51A 1HSLA 1MQGA 3EHSA 5H8FA 1AOVA 1B0LA 1LAFE 2I49A 1XVYA 4R72A 3H6UA 4R75A 3R26A 1EZPA 3IL1B 2RC7A 3FXRA 2F34A 2PX1A 2Q9TA 3PU5A 3PUWE 2XXXA 1FW0A 5L8DA 3MVWA 1MXWA 3MUQA 3PPRA 1B58A 2DSFA 4DZ1A 4GFRA 3T9HB 4U21A 2NWJA 2ZYKA 2PT2A 2VD3A 2F7AA 3IOVA 1PC3A 4YB7A 1MS7A 3CFZA 4KR5A 4NF6A 4ZZAA 4QFOA 1UTBA 1TFDA 1P1QA 3RLFE 4C1UA 1I69A 2V84A 2X7QA 3U92A 1T0KA 4QFPA 5AA4B 1DPEA 3O6GA 1DOTA 1M5BA 4R73A 2CMOA 3OO7A 4G68A 1LAGE 3OSRA 4HCWA 1JVYA 1OLCA 4YAHX 2Q88A 4O3CA 3S9MC 3M3LA 3BFUA 1MQDA 4I62A 4IO3A 1IIWA 4LZ7A 4IO6A 1I6BA 3LSWA 1B4ZA 4BDNA 4XKQA 1SBPA 3V89B 4LUBA 1S9TA 1L5TA 4H5FA 5ICQA 2ZMBA 1PBPA 2D3IA 3VVDA 1MG1A 3QXMA 3C9HA 1XT8A 2P0SA 3OMBA 1B0HA 4DIGA 5AA2B 5CMKA 5ISUA 3QUJA 4OESA 1FTJA 3C34A 3KJTA 4F3GA 1N84A 5K2YA 4IGRA 3LC8A 1ZTYA 3TKDA 2HFBA 5L9OA 3PUVE 5J1DA 1PDAA 4IO5A 4GL0A 1MRPA 4G2ZA 3G3KA 4G4PA 4ELRA 3OELA 1MPCA 3EF7A 1MXYA 1CB6A 2UYFA 3PD8A 3LSLA 2O51A 2P2AA 4O3BA 3TQWA 4EXKA 4H65A 1R1NA 2O7UA 1M5CA 1UIUA 3IK6B 3PUYE 4FEBA 4JXIA 3RNNA 3VDFA 2OCUA 3T93B 5FHOA 4I9DA 1NNKA 3KGCA 3KOTA 5AA2A 1B5IA 1P1NA 4XKNA 1MXUA 4TQUQ 5A5XB 4DLDA 4Z0IA 2V3QA 2Z8EA 1SDXA 2NXOA 3G3GA 1UTBB 3MP8A 3OEMA 4NF5A 3G3FA 4PP0A 3MQ9A 3V83A 1LB8A 2XXTA 3DLNA 1JEUA 3V5AA 2H4IA 1RYXA 1H76A 2NVUB 3TFLA 4E0WA 3IORA 4BDLA 1ZLQA 2F6GA 3M3KA 1B40A 5I56A 3A09A 2RKMA 2V25A 4PFWA 4H8IA 5CMBA 3OO8A 3H6WA 1URSA 3B6QA 3VLUA 4X9TA 3OXNA 2O7IA 4O3AA 1QVSA 2O84X 3BKIB 1P1UA 3KOSA 1LCFA 4NF4A 4PE5B 3O29A 4U1ZA 5TU0A 2QS1A 4ZEFA 2V3TA 3TQLA 5KDTB 2G93A 1MPDA 1TWYA 1UQWA 2F97A 3HHGA 1SW5A 5DVIA 4EF1A 2A5TA 4HTGA 2FA7A 1B32A 1IQ7A 3K0VA 3O2AA 3MBPA 4I1DA 4KI0E 2ZNSA 4R74A 2FNCA 3FASA 4NTLA 5DYHA 3MAMA 2I58A 4C1TA 1GR2A 1ANFA 5HM4B 4ZS9A 4QRZA 2A5TB 3KZGA 4F1YA 4F1VA 4RJZA 5TPAA 1MH3A 2XD2A 1J1NA 1NNPA 3PPQA 4ESXA 2F36A 1D4NA 1NL5A 2HZLA 1MQIA 4EQBA 2H5YA 3I3VA 2I3VA 1LGBC 3FATA 3H7MA 3N6UA 1N7WA 3PV0E 2QS2A 4IY5A 4OXVA 5KZTA 3CIJA 1PB7A 1ZJLA 3TAJA 2LAOA 4OEVA 5H8NB 3H3GA 1PB9A 1QUKA 1VE4A 2DWJA 1P1WA 3GBBA 1B46A 1Y9UA 2OWTA 3TCGA 2YPNA 2DE2A 5DVFA 4OQOA 4FAJA 4RPNA 4ZEDA 1NNTA 3KG2A 2UXAA 3ONMA 2DWIA 4P11A 5L9MA 3V8XB 4EF2A 5FTIA 2V3UA 3N5LA 2XXVA 2DE3A 1JQFA 2E1SA 1AMFA 2UVIA 4YICA 1SD3A 3PUZE 4NF6B 2QL3A 3ILUB 3CSBA 5TPAB 1LB9A 3IOWA 3G3IA 3IR1A 2DYXA 4G68C 1Q35A 4ZECA 4F39A 1IITA 3FJGA 1PB8A 2F6PA 1MM7A 2VP1A 3OSQA 3P7IA 4GXSB 4MF3A 3S4UA 3VVEA 5I58B 3FVGA 2IEEA 2DWAA 3LR1A 4KCDA 5AA3A 3SEYA 5DVJA 3B7DA 3B6TA 1RKMA 3LBSA 4H0WA 3I5OA 4XTCQ 1YPNA 5H8HA 5I59B 4NF4B 2QPQA 3S9LC 2G29A 1LCTA 1A8EA 1MXXA 4LP2B 3MWBA 2B65A 1D9YA 3IX1A 1M5DA 3K1NA 3O9PA 4ECFA 5AA2D 3MP6A 4BDMA 4OFOA 5I56B 1SI1A 1LAHE 2DP8A 2VGQA 3PMVA 3W15C 1HSJA 3N6TA 3TDJA 2F35A 3BFTA 3HHFA 3H06B 3QUFA 2I0CA 3WAFA 4GVOA 1B7HA 1SYIA 4OERA 4OYVA 1MY0A 5EHMA 2ESNA 4UACA 3SESA 5KDTA 2Z22A 3U94A 3S9EA 2XHDA 3K1PA 4R2FA 3UGWA 5I2NA 1NMUA 4LATA 3QAXA 3ZSFA 4F19A 4F3BA 5AA1A 3MJNA 2IA4A 2VHAA 3H03A 3K6VA 3EN3A 4G68B 1MXZA 4LZ8A 4OENA 3T9VA 2Z23A 2HEUA 3K00A 2GHBA 2XX9A 3K2DA 4GF8A 4IY6A 4NF8B 4R6KA 4ZE8A 5H8FB 1SYHA 3EQ1A 3PUXE 5CRYA 3VVFA 2Y7KA 3FVOA 4X1DA 3H6TA 2O69A 2RCBA 3LSXA 1XS5A 2ZYNA 3OD7A 4F18A 1FTMA 1FQCA 3VLVA 1US4A 4NF5B 4RY1A 1LLSA 4KHZE 3ZKLA 2V93A 4QFNA 5DEXB 4R6YA 5ITPA 1AIVA 5A5XA 3TODA 1XVXA 1Q1KA 1B3FA 3O6HA 4ZE9A 1US5A 1B2HA 3I6VA 3FV1A 3FVNA 4P0IA 4AQ4A 3TTLA 1H3DA 1URDA 1D9VA 2AL4A 1A40A 2REGA 4OETA 4QFKA 4OHNA 5TP9A 3K6XA 3UN6A 1ZU0A 4E0XA 2Y7RA 1OMPA 4QSEA 3IJXB 2I0BA 2I3WA 1Y20A 1Z7ME 1YTVA 4IO2A 4FE8A 2B3BA 3CFXA 3FVKA 4JWXA 4OTEA 1Y4CA 4RK9A 3SERA 3KN8A 4XKRA 1SVXB 2P1SA 4OEUA 2A5SA 3QYTA 4GLIA 5ELVA 4FJPA 2OBGA 3RN8A 4F22A 3U1OA 3DP6A 1B1XA 3KJ7A 1S7YA 1MPBA 1B7ZA 1FQEA 4OFJA 4Q0CA 1Z7NE 1ATGA 2QRYA 4YKPA 1ZIUA 2GHAA 2NOOA 3M8UA 3O97A 3SEUA 3T9XB 3IOUA 4GL8A 3T96B 3RTWB 2DE4A 5BWJA 2GH9A 3A3CA 4GXAA 4YB6A 3SEXA 4F29A 1JVXA 2OK2A 3IAZA 3F11A 4RPOA 3SKPA 3MP1A 1LSTA 2H99A 3JYRA 3TZAA 5KCJA 4YKIA 2B3FA 3PD9A 1TXFA 1II5A 4JWYA 1SI0A 2I48A 1MY3A 5I57B 2ZNTA 1WDNA 2DVCA 2R6GE 3HPIA 4JB7A 2I6EA 4ND9A 4RYAA 3MZBA 1BTJA 2PT1A 2XXPA 2XX7A 3U72A 5AA4A 4FATA 3QK6A 3RTFB 4XXUA 3WAEA 2Q8JA 5AE4A 2RF1A 2ONSA 3W9VA 4G8HA 1QJMA 4KYDA 4NWCA 3RGYA 3O66A 1H43A 1H44A 2OZZA 3RQTA 3CR9A 5JEIA 2Z8DA 2HXWA 1Y3PA 2RINA 5F7VA 3PPPA 3RY3A 3Q26A 3FJ7A 5CM6A 3AXFA 1JNFA 2BJJX 3KN7A 3MZ1A 4P0GA 1B3GA 3PMWA 2YJPA 3HSTA 1SW2A 3FUZA 3FGSA 3IB1A 3THIA 3FJMA 1WVJA 5KCJB 2THIA 5LOMA 1Y4TA 2D5WA 4ISUA 1N7XA 4MBPA 4OFLA 1B05A 4N13A 4PFYA 3SDFA 1NKXA 1B52A 3TELA 4ELPA 1QUJA 3C33A 4JWOA 4OVJA 5CMMA 4LONB 1N76A 1LFGA 3PPNA 5FTHA 4ZEIA 1N0TA 3VXBA 5CC2A 4U22A 4IB2A 3CI8A 1GGGA 3JV9A 1EZ9A 1M5EA 2GRVA 1URGA 2HZKA 3C32A 1JEVA 5JTYB 4F2QA 1A99A 2QSXA 3EHUA 1NH7A 5H8QA 1OIBA 1DTGA 4H67A 3OEKA 4AB6A 4EQ9A 1SQYA 1DPPA 1ELJA 1JW1A 1FTOA 1MY2A 2Z8FA 3DM0A 2ZNUA 3G3JA 3M3FA 4ELQA 2H25A 4EUOA 4JBZA 4RK2A 3VV5A 4JDFA 3KBRA 3N94A 1VR5A 1BLFA 3IO6A 3EHTA 2H9BA 2NUVA 3IJOB 2AYSA 1IEJA 2HAVA 1B7UA 2UYEA 2XXWA 4FORA 4U1OA 3TCHA 4U4SA 5K2XA 1DSNA 2PVUA 3HV1A 2ALUA 2X7PA 3VFJA 3K01A 1QKAA 4PETA 1OLAA 2I4CA 3ZS6A 4KPTA 2DQVA 3PPOA 3RUMA 3UORA 5I84A 3KEIA 4KD5A 2GFEA 1I6QA 1OQHA 1Y3QA 3GBAA 4F31B 2ONKE 4X48A 3UP9A 4G77A 4HW8A 1B3HA 2XX8A 4C0RA 2O1MA 4N6PA 1N04A 4FEDA 1A7LA 5M2VA 5ICTA 1OQGA 4LQ5A 4ONYA 1IUDA 4U23A 1FTLA 2X26A 3DP8A 3FZVA 4NE4A 3MVXA 4ZZEA 2Y7IA 1PEBA 1B5HA 3C4MA 4OZ9A 4Q5TA 1H45A 2VOZA 4RNSA 4UA8A 2XXRA 4THIA 4DCXA 4DXCA 2AL5A 1Y1MA 2E0SA 2Y7PA 4KFQA 5I2NB 2UVHA 3E3KA 3A3UA 4MFIA 3IO4A 1D3KA 1IXHA 4ZEBA 3K4UA 5F1QA 1NNFA 1ZKBA 3U93A 3K1MA 3B6WA 3JZJA 4DCYA 1POY1 4GIZA 2UVJA 1B6HA 4WXJA 3UIFA 5IKBA 5JTYA 1B1HA 1JW4A 4BDRA 3RPWA 2O6AA 1QUIA 3UA8A 2ANJA 2VD2A 3U8QA 1RYOA 1MDQA 3KSXA 2HAUA 3OO6A 4TOZA 4HCYA 3MVYA 4U2RA 2UVGA 4Z7EA 1NH8A 3KFMA 1XC1A 1B5JA 3Q25A 1Y3NA 1LBBA 3USDA 5BUUA 1JW5A 1MM6A 3HN0A 5H8HB 1BP5A 3Q27A 2RCAA 2ZXTA 2DOJA 4R6HA 4GQOA 1KWHA 3O28A 4ZEKA 5CI5A 1MY1A 1EH3A 1P1OA 3TTNA 1TFAA 5I2KB 1I6AA 1LBCA 3LSFB 2XXQA 2AIXA 3ECRA 4N07A 3ILTB 2HCAA 2PYYA 4YKKA 4JSOA 4YZZA 3OOAA 2XXHA 4RXLA 5CMCA 4QHQA 1GTKA 2D21A 4LA9A 3TTMA 5CBRA 1MY4A 3C36A 4DDDA 2Y84A 5DT6A 1B3EA 2QS3A 2F8DA 4ESWA 1A55A 4Q30B 2DWHA 3G3HA 4NWDA 1NFTA 4POXA 5EHSA 3VXCA 4DXUA 5I57A 4H5GA 3Q29A 1UTHA 4TLMB 2W7YA 1USYE 4G8NA 3TMGA 2QMWA 3R6UA 4YMAA 1FQBA 4PFUA 3SETA 3QIMA 5H8NA 1VSOA 5H8SA 2ABHA 3HO7A 4NMYA 4YU0A 1BKAA 3C35A 2M8CA 2OWSA 1B4HA 3FV2A 3N26A 4GWOA 4FIMA 4ZDMA 1GV8A 1YCJA 2ZYOA 1LFIA 1FQDA 3E4RA 1AL3A 1N3XA 1TT1A 3MPKA 3IB0A 3KN3A 3MC2A 1HSEA 1POTA 1N3WA 1OVBA 1R9LA 1USYH 4QF9A 1VFDA 5TP9B 3Q28A 3TUSA 1EU8A 3FD3A 2RC8A 1BIYA 1MXVA 4WKMA 4LVQA 3W9WA 1QW0A 1UIVA 1S50A 5IAIA 2CZLA 3EPEA 1WODA 3QSLA 4X1BA 2ONRA 3TYHA 4MLVA 3K6UA 3D4GA 3FXUA 1CE2A 4BDOA 5B7DA 1EZOA 4GRKA 4K3FA 3FXQA 3OENA 1JETA 2RC9A 3H6VA 5DTBA 1OVTA 2REJA 4H1XA 3ZKKA 4F3SA 4R9FA 2Y7WA 3E13X 1O64A 3TCFA 4NF8A 4IO4A 5I2KA 3S9NC 3PMXA 3RT8A 2R71A 1FQFA 2OJTA 3KSJA 4KYSA 4G8MA 2HQ0A 4KQPA 4KCCA 1IZ1A 2FYIA 2ZYMA 3K6WA 4RA1A 5CBSA 4XKPA 4GOTA 4MH5A 2DXRA 3T66A 2O68A 4QSCA 5ITOA 3TTKA 3SEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AH5 A;  1O7T A;  5H8Q B;  3H4Z A;  1LAX A;  3L6G A;  4GD5 A;  2PBW A;  4R9G A;  5HPQ A;  1SW4 A;  3VLW A;  3BBR A;  4MLQ A;  4EQ7 A;  3PGF A;  4EXL A;  3IB2 A;  5JK4 A;  1P99 A;  1ZMG A;  1A8F A;  1YAE A;  1A54 A;  5EYF A;  4YB5 A;  4BLA A;  2QS4 A;  4YMB A;  2XD3 A;  4TLL B;  5FHN A;  3TTR A;  2I4B A;  1R6Z A;  3OO9 A;  3K02 A;  4AB5 A;  3MVZ A;  4NED A;  3RT6 B;  4Q8R A;  1QUL A;  1F9B A;  1IXI A;  3L6H A;  4QSD A;  4OWD A;  4WED A;  1M5F A;  5FHM A;  3TPA A;  2DXY A;  1B3L A;  1LFH A;  2O1L A;  2DS9 A;  4YKJ A;  4EDP A;  2Q2A A;  3LUY A;  3TEP A;  5I58 A;  1XHY A;  2F78 A;  1IXC A;  2QJE A;  2XXU A;  3MZ9 A;  1FQA A;  2WKY A;  4H6D A;  4I8C A;  1MH4 A;  1MQJ A;  3IOT A;  4JSD A;  4M4G A;  4R2B A;  4DXB A;  5B70 A;  5L9S A;  4PFT A;  3CG1 A;  2KLF A;  2PMS A;  4QFL A;  1MDP 1;  4M1V A;  4PQJ A;  1PBQ A;  2F5X A;  2F7B A;  4U4X A;  4XIG Q;  5HBC A;  3VE1 B;  4DE8 A;  4FEC A;  1FTK A;  3HCQ A;  3SEV A;  1O63 A;  3CRB A;  4H8J A;  2OLB A;  5DEX A;  1DTZ A;  3O6I A;  3FIR A;  4IGT A;  1IXG A;  3GZG A;  3D4C A;  4IO7 A;  5I59 A;  2Q2C A;  1GVC A;  4LZ5 A;  4F1U A;  3CG3 A;  3S2V A;  2YLN A;  3T22 A;  3MPL A;  3DP4 A;  1MQH A;  2Q89 A;  1R9Q A;  1Y1Z A;  2XXI A;  3MW0 A;  1B9J A;  3T9U A;  4BDQ A;  3DEL B;  3CVG A;  3UK4 A;  4L17 A;  3ODB A;  4KYE A;  3E9X A;  4WEP A;  1ZBM A;  1VFE A;  2F7C A;  4F2O A;  2DVZ A;  4ELO A;  3GXA A;  1DMB A;  1SW1 A;  4HS7 A;  2R9J A;  3GLB A;  1XOC A;  4OMB A;  3R7X A;  4LQ2 A;  2QMX A;  2XXY A;  4F3P A;  3CFL A;  1UTH B;  3CSG A;  3G7W A;  4POW A;  1FCK A;  2H98 A;  3C31 A;  1QKB A;  1B51 A;  1HSL A;  1MQG A;  3EHS A;  5H8F A;  1AOV A;  1B0L A;  1LAF E;  2I49 A;  1XVY A;  4R72 A;  3H6U A;  4R75 A;  3R26 A;  1EZP A;  3IL1 B;  2RC7 A;  3FXR A;  2F34 A;  2PX1 A;  2Q9T A;  3PU5 A;  3PUW E;  2XXX A;  1FW0 A;  5L8D A;  3MVW A;  1MXW A;  3MUQ A;  3PPR A;  1B58 A;  2DSF A;  4DZ1 A;  4GFR A;  3T9H B;  4U21 A;  2NWJ A;  2ZYK A;  2PT2 A;  2VD3 A;  2F7A A;  3IOV A;  1PC3 A;  4YB7 A;  1MS7 A;  3CFZ A;  4KR5 A;  4NF6 A;  4ZZA A;  4QFO A;  1UTB A;  1TFD A;  1P1Q A;  3RLF E;  4C1U A;  1I69 A;  2V84 A;  2X7Q A;  3U92 A;  1T0K A;  4QFP A;  5AA4 B;  1DPE A;  3O6G A;  1DOT A;  1M5B A;  4R73 A;  2CMO A;  3OO7 A;  4G68 A;  1LAG E;  3OSR A;  4HCW A;  1JVY A;  1OLC A;  4YAH X;  2Q88 A;  4O3C A;  3S9M C;  3M3L A;  3BFU A;  1MQD A;  4I62 A;  4IO3 A;  1IIW A;  4LZ7 A;  4IO6 A;  1I6B A;  3LSW A;  1B4Z A;  4BDN A;  4XKQ A;  1SBP A;  3V89 B;  4LUB A;  1S9T A;  1L5T A;  4H5F A;  5ICQ A;  2ZMB A;  1PBP A;  2D3I A;  3VVD A;  1MG1 A;  3QXM A;  3C9H A;  1XT8 A;  2P0S A;  3OMB A;  1B0H A;  4DIG A;  5AA2 B;  5CMK A;  5ISU A;  3QUJ A;  4OES A;  1FTJ A;  3C34 A;  3KJT A;  4F3G A;  1N84 A;  5K2Y A;  4IGR A;  3LC8 A;  1ZTY A;  3TKD A;  2HFB A;  5L9O A;  3PUV E;  5J1D A;  1PDA A;  4IO5 A;  4GL0 A;  1MRP A;  4G2Z A;  3G3K A;  4G4P A;  4ELR A;  3OEL A;  1MPC A;  3EF7 A;  1MXY A;  1CB6 A;  2UYF A;  3PD8 A;  3LSL A;  2O51 A;  2P2A A;  4O3B A;  3TQW A;  4EXK A;  4H65 A;  1R1N A;  2O7U A;  1M5C A;  1UIU A;  3IK6 B;  3PUY E;  4FEB A;  4JXI A;  3RNN A;  3VDF A;  2OCU A;  3T93 B;  5FHO A;  4I9D A;  1NNK A;  3KGC A;  3KOT A;  5AA2 A;  1B5I A;  1P1N A;  4XKN A;  1MXU A;  4TQU Q;  5A5X B;  4DLD A;  4Z0I A;  2V3Q A;  2Z8E A;  1SDX A;  2NXO A;  3G3G A;  1UTB B;  3MP8 A;  3OEM A;  4NF5 A;  3G3F A;  4PP0 A;  3MQ9 A;  3V83 A;  1LB8 A;  2XXT A;  3DLN A;  1JEU A;  3V5A A;  2H4I A;  1RYX A;  1H76 A;  2NVU B;  3TFL A;  4E0W A;  3IOR A;  4BDL A;  1ZLQ A;  2F6G A;  3M3K A;  1B40 A;  5I56 A;  3A09 A;  2RKM A;  2V25 A;  4PFW A;  4H8I A;  5CMB A;  3OO8 A;  3H6W A;  1URS A;  3B6Q A;  3VLU A;  4X9T A;  3OXN A;  2O7I A;  4O3A A;  1QVS A;  2O84 X;  3BKI B;  1P1U A;  3KOS A;  1LCF A;  4NF4 A;  4PE5 B;  3O29 A;  4U1Z A;  5TU0 A;  2QS1 A;  4ZEF A;  2V3T A;  3TQL A;  5KDT B;  2G93 A;  1MPD A;  1TWY A;  1UQW A;  2F97 A;  3HHG A;  1SW5 A;  5DVI A;  4EF1 A;  2A5T A;  4HTG A;  2FA7 A;  1B32 A;  1IQ7 A;  3K0V A;  3O2A A;  3MBP A;  4I1D A;  4KI0 E;  2ZNS A;  4R74 A;  2FNC A;  3FAS A;  4NTL A;  5DYH A;  3MAM A;  2I58 A;  4C1T A;  1GR2 A;  1ANF A;  5HM4 B;  4ZS9 A;  4QRZ A;  2A5T B;  3KZG A;  4F1Y A;  4F1V A;  4RJZ A;  5TPA A;  1MH3 A;  2XD2 A;  1J1N A;  1NNP A;  3PPQ A;  4ESX A;  2F36 A;  1D4N A;  1NL5 A;  2HZL A;  1MQI A;  4EQB A;  2H5Y A;  3I3V A;  2I3V A;  1LGB C;  3FAT A;  3H7M A;  3N6U A;  1N7W A;  3PV0 E;  2QS2 A;  4IY5 A;  4OXV A;  5KZT A;  3CIJ A;  1PB7 A;  1ZJL A;  3TAJ A;  2LAO A;  4OEV A;  5H8N B;  3H3G A;  1PB9 A;  1QUK A;  1VE4 A;  2DWJ A;  1P1W A;  3GBB A;  1B46 A;  1Y9U A;  2OWT A;  3TCG A;  2YPN A;  2DE2 A;  5DVF A;  4OQO A;  4FAJ A;  4RPN A;  4ZED A;  1NNT A;  3KG2 A;  2UXA A;  3ONM A;  2DWI A;  4P11 A;  5L9M A;  3V8X B;  4EF2 A;  5FTI A;  2V3U A;  3N5L A;  2XXV A;  2DE3 A;  1JQF A;  2E1S A;  1AMF A;  2UVI A;  4YIC A;  1SD3 A;  3PUZ E;  4NF6 B;  2QL3 A;  3ILU B;  3CSB A;  5TPA B;  1LB9 A;  3IOW A;  3G3I A;  3IR1 A;  2DYX A;  4G68 C;  1Q35 A;  4ZEC A;  4F39 A;  1IIT A;  3FJG A;  1PB8 A;  2F6P A;  1MM7 A;  2VP1 A;  3OSQ A;  3P7I A;  4GXS B;  4MF3 A;  3S4U A;  3VVE A;  5I58 B;  3FVG A;  2IEE A;  2DWA A;  3LR1 A;  4KCD A;  5AA3 A;  3SEY A;  5DVJ A;  3B7D A;  3B6T A;  1RKM A;  3LBS A;  4H0W A;  3I5O A;  4XTC Q;  1YPN A;  5H8H A;  5I59 B;  4NF4 B;  2QPQ A;  3S9L C;  2G29 A;  1LCT A;  1A8E A;  1MXX A;  4LP2 B;  3MWB A;  2B65 A;  1D9Y A;  3IX1 A;  1M5D A;  3K1N A;  3O9P A;  4ECF A;  5AA2 D;  3MP6 A;  4BDM A;  4OFO A;  5I56 B;  1SI1 A;  1LAH E;  2DP8 A;  2VGQ A;  3PMV A;  3W15 C;  1HSJ A;  3N6T A;  3TDJ A;  2F35 A;  3BFT A;  3HHF A;  3H06 B;  3QUF A;  2I0C A;  3WAF A;  4GVO A;  1B7H A;  1SYI A;  4OER A;  4OYV A;  1MY0 A;  5EHM A;  2ESN A;  4UAC A;  3SES A;  5KDT A;  2Z22 A;  3U94 A;  3S9E A;  2XHD A;  3K1P A;  4R2F A;  3UGW A;  5I2N A;  1NMU A;  4LAT A;  3QAX A;  3ZSF A;  4F19 A;  4F3B A;  5AA1 A;  3MJN A;  2IA4 A;  2VHA A;  3H03 A;  3K6V A;  3EN3 A;  4G68 B;  1MXZ A;  4LZ8 A;  4OEN A;  3T9V A;  2Z23 A;  2HEU A;  3K00 A;  2GHB A;  2XX9 A;  3K2D A;  4GF8 A;  4IY6 A;  4NF8 B;  4R6K A;  4ZE8 A;  5H8F B;  1SYH A;  3EQ1 A;  3PUX E;  5CRY A;  3VVF A;  2Y7K A;  3FVO A;  4X1D A;  3H6T A;  2O69 A;  2RCB A;  3LSX A;  1XS5 A;  2ZYN A;  3OD7 A;  4F18 A;  1FTM A;  1FQC A;  3VLV A;  1US4 A;  4NF5 B;  4RY1 A;  1LLS A;  4KHZ E;  3ZKL A;  2V93 A;  4QFN A;  5DEX B;  4R6Y A;  5ITP A;  1AIV A;  5A5X A;  3TOD A;  1XVX A;  1Q1K A;  1B3F A;  3O6H A;  4ZE9 A;  1US5 A;  1B2H A;  3I6V A;  3FV1 A;  3FVN A;  4P0I A;  4AQ4 A;  3TTL A;  1H3D A;  1URD A;  1D9V A;  2AL4 A;  1A40 A;  2REG A;  4OET A;  4QFK A;  4OHN A;  5TP9 A;  3K6X A;  3UN6 A;  1ZU0 A;  4E0X A;  2Y7R A;  1OMP A;  4QSE A;  3IJX B;  2I0B A;  2I3W A;  1Y20 A;  1Z7M E;  1YTV A;  4IO2 A;  4FE8 A;  2B3B A;  3CFX A;  3FVK A;  4JWX A;  4OTE A;  1Y4C A;  4RK9 A;  3SER A;  3KN8 A;  4XKR A;  1SVX B;  2P1S A;  4OEU A;  2A5S A;  3QYT A;  4GLI A;  5ELV A;  4FJP A;  2OBG A;  3RN8 A;  4F22 A;  3U1O A;  3DP6 A;  1B1X A;  3KJ7 A;  1S7Y A;  1MPB A;  1B7Z A;  1FQE A;  4OFJ A;  4Q0C A;  1Z7N E;  1ATG A;  2QRY A;  4YKP A;  1ZIU A;  2GHA A;  2NOO A;  3M8U A;  3O97 A;  3SEU A;  3T9X B;  3IOU A;  4GL8 A;  3T96 B;  3RTW B;  2DE4 A;  5BWJ A;  2GH9 A;  3A3C A;  4GXA A;  4YB6 A;  3SEX A;  4F29 A;  1JVX A;  2OK2 A;  3IAZ A;  3F11 A;  4RPO A;  3SKP A;  3MP1 A;  1LST A;  2H99 A;  3JYR A;  3TZA A;  5KCJ A;  4YKI A;  2B3F A;  3PD9 A;  1TXF A;  1II5 A;  4JWY A;  1SI0 A;  2I48 A;  1MY3 A;  5I57 B;  2ZNT A;  1WDN A;  2DVC A;  2R6G E;  3HPI A;  4JB7 A;  2I6E A;  4ND9 A;  4RYA A;  3MZB A;  1BTJ A;  2PT1 A;  2XXP A;  2XX7 A;  3U72 A;  5AA4 A;  4FAT A;  3QK6 A;  3RTF B;  4XXU A;  3WAE A;  2Q8J A;  5AE4 A;  2RF1 A;  2ONS A;  3W9V A;  4G8H A;  1QJM A;  4KYD A;  4NWC A;  3RGY A;  3O66 A;  1H43 A;  1H44 A;  2OZZ A;  3RQT A;  3CR9 A;  5JEI A;  2Z8D A;  2HXW A;  1Y3P A;  2RIN A;  5F7V A;  3PPP A;  3RY3 A;  3Q26 A;  3FJ7 A;  5CM6 A;  3AXF A;  1JNF A;  2BJJ X;  3KN7 A;  3MZ1 A;  4P0G A;  1B3G A;  3PMW A;  2YJP A;  3HST A;  1SW2 A;  3FUZ A;  3FGS A;  3IB1 A;  3THI A;  3FJM A;  1WVJ A;  5KCJ B;  2THI A;  5LOM A;  1Y4T A;  2D5W A;  4ISU A;  1N7X A;  4MBP A;  4OFL A;  1B05 A;  4N13 A;  4PFY A;  3SDF A;  1NKX A;  1B52 A;  3TEL A;  4ELP A;  1QUJ A;  3C33 A;  4JWO A;  4OVJ A;  5CMM A;  4LON B;  1N76 A;  1LFG A;  3PPN A;  5FTH A;  4ZEI A;  1N0T A;  3VXB A;  5CC2 A;  4U22 A;  4IB2 A;  3CI8 A;  1GGG A;  3JV9 A;  1EZ9 A;  1M5E A;  2GRV A;  1URG A;  2HZK A;  3C32 A;  1JEV A;  5JTY B;  4F2Q A;  1A99 A;  2QSX A;  3EHU A;  1NH7 A;  5H8Q A;  1OIB A;  1DTG A;  4H67 A;  3OEK A;  4AB6 A;  4EQ9 A;  1SQY A;  1DPP A;  1ELJ A;  1JW1 A;  1FTO A;  1MY2 A;  2Z8F A;  3DM0 A;  2ZNU A;  3G3J A;  3M3F A;  4ELQ A;  2H25 A;  4EUO A;  4JBZ A;  4RK2 A;  3VV5 A;  4JDF A;  3KBR A;  3N94 A;  1VR5 A;  1BLF A;  3IO6 A;  3EHT A;  2H9B A;  2NUV A;  3IJO B;  2AYS A;  1IEJ A;  2HAV A;  1B7U A;  2UYE A;  2XXW A;  4FOR A;  4U1O A;  3TCH A;  4U4S A;  5K2X A;  1DSN A;  2PVU A;  3HV1 A;  2ALU A;  2X7P A;  3VFJ A;  3K01 A;  1QKA A;  4PET A;  1OLA A;  2I4C A;  3ZS6 A;  4KPT A;  2DQV A;  3PPO A;  3RUM A;  3UOR A;  5I84 A;  3KEI A;  4KD5 A;  2GFE A;  1I6Q A;  1OQH A;  1Y3Q A;  3GBA A;  4F31 B;  2ONK E;  4X48 A;  3UP9 A;  4G77 A;  4HW8 A;  1B3H A;  2XX8 A;  4C0R A;  2O1M A;  4N6P A;  1N04 A;  4FED A;  1A7L A;  5M2V A;  5ICT A;  1OQG A;  4LQ5 A;  4ONY A;  1IUD A;  4U23 A;  1FTL A;  2X26 A;  3DP8 A;  3FZV A;  4NE4 A;  3MVX A;  4ZZE A;  2Y7I A;  1PEB A;  1B5H A;  3C4M A;  4OZ9 A;  4Q5T A;  1H45 A;  2VOZ A;  4RNS A;  4UA8 A;  2XXR A;  4THI A;  4DCX A;  4DXC A;  2AL5 A;  1Y1M A;  2E0S A;  2Y7P A;  4KFQ A;  5I2N B;  2UVH A;  3E3K A;  3A3U A;  4MFI A;  3IO4 A;  1D3K A;  1IXH A;  4ZEB A;  3K4U A;  5F1Q A;  1NNF A;  1ZKB A;  3U93 A;  3K1M A;  3B6W A;  3JZJ A;  4DCY A;  1POY 1;  4GIZ A;  2UVJ A;  1B6H A;  4WXJ A;  3UIF A;  5IKB A;  5JTY A;  1B1H A;  1JW4 A;  4BDR A;  3RPW A;  2O6A A;  1QUI A;  3UA8 A;  2ANJ A;  2VD2 A;  3U8Q A;  1RYO A;  1MDQ A;  3KSX A;  2HAU A;  3OO6 A;  4TOZ A;  4HCY A;  3MVY A;  4U2R A;  2UVG A;  4Z7E A;  1NH8 A;  3KFM A;  1XC1 A;  1B5J A;  3Q25 A;  1Y3N A;  1LBB A;  3USD A;  5BUU A;  1JW5 A;  1MM6 A;  3HN0 A;  5H8H B;  1BP5 A;  3Q27 A;  2RCA A;  2ZXT A;  2DOJ A;  4R6H A;  4GQO A;  1KWH A;  3O28 A;  4ZEK A;  5CI5 A;  1MY1 A;  1EH3 A;  1P1O A;  3TTN A;  1TFA A;  5I2K B;  1I6A A;  1LBC A;  3LSF B;  2XXQ A;  2AIX A;  3ECR A;  4N07 A;  3ILT B;  2HCA A;  2PYY A;  4YKK A;  4JSO A;  4YZZ A;  3OOA A;  2XXH A;  4RXL A;  5CMC A;  4QHQ A;  1GTK A;  2D21 A;  4LA9 A;  3TTM A;  5CBR A;  1MY4 A;  3C36 A;  4DDD A;  2Y84 A;  5DT6 A;  1B3E A;  2QS3 A;  2F8D A;  4ESW A;  1A55 A;  4Q30 B;  2DWH A;  3G3H A;  4NWD A;  1NFT A;  4POX A;  5EHS A;  3VXC A;  4DXU A;  5I57 A;  4H5G A;  3Q29 A;  1UTH A;  4TLM B;  2W7Y A;  1USY E;  4G8N A;  3TMG A;  2QMW A;  3R6U A;  4YMA A;  1FQB A;  4PFU A;  3SET A;  3QIM A;  5H8N A;  1VSO A;  5H8S A;  2ABH A;  3HO7 A;  4NMY A;  4YU0 A;  1BKA A;  3C35 A;  2M8C A;  2OWS A;  1B4H A;  3FV2 A;  3N26 A;  4GWO A;  4FIM A;  4ZDM A;  1GV8 A;  1YCJ A;  2ZYO A;  1LFI A;  1FQD A;  3E4R A;  1AL3 A;  1N3X A;  1TT1 A;  3MPK A;  3IB0 A;  3KN3 A;  3MC2 A;  1HSE A;  1POT A;  1N3W A;  1OVB A;  1R9L A;  1USY H;  4QF9 A;  1VFD A;  5TP9 B;  3Q28 A;  3TUS A;  1EU8 A;  3FD3 A;  2RC8 A;  1BIY A;  1MXV A;  4WKM A;  4LVQ A;  3W9W A;  1QW0 A;  1UIV A;  1S50 A;  5IAI A;  2CZL A;  3EPE A;  1WOD A;  3QSL A;  4X1B A;  2ONR A;  3TYH A;  4MLV A;  3K6U A;  3D4G A;  3FXU A;  1CE2 A;  4BDO A;  5B7D A;  1EZO A;  4GRK A;  4K3F A;  3FXQ A;  3OEN A;  1JET A;  2RC9 A;  3H6V A;  5DTB A;  1OVT A;  2REJ A;  4H1X A;  3ZKK A;  4F3S A;  4R9F A;  2Y7W A;  3E13 X;  1O64 A;  3TCF A;  4NF8 A;  4IO4 A;  5I2K A;  3S9N C;  3PMX A;  3RT8 A;  2R71 A;  1FQF A;  2OJT A;  3KSJ A;  4KYS A;  4G8M A;  2HQ0 A;  4KQP A;  4KCC A;  1IZ1 A;  2FYI A;  2ZYM A;  3K6W A;  4RA1 A;  5CBS A;  4XKP A;  4GOT A;  4MH5 A;  2DXR A;  3T66 A;  2O68 A;  4QSC A;  5ITO A;  3TTK A;  3SEW A; 
#chains in the Genus database with same CATH topology
 1AH5 A;  2PCR A;  1A54 A;  3TTR A;  2QVU A;  5FHN A;  1R6Z A;  3OO9 A;  4AB5 A;  1FBE A;  4OWD A;  4QSD A;  5FHM A;  2DXY A;  1LFH A;  1G0H A;  3TEP A;  4I8C A;  2QJE A;  3MZ9 A;  4OMB A;  2WKY A;  2BJI A;  4M4G A;  5L9S A;  4DXB A;  3VE1 B;  1PBQ A;  2MKZ A;  4U4X A;  5HBC A;  1FBC A;  2OLB A;  1IXG A;  4I40 A;  3MPL A;  2Q89 A;  1Y1Z A;  2XXI A;  1B9J A;  3CVG A;  3U65 A;  3ODB A;  4NGU A;  1VFE A;  1SW1 A;  2V4C A;  5T3J A;  3R7X A;  4F3P A;  2QMX A;  2F3D A;  3CFL A;  1UTH B;  1KA0 A;  1HSL A;  2B4L A;  5H8F A;  1LAF E;  1XVY A;  4AS4 A;  4PC9 A;  3FXR A;  2PX1 A;  3PUW E;  5L8D A;  5EYH A;  3PPR A;  2DSF A;  4PFR A;  3T9H B;  2ZYK A;  2PT2 A;  4QBA A;  4YB7 A;  5IZ1 A;  4NF6 A;  3RLF E;  2X7Q A;  4PBH A;  4QFP A;  5AA4 B;  4HCW A;  1JVY A;  4YAH X;  2Q88 A;  4IO3 A;  4JVD A;  1K9Y A;  1S9T A;  3QXM A;  3C9H A;  5ISU A;  3OMB A;  1FPL A;  3C34 A;  2HFB A;  5L9O A;  4IO5 A;  4GL0 A;  1MRP A;  4HE2 A;  3OEL A;  1MXY A;  4O3B A;  1R1N A;  1M5C A;  4JXI A;  3T93 B;  5ET5 A;  1NNK A;  3KOT A;  5AA2 A;  1EYI A;  1P1N A;  1MXU A;  4TQU Q;  2V3Q A;  1SDX A;  4NF5 A;  3OEM A;  3MQ9 A;  3V83 A;  1JEU A;  2H4I A;  1FPJ A;  1RDY A;  2NVU B;  3IOR A;  5I56 A;  3A09 A;  3OO8 A;  4X9T A;  4G61 A;  2O7I A;  3BKI B;  1LCF A;  5KDT B;  1TWY A;  2F97 A;  3HHG A;  1SW5 A;  4EF1 A;  3D1R A;  1B32 A;  3K0V A;  4NTL A;  2A5T B;  1LBV A;  4RJZ A;  1MH3 A;  2XD2 A;  4ESX A;  3PPQ A;  1RDZ A;  2F36 A;  1NL5 A;  2I3V A;  3FAT A;  3H7M A;  4NF0 A;  4PE3 A;  3CIJ A;  1PB7 A;  1QUK A;  3GBB A;  3BIH A;  2QVV A;  4FAJ A;  3KG2 A;  2DE3 A;  4NF6 B;  5TPA B;  1LB9 A;  3IOW A;  1Q35 A;  4ZEC A;  3FJG A;  3P7I A;  5I58 B;  3FVG A;  2IEE A;  2QFL A;  2DWA A;  4XTC Q;  1YPN A;  2QPQ A;  1A8E A;  1MXX A;  1D9Q A;  3MWB A;  4PAK A;  2ZZW A;  1D9Y A;  3K1N A;  1M5D A;  1IMF A;  1FBG A;  3A29 A;  5I56 B;  3W15 C;  1HSJ A;  3BFT A;  3QUF A;  2I0C A;  4NX1 A;  3U94 A;  3S9E A;  2XHD A;  3K1P A;  4R2F A;  4LAT A;  3ZSF A;  4F3B A;  5AA1 A;  2IA4 A;  3EN3 A;  2Z23 A;  3K00 A;  2XX9 A;  3K2D A;  4NF8 B;  4ZE8 A;  1SYH A;  2Y7K A;  3FVO A;  3H6T A;  2ZYN A;  1FTM A;  1DBZ A;  4NF5 B;  1FBF A;  1XVX A;  3I6V A;  4P0I A;  3TTL A;  1URD A;  1D9V A;  3UN6 A;  1FJ9 A;  5TP9 A;  4QFK A;  2Y7R A;  1NV3 A;  1OMP A;  4QSE A;  3E79 A;  4PF6 A;  2CZI A;  3FVK A;  4UAB A;  4XKR A;  4OEU A;  5ELV A;  3QYT A;  4N4U A;  4AS5 A;  2OBG A;  4F22 A;  1B1X A;  1S7Y A;  1MPB A;  4YKP A;  1Z7N E;  3IOU A;  4GL8 A;  3T96 B;  3SKP A;  2H99 A;  5KCJ A;  4N15 A;  3PD9 A;  1VDW A;  1SI0 A;  3HPI A;  1WDN A;  4JB7 A;  4RYA A;  2XXP A;  3RTF B;  4XXU A;  3WAE A;  2ONS A;  2VPN A;  4G8H A;  4NWC A;  5JEI A;  2OZZ A;  5F7V A;  3FJ7 A;  3AXF A;  3MZ1 A;  4P0G A;  4O8M A;  3HST A;  1SW2 A;  3IB1 A;  5LOM A;  1Y4T A;  4ISU A;  4OFL A;  5ICQ A;  4PFY A;  3C33 A;  4GWZ A;  4JWO A;  3SZP A;  4LON B;  1N0T A;  3VXB A;  4U22 A;  1FPB A;  3C32 A;  5JTY B;  1JEV A;  1NH7 A;  1OIB A;  3OEK A;  1ELJ A;  5IM2 A;  5I5P A;  2ZNU A;  4XEQ A;  4EUO A;  3N94 A;  1IMC A;  3IO6 A;  3IJO B;  2AYS A;  3TCH A;  1DSN A;  2X7P A;  3VFJ A;  2FHY A;  2WBD A;  3K01 A;  3PPO A;  2Y5K A;  5I84 A;  3T1B A;  1Y3Q A;  3GBA A;  1EYK A;  4F31 B;  2ONK E;  4HW8 A;  1N04 A;  4LQ5 A;  4U23 A;  2X26 A;  3FZV A;  3ROJ A;  2Y7I A;  2WX9 A;  4UA8 A;  4DCX A;  4THI A;  5I2N B;  4DXC A;  2E0S A;  4I3E A;  3E3K A;  4MFI A;  1D3K A;  4ZEB A;  4OVP A;  5F1Q A;  1POY 1;  4GIZ A;  1B6H A;  1JW4 A;  5EQ9 A;  1LEV A;  2VD2 A;  1RYO A;  3KSX A;  2HAU A;  3OO6 A;  4TOZ A;  4HCY A;  3MVY A;  2R8T A;  4Z7E A;  4XFE A;  4GX6 A;  1XC1 A;  3Q25 A;  1JW5 A;  1KWH A;  3TTN A;  1TFA A;  1LBC A;  4JSO A;  4YZZ A;  2D21 A;  4LA9 A;  4DDD A;  2QS3 A;  1NV2 A;  4POX A;  1NFT A;  3VXC A;  4H5G A;  3Q29 A;  1UTH A;  1FQB A;  2HHM A;  1IME A;  3QIM A;  5H8S A;  4YU0 A;  1BKA A;  3FV2 A;  4GWO A;  4FIM A;  1LFI A;  1FQD A;  1HSE A;  1POT A;  1R9L A;  1OVB A;  5TP9 B;  3TUS A;  3FD3 A;  2RC8 A;  4WKM A;  1QW0 A;  1S50 A;  2CZL A;  4H46 A;  2HPG A;  1CE2 A;  4GRK A;  5DTB A;  2REJ A;  3PMX A;  2R71 A;  1FQF A;  3KSJ A;  4KYS A;  2FYI A;  2ZYM A;  3T66 A;  4MH5 A;  4QSC A;  5ITO A;  3E78 A;  3TTK A;  5H8Q B;  1O7T A;  3L6G A;  4GD5 A;  4R9G A;  3VLW A;  3PGF A;  5JK4 A;  1ZMG A;  1YAE A;  4YMB A;  3K02 A;  3MVZ A;  4NED A;  1IXI A;  3TPA A;  1B3L A;  3T0J A;  2O1L A;  2DS9 A;  5I58 A;  1FQA A;  1MH4 A;  1MQJ A;  4JSD A;  4QFL A;  1MDP 1;  4M1V A;  4MIJ A;  2F5X A;  3ISP A;  4FEC A;  2Q74 A;  4H8J A;  1DTZ A;  3O6I A;  3FIR A;  3GZG A;  3S2V A;  3T22 A;  3DP4 A;  4BDQ A;  1R9Q A;  4KYE A;  4ELO A;  4NHB A;  1DMB A;  4IR8 A;  2R9J A;  3GLB A;  2XXY A;  3CSG A;  1FCK A;  1AOV A;  3LUZ A;  3R26 A;  3IL1 B;  2Q9T A;  1NV7 A;  3PU5 A;  2XXX A;  1FW0 A;  5LDZ A;  3MVW A;  4MNC A;  2F7A A;  4ZZA A;  1FPK A;  1UTB A;  1P1Q A;  1I69 A;  2OWZ A;  3U92 A;  2CMO A;  3OO7 A;  4G68 A;  5LTC A;  1OLC A;  4O3C A;  1IIW A;  3V89 B;  1YXI A;  4QXD A;  1PBP A;  1MG1 A;  3LV0 A;  5AA2 B;  5IGA A;  4OES A;  1N84 A;  1ZTY A;  1PDA A;  4G4P A;  4ELR A;  1CB6 A;  3LSL A;  3RNN A;  3MYU A;  3VDF A;  2OCU A;  4Z0I A;  2XXK A;  1UTB B;  5I7I A;  4PP0 A;  3V5A A;  2CZH A;  3M3K A;  4X04 A;  3HFU A;  2V25 A;  5CMB A;  3OXN A;  3KOS A;  1P1U A;  4NF4 A;  2Q8M A;  1FSA A;  5TU0 A;  4ZEF A;  3TQL A;  2G93 A;  1MPD A;  1UQW A;  5DVI A;  5ET8 A;  4OVS A;  1IQ7 A;  3U8Q A;  4R74 A;  3VLU A;  1NV0 A;  4KI0 E;  2ZNS A;  4C1T A;  2FNC A;  3MAM A;  2I58 A;  1GR2 A;  4F1V A;  2H5Y A;  3N6U A;  4OXV A;  4IY5 A;  4OEV A;  1P1W A;  2QVR A;  4HXV A;  5DVF A;  4P11 A;  3RPL B;  2V3U A;  4N81 A;  1AMF A;  3MST A;  4YIC A;  2QL3 A;  3ILU B;  3CSB A;  4LN5 A;  4NQ8 A;  4MX6 A;  3IR1 A;  4F39 A;  4MF3 A;  2F6P A;  1MM7 A;  2VP1 A;  5AE4 A;  3RYD A;  3S4U A;  3VVE A;  4KCD A;  5AA3 A;  3B7D A;  3LBS A;  2WBB A;  5I59 B;  1LCT A;  2B65 A;  4PFB A;  5AA2 D;  4OFO A;  3HHF A;  4OYV A;  5EHM A;  3SES A;  5KDT A;  1LBW A;  2VHA A;  3K6V A;  2L5V A;  4LZ8 A;  1MXZ A;  3IFC A;  4GF8 A;  2HEU A;  4IY6 A;  2GHB A;  2KQZ A;  3LSX A;  2RCB A;  1XS5 A;  1US4 A;  4HE0 A;  1IMD A;  1LLS A;  2V93 A;  5DEX B;  4R6Y A;  5ITP A;  3TOD A;  1Q1K A;  2VPO A;  3NOH A;  1US5 A;  1B2H A;  3FVN A;  4AQ4 A;  1H3D A;  1BK4 A;  1A40 A;  3K6X A;  4N91 A;  2I0B A;  2I3W A;  1Y20 A;  1Z7M E;  1YTV A;  4RK9 A;  4Q8R A;  2B3B A;  4GLI A;  3IFA A;  3RN8 A;  3DP6 A;  3KJ7 A;  4N6D A;  1FQE A;  4OFJ A;  1ATG A;  1Q9D A;  2GHA A;  3O97 A;  3T9X B;  2GH9 A;  4YB6 A;  2OK2 A;  3TZA A;  4GWU A;  1FPI A;  2B3F A;  1II5 A;  5I57 B;  2I48 A;  1LBZ A;  2ZNT A;  2DVC A;  2I6E A;  1BTJ A;  4FAT A;  3QK6 A;  1NUZ A;  2Q8J A;  3RGY A;  3O66 A;  1H44 A;  3CR9 A;  4KXP A;  1Y3P A;  2RIN A;  3PPP A;  3Q26 A;  5CM6 A;  2GQ1 A;  2BJJ X;  3THI A;  1WVJ A;  1N7X A;  3ZS6 A;  4ELP A;  1LBX A;  4OVJ A;  4ZEI A;  5CC2 A;  5ESY A;  4IB2 A;  1URG A;  1A99 A;  5H8Q A;  4PDH A;  1DTG A;  1G0I A;  4H67 A;  4AB6 A;  2P3N A;  1SQY A;  1DPP A;  1JW1 A;  2Z8F A;  2H25 A;  4JBZ A;  1VR5 A;  2NUV A;  2HAV A;  4U1O A;  2CZK A;  4PET A;  1OLA A;  3KEI A;  4KD5 A;  2GFE A;  2XWV A;  2KR0 A;  4X48 A;  1B3H A;  3FBP A;  4FED A;  4N6P A;  1A7L A;  1FTL A;  3MVX A;  4ZZE A;  3C4M A;  1Y1M A;  2UVH A;  3IO4 A;  3K1M A;  3B6W A;  3JZJ A;  4WXJ A;  3UA8 A;  2ANJ A;  1MDQ A;  2CEY A;  2UVG A;  3KFM A;  1B5J A;  3USD A;  1BP5 A;  4R6H A;  3O28 A;  1P1O A;  5I2K B;  3LSF B;  3ILT B;  3OOA A;  2XXH A;  4RXL A;  5CMC A;  3TTM A;  5DT6 A;  2F8D A;  4Q30 B;  2DWH A;  2CEX A;  4DXU A;  2W7Y A;  1USY E;  5EYG A;  3R6U A;  1FBH A;  5FBP A;  4NMY A;  3C35 A;  1B4H A;  3N26 A;  4ZDM A;  1FBD A;  1AL3 A;  3MC2 A;  4GBV A;  1USY H;  1VFD A;  1FBP A;  3Q28 A;  1BIY A;  1MXV A;  4N8Y A;  3W9W A;  4DI3 D;  2ZZV A;  3EPE A;  1WOD A;  3TYH A;  4MLV A;  3FXU A;  5B7D A;  5EQ8 A;  1RDX A;  3OEN A;  3ZKK A;  5ET6 A;  4PDD A;  3E13 X;  1O64 A;  3RT8 A;  2OJT A;  2Y5L A;  1NUX A;  4KQP A;  4O7M A;  3K6W A;  4RA1 A;  5CBS A;  4XKP A;  2O68 A;  2PBW A;  1SW4 A;  4EQ7 A;  3IB2 A;  1P99 A;  1A8F A;  4BLA A;  5EYF A;  2XD3 A;  1FPF A;  1QUL A;  1F9B A;  3L6H A;  4WED A;  1M5F A;  4YKJ A;  4EDP A;  1NV4 A;  2Q2A A;  3LUY A;  5IZ3 B;  2F78 A;  1IXC A;  4H6D A;  4PFT A;  2KLF A;  2PMS A;  2F7B A;  1O63 A;  3CRB A;  4MMP A;  4IO7 A;  5I59 A;  1GVC A;  4LZ5 A;  3B50 A;  1XI6 A;  2YLN A;  4I3Y A;  3GYY A;  3E9X A;  4WEP A;  1ZBM A;  2DVZ A;  4GWW A;  4HS7 A;  1XOC A;  1SPI A;  4POW A;  2H98 A;  1B51 A;  3EHS A;  1B0L A;  2I49 A;  3H6U A;  4P8B A;  4R75 A;  2RC7 A;  2F34 A;  1YYZ A;  1MXW A;  3MUQ A;  4MNI A;  1B58 A;  4GFR A;  2VD3 A;  3IOV A;  4C1U A;  1T0K A;  1DPE A;  1DOT A;  1M5B A;  3OSR A;  3S9M C;  3M3L A;  3BFU A;  1MQD A;  4IO6 A;  1I6B A;  3KBZ A;  2ZMB A;  2D3I A;  3VVD A;  4DIG A;  1FTJ A;  3KJT A;  4F3G A;  5K2Y A;  3TKD A;  1FRP A;  5EQ7 A;  4G2Z A;  3G3K A;  3PD8 A;  2P2A A;  4H65 A;  1FTA A;  2O7U A;  4FEB A;  3PUY E;  4P1E A;  5FHO A;  4I9D A;  3KGC A;  1B5I A;  4XKN A;  2JJK A;  2Z8E A;  3G3G A;  3MP8 A;  1LB8 A;  2XXT A;  3DLN A;  3TFL A;  4BDL A;  1ZLQ A;  1B40 A;  3H6W A;  4NAP A;  4O3A A;  4PE5 B;  3O29 A;  4U1Z A;  2WEF A;  2FA7 A;  3FAS A;  1ANF A;  5HM4 B;  3KZG A;  5TPA A;  1J1N A;  1KZ8 A;  1NNP A;  2HXR A;  2HZL A;  2PFY A;  4EQB A;  3I3V A;  1LGB C;  1ZJL A;  3TAJ A;  5H8N B;  1PB9 A;  1VE4 A;  1B46 A;  2OWT A;  2YPN A;  4OQO A;  1NNT A;  5FTI A;  1K9Z A;  1SD3 A;  3PUZ E;  3RPL A;  1FPD A;  4G68 C;  4GXS B;  3LR1 A;  5H8H A;  3B6T A;  1RKM A;  3S9L C;  2G29 A;  4LP2 B;  3MP6 A;  1EYJ A;  1SI1 A;  2DP8 A;  2VGQ A;  3PMV A;  1NI9 A;  3TDJ A;  1B7H A;  4OER A;  1MY0 A;  1DK4 A;  2ZZX A;  4UAC A;  4GWY A;  3UGW A;  5I2N A;  1NMU A;  4F19 A;  4G68 B;  2VT5 A;  4O94 A;  3T9V A;  4R6K A;  3EQ1 A;  5CRY A;  4X1D A;  4PF8 A;  1FQC A;  3VLV A;  4RY1 A;  4QFN A;  5A5X A;  3O6H A;  3FV1 A;  2AL4 A;  2REG A;  4OET A;  4OHN A;  3IJX B;  1IMA A;  4FE8 A;  3CFX A;  1AWB A;  1Y4C A;  3SER A;  3KN8 A;  4FJP A;  3U1O A;  4MNP A;  1B7Z A;  2NOO A;  3SEU A;  3RTW B;  2DE4 A;  5BWJ A;  3A3C A;  4GXA A;  3IAZ A;  3F11 A;  4RPO A;  1LST A;  4PGN A;  3FXB A;  4YKI A;  1TXF A;  4JWY A;  4ND9 A;  2RF1 A;  1QJM A;  4KYD A;  1H43 A;  2Z8D A;  2HXW A;  3B8B A;  3RY3 A;  1JNF A;  1NV5 A;  3FUZ A;  3FGS A;  3FJM A;  2FIX A;  2D5W A;  3SDF A;  1B05 A;  4N13 A;  1NKX A;  3BIG A;  1LFG A;  3PPN A;  5FTH A;  3CI8 A;  1GGG A;  3JV9 A;  1EZ9 A;  1M5E A;  2QSX A;  5A5L A;  4EQ9 A;  1MY2 A;  3G3J A;  4O7I A;  3VV5 A;  4JDF A;  1BLF A;  1IEJ A;  4FOR A;  2XXW A;  4U4S A;  5K2X A;  1QKA A;  2I4C A;  2DQV A;  3UOR A;  4XF5 A;  4N17 A;  4G77 A;  2XX8 A;  2O1M A;  1DCU A;  5M2V A;  1OQG A;  4PBQ A;  1IUD A;  3DP8 A;  1PEB A;  4OZ9 A;  2VOZ A;  4RNS A;  2Y7P A;  3K4U A;  1ZKB A;  3U93 A;  4DCY A;  2UVJ A;  3UIF A;  5JTY A;  1B1H A;  3RPW A;  1QUI A;  4FBP A;  4U2R A;  1Y3N A;  1MM6 A;  3Q27 A;  4GQO A;  4ZEK A;  1MY1 A;  2AIX A;  3ECR A;  4N07 A;  2HCA A;  2PYY A;  4YKK A;  2FBP A;  4QHQ A;  3C36 A;  4GWS A;  2Y84 A;  4ESW A;  4GBW A;  1A55 A;  3G3H A;  4NWD A;  5EHS A;  4G8N A;  4HE1 A;  3TMG A;  2QMW A;  4YMA A;  4PFU A;  1VSO A;  4JVC A;  3HO7 A;  2M8C A;  1GV8 A;  2ZYO A;  3E4R A;  3MPK A;  4F1Y A;  3IB0 A;  3KN3 A;  4QF9 A;  1EU8 A;  4LVQ A;  5IAI A;  4X1B A;  2ONR A;  3D4G A;  1EZO A;  4K3F A;  3FXQ A;  3H6V A;  1OVT A;  4H1X A;  4OVT A;  1NUY A;  3TCF A;  4NF8 A;  2HQ0 A;  4KCC A;  1IZ1 A;  2DXR A;  4PFI A;  3SEW A;  3H4Z A;  1LAX A;  5HPQ A;  3BBR A;  4MLQ A;  4EXL A;  2WYK A;  4YB5 A;  2QS4 A;  4TLL B;  2I4B A;  3RT6 B;  3PTY A;  4X8R A;  1XHY A;  2XXU A;  4R2B A;  3IOT A;  5B70 A;  3CG1 A;  4P1L A;  4PQJ A;  4XIG Q;  4DE8 A;  1FJ6 A;  1FTK A;  3HCQ A;  3SEV A;  5DEX A;  4IGT A;  3D4C A;  2Q2C A;  4F1U A;  3CG3 A;  5DW8 A;  1MQH A;  3T9U A;  3MW0 A;  3DEL B;  3UK4 A;  4L17 A;  4F2O A;  2F7C A;  4NN3 A;  3GXA A;  4LQ2 A;  4PAF A;  3G7W A;  3C31 A;  1QKB A;  1MQG A;  4R72 A;  1EZP A;  4P3L A;  2XWO A;  2WYP A;  4DZ1 A;  4U21 A;  2NWJ A;  1PC3 A;  1MS7 A;  3CFZ A;  4KR5 A;  4MCO A;  4QFO A;  4GWX A;  1TFD A;  2V84 A;  4OVQ A;  1INP A;  3O6G A;  4R73 A;  1LAG E;  5F24 A;  4I62 A;  4LZ7 A;  3CHG A;  3LSW A;  1B4Z A;  4BDN A;  4XKQ A;  1SBP A;  4LUB A;  1L5T A;  4H5F A;  1XT8 A;  2P0S A;  5CMK A;  1B0H A;  3QUJ A;  4IGR A;  3KC0 A;  3LC8 A;  3PUV E;  5J1D A;  1MPC A;  3EF7 A;  3QMF A;  2UYF A;  3TQW A;  2O51 A;  4EXK A;  3IK6 B;  1UIU A;  5A5X B;  4N6K A;  4DLD A;  2NXO A;  3G3F A;  4GX4 A;  1RYX A;  1H76 A;  4E0W A;  2F6G A;  4PAI A;  2RKM A;  4PFW A;  4H8I A;  2DDK A;  1URS A;  3B6Q A;  1QVS A;  2O84 X;  2QS1 A;  1NV1 A;  2V3T A;  2A5T A;  4HTG A;  2PFZ A;  3O2A A;  3MBP A;  4I1D A;  5H8F B;  5DYH A;  4NG7 A;  3EKI A;  4ZS9 A;  4QRZ A;  1D4N A;  1MQI A;  3PV0 E;  1N7W A;  2QS2 A;  4OVR A;  5KZT A;  2LAO A;  3H3G A;  2DWJ A;  1Y9U A;  3TCG A;  2DE2 A;  4RPN A;  4ZED A;  2OX3 A;  5L9M A;  2UXA A;  3ONM A;  2DWI A;  4EF2 A;  3N5L A;  2XXV A;  1JQF A;  2E1S A;  2UVI A;  2B4M A;  3G3I A;  2DYX A;  1IIT A;  1PB8 A;  3OSQ A;  3KC1 A;  4P9K A;  3SEY A;  5DVJ A;  4H0W A;  3I5O A;  4NF4 B;  3IX1 A;  4ECF A;  3O9P A;  4BDM A;  1LAH E;  4P56 A;  3N6T A;  2F35 A;  3H06 B;  3WAF A;  4GVO A;  1SYI A;  2ESN A;  2Z22 A;  3QAX A;  4OAN A;  3MJN A;  3H03 A;  4OEN A;  3VVF A;  3PUX E;  5ET7 A;  2O69 A;  3OD7 A;  4F18 A;  4KHZ E;  3ZKL A;  1AIV A;  2XWI A;  2XA5 A;  1B3F A;  4ZE9 A;  4E0X A;  1ZU0 A;  1FPG A;  4IO2 A;  4OTE A;  5IZ3 A;  4JWX A;  1SVX B;  5I3S A;  2P1S A;  2A5S A;  1YZ0 A;  2FVZ A;  4Q0C A;  2QRY A;  1ZIU A;  3M8U A;  5IZZ A;  4F29 A;  3SEX A;  1JVX A;  3MP1 A;  3JYR A;  5EQA A;  1LBY A;  1MY3 A;  2F3B A;  2R6G E;  3MZB A;  5AA4 A;  2PT1 A;  2XX7 A;  3U72 A;  1CNQ A;  4GX3 A;  3W9V A;  3RQT A;  4MHF A;  3KN7 A;  1B3G A;  3PMW A;  2YJP A;  2XWK A;  5KCJ B;  2THI A;  4MAG A;  4MBP A;  3TEL A;  1B52 A;  1QUJ A;  4H45 A;  5CMM A;  1IMB A;  4MJO A;  1N76 A;  2GRV A;  2HZK A;  4F2Q A;  3EHU A;  1JP4 A;  2FIE A;  1FTO A;  4ELQ A;  3DM0 A;  3M3F A;  4OA4 A;  4MEV A;  4RK2 A;  3KBR A;  3EHT A;  2H9B A;  1B7U A;  2UYE A;  2PVU A;  3HV1 A;  2ALU A;  4KPT A;  3RUM A;  1NV6 A;  1I6Q A;  1OQH A;  1NUW A;  3UP9 A;  4C0R A;  5ICT A;  4ONY A;  4NE4 A;  5J16 A;  1B5H A;  4Q5T A;  1H45 A;  2XXR A;  2AL5 A;  4KFQ A;  3A3U A;  1IXH A;  1NNF A;  4PTK A;  5IKB A;  1QGX A;  4BDR A;  2O6A A;  1NH8 A;  5BUU A;  1LBB A;  3HN0 A;  4PGP A;  5H8H B;  2RCA A;  2ZXT A;  2DOJ A;  5CI5 A;  1EH3 A;  1I6A A;  1KA1 A;  2XXQ A;  2P3V A;  1FPE A;  1GTK A;  5CBR A;  4JVI A;  1MY4 A;  1B3E A;  5I57 A;  4TLM B;  3SET A;  5H8N A;  2ABH A;  2OWS A;  1YCJ A;  1TT1 A;  1N3X A;  3V8X B;  1N3W A;  1UIV A;  3QSL A;  3K6U A;  4BDO A;  1JET A;  2RC9 A;  4F3S A;  4R9F A;  2Y7W A;  4P47 A;  5I2K A;  4IO4 A;  3S9N C;  4G8M A;  4N8G A;  4PCD A;  4GOT A;  4DI4 B; 
#chains in the Genus database with same CATH homology
 1AH5 A;  1O7T A;  5H8Q B;  3H4Z A;  1LAX A;  3L6G A;  4GD5 A;  2PBW A;  4R9G A;  5HPQ A;  1SW4 A;  3VLW A;  3BBR A;  4MLQ A;  4EQ7 A;  3PGF A;  4EXL A;  3IB2 A;  5JK4 A;  1P99 A;  1ZMG A;  1A8F A;  1YAE A;  1A54 A;  5EYF A;  4YB5 A;  4BLA A;  2QS4 A;  4YMB A;  2XD3 A;  4TLL B;  5FHN A;  3TTR A;  2I4B A;  1R6Z A;  3OO9 A;  3K02 A;  4AB5 A;  3MVZ A;  4NED A;  3RT6 B;  4Q8R A;  1QUL A;  1F9B A;  1IXI A;  3L6H A;  4QSD A;  4OWD A;  4WED A;  1M5F A;  5FHM A;  3TPA A;  2DXY A;  1B3L A;  1LFH A;  2O1L A;  2DS9 A;  4YKJ A;  4EDP A;  2Q2A A;  3LUY A;  3TEP A;  5I58 A;  1XHY A;  2F78 A;  1IXC A;  2QJE A;  2XXU A;  3MZ9 A;  1FQA A;  2WKY A;  4H6D A;  4I8C A;  1MH4 A;  1MQJ A;  3IOT A;  4JSD A;  4M4G A;  4R2B A;  4DXB A;  5B70 A;  5L9S A;  4PFT A;  3CG1 A;  2KLF A;  2PMS A;  4QFL A;  1MDP 1;  4M1V A;  4PQJ A;  1PBQ A;  2F5X A;  2F7B A;  4U4X A;  4XIG Q;  5HBC A;  3VE1 B;  4DE8 A;  4FEC A;  1FTK A;  3HCQ A;  3SEV A;  1O63 A;  3CRB A;  4H8J A;  2OLB A;  5DEX A;  1DTZ A;  3O6I A;  3FIR A;  4IGT A;  1IXG A;  3GZG A;  3D4C A;  4IO7 A;  5I59 A;  2Q2C A;  1GVC A;  4LZ5 A;  4F1U A;  3CG3 A;  3S2V A;  2YLN A;  3T22 A;  3MPL A;  3DP4 A;  1MQH A;  2Q89 A;  1R9Q A;  1Y1Z A;  2XXI A;  3MW0 A;  1B9J A;  3T9U A;  4BDQ A;  3DEL B;  3CVG A;  3UK4 A;  4L17 A;  3ODB A;  4KYE A;  3E9X A;  4WEP A;  1ZBM A;  1VFE A;  2F7C A;  4F2O A;  2DVZ A;  4ELO A;  3GXA A;  1DMB A;  1SW1 A;  4HS7 A;  2R9J A;  3GLB A;  1XOC A;  4OMB A;  3R7X A;  4LQ2 A;  2QMX A;  2XXY A;  4F3P A;  3CFL A;  1UTH B;  3CSG A;  3G7W A;  4POW A;  1FCK A;  2H98 A;  3C31 A;  1QKB A;  1B51 A;  1HSL A;  1MQG A;  3EHS A;  5H8F A;  1AOV A;  1B0L A;  1LAF E;  2I49 A;  1XVY A;  4R72 A;  3H6U A;  4R75 A;  3R26 A;  1EZP A;  3IL1 B;  2RC7 A;  3FXR A;  2F34 A;  2PX1 A;  2Q9T A;  3PU5 A;  3PUW E;  2XXX A;  1FW0 A;  5L8D A;  3MVW A;  1MXW A;  3MUQ A;  3PPR A;  1B58 A;  2DSF A;  4DZ1 A;  4GFR A;  3T9H B;  4U21 A;  2NWJ A;  2ZYK A;  2PT2 A;  2VD3 A;  2F7A A;  3IOV A;  1PC3 A;  4YB7 A;  1MS7 A;  3CFZ A;  4KR5 A;  4NF6 A;  4ZZA A;  4QFO A;  1UTB A;  1TFD A;  1P1Q A;  3RLF E;  4C1U A;  1I69 A;  2V84 A;  2X7Q A;  3U92 A;  1T0K A;  4QFP A;  5AA4 B;  1DPE A;  3O6G A;  1DOT A;  1M5B A;  4R73 A;  2CMO A;  3OO7 A;  4G68 A;  1LAG E;  3OSR A;  4HCW A;  1JVY A;  1OLC A;  4YAH X;  2Q88 A;  4O3C A;  3S9M C;  3M3L A;  3BFU A;  1MQD A;  4I62 A;  4IO3 A;  1IIW A;  4LZ7 A;  4IO6 A;  1I6B A;  3LSW A;  1B4Z A;  4BDN A;  4XKQ A;  1SBP A;  3V89 B;  4LUB A;  1S9T A;  1L5T A;  4H5F A;  5ICQ A;  2ZMB A;  1PBP A;  2D3I A;  3VVD A;  1MG1 A;  3QXM A;  3C9H A;  1XT8 A;  2P0S A;  3OMB A;  1B0H A;  4DIG A;  5AA2 B;  5CMK A;  5ISU A;  3QUJ A;  4OES A;  1FTJ A;  3C34 A;  3KJT A;  4F3G A;  1N84 A;  5K2Y A;  4IGR A;  3LC8 A;  1ZTY A;  3TKD A;  2HFB A;  5L9O A;  3PUV E;  5J1D A;  1PDA A;  4IO5 A;  4GL0 A;  1MRP A;  4G2Z A;  3G3K A;  4G4P A;  4ELR A;  3OEL A;  1MPC A;  3EF7 A;  1MXY A;  1CB6 A;  2UYF A;  3PD8 A;  3LSL A;  2O51 A;  2P2A A;  4O3B A;  3TQW A;  4EXK A;  4H65 A;  1R1N A;  2O7U A;  1M5C A;  1UIU A;  3IK6 B;  3PUY E;  4FEB A;  4JXI A;  3RNN A;  3VDF A;  2OCU A;  3T93 B;  5FHO A;  4I9D A;  1NNK A;  3KGC A;  3KOT A;  5AA2 A;  1B5I A;  1P1N A;  4XKN A;  1MXU A;  4TQU Q;  5A5X B;  4DLD A;  4Z0I A;  2V3Q A;  2Z8E A;  1SDX A;  2NXO A;  3G3G A;  1UTB B;  3MP8 A;  3OEM A;  4NF5 A;  3G3F A;  4PP0 A;  3MQ9 A;  3V83 A;  1LB8 A;  2XXT A;  3DLN A;  1JEU A;  3V5A A;  2H4I A;  1RYX A;  1H76 A;  2NVU B;  3TFL A;  4E0W A;  3IOR A;  4BDL A;  1ZLQ A;  2F6G A;  3M3K A;  1B40 A;  5I56 A;  3A09 A;  2RKM A;  2V25 A;  4PFW A;  4H8I A;  5CMB A;  3OO8 A;  3H6W A;  1URS A;  3B6Q A;  3VLU A;  4X9T A;  3OXN A;  2O7I A;  4O3A A;  1QVS A;  2O84 X;  3BKI B;  1P1U A;  3KOS A;  1LCF A;  4NF4 A;  4PE5 B;  3O29 A;  4U1Z A;  5TU0 A;  2QS1 A;  4ZEF A;  2V3T A;  3TQL A;  5KDT B;  2G93 A;  1MPD A;  1TWY A;  1UQW A;  2F97 A;  3HHG A;  1SW5 A;  5DVI A;  4EF1 A;  2A5T A;  4HTG A;  2FA7 A;  1B32 A;  1IQ7 A;  3K0V A;  3O2A A;  3MBP A;  4I1D A;  4KI0 E;  2ZNS A;  4R74 A;  2FNC A;  3FAS A;  4NTL A;  5DYH A;  3MAM A;  2I58 A;  4C1T A;  1GR2 A;  1ANF A;  5HM4 B;  4ZS9 A;  4QRZ A;  2A5T B;  3KZG A;  4F1Y A;  4F1V A;  4RJZ A;  5TPA A;  1MH3 A;  2XD2 A;  1J1N A;  1NNP A;  3PPQ A;  4ESX A;  2F36 A;  1D4N A;  1NL5 A;  2HZL A;  1MQI A;  4EQB A;  2H5Y A;  3I3V A;  2I3V A;  1LGB C;  3FAT A;  3H7M A;  3N6U A;  1N7W A;  3PV0 E;  2QS2 A;  4IY5 A;  4OXV A;  5KZT A;  3CIJ A;  1PB7 A;  1ZJL A;  3TAJ A;  2LAO A;  4OEV A;  5H8N B;  3H3G A;  1PB9 A;  1QUK A;  1VE4 A;  2DWJ A;  1P1W A;  3GBB A;  1B46 A;  1Y9U A;  2OWT A;  3TCG A;  2YPN A;  2DE2 A;  5DVF A;  4OQO A;  4FAJ A;  4RPN A;  4ZED A;  1NNT A;  3KG2 A;  2UXA A;  3ONM A;  2DWI A;  4P11 A;  5L9M A;  3V8X B;  4EF2 A;  5FTI A;  2V3U A;  3N5L A;  2XXV A;  2DE3 A;  1JQF A;  2E1S A;  1AMF A;  2UVI A;  4YIC A;  1SD3 A;  3PUZ E;  4NF6 B;  2QL3 A;  3ILU B;  3CSB A;  5TPA B;  1LB9 A;  3IOW A;  3G3I A;  3IR1 A;  2DYX A;  4G68 C;  1Q35 A;  4ZEC A;  4F39 A;  1IIT A;  3FJG A;  1PB8 A;  2F6P A;  1MM7 A;  2VP1 A;  3OSQ A;  3P7I A;  4GXS B;  4MF3 A;  3S4U A;  3VVE A;  5I58 B;  3FVG A;  2IEE A;  2DWA A;  3LR1 A;  4KCD A;  5AA3 A;  3SEY A;  5DVJ A;  3B7D A;  3B6T A;  1RKM A;  3LBS A;  4H0W A;  3I5O A;  4XTC Q;  1YPN A;  5H8H A;  5I59 B;  4NF4 B;  2QPQ A;  3S9L C;  2G29 A;  1LCT A;  1A8E A;  1MXX A;  4LP2 B;  3MWB A;  2B65 A;  1D9Y A;  3IX1 A;  1M5D A;  3K1N A;  3O9P A;  4ECF A;  5AA2 D;  3MP6 A;  4BDM A;  4OFO A;  5I56 B;  1SI1 A;  1LAH E;  2DP8 A;  2VGQ A;  3PMV A;  3W15 C;  1HSJ A;  3N6T A;  3TDJ A;  2F35 A;  3BFT A;  3HHF A;  3H06 B;  3QUF A;  2I0C A;  3WAF A;  4GVO A;  1B7H A;  1SYI A;  4OER A;  4OYV A;  1MY0 A;  5EHM A;  2ESN A;  4UAC A;  3SES A;  5KDT A;  2Z22 A;  3U94 A;  3S9E A;  2XHD A;  3K1P A;  4R2F A;  3UGW A;  5I2N A;  1NMU A;  4LAT A;  3QAX A;  3ZSF A;  4F19 A;  4F3B A;  5AA1 A;  3MJN A;  2IA4 A;  2VHA A;  3H03 A;  3K6V A;  3EN3 A;  4G68 B;  1MXZ A;  4LZ8 A;  4OEN A;  3T9V A;  2Z23 A;  2HEU A;  3K00 A;  2GHB A;  2XX9 A;  3K2D A;  4GF8 A;  4IY6 A;  4NF8 B;  4R6K A;  4ZE8 A;  5H8F B;  1SYH A;  3EQ1 A;  3PUX E;  5CRY A;  3VVF A;  2Y7K A;  3FVO A;  4X1D A;  3H6T A;  2O69 A;  2RCB A;  3LSX A;  1XS5 A;  2ZYN A;  3OD7 A;  4F18 A;  1FTM A;  1FQC A;  3VLV A;  1US4 A;  4NF5 B;  4RY1 A;  1LLS A;  4KHZ E;  3ZKL A;  2V93 A;  4QFN A;  5DEX B;  4R6Y A;  5ITP A;  1AIV A;  5A5X A;  3TOD A;  1XVX A;  1Q1K A;  1B3F A;  3O6H A;  4ZE9 A;  1US5 A;  1B2H A;  3I6V A;  3FV1 A;  3FVN A;  4P0I A;  4AQ4 A;  3TTL A;  1H3D A;  1URD A;  1D9V A;  2AL4 A;  1A40 A;  2REG A;  4OET A;  4QFK A;  4OHN A;  5TP9 A;  3K6X A;  3UN6 A;  1ZU0 A;  4E0X A;  2Y7R A;  1OMP A;  4QSE A;  3IJX B;  2I0B A;  2I3W A;  1Y20 A;  1Z7M E;  1YTV A;  4IO2 A;  4FE8 A;  2B3B A;  3CFX A;  3FVK A;  4JWX A;  4OTE A;  1Y4C A;  4RK9 A;  3SER A;  3KN8 A;  4XKR A;  1SVX B;  2P1S A;  4OEU A;  2A5S A;  3QYT A;  4GLI A;  5ELV A;  4FJP A;  2OBG A;  3RN8 A;  4F22 A;  3U1O A;  3DP6 A;  1B1X A;  3KJ7 A;  1S7Y A;  1MPB A;  1B7Z A;  1FQE A;  4OFJ A;  4Q0C A;  1Z7N E;  1ATG A;  2QRY A;  4YKP A;  1ZIU A;  2GHA A;  2NOO A;  3M8U A;  3O97 A;  3SEU A;  3T9X B;  3IOU A;  4GL8 A;  3T96 B;  3RTW B;  2DE4 A;  5BWJ A;  2GH9 A;  3A3C A;  4GXA A;  4YB6 A;  3SEX A;  4F29 A;  1JVX A;  2OK2 A;  3IAZ A;  3F11 A;  4RPO A;  3SKP A;  3MP1 A;  1LST A;  2H99 A;  3JYR A;  3TZA A;  5KCJ A;  4YKI A;  2B3F A;  3PD9 A;  1TXF A;  1II5 A;  4JWY A;  1SI0 A;  2I48 A;  1MY3 A;  5I57 B;  2ZNT A;  1WDN A;  2DVC A;  2R6G E;  3HPI A;  4JB7 A;  2I6E A;  4ND9 A;  4RYA A;  3MZB A;  1BTJ A;  2PT1 A;  2XXP A;  2XX7 A;  3U72 A;  5AA4 A;  4FAT A;  3QK6 A;  3RTF B;  4XXU A;  3WAE A;  2Q8J A;  5AE4 A;  2RF1 A;  2ONS A;  3W9V A;  4G8H A;  1QJM A;  4KYD A;  4NWC A;  3RGY A;  3O66 A;  1H43 A;  1H44 A;  2OZZ A;  3RQT A;  3CR9 A;  5JEI A;  2Z8D A;  2HXW A;  1Y3P A;  2RIN A;  5F7V A;  3PPP A;  3RY3 A;  3Q26 A;  3FJ7 A;  5CM6 A;  3AXF A;  1JNF A;  2BJJ X;  3KN7 A;  3MZ1 A;  4P0G A;  1B3G A;  3PMW A;  2YJP A;  3HST A;  1SW2 A;  3FUZ A;  3FGS A;  3IB1 A;  3THI A;  3FJM A;  1WVJ A;  5KCJ B;  2THI A;  5LOM A;  1Y4T A;  2D5W A;  4ISU A;  1N7X A;  4MBP A;  4OFL A;  1B05 A;  4N13 A;  4PFY A;  3SDF A;  1NKX A;  1B52 A;  3TEL A;  4ELP A;  1QUJ A;  3C33 A;  4JWO A;  4OVJ A;  5CMM A;  4LON B;  1N76 A;  1LFG A;  3PPN A;  5FTH A;  4ZEI A;  1N0T A;  3VXB A;  5CC2 A;  4U22 A;  4IB2 A;  3CI8 A;  1GGG A;  3JV9 A;  1EZ9 A;  1M5E A;  2GRV A;  1URG A;  2HZK A;  3C32 A;  1JEV A;  5JTY B;  4F2Q A;  1A99 A;  2QSX A;  3EHU A;  1NH7 A;  5H8Q A;  1OIB A;  1DTG A;  4H67 A;  3OEK A;  4AB6 A;  4EQ9 A;  1SQY A;  1DPP A;  1ELJ A;  1JW1 A;  1FTO A;  1MY2 A;  2Z8F A;  3DM0 A;  2ZNU A;  3G3J A;  3M3F A;  4ELQ A;  2H25 A;  4EUO A;  4JBZ A;  4RK2 A;  3VV5 A;  4JDF A;  3KBR A;  3N94 A;  1VR5 A;  1BLF A;  3IO6 A;  3EHT A;  2H9B A;  2NUV A;  3IJO B;  2AYS A;  1IEJ A;  2HAV A;  1B7U A;  2UYE A;  2XXW A;  4FOR A;  4U1O A;  3TCH A;  4U4S A;  5K2X A;  1DSN A;  2PVU A;  3HV1 A;  2ALU A;  2X7P A;  3VFJ A;  3K01 A;  1QKA A;  4PET A;  1OLA A;  2I4C A;  3ZS6 A;  4KPT A;  2DQV A;  3PPO A;  3RUM A;  3UOR A;  5I84 A;  3KEI A;  4KD5 A;  2GFE A;  1I6Q A;  1OQH A;  1Y3Q A;  3GBA A;  4F31 B;  2ONK E;  4X48 A;  3UP9 A;  4G77 A;  4HW8 A;  1B3H A;  2XX8 A;  4C0R A;  2O1M A;  4N6P A;  1N04 A;  4FED A;  1A7L A;  5M2V A;  5ICT A;  1OQG A;  4LQ5 A;  4ONY A;  1IUD A;  4U23 A;  1FTL A;  2X26 A;  3DP8 A;  3FZV A;  4NE4 A;  3MVX A;  4ZZE A;  2Y7I A;  1PEB A;  1B5H A;  3C4M A;  4OZ9 A;  4Q5T A;  1H45 A;  2VOZ A;  4RNS A;  4UA8 A;  2XXR A;  4THI A;  4DCX A;  4DXC A;  2AL5 A;  1Y1M A;  2E0S A;  2Y7P A;  4KFQ A;  5I2N B;  2UVH A;  3E3K A;  3A3U A;  4MFI A;  3IO4 A;  1D3K A;  1IXH A;  4ZEB A;  3K4U A;  5F1Q A;  1NNF A;  1ZKB A;  3U93 A;  3K1M A;  3B6W A;  3JZJ A;  4DCY A;  1POY 1;  4GIZ A;  2UVJ A;  1B6H A;  4WXJ A;  3UIF A;  5IKB A;  5JTY A;  1B1H A;  1JW4 A;  4BDR A;  3RPW A;  2O6A A;  1QUI A;  3UA8 A;  2ANJ A;  2VD2 A;  3U8Q A;  1RYO A;  1MDQ A;  3KSX A;  2HAU A;  3OO6 A;  4TOZ A;  4HCY A;  3MVY A;  4U2R A;  2UVG A;  4Z7E A;  1NH8 A;  3KFM A;  1XC1 A;  1B5J A;  3Q25 A;  1Y3N A;  1LBB A;  3USD A;  5BUU A;  1JW5 A;  1MM6 A;  3HN0 A;  5H8H B;  1BP5 A;  3Q27 A;  2RCA A;  2ZXT A;  2DOJ A;  4R6H A;  4GQO A;  1KWH A;  3O28 A;  4ZEK A;  5CI5 A;  1MY1 A;  1EH3 A;  1P1O A;  3TTN A;  1TFA A;  5I2K B;  1I6A A;  1LBC A;  3LSF B;  2XXQ A;  2AIX A;  3ECR A;  4N07 A;  3ILT B;  2HCA A;  2PYY A;  4YKK A;  4JSO A;  4YZZ A;  3OOA A;  2XXH A;  4RXL A;  5CMC A;  4QHQ A;  1GTK A;  2D21 A;  4LA9 A;  3TTM A;  5CBR A;  1MY4 A;  3C36 A;  4DDD A;  2Y84 A;  5DT6 A;  1B3E A;  2QS3 A;  2F8D A;  4ESW A;  1A55 A;  4Q30 B;  2DWH A;  3G3H A;  4NWD A;  1NFT A;  4POX A;  5EHS A;  3VXC A;  4DXU A;  5I57 A;  4H5G A;  3Q29 A;  1UTH A;  4TLM B;  2W7Y A;  1USY E;  4G8N A;  3TMG A;  2QMW A;  3R6U A;  4YMA A;  1FQB A;  4PFU A;  3SET A;  3QIM A;  5H8N A;  1VSO A;  5H8S A;  2ABH A;  3HO7 A;  4NMY A;  4YU0 A;  1BKA A;  3C35 A;  2M8C A;  2OWS A;  1B4H A;  3FV2 A;  3N26 A;  4GWO A;  4FIM A;  4ZDM A;  1GV8 A;  1YCJ A;  2ZYO A;  1LFI A;  1FQD A;  3E4R A;  1AL3 A;  1N3X A;  1TT1 A;  3MPK A;  3IB0 A;  3KN3 A;  3MC2 A;  1HSE A;  1POT A;  1N3W A;  1OVB A;  1R9L A;  1USY H;  4QF9 A;  1VFD A;  5TP9 B;  3Q28 A;  3TUS A;  1EU8 A;  3FD3 A;  2RC8 A;  1BIY A;  1MXV A;  4WKM A;  4LVQ A;  3W9W A;  1QW0 A;  1UIV A;  1S50 A;  5IAI A;  2CZL A;  3EPE A;  1WOD A;  3QSL A;  4X1B A;  2ONR A;  3TYH A;  4MLV A;  3K6U A;  3D4G A;  3FXU A;  1CE2 A;  4BDO A;  5B7D A;  1EZO A;  4GRK A;  4K3F A;  3FXQ A;  3OEN A;  1JET A;  2RC9 A;  3H6V A;  5DTB A;  1OVT A;  2REJ A;  4H1X A;  3ZKK A;  4F3S A;  4R9F A;  2Y7W A;  3E13 X;  1O64 A;  3TCF A;  4NF8 A;  4IO4 A;  5I2K A;  3S9N C;  3PMX A;  3RT8 A;  2R71 A;  1FQF A;  2OJT A;  3KSJ A;  4KYS A;  4G8M A;  2HQ0 A;  4KQP A;  4KCC A;  1IZ1 A;  2FYI A;  2ZYM A;  3K6W A;  4RA1 A;  5CBS A;  4XKP A;  4GOT A;  4MH5 A;  2DXR A;  3T66 A;  2O68 A;  4QSC A;  5ITO A;  3TTK A;  3SEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...