1B1XA

Structure of diferric mare lactoferrin at 2.62a resolution
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-dimensional structure of mare diferric lactoferrin at 2.6 A resolution.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords LACTOFERRIN
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA03
4FIMA 1URDA 3MVZA 3C4MA 4GXSB 3QIMA 1B3LA 2XXPA 1A8FA 3B6WA 3IO6A 3MW0A 4H8JA 4R75A 3T9XB 2I3VA 2Z8DA 4BDNA 4EQBA 4Z7EA 3U92A 2XXRA 4N6PA 4PP0A 3FASA 3TEPA 4C1UA 3MWBA 3PUXE 4OESA 4TLLB 1JEVA 1QVSA 3MP1A 1II5A 1NFTA 3SESA 5JEIA 2F78A 4ZS9A 1D9VA 1MPBA 3SEWA 3N26A 1J1NA 2D21A 1AL3A 1B1HA 3MVWA 3QUJA 1IQ7A 1N0TA 2XXVA 4GRKA 2B65A 3MZBA 4XKPA 4BDLA 4HTGA 5JTYB 4G68C 3G3KA 2F6PA 3FJ7A 4U4XA 3Q29A 4KCDA 3K02A 3CG1A 2DQVA 2VP1A 2Y7IA 3Q26A 5BUUA 2UVIA 3OO6A 3TAJA 3C32A 2O51A 2XXTA 3OOAA 4R74A 3VVDA 2QS2A 3IK6B 3PMVA 3RT8A 1VE4A 1MY4A 3BBRA 2DVCA 2DE4A 4DLDA 1JEUA 4GIZA 3Q27A 4DCYA 5K2YA 3N94A 3DLNA 5ICTA 3M8UA 5EYFA 1UIVA 2V84A 3LR1A 3VLUA 1NMUA 2ZNTA 1H76A 3OO9A 2XXUA 1YAEA 4OVJA 1WVJA 2I0CA 3OMBA 3TCFA 3TODA 5AA4B 1B7ZA 1XVYA 1B51A 3OELA 4KCCA 4RPOA 3OSQA 1Y9UA 2VD2A 2O1MA 5KDTA 2OBGA 1B1XA 3O6GA 4P11A 4ELRA 4QF9A 4ZE9A 1ZKBA 1B58A 3U1OA 4YMBA 4FE8A 4E0XA 1SBPA 3KN3A 1XC1A 3TELA 5TPAB 3T66A 3PPPA 4DDDA 1MG1A 2X26A 2DXRA 3I6VA 1BLFA 5I84A 4F1VA 5DEXA 1M5DA 2I4BA 2NWJA 2ZNSA 4H8IA 4YMAA 1FQBA 1LLSA 1MXWA 4NF4B 2RF1A 3ILTB 3V8XB 4BDOA 3PGFA 5JTYA 1MQHA 3VXBA 2ZYKA 1B32A 4HCYA 4YKIA 2ESNA 1JW1A 1IITA 5CBSA 3PU5A 3CSGA 4F2OA 1RYXA 3CFZA 1ZLQA 1NNFA 5DYHA 1YPNA 1TFAA 1TT1A 1WDNA 2OZZA 4ZEBA 3RY3A 4NF4A 2F5XA 4G2ZA 2DWJA 2XD2A 4IB2A 4WKMA 1XS5A 5CRYA 4F22A 4X1DA 3SEXA 3QXMA 4H5FA 2YLNA 2P2AA 1D3KA 2RINA 3CIJA 2BJJX 1QUKA 3KOTA 2CZLA 3EHUA 2B3BA 4P0GA 5CMMA 1UIUA 1KWHA 3KJTA 1SW4A 1US4A 3G3HA 3IORA 5A5XB 1URGA 5EHMA 3ECRA 3R7XA 1N3XA 2OWSA 3DP8A 2W7YA 4F3GA 1GGGA 3G3GA 4H5GA 1H3DA 5CMBA 4C0RA 4OFJA 3UORA 4OTEA 5KCJA 4JDFA 1Y4CA 1O64A 5H8SA 3K2DA 4O3BA 1A55A 4RK2A 1LAXA 5FHOA 3IL1B 4F1YA 4ESXA 4H0WA 2ONRA 3K1MA 1DPPA 2DP8A 3G3IA 3HCQA 4ZZEA 3PUZE 3N5LA 1B3HA 4GVOA 4PETA 3LUYA 1JETA 2UXAA 4XIGQ 1BP5A 1JW4A 1VFEA 1HSEA 2DWHA 5KDTB 5ISUA 2GH9A 1EH3A 1B5HA 1LB9A 4RPNA 5F7VA 1A7LA 1B3EA 1RKMA 1M5EA 2OCUA 2PVUA 4QFOA 3UN6A 1B40A 2V25A 3SETA 3VDFA 3U94A 4M4GA 1MY0A 5ITPA 3OENA 1EZOA 3TQWA 2DS9A 3H6VA 4YAHX 5DEXB 2RCBA 4K3FA 3KOSA 3TDJA 1ZJLA 2DWAA 2M8CA 5I59B 1B7UA 4QFKA 1POTA 2P0SA 1HSLA 1OQHA 3IOTA 1NNTA 2VGQA 3O97A 1NH7A 3UA8A 3EHSA 3TTKA 5CMKA 4LZ5A 4KYSA 1CB6A 4MBPA 1H44A 3ZKLA 1S50A 2QMXA 1Z7NE 2G29A 3DM0A 1IIWA 4L17A 3K1NA 2HFBA 2R9JA 4MLQA 3SERA 2F97A 1B05A 5B7DA 3HHFA 3MC2A 1OVTA 1B5IA 4Q30B 1FTMA 1NNKA 5CI5A 4EUOA 3C33A 2PT2A 4U1ZA 1JVXA 1MQJA 4NMYA 2HCAA 4ZEDA 1MPCA 1IUDA 1A8EA 3H6TA 4LZ7A 3IX1A 1MXVA 2ANJA 2Q9TA 1F9BA 3KBRA 3MPLA 4H65A 2OJTA 3MBPA 4N13A 3T9HB 3V89B 2XXYA 1B3GA 1EZ9A 4OZ9A 4NE4A 4ZEIA 5AA3A 4EF2A 3FJMA 1YCJA 3RTFB 1BTJA 4I9DA 1CE2A 3RNNA 4MLVA 2Y7KA 1XOCA 4BDQA 3T22A 5I57A 1ELJA 3IOWA 3IB2A 4GD5A 3PMWA 4WEDA 3VV5A 4F1UA 2YPNA 4OFOA 1Y3QA 3KJ7A 1N7XA 1RYOA 1XHYA 2PYYA 4F3PA 1ZIUA 2D5WA 2R71A 3IOVA 4X48A 1D4NA 3I5OA 3VVFA 4XXUA 5H8QA 5ITOA 3TCGA 5AA4A 4DIGA 2F8DA 2DE3A 3FD3A 1OQGA 4IY5A 4PFYA 1ZU0A 3N6TA 1PB8A 3BFTA 4F39A 2LAOA 3EQ1A 4YZZA 1QJMA 3LBSA 5FHNA 5L9SA 1FTOA 1JW5A 4LQ5A 4F2QA 2O84X 1LFIA 2D3IA 3D4GA 4QFLA 4YKJA 3KSJA 1OMPA 5L8DA 3TQLA 3MVXA 4NF5A 3K01A 3PD9A 3G3FA 4AB6A 2X7PA 3FXRA 2QS4A 3I3VA 4GFRA 2AL4A 4KPTA 4FAJA 2I58A 4DZ1A 3OEKA 1VR5A 3OO8A 3TTLA 3EF7A 3WAEA 1MH3A 3DP6A 5H8NB 1R9LA 2I3WA 3R26A 3RGYA 1NKXA 5AA2D 2UVHA 4OFLA 2O6AA 3IJOB 2REGA 1LBBA 4ELPA 3ILUB 2ONSA 3KN7A 2XD3A 3UGWA 3W9WA 1A40A 2QL3A 4NEDA 3FV1A 4ZE8A 3MUQA 2FA7A 2IEEA 4R9GA 1GTKA 1SYHA 3KGCA 1S7YA 2I4CA 4EQ9A 4OMBA 1LFHA 4EQ7A 1MM6A 1P1UA 1US5A 2KLFA 4X1BA 4YB7A 2I0BA 1R1NA 5FHMA 5A5XA 1GV8A 3MZ1A 1LSTA 5KZTA 2Q89A 4R72A 1O63A 3MAMA 3O6HA 3S2VA 1Q35A 2ZYMA 3RN8A 3IB1A 1D9YA 4Q0CA 1NNPA 3E13X 1A99A 5EHSA 1XT8A 2XXXA 3E9XA 3U93A 3U8QA 3PPQA 1BKAA 4OHNA 4KHZE 1POY1 1B0LA 1MY2A 4O3CA 4RA1A 3VFJA 3HHGA 3VXCA 1LAFE 3QYTA 4XTCQ 1AMFA 1PDAA 4OETA 1SW5A 4M1VA 2VOZA 4BDMA 1IZ1A 1Y3NA 4TQUQ 1M5BA 2CMOA 2XX9A 4U1OA 3L6GA 4ZEFA 4C1TA 3B7DA 2GRVA 3VLWA 1PB9A 2QS3A 2GHAA 4WEPA 3JYRA 1I6QA 4EXLA 3KZGA 4GL0A 3RT6B 2Y7PA 3AXFA 4OERA 2IA4A 2HAVA 4HS7A 5ICQA 3CFXA 4KFQA 4NTLA 2I49A 1O7TA 4XKRA 4G4PA 3DELB 1GR2A 4YICA 1LAHE 3PPOA 3GLBA 1QUJA 2XHDA 3WAFA 4F3BA 3PMXA 1JNFA 4NF6B 1N76A 3T96B 1B5JA 1PEBA 4OEVA 1P1OA 2V93A 1Y3PA 3GBAA 3H4ZA 1SW2A 3PPNA 5H8HB 3LSXA 4PQJA 1LBCA 1MXUA 3SDFA 2E0SA 1MM7A 4UACA 2ALUA 1P1WA 4WXJA 3UIFA 5AE4A 1MPDA 1OLCA 4ZECA 1FQCA 1PC3A 2F36A 4OXVA 1DTGA 5I56A 2NUVA 4AQ4A 2HQ0A 3QAXA 2XXHA 4MH5A 1B0HA 1SI1A 3R6UA 1DSNA 4ND9A 4IO6A 1FTLA 2ZYNA 1MY1A 4LP2B 2ZNUA 1MXYA 2AIXA 3FVGA 4FEDA 1UQWA 5H8NA 3TTRA 3IR1A 4JSOA 5I56B 1LAGE 3RLFE 2Y84A 3KEIA 1WODA 2HXWA 4Q8RA 2H5YA 3K6XA 4GL8A 4YB6A 2G93A 5AA2A 5I58A 4QFPA 1I6AA 5DVIA 1MXXA 4OWDA 3HO7A 3RQTA 2F34A 4G68A 4YB5A 2FYIA 1B46A 4RXLA 3LC8A 3M3FA 3FGSA 4NF8B 4ZDMA 2VHAA 1P1NA 5AA1A 2NVUB 2QJEA 4U22A 1QKBA 1VSOA 2V3UA 4IO3A 3V5AA 2XXQA 4DCXA 4ESWA 3A3UA 3B6TA 3HPIA 3Q25A 1ATGA 3SKPA 3OO7A 1SW1A 2O7IA 4N07A 4FJPA 2HZLA 3M3LA 1I69A 2UYEA 1QULA 3H6WA 5H8FA 5L9MA 4QSDA 1MQIA 3PPRA 4DXUA 1B9JA 4XKQA 3S4UA 1MDP1 5CBRA 4IGRA 4I1DA 3VVEA 4R6YA 5FTHA 2XX7A 5ELVA 2Y7RA 1MQGA 1OLAA 3FXUA 3T9VA 4U2RA 2THIA 3ZSFA 1B7HA 2RC9A 2Z23A 4U23A 3PUVE 2VD3A 3FUZA 4RJZA 3W15C 3GXAA 1QKAA 2F7AA 1FTKA 2O69A 3PV0E 3KG2A 1MRPA 4AB5A 5B70A 5IAIA 3MP6A 4IO7A 4IY6A 3L6HA 2A5TA 1B4ZA 1H45A 4GOTA 4R73A 3FZVA 1IXCA 2PBWA 5DT6A 2I48A 1XVXA 3CI8A 1P1QA 3LSWA 5HBCA 3VE1B 5I57B 3CVGA 3ONMA 2X7QA 2Z8FA 4TOZA 3ZS6A 2DWIA 1H43A 4YKKA 5H8FB 5TP9B 3PD8A 1R6ZA 4PFWA 1Y1MA 1SI0A 3OSRA 4H67A 2PX1A 1GVCA 3MQ9A 1B52A 1OVBA 4Q5TA 1FQEA 4OEUA 4QRZA 3KFMA 2Q8JA 2UVGA 4RK9A 4FATA 1FCKA 1QUIA 1UTBB 4IGTA 3TTMA 1I6BA 5KCJB 1AOVA 3U72A 5J1DA 4R6HA 3RTWB 3B6QA 4E0WA 1N7WA 3H03A 4OQOA 4Z0IA 1SVXB 3QUFA 3RPWA 3RUMA 3O29A 3OD7A 2QS1A 5DVJA 5I58B 4NF6A 4U21A 3O2AA 2NOOA 2H9BA 4LA9A 3UP9A 3S9MC 3H6UA 3P7IA 4G77A 4HCWA 4KYDA 4QSCA 3TUSA 1FQDA 3IOUA 2R6GE 4GLIA 4GQOA 4ISUA 3TZAA 5M2VA 4OENA 3C9HA 1IEJA 3K00A 4KD5A 3S9EA 1EZPA 1NL5A 2DYXA 2O7UA 3OEMA 1MY3A 1L5TA 4POXA 5I2NA 1EU8A 2ONKE 3C31A 3FVOA 4IO5A 4LVQA 1LCFA 4R2FA 5TU0A 4OYVA 4ECFA 5L9OA 4THIA 3C34A 1R9QA 4XKNA 3GBBA 5CC2A 2V3TA 2RC8A 4F18A 3TMGA 4F29A 1LB8A 4ZEKA 4KYEA 1USYH 2Y7WA 3HSTA 1YTVA 5HM4B 1JVYA 3LSLA 4NWCA 5F1QA 3C35A 2YJPA 4JWXA 2QMWA 3G3JA 3LSFB 4R6KA 3TTNA 4NF8A 2ABHA 2F7CA 2OK2A 4KQPA 5IKBA 5LOMA 5CM6A 1JQFA 2A5TB 3O28A 2H99A 3H06B 3OXNA 4I62A 1Q1KA 1QW0A 3N6UA 3EPEA 3K6UA 1HSJA 1Y4TA 3IJXB 4DE8A 1B3FA 3IAZA 4JBZA 4PFTA 3EN3A 3TFLA 3IB0A 2Q2CA 4ZZAA 5H8HA 4F19A 1IXGA 3Q28A 5JK4A 3F11A 3KN8A 3SEYA 1TFDA 4R2BA 1LGBC 1MS7A 2XXIA 1S9TA 1B2HA 3MZ9A 3G7WA 4G8HA 1DOTA 2HAUA 2RKMA 3ODBA 4DXBA 3TCHA 2Z22A 2ZYOA 1UTBA 3JZJA 4KR5A 3T93B 2DSFA 2I6EA 2DVZA 3A3CA 2H4IA 1LFGA 2UVJA 1Y1ZA 1N04A 2H98A 3JV9A 3O6IA 1AH5A 3FATA 3GZGA 2V3QA 3QK6A 1N84A 3FV2A 3MPKA 3MJNA 1ANFA 1LCTA 3CSBA 1USYE 2Q88A 4QHQA 4H1XA 4R9FA 1TWYA 3CFLA 5H8QB 4GXAA 3TYHA 4FORA 4QSEA 1SQYA 3FVKA 3FJGA 1MQDA 1UTHA 3FIRA 4IO2A 1IXHA 1M5CA 5CMCA 4EDPA 5I2KA 3PUWE 3HV1A 3T9UA 2F7BA 2O1LA 1DTZA 3FVNA 4RY1A 1MXZA 4BDRA 4F3SA 3MP8A 3K4UA 4BLAA 1PBQA 4DXCA 1Z7ME 5FTIA 1B4HA 2QRYA 5DTBA 1ZBMA 3IO4A 2AYSA 2DOJA 2OLBA 1A54A 4MFIA 2QPQA 3UK4A 4JWYA 1TXFA 4ELQA 3W9VA 4YU0A 3ZKKA 3QSLA 3VLVA 4ELOA 4F31B 2OWTA 2F35A 3CRBA 3K6VA 3MVYA 4KI0E 2AL5A 5BWJA 2PT1A 1T0KA 3USDA 3CR9A 2DE2A 3H7MA 4PFUA 4EXKA 1OIBA 4UA8A 2ZXTA 4TLMB 1PB7A 2RC7A 4LZ8A 2XXWA 1DPEA 2P1SA 3HN0A 3H3GA 1VFDA 2DXYA 4FECA 4H6DA 4LUBA 4ONYA 4U4SA 4P0IA 4YKPA 3EHTA 1MDQA 1PBPA 2GHBA 2UYFA 4LATA 4PE5B 2HEUA 3BKIB 2RCAA 3K1PA 5TPAA 4HW8A 4JSDA 2FNCA 3O66A 3D4CA 4X9TA 1AIVA 2PMSA 1N3WA 3E3KA 3KSXA 4G8MA 4I8CA 5AA2B 1URSA 4FEBA 2QSXA 1Y20A 4JXIA 1FW0A 3K0VA 1FQFA 1P99A 3BFUA 4G68B 5I2NB 2NXOA 3V83A 1BIYA 1FTJA 1SD3A 2O68A 4RNSA 3O9PA 4G8NA 1UTHB 3M3KA 3E4RA 4QFNA 5TP9A 1SYIA 4IO4A 3THIA 4JWOA 1ZTYA 3TKDA 1DMBA 1M5FA 3C36A 2H25A 3A09A 4GF8A 4LONB 3TPAA 5HPQA 2WKYA 4EF1A 2A5SA 3CG3A 2F6GA 4JB7A 4LQ2A 1NH8A 2XX8A 2HZKA 4NF5B 1FQAA 2Z8EA 5DVFA 4POWA 2Q2AA 2E1SA 3FXQA 3S9LC 2GFEA 5I2KB 3DP4A 5I59A 2REJA 3SEVA 4NWDA 3K6WA 5K2XA 1MH4A 1SDXA 2B3FA 2ZMBA 4GWOA 3PUYE 1B6HA 4O3AA 3S9NC 4MF3A 1IXIA 4RYAA 1ZMGA 3SEUA
chains in the Genus database with same CATH superfamily
4FIMA 3C4MA 3IO6A 3MW0A 4H8JA 2Z8DA 1EYJA 4N6PA 3E78A 3FASA 4H46A 1JEVA 5JEIA 4N81A 2D21A 1AL3A 3QUJA 1N0TA 2B65A 4U4XA 5BUUA 2Y7IA 3OOAA 3RT8A 1MY4A 2DVCA 4GIZA 1FPJA 4HE2A 1D9QA 1H76A 3OO9A 2B4MA 4OVJA 1WVJA 1YYZA 1B7ZA 1B51A 3O6GA 4JVDA 1ZKBA 4YMBA 4NAPA 1SBPA 4E0XA 5TPAB 4DDDA 3PPPA 3I6VA 5LTCA 1LLSA 4PTKA 4F2OA 1QGXA 2OZZA 2R8TA 2F5XA 4NF4A 4G2ZA 5CRYA 4F22A 4MAGA 4N15A 3SEXA 3CIJA 4NG7A 5CMMA 2B3BA 1UIUA 1KWHA 3IORA 5A5XB 2OWSA 1SPIA 1GGGA 4H5GA 1O64A 5J16A 4H0WA 3K1MA 3G3IA 4PETA 1JETA 2KQZA 1JW4A 1HSEA 2FIEA 2PVUA 4QFOA 2V25A 3VDFA 3TQWA 4YAHX 2CEYA 5IGAA 1B7UA 2P0SA 1HSLA 1OQHA 3BIHA 2VGQA 3TTKA 1S50A 3DM0A 1Z7NE 2G29A 4MLQA 1B05A 3HHFA 4OVPA 1OVTA 1FTMA 5CI5A 4NMYA 4ZEDA 4LZ7A 5L9MA 4N13A 4AB6A 1F9BA 3MPLA 4H65A 4NE4A 4OA4A 5AA3A 3FJMA 3RTFB 4MLVA 3T22A 3IOWA 3IB2A 3VV5A 4OFOA 3KJ7A 2PYYA 1ZIUA 2R71A 3E79A 3IOVA 2JJKA 3TCGA 4DIGA 3N6TA 4F39A 2LAOA 4XFEA 4YZZA 5FHNA 2O84X 3TQLA 3K01A 3PD9A 2X7PA 3FXRA 2QS4A 2AL4A 2I58A 4DZ1A 3OO8A 1MH3A 3DP6A 2I3WA 2REGA 4ELPA 3CHGA 3W9WA 4GX6A 1A40A 2QL3A 3FV1A 2FA7A 4R9GA 1LSTA 1FBCA 4R72A 1O63A 3S2VA 1D9YA 4GWXA 3E13X 1A99A 5EHSA 4N4UA 4KHZE 1MY2A 1FJ9A 4G61A 1SW5A 2XX9A 4C1TA 2GRVA 3JYRA 2WBBA 3RT6B 2HAVA 5ICQA 4PFRA 1LAHE 3WAFA 4F3BA 4OEVA 3PPNA 3LSXA 1MXUA 1NV2A 5I56A 2F36A 1DTGA 1B0HA 3R6UA 1FTLA 3FVGA 2L5VA 5H8NA 4JSOA 5I56B 3RLFE 4GL8A 3K6XA 5I58A 4OWDA 4G68A 3LC8A 1VSOA 2V3UA 1RDXA 1ATGA 3OO7A 1SW1A 4P3LA 1I69A 2UYEA 3H6WA 5CBRA 1B9JA 3S4UA 1MDP1 4IGRA 3VVEA 5FTHA 2XX7A 4GX4A 3FXUA 3ZSFA 3GXAA 2F7AA 2O69A 3KG2A 5IAIA 4AB5A 4PGPA 1NUWA 3VE1B 1P1QA 3LSWA 4OVTA 2HHMA 4YKKA 5H8FB 1R6ZA 4PFWA 4GX3A 2PX1A 4Q5TA 1G0HA 3QMFA 1AOVA 4PC9A 5J1DA 2XWIA 3H03A 3RPWA 3RUMA 5DVJA 2XXKA 4NF6A 3KC0A 2H9BA 4HCWA 4PDDA 4QSCA 3C9HA 2O7UA 1L5TA 4POXA 4R2FA 4ECFA 3C31A 1BK4A 1LCFA 5L9OA 5CC2A 3TMGA 4ZEKA 1USYH 5HM4B 1JVYA 5F1QA 5IZ1A 3LSFB 4NF8A 4DI4B 4H45A 3FBPA 4MMPA 3IB0A 1IXGA 4N6KA 1IMEA 1LGBC 1S9TA 5FBPA 1DOTA 3TCHA 2Z22A 4KR5A 1UTBA 1FPLA 1Y1ZA 3QK6A 1AH5A 1LCTA 4QHQA 1USYE 4EDPA 1MQDA 5CMCA 4IO2A 4F3SA 3B50A 3MP8A 4UABA 1B4HA 1EYKA 1TXFA 1DBZA 3VLVA 4P8BA 4KI0E 3K6VA 3MVYA 4I3EA 4UA8A 1PB7A 4LZ8A 2P1SA 1VFDA 4LUBA 1FPFA 2RCAA 3D4CA 3KSXA 5AA2B 4G8MA 1URSA 4JXIA 1P99A 3BFUA 2NXOA 1BIYA 1SD3A 4G8NA 1UTHB 2QFLA 4JWOA 3TKDA 1FBGA 4P56A 3A09A 4LONB 2A5SA 4NF5B 1FQAA 3U65A 3FXQA 5I2KB 5I59A 2REJA 5K2XA 1SDXA 4FBPA 4O3AA 4GXSB 3QIMA 1B3LA 3T9XB 4R75A 2F3DA 5IZ3A 4PCDA 3MWBA 3MP1A 1II5A 2F78A 2WYKA 1D9VA 3SEWA 5DVFA 4XTCQ 4GRKA 3MVWA 2XXVA 3MZBA 4BDLA 5JTYB 3G3KA 2F6PA 3FJ7A 2KR0A 3K02A 3OO6A 3KBZA 1IMDA 3IK6B 5T3JA 1VE4A 5LDZA 5IZ3B 1JEUA 3N94A 3DLNA 3M8UA 1UIVA 2HXRA 1NMUA 2ZNTA 1INPA 2I0CA 5EQ8A 3GYYA 4GWZA 3OSQA 1Y9UA 5KDTA 2OBGA 1B1XA 4ELRA 3KN3A 3TELA 3T66A 2CZKA 2DXRA 5ET8A 4GWYA 2ZNSA 4H8IA 1FQBA 2RF1A 3ILTB 3VXBA 4YKIA 2ESNA 5CBSA 1TFAA 1TT1A 1WDNA 2DWJA 4WKMA 3QXMA 4H5FA 3KOTA 2BJJX 3EHUA 3KJTA 3DP8A 5CMBA 4C0RA 3UORA 4JDFA 4O3BA 1LAXA 5FHOA 3IL1B 4F1YA 2DP8A 3HCQA 4ZZEA 3PUZE 4GVOA 4XIGQ 5ESYA 1VFEA 1KA0A 4OVSA 4PDHA 5KDTB 2ZZWA 1LB9A 5F7VA 1A7LA 1RKMA 4M4GA 1MY0A 2WX9A 1EZOA 2DS9A 4K3FA 3KOSA 3TDJA 4O7IA 1NH7A 1LBWA 4LZ5A 4MBPA 1H44A 1IIWA 2F97A 5B7DA 3MC2A 1B5IA 4Q30B 1LBVA 2Y5LA 4PAKA 1MPCA 4ESXA 1A8EA 3IX1A 1MXVA 3KBRA 3V89B 3MBPA 1XI6A 1EZ9A 4ZEIA 1BTJA 2Y7KA 1ELJA 1Y3QA 1KZ8A 1N7XA 1RYOA 1D4NA 3I5OA 1OQGA 3BFTA 3LBSA 5L9SA 4GBVA 1FTOA 1JW5A 1LFIA 2D3IA 4QFLA 5L8DA 4PBQA 4NF5A 3G3FA 3OEKA 1VR5A 1AWBA 1FPEA 3R26A 3RGYA 4MX6A 1LBBA 2XD3A 3UGWA 4NEDA 1FBEA 1GTKA 1S7YA 2I4CA 4OMBA 4KXPA 4EQ7A 2OWZA 2I0BA 1R1NA 1GV8A 5KZTA 4PF8A 3O6HA 1Q35A 2ZYMA 1NNPA 3U93A 3U8QA 4OHNA 1LAFE 3QYTA 1AMFA 1PDAA 4M1VA 4BDMA 1IZ1A 1M5BA 1NV4A 3L6GA 3B7DA 1PB9A 4WEPA 2Y7PA 3AXFA 4OERA 4HS7A 4GWWA 4KFQA 4X8RA 1O7TA 4G4PA 3GLBA 1QUJA 3T96B 3KC1A 2QVVA 4PQJA 2WEFA 2E0SA 2ALUA 4WXJA 4ZECA 1DK4A 1VDWA 1SI1A 4ND9A 1DSNA 5ET6A 2ZYNA 1MXYA 4FEDA 2F3BA 1UQWA 2QVUA 2G93A 1I6AA 1MXXA 2F34A 4YB5A 1B46A 4ZDMA 4NF8B 1IMBA 2Y5KA 2NVUB 2QJEA 1QKBA 1FSAA 4ESWA 3A3UA 3SKPA 3M3LA 4P1LA 1QULA 5H8FA 3PPRA 4XKQA 4OANA 3T9VA 2THIA 2RC9A 4JVIA 4O8MA 1QKAA 1FTKA 4IO7A 3ROJA 4IY6A 3L6HA 2A5TA 1XVXA 5HBCA 3CVGA 3ONMA 4TOZA 1Y1MA 4H67A 1B52A 4OEUA 4RK9A 4FATA 3TTMA 1I6BA 5KCJB 3O29A 3OD7A 5I58B 4U21A 3O2AA 5I3SA 3UP9A 4KYDA 3TUSA 3IOUA 2R6GE 3TZAA 4KD5A 1NL5A 2DYXA 3RNNA 1EU8A 4IO5A 5TU0A 3GBBA 4DI3D 2Y7WA 1YTVA 4R6KA 2QMWA 5CM6A 3O28A 3OXNA 2H99A 3H06B 2Q2CA 4ZZAA 3Q28A 3SEYA 1TFDA 5DW8A 1MS7A 4G8HA 4LN5A 4DXBA 3JZJA 2DSFA 2DVZA 2H4IA 1N04A 3JV9A 1N84A 3MPKA 3MJNA 3RY3A 3CSBA 5H8QB 3TYHA 1TWYA 4GXAA 3FVKA 1M5CA 4AS4A 3T9UA 1MXZA 4MCOA 3A29A 4DXCA 1Z7ME 2QRYA 3IO4A 2AYSA 4O7MA 1NI9A 3UK4A 4JWYA 4ELQA 3ZKKA 3QSLA 2XWVA 2OWTA 2F35A 2AL5A 2PT1A 1IMCA 2DE2A 3H7MA 4PFUA 4EXKA 5I2NA 2XXWA 4H6DA 2DXYA 4U4SA 3EHTA 4PFTA 2GHBA 5TPAA 5IM2A 4LATA 2HEUA 3BKIB 4PE5B 4HW8A 2FNCA 2VT5A 3E3KA 4I8CA 4FEBA 1Y20A 3K0VA 5I2NB 3V83A 2O68A 3O9PA 3M3KA 4QFNA 2FHYA 1SYIA 1ZTYA 3C36A 5HPQA 3TPAA 3CG3A 2F6GA 4OVRA 2HZKA 2WBDA 3K6WA 3PUYE 4MF3A 1IXIA 2XXPA 3B6WA 4BDNA 4Z7EA 3U92A 4PP0A 1NUZA 1NV1A 1QVSA 1NFTA 4ZS9A 4NF0A 3N26A 1J1NA 1IQ7A 4HTGA 3Q29A 1FBPA 4KCDA 3Q26A 2VP1A 2UVIA 3C32A 4NN3A 3PMVA 2DE4A 4NHBA 4DCYA 4PFBA 5ICTA 2V84A 3LR1A 3VLUA 1NV3A 2PFZA 1YAEA 2XXUA 3OELA 1XVYA 4KCCA 4N8YA 2VD2A 2O1MA 4OVQA 4P11A 4QF9A 3U1OA 4FE8A 2XWKA 1KA1A 4NX1A 1MG1A 1BLFA 4NF4B 4BDOA 4MNIA 1MQHA 4HCYA 2XA5A 3IFAA 1RYXA 3CFZA 1ZLQA 1NNFA 1YPNA 3PTYA 2XD2A 4IB2A 1XS5A 1QUKA 2CZLA 1SW4A 1URGA 5EHMA 3ECRA 1LEVA 3R7XA 1N3XA 4F3GA 2W7YA 1FBDA 5KCJA 1Y4CA 4P1EA 3K2DA 4RK2A 1DPPA 4O94A 4YKPA 1B3HA 3LUYA 1BP5A 4XEQA 1LBYA 2MKZA 2DWHA 2GH9A 1EH3A 4RPNA 2OCUA 1M5EA 2OX3A 2ZZVA 3OENA 3H6VA 2M8CA 2DWAA 5I59B 1POTA 1NNTA 3O97A 3EHSA 4KYSA 4HE1A 2QMXA 4L17A 3ZKLA 3SERA 3K1NA 2HFBA 2R9JA 1EYIA 1NNKA 3ISPA 2CZIA 4U1ZA 1JVXA 2HCAA 2ANJA 2Q9TA 2OJTA 2FVZA 4OZ9A 4EF2A 4I9DA 1CE2A 4BDQA 3PMWA 1NUYA 2YPNA 4PGNA 4PAIA 4F3PA 2D5WA 3T0JA 4XXUA 5H8QA 5AA4A 2DE3A 3FD3A 4IY5A 1PB8A 5F24A 4F2QA 4LQ5A 3D4GA 4YKJA 1OMPA 3MVXA 3I3VA 4KPTA 3TTLA 5H8NB 1R9LA 1NKXA 4MEVA 5AA2D 4OFLA 3ILUB 3KN7A 4MIJA 3MUQA 2IEEA 1SYHA 3KGCA 1LFHA 1MM6A 1US5A 1YZ0A 4X1BA 3MZ1A 4P47A 4Q0CA 1Q9DA 5EYHA 1XT8A 2XXXA 3E9XA 4GBWA 3PPQA 1BKAA 1POY1 1B0LA 4O3CA 4PFIA 4RA1A 3HHGA 3VXCA 1FRPA 4OETA 4TQUQ 4U1OA 5EQAA 3HFUA 1K9ZA 4AS5A 4EXLA 1I6QA 4GL0A 2IA4A 1GR2A 4YICA 2XHDA 3PMXA 4NF6B 1N76A 1B5JA 1PEBA 3H4ZA 3S9NC 1SW2A 1LBCA 4I40A 3UIFA 5ET5A 3RPLA 1OLCA 1PC3A 4OXVA 2XXHA 1MY1A 2ZNUA 2AIXA 3BIGA 3IR1A 2Y84A 1WODA 2H5YA 4YB6A 1IMFA 2VPNA 4RXLA 3M3FA 5AA1A 3V5AA 3Q25A 4FJPA 2HZLA 4QSDA 1MQIA 1EZPA 4I1DA 5ELVA 2Y7RA 1MQGA 4U2RA 3PUVE 5ET7A 1MRPA 3MP6A 2CZHA 4NGUA 4GOTA 2DDKA 2I48A 2X7QA 2Z8FA 3ZS6A 2DWIA 4MNPA 3OSRA 1OVBA 1FQEA 3KFMA 1FCKA 1QUIA 2Q8MA 3B6QA 4P9KA 4OQOA 1SVXB 2QS1A 2NOOA 4LA9A 4G77A 1FPBA 5I5PA 4GLIA 4GQOA 4ISUA 3S9EA 3OEMA 4OYVA 3C34A 1R9QA 3FXBA 4F29A 1LB8A 4KYEA 3HSTA 4NWCA 3C35A 2YJPA 3TTNA 2ABHA 2F7CA 2OK2A 4KQPA 4I62A 1Q1KA 1QW0A 3N6UA 5EYGA 1HSJA 3IJXB 3IAZA 1IMAA 3TFLA 5H8HA 5JK4A 3F11A 4R2BA 2XXIA 3MZ9A 2HAUA 3T93B 2I6EA 3D1RA 2H98A 3O6IA 3GZGA 2V3QA 3FV2A 4R9FA 4H1XA 4QSEA 1SQYA 4IR8A 5IZZA 3HV1A 2F7BA 1DTZA 4BDRA 1JP4A 1PBQA 2CEXA 1ZBMA 2DOJA 4MFIA 3EKIA 3W9VA 4PF6A 4ELOA 4F31B 3CRBA 3USDA 3CR9A 1OIBA 2ZXTA 4TLMB 3HN0A 4FECA 3H3GA 4ONYA 1FPDA 1MDQA 1PBPA 2UYFA 3LUZA 4GWSA 3K1PA 3O66A 2QSXA 1FQFA 1NV7A 1NV5A 3E4RA 1DMBA 4GF8A 2WKYA 4LQ2A 4POWA 2Q2AA 1NV0A 2GFEA 3DP4A 3SEVA 4NWDA 3V8XB 1MH4A 4GWOA 2B3FA 1B6HA 1ZMGA 3SEUA 1URDA 3MVZA 1A8FA 4EQBA 2I3VA 2XXRA 4MJOA 3TEPA 4HXVA 4C1UA 3PUXE 4OESA 4TLLB 4N91A 3SESA 1MPBA 1B1HA 2VPOA 4XKPA 4QXDA 4G68C 3CG1A 2DQVA 3TAJA 2O51A 2XXTA 4R74A 3VVDA 2QS2A 3BBRA 4DLDA 3Q27A 1YXIA 5K2YA 5EYFA 1G0IA 3OMBA 3TCFA 3TODA 5AA4B 4RPOA 1RDYA 4ZE9A 1B58A 2FBPA 1XC1A 4PE3A 2X26A 5I84A 4F1VA 5DEXA 1M5DA 2I4BA 2NWJA 4YMAA 1MXWA 5JTYA 3PGFA 2ZYKA 1B32A 1JW1A 1IITA 3PU5A 3CSGA 5DYHA 4ZEBA 2Q74A 4X1DA 2YLNA 2P2AA 1D3KA 2RINA 4P0GA 4GWUA 1RDZA 1US4A 4N6DA 3G3HA 3RPLB 3G3GA 1H3DA 4OFJA 4OTEA 5H8SA 1A55A 1FBHA 2ONRA 3N5LA 2UXAA 1FTAA 5ISUA 1B5HA 5EQ7A 3UN6A 1B3EA 4I3YA 1B40A 3SETA 1LBZA 5I7IA 3U94A 5ITPA 1FPIA 5DEXB 2RCBA 1ZJLA 4QFKA 3IOTA 3UA8A 2FIXA 5CMKA 1CB6A 3RYDA 4EUOA 3C33A 2PT2A 1MQJA 1FPGA 1IUDA 3H6TA 2XXYA 1B3GA 1FJ6A 1YCJA 1XOCA 5I57A 4WEDA 4GD5A 4F1UA 1XHYA 4X48A 1FPKA 3VVFA 5ITOA 2F8DA 4PFYA 2PFYA 1ZU0A 3EQ1A 5A5LA 1QJMA 4PBHA 3KSJA 4GFRA 4FAJA 1LBXA 2V4CA 3EF7A 3WAEA 2PCRA 2UVHA 2O6AA 3IJOB 2ONSA 5EQ9A 4ZE8A 3NOHA 1DCUA 4EQ9A 1P1UA 2KLFA 4YB7A 5FHMA 5A5XA 3MSTA 2Q89A 3MAMA 3RN8A 3IB1A 4XF5A 1NUXA 1K9YA 3VFJA 2VOZA 1Y3NA 2CMOA 4ZEFA 3VLWA 2QS3A 2GHAA 3SZPA 3KZGA 3CFXA 4NQ8A 4NTLA 2I49A 4XKRA 3DELB 3PPOA 1JNFA 3T1BA 1P1OA 2V93A 1Y3PA 3GBAA 5H8HB 3B8BA 1CNQA 3SDFA 1MM7A 4UACA 1P1WA 5AE4A 1MPDA 1FQCA 4MNCA 2NUVA 4AQ4A 2HQ0A 3QAXA 4MH5A 4IO6A 4LP2B 3TTRA 1LAGE 3KEIA 2HXWA 4Q8RA 5AA2A 2WYPA 4QFPA 5DVIA 1FBFA 3HO7A 3RQTA 2FYIA 3FGSA 2VHAA 1P1NA 4U22A 4IO3A 2XXQA 4DCXA 4N8GA 3B6TA 3HPIA 4N07A 2O7IA 4DXUA 4R6YA 1OLAA 1B7HA 2Z23A 4U23A 2VD3A 3FUZA 4RJZA 3W15C 4X04A 3PV0E 5B70A 1B4ZA 1H45A 4HE0A 4R73A 3FZVA 1IXCA 2PBWA 5DT6A 3CI8A 5I57B 1H43A 5TP9B 3PD8A 1GVCA 1SI0A 3MQ9A 4QRZA 2Q8JA 2UVGA 4IGTA 1UTBB 3U72A 4R6HA 3RTWB 4E0WA 1N7WA 4Z0IA 3QUFA 3S9MC 3H6UA 3P7IA 1FQDA 5M2VA 4OENA 1IEJA 3K00A 2BJIA 1MY3A 2ONKE 3FVOA 4LVQA 4THIA 4XKNA 2V3TA 2RC8A 4F18A 2GQ1A 3LSLA 4JWXA 3G3JA 2ZZXA 5IKBA 5LOMA 1JQFA 2A5TB 3EPEA 3K6UA 1Y4TA 4DE8A 1B3FA 4JBZA 3EN3A 4F19A 3KN8A 1B2HA 3G7WA 3LV0A 2RKMA 3ODBA 4N17A 2ZYOA 3A3CA 1LFGA 1NV6A 2UVJA 3FATA 4QBAA 2P3NA 1ANFA 2Q88A 2B4LA 3CFLA 4FORA 3FJGA 1UTHA 5I2KA 3FIRA 1IXHA 3PUWE 2O1LA 4RY1A 3FVNA 3K4UA 2P3VA 4BLAA 5FTIA 4JVCA 5DTBA 2OLBA 1A54A 2QPQA 4YU0A 4PAFA 5BWJA 3IFCA 1T0KA 2RC7A 3MYUA 1DPEA 4P0IA 4JSDA 4X9TA 1AIVA 2PMSA 1N3WA 1FW0A 4G68B 2QVRA 4RNSA 1FTJA 4MHFA 5TP9A 2HPGA 4IO4A 3THIA 1M5FA 2H25A 4EF1A 4JB7A 1NH8A 2XX8A 2Z8EA 2E1SA 3S9LC 3T9HB 2ZMBA 2XWOA 4RYAA
chains in the Genus database with same CATH topology
4FIMA 1URDA 3MVZA 3C4MA 4GXSB 3QIMA 1B3LA 2XXPA 1A8FA 3B6WA 3IO6A 3MW0A 4H8JA 4R75A 3T9XB 2I3VA 2Z8DA 4BDNA 4EQBA 4Z7EA 3U92A 2XXRA 4N6PA 4PP0A 3FASA 3TEPA 4C1UA 3MWBA 3PUXE 4OESA 4TLLB 1JEVA 1QVSA 3MP1A 1II5A 1NFTA 3SESA 5JEIA 2F78A 4ZS9A 1D9VA 1MPBA 3SEWA 3N26A 1J1NA 2D21A 1AL3A 1B1HA 3MVWA 3QUJA 1IQ7A 1N0TA 2XXVA 4GRKA 2B65A 3MZBA 4XKPA 4BDLA 4HTGA 5JTYB 4G68C 3G3KA 2F6PA 3FJ7A 4U4XA 3Q29A 4KCDA 3K02A 3CG1A 2DQVA 2VP1A 2Y7IA 3Q26A 5BUUA 2UVIA 3OO6A 3TAJA 3C32A 2O51A 2XXTA 3OOAA 4R74A 3VVDA 2QS2A 3IK6B 3PMVA 3RT8A 1VE4A 1MY4A 3BBRA 2DVCA 2DE4A 4DLDA 1JEUA 4GIZA 3Q27A 4DCYA 5K2YA 3N94A 3DLNA 5ICTA 3M8UA 5EYFA 1UIVA 2V84A 3LR1A 3VLUA 1NMUA 2ZNTA 1H76A 3OO9A 2XXUA 1YAEA 4OVJA 1WVJA 2I0CA 3OMBA 3TCFA 3TODA 5AA4B 1B7ZA 1XVYA 1B51A 3OELA 4KCCA 4RPOA 3OSQA 1Y9UA 2VD2A 2O1MA 5KDTA 2OBGA 1B1XA 3O6GA 4P11A 4ELRA 4QF9A 4ZE9A 1ZKBA 1B58A 3U1OA 4YMBA 4FE8A 4E0XA 1SBPA 3KN3A 1XC1A 3TELA 5TPAB 3T66A 3PPPA 4DDDA 1MG1A 2X26A 2DXRA 3I6VA 1BLFA 5I84A 4F1VA 5DEXA 1M5DA 2I4BA 2NWJA 2ZNSA 4H8IA 4YMAA 1FQBA 1LLSA 1MXWA 4NF4B 2RF1A 3ILTB 3V8XB 4BDOA 3PGFA 5JTYA 1MQHA 3VXBA 2ZYKA 1B32A 4HCYA 4YKIA 2ESNA 1JW1A 1IITA 5CBSA 3PU5A 3CSGA 4F2OA 1RYXA 3CFZA 1ZLQA 1NNFA 5DYHA 1YPNA 1TFAA 1TT1A 1WDNA 2OZZA 4ZEBA 3RY3A 4NF4A 2F5XA 4G2ZA 2DWJA 2XD2A 4IB2A 4WKMA 1XS5A 5CRYA 4F22A 4X1DA 3SEXA 3QXMA 4H5FA 2YLNA 2P2AA 1D3KA 2RINA 3CIJA 2BJJX 1QUKA 3KOTA 2CZLA 3EHUA 2B3BA 4P0GA 5CMMA 1UIUA 1KWHA 3KJTA 1SW4A 1US4A 3G3HA 3IORA 5A5XB 1URGA 5EHMA 3ECRA 3R7XA 1N3XA 2OWSA 3DP8A 2W7YA 4F3GA 1GGGA 3G3GA 4H5GA 1H3DA 5CMBA 4C0RA 4OFJA 3UORA 4OTEA 5KCJA 4JDFA 1Y4CA 1O64A 5H8SA 3K2DA 4O3BA 1A55A 4RK2A 1LAXA 5FHOA 3IL1B 4F1YA 4ESXA 4H0WA 2ONRA 3K1MA 1DPPA 2DP8A 3G3IA 3HCQA 4ZZEA 3PUZE 3N5LA 1B3HA 4GVOA 4PETA 3LUYA 1JETA 2UXAA 4XIGQ 1BP5A 1JW4A 1VFEA 1HSEA 2DWHA 5KDTB 5ISUA 2GH9A 1EH3A 1B5HA 1LB9A 4RPNA 5F7VA 1A7LA 1B3EA 1RKMA 1M5EA 2OCUA 2PVUA 4QFOA 3UN6A 1B40A 2V25A 3SETA 3VDFA 3U94A 4M4GA 1MY0A 5ITPA 3OENA 1EZOA 3TQWA 2DS9A 3H6VA 4YAHX 5DEXB 2RCBA 4K3FA 3KOSA 3TDJA 1ZJLA 2DWAA 2M8CA 5I59B 1B7UA 4QFKA 1POTA 2P0SA 1HSLA 1OQHA 3IOTA 1NNTA 2VGQA 3O97A 1NH7A 3UA8A 3EHSA 3TTKA 5CMKA 4LZ5A 4KYSA 1CB6A 4MBPA 1H44A 3ZKLA 1S50A 2QMXA 1Z7NE 2G29A 3DM0A 1IIWA 4L17A 3K1NA 2HFBA 2R9JA 4MLQA 3SERA 2F97A 1B05A 5B7DA 3HHFA 3MC2A 1OVTA 1B5IA 4Q30B 1FTMA 1NNKA 5CI5A 4EUOA 3C33A 2PT2A 4U1ZA 1JVXA 1MQJA 4NMYA 2HCAA 4ZEDA 1MPCA 1IUDA 1A8EA 3H6TA 4LZ7A 3IX1A 1MXVA 2ANJA 2Q9TA 1F9BA 3KBRA 3MPLA 4H65A 2OJTA 3MBPA 4N13A 3T9HB 3V89B 2XXYA 1B3GA 1EZ9A 4OZ9A 4NE4A 4ZEIA 5AA3A 4EF2A 3FJMA 1YCJA 3RTFB 1BTJA 4I9DA 1CE2A 3RNNA 4MLVA 2Y7KA 1XOCA 4BDQA 3T22A 5I57A 1ELJA 3IOWA 3IB2A 4GD5A 3PMWA 4WEDA 3VV5A 4F1UA 2YPNA 4OFOA 1Y3QA 3KJ7A 1N7XA 1RYOA 1XHYA 2PYYA 4F3PA 1ZIUA 2D5WA 2R71A 3IOVA 4X48A 1D4NA 3I5OA 3VVFA 4XXUA 5H8QA 5ITOA 3TCGA 5AA4A 4DIGA 2F8DA 2DE3A 3FD3A 1OQGA 4IY5A 4PFYA 1ZU0A 3N6TA 1PB8A 3BFTA 4F39A 2LAOA 3EQ1A 4YZZA 1QJMA 3LBSA 5FHNA 5L9SA 1FTOA 1JW5A 4LQ5A 4F2QA 2O84X 1LFIA 2D3IA 3D4GA 4QFLA 4YKJA 3KSJA 1OMPA 5L8DA 3TQLA 3MVXA 4NF5A 3K01A 3PD9A 3G3FA 4AB6A 2X7PA 3FXRA 2QS4A 3I3VA 4GFRA 2AL4A 4KPTA 4FAJA 2I58A 4DZ1A 3OEKA 1VR5A 3OO8A 3TTLA 3EF7A 3WAEA 1MH3A 3DP6A 5H8NB 1R9LA 2I3WA 3R26A 3RGYA 1NKXA 5AA2D 2UVHA 4OFLA 2O6AA 3IJOB 2REGA 1LBBA 4ELPA 3ILUB 2ONSA 3KN7A 2XD3A 3UGWA 3W9WA 1A40A 2QL3A 4NEDA 3FV1A 4ZE8A 3MUQA 2FA7A 2IEEA 4R9GA 1GTKA 1SYHA 3KGCA 1S7YA 2I4CA 4EQ9A 4OMBA 1LFHA 4EQ7A 1MM6A 1P1UA 1US5A 2KLFA 4X1BA 4YB7A 2I0BA 1R1NA 5FHMA 5A5XA 1GV8A 3MZ1A 1LSTA 5KZTA 2Q89A 4R72A 1O63A 3MAMA 3O6HA 3S2VA 1Q35A 2ZYMA 3RN8A 3IB1A 1D9YA 4Q0CA 1NNPA 3E13X 1A99A 5EHSA 1XT8A 2XXXA 3E9XA 3U93A 3U8QA 3PPQA 1BKAA 4OHNA 4KHZE 1POY1 1B0LA 1MY2A 4O3CA 4RA1A 3VFJA 3HHGA 3VXCA 1LAFE 3QYTA 4XTCQ 1AMFA 1PDAA 4OETA 1SW5A 4M1VA 2VOZA 4BDMA 1IZ1A 1Y3NA 4TQUQ 1M5BA 2CMOA 2XX9A 4U1OA 3L6GA 4ZEFA 4C1TA 3B7DA 2GRVA 3VLWA 1PB9A 2QS3A 2GHAA 4WEPA 3JYRA 1I6QA 4EXLA 3KZGA 4GL0A 3RT6B 2Y7PA 3AXFA 4OERA 2IA4A 2HAVA 4HS7A 5ICQA 3CFXA 4KFQA 4NTLA 2I49A 1O7TA 4XKRA 4G4PA 3DELB 1GR2A 4YICA 1LAHE 3PPOA 3GLBA 1QUJA 2XHDA 3WAFA 4F3BA 3PMXA 1JNFA 4NF6B 1N76A 3T96B 1B5JA 1PEBA 4OEVA 1P1OA 2V93A 1Y3PA 3GBAA 3H4ZA 1SW2A 3PPNA 5H8HB 3LSXA 4PQJA 1LBCA 1MXUA 3SDFA 2E0SA 1MM7A 4UACA 2ALUA 1P1WA 4WXJA 3UIFA 5AE4A 1MPDA 1OLCA 4ZECA 1FQCA 1PC3A 2F36A 4OXVA 1DTGA 5I56A 2NUVA 4AQ4A 2HQ0A 3QAXA 2XXHA 4MH5A 1B0HA 1SI1A 3R6UA 1DSNA 4ND9A 4IO6A 1FTLA 2ZYNA 1MY1A 4LP2B 2ZNUA 1MXYA 2AIXA 3FVGA 4FEDA 1UQWA 5H8NA 3TTRA 3IR1A 4JSOA 5I56B 1LAGE 3RLFE 2Y84A 3KEIA 1WODA 2HXWA 4Q8RA 2H5YA 3K6XA 4GL8A 4YB6A 2G93A 5AA2A 5I58A 4QFPA 1I6AA 5DVIA 1MXXA 4OWDA 3HO7A 3RQTA 2F34A 4G68A 4YB5A 2FYIA 1B46A 4RXLA 3LC8A 3M3FA 3FGSA 4NF8B 4ZDMA 2VHAA 1P1NA 5AA1A 2NVUB 2QJEA 4U22A 1QKBA 1VSOA 2V3UA 4IO3A 3V5AA 2XXQA 4DCXA 4ESWA 3A3UA 3B6TA 3HPIA 3Q25A 1ATGA 3SKPA 3OO7A 1SW1A 2O7IA 4N07A 4FJPA 2HZLA 3M3LA 1I69A 2UYEA 1QULA 3H6WA 5H8FA 5L9MA 4QSDA 1MQIA 3PPRA 4DXUA 1B9JA 4XKQA 3S4UA 1MDP1 5CBRA 4IGRA 4I1DA 3VVEA 4R6YA 5FTHA 2XX7A 5ELVA 2Y7RA 1MQGA 1OLAA 3FXUA 3T9VA 4U2RA 2THIA 3ZSFA 1B7HA 2RC9A 2Z23A 4U23A 3PUVE 2VD3A 3FUZA 4RJZA 3W15C 3GXAA 1QKAA 2F7AA 1FTKA 2O69A 3PV0E 3KG2A 1MRPA 4AB5A 5B70A 5IAIA 3MP6A 4IO7A 4IY6A 3L6HA 2A5TA 1B4ZA 1H45A 4GOTA 4R73A 3FZVA 1IXCA 2PBWA 5DT6A 2I48A 1XVXA 3CI8A 1P1QA 3LSWA 5HBCA 3VE1B 5I57B 3CVGA 3ONMA 2X7QA 2Z8FA 4TOZA 3ZS6A 2DWIA 1H43A 4YKKA 5H8FB 5TP9B 3PD8A 1R6ZA 4PFWA 1Y1MA 1SI0A 3OSRA 4H67A 2PX1A 1GVCA 3MQ9A 1B52A 1OVBA 4Q5TA 1FQEA 4OEUA 4QRZA 3KFMA 2Q8JA 2UVGA 4RK9A 4FATA 1FCKA 1QUIA 1UTBB 4IGTA 3TTMA 1I6BA 5KCJB 1AOVA 3U72A 5J1DA 4R6HA 3RTWB 3B6QA 4E0WA 1N7WA 3H03A 4OQOA 4Z0IA 1SVXB 3QUFA 3RPWA 3RUMA 3O29A 3OD7A 2QS1A 5DVJA 5I58B 4NF6A 4U21A 3O2AA 2NOOA 2H9BA 4LA9A 3UP9A 3S9MC 3H6UA 3P7IA 4G77A 4HCWA 4KYDA 4QSCA 3TUSA 1FQDA 3IOUA 2R6GE 4GLIA 4GQOA 4ISUA 3TZAA 5M2VA 4OENA 3C9HA 1IEJA 3K00A 4KD5A 3S9EA 1EZPA 1NL5A 2DYXA 2O7UA 3OEMA 1MY3A 1L5TA 4POXA 5I2NA 1EU8A 2ONKE 3C31A 3FVOA 4IO5A 4LVQA 1LCFA 4R2FA 5TU0A 4OYVA 4ECFA 5L9OA 4THIA 3C34A 1R9QA 4XKNA 3GBBA 5CC2A 2V3TA 2RC8A 4F18A 3TMGA 4F29A 1LB8A 4ZEKA 4KYEA 1USYH 2Y7WA 3HSTA 1YTVA 5HM4B 1JVYA 3LSLA 4NWCA 5F1QA 3C35A 2YJPA 4JWXA 2QMWA 3G3JA 3LSFB 4R6KA 3TTNA 4NF8A 2ABHA 2F7CA 2OK2A 4KQPA 5IKBA 5LOMA 5CM6A 1JQFA 2A5TB 3O28A 2H99A 3H06B 3OXNA 4I62A 1Q1KA 1QW0A 3N6UA 3EPEA 3K6UA 1HSJA 1Y4TA 3IJXB 4DE8A 1B3FA 3IAZA 4JBZA 4PFTA 3EN3A 3TFLA 3IB0A 2Q2CA 4ZZAA 5H8HA 4F19A 1IXGA 3Q28A 5JK4A 3F11A 3KN8A 3SEYA 1TFDA 4R2BA 1LGBC 1MS7A 2XXIA 1S9TA 1B2HA 3MZ9A 3G7WA 4G8HA 1DOTA 2HAUA 2RKMA 3ODBA 4DXBA 3TCHA 2Z22A 2ZYOA 1UTBA 3JZJA 4KR5A 3T93B 2DSFA 2I6EA 2DVZA 3A3CA 2H4IA 1LFGA 2UVJA 1Y1ZA 1N04A 2H98A 3JV9A 3O6IA 1AH5A 3FATA 3GZGA 2V3QA 3QK6A 1N84A 3FV2A 3MPKA 3MJNA 1ANFA 1LCTA 3CSBA 1USYE 2Q88A 4QHQA 4H1XA 4R9FA 1TWYA 3CFLA 5H8QB 4GXAA 3TYHA 4FORA 4QSEA 1SQYA 3FVKA 3FJGA 1MQDA 1UTHA 3FIRA 4IO2A 1IXHA 1M5CA 5CMCA 4EDPA 5I2KA 3PUWE 3HV1A 3T9UA 2F7BA 2O1LA 1DTZA 3FVNA 4RY1A 1MXZA 4BDRA 4F3SA 3MP8A 3K4UA 4BLAA 1PBQA 4DXCA 1Z7ME 5FTIA 1B4HA 2QRYA 5DTBA 1ZBMA 3IO4A 2AYSA 2DOJA 2OLBA 1A54A 4MFIA 2QPQA 3UK4A 4JWYA 1TXFA 4ELQA 3W9VA 4YU0A 3ZKKA 3QSLA 3VLVA 4ELOA 4F31B 2OWTA 2F35A 3CRBA 3K6VA 3MVYA 4KI0E 2AL5A 5BWJA 2PT1A 1T0KA 3USDA 3CR9A 2DE2A 3H7MA 4PFUA 4EXKA 1OIBA 4UA8A 2ZXTA 4TLMB 1PB7A 2RC7A 4LZ8A 2XXWA 1DPEA 2P1SA 3HN0A 3H3GA 1VFDA 2DXYA 4FECA 4H6DA 4LUBA 4ONYA 4U4SA 4P0IA 4YKPA 3EHTA 1MDQA 1PBPA 2GHBA 2UYFA 4LATA 4PE5B 2HEUA 3BKIB 2RCAA 3K1PA 5TPAA 4HW8A 4JSDA 2FNCA 3O66A 3D4CA 4X9TA 1AIVA 2PMSA 1N3WA 3E3KA 3KSXA 4G8MA 4I8CA 5AA2B 1URSA 4FEBA 2QSXA 1Y20A 4JXIA 1FW0A 3K0VA 1FQFA 1P99A 3BFUA 4G68B 5I2NB 2NXOA 3V83A 1BIYA 1FTJA 1SD3A 2O68A 4RNSA 3O9PA 4G8NA 1UTHB 3M3KA 3E4RA 4QFNA 5TP9A 1SYIA 4IO4A 3THIA 4JWOA 1ZTYA 3TKDA 1DMBA 1M5FA 3C36A 2H25A 3A09A 4GF8A 4LONB 3TPAA 5HPQA 2WKYA 4EF1A 2A5SA 3CG3A 2F6GA 4JB7A 4LQ2A 1NH8A 2XX8A 2HZKA 4NF5B 1FQAA 2Z8EA 5DVFA 4POWA 2Q2AA 2E1SA 3FXQA 3S9LC 2GFEA 5I2KB 3DP4A 5I59A 2REJA 3SEVA 4NWDA 3K6WA 5K2XA 1MH4A 1SDXA 2B3FA 2ZMBA 4GWOA 3PUYE 1B6HA 4O3AA 3S9NC 4MF3A 1IXIA 4RYAA 1ZMGA 3SEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIM A;  1URD A;  3MVZ A;  3C4M A;  4GXS B;  3QIM A;  1B3L A;  2XXP A;  1A8F A;  3B6W A;  3IO6 A;  3MW0 A;  4H8J A;  4R75 A;  3T9X B;  2I3V A;  2Z8D A;  4BDN A;  4EQB A;  4Z7E A;  3U92 A;  2XXR A;  4N6P A;  4PP0 A;  3FAS A;  3TEP A;  4C1U A;  3MWB A;  3PUX E;  4OES A;  4TLL B;  1JEV A;  1QVS A;  3MP1 A;  1II5 A;  1NFT A;  3SES A;  5JEI A;  2F78 A;  4ZS9 A;  1D9V A;  1MPB A;  3SEW A;  3N26 A;  1J1N A;  2D21 A;  1AL3 A;  1B1H A;  3MVW A;  3QUJ A;  1IQ7 A;  1N0T A;  2XXV A;  4GRK A;  2B65 A;  3MZB A;  4XKP A;  4BDL A;  4HTG A;  5JTY B;  4G68 C;  3G3K A;  2F6P A;  3FJ7 A;  4U4X A;  3Q29 A;  4KCD A;  3K02 A;  3CG1 A;  2DQV A;  2VP1 A;  2Y7I A;  3Q26 A;  5BUU A;  2UVI A;  3OO6 A;  3TAJ A;  3C32 A;  2O51 A;  2XXT A;  3OOA A;  4R74 A;  3VVD A;  2QS2 A;  3IK6 B;  3PMV A;  3RT8 A;  1VE4 A;  1MY4 A;  3BBR A;  2DVC A;  2DE4 A;  4DLD A;  1JEU A;  4GIZ A;  3Q27 A;  4DCY A;  5K2Y A;  3N94 A;  3DLN A;  5ICT A;  3M8U A;  5EYF A;  1UIV A;  2V84 A;  3LR1 A;  3VLU A;  1NMU A;  2ZNT A;  1H76 A;  3OO9 A;  2XXU A;  1YAE A;  4OVJ A;  1WVJ A;  2I0C A;  3OMB A;  3TCF A;  3TOD A;  5AA4 B;  1B7Z A;  1XVY A;  1B51 A;  3OEL A;  4KCC A;  4RPO A;  3OSQ A;  1Y9U A;  2VD2 A;  2O1M A;  5KDT A;  2OBG A;  1B1X A;  3O6G A;  4P11 A;  4ELR A;  4QF9 A;  4ZE9 A;  1ZKB A;  1B58 A;  3U1O A;  4YMB A;  4FE8 A;  4E0X A;  1SBP A;  3KN3 A;  1XC1 A;  3TEL A;  5TPA B;  3T66 A;  3PPP A;  4DDD A;  1MG1 A;  2X26 A;  2DXR A;  3I6V A;  1BLF A;  5I84 A;  4F1V A;  5DEX A;  1M5D A;  2I4B A;  2NWJ A;  2ZNS A;  4H8I A;  4YMA A;  1FQB A;  1LLS A;  1MXW A;  4NF4 B;  2RF1 A;  3ILT B;  3V8X B;  4BDO A;  3PGF A;  5JTY A;  1MQH A;  3VXB A;  2ZYK A;  1B32 A;  4HCY A;  4YKI A;  2ESN A;  1JW1 A;  1IIT A;  5CBS A;  3PU5 A;  3CSG A;  4F2O A;  1RYX A;  3CFZ A;  1ZLQ A;  1NNF A;  5DYH A;  1YPN A;  1TFA A;  1TT1 A;  1WDN A;  2OZZ A;  4ZEB A;  3RY3 A;  4NF4 A;  2F5X A;  4G2Z A;  2DWJ A;  2XD2 A;  4IB2 A;  4WKM A;  1XS5 A;  5CRY A;  4F22 A;  4X1D A;  3SEX A;  3QXM A;  4H5F A;  2YLN A;  2P2A A;  1D3K A;  2RIN A;  3CIJ A;  2BJJ X;  1QUK A;  3KOT A;  2CZL A;  3EHU A;  2B3B A;  4P0G A;  5CMM A;  1UIU A;  1KWH A;  3KJT A;  1SW4 A;  1US4 A;  3G3H A;  3IOR A;  5A5X B;  1URG A;  5EHM A;  3ECR A;  3R7X A;  1N3X A;  2OWS A;  3DP8 A;  2W7Y A;  4F3G A;  1GGG A;  3G3G A;  4H5G A;  1H3D A;  5CMB A;  4C0R A;  4OFJ A;  3UOR A;  4OTE A;  5KCJ A;  4JDF A;  1Y4C A;  1O64 A;  5H8S A;  3K2D A;  4O3B A;  1A55 A;  4RK2 A;  1LAX A;  5FHO A;  3IL1 B;  4F1Y A;  4ESX A;  4H0W A;  2ONR A;  3K1M A;  1DPP A;  2DP8 A;  3G3I A;  3HCQ A;  4ZZE A;  3PUZ E;  3N5L A;  1B3H A;  4GVO A;  4PET A;  3LUY A;  1JET A;  2UXA A;  4XIG Q;  1BP5 A;  1JW4 A;  1VFE A;  1HSE A;  2DWH A;  5KDT B;  5ISU A;  2GH9 A;  1EH3 A;  1B5H A;  1LB9 A;  4RPN A;  5F7V A;  1A7L A;  1B3E A;  1RKM A;  1M5E A;  2OCU A;  2PVU A;  4QFO A;  3UN6 A;  1B40 A;  2V25 A;  3SET A;  3VDF A;  3U94 A;  4M4G A;  1MY0 A;  5ITP A;  3OEN A;  1EZO A;  3TQW A;  2DS9 A;  3H6V A;  4YAH X;  5DEX B;  2RCB A;  4K3F A;  3KOS A;  3TDJ A;  1ZJL A;  2DWA A;  2M8C A;  5I59 B;  1B7U A;  4QFK A;  1POT A;  2P0S A;  1HSL A;  1OQH A;  3IOT A;  1NNT A;  2VGQ A;  3O97 A;  1NH7 A;  3UA8 A;  3EHS A;  3TTK A;  5CMK A;  4LZ5 A;  4KYS A;  1CB6 A;  4MBP A;  1H44 A;  3ZKL A;  1S50 A;  2QMX A;  1Z7N E;  2G29 A;  3DM0 A;  1IIW A;  4L17 A;  3K1N A;  2HFB A;  2R9J A;  4MLQ A;  3SER A;  2F97 A;  1B05 A;  5B7D A;  3HHF A;  3MC2 A;  1OVT A;  1B5I A;  4Q30 B;  1FTM A;  1NNK A;  5CI5 A;  4EUO A;  3C33 A;  2PT2 A;  4U1Z A;  1JVX A;  1MQJ A;  4NMY A;  2HCA A;  4ZED A;  1MPC A;  1IUD A;  1A8E A;  3H6T A;  4LZ7 A;  3IX1 A;  1MXV A;  2ANJ A;  2Q9T A;  1F9B A;  3KBR A;  3MPL A;  4H65 A;  2OJT A;  3MBP A;  4N13 A;  3T9H B;  3V89 B;  2XXY A;  1B3G A;  1EZ9 A;  4OZ9 A;  4NE4 A;  4ZEI A;  5AA3 A;  4EF2 A;  3FJM A;  1YCJ A;  3RTF B;  1BTJ A;  4I9D A;  1CE2 A;  3RNN A;  4MLV A;  2Y7K A;  1XOC A;  4BDQ A;  3T22 A;  5I57 A;  1ELJ A;  3IOW A;  3IB2 A;  4GD5 A;  3PMW A;  4WED A;  3VV5 A;  4F1U A;  2YPN A;  4OFO A;  1Y3Q A;  3KJ7 A;  1N7X A;  1RYO A;  1XHY A;  2PYY A;  4F3P A;  1ZIU A;  2D5W A;  2R71 A;  3IOV A;  4X48 A;  1D4N A;  3I5O A;  3VVF A;  4XXU A;  5H8Q A;  5ITO A;  3TCG A;  5AA4 A;  4DIG A;  2F8D A;  2DE3 A;  3FD3 A;  1OQG A;  4IY5 A;  4PFY A;  1ZU0 A;  3N6T A;  1PB8 A;  3BFT A;  4F39 A;  2LAO A;  3EQ1 A;  4YZZ A;  1QJM A;  3LBS A;  5FHN A;  5L9S A;  1FTO A;  1JW5 A;  4LQ5 A;  4F2Q A;  2O84 X;  1LFI A;  2D3I A;  3D4G A;  4QFL A;  4YKJ A;  3KSJ A;  1OMP A;  5L8D A;  3TQL A;  3MVX A;  4NF5 A;  3K01 A;  3PD9 A;  3G3F A;  4AB6 A;  2X7P A;  3FXR A;  2QS4 A;  3I3V A;  4GFR A;  2AL4 A;  4KPT A;  4FAJ A;  2I58 A;  4DZ1 A;  3OEK A;  1VR5 A;  3OO8 A;  3TTL A;  3EF7 A;  3WAE A;  1MH3 A;  3DP6 A;  5H8N B;  1R9L A;  2I3W A;  3R26 A;  3RGY A;  1NKX A;  5AA2 D;  2UVH A;  4OFL A;  2O6A A;  3IJO B;  2REG A;  1LBB A;  4ELP A;  3ILU B;  2ONS A;  3KN7 A;  2XD3 A;  3UGW A;  3W9W A;  1A40 A;  2QL3 A;  4NED A;  3FV1 A;  4ZE8 A;  3MUQ A;  2FA7 A;  2IEE A;  4R9G A;  1GTK A;  1SYH A;  3KGC A;  1S7Y A;  2I4C A;  4EQ9 A;  4OMB A;  1LFH A;  4EQ7 A;  1MM6 A;  1P1U A;  1US5 A;  2KLF A;  4X1B A;  4YB7 A;  2I0B A;  1R1N A;  5FHM A;  5A5X A;  1GV8 A;  3MZ1 A;  1LST A;  5KZT A;  2Q89 A;  4R72 A;  1O63 A;  3MAM A;  3O6H A;  3S2V A;  1Q35 A;  2ZYM A;  3RN8 A;  3IB1 A;  1D9Y A;  4Q0C A;  1NNP A;  3E13 X;  1A99 A;  5EHS A;  1XT8 A;  2XXX A;  3E9X A;  3U93 A;  3U8Q A;  3PPQ A;  1BKA A;  4OHN A;  4KHZ E;  1POY 1;  1B0L A;  1MY2 A;  4O3C A;  4RA1 A;  3VFJ A;  3HHG A;  3VXC A;  1LAF E;  3QYT A;  4XTC Q;  1AMF A;  1PDA A;  4OET A;  1SW5 A;  4M1V A;  2VOZ A;  4BDM A;  1IZ1 A;  1Y3N A;  4TQU Q;  1M5B A;  2CMO A;  2XX9 A;  4U1O A;  3L6G A;  4ZEF A;  4C1T A;  3B7D A;  2GRV A;  3VLW A;  1PB9 A;  2QS3 A;  2GHA A;  4WEP A;  3JYR A;  1I6Q A;  4EXL A;  3KZG A;  4GL0 A;  3RT6 B;  2Y7P A;  3AXF A;  4OER A;  2IA4 A;  2HAV A;  4HS7 A;  5ICQ A;  3CFX A;  4KFQ A;  4NTL A;  2I49 A;  1O7T A;  4XKR A;  4G4P A;  3DEL B;  1GR2 A;  4YIC A;  1LAH E;  3PPO A;  3GLB A;  1QUJ A;  2XHD A;  3WAF A;  4F3B A;  3PMX A;  1JNF A;  4NF6 B;  1N76 A;  3T96 B;  1B5J A;  1PEB A;  4OEV A;  1P1O A;  2V93 A;  1Y3P A;  3GBA A;  3H4Z A;  1SW2 A;  3PPN A;  5H8H B;  3LSX A;  4PQJ A;  1LBC A;  1MXU A;  3SDF A;  2E0S A;  1MM7 A;  4UAC A;  2ALU A;  1P1W A;  4WXJ A;  3UIF A;  5AE4 A;  1MPD A;  1OLC A;  4ZEC A;  1FQC A;  1PC3 A;  2F36 A;  4OXV A;  1DTG A;  5I56 A;  2NUV A;  4AQ4 A;  2HQ0 A;  3QAX A;  2XXH A;  4MH5 A;  1B0H A;  1SI1 A;  3R6U A;  1DSN A;  4ND9 A;  4IO6 A;  1FTL A;  2ZYN A;  1MY1 A;  4LP2 B;  2ZNU A;  1MXY A;  2AIX A;  3FVG A;  4FED A;  1UQW A;  5H8N A;  3TTR A;  3IR1 A;  4JSO A;  5I56 B;  1LAG E;  3RLF E;  2Y84 A;  3KEI A;  1WOD A;  2HXW A;  4Q8R A;  2H5Y A;  3K6X A;  4GL8 A;  4YB6 A;  2G93 A;  5AA2 A;  5I58 A;  4QFP A;  1I6A A;  5DVI A;  1MXX A;  4OWD A;  3HO7 A;  3RQT A;  2F34 A;  4G68 A;  4YB5 A;  2FYI A;  1B46 A;  4RXL A;  3LC8 A;  3M3F A;  3FGS A;  4NF8 B;  4ZDM A;  2VHA A;  1P1N A;  5AA1 A;  2NVU B;  2QJE A;  4U22 A;  1QKB A;  1VSO A;  2V3U A;  4IO3 A;  3V5A A;  2XXQ A;  4DCX A;  4ESW A;  3A3U A;  3B6T A;  3HPI A;  3Q25 A;  1ATG A;  3SKP A;  3OO7 A;  1SW1 A;  2O7I A;  4N07 A;  4FJP A;  2HZL A;  3M3L A;  1I69 A;  2UYE A;  1QUL A;  3H6W A;  5H8F A;  5L9M A;  4QSD A;  1MQI A;  3PPR A;  4DXU A;  1B9J A;  4XKQ A;  3S4U A;  1MDP 1;  5CBR A;  4IGR A;  4I1D A;  3VVE A;  4R6Y A;  5FTH A;  2XX7 A;  5ELV A;  2Y7R A;  1MQG A;  1OLA A;  3FXU A;  3T9V A;  4U2R A;  2THI A;  3ZSF A;  1B7H A;  2RC9 A;  2Z23 A;  4U23 A;  3PUV E;  2VD3 A;  3FUZ A;  4RJZ A;  3W15 C;  3GXA A;  1QKA A;  2F7A A;  1FTK A;  2O69 A;  3PV0 E;  3KG2 A;  1MRP A;  4AB5 A;  5B70 A;  5IAI A;  3MP6 A;  4IO7 A;  4IY6 A;  3L6H A;  2A5T A;  1B4Z A;  1H45 A;  4GOT A;  4R73 A;  3FZV A;  1IXC A;  2PBW A;  5DT6 A;  2I48 A;  1XVX A;  3CI8 A;  1P1Q A;  3LSW A;  5HBC A;  3VE1 B;  5I57 B;  3CVG A;  3ONM A;  2X7Q A;  2Z8F A;  4TOZ A;  3ZS6 A;  2DWI A;  1H43 A;  4YKK A;  5H8F B;  5TP9 B;  3PD8 A;  1R6Z A;  4PFW A;  1Y1M A;  1SI0 A;  3OSR A;  4H67 A;  2PX1 A;  1GVC A;  3MQ9 A;  1B52 A;  1OVB A;  4Q5T A;  1FQE A;  4OEU A;  4QRZ A;  3KFM A;  2Q8J A;  2UVG A;  4RK9 A;  4FAT A;  1FCK A;  1QUI A;  1UTB B;  4IGT A;  3TTM A;  1I6B A;  5KCJ B;  1AOV A;  3U72 A;  5J1D A;  4R6H A;  3RTW B;  3B6Q A;  4E0W A;  1N7W A;  3H03 A;  4OQO A;  4Z0I A;  1SVX B;  3QUF A;  3RPW A;  3RUM A;  3O29 A;  3OD7 A;  2QS1 A;  5DVJ A;  5I58 B;  4NF6 A;  4U21 A;  3O2A A;  2NOO A;  2H9B A;  4LA9 A;  3UP9 A;  3S9M C;  3H6U A;  3P7I A;  4G77 A;  4HCW A;  4KYD A;  4QSC A;  3TUS A;  1FQD A;  3IOU A;  2R6G E;  4GLI A;  4GQO A;  4ISU A;  3TZA A;  5M2V A;  4OEN A;  3C9H A;  1IEJ A;  3K00 A;  4KD5 A;  3S9E A;  1EZP A;  1NL5 A;  2DYX A;  2O7U A;  3OEM A;  1MY3 A;  1L5T A;  4POX A;  5I2N A;  1EU8 A;  2ONK E;  3C31 A;  3FVO A;  4IO5 A;  4LVQ A;  1LCF A;  4R2F A;  5TU0 A;  4OYV A;  4ECF A;  5L9O A;  4THI A;  3C34 A;  1R9Q A;  4XKN A;  3GBB A;  5CC2 A;  2V3T A;  2RC8 A;  4F18 A;  3TMG A;  4F29 A;  1LB8 A;  4ZEK A;  4KYE A;  1USY H;  2Y7W A;  3HST A;  1YTV A;  5HM4 B;  1JVY A;  3LSL A;  4NWC A;  5F1Q A;  3C35 A;  2YJP A;  4JWX A;  2QMW A;  3G3J A;  3LSF B;  4R6K A;  3TTN A;  4NF8 A;  2ABH A;  2F7C A;  2OK2 A;  4KQP A;  5IKB A;  5LOM A;  5CM6 A;  1JQF A;  2A5T B;  3O28 A;  2H99 A;  3H06 B;  3OXN A;  4I62 A;  1Q1K A;  1QW0 A;  3N6U A;  3EPE A;  3K6U A;  1HSJ A;  1Y4T A;  3IJX B;  4DE8 A;  1B3F A;  3IAZ A;  4JBZ A;  4PFT A;  3EN3 A;  3TFL A;  3IB0 A;  2Q2C A;  4ZZA A;  5H8H A;  4F19 A;  1IXG A;  3Q28 A;  5JK4 A;  3F11 A;  3KN8 A;  3SEY A;  1TFD A;  4R2B A;  1LGB C;  1MS7 A;  2XXI A;  1S9T A;  1B2H A;  3MZ9 A;  3G7W A;  4G8H A;  1DOT A;  2HAU A;  2RKM A;  3ODB A;  4DXB A;  3TCH A;  2Z22 A;  2ZYO A;  1UTB A;  3JZJ A;  4KR5 A;  3T93 B;  2DSF A;  2I6E A;  2DVZ A;  3A3C A;  2H4I A;  1LFG A;  2UVJ A;  1Y1Z A;  1N04 A;  2H98 A;  3JV9 A;  3O6I A;  1AH5 A;  3FAT A;  3GZG A;  2V3Q A;  3QK6 A;  1N84 A;  3FV2 A;  3MPK A;  3MJN A;  1ANF A;  1LCT A;  3CSB A;  1USY E;  2Q88 A;  4QHQ A;  4H1X A;  4R9F A;  1TWY A;  3CFL A;  5H8Q B;  4GXA A;  3TYH A;  4FOR A;  4QSE A;  1SQY A;  3FVK A;  3FJG A;  1MQD A;  1UTH A;  3FIR A;  4IO2 A;  1IXH A;  1M5C A;  5CMC A;  4EDP A;  5I2K A;  3PUW E;  3HV1 A;  3T9U A;  2F7B A;  2O1L A;  1DTZ A;  3FVN A;  4RY1 A;  1MXZ A;  4BDR A;  4F3S A;  3MP8 A;  3K4U A;  4BLA A;  1PBQ A;  4DXC A;  1Z7M E;  5FTI A;  1B4H A;  2QRY A;  5DTB A;  1ZBM A;  3IO4 A;  2AYS A;  2DOJ A;  2OLB A;  1A54 A;  4MFI A;  2QPQ A;  3UK4 A;  4JWY A;  1TXF A;  4ELQ A;  3W9V A;  4YU0 A;  3ZKK A;  3QSL A;  3VLV A;  4ELO A;  4F31 B;  2OWT A;  2F35 A;  3CRB A;  3K6V A;  3MVY A;  4KI0 E;  2AL5 A;  5BWJ A;  2PT1 A;  1T0K A;  3USD A;  3CR9 A;  2DE2 A;  3H7M A;  4PFU A;  4EXK A;  1OIB A;  4UA8 A;  2ZXT A;  4TLM B;  1PB7 A;  2RC7 A;  4LZ8 A;  2XXW A;  1DPE A;  2P1S A;  3HN0 A;  3H3G A;  1VFD A;  2DXY A;  4FEC A;  4H6D A;  4LUB A;  4ONY A;  4U4S A;  4P0I A;  4YKP A;  3EHT A;  1MDQ A;  1PBP A;  2GHB A;  2UYF A;  4LAT A;  4PE5 B;  2HEU A;  3BKI B;  2RCA A;  3K1P A;  5TPA A;  4HW8 A;  4JSD A;  2FNC A;  3O66 A;  3D4C A;  4X9T A;  1AIV A;  2PMS A;  1N3W A;  3E3K A;  3KSX A;  4G8M A;  4I8C A;  5AA2 B;  1URS A;  4FEB A;  2QSX A;  1Y20 A;  4JXI A;  1FW0 A;  3K0V A;  1FQF A;  1P99 A;  3BFU A;  4G68 B;  5I2N B;  2NXO A;  3V83 A;  1BIY A;  1FTJ A;  1SD3 A;  2O68 A;  4RNS A;  3O9P A;  4G8N A;  1UTH B;  3M3K A;  3E4R A;  4QFN A;  5TP9 A;  1SYI A;  4IO4 A;  3THI A;  4JWO A;  1ZTY A;  3TKD A;  1DMB A;  1M5F A;  3C36 A;  2H25 A;  3A09 A;  4GF8 A;  4LON B;  3TPA A;  5HPQ A;  2WKY A;  4EF1 A;  2A5S A;  3CG3 A;  2F6G A;  4JB7 A;  4LQ2 A;  1NH8 A;  2XX8 A;  2HZK A;  4NF5 B;  1FQA A;  2Z8E A;  5DVF A;  4POW A;  2Q2A A;  2E1S A;  3FXQ A;  3S9L C;  2GFE A;  5I2K B;  3DP4 A;  5I59 A;  2REJ A;  3SEV A;  4NWD A;  3K6W A;  5K2X A;  1MH4 A;  1SDX A;  2B3F A;  2ZMB A;  4GWO A;  3PUY E;  1B6H A;  4O3A A;  3S9N C;  4MF3 A;  1IXI A;  4RYA A;  1ZMG A;  3SEU A; 
#chains in the Genus database with same CATH topology
 4FIM A;  3C4M A;  3IO6 A;  3MW0 A;  4H8J A;  2Z8D A;  1EYJ A;  4N6P A;  3E78 A;  3FAS A;  4H46 A;  1JEV A;  5JEI A;  4N81 A;  2D21 A;  1AL3 A;  3QUJ A;  1N0T A;  2B65 A;  4U4X A;  5BUU A;  2Y7I A;  3OOA A;  3RT8 A;  1MY4 A;  2DVC A;  4GIZ A;  1FPJ A;  4HE2 A;  1D9Q A;  1H76 A;  3OO9 A;  2B4M A;  4OVJ A;  1WVJ A;  1YYZ A;  1B7Z A;  1B51 A;  3O6G A;  4JVD A;  1ZKB A;  4YMB A;  4NAP A;  1SBP A;  4E0X A;  5TPA B;  4DDD A;  3PPP A;  3I6V A;  5LTC A;  1LLS A;  4PTK A;  4F2O A;  1QGX A;  2OZZ A;  2R8T A;  2F5X A;  4NF4 A;  4G2Z A;  5CRY A;  4F22 A;  4MAG A;  4N15 A;  3SEX A;  3CIJ A;  4NG7 A;  5CMM A;  2B3B A;  1UIU A;  1KWH A;  3IOR A;  5A5X B;  2OWS A;  1SPI A;  1GGG A;  4H5G A;  1O64 A;  5J16 A;  4H0W A;  3K1M A;  3G3I A;  4PET A;  1JET A;  2KQZ A;  1JW4 A;  1HSE A;  2FIE A;  2PVU A;  4QFO A;  2V25 A;  3VDF A;  3TQW A;  4YAH X;  2CEY A;  5IGA A;  1B7U A;  2P0S A;  1HSL A;  1OQH A;  3BIH A;  2VGQ A;  3TTK A;  1S50 A;  3DM0 A;  1Z7N E;  2G29 A;  4MLQ A;  1B05 A;  3HHF A;  4OVP A;  1OVT A;  1FTM A;  5CI5 A;  4NMY A;  4ZED A;  4LZ7 A;  5L9M A;  4N13 A;  4AB6 A;  1F9B A;  3MPL A;  4H65 A;  4NE4 A;  4OA4 A;  5AA3 A;  3FJM A;  3RTF B;  4MLV A;  3T22 A;  3IOW A;  3IB2 A;  3VV5 A;  4OFO A;  3KJ7 A;  2PYY A;  1ZIU A;  2R71 A;  3E79 A;  3IOV A;  2JJK A;  3TCG A;  4DIG A;  3N6T A;  4F39 A;  2LAO A;  4XFE A;  4YZZ A;  5FHN A;  2O84 X;  3TQL A;  3K01 A;  3PD9 A;  2X7P A;  3FXR A;  2QS4 A;  2AL4 A;  2I58 A;  4DZ1 A;  3OO8 A;  1MH3 A;  3DP6 A;  2I3W A;  2REG A;  4ELP A;  3CHG A;  3W9W A;  4GX6 A;  1A40 A;  2QL3 A;  3FV1 A;  2FA7 A;  4R9G A;  1LST A;  1FBC A;  4R72 A;  1O63 A;  3S2V A;  1D9Y A;  4GWX A;  3E13 X;  1A99 A;  5EHS A;  4N4U A;  4KHZ E;  1MY2 A;  1FJ9 A;  4G61 A;  1SW5 A;  2XX9 A;  4C1T A;  2GRV A;  3JYR A;  2WBB A;  3RT6 B;  2HAV A;  5ICQ A;  4PFR A;  1LAH E;  3WAF A;  4F3B A;  4OEV A;  3PPN A;  3LSX A;  1MXU A;  1NV2 A;  5I56 A;  2F36 A;  1DTG A;  1B0H A;  3R6U A;  1FTL A;  3FVG A;  2L5V A;  5H8N A;  4JSO A;  5I56 B;  3RLF E;  4GL8 A;  3K6X A;  5I58 A;  4OWD A;  4G68 A;  3LC8 A;  1VSO A;  2V3U A;  1RDX A;  1ATG A;  3OO7 A;  1SW1 A;  4P3L A;  1I69 A;  2UYE A;  3H6W A;  5CBR A;  1B9J A;  3S4U A;  1MDP 1;  4IGR A;  3VVE A;  5FTH A;  2XX7 A;  4GX4 A;  3FXU A;  3ZSF A;  3GXA A;  2F7A A;  2O69 A;  3KG2 A;  5IAI A;  4AB5 A;  4PGP A;  1NUW A;  3VE1 B;  1P1Q A;  3LSW A;  4OVT A;  2HHM A;  4YKK A;  5H8F B;  1R6Z A;  4PFW A;  4GX3 A;  2PX1 A;  4Q5T A;  1G0H A;  3QMF A;  1AOV A;  4PC9 A;  5J1D A;  2XWI A;  3H03 A;  3RPW A;  3RUM A;  5DVJ A;  2XXK A;  4NF6 A;  3KC0 A;  2H9B A;  4HCW A;  4PDD A;  4QSC A;  3C9H A;  2O7U A;  1L5T A;  4POX A;  4R2F A;  4ECF A;  3C31 A;  1BK4 A;  1LCF A;  5L9O A;  5CC2 A;  3TMG A;  4ZEK A;  1USY H;  5HM4 B;  1JVY A;  5F1Q A;  5IZ1 A;  3LSF B;  4NF8 A;  4DI4 B;  4H45 A;  3FBP A;  4MMP A;  3IB0 A;  1IXG A;  4N6K A;  1IME A;  1LGB C;  1S9T A;  5FBP A;  1DOT A;  3TCH A;  2Z22 A;  4KR5 A;  1UTB A;  1FPL A;  1Y1Z A;  3QK6 A;  1AH5 A;  1LCT A;  4QHQ A;  1USY E;  4EDP A;  1MQD A;  5CMC A;  4IO2 A;  4F3S A;  3B50 A;  3MP8 A;  4UAB A;  1B4H A;  1EYK A;  1TXF A;  1DBZ A;  3VLV A;  4P8B A;  4KI0 E;  3K6V A;  3MVY A;  4I3E A;  4UA8 A;  1PB7 A;  4LZ8 A;  2P1S A;  1VFD A;  4LUB A;  1FPF A;  2RCA A;  3D4C A;  3KSX A;  5AA2 B;  4G8M A;  1URS A;  4JXI A;  1P99 A;  3BFU A;  2NXO A;  1BIY A;  1SD3 A;  4G8N A;  1UTH B;  2QFL A;  4JWO A;  3TKD A;  1FBG A;  4P56 A;  3A09 A;  4LON B;  2A5S A;  4NF5 B;  1FQA A;  3U65 A;  3FXQ A;  5I2K B;  5I59 A;  2REJ A;  5K2X A;  1SDX A;  4FBP A;  4O3A A;  4GXS B;  3QIM A;  1B3L A;  3T9X B;  4R75 A;  2F3D A;  5IZ3 A;  4PCD A;  3MWB A;  3MP1 A;  1II5 A;  2F78 A;  2WYK A;  1D9V A;  3SEW A;  5DVF A;  4XTC Q;  4GRK A;  3MVW A;  2XXV A;  3MZB A;  4BDL A;  5JTY B;  3G3K A;  2F6P A;  3FJ7 A;  2KR0 A;  3K02 A;  3OO6 A;  3KBZ A;  1IMD A;  3IK6 B;  5T3J A;  1VE4 A;  5LDZ A;  5IZ3 B;  1JEU A;  3N94 A;  3DLN A;  3M8U A;  1UIV A;  2HXR A;  1NMU A;  2ZNT A;  1INP A;  2I0C A;  5EQ8 A;  3GYY A;  4GWZ A;  3OSQ A;  1Y9U A;  5KDT A;  2OBG A;  1B1X A;  4ELR A;  3KN3 A;  3TEL A;  3T66 A;  2CZK A;  2DXR A;  5ET8 A;  4GWY A;  2ZNS A;  4H8I A;  1FQB A;  2RF1 A;  3ILT B;  3VXB A;  4YKI A;  2ESN A;  5CBS A;  1TFA A;  1TT1 A;  1WDN A;  2DWJ A;  4WKM A;  3QXM A;  4H5F A;  3KOT A;  2BJJ X;  3EHU A;  3KJT A;  3DP8 A;  5CMB A;  4C0R A;  3UOR A;  4JDF A;  4O3B A;  1LAX A;  5FHO A;  3IL1 B;  4F1Y A;  2DP8 A;  3HCQ A;  4ZZE A;  3PUZ E;  4GVO A;  4XIG Q;  5ESY A;  1VFE A;  1KA0 A;  4OVS A;  4PDH A;  5KDT B;  2ZZW A;  1LB9 A;  5F7V A;  1A7L A;  1RKM A;  4M4G A;  1MY0 A;  2WX9 A;  1EZO A;  2DS9 A;  4K3F A;  3KOS A;  3TDJ A;  4O7I A;  1NH7 A;  1LBW A;  4LZ5 A;  4MBP A;  1H44 A;  1IIW A;  2F97 A;  5B7D A;  3MC2 A;  1B5I A;  4Q30 B;  1LBV A;  2Y5L A;  4PAK A;  1MPC A;  4ESX A;  1A8E A;  3IX1 A;  1MXV A;  3KBR A;  3V89 B;  3MBP A;  1XI6 A;  1EZ9 A;  4ZEI A;  1BTJ A;  2Y7K A;  1ELJ A;  1Y3Q A;  1KZ8 A;  1N7X A;  1RYO A;  1D4N A;  3I5O A;  1OQG A;  3BFT A;  3LBS A;  5L9S A;  4GBV A;  1FTO A;  1JW5 A;  1LFI A;  2D3I A;  4QFL A;  5L8D A;  4PBQ A;  4NF5 A;  3G3F A;  3OEK A;  1VR5 A;  1AWB A;  1FPE A;  3R26 A;  3RGY A;  4MX6 A;  1LBB A;  2XD3 A;  3UGW A;  4NED A;  1FBE A;  1GTK A;  1S7Y A;  2I4C A;  4OMB A;  4KXP A;  4EQ7 A;  2OWZ A;  2I0B A;  1R1N A;  1GV8 A;  5KZT A;  4PF8 A;  3O6H A;  1Q35 A;  2ZYM A;  1NNP A;  3U93 A;  3U8Q A;  4OHN A;  1LAF E;  3QYT A;  1AMF A;  1PDA A;  4M1V A;  4BDM A;  1IZ1 A;  1M5B A;  1NV4 A;  3L6G A;  3B7D A;  1PB9 A;  4WEP A;  2Y7P A;  3AXF A;  4OER A;  4HS7 A;  4GWW A;  4KFQ A;  4X8R A;  1O7T A;  4G4P A;  3GLB A;  1QUJ A;  3T96 B;  3KC1 A;  2QVV A;  4PQJ A;  2WEF A;  2E0S A;  2ALU A;  4WXJ A;  4ZEC A;  1DK4 A;  1VDW A;  1SI1 A;  4ND9 A;  1DSN A;  5ET6 A;  2ZYN A;  1MXY A;  4FED A;  2F3B A;  1UQW A;  2QVU A;  2G93 A;  1I6A A;  1MXX A;  2F34 A;  4YB5 A;  1B46 A;  4ZDM A;  4NF8 B;  1IMB A;  2Y5K A;  2NVU B;  2QJE A;  1QKB A;  1FSA A;  4ESW A;  3A3U A;  3SKP A;  3M3L A;  4P1L A;  1QUL A;  5H8F A;  3PPR A;  4XKQ A;  4OAN A;  3T9V A;  2THI A;  2RC9 A;  4JVI A;  4O8M A;  1QKA A;  1FTK A;  4IO7 A;  3ROJ A;  4IY6 A;  3L6H A;  2A5T A;  1XVX A;  5HBC A;  3CVG A;  3ONM A;  4TOZ A;  1Y1M A;  4H67 A;  1B52 A;  4OEU A;  4RK9 A;  4FAT A;  3TTM A;  1I6B A;  5KCJ B;  3O29 A;  3OD7 A;  5I58 B;  4U21 A;  3O2A A;  5I3S A;  3UP9 A;  4KYD A;  3TUS A;  3IOU A;  2R6G E;  3TZA A;  4KD5 A;  1NL5 A;  2DYX A;  3RNN A;  1EU8 A;  4IO5 A;  5TU0 A;  3GBB A;  4DI3 D;  2Y7W A;  1YTV A;  4R6K A;  2QMW A;  5CM6 A;  3O28 A;  3OXN A;  2H99 A;  3H06 B;  2Q2C A;  4ZZA A;  3Q28 A;  3SEY A;  1TFD A;  5DW8 A;  1MS7 A;  4G8H A;  4LN5 A;  4DXB A;  3JZJ A;  2DSF A;  2DVZ A;  2H4I A;  1N04 A;  3JV9 A;  1N84 A;  3MPK A;  3MJN A;  3RY3 A;  3CSB A;  5H8Q B;  3TYH A;  1TWY A;  4GXA A;  3FVK A;  1M5C A;  4AS4 A;  3T9U A;  1MXZ A;  4MCO A;  3A29 A;  4DXC A;  1Z7M E;  2QRY A;  3IO4 A;  2AYS A;  4O7M A;  1NI9 A;  3UK4 A;  4JWY A;  4ELQ A;  3ZKK A;  3QSL A;  2XWV A;  2OWT A;  2F35 A;  2AL5 A;  2PT1 A;  1IMC A;  2DE2 A;  3H7M A;  4PFU A;  4EXK A;  5I2N A;  2XXW A;  4H6D A;  2DXY A;  4U4S A;  3EHT A;  4PFT A;  2GHB A;  5TPA A;  5IM2 A;  4LAT A;  2HEU A;  3BKI B;  4PE5 B;  4HW8 A;  2FNC A;  2VT5 A;  3E3K A;  4I8C A;  4FEB A;  1Y20 A;  3K0V A;  5I2N B;  3V83 A;  2O68 A;  3O9P A;  3M3K A;  4QFN A;  2FHY A;  1SYI A;  1ZTY A;  3C36 A;  5HPQ A;  3TPA A;  3CG3 A;  2F6G A;  4OVR A;  2HZK A;  2WBD A;  3K6W A;  3PUY E;  4MF3 A;  1IXI A;  2XXP A;  3B6W A;  4BDN A;  4Z7E A;  3U92 A;  4PP0 A;  1NUZ A;  1NV1 A;  1QVS A;  1NFT A;  4ZS9 A;  4NF0 A;  3N26 A;  1J1N A;  1IQ7 A;  4HTG A;  3Q29 A;  1FBP A;  4KCD A;  3Q26 A;  2VP1 A;  2UVI A;  3C32 A;  4NN3 A;  3PMV A;  2DE4 A;  4NHB A;  4DCY A;  4PFB A;  5ICT A;  2V84 A;  3LR1 A;  3VLU A;  1NV3 A;  2PFZ A;  1YAE A;  2XXU A;  3OEL A;  1XVY A;  4KCC A;  4N8Y A;  2VD2 A;  2O1M A;  4OVQ A;  4P11 A;  4QF9 A;  3U1O A;  4FE8 A;  2XWK A;  1KA1 A;  4NX1 A;  1MG1 A;  1BLF A;  4NF4 B;  4BDO A;  4MNI A;  1MQH A;  4HCY A;  2XA5 A;  3IFA A;  1RYX A;  3CFZ A;  1ZLQ A;  1NNF A;  1YPN A;  3PTY A;  2XD2 A;  4IB2 A;  1XS5 A;  1QUK A;  2CZL A;  1SW4 A;  1URG A;  5EHM A;  3ECR A;  1LEV A;  3R7X A;  1N3X A;  4F3G A;  2W7Y A;  1FBD A;  5KCJ A;  1Y4C A;  4P1E A;  3K2D A;  4RK2 A;  1DPP A;  4O94 A;  4YKP A;  1B3H A;  3LUY A;  1BP5 A;  4XEQ A;  1LBY A;  2MKZ A;  2DWH A;  2GH9 A;  1EH3 A;  4RPN A;  2OCU A;  1M5E A;  2OX3 A;  2ZZV A;  3OEN A;  3H6V A;  2M8C A;  2DWA A;  5I59 B;  1POT A;  1NNT A;  3O97 A;  3EHS A;  4KYS A;  4HE1 A;  2QMX A;  4L17 A;  3ZKL A;  3SER A;  3K1N A;  2HFB A;  2R9J A;  1EYI A;  1NNK A;  3ISP A;  2CZI A;  4U1Z A;  1JVX A;  2HCA A;  2ANJ A;  2Q9T A;  2OJT A;  2FVZ A;  4OZ9 A;  4EF2 A;  4I9D A;  1CE2 A;  4BDQ A;  3PMW A;  1NUY A;  2YPN A;  4PGN A;  4PAI A;  4F3P A;  2D5W A;  3T0J A;  4XXU A;  5H8Q A;  5AA4 A;  2DE3 A;  3FD3 A;  4IY5 A;  1PB8 A;  5F24 A;  4F2Q A;  4LQ5 A;  3D4G A;  4YKJ A;  1OMP A;  3MVX A;  3I3V A;  4KPT A;  3TTL A;  5H8N B;  1R9L A;  1NKX A;  4MEV A;  5AA2 D;  4OFL A;  3ILU B;  3KN7 A;  4MIJ A;  3MUQ A;  2IEE A;  1SYH A;  3KGC A;  1LFH A;  1MM6 A;  1US5 A;  1YZ0 A;  4X1B A;  3MZ1 A;  4P47 A;  4Q0C A;  1Q9D A;  5EYH A;  1XT8 A;  2XXX A;  3E9X A;  4GBW A;  3PPQ A;  1BKA A;  1POY 1;  1B0L A;  4O3C A;  4PFI A;  4RA1 A;  3HHG A;  3VXC A;  1FRP A;  4OET A;  4TQU Q;  4U1O A;  5EQA A;  3HFU A;  1K9Z A;  4AS5 A;  4EXL A;  1I6Q A;  4GL0 A;  2IA4 A;  1GR2 A;  4YIC A;  2XHD A;  3PMX A;  4NF6 B;  1N76 A;  1B5J A;  1PEB A;  3H4Z A;  3S9N C;  1SW2 A;  1LBC A;  4I40 A;  3UIF A;  5ET5 A;  3RPL A;  1OLC A;  1PC3 A;  4OXV A;  2XXH A;  1MY1 A;  2ZNU A;  2AIX A;  3BIG A;  3IR1 A;  2Y84 A;  1WOD A;  2H5Y A;  4YB6 A;  1IMF A;  2VPN A;  4RXL A;  3M3F A;  5AA1 A;  3V5A A;  3Q25 A;  4FJP A;  2HZL A;  4QSD A;  1MQI A;  1EZP A;  4I1D A;  5ELV A;  2Y7R A;  1MQG A;  4U2R A;  3PUV E;  5ET7 A;  1MRP A;  3MP6 A;  2CZH A;  4NGU A;  4GOT A;  2DDK A;  2I48 A;  2X7Q A;  2Z8F A;  3ZS6 A;  2DWI A;  4MNP A;  3OSR A;  1OVB A;  1FQE A;  3KFM A;  1FCK A;  1QUI A;  2Q8M A;  3B6Q A;  4P9K A;  4OQO A;  1SVX B;  2QS1 A;  2NOO A;  4LA9 A;  4G77 A;  1FPB A;  5I5P A;  4GLI A;  4GQO A;  4ISU A;  3S9E A;  3OEM A;  4OYV A;  3C34 A;  1R9Q A;  3FXB A;  4F29 A;  1LB8 A;  4KYE A;  3HST A;  4NWC A;  3C35 A;  2YJP A;  3TTN A;  2ABH A;  2F7C A;  2OK2 A;  4KQP A;  4I62 A;  1Q1K A;  1QW0 A;  3N6U A;  5EYG A;  1HSJ A;  3IJX B;  3IAZ A;  1IMA A;  3TFL A;  5H8H A;  5JK4 A;  3F11 A;  4R2B A;  2XXI A;  3MZ9 A;  2HAU A;  3T93 B;  2I6E A;  3D1R A;  2H98 A;  3O6I A;  3GZG A;  2V3Q A;  3FV2 A;  4R9F A;  4H1X A;  4QSE A;  1SQY A;  4IR8 A;  5IZZ A;  3HV1 A;  2F7B A;  1DTZ A;  4BDR A;  1JP4 A;  1PBQ A;  2CEX A;  1ZBM A;  2DOJ A;  4MFI A;  3EKI A;  3W9V A;  4PF6 A;  4ELO A;  4F31 B;  3CRB A;  3USD A;  3CR9 A;  1OIB A;  2ZXT A;  4TLM B;  3HN0 A;  4FEC A;  3H3G A;  4ONY A;  1FPD A;  1MDQ A;  1PBP A;  2UYF A;  3LUZ A;  4GWS A;  3K1P A;  3O66 A;  2QSX A;  1FQF A;  1NV7 A;  1NV5 A;  3E4R A;  1DMB A;  4GF8 A;  2WKY A;  4LQ2 A;  4POW A;  2Q2A A;  1NV0 A;  2GFE A;  3DP4 A;  3SEV A;  4NWD A;  3V8X B;  1MH4 A;  4GWO A;  2B3F A;  1B6H A;  1ZMG A;  3SEU A;  1URD A;  3MVZ A;  1A8F A;  4EQB A;  2I3V A;  2XXR A;  4MJO A;  3TEP A;  4HXV A;  4C1U A;  3PUX E;  4OES A;  4TLL B;  4N91 A;  3SES A;  1MPB A;  1B1H A;  2VPO A;  4XKP A;  4QXD A;  4G68 C;  3CG1 A;  2DQV A;  3TAJ A;  2O51 A;  2XXT A;  4R74 A;  3VVD A;  2QS2 A;  3BBR A;  4DLD A;  3Q27 A;  1YXI A;  5K2Y A;  5EYF A;  1G0I A;  3OMB A;  3TCF A;  3TOD A;  5AA4 B;  4RPO A;  1RDY A;  4ZE9 A;  1B58 A;  2FBP A;  1XC1 A;  4PE3 A;  2X26 A;  5I84 A;  4F1V A;  5DEX A;  1M5D A;  2I4B A;  2NWJ A;  4YMA A;  1MXW A;  5JTY A;  3PGF A;  2ZYK A;  1B32 A;  1JW1 A;  1IIT A;  3PU5 A;  3CSG A;  5DYH A;  4ZEB A;  2Q74 A;  4X1D A;  2YLN A;  2P2A A;  1D3K A;  2RIN A;  4P0G A;  4GWU A;  1RDZ A;  1US4 A;  4N6D A;  3G3H A;  3RPL B;  3G3G A;  1H3D A;  4OFJ A;  4OTE A;  5H8S A;  1A55 A;  1FBH A;  2ONR A;  3N5L A;  2UXA A;  1FTA A;  5ISU A;  1B5H A;  5EQ7 A;  3UN6 A;  1B3E A;  4I3Y A;  1B40 A;  3SET A;  1LBZ A;  5I7I A;  3U94 A;  5ITP A;  1FPI A;  5DEX B;  2RCB A;  1ZJL A;  4QFK A;  3IOT A;  3UA8 A;  2FIX A;  5CMK A;  1CB6 A;  3RYD A;  4EUO A;  3C33 A;  2PT2 A;  1MQJ A;  1FPG A;  1IUD A;  3H6T A;  2XXY A;  1B3G A;  1FJ6 A;  1YCJ A;  1XOC A;  5I57 A;  4WED A;  4GD5 A;  4F1U A;  1XHY A;  4X48 A;  1FPK A;  3VVF A;  5ITO A;  2F8D A;  4PFY A;  2PFY A;  1ZU0 A;  3EQ1 A;  5A5L A;  1QJM A;  4PBH A;  3KSJ A;  4GFR A;  4FAJ A;  1LBX A;  2V4C A;  3EF7 A;  3WAE A;  2PCR A;  2UVH A;  2O6A A;  3IJO B;  2ONS A;  5EQ9 A;  4ZE8 A;  3NOH A;  1DCU A;  4EQ9 A;  1P1U A;  2KLF A;  4YB7 A;  5FHM A;  5A5X A;  3MST A;  2Q89 A;  3MAM A;  3RN8 A;  3IB1 A;  4XF5 A;  1NUX A;  1K9Y A;  3VFJ A;  2VOZ A;  1Y3N A;  2CMO A;  4ZEF A;  3VLW A;  2QS3 A;  2GHA A;  3SZP A;  3KZG A;  3CFX A;  4NQ8 A;  4NTL A;  2I49 A;  4XKR A;  3DEL B;  3PPO A;  1JNF A;  3T1B A;  1P1O A;  2V93 A;  1Y3P A;  3GBA A;  5H8H B;  3B8B A;  1CNQ A;  3SDF A;  1MM7 A;  4UAC A;  1P1W A;  5AE4 A;  1MPD A;  1FQC A;  4MNC A;  2NUV A;  4AQ4 A;  2HQ0 A;  3QAX A;  4MH5 A;  4IO6 A;  4LP2 B;  3TTR A;  1LAG E;  3KEI A;  2HXW A;  4Q8R A;  5AA2 A;  2WYP A;  4QFP A;  5DVI A;  1FBF A;  3HO7 A;  3RQT A;  2FYI A;  3FGS A;  2VHA A;  1P1N A;  4U22 A;  4IO3 A;  2XXQ A;  4DCX A;  4N8G A;  3B6T A;  3HPI A;  4N07 A;  2O7I A;  4DXU A;  4R6Y A;  1OLA A;  1B7H A;  2Z23 A;  4U23 A;  2VD3 A;  3FUZ A;  4RJZ A;  3W15 C;  4X04 A;  3PV0 E;  5B70 A;  1B4Z A;  1H45 A;  4HE0 A;  4R73 A;  3FZV A;  1IXC A;  2PBW A;  5DT6 A;  3CI8 A;  5I57 B;  1H43 A;  5TP9 B;  3PD8 A;  1GVC A;  1SI0 A;  3MQ9 A;  4QRZ A;  2Q8J A;  2UVG A;  4IGT A;  1UTB B;  3U72 A;  4R6H A;  3RTW B;  4E0W A;  1N7W A;  4Z0I A;  3QUF A;  3S9M C;  3H6U A;  3P7I A;  1FQD A;  5M2V A;  4OEN A;  1IEJ A;  3K00 A;  2BJI A;  1MY3 A;  2ONK E;  3FVO A;  4LVQ A;  4THI A;  4XKN A;  2V3T A;  2RC8 A;  4F18 A;  2GQ1 A;  3LSL A;  4JWX A;  3G3J A;  2ZZX A;  5IKB A;  5LOM A;  1JQF A;  2A5T B;  3EPE A;  3K6U A;  1Y4T A;  4DE8 A;  1B3F A;  4JBZ A;  3EN3 A;  4F19 A;  3KN8 A;  1B2H A;  3G7W A;  3LV0 A;  2RKM A;  3ODB A;  4N17 A;  2ZYO A;  3A3C A;  1LFG A;  1NV6 A;  2UVJ A;  3FAT A;  4QBA A;  2P3N A;  1ANF A;  2Q88 A;  2B4L A;  3CFL A;  4FOR A;  3FJG A;  1UTH A;  5I2K A;  3FIR A;  1IXH A;  3PUW E;  2O1L A;  4RY1 A;  3FVN A;  3K4U A;  2P3V A;  4BLA A;  5FTI A;  4JVC A;  5DTB A;  2OLB A;  1A54 A;  2QPQ A;  4YU0 A;  4PAF A;  5BWJ A;  3IFC A;  1T0K A;  2RC7 A;  3MYU A;  1DPE A;  4P0I A;  4JSD A;  4X9T A;  1AIV A;  2PMS A;  1N3W A;  1FW0 A;  4G68 B;  2QVR A;  4RNS A;  1FTJ A;  4MHF A;  5TP9 A;  2HPG A;  4IO4 A;  3THI A;  1M5F A;  2H25 A;  4EF1 A;  4JB7 A;  1NH8 A;  2XX8 A;  2Z8E A;  2E1S A;  3S9L C;  3T9H B;  2ZMB A;  2XWO A;  4RYA A; 
#chains in the Genus database with same CATH homology
 4FIM A;  1URD A;  3MVZ A;  3C4M A;  4GXS B;  3QIM A;  1B3L A;  2XXP A;  1A8F A;  3B6W A;  3IO6 A;  3MW0 A;  4H8J A;  4R75 A;  3T9X B;  2I3V A;  2Z8D A;  4BDN A;  4EQB A;  4Z7E A;  3U92 A;  2XXR A;  4N6P A;  4PP0 A;  3FAS A;  3TEP A;  4C1U A;  3MWB A;  3PUX E;  4OES A;  4TLL B;  1JEV A;  1QVS A;  3MP1 A;  1II5 A;  1NFT A;  3SES A;  5JEI A;  2F78 A;  4ZS9 A;  1D9V A;  1MPB A;  3SEW A;  3N26 A;  1J1N A;  2D21 A;  1AL3 A;  1B1H A;  3MVW A;  3QUJ A;  1IQ7 A;  1N0T A;  2XXV A;  4GRK A;  2B65 A;  3MZB A;  4XKP A;  4BDL A;  4HTG A;  5JTY B;  4G68 C;  3G3K A;  2F6P A;  3FJ7 A;  4U4X A;  3Q29 A;  4KCD A;  3K02 A;  3CG1 A;  2DQV A;  2VP1 A;  2Y7I A;  3Q26 A;  5BUU A;  2UVI A;  3OO6 A;  3TAJ A;  3C32 A;  2O51 A;  2XXT A;  3OOA A;  4R74 A;  3VVD A;  2QS2 A;  3IK6 B;  3PMV A;  3RT8 A;  1VE4 A;  1MY4 A;  3BBR A;  2DVC A;  2DE4 A;  4DLD A;  1JEU A;  4GIZ A;  3Q27 A;  4DCY A;  5K2Y A;  3N94 A;  3DLN A;  5ICT A;  3M8U A;  5EYF A;  1UIV A;  2V84 A;  3LR1 A;  3VLU A;  1NMU A;  2ZNT A;  1H76 A;  3OO9 A;  2XXU A;  1YAE A;  4OVJ A;  1WVJ A;  2I0C A;  3OMB A;  3TCF A;  3TOD A;  5AA4 B;  1B7Z A;  1XVY A;  1B51 A;  3OEL A;  4KCC A;  4RPO A;  3OSQ A;  1Y9U A;  2VD2 A;  2O1M A;  5KDT A;  2OBG A;  1B1X A;  3O6G A;  4P11 A;  4ELR A;  4QF9 A;  4ZE9 A;  1ZKB A;  1B58 A;  3U1O A;  4YMB A;  4FE8 A;  4E0X A;  1SBP A;  3KN3 A;  1XC1 A;  3TEL A;  5TPA B;  3T66 A;  3PPP A;  4DDD A;  1MG1 A;  2X26 A;  2DXR A;  3I6V A;  1BLF A;  5I84 A;  4F1V A;  5DEX A;  1M5D A;  2I4B A;  2NWJ A;  2ZNS A;  4H8I A;  4YMA A;  1FQB A;  1LLS A;  1MXW A;  4NF4 B;  2RF1 A;  3ILT B;  3V8X B;  4BDO A;  3PGF A;  5JTY A;  1MQH A;  3VXB A;  2ZYK A;  1B32 A;  4HCY A;  4YKI A;  2ESN A;  1JW1 A;  1IIT A;  5CBS A;  3PU5 A;  3CSG A;  4F2O A;  1RYX A;  3CFZ A;  1ZLQ A;  1NNF A;  5DYH A;  1YPN A;  1TFA A;  1TT1 A;  1WDN A;  2OZZ A;  4ZEB A;  3RY3 A;  4NF4 A;  2F5X A;  4G2Z A;  2DWJ A;  2XD2 A;  4IB2 A;  4WKM A;  1XS5 A;  5CRY A;  4F22 A;  4X1D A;  3SEX A;  3QXM A;  4H5F A;  2YLN A;  2P2A A;  1D3K A;  2RIN A;  3CIJ A;  2BJJ X;  1QUK A;  3KOT A;  2CZL A;  3EHU A;  2B3B A;  4P0G A;  5CMM A;  1UIU A;  1KWH A;  3KJT A;  1SW4 A;  1US4 A;  3G3H A;  3IOR A;  5A5X B;  1URG A;  5EHM A;  3ECR A;  3R7X A;  1N3X A;  2OWS A;  3DP8 A;  2W7Y A;  4F3G A;  1GGG A;  3G3G A;  4H5G A;  1H3D A;  5CMB A;  4C0R A;  4OFJ A;  3UOR A;  4OTE A;  5KCJ A;  4JDF A;  1Y4C A;  1O64 A;  5H8S A;  3K2D A;  4O3B A;  1A55 A;  4RK2 A;  1LAX A;  5FHO A;  3IL1 B;  4F1Y A;  4ESX A;  4H0W A;  2ONR A;  3K1M A;  1DPP A;  2DP8 A;  3G3I A;  3HCQ A;  4ZZE A;  3PUZ E;  3N5L A;  1B3H A;  4GVO A;  4PET A;  3LUY A;  1JET A;  2UXA A;  4XIG Q;  1BP5 A;  1JW4 A;  1VFE A;  1HSE A;  2DWH A;  5KDT B;  5ISU A;  2GH9 A;  1EH3 A;  1B5H A;  1LB9 A;  4RPN A;  5F7V A;  1A7L A;  1B3E A;  1RKM A;  1M5E A;  2OCU A;  2PVU A;  4QFO A;  3UN6 A;  1B40 A;  2V25 A;  3SET A;  3VDF A;  3U94 A;  4M4G A;  1MY0 A;  5ITP A;  3OEN A;  1EZO A;  3TQW A;  2DS9 A;  3H6V A;  4YAH X;  5DEX B;  2RCB A;  4K3F A;  3KOS A;  3TDJ A;  1ZJL A;  2DWA A;  2M8C A;  5I59 B;  1B7U A;  4QFK A;  1POT A;  2P0S A;  1HSL A;  1OQH A;  3IOT A;  1NNT A;  2VGQ A;  3O97 A;  1NH7 A;  3UA8 A;  3EHS A;  3TTK A;  5CMK A;  4LZ5 A;  4KYS A;  1CB6 A;  4MBP A;  1H44 A;  3ZKL A;  1S50 A;  2QMX A;  1Z7N E;  2G29 A;  3DM0 A;  1IIW A;  4L17 A;  3K1N A;  2HFB A;  2R9J A;  4MLQ A;  3SER A;  2F97 A;  1B05 A;  5B7D A;  3HHF A;  3MC2 A;  1OVT A;  1B5I A;  4Q30 B;  1FTM A;  1NNK A;  5CI5 A;  4EUO A;  3C33 A;  2PT2 A;  4U1Z A;  1JVX A;  1MQJ A;  4NMY A;  2HCA A;  4ZED A;  1MPC A;  1IUD A;  1A8E A;  3H6T A;  4LZ7 A;  3IX1 A;  1MXV A;  2ANJ A;  2Q9T A;  1F9B A;  3KBR A;  3MPL A;  4H65 A;  2OJT A;  3MBP A;  4N13 A;  3T9H B;  3V89 B;  2XXY A;  1B3G A;  1EZ9 A;  4OZ9 A;  4NE4 A;  4ZEI A;  5AA3 A;  4EF2 A;  3FJM A;  1YCJ A;  3RTF B;  1BTJ A;  4I9D A;  1CE2 A;  3RNN A;  4MLV A;  2Y7K A;  1XOC A;  4BDQ A;  3T22 A;  5I57 A;  1ELJ A;  3IOW A;  3IB2 A;  4GD5 A;  3PMW A;  4WED A;  3VV5 A;  4F1U A;  2YPN A;  4OFO A;  1Y3Q A;  3KJ7 A;  1N7X A;  1RYO A;  1XHY A;  2PYY A;  4F3P A;  1ZIU A;  2D5W A;  2R71 A;  3IOV A;  4X48 A;  1D4N A;  3I5O A;  3VVF A;  4XXU A;  5H8Q A;  5ITO A;  3TCG A;  5AA4 A;  4DIG A;  2F8D A;  2DE3 A;  3FD3 A;  1OQG A;  4IY5 A;  4PFY A;  1ZU0 A;  3N6T A;  1PB8 A;  3BFT A;  4F39 A;  2LAO A;  3EQ1 A;  4YZZ A;  1QJM A;  3LBS A;  5FHN A;  5L9S A;  1FTO A;  1JW5 A;  4LQ5 A;  4F2Q A;  2O84 X;  1LFI A;  2D3I A;  3D4G A;  4QFL A;  4YKJ A;  3KSJ A;  1OMP A;  5L8D A;  3TQL A;  3MVX A;  4NF5 A;  3K01 A;  3PD9 A;  3G3F A;  4AB6 A;  2X7P A;  3FXR A;  2QS4 A;  3I3V A;  4GFR A;  2AL4 A;  4KPT A;  4FAJ A;  2I58 A;  4DZ1 A;  3OEK A;  1VR5 A;  3OO8 A;  3TTL A;  3EF7 A;  3WAE A;  1MH3 A;  3DP6 A;  5H8N B;  1R9L A;  2I3W A;  3R26 A;  3RGY A;  1NKX A;  5AA2 D;  2UVH A;  4OFL A;  2O6A A;  3IJO B;  2REG A;  1LBB A;  4ELP A;  3ILU B;  2ONS A;  3KN7 A;  2XD3 A;  3UGW A;  3W9W A;  1A40 A;  2QL3 A;  4NED A;  3FV1 A;  4ZE8 A;  3MUQ A;  2FA7 A;  2IEE A;  4R9G A;  1GTK A;  1SYH A;  3KGC A;  1S7Y A;  2I4C A;  4EQ9 A;  4OMB A;  1LFH A;  4EQ7 A;  1MM6 A;  1P1U A;  1US5 A;  2KLF A;  4X1B A;  4YB7 A;  2I0B A;  1R1N A;  5FHM A;  5A5X A;  1GV8 A;  3MZ1 A;  1LST A;  5KZT A;  2Q89 A;  4R72 A;  1O63 A;  3MAM A;  3O6H A;  3S2V A;  1Q35 A;  2ZYM A;  3RN8 A;  3IB1 A;  1D9Y A;  4Q0C A;  1NNP A;  3E13 X;  1A99 A;  5EHS A;  1XT8 A;  2XXX A;  3E9X A;  3U93 A;  3U8Q A;  3PPQ A;  1BKA A;  4OHN A;  4KHZ E;  1POY 1;  1B0L A;  1MY2 A;  4O3C A;  4RA1 A;  3VFJ A;  3HHG A;  3VXC A;  1LAF E;  3QYT A;  4XTC Q;  1AMF A;  1PDA A;  4OET A;  1SW5 A;  4M1V A;  2VOZ A;  4BDM A;  1IZ1 A;  1Y3N A;  4TQU Q;  1M5B A;  2CMO A;  2XX9 A;  4U1O A;  3L6G A;  4ZEF A;  4C1T A;  3B7D A;  2GRV A;  3VLW A;  1PB9 A;  2QS3 A;  2GHA A;  4WEP A;  3JYR A;  1I6Q A;  4EXL A;  3KZG A;  4GL0 A;  3RT6 B;  2Y7P A;  3AXF A;  4OER A;  2IA4 A;  2HAV A;  4HS7 A;  5ICQ A;  3CFX A;  4KFQ A;  4NTL A;  2I49 A;  1O7T A;  4XKR A;  4G4P A;  3DEL B;  1GR2 A;  4YIC A;  1LAH E;  3PPO A;  3GLB A;  1QUJ A;  2XHD A;  3WAF A;  4F3B A;  3PMX A;  1JNF A;  4NF6 B;  1N76 A;  3T96 B;  1B5J A;  1PEB A;  4OEV A;  1P1O A;  2V93 A;  1Y3P A;  3GBA A;  3H4Z A;  1SW2 A;  3PPN A;  5H8H B;  3LSX A;  4PQJ A;  1LBC A;  1MXU A;  3SDF A;  2E0S A;  1MM7 A;  4UAC A;  2ALU A;  1P1W A;  4WXJ A;  3UIF A;  5AE4 A;  1MPD A;  1OLC A;  4ZEC A;  1FQC A;  1PC3 A;  2F36 A;  4OXV A;  1DTG A;  5I56 A;  2NUV A;  4AQ4 A;  2HQ0 A;  3QAX A;  2XXH A;  4MH5 A;  1B0H A;  1SI1 A;  3R6U A;  1DSN A;  4ND9 A;  4IO6 A;  1FTL A;  2ZYN A;  1MY1 A;  4LP2 B;  2ZNU A;  1MXY A;  2AIX A;  3FVG A;  4FED A;  1UQW A;  5H8N A;  3TTR A;  3IR1 A;  4JSO A;  5I56 B;  1LAG E;  3RLF E;  2Y84 A;  3KEI A;  1WOD A;  2HXW A;  4Q8R A;  2H5Y A;  3K6X A;  4GL8 A;  4YB6 A;  2G93 A;  5AA2 A;  5I58 A;  4QFP A;  1I6A A;  5DVI A;  1MXX A;  4OWD A;  3HO7 A;  3RQT A;  2F34 A;  4G68 A;  4YB5 A;  2FYI A;  1B46 A;  4RXL A;  3LC8 A;  3M3F A;  3FGS A;  4NF8 B;  4ZDM A;  2VHA A;  1P1N A;  5AA1 A;  2NVU B;  2QJE A;  4U22 A;  1QKB A;  1VSO A;  2V3U A;  4IO3 A;  3V5A A;  2XXQ A;  4DCX A;  4ESW A;  3A3U A;  3B6T A;  3HPI A;  3Q25 A;  1ATG A;  3SKP A;  3OO7 A;  1SW1 A;  2O7I A;  4N07 A;  4FJP A;  2HZL A;  3M3L A;  1I69 A;  2UYE A;  1QUL A;  3H6W A;  5H8F A;  5L9M A;  4QSD A;  1MQI A;  3PPR A;  4DXU A;  1B9J A;  4XKQ A;  3S4U A;  1MDP 1;  5CBR A;  4IGR A;  4I1D A;  3VVE A;  4R6Y A;  5FTH A;  2XX7 A;  5ELV A;  2Y7R A;  1MQG A;  1OLA A;  3FXU A;  3T9V A;  4U2R A;  2THI A;  3ZSF A;  1B7H A;  2RC9 A;  2Z23 A;  4U23 A;  3PUV E;  2VD3 A;  3FUZ A;  4RJZ A;  3W15 C;  3GXA A;  1QKA A;  2F7A A;  1FTK A;  2O69 A;  3PV0 E;  3KG2 A;  1MRP A;  4AB5 A;  5B70 A;  5IAI A;  3MP6 A;  4IO7 A;  4IY6 A;  3L6H A;  2A5T A;  1B4Z A;  1H45 A;  4GOT A;  4R73 A;  3FZV A;  1IXC A;  2PBW A;  5DT6 A;  2I48 A;  1XVX A;  3CI8 A;  1P1Q A;  3LSW A;  5HBC A;  3VE1 B;  5I57 B;  3CVG A;  3ONM A;  2X7Q A;  2Z8F A;  4TOZ A;  3ZS6 A;  2DWI A;  1H43 A;  4YKK A;  5H8F B;  5TP9 B;  3PD8 A;  1R6Z A;  4PFW A;  1Y1M A;  1SI0 A;  3OSR A;  4H67 A;  2PX1 A;  1GVC A;  3MQ9 A;  1B52 A;  1OVB A;  4Q5T A;  1FQE A;  4OEU A;  4QRZ A;  3KFM A;  2Q8J A;  2UVG A;  4RK9 A;  4FAT A;  1FCK A;  1QUI A;  1UTB B;  4IGT A;  3TTM A;  1I6B A;  5KCJ B;  1AOV A;  3U72 A;  5J1D A;  4R6H A;  3RTW B;  3B6Q A;  4E0W A;  1N7W A;  3H03 A;  4OQO A;  4Z0I A;  1SVX B;  3QUF A;  3RPW A;  3RUM A;  3O29 A;  3OD7 A;  2QS1 A;  5DVJ A;  5I58 B;  4NF6 A;  4U21 A;  3O2A A;  2NOO A;  2H9B A;  4LA9 A;  3UP9 A;  3S9M C;  3H6U A;  3P7I A;  4G77 A;  4HCW A;  4KYD A;  4QSC A;  3TUS A;  1FQD A;  3IOU A;  2R6G E;  4GLI A;  4GQO A;  4ISU A;  3TZA A;  5M2V A;  4OEN A;  3C9H A;  1IEJ A;  3K00 A;  4KD5 A;  3S9E A;  1EZP A;  1NL5 A;  2DYX A;  2O7U A;  3OEM A;  1MY3 A;  1L5T A;  4POX A;  5I2N A;  1EU8 A;  2ONK E;  3C31 A;  3FVO A;  4IO5 A;  4LVQ A;  1LCF A;  4R2F A;  5TU0 A;  4OYV A;  4ECF A;  5L9O A;  4THI A;  3C34 A;  1R9Q A;  4XKN A;  3GBB A;  5CC2 A;  2V3T A;  2RC8 A;  4F18 A;  3TMG A;  4F29 A;  1LB8 A;  4ZEK A;  4KYE A;  1USY H;  2Y7W A;  3HST A;  1YTV A;  5HM4 B;  1JVY A;  3LSL A;  4NWC A;  5F1Q A;  3C35 A;  2YJP A;  4JWX A;  2QMW A;  3G3J A;  3LSF B;  4R6K A;  3TTN A;  4NF8 A;  2ABH A;  2F7C A;  2OK2 A;  4KQP A;  5IKB A;  5LOM A;  5CM6 A;  1JQF A;  2A5T B;  3O28 A;  2H99 A;  3H06 B;  3OXN A;  4I62 A;  1Q1K A;  1QW0 A;  3N6U A;  3EPE A;  3K6U A;  1HSJ A;  1Y4T A;  3IJX B;  4DE8 A;  1B3F A;  3IAZ A;  4JBZ A;  4PFT A;  3EN3 A;  3TFL A;  3IB0 A;  2Q2C A;  4ZZA A;  5H8H A;  4F19 A;  1IXG A;  3Q28 A;  5JK4 A;  3F11 A;  3KN8 A;  3SEY A;  1TFD A;  4R2B A;  1LGB C;  1MS7 A;  2XXI A;  1S9T A;  1B2H A;  3MZ9 A;  3G7W A;  4G8H A;  1DOT A;  2HAU A;  2RKM A;  3ODB A;  4DXB A;  3TCH A;  2Z22 A;  2ZYO A;  1UTB A;  3JZJ A;  4KR5 A;  3T93 B;  2DSF A;  2I6E A;  2DVZ A;  3A3C A;  2H4I A;  1LFG A;  2UVJ A;  1Y1Z A;  1N04 A;  2H98 A;  3JV9 A;  3O6I A;  1AH5 A;  3FAT A;  3GZG A;  2V3Q A;  3QK6 A;  1N84 A;  3FV2 A;  3MPK A;  3MJN A;  1ANF A;  1LCT A;  3CSB A;  1USY E;  2Q88 A;  4QHQ A;  4H1X A;  4R9F A;  1TWY A;  3CFL A;  5H8Q B;  4GXA A;  3TYH A;  4FOR A;  4QSE A;  1SQY A;  3FVK A;  3FJG A;  1MQD A;  1UTH A;  3FIR A;  4IO2 A;  1IXH A;  1M5C A;  5CMC A;  4EDP A;  5I2K A;  3PUW E;  3HV1 A;  3T9U A;  2F7B A;  2O1L A;  1DTZ A;  3FVN A;  4RY1 A;  1MXZ A;  4BDR A;  4F3S A;  3MP8 A;  3K4U A;  4BLA A;  1PBQ A;  4DXC A;  1Z7M E;  5FTI A;  1B4H A;  2QRY A;  5DTB A;  1ZBM A;  3IO4 A;  2AYS A;  2DOJ A;  2OLB A;  1A54 A;  4MFI A;  2QPQ A;  3UK4 A;  4JWY A;  1TXF A;  4ELQ A;  3W9V A;  4YU0 A;  3ZKK A;  3QSL A;  3VLV A;  4ELO A;  4F31 B;  2OWT A;  2F35 A;  3CRB A;  3K6V A;  3MVY A;  4KI0 E;  2AL5 A;  5BWJ A;  2PT1 A;  1T0K A;  3USD A;  3CR9 A;  2DE2 A;  3H7M A;  4PFU A;  4EXK A;  1OIB A;  4UA8 A;  2ZXT A;  4TLM B;  1PB7 A;  2RC7 A;  4LZ8 A;  2XXW A;  1DPE A;  2P1S A;  3HN0 A;  3H3G A;  1VFD A;  2DXY A;  4FEC A;  4H6D A;  4LUB A;  4ONY A;  4U4S A;  4P0I A;  4YKP A;  3EHT A;  1MDQ A;  1PBP A;  2GHB A;  2UYF A;  4LAT A;  4PE5 B;  2HEU A;  3BKI B;  2RCA A;  3K1P A;  5TPA A;  4HW8 A;  4JSD A;  2FNC A;  3O66 A;  3D4C A;  4X9T A;  1AIV A;  2PMS A;  1N3W A;  3E3K A;  3KSX A;  4G8M A;  4I8C A;  5AA2 B;  1URS A;  4FEB A;  2QSX A;  1Y20 A;  4JXI A;  1FW0 A;  3K0V A;  1FQF A;  1P99 A;  3BFU A;  4G68 B;  5I2N B;  2NXO A;  3V83 A;  1BIY A;  1FTJ A;  1SD3 A;  2O68 A;  4RNS A;  3O9P A;  4G8N A;  1UTH B;  3M3K A;  3E4R A;  4QFN A;  5TP9 A;  1SYI A;  4IO4 A;  3THI A;  4JWO A;  1ZTY A;  3TKD A;  1DMB A;  1M5F A;  3C36 A;  2H25 A;  3A09 A;  4GF8 A;  4LON B;  3TPA A;  5HPQ A;  2WKY A;  4EF1 A;  2A5S A;  3CG3 A;  2F6G A;  4JB7 A;  4LQ2 A;  1NH8 A;  2XX8 A;  2HZK A;  4NF5 B;  1FQA A;  2Z8E A;  5DVF A;  4POW A;  2Q2A A;  2E1S A;  3FXQ A;  3S9L C;  2GFE A;  5I2K B;  3DP4 A;  5I59 A;  2REJ A;  3SEV A;  4NWD A;  3K6W A;  5K2X A;  1MH4 A;  1SDX A;  2B3F A;  2ZMB A;  4GWO A;  3PUY E;  1B6H A;  4O3A A;  3S9N C;  4MF3 A;  1IXI A;  4RYA A;  1ZMG A;  3SEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...