1B1XA

Structure of diferric mare lactoferrin at 2.62a resolution
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACTOFERRIN
publication title Three-dimensional structure of mare diferric lactoferrin at 2.6 A resolution.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA03
3F11A 3UN6A 3FV1A 3O6HA 1B3EA 1MPCA 3H06B 3QXMA 2XXVA 1RKMA 3KN7A 3PUVE 4Q5TA 1PB8A 1OQHA 2QJEA 2PX1A 2Y7KA 3U93A 3EQ1A 4C1TA 1IUDA 4N07A 3RY3A 4JB7A 3IK6B 4EXLA 4QF9A 3TEPA 1N7XA 3FJ7A 2O69A 4NF8B 3KBRA 4ISUA 3C36A 3DELB 1N7WA 3K1NA 3D4GA 2OWTA 1MY2A 2HZKA 1IXHA 3USDA 4NF6B 1DOTA 1JVXA 4YKPA 2I48A 5JEIA 2ONKE 4G4PA 2ESNA 4QRZA 4OMBA 4WXJA 3WAEA 3IO4A 4F3BA 1GGGA 4DE8A 3OSRA 3CR9A 5FTIA 1PB7A 3H6VA 4ZE9A 2DVZA 3OO8A 1FQFA 3PPOA 5L9MA 5L8DA 3TTLA 3CSGA 2P2AA 1UTHB 3G3HA 4TOZA 5CBRA 1MQJA 4R2FA 3HN0A 5KDTB 3TCGA 3MPLA 1LCTA 2V93A 3I6VA 3UK4A 3FVOA 2H25A 5IKBA 2E1SA 2RC7A 1TXFA 2H9BA 1FQAA 1LAFE 2DOJA 3Q28A 1B51A 5DEXA 1B58A 1Y9UA 4ELRA 3MUQA 2XHDA 1CB6A 2Q88A 3TAJA 4F31B 2FNCA 1M5BA 5H8QB 3KN8A 4R6KA 1FQEA 1NKXA 4GD5A 1J1NA 4RJZA 1GVCA 3OD7A 3DP6A 5AA1A 4E0XA 2DWHA 4M1VA 3FJGA 4NF8A 3VLWA 2NWJA 5H8SA 1SW2A 3HHGA 1M5FA 3FVGA 4O3AA 3IJOB 3S9EA 5AA3A 3Q27A 3FZVA 1QKAA 4IY6A 5HM4B 3H6WA 1MS7A 4NF6A 3SERA 3K02A 1PBPA 2I49A 3QK6A 1MDQA 3I3VA 3LSWA 1MXYA 4N13A 3IR1A 4U2RA 1NH8A 4QFPA 1LBBA 3DLNA 2V3TA 1B9JA 1O63A 5CMKA 4RNSA 1VFDA 3N26A 1P99A 4R6HA 1TWYA 2VD3A 5DVFA 1LB8A 3R6UA 5J1DA 4WEPA 1UTHA 4NF4B 3KEIA 4P11A 5TPAA 5I58A 3SEWA 2XX7A 5B7DA 1A40A 3GZGA 4JSDA 3TCFA 4KCCA 2R6GE 2AYSA 4I9DA 2OWSA 1LAGE 3T9HB 3VV5A 2RCAA 4G77A 4LA9A 3RQTA 1OQGA 2I4CA 4F3GA 2VGQA 3U72A 1MPBA 5F1QA 3T9XB 4EF1A 4H65A 3SETA 2F78A 4PETA 2Y7PA 3THIA 5H8QA 3IL1B 4AB5A 3QUJA 1NNKA 2DP8A 3RUMA 1MH4A 2KLFA 3FATA 3VFJA 3S4UA 4LONB 4OWDA 3D4CA 3MVZA 1MM7A 1UTBB 2UYEA 1B3LA 3V89B 1FTKA 4PFWA 3OEKA 4XIGQ 3G3IA 3IJXB 4MBPA 4X1BA 1ZKBA 2QS1A 4H67A 1PC3A 2HAVA 2Q89A 4RA1A 2PMSA 1XT8A 3OSQA 4H5GA 2I3VA 4PFYA 3ODBA 4GLIA 3ZKKA 4YKKA 3DM0A 1S50A 2PT2A 4U4XA 3ILUB 1D9VA 2M8CA 4OENA 4YU0A 3HSTA 3EF7A 3G3KA 3PPNA 2H99A 2VOZA 3IX1A 1SW1A 1D4NA 1VFEA 3DP8A 1H76A 4ZEFA 1JEUA 4R73A 3KOSA 2DWIA 5ELVA 3ECRA 3BBRA 2ZNSA 1SVXB 1Y3NA 3TZAA 4JSOA 1A7LA 4NF4A 2QPQA 3FV2A 1WODA 3K4UA 4M4GA 2PVUA 4H8IA 4NMYA 2XXWA 4IO2A 4IO6A 3VVFA 5FTHA 1ZU0A 3SEXA 3L6HA 1S9TA 4BLAA 3C33A 3O29A 1BLFA 2UXAA 4F18A 1MQIA 4OFLA 3FXRA 2ZYNA 4R9GA 3PMWA 1USYE 1MRPA 2HZLA 2ZYOA 1P1OA 2REJA 5I84A 1MDP1 4GVOA 5H8NB 5AA2A 3OELA 2XXIA 5I59B 3KZGA 4IO5A 3Q25A 1Z7ME 2LAOA 4HS7A 4KR5A 2OZZA 3HO7A 2B3BA 1N3XA 1VE4A 2PYYA 3U1OA 2V84A 2RF1A 3PPPA 3R7XA 3SEYA 4U1OA 1DSNA 2X7PA 3FASA 4KFQA 3K2DA 4AQ4A 3HPIA 3OO9A 3TQWA 3H6TA 1D3KA 1DTZA 4WEDA 1SW4A 3S2VA 4OXVA 2I58A 3FD3A 4QSEA 3HV1A 3ZS6A 1XOCA 1M5CA 2WKYA 3S9LC 5CM6A 1US4A 2RC9A 2DE2A 4ZZAA 3JZJA 2Z8EA 1B7HA 4NF5B 2XXRA 2DSFA 1XVYA 1QVSA 3SEUA 1GR2A 3IOVA 3MPKA 3CI8A 1FTLA 4LZ5A 4XXUA 1H43A 4C0RA 4POWA 2OCUA 5AA2D 2I3WA 3RT6B 5F7VA 5AA4B 4F3SA 4KPTA 4GFRA 3H03A 4LZ7A 4QFOA 3MC2A 2R71A 4G68A 2F7CA 1ZBMA 4ELPA 1A55A 2QMXA 4YICA 3TFLA 3IB2A 5I59A 4OHNA 1N76A 4G68C 3B7DA 4ELOA 3EHSA 2DE4A 3IO6A 3KOTA 1B4ZA 4BDNA 2ZNUA 3OO7A 3H6UA 1LB9A 1N04A 3FJMA 4R74A 4X48A 1MXZA 4RK2A 1HSJA 4RPOA 4Q0CA 3T93B 4YKJA 3SESA 3TCHA 1Y3PA 4ZEIA 1NNPA 1H44A 2ANJA 4U1ZA 4FAJA 3C32A 3LSLA 2QS2A 2P0SA 5I2NA 1ZLQA 4GL0A 1XC1A 1TT1A 4R2BA 4HW8A 1UIVA 2ZYKA 1JW4A 2XD2A 2IEEA 1FTOA 1B5JA 2OBGA 3TTNA 1F9BA 3RNNA 1PB9A 3CFXA 1MXXA 3PUWE 1MPDA 4TLMB 5HPQA 2Y84A 4NF5A 1US5A 4KQPA 2O1MA 3MZ1A 4GRKA 3TUSA 1I6QA 4LQ5A 1QUIA 4ESWA 4IB2A 4YMAA 3VVDA 4POXA 1URSA 4Q30B 4MH5A 3V83A 5AA4A 3KJTA 3RTFB 4Q8RA 3T9VA 4EQBA 1T0KA 3RGYA 4PQJA 2E0SA 3R26A 4TLLB 3T96B 3W9VA 4EQ9A 3O66A 4FORA 2HEUA 1D9YA 2ONRA 3O2AA 5DVIA 1I6AA 4OZ9A 2XXXA 5DYHA 2H4IA 1B0HA 1NFTA 1FTMA 4ZEBA 1SQYA 4JWOA 4FJPA 4G8MA 4PFTA 5I2KB 2THIA 2QMWA 4ZEKA 4QSDA 4LATA 5K2YA 3CFZA 2Q8JA 2GH9A 2AIXA 3EN3A 1FCKA 2GHAA 2HAUA 4HCYA 1R1NA 4X1DA 3FVNA 1AMFA 1EH3A 1LFHA 4L17A 3K6XA 1MXVA 1BP5A 4LVQA 1B40A 2OJTA 4JWXA 2UVJA 1LFIA 1URDA 3TDJA 3IOWA 3MW0A 2OLBA 1FQBA 3C9HA 2QRYA 5KDTA 1B32A 3FXUA 3MVYA 3W15C 4KI0E 4HTGA 3LSFB 1UIUA 3EPEA 2A5TB 2VP1A 2D5WA 3RTWB 3C35A 5H8FB 1BKAA 1Z7NE 3K6VA 4QFNA 3FXQA 3LBSA 2BJJX 3PUXE 4KYSA 3S9NC 4ZZEA 4BDRA 4THIA 3K6WA 1NNFA 3TTKA 4ND9A 2Y7WA 3E4RA 1QW0A 3PMXA 4ESXA 5A5XB 1I69A 1AL3A 4F1VA 1LGBC 3VLUA 4RY1A 1LSTA 1IITA 2W7YA 2I4BA 1FW0A 4YB7A 1H3DA 2UYFA 4I62A 3UGWA 1OLAA 4LZ8A 1B1XA 4H0WA 2F5XA 2F7AA 4ZE8A 1O64A 4ZS9A 2AL5A 4E0WA 1IEJA 4IGRA 1DPPA 4QSCA 1H45A 3C4MA 4FATA 1BIYA 4YB6A 4DCXA 4EQ7A 2Z8DA 2ZXTA 3N5LA 3PUYE 4EF2A 3G3GA 4QFLA 4NWCA 1B4HA 3OEMA 3CSBA 3OXNA 4R72A 3IAZA 3M3LA 4O3BA 2I0CA 2UVIA 5HBCA 1SD3A 1SI1A 3K1PA 1IXCA 2DVCA 2UVGA 2F8DA 1Y1ZA 1SDXA 1B7ZA 4N6PA 4O3CA 3KG2A 2A5TA 5K2XA 3OMBA 2O1LA 3BKIB 3E3KA 4YZZA 1QJMA 4MFIA 3H3GA 3FVKA 4X9TA 5H8FA 3MQ9A 1JW1A 4GXAA 1AIVA 4F2QA 1SI0A 3KFMA 4DXBA 2REGA 4IGTA 3IOUA 5FHOA 1PDAA 5H8HB 3QUFA 3KGCA 1YPNA 2FYIA 4DDDA 5A5XA 2XXYA 2HXWA 2B3FA 4P0GA 1B46A 4FE8A 4F1YA 1UTBA 1MQDA 3CFLA 1MXWA 2I6EA 2V25A 1XS5A 3PMVA 3K01A 4OTEA 1EU8A 1DTGA 3A3CA 1LCFA 1SW5A 1M5DA 2V3QA 1GV8A 3G3JA 5L9OA 3M3KA 5CRYA 1Y3QA 3MWBA 4K3FA 5CBSA 2PBWA 3C31A 4OEUA 4F2OA 5BWJA 3UA8A 3ILTB 1NNTA 2XXUA 3PGFA 4H6DA 3QIMA 1YTVA 3T66A 4OERA 2HCAA 3BFUA 1LAXA 3LR1A 1Y20A 2O68A 5DVJA 4F39A 2QS3A 1LLSA 3O6IA 4YB5A 5I56B 4UA8A 4G8NA 4FIMA 3VE1B 2NUVA 1P1QA 1JETA 3TYHA 1VR5A 1FQDA 3O97A 1EZ9A 1DMBA 1LFGA 3PPQA 4JDFA 1IZ1A 1PBQA 3V5AA 3CG1A 3MVWA 2DXYA 4NWDA 4FECA 4EDPA 1B6HA 2F6PA 1MG1A 4XKQA 5DEXB 3C34A 1MY1A 2XD3A 2A5SA 4H5FA 5B70A 1QUJA 4Z0IA 5H8NA 4KYEA 1OVBA 3MAMA 5JTYB 3RT8A 2NOOA 1GTKA 4MLQA 3MVXA 2YJPA 3GLBA 3UORA 3E9XA 1L5TA 1ANFA 1B5HA 1N84A 2DWAA 4G2ZA 2HQ0A 5TP9B 2DS9A 3LC8A 3QSLA 4I8CA 2O7UA 4YKIA 1LBCA 1B05A 1YAEA 3PD8A 2O6AA 2X7QA 2DWJA 1WVJA 4RK9A 3VXCA 1JVYA 4ELQA 3IORA 2O84X 3T22A 1Q35A 4LP2B 3O6GA 5FHMA 1AH5A 4DXCA 3Q26A 3DP4A 3S9MC 4U4SA 4DLDA 4GOTA 5IAIA 3VXBA 3TKDA 2Y7IA 2I0BA 1MQHA 2RINA 5I56A 4RYAA 2NXOA 3MP1A 5TPAB 1NH7A 5I58B 3L6GA 1P1WA 4H8JA 4BDQA 4Z7EA 3PPRA 1MY3A 3LSXA 3PD9A 4R9FA 1EZOA 3BFTA 3V8XB 3H7MA 4IO4A 2XX9A 4KCDA 4EUOA 3SEVA 2F35A 1YCJA 4IO3A 2D21A 1B3HA 4BDMA 5CI5A 4GXSB 1SYHA 2XXPA 3FUZA 5JTYA 4FEBA 4KYDA 4H1XA 3P7IA 1MM6A 1OVTA 1LAHE 1VSOA 1IQ7A 3N6TA 3FGSA 1JEVA 4AB6A 3G3FA 5TP9A 4QFKA 4F29A 1ATGA 1Y4TA 4ZECA 1IXGA 2YLNA 1JW5A 1QUKA 3GXAA 4NE4A 2F6GA 2HFBA 1OMPA 3QYTA 4P0IA 5EHMA 1KWHA 3PUZE 2X26A 1DPEA 4WKMA 3VDFA 2F97A 3U92A 1B3FA 5DT6A 3G7WA 3IOTA 2QL3A 4JBZA 3OENA 1N0TA 1XVXA 4XKNA 3CVGA 3KSXA 4YAHX 2XXHA 1OIBA 5KCJB 3AXFA 2CMOA 1PEBA 4YMBA 4GQOA 2ZYMA 4C1UA 5FHNA 1B5IA 1Y4CA 4MLVA 4XKPA 3UIFA 3ZSFA 2ZNTA 1Q1KA 3O9PA 3HCQA 4EXKA 4F1UA 1IIWA 4PE5B 1SBPA 1R6ZA 3TMGA 1URGA 1B0LA 2DQVA 3JV9A 4NTLA 2Z8FA 3TELA 3PU5A 1B7UA 3CG3A 3K00A 2Q2CA 4GL8A 3B6TA 2QSXA 1B3GA 2H98A 5CMBA 3K1MA 1MY0A 1I6BA 2O51A 4XKRA 1QKBA 4DIGA 3A09A 1JNFA 1RYOA 3LUYA 2GFEA 1SYIA 5TU0A 3B6QA 1QULA 3FIRA 2F36A 2IA4A 2V3UA 1RYXA 2DYXA 2F7BA 5AE4A 2FA7A 4BDOA 4OFOA 5ICQA 5AA2B 3A3UA 1A54A 2PT1A 5I2KA 5LOMA 5CMCA 2NVUB 4PP0A 1XHYA 1B2HA 1EZPA 4KD5A 4ZDMA 2H5YA 3SKPA 4JWYA 5CC2A 2RKMA 1HSLA 1S7YA 2YPNA 1ZTYA 1O7TA 5ITOA 4DXUA 2Z23A 2G29A 1B1HA 3PV0E 4R75A 4OYVA 5KCJA 3E13X 1ZJLA 3U8QA 3GBAA 1N3WA 3RLFE 5KZTA 3H4ZA 2D3IA 5JK4A 1ZIUA 4TQUQ 3TPAA 1FQCA 2G93A 3KSJA 1BTJA 4IO7A 1WDNA 2Q9TA 4RXLA 4LQ2A 2P1SA 1M5EA 5I57B 3IB0A 4F22A 3EHUA 4U22A 3IB1A 1IXIA 2GRVA 3TQLA 4ZEDA 5ITPA 5ICTA 1POY1 5BUUA 5EYFA 3OO6A 3OOAA 1FTJA 3TTMA 4XTCQ 2Q2AA 3TODA 2RC8A 1CE2A 2R9JA 2B65A 3RPWA 4UACA 3K0VA 2ZMBA 3W9WA 5ISUA 3CIJA 1P1NA 4JXIA 1R9QA 4FEDA 2XXQA 3B6WA 2GHBA 4I1DA 1NMUA 3RN8A 4NEDA 1MH3A 3MZBA 5EHSA 4G8HA 1TFAA 2CZLA 3KJ7A 1Y1MA 4DZ1A 3MZ9A 4G68B 1HSEA 2ONSA 2VD2A 1USYH 3ONMA 3VLVA 4R6YA 3M8UA 3UP9A 1OLCA 1A99A 1A8FA 4OQOA 1MY4A 3VVEA 3K6UA 4BDLA 1R9LA 3T9UA 3U94A 4ECFA 3Q29A 4IY5A 4OFJA 4U21A 5CMMA 4F19A 1MQGA 2DXRA 1B52A 4U23A 3MP8A 4OETA 3CRBA 4F3PA 3MJNA 4GF8A 3JYRA 3SDFA 4MF3A 2ABHA 4OEVA 5M2VA 4LUBA 1II5A 1MXUA 3GBBA 2ALUA 2Y7RA 5DTBA 1NL5A 2VHAA 2O7IA 3TTRA 2AL4A 1JQFA 1TFDA 1UQWA 4HCWA 4KHZE 5I2NB 3EHTA 4GIZA 4RPNA 4PFUA 3QAXA 5L9SA 4GWOA 4DCYA 1P1UA 2F34A 1AOVA 3MP6A 2UVHA 5I57A 2XX8A 3O28A 1POTA 2XXTA 3N94A 3WAFA 4OVJA 3M3FA 4ONYA 3ZKLA 2Z22A 2RCBA 1A8EA 3HHFA 1ZMGA 2QS4A 3MBPA 4QHQA 3I5OA 1ELJA 4OESA 2OK2A 3N6UA 2DE3A 5H8HA 3KN3A
chains in the Genus database with same CATH superfamily
3F11A 4I40A 3UN6A 3FV1A 4JVCA 3O6HA 1B3EA 1MPCA 1LEVA 5ESYA 3H06B 3QXMA 2XXVA 1RKMA 3KN7A 3PUVE 4MNIA 4Q5TA 1PB8A 4NN3A 2WYPA 1OQHA 2QJEA 2PX1A 2Y7KA 4PAFA 3U93A 3EQ1A 4C1TA 1IUDA 4N07A 3RY3A 4JB7A 3IK6B 4EXLA 4QF9A 3TEPA 1N7XA 5A5LA 3FJ7A 2O69A 4NF8B 4X04A 3KBRA 4ISUA 3C36A 3DELB 4OVSA 1N7WA 3K1NA 3D4GA 2OWTA 1MY2A 3A29A 2HZKA 1IXHA 3USDA 1IMBA 1DOTA 4NF6B 1JVXA 4YKPA 2I48A 1EYKA 5JEIA 2ONKE 4G4PA 2ESNA 4QRZA 4OMBA 4WXJA 3WAEA 3IO4A 5EQ7A 4F3BA 1GGGA 4DE8A 3OSRA 3CR9A 5FTIA 2L5VA 1PB7A 3H6VA 4PAKA 4ZE9A 4HE0A 2DVZA 3OO8A 1FQFA 3PPOA 5L9MA 5L8DA 3MYUA 3TTLA 3CSGA 2P2AA 1UTHB 3G3HA 4TOZA 5CBRA 2FIXA 1MQJA 4R2FA 3HN0A 5KDTB 3TCGA 3MPLA 1LCTA 2V93A 3I6VA 3UK4A 3FVOA 2H25A 5IKBA 4PC9A 2OX3A 1QGXA 2E1SA 2RC7A 1TXFA 2H9BA 1FQAA 1LAFE 2DOJA 3Q28A 1JP4A 1B51A 5DEXA 1B58A 2BJIA 1Y9UA 1IMCA 4ELRA 5I7IA 3MUQA 2XHDA 2ZZVA 1CB6A 2Q88A 3TAJA 4F31B 2FNCA 1FPIA 1M5BA 5H8QB 3KN8A 4R6KA 1FQEA 1NKXA 4GD5A 1J1NA 4RJZA 1GVCA 1LBXA 3OD7A 3DP6A 1NV3A 5AA1A 4E0XA 2DWHA 4M1VA 3FJGA 4NX1A 4NF8A 3VLWA 2NWJA 5H8SA 1SW2A 3HHGA 1M5FA 3FVGA 3ISPA 4O3AA 4N91A 3IJOB 4MNPA 3S9EA 5AA3A 3Q27A 3FZVA 1QKAA 4IY6A 5HM4B 3H6WA 1MS7A 4NF6A 3SERA 3K02A 1PBPA 2I49A 5LDZA 3QK6A 4OVTA 1MDQA 3I3VA 3LSWA 1MXYA 4N13A 3FBPA 3IR1A 4U2RA 1NH8A 4QFPA 1LBBA 3DLNA 2V3TA 1B9JA 2CZHA 1O63A 5CMKA 4RNSA 1IMEA 1VFDA 3N26A 1FRPA 1P99A 4R6HA 1TWYA 2VD3A 4OVRA 5DVFA 1LB8A 3R6UA 4PBQA 5J1DA 4WEPA 1UTHA 4NF4B 3KEIA 4P11A 5TPAA 5I58A 3SEWA 2XX7A 5B7DA 1A40A 3GZGA 4JSDA 3TCFA 4KCCA 4N8GA 4OA4A 2R6GE 1IMAA 2AYSA 2CZIA 4I9DA 2OWSA 1LAGE 3T9HB 3VV5A 2RCAA 4G77A 4LA9A 3RQTA 1OQGA 2I4CA 4F3GA 2VGQA 3U72A 4MMPA 1MPBA 5F1QA 3T9XB 4EF1A 3KC1A 4H65A 3SETA 2F78A 4GX3A 4PETA 2Y7PA 3IL1B 5H8QA 3THIA 4AB5A 3QUJA 1NNKA 2DP8A 1FPLA 3RUMA 1MH4A 2KLFA 3FATA 3VFJA 3EKIA 4P8BA 4PTKA 3S4UA 4LONB 4OWDA 4N15A 3D4CA 2KR0A 3MVZA 1MM7A 1UTBB 2UYEA 1B3LA 3V89B 1BK4A 1FTKA 4PFWA 3OEKA 4XIGQ 3G3IA 3IJXB 4MBPA 4X1BA 1ZKBA 1FPKA 2QS1A 4PGNA 1RDXA 1NI9A 4H67A 1DBZA 1PC3A 2HAVA 5ET6A 2Q89A 4RA1A 2PMSA 4PBHA 1XT8A 3OSQA 4H5GA 2I3VA 4PFYA 3ODBA 4GLIA 4GBVA 1FJ9A 3ZKKA 4YKKA 3DM0A 1S50A 2PT2A 4U4XA 3ILUB 1D9VA 2M8CA 4OENA 4YU0A 2P3NA 3HSTA 3EF7A 3PPNA 3G3KA 2H99A 2VOZA 3IX1A 1SW1A 1D4NA 1VFEA 3DP8A 1H76A 4ZEFA 5EYGA 1JEUA 4R73A 3KOSA 2DWIA 5ELVA 3ECRA 3BBRA 2ZNSA 1SVXB 1Y3NA 3TZAA 4JSOA 1A7LA 4NF4A 2QPQA 3FV2A 1WODA 3K4UA 4M4GA 4O8MA 1K9YA 2PVUA 4H8IA 1NV0A 4NMYA 2XXWA 2HXRA 4IO2A 4IO6A 3VVFA 4PF6A 5FTHA 4QXDA 1ZU0A 1NV4A 3SEXA 3L6HA 1S9TA 4BLAA 3C33A 3O29A 4GWUA 1BLFA 2UXAA 4F18A 1MQIA 4OFLA 3FXRA 2ZYNA 3E78A 4R9GA 3PMWA 1USYE 1MRPA 2HZLA 3MSTA 4MHFA 2ZYOA 1P1OA 2REJA 5I84A 1MDP1 4GVOA 5H8NB 5AA2A 2WEFA 3OELA 2XXIA 5I59B 3KZGA 4IO5A 3Q25A 1Z7ME 2Q74A 2LAOA 4HS7A 5IM2A 4KR5A 2OZZA 1IMDA 3HO7A 2B3BA 2Q8MA 1N3XA 2R8TA 1VE4A 2PYYA 4UABA 3U1OA 2V84A 2RF1A 2XWKA 3PPPA 4N17A 3R7XA 3SEYA 4U1OA 2QVVA 2WBBA 1FPGA 1DSNA 4MJOA 2X7PA 3FASA 4KFQA 3K2DA 4AQ4A 3HPIA 3OO9A 3TQWA 3H6TA 1D3KA 1LBYA 1DTZA 3U65A 4P47A 4WEDA 1SW4A 3S2VA 1FBHA 4OXVA 2I58A 3FD3A 4QSEA 1FPBA 5IZZA 3HV1A 3ZS6A 1XOCA 2KQZA 1M5CA 2WKYA 3S9LC 1FSAA 5CM6A 1US4A 2RC9A 2WBDA 2DE2A 4ZZAA 3JZJA 1FTAA 2Z8EA 1B7HA 4H45A 4NF5B 2XXRA 2DSFA 3B50A 1XVYA 1NUYA 1QVSA 3SEUA 1GR2A 3IOVA 4QBAA 1NUXA 3MPKA 3CI8A 1FTLA 4LZ5A 4DI4B 4XXUA 1H43A 4C0RA 4POWA 2OCUA 5AA2D 2I3WA 3RT6B 5F7VA 5AA4B 4F3SA 4KPTA 4GFRA 3H03A 4LZ7A 4QFOA 3MC2A 2R71A 4P3LA 4G68A 2F7CA 1ZBMA 4ELPA 1A55A 2QMXA 2PCRA 4YICA 3TFLA 3IB2A 5I59A 4OHNA 1N76A 4G68C 3B7DA 4ELOA 3EHSA 2DE4A 3IO6A 3KOTA 1B4ZA 4BDNA 2ZNUA 3OO7A 4NF0A 3H6UA 1LB9A 1N04A 2CEXA 3FJMA 4R74A 4X48A 4PFRA 1MXZA 4RK2A 1HSJA 4RPOA 4Q0CA 3T93B 4YKJA 3SESA 3TCHA 1Y3PA 4ZEIA 1NNPA 1H44A 4GWYA 4NGUA 2ANJA 4U1ZA 4FAJA 3C32A 3LSLA 3HFUA 2QS2A 2P0SA 2CEYA 5I2NA 1ZLQA 4GL0A 1XC1A 1TT1A 2JJKA 4R2BA 1IMFA 4HW8A 1UIVA 4P1LA 2ZYKA 4N6DA 1JW4A 2XD2A 2IEEA 1FTOA 4HE1A 5ET7A 1B5JA 1DCUA 2OBGA 3TTNA 2GQ1A 1F9BA 3RNNA 1PB9A 4HXVA 3CFXA 1MXXA 3PUWE 1MPDA 4TLMB 5HPQA 2Y84A 1FBGA 1NV7A 4PGPA 4NF5A 1US5A 1LBZA 4KQPA 2O1MA 3MZ1A 4GRKA 3TUSA 1I6QA 5LTCA 4LQ5A 1QUIA 4GX6A 1DK4A 4ESWA 4IB2A 4YMAA 3VVDA 4POXA 1URSA 4Q30B 4MH5A 3V83A 5AA4A 3KJTA 3RTFB 4Q8RA 4MCOA 3T9VA 1NUWA 4EQBA 1T0KA 3RGYA 4PQJA 2E0SA 3R26A 2VPOA 4TLLB 3T96B 3W9VA 4EQ9A 3O66A 4FORA 2HEUA 1D9YA 2DDKA 2ONRA 3T0JA 3O2AA 2V4CA 5DVIA 1I6AA 4OZ9A 2XXXA 5DYHA 2H4IA 1B0HA 1NFTA 1FTMA 2P3VA 4ZEBA 1SQYA 4JWOA 4FJPA 4G8MA 4PFTA 4MIJA 1D9QA 3E79A 5I2KB 2THIA 2QMWA 4ZEKA 4QSDA 4LATA 5K2YA 3CFZA 2Q8JA 2GH9A 3IFCA 2AIXA 3EN3A 1FCKA 2GHAA 2HAUA 4HCYA 1R1NA 4X1DA 3FVNA 1FPFA 1AMFA 1EH3A 1FBFA 4N4UA 1LFHA 4L17A 3K6XA 1MXVA 1BP5A 4LVQA 4OANA 1B40A 2OJTA 4JWXA 2UVJA 1LFIA 1URDA 3TDJA 3IOWA 3MW0A 4O94A 2OLBA 1FQBA 3C9HA 2QRYA 5KDTA 1B32A 2B4MA 3FXUA 3MVYA 3W15C 4KI0E 4HTGA 3LSFB 4PDDA 1UIUA 2VPNA 3EPEA 2A5TB 3ROJA 4HE2A 2VP1A 1Q9DA 2D5WA 3RTWB 3C35A 5H8FB 1BKAA 1Z7NE 4QFNA 3K6VA 3FXQA 3LBSA 2BJJX 3PUXE 4KYSA 3S9NC 4ZZEA 4BDRA 4AS4A 2QVRA 4THIA 3K6WA 1NNFA 3TTKA 2ZZXA 4ND9A 4I3YA 5IZ1A 2Y7WA 3E4RA 1QW0A 3PMXA 4P9KA 4ESXA 5A5XB 1I69A 1AL3A 4F1VA 1LGBC 3VLUA 4RY1A 1LSTA 1IITA 2W7YA 2I4BA 1FW0A 4YB7A 5EQ8A 1H3DA 1G0HA 2UYFA 4I62A 4KXPA 5IZ3B 3UGWA 1OLAA 4LZ8A 1B1XA 2PFYA 4H0WA 2F5XA 2F7AA 4ZE8A 1O64A 4ZS9A 2AL5A 4E0WA 1IEJA 4IGRA 1DPPA 4QSCA 1H45A 3C4MA 4FATA 1BIYA 4YB6A 4DCXA 4EQ7A 2Z8DA 2ZXTA 3N5LA 3PUYE 4PFBA 4EF2A 3G3GA 3KBZA 3LUZA 4QFLA 4NWCA 1B4HA 3OEMA 3CSBA 3OXNA 3RYDA 4R72A 3IAZA 3M3LA 4O3BA 2I0CA 2UVIA 5HBCA 1SD3A 1SI1A 3K1PA 3RPLB 1IXCA 2DVCA 2UVGA 2F8DA 1Y1ZA 1SDXA 1B7ZA 5I5PA 4N6PA 4O3CA 3KG2A 2A5TA 5K2XA 3OMBA 2O1LA 3BKIB 3E3KA 4YZZA 1QJMA 4MFIA 3H3GA 3FVKA 4X9TA 5H8FA 3MQ9A 1JW1A 4GXAA 1FBDA 1AIVA 4F2QA 1VDWA 1SI0A 4NQ8A 3KFMA 4DXBA 2REGA 4NAPA 4IGTA 3IOUA 5FHOA 1PDAA 3NOHA 1KZ8A 5H8HB 3QUFA 3KGCA 1YPNA 2FYIA 4DDDA 5A5XA 1G0IA 2XXYA 2HXWA 2B3FA 4P0GA 2XWIA 4XEQA 1B46A 1EYJA 5DW8A 1KA1A 4FE8A 4PAIA 4F1YA 1UTBA 1YXIA 1MQDA 3CFLA 1MXWA 2I6EA 2V25A 1XS5A 3PMVA 1EYIA 3K01A 4XF5A 4OTEA 1EU8A 4MEVA 1DTGA 3A3CA 1LCFA 1SW5A 1M5DA 2V3QA 1GV8A 3G3JA 5L9OA 3M3KA 4P56A 5CRYA 1Y3QA 3MWBA 4K3FA 5CBSA 2PBWA 3C31A 4OEUA 4F2OA 5BWJA 3UA8A 2HPGA 3ILTB 4P1EA 1NNTA 2XXUA 3PGFA 4H6DA 3QIMA 2XWOA 1YTVA 3T66A 4OERA 2HCAA 3BFUA 3RPLA 1LAXA 3LR1A 1Y20A 5EYHA 2O68A 4OVQA 5DVJA 3D1RA 4F39A 2QS3A 1LLSA 3O6IA 4YB5A 5I56B 4UA8A 4G8NA 1YYZA 4X8RA 4FIMA 3VE1B 2NUVA 1P1QA 1JETA 3TYHA 1VR5A 1FQDA 1SPIA 4LN5A 3O97A 1EZ9A 1DMBA 1LFGA 3PPQA 4JDFA 1IZ1A 1PBQA 3V5AA 3CG1A 3MVWA 2DXYA 4NWDA 4FECA 1FPEA 4EDPA 1B6HA 2F6PA 1MG1A 4XKQA 5DEXB 3C34A 1MY1A 4NHBA 2XD3A 2A5SA 4H5FA 1QUJA 4Z0IA 5B70A 5H8NA 4KYEA 1OVBA 3MAMA 5JTYB 3RT8A 2NOOA 1GTKA 4MLQA 3MVXA 5T3JA 2YJPA 3GLBA 3UORA 3E9XA 1L5TA 1FPDA 1ANFA 1B5HA 4GX4A 1N84A 1FPJA 2DWAA 2Y5LA 4G2ZA 2CZKA 2HQ0A 5TP9B 2DS9A 3LC8A 3QSLA 5J16A 4I8CA 2O7UA 4YKIA 1LBCA 1B05A 1YAEA 3PD8A 2O6AA 2X7QA 2DWJA 1FJ6A 1WVJA 4N6KA 4RK9A 3VXCA 1JVYA 4ELQA 3IORA 4PE3A 2O84X 3T22A 4PF8A 1Q35A 4LP2B 3O6GA 5FHMA 2ZZWA 1AH5A 4DXCA 3Q26A 3DP4A 3S9MC 4U4SA 2FBPA 4IR8A 1FBEA 4DLDA 4GOTA 5IAIA 3VXBA 3TKDA 2Y7IA 2I0BA 5ET8A 1MQHA 2RINA 5I56A 5ET5A 4RYAA 2B4LA 2NXOA 3MP1A 5TPAB 1NH7A 2FHYA 5I58B 3L6GA 1P1WA 1FBCA 4H8JA 4BDQA 4Z7EA 3PPRA 2PFZA 1MY3A 2WX9A 4JVDA 3LSXA 3PD9A 4MX6A 4O7IA 4R9FA 1EZOA 3BFTA 3V8XB 3H7MA 4IO4A 3LV0A 2XX9A 4KCDA 4EUOA 3SEVA 2F35A 4I3EA 1YCJA 4IO3A 2D21A 1B3HA 1FBPA 4BDMA 1NV6A 5CI5A 4GXSB 4N81A 1SYHA 2XXPA 3FUZA 5JTYA 4FEBA 4AS5A 4KYDA 1NUZA 4H1XA 2F3DA 5F24A 3P7IA 1MM6A 1OVTA 1LAHE 1VSOA 1IQ7A 3N6TA 3FGSA 1JEVA 4AB6A 3BIGA 3G3FA 5TP9A 4QFKA 4F29A 1ATGA 1Y4TA 4ZECA 1IXGA 2YLNA 1JW5A 1QUKA 1YZ0A 2VT5A 3GXAA 4NE4A 3CHGA 2F6GA 2HFBA 1OMPA 3QYTA 4P0IA 5EHMA 1KWHA 1NV5A 3PUZE 1AWBA 2X26A 1DPEA 4WKMA 3VDFA 2F97A 3U92A 1B3FA 5DT6A 3G7WA 3IOTA 2QL3A 4JBZA 3OENA 1N0TA 1XVXA 4XKNA 3CVGA 3KSXA 4YAHX 2XXHA 1OIBA 5KCJB 1XI6A 3AXFA 2CMOA 1PEBA 2FVZA 3GYYA 4GWZA 4H46A 4YMBA 4GQOA 4XFEA 2ZYMA 4C1UA 5FHNA 1B5IA 1Y4CA 4MLVA 4XKPA 3UIFA 2HHMA 3ZSFA 2ZNTA 1Q1KA 3O9PA 3HCQA 4O7MA 4EXKA 4MAGA 4F1UA 1IIWA 4PE5B 1SBPA 3QMFA 1R6ZA 4OVPA 5EQAA 3TMGA 1URGA 1B0LA 2DQVA 3JV9A 2XXKA 4NTLA 2Z8FA 3TELA 3PU5A 1B7UA 3CG3A 3K00A 2Q2CA 4GL8A 3B6TA 2QSXA 1B3GA 2H98A 5CMBA 3K1MA 1MY0A 1I6BA 2O51A 4XKRA 1QKBA 4DIGA 3A09A 1JNFA 2Y5KA 1RYOA 3LUYA 4FBPA 2GFEA 1SYIA 5TU0A 3B6QA 1QULA 3FIRA 4N8YA 2F36A 2IA4A 2V3UA 4GWXA 1RYXA 2DYXA 2F7BA 5AE4A 2FA7A 2OWZA 4BDOA 4OFOA 5ICQA 4NG7A 5AA2B 3A3UA 1A54A 2PT1A 5I2KA 1KA0A 3B8BA 5LOMA 5CMCA 4MNCA 2NVUB 4PP0A 1XHYA 1B2HA 1EZPA 4KD5A 4ZDMA 2QVUA 2H5YA 2F3BA 3SKPA 4JWYA 5CC2A 2RKMA 1HSLA 1S7YA 2MKZA 2YPNA 1ZTYA 1O7TA 5ITOA 4DXUA 2Z23A 2G29A 1B1HA 3PV0E 4R75A 4OYVA 5KCJA 3E13X 1ZJLA 3U8QA 3GBAA 1N3WA 3RLFE 5KZTA 3KC0A 4GWWA 5FBPA 3H4ZA 2D3IA 5JK4A 1ZIUA 4TQUQ 3TPAA 1LBWA 1FQCA 2G93A 3KSJA 1BTJA 4IO7A 1WDNA 2Q9TA 4RXLA 4LQ2A 2P1SA 1M5EA 5I57B 3IB0A 4F22A 3EHUA 4U22A 1RDYA 3IB1A 1IXIA 2GRVA 3TQLA 4G61A 4ZEDA 5ITPA 4GBWA 4DI3D 1NV1A 5ICTA 1POY1 5BUUA 5EYFA 3OO6A 3OOAA 5I3SA 1FTJA 3TTMA 4XTCQ 3FXBA 2Q2AA 3TODA 2RC8A 1CE2A 2R9JA 2XA5A 2B65A 3RPWA 4UACA 3K0VA 2ZMBA 3PTYA 3W9WA 5ISUA 3CIJA 1P1NA 4JXIA 1R9QA 4FEDA 2XXQA 3B6WA 3T1BA 2GHBA 4I1DA 1NMUA 3RN8A 4NEDA 1MH3A 3MZBA 5EHSA 5IZ3A 4G8HA 1TFAA 2CZLA 3KJ7A 4PDHA 1Y1MA 4DZ1A 3BIHA 3MZ9A 4G68B 1HSEA 2ONSA 4PCDA 2VD2A 1USYH 3ONMA 3VLVA 4R6YA 3M8UA 3UP9A 1OLCA 1A99A 1A8FA 4OQOA 1MY4A 3VVEA 3K6UA 3SZPA 4BDLA 1R9LA 3T9UA 3U94A 4ECFA 3Q29A 4IY5A 4OFJA 4U21A 5CMMA 4F19A 1MQGA 2DXRA 1B52A 2XWVA 4U23A 3MP8A 4OETA 3CRBA 4F3PA 3MJNA 4GF8A 3JYRA 3SDFA 4MF3A 1INPA 2ABHA 4OEVA 5M2VA 4PFIA 1II5A 4LUBA 1MXUA 3GBBA 2ALUA 2Y7RA 1CNQA 5DTBA 4GWSA 1NL5A 2VHAA 2O7IA 3TTRA 2AL4A 1JQFA 1TFDA 2FIEA 1UQWA 4HCWA 4KHZE 5I2NB 3EHTA 4GIZA 4RPNA 4PFUA 3QAXA 5L9SA 4GWOA 4DCYA 2QFLA 1P1UA 2F34A 1K9ZA 1AOVA 3MP6A 2UVHA 5I57A 2XX8A 1NV2A 4JVIA 3O28A 1POTA 1RDZA 2XXTA 5IGAA 3N94A 3WAFA 4OVJA 3M3FA 4ONYA 3ZKLA 2Z22A 1LBVA 2RCBA 1A8EA 3HHFA 1ZMGA 2QS4A 3MBPA 2WYKA 4QHQA 3IFAA 3I5OA 1ELJA 4OESA 2OK2A 5EQ9A 3N6UA 2DE3A 5H8HA 3KN3A
chains in the Genus database with same CATH topology
3F11A 3UN6A 3FV1A 3O6HA 1B3EA 1MPCA 3H06B 3QXMA 2XXVA 1RKMA 3KN7A 3PUVE 4Q5TA 1PB8A 1OQHA 2QJEA 2PX1A 2Y7KA 3U93A 3EQ1A 4C1TA 1IUDA 4N07A 3RY3A 4JB7A 3IK6B 4EXLA 4QF9A 3TEPA 1N7XA 3FJ7A 2O69A 4NF8B 3KBRA 4ISUA 3C36A 3DELB 1N7WA 3K1NA 3D4GA 2OWTA 1MY2A 2HZKA 1IXHA 3USDA 4NF6B 1DOTA 1JVXA 4YKPA 2I48A 5JEIA 2ONKE 4G4PA 2ESNA 4QRZA 4OMBA 4WXJA 3WAEA 3IO4A 4F3BA 1GGGA 4DE8A 3OSRA 3CR9A 5FTIA 1PB7A 3H6VA 4ZE9A 2DVZA 3OO8A 1FQFA 3PPOA 5L9MA 5L8DA 3TTLA 3CSGA 2P2AA 1UTHB 3G3HA 4TOZA 5CBRA 1MQJA 4R2FA 3HN0A 5KDTB 3TCGA 3MPLA 1LCTA 2V93A 3I6VA 3UK4A 3FVOA 2H25A 5IKBA 2E1SA 2RC7A 1TXFA 2H9BA 1FQAA 1LAFE 2DOJA 3Q28A 1B51A 5DEXA 1B58A 1Y9UA 4ELRA 3MUQA 2XHDA 1CB6A 2Q88A 3TAJA 4F31B 2FNCA 1M5BA 5H8QB 3KN8A 4R6KA 1FQEA 1NKXA 4GD5A 1J1NA 4RJZA 1GVCA 3OD7A 3DP6A 5AA1A 4E0XA 2DWHA 4M1VA 3FJGA 4NF8A 3VLWA 2NWJA 5H8SA 1SW2A 3HHGA 1M5FA 3FVGA 4O3AA 3IJOB 3S9EA 5AA3A 3Q27A 3FZVA 1QKAA 4IY6A 5HM4B 3H6WA 1MS7A 4NF6A 3SERA 3K02A 1PBPA 2I49A 3QK6A 1MDQA 3I3VA 3LSWA 1MXYA 4N13A 3IR1A 4U2RA 1NH8A 4QFPA 1LBBA 3DLNA 2V3TA 1B9JA 1O63A 5CMKA 4RNSA 1VFDA 3N26A 1P99A 4R6HA 1TWYA 2VD3A 5DVFA 1LB8A 3R6UA 5J1DA 4WEPA 1UTHA 4NF4B 3KEIA 4P11A 5TPAA 5I58A 3SEWA 2XX7A 5B7DA 1A40A 3GZGA 4JSDA 3TCFA 4KCCA 2R6GE 2AYSA 4I9DA 2OWSA 1LAGE 3T9HB 3VV5A 2RCAA 4G77A 4LA9A 3RQTA 1OQGA 2I4CA 4F3GA 2VGQA 3U72A 1MPBA 5F1QA 3T9XB 4EF1A 4H65A 3SETA 2F78A 4PETA 2Y7PA 3THIA 5H8QA 3IL1B 4AB5A 3QUJA 1NNKA 2DP8A 3RUMA 1MH4A 2KLFA 3FATA 3VFJA 3S4UA 4LONB 4OWDA 3D4CA 3MVZA 1MM7A 1UTBB 2UYEA 1B3LA 3V89B 1FTKA 4PFWA 3OEKA 4XIGQ 3G3IA 3IJXB 4MBPA 4X1BA 1ZKBA 2QS1A 4H67A 1PC3A 2HAVA 2Q89A 4RA1A 2PMSA 1XT8A 3OSQA 4H5GA 2I3VA 4PFYA 3ODBA 4GLIA 3ZKKA 4YKKA 3DM0A 1S50A 2PT2A 4U4XA 3ILUB 1D9VA 2M8CA 4OENA 4YU0A 3HSTA 3EF7A 3G3KA 3PPNA 2H99A 2VOZA 3IX1A 1SW1A 1D4NA 1VFEA 3DP8A 1H76A 4ZEFA 1JEUA 4R73A 3KOSA 2DWIA 5ELVA 3ECRA 3BBRA 2ZNSA 1SVXB 1Y3NA 3TZAA 4JSOA 1A7LA 4NF4A 2QPQA 3FV2A 1WODA 3K4UA 4M4GA 2PVUA 4H8IA 4NMYA 2XXWA 4IO2A 4IO6A 3VVFA 5FTHA 1ZU0A 3SEXA 3L6HA 1S9TA 4BLAA 3C33A 3O29A 1BLFA 2UXAA 4F18A 1MQIA 4OFLA 3FXRA 2ZYNA 4R9GA 3PMWA 1USYE 1MRPA 2HZLA 2ZYOA 1P1OA 2REJA 5I84A 1MDP1 4GVOA 5H8NB 5AA2A 3OELA 2XXIA 5I59B 3KZGA 4IO5A 3Q25A 1Z7ME 2LAOA 4HS7A 4KR5A 2OZZA 3HO7A 2B3BA 1N3XA 1VE4A 2PYYA 3U1OA 2V84A 2RF1A 3PPPA 3R7XA 3SEYA 4U1OA 1DSNA 2X7PA 3FASA 4KFQA 3K2DA 4AQ4A 3HPIA 3OO9A 3TQWA 3H6TA 1D3KA 1DTZA 4WEDA 1SW4A 3S2VA 4OXVA 2I58A 3FD3A 4QSEA 3HV1A 3ZS6A 1XOCA 1M5CA 2WKYA 3S9LC 5CM6A 1US4A 2RC9A 2DE2A 4ZZAA 3JZJA 2Z8EA 1B7HA 4NF5B 2XXRA 2DSFA 1XVYA 1QVSA 3SEUA 1GR2A 3IOVA 3MPKA 3CI8A 1FTLA 4LZ5A 4XXUA 1H43A 4C0RA 4POWA 2OCUA 5AA2D 2I3WA 3RT6B 5F7VA 5AA4B 4F3SA 4KPTA 4GFRA 3H03A 4LZ7A 4QFOA 3MC2A 2R71A 4G68A 2F7CA 1ZBMA 4ELPA 1A55A 2QMXA 4YICA 3TFLA 3IB2A 5I59A 4OHNA 1N76A 4G68C 3B7DA 4ELOA 3EHSA 2DE4A 3IO6A 3KOTA 1B4ZA 4BDNA 2ZNUA 3OO7A 3H6UA 1LB9A 1N04A 3FJMA 4R74A 4X48A 1MXZA 4RK2A 1HSJA 4RPOA 4Q0CA 3T93B 4YKJA 3SESA 3TCHA 1Y3PA 4ZEIA 1NNPA 1H44A 2ANJA 4U1ZA 4FAJA 3C32A 3LSLA 2QS2A 2P0SA 5I2NA 1ZLQA 4GL0A 1XC1A 1TT1A 4R2BA 4HW8A 1UIVA 2ZYKA 1JW4A 2XD2A 2IEEA 1FTOA 1B5JA 2OBGA 3TTNA 1F9BA 3RNNA 1PB9A 3CFXA 1MXXA 3PUWE 1MPDA 4TLMB 5HPQA 2Y84A 4NF5A 1US5A 4KQPA 2O1MA 3MZ1A 4GRKA 3TUSA 1I6QA 4LQ5A 1QUIA 4ESWA 4IB2A 4YMAA 3VVDA 4POXA 1URSA 4Q30B 4MH5A 3V83A 5AA4A 3KJTA 3RTFB 4Q8RA 3T9VA 4EQBA 1T0KA 3RGYA 4PQJA 2E0SA 3R26A 4TLLB 3T96B 3W9VA 4EQ9A 3O66A 4FORA 2HEUA 1D9YA 2ONRA 3O2AA 5DVIA 1I6AA 4OZ9A 2XXXA 5DYHA 2H4IA 1B0HA 1NFTA 1FTMA 4ZEBA 1SQYA 4JWOA 4FJPA 4G8MA 4PFTA 5I2KB 2THIA 2QMWA 4ZEKA 4QSDA 4LATA 5K2YA 3CFZA 2Q8JA 2GH9A 2AIXA 3EN3A 1FCKA 2GHAA 2HAUA 4HCYA 1R1NA 4X1DA 3FVNA 1AMFA 1EH3A 1LFHA 4L17A 3K6XA 1MXVA 1BP5A 4LVQA 1B40A 2OJTA 4JWXA 2UVJA 1LFIA 1URDA 3TDJA 3IOWA 3MW0A 2OLBA 1FQBA 3C9HA 2QRYA 5KDTA 1B32A 3FXUA 3MVYA 3W15C 4KI0E 4HTGA 3LSFB 1UIUA 3EPEA 2A5TB 2VP1A 2D5WA 3RTWB 3C35A 5H8FB 1BKAA 1Z7NE 3K6VA 4QFNA 3FXQA 3LBSA 2BJJX 3PUXE 4KYSA 3S9NC 4ZZEA 4BDRA 4THIA 3K6WA 1NNFA 3TTKA 4ND9A 2Y7WA 3E4RA 1QW0A 3PMXA 4ESXA 5A5XB 1I69A 1AL3A 4F1VA 1LGBC 3VLUA 4RY1A 1LSTA 1IITA 2W7YA 2I4BA 1FW0A 4YB7A 1H3DA 2UYFA 4I62A 3UGWA 1OLAA 4LZ8A 1B1XA 4H0WA 2F5XA 2F7AA 4ZE8A 1O64A 4ZS9A 2AL5A 4E0WA 1IEJA 4IGRA 1DPPA 4QSCA 1H45A 3C4MA 4FATA 1BIYA 4YB6A 4DCXA 4EQ7A 2Z8DA 2ZXTA 3N5LA 3PUYE 4EF2A 3G3GA 4QFLA 4NWCA 1B4HA 3OEMA 3CSBA 3OXNA 4R72A 3IAZA 3M3LA 4O3BA 2I0CA 2UVIA 5HBCA 1SD3A 1SI1A 3K1PA 1IXCA 2DVCA 2UVGA 2F8DA 1Y1ZA 1SDXA 1B7ZA 4N6PA 4O3CA 3KG2A 2A5TA 5K2XA 3OMBA 2O1LA 3BKIB 3E3KA 4YZZA 1QJMA 4MFIA 3H3GA 3FVKA 4X9TA 5H8FA 3MQ9A 1JW1A 4GXAA 1AIVA 4F2QA 1SI0A 3KFMA 4DXBA 2REGA 4IGTA 3IOUA 5FHOA 1PDAA 5H8HB 3QUFA 3KGCA 1YPNA 2FYIA 4DDDA 5A5XA 2XXYA 2HXWA 2B3FA 4P0GA 1B46A 4FE8A 4F1YA 1UTBA 1MQDA 3CFLA 1MXWA 2I6EA 2V25A 1XS5A 3PMVA 3K01A 4OTEA 1EU8A 1DTGA 3A3CA 1LCFA 1SW5A 1M5DA 2V3QA 1GV8A 3G3JA 5L9OA 3M3KA 5CRYA 1Y3QA 3MWBA 4K3FA 5CBSA 2PBWA 3C31A 4OEUA 4F2OA 5BWJA 3UA8A 3ILTB 1NNTA 2XXUA 3PGFA 4H6DA 3QIMA 1YTVA 3T66A 4OERA 2HCAA 3BFUA 1LAXA 3LR1A 1Y20A 2O68A 5DVJA 4F39A 2QS3A 1LLSA 3O6IA 4YB5A 5I56B 4UA8A 4G8NA 4FIMA 3VE1B 2NUVA 1P1QA 1JETA 3TYHA 1VR5A 1FQDA 3O97A 1EZ9A 1DMBA 1LFGA 3PPQA 4JDFA 1IZ1A 1PBQA 3V5AA 3CG1A 3MVWA 2DXYA 4NWDA 4FECA 4EDPA 1B6HA 2F6PA 1MG1A 4XKQA 5DEXB 3C34A 1MY1A 2XD3A 2A5SA 4H5FA 5B70A 1QUJA 4Z0IA 5H8NA 4KYEA 1OVBA 3MAMA 5JTYB 3RT8A 2NOOA 1GTKA 4MLQA 3MVXA 2YJPA 3GLBA 3UORA 3E9XA 1L5TA 1ANFA 1B5HA 1N84A 2DWAA 4G2ZA 2HQ0A 5TP9B 2DS9A 3LC8A 3QSLA 4I8CA 2O7UA 4YKIA 1LBCA 1B05A 1YAEA 3PD8A 2O6AA 2X7QA 2DWJA 1WVJA 4RK9A 3VXCA 1JVYA 4ELQA 3IORA 2O84X 3T22A 1Q35A 4LP2B 3O6GA 5FHMA 1AH5A 4DXCA 3Q26A 3DP4A 3S9MC 4U4SA 4DLDA 4GOTA 5IAIA 3VXBA 3TKDA 2Y7IA 2I0BA 1MQHA 2RINA 5I56A 4RYAA 2NXOA 3MP1A 5TPAB 1NH7A 5I58B 3L6GA 1P1WA 4H8JA 4BDQA 4Z7EA 3PPRA 1MY3A 3LSXA 3PD9A 4R9FA 1EZOA 3BFTA 3V8XB 3H7MA 4IO4A 2XX9A 4KCDA 4EUOA 3SEVA 2F35A 1YCJA 4IO3A 2D21A 1B3HA 4BDMA 5CI5A 4GXSB 1SYHA 2XXPA 3FUZA 5JTYA 4FEBA 4KYDA 4H1XA 3P7IA 1MM6A 1OVTA 1LAHE 1VSOA 1IQ7A 3N6TA 3FGSA 1JEVA 4AB6A 3G3FA 5TP9A 4QFKA 4F29A 1ATGA 1Y4TA 4ZECA 1IXGA 2YLNA 1JW5A 1QUKA 3GXAA 4NE4A 2F6GA 2HFBA 1OMPA 3QYTA 4P0IA 5EHMA 1KWHA 3PUZE 2X26A 1DPEA 4WKMA 3VDFA 2F97A 3U92A 1B3FA 5DT6A 3G7WA 3IOTA 2QL3A 4JBZA 3OENA 1N0TA 1XVXA 4XKNA 3CVGA 3KSXA 4YAHX 2XXHA 1OIBA 5KCJB 3AXFA 2CMOA 1PEBA 4YMBA 4GQOA 2ZYMA 4C1UA 5FHNA 1B5IA 1Y4CA 4MLVA 4XKPA 3UIFA 3ZSFA 2ZNTA 1Q1KA 3O9PA 3HCQA 4EXKA 4F1UA 1IIWA 4PE5B 1SBPA 1R6ZA 3TMGA 1URGA 1B0LA 2DQVA 3JV9A 4NTLA 2Z8FA 3TELA 3PU5A 1B7UA 3CG3A 3K00A 2Q2CA 4GL8A 3B6TA 2QSXA 1B3GA 2H98A 5CMBA 3K1MA 1MY0A 1I6BA 2O51A 4XKRA 1QKBA 4DIGA 3A09A 1JNFA 1RYOA 3LUYA 2GFEA 1SYIA 5TU0A 3B6QA 1QULA 3FIRA 2F36A 2IA4A 2V3UA 1RYXA 2DYXA 2F7BA 5AE4A 2FA7A 4BDOA 4OFOA 5ICQA 5AA2B 3A3UA 1A54A 2PT1A 5I2KA 5LOMA 5CMCA 2NVUB 4PP0A 1XHYA 1B2HA 1EZPA 4KD5A 4ZDMA 2H5YA 3SKPA 4JWYA 5CC2A 2RKMA 1HSLA 1S7YA 2YPNA 1ZTYA 1O7TA 5ITOA 4DXUA 2Z23A 2G29A 1B1HA 3PV0E 4R75A 4OYVA 5KCJA 3E13X 1ZJLA 3U8QA 3GBAA 1N3WA 3RLFE 5KZTA 3H4ZA 2D3IA 5JK4A 1ZIUA 4TQUQ 3TPAA 1FQCA 2G93A 3KSJA 1BTJA 4IO7A 1WDNA 2Q9TA 4RXLA 4LQ2A 2P1SA 1M5EA 5I57B 3IB0A 4F22A 3EHUA 4U22A 3IB1A 1IXIA 2GRVA 3TQLA 4ZEDA 5ITPA 5ICTA 1POY1 5BUUA 5EYFA 3OO6A 3OOAA 1FTJA 3TTMA 4XTCQ 2Q2AA 3TODA 2RC8A 1CE2A 2R9JA 2B65A 3RPWA 4UACA 3K0VA 2ZMBA 3W9WA 5ISUA 3CIJA 1P1NA 4JXIA 1R9QA 4FEDA 2XXQA 3B6WA 2GHBA 4I1DA 1NMUA 3RN8A 4NEDA 1MH3A 3MZBA 5EHSA 4G8HA 1TFAA 2CZLA 3KJ7A 1Y1MA 4DZ1A 3MZ9A 4G68B 1HSEA 2ONSA 2VD2A 1USYH 3ONMA 3VLVA 4R6YA 3M8UA 3UP9A 1OLCA 1A99A 1A8FA 4OQOA 1MY4A 3VVEA 3K6UA 4BDLA 1R9LA 3T9UA 3U94A 4ECFA 3Q29A 4IY5A 4OFJA 4U21A 5CMMA 4F19A 1MQGA 2DXRA 1B52A 4U23A 3MP8A 4OETA 3CRBA 4F3PA 3MJNA 4GF8A 3JYRA 3SDFA 4MF3A 2ABHA 4OEVA 5M2VA 4LUBA 1II5A 1MXUA 3GBBA 2ALUA 2Y7RA 5DTBA 1NL5A 2VHAA 2O7IA 3TTRA 2AL4A 1JQFA 1TFDA 1UQWA 4HCWA 4KHZE 5I2NB 3EHTA 4GIZA 4RPNA 4PFUA 3QAXA 5L9SA 4GWOA 4DCYA 1P1UA 2F34A 1AOVA 3MP6A 2UVHA 5I57A 2XX8A 3O28A 1POTA 2XXTA 3N94A 3WAFA 4OVJA 3M3FA 4ONYA 3ZKLA 2Z22A 2RCBA 1A8EA 3HHFA 1ZMGA 2QS4A 3MBPA 4QHQA 3I5OA 1ELJA 4OESA 2OK2A 3N6UA 2DE3A 5H8HA 3KN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F11 A;  3UN6 A;  3FV1 A;  3O6H A;  1B3E A;  1MPC A;  3H06 B;  3QXM A;  2XXV A;  1RKM A;  3KN7 A;  3PUV E;  4Q5T A;  1PB8 A;  1OQH A;  2QJE A;  2PX1 A;  2Y7K A;  3U93 A;  3EQ1 A;  4C1T A;  1IUD A;  4N07 A;  3RY3 A;  4JB7 A;  3IK6 B;  4EXL A;  4QF9 A;  3TEP A;  1N7X A;  3FJ7 A;  2O69 A;  4NF8 B;  3KBR A;  4ISU A;  3C36 A;  3DEL B;  1N7W A;  3K1N A;  3D4G A;  2OWT A;  1MY2 A;  2HZK A;  1IXH A;  3USD A;  4NF6 B;  1DOT A;  1JVX A;  4YKP A;  2I48 A;  5JEI A;  2ONK E;  4G4P A;  2ESN A;  4QRZ A;  4OMB A;  4WXJ A;  3WAE A;  3IO4 A;  4F3B A;  1GGG A;  4DE8 A;  3OSR A;  3CR9 A;  5FTI A;  1PB7 A;  3H6V A;  4ZE9 A;  2DVZ A;  3OO8 A;  1FQF A;  3PPO A;  5L9M A;  5L8D A;  3TTL A;  3CSG A;  2P2A A;  1UTH B;  3G3H A;  4TOZ A;  5CBR A;  1MQJ A;  4R2F A;  3HN0 A;  5KDT B;  3TCG A;  3MPL A;  1LCT A;  2V93 A;  3I6V A;  3UK4 A;  3FVO A;  2H25 A;  5IKB A;  2E1S A;  2RC7 A;  1TXF A;  2H9B A;  1FQA A;  1LAF E;  2DOJ A;  3Q28 A;  1B51 A;  5DEX A;  1B58 A;  1Y9U A;  4ELR A;  3MUQ A;  2XHD A;  1CB6 A;  2Q88 A;  3TAJ A;  4F31 B;  2FNC A;  1M5B A;  5H8Q B;  3KN8 A;  4R6K A;  1FQE A;  1NKX A;  4GD5 A;  1J1N A;  4RJZ A;  1GVC A;  3OD7 A;  3DP6 A;  5AA1 A;  4E0X A;  2DWH A;  4M1V A;  3FJG A;  4NF8 A;  3VLW A;  2NWJ A;  5H8S A;  1SW2 A;  3HHG A;  1M5F A;  3FVG A;  4O3A A;  3IJO B;  3S9E A;  5AA3 A;  3Q27 A;  3FZV A;  1QKA A;  4IY6 A;  5HM4 B;  3H6W A;  1MS7 A;  4NF6 A;  3SER A;  3K02 A;  1PBP A;  2I49 A;  3QK6 A;  1MDQ A;  3I3V A;  3LSW A;  1MXY A;  4N13 A;  3IR1 A;  4U2R A;  1NH8 A;  4QFP A;  1LBB A;  3DLN A;  2V3T A;  1B9J A;  1O63 A;  5CMK A;  4RNS A;  1VFD A;  3N26 A;  1P99 A;  4R6H A;  1TWY A;  2VD3 A;  5DVF A;  1LB8 A;  3R6U A;  5J1D A;  4WEP A;  1UTH A;  4NF4 B;  3KEI A;  4P11 A;  5TPA A;  5I58 A;  3SEW A;  2XX7 A;  5B7D A;  1A40 A;  3GZG A;  4JSD A;  3TCF A;  4KCC A;  2R6G E;  2AYS A;  4I9D A;  2OWS A;  1LAG E;  3T9H B;  3VV5 A;  2RCA A;  4G77 A;  4LA9 A;  3RQT A;  1OQG A;  2I4C A;  4F3G A;  2VGQ A;  3U72 A;  1MPB A;  5F1Q A;  3T9X B;  4EF1 A;  4H65 A;  3SET A;  2F78 A;  4PET A;  2Y7P A;  3THI A;  5H8Q A;  3IL1 B;  4AB5 A;  3QUJ A;  1NNK A;  2DP8 A;  3RUM A;  1MH4 A;  2KLF A;  3FAT A;  3VFJ A;  3S4U A;  4LON B;  4OWD A;  3D4C A;  3MVZ A;  1MM7 A;  1UTB B;  2UYE A;  1B3L A;  3V89 B;  1FTK A;  4PFW A;  3OEK A;  4XIG Q;  3G3I A;  3IJX B;  4MBP A;  4X1B A;  1ZKB A;  2QS1 A;  4H67 A;  1PC3 A;  2HAV A;  2Q89 A;  4RA1 A;  2PMS A;  1XT8 A;  3OSQ A;  4H5G A;  2I3V A;  4PFY A;  3ODB A;  4GLI A;  3ZKK A;  4YKK A;  3DM0 A;  1S50 A;  2PT2 A;  4U4X A;  3ILU B;  1D9V A;  2M8C A;  4OEN A;  4YU0 A;  3HST A;  3EF7 A;  3G3K A;  3PPN A;  2H99 A;  2VOZ A;  3IX1 A;  1SW1 A;  1D4N A;  1VFE A;  3DP8 A;  1H76 A;  4ZEF A;  1JEU A;  4R73 A;  3KOS A;  2DWI A;  5ELV A;  3ECR A;  3BBR A;  2ZNS A;  1SVX B;  1Y3N A;  3TZA A;  4JSO A;  1A7L A;  4NF4 A;  2QPQ A;  3FV2 A;  1WOD A;  3K4U A;  4M4G A;  2PVU A;  4H8I A;  4NMY A;  2XXW A;  4IO2 A;  4IO6 A;  3VVF A;  5FTH A;  1ZU0 A;  3SEX A;  3L6H A;  1S9T A;  4BLA A;  3C33 A;  3O29 A;  1BLF A;  2UXA A;  4F18 A;  1MQI A;  4OFL A;  3FXR A;  2ZYN A;  4R9G A;  3PMW A;  1USY E;  1MRP A;  2HZL A;  2ZYO A;  1P1O A;  2REJ A;  5I84 A;  1MDP 1;  4GVO A;  5H8N B;  5AA2 A;  3OEL A;  2XXI A;  5I59 B;  3KZG A;  4IO5 A;  3Q25 A;  1Z7M E;  2LAO A;  4HS7 A;  4KR5 A;  2OZZ A;  3HO7 A;  2B3B A;  1N3X A;  1VE4 A;  2PYY A;  3U1O A;  2V84 A;  2RF1 A;  3PPP A;  3R7X A;  3SEY A;  4U1O A;  1DSN A;  2X7P A;  3FAS A;  4KFQ A;  3K2D A;  4AQ4 A;  3HPI A;  3OO9 A;  3TQW A;  3H6T A;  1D3K A;  1DTZ A;  4WED A;  1SW4 A;  3S2V A;  4OXV A;  2I58 A;  3FD3 A;  4QSE A;  3HV1 A;  3ZS6 A;  1XOC A;  1M5C A;  2WKY A;  3S9L C;  5CM6 A;  1US4 A;  2RC9 A;  2DE2 A;  4ZZA A;  3JZJ A;  2Z8E A;  1B7H A;  4NF5 B;  2XXR A;  2DSF A;  1XVY A;  1QVS A;  3SEU A;  1GR2 A;  3IOV A;  3MPK A;  3CI8 A;  1FTL A;  4LZ5 A;  4XXU A;  1H43 A;  4C0R A;  4POW A;  2OCU A;  5AA2 D;  2I3W A;  3RT6 B;  5F7V A;  5AA4 B;  4F3S A;  4KPT A;  4GFR A;  3H03 A;  4LZ7 A;  4QFO A;  3MC2 A;  2R71 A;  4G68 A;  2F7C A;  1ZBM A;  4ELP A;  1A55 A;  2QMX A;  4YIC A;  3TFL A;  3IB2 A;  5I59 A;  4OHN A;  1N76 A;  4G68 C;  3B7D A;  4ELO A;  3EHS A;  2DE4 A;  3IO6 A;  3KOT A;  1B4Z A;  4BDN A;  2ZNU A;  3OO7 A;  3H6U A;  1LB9 A;  1N04 A;  3FJM A;  4R74 A;  4X48 A;  1MXZ A;  4RK2 A;  1HSJ A;  4RPO A;  4Q0C A;  3T93 B;  4YKJ A;  3SES A;  3TCH A;  1Y3P A;  4ZEI A;  1NNP A;  1H44 A;  2ANJ A;  4U1Z A;  4FAJ A;  3C32 A;  3LSL A;  2QS2 A;  2P0S A;  5I2N A;  1ZLQ A;  4GL0 A;  1XC1 A;  1TT1 A;  4R2B A;  4HW8 A;  1UIV A;  2ZYK A;  1JW4 A;  2XD2 A;  2IEE A;  1FTO A;  1B5J A;  2OBG A;  3TTN A;  1F9B A;  3RNN A;  1PB9 A;  3CFX A;  1MXX A;  3PUW E;  1MPD A;  4TLM B;  5HPQ A;  2Y84 A;  4NF5 A;  1US5 A;  4KQP A;  2O1M A;  3MZ1 A;  4GRK A;  3TUS A;  1I6Q A;  4LQ5 A;  1QUI A;  4ESW A;  4IB2 A;  4YMA A;  3VVD A;  4POX A;  1URS A;  4Q30 B;  4MH5 A;  3V83 A;  5AA4 A;  3KJT A;  3RTF B;  4Q8R A;  3T9V A;  4EQB A;  1T0K A;  3RGY A;  4PQJ A;  2E0S A;  3R26 A;  4TLL B;  3T96 B;  3W9V A;  4EQ9 A;  3O66 A;  4FOR A;  2HEU A;  1D9Y A;  2ONR A;  3O2A A;  5DVI A;  1I6A A;  4OZ9 A;  2XXX A;  5DYH A;  2H4I A;  1B0H A;  1NFT A;  1FTM A;  4ZEB A;  1SQY A;  4JWO A;  4FJP A;  4G8M A;  4PFT A;  5I2K B;  2THI A;  2QMW A;  4ZEK A;  4QSD A;  4LAT A;  5K2Y A;  3CFZ A;  2Q8J A;  2GH9 A;  2AIX A;  3EN3 A;  1FCK A;  2GHA A;  2HAU A;  4HCY A;  1R1N A;  4X1D A;  3FVN A;  1AMF A;  1EH3 A;  1LFH A;  4L17 A;  3K6X A;  1MXV A;  1BP5 A;  4LVQ A;  1B40 A;  2OJT A;  4JWX A;  2UVJ A;  1LFI A;  1URD A;  3TDJ A;  3IOW A;  3MW0 A;  2OLB A;  1FQB A;  3C9H A;  2QRY A;  5KDT A;  1B32 A;  3FXU A;  3MVY A;  3W15 C;  4KI0 E;  4HTG A;  3LSF B;  1UIU A;  3EPE A;  2A5T B;  2VP1 A;  2D5W A;  3RTW B;  3C35 A;  5H8F B;  1BKA A;  1Z7N E;  3K6V A;  4QFN A;  3FXQ A;  3LBS A;  2BJJ X;  3PUX E;  4KYS A;  3S9N C;  4ZZE A;  4BDR A;  4THI A;  3K6W A;  1NNF A;  3TTK A;  4ND9 A;  2Y7W A;  3E4R A;  1QW0 A;  3PMX A;  4ESX A;  5A5X B;  1I69 A;  1AL3 A;  4F1V A;  1LGB C;  3VLU A;  4RY1 A;  1LST A;  1IIT A;  2W7Y A;  2I4B A;  1FW0 A;  4YB7 A;  1H3D A;  2UYF A;  4I62 A;  3UGW A;  1OLA A;  4LZ8 A;  1B1X A;  4H0W A;  2F5X A;  2F7A A;  4ZE8 A;  1O64 A;  4ZS9 A;  2AL5 A;  4E0W A;  1IEJ A;  4IGR A;  1DPP A;  4QSC A;  1H45 A;  3C4M A;  4FAT A;  1BIY A;  4YB6 A;  4DCX A;  4EQ7 A;  2Z8D A;  2ZXT A;  3N5L A;  3PUY E;  4EF2 A;  3G3G A;  4QFL A;  4NWC A;  1B4H A;  3OEM A;  3CSB A;  3OXN A;  4R72 A;  3IAZ A;  3M3L A;  4O3B A;  2I0C A;  2UVI A;  5HBC A;  1SD3 A;  1SI1 A;  3K1P A;  1IXC A;  2DVC A;  2UVG A;  2F8D A;  1Y1Z A;  1SDX A;  1B7Z A;  4N6P A;  4O3C A;  3KG2 A;  2A5T A;  5K2X A;  3OMB A;  2O1L A;  3BKI B;  3E3K A;  4YZZ A;  1QJM A;  4MFI A;  3H3G A;  3FVK A;  4X9T A;  5H8F A;  3MQ9 A;  1JW1 A;  4GXA A;  1AIV A;  4F2Q A;  1SI0 A;  3KFM A;  4DXB A;  2REG A;  4IGT A;  3IOU A;  5FHO A;  1PDA A;  5H8H B;  3QUF A;  3KGC A;  1YPN A;  2FYI A;  4DDD A;  5A5X A;  2XXY A;  2HXW A;  2B3F A;  4P0G A;  1B46 A;  4FE8 A;  4F1Y A;  1UTB A;  1MQD A;  3CFL A;  1MXW A;  2I6E A;  2V25 A;  1XS5 A;  3PMV A;  3K01 A;  4OTE A;  1EU8 A;  1DTG A;  3A3C A;  1LCF A;  1SW5 A;  1M5D A;  2V3Q A;  1GV8 A;  3G3J A;  5L9O A;  3M3K A;  5CRY A;  1Y3Q A;  3MWB A;  4K3F A;  5CBS A;  2PBW A;  3C31 A;  4OEU A;  4F2O A;  5BWJ A;  3UA8 A;  3ILT B;  1NNT A;  2XXU A;  3PGF A;  4H6D A;  3QIM A;  1YTV A;  3T66 A;  4OER A;  2HCA A;  3BFU A;  1LAX A;  3LR1 A;  1Y20 A;  2O68 A;  5DVJ A;  4F39 A;  2QS3 A;  1LLS A;  3O6I A;  4YB5 A;  5I56 B;  4UA8 A;  4G8N A;  4FIM A;  3VE1 B;  2NUV A;  1P1Q A;  1JET A;  3TYH A;  1VR5 A;  1FQD A;  3O97 A;  1EZ9 A;  1DMB A;  1LFG A;  3PPQ A;  4JDF A;  1IZ1 A;  1PBQ A;  3V5A A;  3CG1 A;  3MVW A;  2DXY A;  4NWD A;  4FEC A;  4EDP A;  1B6H A;  2F6P A;  1MG1 A;  4XKQ A;  5DEX B;  3C34 A;  1MY1 A;  2XD3 A;  2A5S A;  4H5F A;  5B70 A;  1QUJ A;  4Z0I A;  5H8N A;  4KYE A;  1OVB A;  3MAM A;  5JTY B;  3RT8 A;  2NOO A;  1GTK A;  4MLQ A;  3MVX A;  2YJP A;  3GLB A;  3UOR A;  3E9X A;  1L5T A;  1ANF A;  1B5H A;  1N84 A;  2DWA A;  4G2Z A;  2HQ0 A;  5TP9 B;  2DS9 A;  3LC8 A;  3QSL A;  4I8C A;  2O7U A;  4YKI A;  1LBC A;  1B05 A;  1YAE A;  3PD8 A;  2O6A A;  2X7Q A;  2DWJ A;  1WVJ A;  4RK9 A;  3VXC A;  1JVY A;  4ELQ A;  3IOR A;  2O84 X;  3T22 A;  1Q35 A;  4LP2 B;  3O6G A;  5FHM A;  1AH5 A;  4DXC A;  3Q26 A;  3DP4 A;  3S9M C;  4U4S A;  4DLD A;  4GOT A;  5IAI A;  3VXB A;  3TKD A;  2Y7I A;  2I0B A;  1MQH A;  2RIN A;  5I56 A;  4RYA A;  2NXO A;  3MP1 A;  5TPA B;  1NH7 A;  5I58 B;  3L6G A;  1P1W A;  4H8J A;  4BDQ A;  4Z7E A;  3PPR A;  1MY3 A;  3LSX A;  3PD9 A;  4R9F A;  1EZO A;  3BFT A;  3V8X B;  3H7M A;  4IO4 A;  2XX9 A;  4KCD A;  4EUO A;  3SEV A;  2F35 A;  1YCJ A;  4IO3 A;  2D21 A;  1B3H A;  4BDM A;  5CI5 A;  4GXS B;  1SYH A;  2XXP A;  3FUZ A;  5JTY A;  4FEB A;  4KYD A;  4H1X A;  3P7I A;  1MM6 A;  1OVT A;  1LAH E;  1VSO A;  1IQ7 A;  3N6T A;  3FGS A;  1JEV A;  4AB6 A;  3G3F A;  5TP9 A;  4QFK A;  4F29 A;  1ATG A;  1Y4T A;  4ZEC A;  1IXG A;  2YLN A;  1JW5 A;  1QUK A;  3GXA A;  4NE4 A;  2F6G A;  2HFB A;  1OMP A;  3QYT A;  4P0I A;  5EHM A;  1KWH A;  3PUZ E;  2X26 A;  1DPE A;  4WKM A;  3VDF A;  2F97 A;  3U92 A;  1B3F A;  5DT6 A;  3G7W A;  3IOT A;  2QL3 A;  4JBZ A;  3OEN A;  1N0T A;  1XVX A;  4XKN A;  3CVG A;  3KSX A;  4YAH X;  2XXH A;  1OIB A;  5KCJ B;  3AXF A;  2CMO A;  1PEB A;  4YMB A;  4GQO A;  2ZYM A;  4C1U A;  5FHN A;  1B5I A;  1Y4C A;  4MLV A;  4XKP A;  3UIF A;  3ZSF A;  2ZNT A;  1Q1K A;  3O9P A;  3HCQ A;  4EXK A;  4F1U A;  1IIW A;  4PE5 B;  1SBP A;  1R6Z A;  3TMG A;  1URG A;  1B0L A;  2DQV A;  3JV9 A;  4NTL A;  2Z8F A;  3TEL A;  3PU5 A;  1B7U A;  3CG3 A;  3K00 A;  2Q2C A;  4GL8 A;  3B6T A;  2QSX A;  1B3G A;  2H98 A;  5CMB A;  3K1M A;  1MY0 A;  1I6B A;  2O51 A;  4XKR A;  1QKB A;  4DIG A;  3A09 A;  1JNF A;  1RYO A;  3LUY A;  2GFE A;  1SYI A;  5TU0 A;  3B6Q A;  1QUL A;  3FIR A;  2F36 A;  2IA4 A;  2V3U A;  1RYX A;  2DYX A;  2F7B A;  5AE4 A;  2FA7 A;  4BDO A;  4OFO A;  5ICQ A;  5AA2 B;  3A3U A;  1A54 A;  2PT1 A;  5I2K A;  5LOM A;  5CMC A;  2NVU B;  4PP0 A;  1XHY A;  1B2H A;  1EZP A;  4KD5 A;  4ZDM A;  2H5Y A;  3SKP A;  4JWY A;  5CC2 A;  2RKM A;  1HSL A;  1S7Y A;  2YPN A;  1ZTY A;  1O7T A;  5ITO A;  4DXU A;  2Z23 A;  2G29 A;  1B1H A;  3PV0 E;  4R75 A;  4OYV A;  5KCJ A;  3E13 X;  1ZJL A;  3U8Q A;  3GBA A;  1N3W A;  3RLF E;  5KZT A;  3H4Z A;  2D3I A;  5JK4 A;  1ZIU A;  4TQU Q;  3TPA A;  1FQC A;  2G93 A;  3KSJ A;  1BTJ A;  4IO7 A;  1WDN A;  2Q9T A;  4RXL A;  4LQ2 A;  2P1S A;  1M5E A;  5I57 B;  3IB0 A;  4F22 A;  3EHU A;  4U22 A;  3IB1 A;  1IXI A;  2GRV A;  3TQL A;  4ZED A;  5ITP A;  5ICT A;  1POY 1;  5BUU A;  5EYF A;  3OO6 A;  3OOA A;  1FTJ A;  3TTM A;  4XTC Q;  2Q2A A;  3TOD A;  2RC8 A;  1CE2 A;  2R9J A;  2B65 A;  3RPW A;  4UAC A;  3K0V A;  2ZMB A;  3W9W A;  5ISU A;  3CIJ A;  1P1N A;  4JXI A;  1R9Q A;  4FED A;  2XXQ A;  3B6W A;  2GHB A;  4I1D A;  1NMU A;  3RN8 A;  4NED A;  1MH3 A;  3MZB A;  5EHS A;  4G8H A;  1TFA A;  2CZL A;  3KJ7 A;  1Y1M A;  4DZ1 A;  3MZ9 A;  4G68 B;  1HSE A;  2ONS A;  2VD2 A;  1USY H;  3ONM A;  3VLV A;  4R6Y A;  3M8U A;  3UP9 A;  1OLC A;  1A99 A;  1A8F A;  4OQO A;  1MY4 A;  3VVE A;  3K6U A;  4BDL A;  1R9L A;  3T9U A;  3U94 A;  4ECF A;  3Q29 A;  4IY5 A;  4OFJ A;  4U21 A;  5CMM A;  4F19 A;  1MQG A;  2DXR A;  1B52 A;  4U23 A;  3MP8 A;  4OET A;  3CRB A;  4F3P A;  3MJN A;  4GF8 A;  3JYR A;  3SDF A;  4MF3 A;  2ABH A;  4OEV A;  5M2V A;  4LUB A;  1II5 A;  1MXU A;  3GBB A;  2ALU A;  2Y7R A;  5DTB A;  1NL5 A;  2VHA A;  2O7I A;  3TTR A;  2AL4 A;  1JQF A;  1TFD A;  1UQW A;  4HCW A;  4KHZ E;  5I2N B;  3EHT A;  4GIZ A;  4RPN A;  4PFU A;  3QAX A;  5L9S A;  4GWO A;  4DCY A;  1P1U A;  2F34 A;  1AOV A;  3MP6 A;  2UVH A;  5I57 A;  2XX8 A;  3O28 A;  1POT A;  2XXT A;  3N94 A;  3WAF A;  4OVJ A;  3M3F A;  4ONY A;  3ZKL A;  2Z22 A;  2RCB A;  1A8E A;  3HHF A;  1ZMG A;  2QS4 A;  3MBP A;  4QHQ A;  3I5O A;  1ELJ A;  4OES A;  2OK2 A;  3N6U A;  2DE3 A;  5H8H A;  3KN3 A; 
#chains in the Genus database with same CATH topology
 3F11 A;  4I40 A;  3UN6 A;  3FV1 A;  4JVC A;  3O6H A;  1B3E A;  1MPC A;  1LEV A;  5ESY A;  3H06 B;  3QXM A;  2XXV A;  1RKM A;  3KN7 A;  3PUV E;  4MNI A;  4Q5T A;  1PB8 A;  4NN3 A;  2WYP A;  1OQH A;  2QJE A;  2PX1 A;  2Y7K A;  4PAF A;  3U93 A;  3EQ1 A;  4C1T A;  1IUD A;  4N07 A;  3RY3 A;  4JB7 A;  3IK6 B;  4EXL A;  4QF9 A;  3TEP A;  1N7X A;  5A5L A;  3FJ7 A;  2O69 A;  4NF8 B;  4X04 A;  3KBR A;  4ISU A;  3C36 A;  3DEL B;  4OVS A;  1N7W A;  3K1N A;  3D4G A;  2OWT A;  1MY2 A;  3A29 A;  2HZK A;  1IXH A;  3USD A;  1IMB A;  1DOT A;  4NF6 B;  1JVX A;  4YKP A;  2I48 A;  1EYK A;  5JEI A;  2ONK E;  4G4P A;  2ESN A;  4QRZ A;  4OMB A;  4WXJ A;  3WAE A;  3IO4 A;  5EQ7 A;  4F3B A;  1GGG A;  4DE8 A;  3OSR A;  3CR9 A;  5FTI A;  2L5V A;  1PB7 A;  3H6V A;  4PAK A;  4ZE9 A;  4HE0 A;  2DVZ A;  3OO8 A;  1FQF A;  3PPO A;  5L9M A;  5L8D A;  3MYU A;  3TTL A;  3CSG A;  2P2A A;  1UTH B;  3G3H A;  4TOZ A;  5CBR A;  2FIX A;  1MQJ A;  4R2F A;  3HN0 A;  5KDT B;  3TCG A;  3MPL A;  1LCT A;  2V93 A;  3I6V A;  3UK4 A;  3FVO A;  2H25 A;  5IKB A;  4PC9 A;  2OX3 A;  1QGX A;  2E1S A;  2RC7 A;  1TXF A;  2H9B A;  1FQA A;  1LAF E;  2DOJ A;  3Q28 A;  1JP4 A;  1B51 A;  5DEX A;  1B58 A;  2BJI A;  1Y9U A;  1IMC A;  4ELR A;  5I7I A;  3MUQ A;  2XHD A;  2ZZV A;  1CB6 A;  2Q88 A;  3TAJ A;  4F31 B;  2FNC A;  1FPI A;  1M5B A;  5H8Q B;  3KN8 A;  4R6K A;  1FQE A;  1NKX A;  4GD5 A;  1J1N A;  4RJZ A;  1GVC A;  1LBX A;  3OD7 A;  3DP6 A;  1NV3 A;  5AA1 A;  4E0X A;  2DWH A;  4M1V A;  3FJG A;  4NX1 A;  4NF8 A;  3VLW A;  2NWJ A;  5H8S A;  1SW2 A;  3HHG A;  1M5F A;  3FVG A;  3ISP A;  4O3A A;  4N91 A;  3IJO B;  4MNP A;  3S9E A;  5AA3 A;  3Q27 A;  3FZV A;  1QKA A;  4IY6 A;  5HM4 B;  3H6W A;  1MS7 A;  4NF6 A;  3SER A;  3K02 A;  1PBP A;  2I49 A;  5LDZ A;  3QK6 A;  4OVT A;  1MDQ A;  3I3V A;  3LSW A;  1MXY A;  4N13 A;  3FBP A;  3IR1 A;  4U2R A;  1NH8 A;  4QFP A;  1LBB A;  3DLN A;  2V3T A;  1B9J A;  2CZH A;  1O63 A;  5CMK A;  4RNS A;  1IME A;  1VFD A;  3N26 A;  1FRP A;  1P99 A;  4R6H A;  1TWY A;  2VD3 A;  4OVR A;  5DVF A;  1LB8 A;  3R6U A;  4PBQ A;  5J1D A;  4WEP A;  1UTH A;  4NF4 B;  3KEI A;  4P11 A;  5TPA A;  5I58 A;  3SEW A;  2XX7 A;  5B7D A;  1A40 A;  3GZG A;  4JSD A;  3TCF A;  4KCC A;  4N8G A;  4OA4 A;  2R6G E;  1IMA A;  2AYS A;  2CZI A;  4I9D A;  2OWS A;  1LAG E;  3T9H B;  3VV5 A;  2RCA A;  4G77 A;  4LA9 A;  3RQT A;  1OQG A;  2I4C A;  4F3G A;  2VGQ A;  3U72 A;  4MMP A;  1MPB A;  5F1Q A;  3T9X B;  4EF1 A;  3KC1 A;  4H65 A;  3SET A;  2F78 A;  4GX3 A;  4PET A;  2Y7P A;  3IL1 B;  5H8Q A;  3THI A;  4AB5 A;  3QUJ A;  1NNK A;  2DP8 A;  1FPL A;  3RUM A;  1MH4 A;  2KLF A;  3FAT A;  3VFJ A;  3EKI A;  4P8B A;  4PTK A;  3S4U A;  4LON B;  4OWD A;  4N15 A;  3D4C A;  2KR0 A;  3MVZ A;  1MM7 A;  1UTB B;  2UYE A;  1B3L A;  3V89 B;  1BK4 A;  1FTK A;  4PFW A;  3OEK A;  4XIG Q;  3G3I A;  3IJX B;  4MBP A;  4X1B A;  1ZKB A;  1FPK A;  2QS1 A;  4PGN A;  1RDX A;  1NI9 A;  4H67 A;  1DBZ A;  1PC3 A;  2HAV A;  5ET6 A;  2Q89 A;  4RA1 A;  2PMS A;  4PBH A;  1XT8 A;  3OSQ A;  4H5G A;  2I3V A;  4PFY A;  3ODB A;  4GLI A;  4GBV A;  1FJ9 A;  3ZKK A;  4YKK A;  3DM0 A;  1S50 A;  2PT2 A;  4U4X A;  3ILU B;  1D9V A;  2M8C A;  4OEN A;  4YU0 A;  2P3N A;  3HST A;  3EF7 A;  3PPN A;  3G3K A;  2H99 A;  2VOZ A;  3IX1 A;  1SW1 A;  1D4N A;  1VFE A;  3DP8 A;  1H76 A;  4ZEF A;  5EYG A;  1JEU A;  4R73 A;  3KOS A;  2DWI A;  5ELV A;  3ECR A;  3BBR A;  2ZNS A;  1SVX B;  1Y3N A;  3TZA A;  4JSO A;  1A7L A;  4NF4 A;  2QPQ A;  3FV2 A;  1WOD A;  3K4U A;  4M4G A;  4O8M A;  1K9Y A;  2PVU A;  4H8I A;  1NV0 A;  4NMY A;  2XXW A;  2HXR A;  4IO2 A;  4IO6 A;  3VVF A;  4PF6 A;  5FTH A;  4QXD A;  1ZU0 A;  1NV4 A;  3SEX A;  3L6H A;  1S9T A;  4BLA A;  3C33 A;  3O29 A;  4GWU A;  1BLF A;  2UXA A;  4F18 A;  1MQI A;  4OFL A;  3FXR A;  2ZYN A;  3E78 A;  4R9G A;  3PMW A;  1USY E;  1MRP A;  2HZL A;  3MST A;  4MHF A;  2ZYO A;  1P1O A;  2REJ A;  5I84 A;  1MDP 1;  4GVO A;  5H8N B;  5AA2 A;  2WEF A;  3OEL A;  2XXI A;  5I59 B;  3KZG A;  4IO5 A;  3Q25 A;  1Z7M E;  2Q74 A;  2LAO A;  4HS7 A;  5IM2 A;  4KR5 A;  2OZZ A;  1IMD A;  3HO7 A;  2B3B A;  2Q8M A;  1N3X A;  2R8T A;  1VE4 A;  2PYY A;  4UAB A;  3U1O A;  2V84 A;  2RF1 A;  2XWK A;  3PPP A;  4N17 A;  3R7X A;  3SEY A;  4U1O A;  2QVV A;  2WBB A;  1FPG A;  1DSN A;  4MJO A;  2X7P A;  3FAS A;  4KFQ A;  3K2D A;  4AQ4 A;  3HPI A;  3OO9 A;  3TQW A;  3H6T A;  1D3K A;  1LBY A;  1DTZ A;  3U65 A;  4P47 A;  4WED A;  1SW4 A;  3S2V A;  1FBH A;  4OXV A;  2I58 A;  3FD3 A;  4QSE A;  1FPB A;  5IZZ A;  3HV1 A;  3ZS6 A;  1XOC A;  2KQZ A;  1M5C A;  2WKY A;  3S9L C;  1FSA A;  5CM6 A;  1US4 A;  2RC9 A;  2WBD A;  2DE2 A;  4ZZA A;  3JZJ A;  1FTA A;  2Z8E A;  1B7H A;  4H45 A;  4NF5 B;  2XXR A;  2DSF A;  3B50 A;  1XVY A;  1NUY A;  1QVS A;  3SEU A;  1GR2 A;  3IOV A;  4QBA A;  1NUX A;  3MPK A;  3CI8 A;  1FTL A;  4LZ5 A;  4DI4 B;  4XXU A;  1H43 A;  4C0R A;  4POW A;  2OCU A;  5AA2 D;  2I3W A;  3RT6 B;  5F7V A;  5AA4 B;  4F3S A;  4KPT A;  4GFR A;  3H03 A;  4LZ7 A;  4QFO A;  3MC2 A;  2R71 A;  4P3L A;  4G68 A;  2F7C A;  1ZBM A;  4ELP A;  1A55 A;  2QMX A;  2PCR A;  4YIC A;  3TFL A;  3IB2 A;  5I59 A;  4OHN A;  1N76 A;  4G68 C;  3B7D A;  4ELO A;  3EHS A;  2DE4 A;  3IO6 A;  3KOT A;  1B4Z A;  4BDN A;  2ZNU A;  3OO7 A;  4NF0 A;  3H6U A;  1LB9 A;  1N04 A;  2CEX A;  3FJM A;  4R74 A;  4X48 A;  4PFR A;  1MXZ A;  4RK2 A;  1HSJ A;  4RPO A;  4Q0C A;  3T93 B;  4YKJ A;  3SES A;  3TCH A;  1Y3P A;  4ZEI A;  1NNP A;  1H44 A;  4GWY A;  4NGU A;  2ANJ A;  4U1Z A;  4FAJ A;  3C32 A;  3LSL A;  3HFU A;  2QS2 A;  2P0S A;  2CEY A;  5I2N A;  1ZLQ A;  4GL0 A;  1XC1 A;  1TT1 A;  2JJK A;  4R2B A;  1IMF A;  4HW8 A;  1UIV A;  4P1L A;  2ZYK A;  4N6D A;  1JW4 A;  2XD2 A;  2IEE A;  1FTO A;  4HE1 A;  5ET7 A;  1B5J A;  1DCU A;  2OBG A;  3TTN A;  2GQ1 A;  1F9B A;  3RNN A;  1PB9 A;  4HXV A;  3CFX A;  1MXX A;  3PUW E;  1MPD A;  4TLM B;  5HPQ A;  2Y84 A;  1FBG A;  1NV7 A;  4PGP A;  4NF5 A;  1US5 A;  1LBZ A;  4KQP A;  2O1M A;  3MZ1 A;  4GRK A;  3TUS A;  1I6Q A;  5LTC A;  4LQ5 A;  1QUI A;  4GX6 A;  1DK4 A;  4ESW A;  4IB2 A;  4YMA A;  3VVD A;  4POX A;  1URS A;  4Q30 B;  4MH5 A;  3V83 A;  5AA4 A;  3KJT A;  3RTF B;  4Q8R A;  4MCO A;  3T9V A;  1NUW A;  4EQB A;  1T0K A;  3RGY A;  4PQJ A;  2E0S A;  3R26 A;  2VPO A;  4TLL B;  3T96 B;  3W9V A;  4EQ9 A;  3O66 A;  4FOR A;  2HEU A;  1D9Y A;  2DDK A;  2ONR A;  3T0J A;  3O2A A;  2V4C A;  5DVI A;  1I6A A;  4OZ9 A;  2XXX A;  5DYH A;  2H4I A;  1B0H A;  1NFT A;  1FTM A;  2P3V A;  4ZEB A;  1SQY A;  4JWO A;  4FJP A;  4G8M A;  4PFT A;  4MIJ A;  1D9Q A;  3E79 A;  5I2K B;  2THI A;  2QMW A;  4ZEK A;  4QSD A;  4LAT A;  5K2Y A;  3CFZ A;  2Q8J A;  2GH9 A;  3IFC A;  2AIX A;  3EN3 A;  1FCK A;  2GHA A;  2HAU A;  4HCY A;  1R1N A;  4X1D A;  3FVN A;  1FPF A;  1AMF A;  1EH3 A;  1FBF A;  4N4U A;  1LFH A;  4L17 A;  3K6X A;  1MXV A;  1BP5 A;  4LVQ A;  4OAN A;  1B40 A;  2OJT A;  4JWX A;  2UVJ A;  1LFI A;  1URD A;  3TDJ A;  3IOW A;  3MW0 A;  4O94 A;  2OLB A;  1FQB A;  3C9H A;  2QRY A;  5KDT A;  1B32 A;  2B4M A;  3FXU A;  3MVY A;  3W15 C;  4KI0 E;  4HTG A;  3LSF B;  4PDD A;  1UIU A;  2VPN A;  3EPE A;  2A5T B;  3ROJ A;  4HE2 A;  2VP1 A;  1Q9D A;  2D5W A;  3RTW B;  3C35 A;  5H8F B;  1BKA A;  1Z7N E;  4QFN A;  3K6V A;  3FXQ A;  3LBS A;  2BJJ X;  3PUX E;  4KYS A;  3S9N C;  4ZZE A;  4BDR A;  4AS4 A;  2QVR A;  4THI A;  3K6W A;  1NNF A;  3TTK A;  2ZZX A;  4ND9 A;  4I3Y A;  5IZ1 A;  2Y7W A;  3E4R A;  1QW0 A;  3PMX A;  4P9K A;  4ESX A;  5A5X B;  1I69 A;  1AL3 A;  4F1V A;  1LGB C;  3VLU A;  4RY1 A;  1LST A;  1IIT A;  2W7Y A;  2I4B A;  1FW0 A;  4YB7 A;  5EQ8 A;  1H3D A;  1G0H A;  2UYF A;  4I62 A;  4KXP A;  5IZ3 B;  3UGW A;  1OLA A;  4LZ8 A;  1B1X A;  2PFY A;  4H0W A;  2F5X A;  2F7A A;  4ZE8 A;  1O64 A;  4ZS9 A;  2AL5 A;  4E0W A;  1IEJ A;  4IGR A;  1DPP A;  4QSC A;  1H45 A;  3C4M A;  4FAT A;  1BIY A;  4YB6 A;  4DCX A;  4EQ7 A;  2Z8D A;  2ZXT A;  3N5L A;  3PUY E;  4PFB A;  4EF2 A;  3G3G A;  3KBZ A;  3LUZ A;  4QFL A;  4NWC A;  1B4H A;  3OEM A;  3CSB A;  3OXN A;  3RYD A;  4R72 A;  3IAZ A;  3M3L A;  4O3B A;  2I0C A;  2UVI A;  5HBC A;  1SD3 A;  1SI1 A;  3K1P A;  3RPL B;  1IXC A;  2DVC A;  2UVG A;  2F8D A;  1Y1Z A;  1SDX A;  1B7Z A;  5I5P A;  4N6P A;  4O3C A;  3KG2 A;  2A5T A;  5K2X A;  3OMB A;  2O1L A;  3BKI B;  3E3K A;  4YZZ A;  1QJM A;  4MFI A;  3H3G A;  3FVK A;  4X9T A;  5H8F A;  3MQ9 A;  1JW1 A;  4GXA A;  1FBD A;  1AIV A;  4F2Q A;  1VDW A;  1SI0 A;  4NQ8 A;  3KFM A;  4DXB A;  2REG A;  4NAP A;  4IGT A;  3IOU A;  5FHO A;  1PDA A;  3NOH A;  1KZ8 A;  5H8H B;  3QUF A;  3KGC A;  1YPN A;  2FYI A;  4DDD A;  5A5X A;  1G0I A;  2XXY A;  2HXW A;  2B3F A;  4P0G A;  2XWI A;  4XEQ A;  1B46 A;  1EYJ A;  5DW8 A;  1KA1 A;  4FE8 A;  4PAI A;  4F1Y A;  1UTB A;  1YXI A;  1MQD A;  3CFL A;  1MXW A;  2I6E A;  2V25 A;  1XS5 A;  3PMV A;  1EYI A;  3K01 A;  4XF5 A;  4OTE A;  1EU8 A;  4MEV A;  1DTG A;  3A3C A;  1LCF A;  1SW5 A;  1M5D A;  2V3Q A;  1GV8 A;  3G3J A;  5L9O A;  3M3K A;  4P56 A;  5CRY A;  1Y3Q A;  3MWB A;  4K3F A;  5CBS A;  2PBW A;  3C31 A;  4OEU A;  4F2O A;  5BWJ A;  3UA8 A;  2HPG A;  3ILT B;  4P1E A;  1NNT A;  2XXU A;  3PGF A;  4H6D A;  3QIM A;  2XWO A;  1YTV A;  3T66 A;  4OER A;  2HCA A;  3BFU A;  3RPL A;  1LAX A;  3LR1 A;  1Y20 A;  5EYH A;  2O68 A;  4OVQ A;  5DVJ A;  3D1R A;  4F39 A;  2QS3 A;  1LLS A;  3O6I A;  4YB5 A;  5I56 B;  4UA8 A;  4G8N A;  1YYZ A;  4X8R A;  4FIM A;  3VE1 B;  2NUV A;  1P1Q A;  1JET A;  3TYH A;  1VR5 A;  1FQD A;  1SPI A;  4LN5 A;  3O97 A;  1EZ9 A;  1DMB A;  1LFG A;  3PPQ A;  4JDF A;  1IZ1 A;  1PBQ A;  3V5A A;  3CG1 A;  3MVW A;  2DXY A;  4NWD A;  4FEC A;  1FPE A;  4EDP A;  1B6H A;  2F6P A;  1MG1 A;  4XKQ A;  5DEX B;  3C34 A;  1MY1 A;  4NHB A;  2XD3 A;  2A5S A;  4H5F A;  1QUJ A;  4Z0I A;  5B70 A;  5H8N A;  4KYE A;  1OVB A;  3MAM A;  5JTY B;  3RT8 A;  2NOO A;  1GTK A;  4MLQ A;  3MVX A;  5T3J A;  2YJP A;  3GLB A;  3UOR A;  3E9X A;  1L5T A;  1FPD A;  1ANF A;  1B5H A;  4GX4 A;  1N84 A;  1FPJ A;  2DWA A;  2Y5L A;  4G2Z A;  2CZK A;  2HQ0 A;  5TP9 B;  2DS9 A;  3LC8 A;  3QSL A;  5J16 A;  4I8C A;  2O7U A;  4YKI A;  1LBC A;  1B05 A;  1YAE A;  3PD8 A;  2O6A A;  2X7Q A;  2DWJ A;  1FJ6 A;  1WVJ A;  4N6K A;  4RK9 A;  3VXC A;  1JVY A;  4ELQ A;  3IOR A;  4PE3 A;  2O84 X;  3T22 A;  4PF8 A;  1Q35 A;  4LP2 B;  3O6G A;  5FHM A;  2ZZW A;  1AH5 A;  4DXC A;  3Q26 A;  3DP4 A;  3S9M C;  4U4S A;  2FBP A;  4IR8 A;  1FBE A;  4DLD A;  4GOT A;  5IAI A;  3VXB A;  3TKD A;  2Y7I A;  2I0B A;  5ET8 A;  1MQH A;  2RIN A;  5I56 A;  5ET5 A;  4RYA A;  2B4L A;  2NXO A;  3MP1 A;  5TPA B;  1NH7 A;  2FHY A;  5I58 B;  3L6G A;  1P1W A;  1FBC A;  4H8J A;  4BDQ A;  4Z7E A;  3PPR A;  2PFZ A;  1MY3 A;  2WX9 A;  4JVD A;  3LSX A;  3PD9 A;  4MX6 A;  4O7I A;  4R9F A;  1EZO A;  3BFT A;  3V8X B;  3H7M A;  4IO4 A;  3LV0 A;  2XX9 A;  4KCD A;  4EUO A;  3SEV A;  2F35 A;  4I3E A;  1YCJ A;  4IO3 A;  2D21 A;  1B3H A;  1FBP A;  4BDM A;  1NV6 A;  5CI5 A;  4GXS B;  4N81 A;  1SYH A;  2XXP A;  3FUZ A;  5JTY A;  4FEB A;  4AS5 A;  4KYD A;  1NUZ A;  4H1X A;  2F3D A;  5F24 A;  3P7I A;  1MM6 A;  1OVT A;  1LAH E;  1VSO A;  1IQ7 A;  3N6T A;  3FGS A;  1JEV A;  4AB6 A;  3BIG A;  3G3F A;  5TP9 A;  4QFK A;  4F29 A;  1ATG A;  1Y4T A;  4ZEC A;  1IXG A;  2YLN A;  1JW5 A;  1QUK A;  1YZ0 A;  2VT5 A;  3GXA A;  4NE4 A;  3CHG A;  2F6G A;  2HFB A;  1OMP A;  3QYT A;  4P0I A;  5EHM A;  1KWH A;  1NV5 A;  3PUZ E;  1AWB A;  2X26 A;  1DPE A;  4WKM A;  3VDF A;  2F97 A;  3U92 A;  1B3F A;  5DT6 A;  3G7W A;  3IOT A;  2QL3 A;  4JBZ A;  3OEN A;  1N0T A;  1XVX A;  4XKN A;  3CVG A;  3KSX A;  4YAH X;  2XXH A;  1OIB A;  5KCJ B;  1XI6 A;  3AXF A;  2CMO A;  1PEB A;  2FVZ A;  3GYY A;  4GWZ A;  4H46 A;  4YMB A;  4GQO A;  4XFE A;  2ZYM A;  4C1U A;  5FHN A;  1B5I A;  1Y4C A;  4MLV A;  4XKP A;  3UIF A;  2HHM A;  3ZSF A;  2ZNT A;  1Q1K A;  3O9P A;  3HCQ A;  4O7M A;  4EXK A;  4MAG A;  4F1U A;  1IIW A;  4PE5 B;  1SBP A;  3QMF A;  1R6Z A;  4OVP A;  5EQA A;  3TMG A;  1URG A;  1B0L A;  2DQV A;  3JV9 A;  2XXK A;  4NTL A;  2Z8F A;  3TEL A;  3PU5 A;  1B7U A;  3CG3 A;  3K00 A;  2Q2C A;  4GL8 A;  3B6T A;  2QSX A;  1B3G A;  2H98 A;  5CMB A;  3K1M A;  1MY0 A;  1I6B A;  2O51 A;  4XKR A;  1QKB A;  4DIG A;  3A09 A;  1JNF A;  2Y5K A;  1RYO A;  3LUY A;  4FBP A;  2GFE A;  1SYI A;  5TU0 A;  3B6Q A;  1QUL A;  3FIR A;  4N8Y A;  2F36 A;  2IA4 A;  2V3U A;  4GWX A;  1RYX A;  2DYX A;  2F7B A;  5AE4 A;  2FA7 A;  2OWZ A;  4BDO A;  4OFO A;  5ICQ A;  4NG7 A;  5AA2 B;  3A3U A;  1A54 A;  2PT1 A;  5I2K A;  1KA0 A;  3B8B A;  5LOM A;  5CMC A;  4MNC A;  2NVU B;  4PP0 A;  1XHY A;  1B2H A;  1EZP A;  4KD5 A;  4ZDM A;  2QVU A;  2H5Y A;  2F3B A;  3SKP A;  4JWY A;  5CC2 A;  2RKM A;  1HSL A;  1S7Y A;  2MKZ A;  2YPN A;  1ZTY A;  1O7T A;  5ITO A;  4DXU A;  2Z23 A;  2G29 A;  1B1H A;  3PV0 E;  4R75 A;  4OYV A;  5KCJ A;  3E13 X;  1ZJL A;  3U8Q A;  3GBA A;  1N3W A;  3RLF E;  5KZT A;  3KC0 A;  4GWW A;  5FBP A;  3H4Z A;  2D3I A;  5JK4 A;  1ZIU A;  4TQU Q;  3TPA A;  1LBW A;  1FQC A;  2G93 A;  3KSJ A;  1BTJ A;  4IO7 A;  1WDN A;  2Q9T A;  4RXL A;  4LQ2 A;  2P1S A;  1M5E A;  5I57 B;  3IB0 A;  4F22 A;  3EHU A;  4U22 A;  1RDY A;  3IB1 A;  1IXI A;  2GRV A;  3TQL A;  4G61 A;  4ZED A;  5ITP A;  4GBW A;  4DI3 D;  1NV1 A;  5ICT A;  1POY 1;  5BUU A;  5EYF A;  3OO6 A;  3OOA A;  5I3S A;  1FTJ A;  3TTM A;  4XTC Q;  3FXB A;  2Q2A A;  3TOD A;  2RC8 A;  1CE2 A;  2R9J A;  2XA5 A;  2B65 A;  3RPW A;  4UAC A;  3K0V A;  2ZMB A;  3PTY A;  3W9W A;  5ISU A;  3CIJ A;  1P1N A;  4JXI A;  1R9Q A;  4FED A;  2XXQ A;  3B6W A;  3T1B A;  2GHB A;  4I1D A;  1NMU A;  3RN8 A;  4NED A;  1MH3 A;  3MZB A;  5EHS A;  5IZ3 A;  4G8H A;  1TFA A;  2CZL A;  3KJ7 A;  4PDH A;  1Y1M A;  4DZ1 A;  3BIH A;  3MZ9 A;  4G68 B;  1HSE A;  2ONS A;  4PCD A;  2VD2 A;  1USY H;  3ONM A;  3VLV A;  4R6Y A;  3M8U A;  3UP9 A;  1OLC A;  1A99 A;  1A8F A;  4OQO A;  1MY4 A;  3VVE A;  3K6U A;  3SZP A;  4BDL A;  1R9L A;  3T9U A;  3U94 A;  4ECF A;  3Q29 A;  4IY5 A;  4OFJ A;  4U21 A;  5CMM A;  4F19 A;  1MQG A;  2DXR A;  1B52 A;  2XWV A;  4U23 A;  3MP8 A;  4OET A;  3CRB A;  4F3P A;  3MJN A;  4GF8 A;  3JYR A;  3SDF A;  4MF3 A;  1INP A;  2ABH A;  4OEV A;  5M2V A;  4PFI A;  1II5 A;  4LUB A;  1MXU A;  3GBB A;  2ALU A;  2Y7R A;  1CNQ A;  5DTB A;  4GWS A;  1NL5 A;  2VHA A;  2O7I A;  3TTR A;  2AL4 A;  1JQF A;  1TFD A;  2FIE A;  1UQW A;  4HCW A;  4KHZ E;  5I2N B;  3EHT A;  4GIZ A;  4RPN A;  4PFU A;  3QAX A;  5L9S A;  4GWO A;  4DCY A;  2QFL A;  1P1U A;  2F34 A;  1K9Z A;  1AOV A;  3MP6 A;  2UVH A;  5I57 A;  2XX8 A;  1NV2 A;  4JVI A;  3O28 A;  1POT A;  1RDZ A;  2XXT A;  5IGA A;  3N94 A;  3WAF A;  4OVJ A;  3M3F A;  4ONY A;  3ZKL A;  2Z22 A;  1LBV A;  2RCB A;  1A8E A;  3HHF A;  1ZMG A;  2QS4 A;  3MBP A;  2WYK A;  4QHQ A;  3IFA A;  3I5O A;  1ELJ A;  4OES A;  2OK2 A;  5EQ9 A;  3N6U A;  2DE3 A;  5H8H A;  3KN3 A; 
#chains in the Genus database with same CATH homology
 3F11 A;  3UN6 A;  3FV1 A;  3O6H A;  1B3E A;  1MPC A;  3H06 B;  3QXM A;  2XXV A;  1RKM A;  3KN7 A;  3PUV E;  4Q5T A;  1PB8 A;  1OQH A;  2QJE A;  2PX1 A;  2Y7K A;  3U93 A;  3EQ1 A;  4C1T A;  1IUD A;  4N07 A;  3RY3 A;  4JB7 A;  3IK6 B;  4EXL A;  4QF9 A;  3TEP A;  1N7X A;  3FJ7 A;  2O69 A;  4NF8 B;  3KBR A;  4ISU A;  3C36 A;  3DEL B;  1N7W A;  3K1N A;  3D4G A;  2OWT A;  1MY2 A;  2HZK A;  1IXH A;  3USD A;  4NF6 B;  1DOT A;  1JVX A;  4YKP A;  2I48 A;  5JEI A;  2ONK E;  4G4P A;  2ESN A;  4QRZ A;  4OMB A;  4WXJ A;  3WAE A;  3IO4 A;  4F3B A;  1GGG A;  4DE8 A;  3OSR A;  3CR9 A;  5FTI A;  1PB7 A;  3H6V A;  4ZE9 A;  2DVZ A;  3OO8 A;  1FQF A;  3PPO A;  5L9M A;  5L8D A;  3TTL A;  3CSG A;  2P2A A;  1UTH B;  3G3H A;  4TOZ A;  5CBR A;  1MQJ A;  4R2F A;  3HN0 A;  5KDT B;  3TCG A;  3MPL A;  1LCT A;  2V93 A;  3I6V A;  3UK4 A;  3FVO A;  2H25 A;  5IKB A;  2E1S A;  2RC7 A;  1TXF A;  2H9B A;  1FQA A;  1LAF E;  2DOJ A;  3Q28 A;  1B51 A;  5DEX A;  1B58 A;  1Y9U A;  4ELR A;  3MUQ A;  2XHD A;  1CB6 A;  2Q88 A;  3TAJ A;  4F31 B;  2FNC A;  1M5B A;  5H8Q B;  3KN8 A;  4R6K A;  1FQE A;  1NKX A;  4GD5 A;  1J1N A;  4RJZ A;  1GVC A;  3OD7 A;  3DP6 A;  5AA1 A;  4E0X A;  2DWH A;  4M1V A;  3FJG A;  4NF8 A;  3VLW A;  2NWJ A;  5H8S A;  1SW2 A;  3HHG A;  1M5F A;  3FVG A;  4O3A A;  3IJO B;  3S9E A;  5AA3 A;  3Q27 A;  3FZV A;  1QKA A;  4IY6 A;  5HM4 B;  3H6W A;  1MS7 A;  4NF6 A;  3SER A;  3K02 A;  1PBP A;  2I49 A;  3QK6 A;  1MDQ A;  3I3V A;  3LSW A;  1MXY A;  4N13 A;  3IR1 A;  4U2R A;  1NH8 A;  4QFP A;  1LBB A;  3DLN A;  2V3T A;  1B9J A;  1O63 A;  5CMK A;  4RNS A;  1VFD A;  3N26 A;  1P99 A;  4R6H A;  1TWY A;  2VD3 A;  5DVF A;  1LB8 A;  3R6U A;  5J1D A;  4WEP A;  1UTH A;  4NF4 B;  3KEI A;  4P11 A;  5TPA A;  5I58 A;  3SEW A;  2XX7 A;  5B7D A;  1A40 A;  3GZG A;  4JSD A;  3TCF A;  4KCC A;  2R6G E;  2AYS A;  4I9D A;  2OWS A;  1LAG E;  3T9H B;  3VV5 A;  2RCA A;  4G77 A;  4LA9 A;  3RQT A;  1OQG A;  2I4C A;  4F3G A;  2VGQ A;  3U72 A;  1MPB A;  5F1Q A;  3T9X B;  4EF1 A;  4H65 A;  3SET A;  2F78 A;  4PET A;  2Y7P A;  3THI A;  5H8Q A;  3IL1 B;  4AB5 A;  3QUJ A;  1NNK A;  2DP8 A;  3RUM A;  1MH4 A;  2KLF A;  3FAT A;  3VFJ A;  3S4U A;  4LON B;  4OWD A;  3D4C A;  3MVZ A;  1MM7 A;  1UTB B;  2UYE A;  1B3L A;  3V89 B;  1FTK A;  4PFW A;  3OEK A;  4XIG Q;  3G3I A;  3IJX B;  4MBP A;  4X1B A;  1ZKB A;  2QS1 A;  4H67 A;  1PC3 A;  2HAV A;  2Q89 A;  4RA1 A;  2PMS A;  1XT8 A;  3OSQ A;  4H5G A;  2I3V A;  4PFY A;  3ODB A;  4GLI A;  3ZKK A;  4YKK A;  3DM0 A;  1S50 A;  2PT2 A;  4U4X A;  3ILU B;  1D9V A;  2M8C A;  4OEN A;  4YU0 A;  3HST A;  3EF7 A;  3G3K A;  3PPN A;  2H99 A;  2VOZ A;  3IX1 A;  1SW1 A;  1D4N A;  1VFE A;  3DP8 A;  1H76 A;  4ZEF A;  1JEU A;  4R73 A;  3KOS A;  2DWI A;  5ELV A;  3ECR A;  3BBR A;  2ZNS A;  1SVX B;  1Y3N A;  3TZA A;  4JSO A;  1A7L A;  4NF4 A;  2QPQ A;  3FV2 A;  1WOD A;  3K4U A;  4M4G A;  2PVU A;  4H8I A;  4NMY A;  2XXW A;  4IO2 A;  4IO6 A;  3VVF A;  5FTH A;  1ZU0 A;  3SEX A;  3L6H A;  1S9T A;  4BLA A;  3C33 A;  3O29 A;  1BLF A;  2UXA A;  4F18 A;  1MQI A;  4OFL A;  3FXR A;  2ZYN A;  4R9G A;  3PMW A;  1USY E;  1MRP A;  2HZL A;  2ZYO A;  1P1O A;  2REJ A;  5I84 A;  1MDP 1;  4GVO A;  5H8N B;  5AA2 A;  3OEL A;  2XXI A;  5I59 B;  3KZG A;  4IO5 A;  3Q25 A;  1Z7M E;  2LAO A;  4HS7 A;  4KR5 A;  2OZZ A;  3HO7 A;  2B3B A;  1N3X A;  1VE4 A;  2PYY A;  3U1O A;  2V84 A;  2RF1 A;  3PPP A;  3R7X A;  3SEY A;  4U1O A;  1DSN A;  2X7P A;  3FAS A;  4KFQ A;  3K2D A;  4AQ4 A;  3HPI A;  3OO9 A;  3TQW A;  3H6T A;  1D3K A;  1DTZ A;  4WED A;  1SW4 A;  3S2V A;  4OXV A;  2I58 A;  3FD3 A;  4QSE A;  3HV1 A;  3ZS6 A;  1XOC A;  1M5C A;  2WKY A;  3S9L C;  5CM6 A;  1US4 A;  2RC9 A;  2DE2 A;  4ZZA A;  3JZJ A;  2Z8E A;  1B7H A;  4NF5 B;  2XXR A;  2DSF A;  1XVY A;  1QVS A;  3SEU A;  1GR2 A;  3IOV A;  3MPK A;  3CI8 A;  1FTL A;  4LZ5 A;  4XXU A;  1H43 A;  4C0R A;  4POW A;  2OCU A;  5AA2 D;  2I3W A;  3RT6 B;  5F7V A;  5AA4 B;  4F3S A;  4KPT A;  4GFR A;  3H03 A;  4LZ7 A;  4QFO A;  3MC2 A;  2R71 A;  4G68 A;  2F7C A;  1ZBM A;  4ELP A;  1A55 A;  2QMX A;  4YIC A;  3TFL A;  3IB2 A;  5I59 A;  4OHN A;  1N76 A;  4G68 C;  3B7D A;  4ELO A;  3EHS A;  2DE4 A;  3IO6 A;  3KOT A;  1B4Z A;  4BDN A;  2ZNU A;  3OO7 A;  3H6U A;  1LB9 A;  1N04 A;  3FJM A;  4R74 A;  4X48 A;  1MXZ A;  4RK2 A;  1HSJ A;  4RPO A;  4Q0C A;  3T93 B;  4YKJ A;  3SES A;  3TCH A;  1Y3P A;  4ZEI A;  1NNP A;  1H44 A;  2ANJ A;  4U1Z A;  4FAJ A;  3C32 A;  3LSL A;  2QS2 A;  2P0S A;  5I2N A;  1ZLQ A;  4GL0 A;  1XC1 A;  1TT1 A;  4R2B A;  4HW8 A;  1UIV A;  2ZYK A;  1JW4 A;  2XD2 A;  2IEE A;  1FTO A;  1B5J A;  2OBG A;  3TTN A;  1F9B A;  3RNN A;  1PB9 A;  3CFX A;  1MXX A;  3PUW E;  1MPD A;  4TLM B;  5HPQ A;  2Y84 A;  4NF5 A;  1US5 A;  4KQP A;  2O1M A;  3MZ1 A;  4GRK A;  3TUS A;  1I6Q A;  4LQ5 A;  1QUI A;  4ESW A;  4IB2 A;  4YMA A;  3VVD A;  4POX A;  1URS A;  4Q30 B;  4MH5 A;  3V83 A;  5AA4 A;  3KJT A;  3RTF B;  4Q8R A;  3T9V A;  4EQB A;  1T0K A;  3RGY A;  4PQJ A;  2E0S A;  3R26 A;  4TLL B;  3T96 B;  3W9V A;  4EQ9 A;  3O66 A;  4FOR A;  2HEU A;  1D9Y A;  2ONR A;  3O2A A;  5DVI A;  1I6A A;  4OZ9 A;  2XXX A;  5DYH A;  2H4I A;  1B0H A;  1NFT A;  1FTM A;  4ZEB A;  1SQY A;  4JWO A;  4FJP A;  4G8M A;  4PFT A;  5I2K B;  2THI A;  2QMW A;  4ZEK A;  4QSD A;  4LAT A;  5K2Y A;  3CFZ A;  2Q8J A;  2GH9 A;  2AIX A;  3EN3 A;  1FCK A;  2GHA A;  2HAU A;  4HCY A;  1R1N A;  4X1D A;  3FVN A;  1AMF A;  1EH3 A;  1LFH A;  4L17 A;  3K6X A;  1MXV A;  1BP5 A;  4LVQ A;  1B40 A;  2OJT A;  4JWX A;  2UVJ A;  1LFI A;  1URD A;  3TDJ A;  3IOW A;  3MW0 A;  2OLB A;  1FQB A;  3C9H A;  2QRY A;  5KDT A;  1B32 A;  3FXU A;  3MVY A;  3W15 C;  4KI0 E;  4HTG A;  3LSF B;  1UIU A;  3EPE A;  2A5T B;  2VP1 A;  2D5W A;  3RTW B;  3C35 A;  5H8F B;  1BKA A;  1Z7N E;  3K6V A;  4QFN A;  3FXQ A;  3LBS A;  2BJJ X;  3PUX E;  4KYS A;  3S9N C;  4ZZE A;  4BDR A;  4THI A;  3K6W A;  1NNF A;  3TTK A;  4ND9 A;  2Y7W A;  3E4R A;  1QW0 A;  3PMX A;  4ESX A;  5A5X B;  1I69 A;  1AL3 A;  4F1V A;  1LGB C;  3VLU A;  4RY1 A;  1LST A;  1IIT A;  2W7Y A;  2I4B A;  1FW0 A;  4YB7 A;  1H3D A;  2UYF A;  4I62 A;  3UGW A;  1OLA A;  4LZ8 A;  1B1X A;  4H0W A;  2F5X A;  2F7A A;  4ZE8 A;  1O64 A;  4ZS9 A;  2AL5 A;  4E0W A;  1IEJ A;  4IGR A;  1DPP A;  4QSC A;  1H45 A;  3C4M A;  4FAT A;  1BIY A;  4YB6 A;  4DCX A;  4EQ7 A;  2Z8D A;  2ZXT A;  3N5L A;  3PUY E;  4EF2 A;  3G3G A;  4QFL A;  4NWC A;  1B4H A;  3OEM A;  3CSB A;  3OXN A;  4R72 A;  3IAZ A;  3M3L A;  4O3B A;  2I0C A;  2UVI A;  5HBC A;  1SD3 A;  1SI1 A;  3K1P A;  1IXC A;  2DVC A;  2UVG A;  2F8D A;  1Y1Z A;  1SDX A;  1B7Z A;  4N6P A;  4O3C A;  3KG2 A;  2A5T A;  5K2X A;  3OMB A;  2O1L A;  3BKI B;  3E3K A;  4YZZ A;  1QJM A;  4MFI A;  3H3G A;  3FVK A;  4X9T A;  5H8F A;  3MQ9 A;  1JW1 A;  4GXA A;  1AIV A;  4F2Q A;  1SI0 A;  3KFM A;  4DXB A;  2REG A;  4IGT A;  3IOU A;  5FHO A;  1PDA A;  5H8H B;  3QUF A;  3KGC A;  1YPN A;  2FYI A;  4DDD A;  5A5X A;  2XXY A;  2HXW A;  2B3F A;  4P0G A;  1B46 A;  4FE8 A;  4F1Y A;  1UTB A;  1MQD A;  3CFL A;  1MXW A;  2I6E A;  2V25 A;  1XS5 A;  3PMV A;  3K01 A;  4OTE A;  1EU8 A;  1DTG A;  3A3C A;  1LCF A;  1SW5 A;  1M5D A;  2V3Q A;  1GV8 A;  3G3J A;  5L9O A;  3M3K A;  5CRY A;  1Y3Q A;  3MWB A;  4K3F A;  5CBS A;  2PBW A;  3C31 A;  4OEU A;  4F2O A;  5BWJ A;  3UA8 A;  3ILT B;  1NNT A;  2XXU A;  3PGF A;  4H6D A;  3QIM A;  1YTV A;  3T66 A;  4OER A;  2HCA A;  3BFU A;  1LAX A;  3LR1 A;  1Y20 A;  2O68 A;  5DVJ A;  4F39 A;  2QS3 A;  1LLS A;  3O6I A;  4YB5 A;  5I56 B;  4UA8 A;  4G8N A;  4FIM A;  3VE1 B;  2NUV A;  1P1Q A;  1JET A;  3TYH A;  1VR5 A;  1FQD A;  3O97 A;  1EZ9 A;  1DMB A;  1LFG A;  3PPQ A;  4JDF A;  1IZ1 A;  1PBQ A;  3V5A A;  3CG1 A;  3MVW A;  2DXY A;  4NWD A;  4FEC A;  4EDP A;  1B6H A;  2F6P A;  1MG1 A;  4XKQ A;  5DEX B;  3C34 A;  1MY1 A;  2XD3 A;  2A5S A;  4H5F A;  5B70 A;  1QUJ A;  4Z0I A;  5H8N A;  4KYE A;  1OVB A;  3MAM A;  5JTY B;  3RT8 A;  2NOO A;  1GTK A;  4MLQ A;  3MVX A;  2YJP A;  3GLB A;  3UOR A;  3E9X A;  1L5T A;  1ANF A;  1B5H A;  1N84 A;  2DWA A;  4G2Z A;  2HQ0 A;  5TP9 B;  2DS9 A;  3LC8 A;  3QSL A;  4I8C A;  2O7U A;  4YKI A;  1LBC A;  1B05 A;  1YAE A;  3PD8 A;  2O6A A;  2X7Q A;  2DWJ A;  1WVJ A;  4RK9 A;  3VXC A;  1JVY A;  4ELQ A;  3IOR A;  2O84 X;  3T22 A;  1Q35 A;  4LP2 B;  3O6G A;  5FHM A;  1AH5 A;  4DXC A;  3Q26 A;  3DP4 A;  3S9M C;  4U4S A;  4DLD A;  4GOT A;  5IAI A;  3VXB A;  3TKD A;  2Y7I A;  2I0B A;  1MQH A;  2RIN A;  5I56 A;  4RYA A;  2NXO A;  3MP1 A;  5TPA B;  1NH7 A;  5I58 B;  3L6G A;  1P1W A;  4H8J A;  4BDQ A;  4Z7E A;  3PPR A;  1MY3 A;  3LSX A;  3PD9 A;  4R9F A;  1EZO A;  3BFT A;  3V8X B;  3H7M A;  4IO4 A;  2XX9 A;  4KCD A;  4EUO A;  3SEV A;  2F35 A;  1YCJ A;  4IO3 A;  2D21 A;  1B3H A;  4BDM A;  5CI5 A;  4GXS B;  1SYH A;  2XXP A;  3FUZ A;  5JTY A;  4FEB A;  4KYD A;  4H1X A;  3P7I A;  1MM6 A;  1OVT A;  1LAH E;  1VSO A;  1IQ7 A;  3N6T A;  3FGS A;  1JEV A;  4AB6 A;  3G3F A;  5TP9 A;  4QFK A;  4F29 A;  1ATG A;  1Y4T A;  4ZEC A;  1IXG A;  2YLN A;  1JW5 A;  1QUK A;  3GXA A;  4NE4 A;  2F6G A;  2HFB A;  1OMP A;  3QYT A;  4P0I A;  5EHM A;  1KWH A;  3PUZ E;  2X26 A;  1DPE A;  4WKM A;  3VDF A;  2F97 A;  3U92 A;  1B3F A;  5DT6 A;  3G7W A;  3IOT A;  2QL3 A;  4JBZ A;  3OEN A;  1N0T A;  1XVX A;  4XKN A;  3CVG A;  3KSX A;  4YAH X;  2XXH A;  1OIB A;  5KCJ B;  3AXF A;  2CMO A;  1PEB A;  4YMB A;  4GQO A;  2ZYM A;  4C1U A;  5FHN A;  1B5I A;  1Y4C A;  4MLV A;  4XKP A;  3UIF A;  3ZSF A;  2ZNT A;  1Q1K A;  3O9P A;  3HCQ A;  4EXK A;  4F1U A;  1IIW A;  4PE5 B;  1SBP A;  1R6Z A;  3TMG A;  1URG A;  1B0L A;  2DQV A;  3JV9 A;  4NTL A;  2Z8F A;  3TEL A;  3PU5 A;  1B7U A;  3CG3 A;  3K00 A;  2Q2C A;  4GL8 A;  3B6T A;  2QSX A;  1B3G A;  2H98 A;  5CMB A;  3K1M A;  1MY0 A;  1I6B A;  2O51 A;  4XKR A;  1QKB A;  4DIG A;  3A09 A;  1JNF A;  1RYO A;  3LUY A;  2GFE A;  1SYI A;  5TU0 A;  3B6Q A;  1QUL A;  3FIR A;  2F36 A;  2IA4 A;  2V3U A;  1RYX A;  2DYX A;  2F7B A;  5AE4 A;  2FA7 A;  4BDO A;  4OFO A;  5ICQ A;  5AA2 B;  3A3U A;  1A54 A;  2PT1 A;  5I2K A;  5LOM A;  5CMC A;  2NVU B;  4PP0 A;  1XHY A;  1B2H A;  1EZP A;  4KD5 A;  4ZDM A;  2H5Y A;  3SKP A;  4JWY A;  5CC2 A;  2RKM A;  1HSL A;  1S7Y A;  2YPN A;  1ZTY A;  1O7T A;  5ITO A;  4DXU A;  2Z23 A;  2G29 A;  1B1H A;  3PV0 E;  4R75 A;  4OYV A;  5KCJ A;  3E13 X;  1ZJL A;  3U8Q A;  3GBA A;  1N3W A;  3RLF E;  5KZT A;  3H4Z A;  2D3I A;  5JK4 A;  1ZIU A;  4TQU Q;  3TPA A;  1FQC A;  2G93 A;  3KSJ A;  1BTJ A;  4IO7 A;  1WDN A;  2Q9T A;  4RXL A;  4LQ2 A;  2P1S A;  1M5E A;  5I57 B;  3IB0 A;  4F22 A;  3EHU A;  4U22 A;  3IB1 A;  1IXI A;  2GRV A;  3TQL A;  4ZED A;  5ITP A;  5ICT A;  1POY 1;  5BUU A;  5EYF A;  3OO6 A;  3OOA A;  1FTJ A;  3TTM A;  4XTC Q;  2Q2A A;  3TOD A;  2RC8 A;  1CE2 A;  2R9J A;  2B65 A;  3RPW A;  4UAC A;  3K0V A;  2ZMB A;  3W9W A;  5ISU A;  3CIJ A;  1P1N A;  4JXI A;  1R9Q A;  4FED A;  2XXQ A;  3B6W A;  2GHB A;  4I1D A;  1NMU A;  3RN8 A;  4NED A;  1MH3 A;  3MZB A;  5EHS A;  4G8H A;  1TFA A;  2CZL A;  3KJ7 A;  1Y1M A;  4DZ1 A;  3MZ9 A;  4G68 B;  1HSE A;  2ONS A;  2VD2 A;  1USY H;  3ONM A;  3VLV A;  4R6Y A;  3M8U A;  3UP9 A;  1OLC A;  1A99 A;  1A8F A;  4OQO A;  1MY4 A;  3VVE A;  3K6U A;  4BDL A;  1R9L A;  3T9U A;  3U94 A;  4ECF A;  3Q29 A;  4IY5 A;  4OFJ A;  4U21 A;  5CMM A;  4F19 A;  1MQG A;  2DXR A;  1B52 A;  4U23 A;  3MP8 A;  4OET A;  3CRB A;  4F3P A;  3MJN A;  4GF8 A;  3JYR A;  3SDF A;  4MF3 A;  2ABH A;  4OEV A;  5M2V A;  4LUB A;  1II5 A;  1MXU A;  3GBB A;  2ALU A;  2Y7R A;  5DTB A;  1NL5 A;  2VHA A;  2O7I A;  3TTR A;  2AL4 A;  1JQF A;  1TFD A;  1UQW A;  4HCW A;  4KHZ E;  5I2N B;  3EHT A;  4GIZ A;  4RPN A;  4PFU A;  3QAX A;  5L9S A;  4GWO A;  4DCY A;  1P1U A;  2F34 A;  1AOV A;  3MP6 A;  2UVH A;  5I57 A;  2XX8 A;  3O28 A;  1POT A;  2XXT A;  3N94 A;  3WAF A;  4OVJ A;  3M3F A;  4ONY A;  3ZKL A;  2Z22 A;  2RCB A;  1A8E A;  3HHF A;  1ZMG A;  2QS4 A;  3MBP A;  4QHQ A;  3I5O A;  1ELJ A;  4OES A;  2OK2 A;  3N6U A;  2DE3 A;  5H8H A;  3KN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...