1B1XA

Structure of diferric mare lactoferrin at 2.62a resolution
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
b'APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACTOFERRIN
publication title Three-dimensional structure of mare diferric lactoferrin at 2.6 A resolution.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA03
4F1VA 2I3WA 3MP6A 2Y7PA 1SW4A 3CFZA 4GD5A 3W9VA 1BTJA 3G3JA 4N6PA 4F2OA 1NNFA 3EN3A 1JQFA 1H44A 3JZJA 1A54A 4OTEA 4PFWA 1PEBA 4JDFA 2HZKA 4YMBA 4I62A 1UTBB 4P0GA 3TPAA 2QS1A 1GVCA 4YICA 1SW2A 1FQAA 5FHMA 1ZTYA 3UA8A 3EF7A 4IO4A 3K01A 3KZGA 1XVXA 1US4A 2H5YA 2F7BA 3EHSA 5H8NB 4F1YA 4DDDA 4PFUA 2Z8DA 2DP8A 2Q8JA 1B52A 5CMMA 5DEXA 4RPNA 2HEUA 4F22A 4C0RA 3ILUB 3CSGA 4OERA 1PB9A 1URSA 5LOMA 1YPNA 3IB0A 2V25A 2ZXTA 2GFEA 4KPTA 3MC2A 3M3KA 3UK4A 2RC9A 2VGQA 3C33A 5CMCA 2DVZA 2XD3A 2HAVA 3TUSA 1XHYA 4QFLA 3V8XB 2W7YA 4ZEKA 1P1OA 3K1PA 3K4UA 3Q27A 3V5AA 3FASA 4F1UA 1VFDA 2PT1A 2UYEA 3C32A 4U4XA 3TQLA 1B7ZA 3HHFA 5I2NA 1FTLA 3E3KA 4F29A 1H43A 1II5A 2IA4A 1MH4A 3I5OA 4JSOA 2O1LA 3RLFE 2DXYA 3TZAA 1QUJA 2ESNA 4G68C 1IXCA 4FORA 4C1UA 3FVOA 3PUYE 2P2AA 3H4ZA 3EHUA 3PMWA 4IO5A 2AL5A 1EZOA 1HSLA 1A40A 4R6KA 3TMGA 1SW1A 1HSJA 3T66A 4ZE8A 4OZ9A 2XXUA 3T9UA 1PBPA 3TAJA 5KCJB 2HQ0A 1H45A 2XX9A 1B4HA 3SEUA 3O9PA 5EHMA 1Y4TA 4DZ1A 2QRYA 3FGSA 5CC2A 4H1XA 5I58B 1SVXB 4TOZA 3DP4A 2V3UA 1CE2A 1EZ9A 3O28A 2FYIA 2UVGA 4FE8A 1VFEA 5I56A 1MM6A 3D4CA 4R2FA 1QKBA 1ELJA 3A3CA 5ITOA 1VR5A 4RXLA 4G8MA 4ZZEA 1N84A 5F1QA 5AA2D 3FVKA 4MF3A 4H5FA 3K0VA 2O7UA 3IO6A 1B40A 3O2AA 3LC8A 4DXUA 1DSNA 4DCYA 3FJMA 4YB6A 4GVOA 3BKIB 1I6AA 3MZ9A 5EYFA 3IX1A 3IK6B 5HPQA 1UTHB 4ZS9A 4PQJA 3TCFA 1MDQA 4LZ8A 4LP2B 3TKDA 4DXCA 3CG3A 1MG1A 1MQHA 3SKPA 2O1MA 4LUBA 4G68A 4IO7A 3USDA 1B58A 4EDPA 1IXHA 1EU8A 3UN6A 3QSLA 3HO7A 4BDLA 1FTJA 1POY1 2ANJA 3LSLA 3T96B 1UIVA 4WEPA 1OIBA 1VSOA 4LONB 1ZKBA 1QKAA 5FHOA 2RC8A 4LQ5A 4GL0A 1OLCA 3O6GA 1AL3A 3K02A 4OEVA 1B5HA 4GLIA 4BDQA 1AH5A 5HBCA 4ELRA 1TT1A 1R6ZA 3VV5A 5H8FB 4F3SA 2O6AA 1P99A 2VD3A 2V3QA 3UORA 1B7UA 1MH3A 3VVFA 1MXZA 1PC3A 2YPNA 2QPQA 4OVJA 4R75A 4JB7A 2XXQA 4X1DA 1NNKA 2GRVA 1XVYA 4F39A 3RNNA 1JEVA 2DWJA 4IO6A 1WVJA 4R6HA 5DVFA 2RF1A 1IXIA 2I0BA 4MLQA 4LQ2A 2XX7A 4Q8RA 2ONKE 2F7AA 2NOOA 2GHBA 2UVIA 2F6PA 1SBPA 1SYHA 1A7LA 2QS2A 3TODA 4G2ZA 2ZMBA 1Y9UA 3MP1A 3TELA 2NXOA 3R6UA 2D3IA 4IY5A 4GRKA 3TTLA 3HV1A 2XXPA 2A5SA 3VLWA 4RA1A 3KN3A 5I59A 1DMBA 4EF1A 3HCQA 5K2XA 2OK2A 3S9LC 4THIA 4PP0A 4F3GA 4RPOA 4AB5A 3C34A 1B3HA 5I57B 3DELB 5I2KB 4EQ9A 1QUIA 4BDOA 2O7IA 4QFOA 4R2BA 2X7QA 4OESA 3IO4A 3UP9A 2OZZA 2HAUA 5AA3A 1FCKA 5ICQA 3ILTB 2Y7IA 3KN7A 2X26A 1M5BA 2ZYKA 3R7XA 1M5EA 2Y7KA 3RQTA 1R9QA 3MJNA 1VE4A 4DXBA 1Y4CA 2Z8FA 4NEDA 1Z7ME 1ANFA 4ELOA 3RPWA 4F3BA 4YB7A 2DVCA 1MXXA 1JEUA 3A09A 2ZYNA 1PBQA 1IXGA 4KCDA 3MQ9A 4YZZA 3IB1A 5ICTA 4WKMA 4DIGA 3BBRA 4N13A 5CBRA 3S9EA 1NMUA 3H06B 3IOWA 2DS9A 3EHTA 1O64A 4O3AA 4ONYA 4XKNA 1N76A 4FJPA 5DTBA 5CM6A 3AXFA 2OWTA 1NNTA 2Z8EA 1SDXA 4I1DA 4YKJA 1A8FA 1R9LA 3H6TA 3QK6A 1TFDA 4UA8A 3T9VA 1MXWA 2RCBA 3IJOB 1WDNA 3K1NA 4NF5A 1B0LA 4ESXA 4RNSA 4ELQA 1LB8A 1MDP1 3KJ7A 3CFXA 3VVDA 3VFJA 2ONSA 3MAMA 3UIFA 3C31A 1B51A 2I4BA 3SETA 4GL8A 2XHDA 4R9GA 2OCUA 4IO3A 3IJXB 2ALUA 4TQUQ 3TYHA 4OHNA 1D4NA 4YB5A 2G29A 1FQEA 3LUYA 3L6GA 3T22A 2QL3A 4F19A 3RGYA 4G8NA 3QAXA 4HCYA 2A5TA 2F7CA 1M5DA 2Y7RA 3CG1A 4QHQA 4Q0CA 3KOTA 3IL1B 4JWOA 4NF6B 4JXIA 1OLAA 4NF8B 2I6EA 4IY6A 4OFJA 5B7DA 3M3LA 3SDFA 1MPCA 4ZZAA 1N7XA 3MZBA 4ZECA 3RT6B 1FQCA 3MUQA 5JTYB 1H76A 4R6YA 1IZ1A 1GR2A 1JW1A 2DE3A 3TCGA 5TPAB 4XIGQ 1MY2A 3OELA 5DVIA 1BLFA 3E4RA 2XXWA 4R72A 4QFNA 2DE4A 4FEDA 2DWHA 3KSJA 4YKIA 3H3GA 3MP8A 4QSDA 1MQGA 1MY0A 4R9FA 1MY1A 4MLVA 5H8HA 2HXWA 4PFYA 2GH9A 5KDTB 3PD8A 3W15C 2VD2A 5TP9B 3HPIA 2ONRA 4BLAA 3TTRA 1Y20A 4ND9A 5CMKA 1QW0A 1SD3A 4OFOA 1TWYA 4EQ7A 1N0TA 1NKXA 3IAZA 3TCHA 3T93B 3HHGA 4KCCA 3QUFA 4OYVA 1QJMA 4H8JA 3OMBA 1MXUA 2VP1A 4GXAA 1FW0A 3DP6A 2D5WA 4G8HA 2UYFA 3ZSFA 4QSEA 4G77A 3ODBA 2IEEA 4OXVA 4P11A 4C1TA 1I69A 3FXRA 4H5GA 5AA4B 2XXRA 3LSWA 4NF4A 1MPDA 5H8QA 2R71A 1T0KA 2PBWA 1PB8A 3MVYA 3VE1B 1B3FA 1ZMGA 4RY1A 3DLNA 2X7PA 4KYDA 1R1NA 3U92A 3SEYA 4MH5A 3CRBA 1F9BA 3ECRA 3KN8A 4MBPA 1FQDA 2VOZA 3G3FA 1B5JA 1AIVA 2HFBA 2DE2A 3PGFA 3D4GA 4TLLB 3Q29A 4LZ7A 2F97A 1ZIUA 1B3GA 1NFTA 4X9TA 2UVHA 3FXQA 2Q89A 2AYSA 4N07A 3CIJA 4E0XA 1Y3QA 3S9MC 1ZLQA 5K2YA 2THIA 2PMSA 1Y1ZA 4ZDMA 1B05A 3S4UA 2DOJA 1Q1KA 1XOCA 2OWSA 5CBSA 2GHAA 1SI0A 1B32A 4YKKA 3RN8A 3C9HA 1NH8A 5DYHA 2E1SA 3KBRA 3T9XB 1MS7A 3W9WA 1MPBA 2I49A 4XTCQ 3VXCA 3GZGA 4KR5A 3N94A 3OO8A 2ZYOA 4FECA 4YU0A 2RKMA 1UTBA 4U1OA 4H67A 4NMYA 1RYXA 4F2QA 1ZJLA 4ZEBA 3VVEA 1P1NA 5ELVA 3S2VA 1M5CA 2WKYA 3U8QA 2Y7WA 4RK2A 3LBSA 2I3VA 2Z23A 1MY4A 5H8NA 3THIA 1I6QA 1DPPA 2OJTA 1OVBA 2XXIA 1QVSA 1ZBMA 4LZ5A 3C35A 1Q35A 4FIMA 4PE5B 2DWAA 3KOSA 1TFAA 4M4GA 2ZNSA 4EQBA 1QULA 4OEUA 5I2NB 1PDAA 3VDFA 2OLBA 3ZS6A 3UGWA 3TFLA 5EHSA 5KZTA 4RK9A 2O69A 4IO2A 2CMOA 1LAGE 3JV9A 1SI1A 2Q2AA 3B6QA 4BDMA 1B9JA 2XD2A 3GLBA 1B7HA 4RYAA 3OO6A 4U22A 1N04A 4EUOA 3MVXA 3KJTA 3IOTA 4KHZE 3MW0A 1MRPA 4R74A 4F3PA 4U2RA 4GIZA 1Y3PA 5L9MA 3MVWA 1S50A 1LLSA 3FD3A 1MXYA 4Z0IA 2B65A 1LB9A 3TTKA 5I84A 3Q28A 3RTFB 1D3KA 2XXXA 2KLFA 2R9JA 3OO7A 4YMAA 4X1BA 3BFTA 1IITA 4NTLA 1WODA 4POXA 1SQYA 3OOAA 1TXFA 4GXSB 3PPOA 1B0HA 4E0WA 3CI8A 4NWDA 5I56B 4I9DA 3RY3A 2G93A 5ITPA 4ESWA 5AA2B 1LBBA 2RINA 1N3WA 5FTHA 2UVJA 5KCJA 2V84A 4ZEDA 3PU5A 4EXKA 3IB2A 4JWYA 1JVXA 1FTOA 3FV2A 4HW8A 2Y84A 2YJPA 4G68B 1LFIA 3RTWB 1NL5A 5I58A 2E0SA 2F78A 4OWDA 2M8CA 3O97A 2F35A 1A55A 1LAFE 4Z7EA 2F6GA 1B46A 5A5XB 3L6HA 5B70A 1GGGA 1J1NA 4OFLA 3K6VA 4TLMB 3VLVA 4ECFA 1Y3NA 1N3XA 3N26A 1PB7A 1FQBA 1USYE 3LR1A 1HSEA 1UTHA 2V93A 2I58A 1QUKA 1OQHA 4LA9A 4U4SA 2I4CA 1SW5A 1JNFA 3CR9A 3B6WA 5CI5A 1B6HA 1USYH 3B7DA 3KG2A 5DT6A 2PX1A 3RT8A 1JW4A 4LVQA 1AOVA 1B3EA 3P7IA 2DWIA 1BIYA 3HSTA 1D9YA 4I8CA 1L5TA 4WXJA 4ZEIA 3FV1A 2VHAA 3M3FA 3IORA 5L9SA 1DPEA 1OVTA 1RYOA 4QFKA 2I48A 1S7YA 4HCWA 3JYRA 1LSTA 3N6UA 2UXAA 2DQVA 3K2DA 5H8FA 4G4PA 5FHNA 4OQOA 4POWA 4X48A 5H8SA 1URGA 1Z7NE 1MQDA 4RJZA 4JBZA 1MQIA 1JVYA 1LBCA 4F31B 4KFQA 3Q25A 2ZNTA 4DCXA 5I59B 3FATA 2O51A 1YCJA 4QSCA 4JWXA 5TU0A 2QMXA 5L8DA 2I0CA 4IB2A 2REJA 3PPQA 3TDJA 1MXVA 2QSXA 2H25A 2XXYA 2PT2A 2HZLA 1LFHA 3LSXA 3SEXA 3PD9A 2B3BA 1FTMA 1EZPA 3N5LA 1GV8A 4XXUA 1IEJA 1MQJA 3TQWA 3C4MA 4HS7A 3I6VA 3MWBA 3I3VA 1OQGA 2DYXA 4P0IA 1LAXA 3MBPA 4NWCA 1D9VA 1P1QA 3H6WA 3MPLA 5I57A 3U72A 5I2KA 1IUDA 1LCTA 2V3TA 3VXBA 3S9NC 2FNCA 3O6IA 5L9OA 4QRZA 4F18A 2XXHA 1POTA 1US5A 2PYYA 3PPPA 3OSQA 3SEVA 3K6WA 3O29A 4PFTA 1Y1MA 3KGCA 4FEBA 1EH3A 1FQFA 4YAHX 2XXTA 4XKRA 1XS5A 1YTVA 1YAEA 1RKMA 3U94A 4XKQA 2H98A 4EF2A 2H4IA 2D21A 1MM7A 1O7TA 4OENA 5AA2A 4NF5B 1P1UA 3OEKA 1B1HA 1O63A 1UIUA 2R6GE 3CVGA 1H3DA 4HTGA 3PUWE 3WAFA 5AE4A 1BP5A 3G3GA 5M2VA 3FZVA 4ISUA 3FJ7A 3H03A 4EXLA 4ZE9A 4UACA 3OXNA 1AMFA 5BWJA 3KFMA 3O6HA 1DTGA 4O3BA 3G7WA 4WEDA 2F36A 2AIXA 2O84X 3ZKKA 3KEIA 4PETA 3IOVA 1IIWA 5A5XA 2H99A 2Q2CA 5BUUA 3K00A 3E13X 5J1DA 2XX8A 1GTKA 4QFPA 3CSBA 1LFGA 5CMBA 3OD7A 1JW5A 4IGRA 4M1VA 4L17A 3LSFB 3MZ1A 2A5TB 3M8UA 5DEXB 3U93A 2DXRA 1B5IA 3IOUA 3VLUA 3TTNA 3BFUA 3H7MA 2Q9TA 4AB6A 2H9BA 5IKBA 1KWHA 4YKPA 3K1MA 2NVUB 2O68A 3U1OA 4KQPA 1SYIA 3PV0E 1A99A 4Q5TA 3TEPA 3PUVE 3V89B 3DM0A 3WAEA 1I6BA 4O3CA 4FATA 5HM4B 3HN0A 3O66A 1UQWA 4BDNA 3QUJA 3A3UA 4NF6A 4H6DA 4NF8A 3QYTA 1LCFA 3IR1A 2P1SA 2QJEA 2Z22A 1CB6A 4MFIA 2RC7A 3DP8A 3OO9A 1FTKA 1S9TA 3PUZE 1XC1A 4H8IA 4U1ZA 3K6UA 1LGBC 2Q88A 4H0WA 5H8HB 5AA1A 4AQ4A 1URDA 2OBGA 5JEIA 2HCAA 4ZEFA 4GOTA 2QS4A 3PMVA 3G3IA 3SEWA 2XXVA 4GF8A 3K6XA 4KI0E 5JTYA 1DTZA 3KSXA 1XT8A 4OETA 3PPNA 1BKAA 3T9HB 3SERA 3QXMA 5TPAA 3F11A 5CRYA 4BDRA 1ATGA 1IQ7A 2B3FA 3MPKA 1OMPA 5JK4A 1MY3A 3FVGA 3FXUA 3QIMA 2REGA 3ZKLA 4OMBA 3MVZA 5KDTA 1A8EA 3GXAA 5TP9A 2F5XA 3C36A 3G3HA 1JETA 2NWJA 5IAIA 4DLDA 2QS3A 2ZYMA 2AL4A 3GBAA 3H6UA 2ABHA 4NF4B 3PMXA 5H8QB 1B3LA 4GWOA 3RUMA 4K3FA 1NH7A 1NNPA 3PPRA 3ONMA 2CZLA 2FA7A 1P1WA 4FAJA 4LATA 2P0SA 3PUXE 1B1XA 1B4ZA 2QMWA 3SESA 3OEMA 4XKPA 3N6TA 1M5FA 2ZNUA 4KYEA 3R26A 4QF9A 3H6VA 3GBBA 2DSFA 2NUVA 4ELPA 5ISUA 4GFRA 5AA4A 3EQ1A 3FUZA 4Q30B 5FTIA 3B6TA 4R73A 3OSRA 4GQOA 1LAHE 2YLNA 5F7VA 2F34A 2RCAA 1N7WA 4U23A 2PVUA 4KYSA 4IGTA 1ZU0A 3Q26A 3FVNA 3FIRA 1B2HA 2LAOA 1DOTA 3TTMA 3G3KA 4JSDA 4NE4A 3CFLA 3E9XA 3FJGA 4DE8A 2BJJX 4U21A 3EPEA 5DVJA 4KD5A 4H65A 3V83A 2F8DA 3OENA
chains in the Genus database with same CATH superfamily
4F1VA 2I3WA 3MP6A 2Y7PA 5EQ9A 2QFLA 1SW4A 3CFZA 4GD5A 3W9VA 1BTJA 3G3JA 4N6PA 4F2OA 5ET5A 1NNFA 3EN3A 1JQFA 1H44A 3ISPA 3JZJA 1A54A 4OTEA 4PFWA 1PEBA 4JDFA 2HZKA 4YMBA 4I62A 1KZ8A 1UTBB 4P0GA 3TPAA 2QS1A 3MSTA 1GVCA 4YICA 1SW2A 1FQAA 4LN5A 5FHMA 1ZTYA 3UA8A 3EF7A 4IO4A 3K01A 3KZGA 1XVXA 1US4A 2H5YA 2F7BA 5IZ3A 3EHSA 5H8NB 4F1YA 4DDDA 4PFUA 2Z8DA 2DP8A 2Q8JA 1NV6A 1B52A 2XWVA 5CMMA 5DEXA 4RPNA 5I7IA 2HEUA 4HXVA 4F22A 4C0RA 3ILUB 3CSGA 4OERA 4I40A 1PB9A 4MNIA 1URSA 5LOMA 1YPNA 2GQ1A 3IB0A 2WBDA 2V4CA 4OVTA 4PDDA 2V25A 2ZXTA 4PGNA 2GFEA 5IZZA 3FXBA 4KPTA 3MC2A 3M3KA 3UK4A 2RC9A 2VGQA 3C33A 5CMCA 1NUWA 3IFCA 2DVZA 2FIXA 2XD3A 2HAVA 3TUSA 5LTCA 1XHYA 4QFLA 3V8XB 2W7YA 4ZEKA 1P1OA 3K1PA 3K4UA 3Q27A 3V5AA 3FASA 4X04A 4F1UA 1VFDA 2PT1A 4P1LA 2UYEA 3C32A 4JVDA 4U4XA 3TQLA 1B7ZA 3HHFA 5I2NA 1FTLA 3E3KA 4F29A 1H43A 1II5A 2IA4A 1MH4A 1FBGA 3I5OA 4JSOA 1NV5A 2Y5KA 2O1LA 3RLFE 1LBVA 2DXYA 3TZAA 1QUJA 2ESNA 4G68C 1IXCA 4FORA 4C1UA 3FVOA 3PUYE 2P2AA 3H4ZA 3EHUA 2ZZWA 3PMWA 4IO5A 2AL5A 1YZ0A 1EZOA 1HSLA 1A40A 4R6KA 2Y5LA 3TMGA 1SW1A 1HSJA 5EQ8A 4GX6A 4PCDA 3T66A 4ZE8A 4NX1A 4OZ9A 2XXUA 3T9UA 1PBPA 3TAJA 3D1RA 5KCJB 2HQ0A 4P1EA 3BIGA 1H45A 2XX9A 1B4HA 3SEUA 3O9PA 5EHMA 1Y4TA 4DZ1A 2QRYA 3FGSA 5CC2A 4PBQA 4H1XA 5I58B 1SVXB 4TOZA 3DP4A 2JJKA 2V3UA 2OX3A 5J16A 1CE2A 1EZ9A 3O28A 2FYIA 1LBWA 2UVGA 4FE8A 1VFEA 5I56A 1MM6A 3D4CA 4R2FA 1QKBA 1ELJA 3A3CA 5IM2A 5ITOA 1VR5A 4RXLA 4G8MA 4ZZEA 1N84A 2WYPA 5F1QA 5AA2D 3FVKA 4MF3A 4H5FA 3K0VA 2O7UA 3IO6A 1B40A 3O2AA 3LC8A 4DXUA 1DSNA 4DCYA 3FJMA 4YB6A 4GVOA 3BKIB 1I6AA 3MZ9A 5EYFA 3IX1A 3IK6B 2Q8MA 5HPQA 1UTHB 4ZS9A 4PQJA 4PE3A 3TCFA 3LUZA 1MDQA 4LZ8A 4LP2B 3TKDA 4DXCA 3CG3A 1MG1A 4MNCA 1MQHA 3HFUA 3SKPA 2O1MA 4LUBA 4G68A 4IO7A 3USDA 2WYKA 4PF6A 1B58A 4EDPA 4N4UA 1IXHA 1EU8A 3UN6A 3QSLA 3HO7A 4BDLA 1FTJA 1POY1 2ANJA 3LSLA 1UIVA 3T96B 4WEPA 1OIBA 1VSOA 1NV4A 2HPGA 4LONB 1ZKBA 1LBZA 1QKAA 5FHOA 4MCOA 2RC8A 4LQ5A 2F3BA 4GL0A 1OLCA 1EYJA 3O6GA 1AL3A 3K02A 4OEVA 1B5HA 1NUYA 4GLIA 4BDQA 1AH5A 1FPIA 5HBCA 4ELRA 1FBEA 1TT1A 1LBXA 1R6ZA 3VV5A 4N81A 5H8FB 5IZ1A 4F3SA 2O6AA 1P99A 2VD3A 2V3QA 3UORA 1B7UA 1MH3A 3VVFA 1MXZA 1PC3A 2YPNA 2QPQA 4OVJA 4R75A 4JB7A 5IGAA 2XXQA 4X1DA 1NNKA 2GRVA 1XVYA 4F39A 3RNNA 1JEVA 2DWJA 4IO6A 1WVJA 4R6HA 5DVFA 2RF1A 1IXIA 2P3VA 2I0BA 4MLQA 4LQ2A 2XX7A 4Q8RA 2ONKE 2F7AA 2NOOA 2GHBA 2UVIA 2F6PA 1SBPA 1SYHA 2QVUA 1A7LA 1KA1A 2QS2A 1FBDA 3TODA 4G2ZA 1NV7A 2ZMBA 4GWWA 1Y9UA 3MP1A 4H46A 3TELA 2NXOA 3R6UA 2D3IA 4IY5A 4GRKA 3TTLA 3HV1A 4I3YA 2XXPA 2A5SA 3VLWA 4RA1A 3KN3A 5I59A 1DMBA 4EF1A 3HCQA 2B4MA 5K2XA 1G0IA 2OK2A 3S9LC 4THIA 4PP0A 4F3GA 4RPOA 4AB5A 1G0HA 3C34A 3FBPA 1B3HA 5I57B 3DELB 5I2KB 4GBWA 4EQ9A 1QUIA 4BDOA 2R8TA 2O7IA 4QFOA 4R2BA 2X7QA 4OESA 3IO4A 3UP9A 2OZZA 2HAUA 5AA3A 1FCKA 1FRPA 5I5PA 5ICQA 3ILTB 2Y7IA 3KN7A 2X26A 1M5BA 2ZYKA 1YYZA 3R7XA 1M5EA 2Y7KA 1FBHA 3RQTA 1R9QA 3MJNA 1VE4A 3EKIA 4DXBA 1Y4CA 2Z8FA 4NEDA 1ANFA 1Z7ME 4ELOA 3RPWA 4F3BA 4YB7A 2DVCA 1MXXA 1JEUA 3A09A 2ZYNA 1PBQA 1IXGA 4KCDA 3MQ9A 4YZZA 3IB1A 4O7IA 5ICTA 4WKMA 4DIGA 3BBRA 4N13A 5CBRA 3S9EA 1NMUA 3H06B 3IOWA 2DS9A 3EHTA 1O64A 4O3AA 4ONYA 4XKNA 1N76A 4FJPA 5DTBA 1IMCA 5CM6A 3AXFA 5ET8A 2OWTA 1NNTA 2Z8EA 1SDXA 4I1DA 4HE1A 5FBPA 4YKJA 4HE2A 1A8FA 1R9LA 3H6TA 4N6DA 3QK6A 1TFDA 4UA8A 3T9VA 1MXWA 3NOHA 2RCBA 3IJOB 4X8RA 1WDNA 3K1NA 4NF5A 4NG7A 1B0LA 2FHYA 4ESXA 4RNSA 4ELQA 1LB8A 1MDP1 3KJ7A 3CFXA 3VVDA 3VFJA 2ONSA 3MAMA 3UIFA 3C31A 1B51A 2I4BA 3SETA 4GL8A 2XHDA 4P47A 4R9GA 2OCUA 4IO3A 3IJXB 2ALUA 4TQUQ 3TYHA 4OHNA 4N15A 1D4NA 4YB5A 2G29A 1FQEA 3LUYA 3L6GA 4PFIA 3T22A 2QL3A 4F19A 3RGYA 4G8NA 3QAXA 3MYUA 4HCYA 2A5TA 2F7CA 1M5DA 2Y7RA 3CG1A 4QHQA 4Q0CA 4QBAA 3KOTA 3IL1B 4JWOA 4NF6B 4JXIA 1FBFA 4NF0A 1OLAA 4O94A 4NF8B 2I6EA 4IY6A 1K9ZA 4OFJA 5B7DA 3M3LA 3SDFA 1MPCA 4PDHA 4ZZAA 4DI4B 1N7XA 3MZBA 4PBHA 2PFYA 4ZECA 3RT6B 1FQCA 3MUQA 5JTYB 1H76A 4R6YA 1IZ1A 1GR2A 2CZIA 1JW1A 1LEVA 2DE3A 3TCGA 5TPAB 4XIGQ 1MY2A 3OELA 4GX4A 2VT5A 1BLFA 5DVIA 3E4RA 2XXWA 4R72A 4QFNA 2DE4A 4FEDA 2DWHA 3KSJA 4YKIA 3H3GA 3MP8A 4QSDA 1MQGA 1MY0A 4R9FA 1MY1A 1NUXA 4MLVA 5H8HA 2HXWA 4PFYA 2GH9A 5EQ7A 5KDTB 3PD8A 3W15C 2VD2A 4N8YA 5TP9B 3HPIA 2ONRA 4BLAA 3TTRA 1Y20A 4P3LA 1Q9DA 4ND9A 3RPLB 5CMKA 1QW0A 1SD3A 4OFOA 1TWYA 4EQ7A 1N0TA 1NKXA 1KA0A 3IAZA 3T93B 3TCHA 3HHGA 4KCCA 3QUFA 4OYVA 1QJMA 2PFZA 4H8JA 3CHGA 2HHMA 1XI6A 3OMBA 2KQZA 1MXUA 2VP1A 4GXAA 1FW0A 1FBPA 3DP6A 2D5WA 4G8HA 3ROJA 2UYFA 3ZSFA 4QSEA 4G77A 1CNQA 3ODBA 2IEEA 4OXVA 4P11A 4C1TA 1I69A 3FXRA 4H5GA 5AA4B 2XXRA 1EYKA 3LSWA 4NF4A 1MPDA 5H8QA 2R71A 1T0KA 2PBWA 1PB8A 3RYDA 3MVYA 1BK4A 4AS4A 3VE1B 1B3FA 1ZMGA 4RY1A 3DLNA 2X7PA 2MKZA 4KYDA 4PTKA 1R1NA 4XEQA 2XXKA 3U92A 4GX3A 3SEYA 4MH5A 1FPKA 3CRBA 1F9BA 3ECRA 2PCRA 3KN8A 4MBPA 4MNPA 1FQDA 2VOZA 3G3FA 1B5JA 1AIVA 3KBZA 2HFBA 4I3EA 2DE2A 3PGFA 3D4GA 4TLLB 2XWIA 3Q29A 4LZ7A 2F97A 1ZIUA 1B3GA 1NFTA 4GWZA 4X9TA 2UVHA 4PC9A 3FXQA 2Q89A 5EYGA 2AYSA 4N07A 4P56A 2KR0A 3CIJA 2F3DA 4E0XA 1Y3QA 3S9MC 1ZLQA 5K2YA 2THIA 2PMSA 1Y1ZA 4ZDMA 1B05A 2WBBA 2QVVA 3S4UA 2DOJA 1NUZA 1Q1KA 2P3NA 1XOCA 2ZZXA 2OWSA 5CBSA 5IZ3B 2GHAA 2FIEA 1SI0A 1B32A 4YKKA 3RN8A 1JP4A 1NH8A 3C9HA 5DYHA 1NI9A 2E1SA 3IFAA 3KBRA 3T9XB 1MS7A 1IMBA 3W9WA 1MPBA 2I49A 4MJOA 4XTCQ 3VXCA 3GZGA 4KR5A 3N94A 3OO8A 2ZYOA 4FECA 4YU0A 1FPGA 2RKMA 1DK4A 2DDKA 2CZKA 1UTBA 4U1OA 1IMEA 4H67A 4NMYA 1RYXA 4F2QA 3U65A 1ZJLA 4ZEBA 3VVEA 1P1NA 5ELVA 3S2VA 1M5CA 2WKYA 3U8QA 2Y7WA 4RK2A 3LBSA 2I3VA 2Z23A 1MY4A 5H8NA 3THIA 1I6QA 1DPPA 2OJTA 1OVBA 2XXIA 1QVSA 1YXIA 1ZBMA 4LZ5A 3C35A 1Q35A 1RDZA 4FIMA 2DWAA 4PE5B 3KOSA 1TFAA 4GWYA 4PAKA 4M4GA 2ZNSA 4EQBA 1QULA 4OVRA 4XF5A 2WEFA 4OEUA 5I2NB 1PDAA 3VDFA 2OLBA 3ZS6A 3UGWA 4NAPA 3TFLA 5EHSA 5KZTA 4RK9A 2O69A 4IO2A 2CMOA 1LAGE 1EYIA 3JV9A 1SI1A 3E79A 2Q2AA 3B6QA 4BDMA 1B9JA 2XD2A 3GLBA 1B7HA 4RYAA 3OO6A 4UABA 4U22A 1N04A 4EUOA 3MVXA 3KJTA 3IOTA 4KHZE 3MW0A 1MRPA 4R74A 4F3PA 4U2RA 5EQAA 4GIZA 1Y3PA 4PAFA 5L9MA 3MVWA 4GWSA 1S50A 1LLSA 3FD3A 1MXYA 4Z0IA 2B65A 1LB9A 3TTKA 5I84A 1FTAA 3Q28A 3RTFB 1D3KA 2XXXA 2KLFA 2R9JA 3OO7A 4YMAA 4X1BA 3BFTA 1IITA 4NTLA 2L5VA 4JVIA 1WODA 4POXA 1SQYA 5ET7A 3OOAA 1TXFA 4GXSB 3PPOA 1B0HA 3PTYA 1FPEA 4E0WA 3CI8A 3T1BA 4NWDA 2FBPA 5I56B 4I9DA 4NN3A 3RY3A 2G93A 5ITPA 4ESWA 5AA2B 1LBBA 2RINA 1N3WA 4JVCA 5FTHA 2UVJA 5KCJA 2V84A 4ZEDA 3PU5A 4EXKA 4IR8A 3IB2A 4JWYA 1JVXA 3SZPA 1FTOA 3FV2A 4HW8A 2Y84A 2YJPA 4G68B 1LFIA 3RTWB 1NL5A 5I58A 2E0SA 2F78A 4OWDA 2M8CA 3O97A 2F35A 1A55A 1LAFE 4Z7EA 2F6GA 1B46A 3KC1A 5A5XB 3L6HA 3B50A 5B70A 1GGGA 1J1NA 4OFLA 3K6VA 4TLMB 3VLVA 4ECFA 1Y3NA 1N3XA 3N26A 1PB7A 1FQBA 1USYE 3LR1A 1HSEA 1UTHA 2V93A 2I58A 1QUKA 1OQHA 4LA9A 4U4SA 2I4CA 4G61A 4GBVA 1SW5A 1JNFA 3CR9A 3B6WA 5CI5A 1B6HA 1USYH 1INPA 3B7DA 3KG2A 3KC0A 5DT6A 2PX1A 3RT8A 1AWBA 1JW4A 4LVQA 1AOVA 1B3EA 3P7IA 1FPJA 2DWIA 1BIYA 2FVZA 3HSTA 1D9YA 4I8CA 1L5TA 4WXJA 4ZEIA 3FV1A 2VHAA 4GWUA 3M3FA 4HE0A 3IORA 5L9SA 3A29A 1DPEA 1OVTA 1RYOA 4QFKA 2I48A 2XWKA 1S7YA 4HCWA 3JYRA 1FPFA 1LSTA 3N6UA 2UXAA 2DQVA 3K2DA 5H8FA 4G4PA 5FHNA 4OQOA 4POWA 4KXPA 4X48A 5H8SA 1URGA 4MMPA 4PF8A 1Z7NE 1MQDA 4RJZA 4JBZA 1MQIA 1JVYA 1LBCA 4OVSA 4F31B 4KFQA 1FPBA 3Q25A 2ZNTA 4DCXA 5I59B 4PFRA 3FATA 2O51A 1YCJA 4QSCA 4JWXA 5TU0A 2QMXA 5L8DA 4PGPA 2I0CA 4IB2A 2REJA 3PPQA 4P8BA 3TDJA 2QVRA 4P9KA 1MXVA 2QSXA 5I3SA 2H25A 2XXYA 1RDXA 2PT2A 2ZZVA 2HZLA 1LFHA 3LSXA 3SEXA 3PD9A 2B3BA 1FTMA 1EZPA 3N5LA 1GV8A 1DCUA 4XXUA 1IEJA 1MQJA 4O7MA 3TQWA 3C4MA 4HS7A 5DW8A 3I6VA 5T3JA 3MWBA 2Q74A 3I3VA 5ESYA 1OQGA 2DYXA 4P0IA 1LAXA 3MBPA 4NWCA 1D9VA 1P1QA 1LBYA 3H6WA 4MIJA 1NV3A 3MPLA 5I57A 3U72A 5I2KA 1FJ9A 1IUDA 1LCTA 2V3TA 3VXBA 4AS5A 2CEXA 3S9NC 2FNCA 4XFEA 3O6IA 5L9OA 4QRZA 4F18A 2XXHA 4OANA 3GYYA 1POTA 1QGXA 1US5A 2PYYA 3PPPA 3OSQA 1NV2A 3SEVA 3K6WA 3O29A 4PFTA 1Y1MA 3KGCA 4FEBA 1EH3A 1FQFA 4YAHX 2XXTA 4XKRA 4PFBA 1XS5A 1YTVA 1YAEA 1RKMA 2VPNA 3U94A 4XKQA 2H98A 4EF2A 2H4IA 2D21A 1FJ6A 1MM7A 1O7TA 4OENA 5AA2A 4NF5B 1P1UA 3OEKA 1B1HA 1O63A 1UIUA 2R6GE 4N17A 3CVGA 1H3DA 4HTGA 3PUWE 3WAFA 5AE4A 4MX6A 1BP5A 3G3GA 5M2VA 3FZVA 4ISUA 1FPLA 3FJ7A 3H03A 4EXLA 4ZE9A 4UACA 3OXNA 1AMFA 1SPIA 5BWJA 3KFMA 3O6HA 1DTGA 4O3BA 2HXRA 3G7WA 4WEDA 2F36A 2AIXA 1IMAA 2O84X 3ZKKA 3KEIA 4PETA 4N91A 3IOVA 1IIWA 5A5XA 3E78A 2H99A 2Q2CA 5BUUA 3K00A 3E13X 4O8MA 5J1DA 2XX8A 1GTKA 4QFPA 3CSBA 1LFGA 5CMBA 3OD7A 1JW5A 4IGRA 4M1VA 4L17A 5ET6A 3LSFB 3MZ1A 2A5TB 4QXDA 3M8UA 4NGUA 5DEXB 3U93A 2DXRA 1B5IA 1FPDA 4OA4A 3IOUA 3VLUA 3TTNA 3BFUA 3H7MA 2Q9TA 4AB6A 2H9BA 5IKBA 1KWHA 4YKPA 2WX9A 1FBCA 3K1MA 2NVUB 2O68A 3U1OA 4KQPA 3LV0A 1SYIA 3PV0E 4N8GA 4N6KA 1A99A 4Q5TA 3T0JA 3QMFA 3TEPA 3PUVE 3V89B 3DM0A 3WAEA 1I6BA 4O3CA 4FATA 4H45A 5HM4B 3HN0A 3O66A 1UQWA 4BDNA 3QUJA 3A3UA 4NF6A 4H6DA 4FBPA 4NF8A 3QYTA 1LCFA 3IR1A 2P1SA 2B4LA 2QJEA 2Z22A 5EYHA 1CB6A 4MFIA 2RC7A 3DP8A 3OO9A 4NHBA 1FTKA 1S9TA 3PUZE 1VDWA 1XC1A 4H8IA 4U1ZA 4MAGA 5A5LA 3K6UA 1LGBC 1K9YA 4DI3D 2Q88A 4H0WA 5H8HB 5AA1A 4AQ4A 1URDA 2OBGA 5JEIA 2HCAA 4ZEFA 4GOTA 2QS4A 3PMVA 3B8BA 3G3IA 3SEWA 2XXVA 4GF8A 3K6XA 4KI0E 5JTYA 1IMFA 1DTZA 3KSXA 1XT8A 4OVPA 4OETA 2OWZA 2BJIA 3PPNA 1BKAA 3T9HB 3SERA 3BIHA 3QXMA 4NQ8A 5TPAA 3F11A 5CRYA 2CZHA 4BDRA 1ATGA 1IQ7A 2B3FA 1DBZA 3MPKA 1OMPA 5JK4A 2XWOA 1MY3A 3FVGA 3FXUA 3QIMA 2REGA 3ZKLA 4OMBA 3MVZA 5KDTA 1A8EA 3GXAA 5TP9A 2F5XA 3C36A 3G3HA 1JETA 2NWJA 5IAIA 4DLDA 2QS3A 2ZYMA 4PAIA 2AL4A 3GBAA 3H6UA 1RDYA 2CEYA 2ABHA 4NF4B 3RPLA 3PMXA 5H8QB 1B3LA 4GWOA 3RUMA 4K3FA 1IMDA 1NH7A 1NNPA 3PPRA 3ONMA 2CZLA 2FA7A 1P1WA 4FAJA 4LATA 2P0SA 3PUXE 1B1XA 1B4ZA 1NV1A 2QMWA 3SESA 1FSAA 3OEMA 4XKPA 3N6TA 1M5FA 2ZNUA 4KYEA 4GWXA 3R26A 4QF9A 3H6VA 3GBBA 2DSFA 2NUVA 4ELPA 4MEVA 5ISUA 4GFRA 5AA4A 5LDZA 3EQ1A 4OVQA 3FUZA 4Q30B 5FTIA 3B6TA 4R73A 3OSRA 4GQOA 1LAHE 2YLNA 5F7VA 1D9QA 2F34A 2RCAA 1N7WA 5F24A 4U23A 2PVUA 4KYSA 2XA5A 4IGTA 1ZU0A 3Q26A 3FVNA 3FIRA 4MHFA 1B2HA 2LAOA 1DOTA 3TTMA 3G3KA 4JSDA 4NE4A 3CFLA 3E9XA 3FJGA 4DE8A 2BJJX 4U21A 3EPEA 5DVJA 2VPOA 4KD5A 1NV0A 4H65A 3V83A 2F8DA 3OENA
chains in the Genus database with same CATH topology
4F1VA 2I3WA 3MP6A 2Y7PA 1SW4A 3CFZA 4GD5A 3W9VA 1BTJA 3G3JA 4N6PA 4F2OA 1NNFA 3EN3A 1JQFA 1H44A 3JZJA 1A54A 4OTEA 4PFWA 1PEBA 4JDFA 2HZKA 4YMBA 4I62A 1UTBB 4P0GA 3TPAA 2QS1A 1GVCA 4YICA 1SW2A 1FQAA 5FHMA 1ZTYA 3UA8A 3EF7A 4IO4A 3K01A 3KZGA 1XVXA 1US4A 2H5YA 2F7BA 3EHSA 5H8NB 4F1YA 4DDDA 4PFUA 2Z8DA 2DP8A 2Q8JA 1B52A 5CMMA 5DEXA 4RPNA 2HEUA 4F22A 4C0RA 3ILUB 3CSGA 4OERA 1PB9A 1URSA 5LOMA 1YPNA 3IB0A 2V25A 2ZXTA 2GFEA 4KPTA 3MC2A 3M3KA 3UK4A 2RC9A 2VGQA 3C33A 5CMCA 2DVZA 2XD3A 2HAVA 3TUSA 1XHYA 4QFLA 3V8XB 2W7YA 4ZEKA 1P1OA 3K1PA 3K4UA 3Q27A 3V5AA 3FASA 4F1UA 1VFDA 2PT1A 2UYEA 3C32A 4U4XA 3TQLA 1B7ZA 3HHFA 5I2NA 1FTLA 3E3KA 4F29A 1H43A 1II5A 2IA4A 1MH4A 3I5OA 4JSOA 2O1LA 3RLFE 2DXYA 3TZAA 1QUJA 2ESNA 4G68C 1IXCA 4FORA 4C1UA 3FVOA 3PUYE 2P2AA 3H4ZA 3EHUA 3PMWA 4IO5A 2AL5A 1EZOA 1HSLA 1A40A 4R6KA 3TMGA 1SW1A 1HSJA 3T66A 4ZE8A 4OZ9A 2XXUA 3T9UA 1PBPA 3TAJA 5KCJB 2HQ0A 1H45A 2XX9A 1B4HA 3SEUA 3O9PA 5EHMA 1Y4TA 4DZ1A 2QRYA 3FGSA 5CC2A 4H1XA 5I58B 1SVXB 4TOZA 3DP4A 2V3UA 1CE2A 1EZ9A 3O28A 2FYIA 2UVGA 4FE8A 1VFEA 5I56A 1MM6A 3D4CA 4R2FA 1QKBA 1ELJA 3A3CA 5ITOA 1VR5A 4RXLA 4G8MA 4ZZEA 1N84A 5F1QA 5AA2D 3FVKA 4MF3A 4H5FA 3K0VA 2O7UA 3IO6A 1B40A 3O2AA 3LC8A 4DXUA 1DSNA 4DCYA 3FJMA 4YB6A 4GVOA 3BKIB 1I6AA 3MZ9A 5EYFA 3IX1A 3IK6B 5HPQA 1UTHB 4ZS9A 4PQJA 3TCFA 1MDQA 4LZ8A 4LP2B 3TKDA 4DXCA 3CG3A 1MG1A 1MQHA 3SKPA 2O1MA 4LUBA 4G68A 4IO7A 3USDA 1B58A 4EDPA 1IXHA 1EU8A 3UN6A 3QSLA 3HO7A 4BDLA 1FTJA 1POY1 2ANJA 3LSLA 3T96B 1UIVA 4WEPA 1OIBA 1VSOA 4LONB 1ZKBA 1QKAA 5FHOA 2RC8A 4LQ5A 4GL0A 1OLCA 3O6GA 1AL3A 3K02A 4OEVA 1B5HA 4GLIA 4BDQA 1AH5A 5HBCA 4ELRA 1TT1A 1R6ZA 3VV5A 5H8FB 4F3SA 2O6AA 1P99A 2VD3A 2V3QA 3UORA 1B7UA 1MH3A 3VVFA 1MXZA 1PC3A 2YPNA 2QPQA 4OVJA 4R75A 4JB7A 2XXQA 4X1DA 1NNKA 2GRVA 1XVYA 4F39A 3RNNA 1JEVA 2DWJA 4IO6A 1WVJA 4R6HA 5DVFA 2RF1A 1IXIA 2I0BA 4MLQA 4LQ2A 2XX7A 4Q8RA 2ONKE 2F7AA 2NOOA 2GHBA 2UVIA 2F6PA 1SBPA 1SYHA 1A7LA 2QS2A 3TODA 4G2ZA 2ZMBA 1Y9UA 3MP1A 3TELA 2NXOA 3R6UA 2D3IA 4IY5A 4GRKA 3TTLA 3HV1A 2XXPA 2A5SA 3VLWA 4RA1A 3KN3A 5I59A 1DMBA 4EF1A 3HCQA 5K2XA 2OK2A 3S9LC 4THIA 4PP0A 4F3GA 4RPOA 4AB5A 3C34A 1B3HA 5I57B 3DELB 5I2KB 4EQ9A 1QUIA 4BDOA 2O7IA 4QFOA 4R2BA 2X7QA 4OESA 3IO4A 3UP9A 2OZZA 2HAUA 5AA3A 1FCKA 5ICQA 3ILTB 2Y7IA 3KN7A 2X26A 1M5BA 2ZYKA 3R7XA 1M5EA 2Y7KA 3RQTA 1R9QA 3MJNA 1VE4A 4DXBA 1Y4CA 2Z8FA 4NEDA 1Z7ME 1ANFA 4ELOA 3RPWA 4F3BA 4YB7A 2DVCA 1MXXA 1JEUA 3A09A 2ZYNA 1PBQA 1IXGA 4KCDA 3MQ9A 4YZZA 3IB1A 5ICTA 4WKMA 4DIGA 3BBRA 4N13A 5CBRA 3S9EA 1NMUA 3H06B 3IOWA 2DS9A 3EHTA 1O64A 4O3AA 4ONYA 4XKNA 1N76A 4FJPA 5DTBA 5CM6A 3AXFA 2OWTA 1NNTA 2Z8EA 1SDXA 4I1DA 4YKJA 1A8FA 1R9LA 3H6TA 3QK6A 1TFDA 4UA8A 3T9VA 1MXWA 2RCBA 3IJOB 1WDNA 3K1NA 4NF5A 1B0LA 4ESXA 4RNSA 4ELQA 1LB8A 1MDP1 3KJ7A 3CFXA 3VVDA 3VFJA 2ONSA 3MAMA 3UIFA 3C31A 1B51A 2I4BA 3SETA 4GL8A 2XHDA 4R9GA 2OCUA 4IO3A 3IJXB 2ALUA 4TQUQ 3TYHA 4OHNA 1D4NA 4YB5A 2G29A 1FQEA 3LUYA 3L6GA 3T22A 2QL3A 4F19A 3RGYA 4G8NA 3QAXA 4HCYA 2A5TA 2F7CA 1M5DA 2Y7RA 3CG1A 4QHQA 4Q0CA 3KOTA 3IL1B 4JWOA 4NF6B 4JXIA 1OLAA 4NF8B 2I6EA 4IY6A 4OFJA 5B7DA 3M3LA 3SDFA 1MPCA 4ZZAA 1N7XA 3MZBA 4ZECA 3RT6B 1FQCA 3MUQA 5JTYB 1H76A 4R6YA 1IZ1A 1GR2A 1JW1A 2DE3A 3TCGA 5TPAB 4XIGQ 1MY2A 3OELA 5DVIA 1BLFA 3E4RA 2XXWA 4R72A 4QFNA 2DE4A 4FEDA 2DWHA 3KSJA 4YKIA 3H3GA 3MP8A 4QSDA 1MQGA 1MY0A 4R9FA 1MY1A 4MLVA 5H8HA 2HXWA 4PFYA 2GH9A 5KDTB 3PD8A 3W15C 2VD2A 5TP9B 3HPIA 2ONRA 4BLAA 3TTRA 1Y20A 4ND9A 5CMKA 1QW0A 1SD3A 4OFOA 1TWYA 4EQ7A 1N0TA 1NKXA 3IAZA 3TCHA 3T93B 3HHGA 4KCCA 3QUFA 4OYVA 1QJMA 4H8JA 3OMBA 1MXUA 2VP1A 4GXAA 1FW0A 3DP6A 2D5WA 4G8HA 2UYFA 3ZSFA 4QSEA 4G77A 3ODBA 2IEEA 4OXVA 4P11A 4C1TA 1I69A 3FXRA 4H5GA 5AA4B 2XXRA 3LSWA 4NF4A 1MPDA 5H8QA 2R71A 1T0KA 2PBWA 1PB8A 3MVYA 3VE1B 1B3FA 1ZMGA 4RY1A 3DLNA 2X7PA 4KYDA 1R1NA 3U92A 3SEYA 4MH5A 3CRBA 1F9BA 3ECRA 3KN8A 4MBPA 1FQDA 2VOZA 3G3FA 1B5JA 1AIVA 2HFBA 2DE2A 3PGFA 3D4GA 4TLLB 3Q29A 4LZ7A 2F97A 1ZIUA 1B3GA 1NFTA 4X9TA 2UVHA 3FXQA 2Q89A 2AYSA 4N07A 3CIJA 4E0XA 1Y3QA 3S9MC 1ZLQA 5K2YA 2THIA 2PMSA 1Y1ZA 4ZDMA 1B05A 3S4UA 2DOJA 1Q1KA 1XOCA 2OWSA 5CBSA 2GHAA 1SI0A 1B32A 4YKKA 3RN8A 3C9HA 1NH8A 5DYHA 2E1SA 3KBRA 3T9XB 1MS7A 3W9WA 1MPBA 2I49A 4XTCQ 3VXCA 3GZGA 4KR5A 3N94A 3OO8A 2ZYOA 4FECA 4YU0A 2RKMA 1UTBA 4U1OA 4H67A 4NMYA 1RYXA 4F2QA 1ZJLA 4ZEBA 3VVEA 1P1NA 5ELVA 3S2VA 1M5CA 2WKYA 3U8QA 2Y7WA 4RK2A 3LBSA 2I3VA 2Z23A 1MY4A 5H8NA 3THIA 1I6QA 1DPPA 2OJTA 1OVBA 2XXIA 1QVSA 1ZBMA 4LZ5A 3C35A 1Q35A 4FIMA 4PE5B 2DWAA 3KOSA 1TFAA 4M4GA 2ZNSA 4EQBA 1QULA 4OEUA 5I2NB 1PDAA 3VDFA 2OLBA 3ZS6A 3UGWA 3TFLA 5EHSA 5KZTA 4RK9A 2O69A 4IO2A 2CMOA 1LAGE 3JV9A 1SI1A 2Q2AA 3B6QA 4BDMA 1B9JA 2XD2A 3GLBA 1B7HA 4RYAA 3OO6A 4U22A 1N04A 4EUOA 3MVXA 3KJTA 3IOTA 4KHZE 3MW0A 1MRPA 4R74A 4F3PA 4U2RA 4GIZA 1Y3PA 5L9MA 3MVWA 1S50A 1LLSA 3FD3A 1MXYA 4Z0IA 2B65A 1LB9A 3TTKA 5I84A 3Q28A 3RTFB 1D3KA 2XXXA 2KLFA 2R9JA 3OO7A 4YMAA 4X1BA 3BFTA 1IITA 4NTLA 1WODA 4POXA 1SQYA 3OOAA 1TXFA 4GXSB 3PPOA 1B0HA 4E0WA 3CI8A 4NWDA 5I56B 4I9DA 3RY3A 2G93A 5ITPA 4ESWA 5AA2B 1LBBA 2RINA 1N3WA 5FTHA 2UVJA 5KCJA 2V84A 4ZEDA 3PU5A 4EXKA 3IB2A 4JWYA 1JVXA 1FTOA 3FV2A 4HW8A 2Y84A 2YJPA 4G68B 1LFIA 3RTWB 1NL5A 5I58A 2E0SA 2F78A 4OWDA 2M8CA 3O97A 2F35A 1A55A 1LAFE 4Z7EA 2F6GA 1B46A 5A5XB 3L6HA 5B70A 1GGGA 1J1NA 4OFLA 3K6VA 4TLMB 3VLVA 4ECFA 1Y3NA 1N3XA 3N26A 1PB7A 1FQBA 1USYE 3LR1A 1HSEA 1UTHA 2V93A 2I58A 1QUKA 1OQHA 4LA9A 4U4SA 2I4CA 1SW5A 1JNFA 3CR9A 3B6WA 5CI5A 1B6HA 1USYH 3B7DA 3KG2A 5DT6A 2PX1A 3RT8A 1JW4A 4LVQA 1AOVA 1B3EA 3P7IA 2DWIA 1BIYA 3HSTA 1D9YA 4I8CA 1L5TA 4WXJA 4ZEIA 3FV1A 2VHAA 3M3FA 3IORA 5L9SA 1DPEA 1OVTA 1RYOA 4QFKA 2I48A 1S7YA 4HCWA 3JYRA 1LSTA 3N6UA 2UXAA 2DQVA 3K2DA 5H8FA 4G4PA 5FHNA 4OQOA 4POWA 4X48A 5H8SA 1URGA 1Z7NE 1MQDA 4RJZA 4JBZA 1MQIA 1JVYA 1LBCA 4F31B 4KFQA 3Q25A 2ZNTA 4DCXA 5I59B 3FATA 2O51A 1YCJA 4QSCA 4JWXA 5TU0A 2QMXA 5L8DA 2I0CA 4IB2A 2REJA 3PPQA 3TDJA 1MXVA 2QSXA 2H25A 2XXYA 2PT2A 2HZLA 1LFHA 3LSXA 3SEXA 3PD9A 2B3BA 1FTMA 1EZPA 3N5LA 1GV8A 4XXUA 1IEJA 1MQJA 3TQWA 3C4MA 4HS7A 3I6VA 3MWBA 3I3VA 1OQGA 2DYXA 4P0IA 1LAXA 3MBPA 4NWCA 1D9VA 1P1QA 3H6WA 3MPLA 5I57A 3U72A 5I2KA 1IUDA 1LCTA 2V3TA 3VXBA 3S9NC 2FNCA 3O6IA 5L9OA 4QRZA 4F18A 2XXHA 1POTA 1US5A 2PYYA 3PPPA 3OSQA 3SEVA 3K6WA 3O29A 4PFTA 1Y1MA 3KGCA 4FEBA 1EH3A 1FQFA 4YAHX 2XXTA 4XKRA 1XS5A 1YTVA 1YAEA 1RKMA 3U94A 4XKQA 2H98A 4EF2A 2H4IA 2D21A 1MM7A 1O7TA 4OENA 5AA2A 4NF5B 1P1UA 3OEKA 1B1HA 1O63A 1UIUA 2R6GE 3CVGA 1H3DA 4HTGA 3PUWE 3WAFA 5AE4A 1BP5A 3G3GA 5M2VA 3FZVA 4ISUA 3FJ7A 3H03A 4EXLA 4ZE9A 4UACA 3OXNA 1AMFA 5BWJA 3KFMA 3O6HA 1DTGA 4O3BA 3G7WA 4WEDA 2F36A 2AIXA 2O84X 3ZKKA 3KEIA 4PETA 3IOVA 1IIWA 5A5XA 2H99A 2Q2CA 5BUUA 3K00A 3E13X 5J1DA 2XX8A 1GTKA 4QFPA 3CSBA 1LFGA 5CMBA 3OD7A 1JW5A 4IGRA 4M1VA 4L17A 3LSFB 3MZ1A 2A5TB 3M8UA 5DEXB 3U93A 2DXRA 1B5IA 3IOUA 3VLUA 3TTNA 3BFUA 3H7MA 2Q9TA 4AB6A 2H9BA 5IKBA 1KWHA 4YKPA 3K1MA 2NVUB 2O68A 3U1OA 4KQPA 1SYIA 3PV0E 1A99A 4Q5TA 3TEPA 3PUVE 3V89B 3DM0A 3WAEA 1I6BA 4O3CA 4FATA 5HM4B 3HN0A 3O66A 1UQWA 4BDNA 3QUJA 3A3UA 4NF6A 4H6DA 4NF8A 3QYTA 1LCFA 3IR1A 2P1SA 2QJEA 2Z22A 1CB6A 4MFIA 2RC7A 3DP8A 3OO9A 1FTKA 1S9TA 3PUZE 1XC1A 4H8IA 4U1ZA 3K6UA 1LGBC 2Q88A 4H0WA 5H8HB 5AA1A 4AQ4A 1URDA 2OBGA 5JEIA 2HCAA 4ZEFA 4GOTA 2QS4A 3PMVA 3G3IA 3SEWA 2XXVA 4GF8A 3K6XA 4KI0E 5JTYA 1DTZA 3KSXA 1XT8A 4OETA 3PPNA 1BKAA 3T9HB 3SERA 3QXMA 5TPAA 3F11A 5CRYA 4BDRA 1ATGA 1IQ7A 2B3FA 3MPKA 1OMPA 5JK4A 1MY3A 3FVGA 3FXUA 3QIMA 2REGA 3ZKLA 4OMBA 3MVZA 5KDTA 1A8EA 3GXAA 5TP9A 2F5XA 3C36A 3G3HA 1JETA 2NWJA 5IAIA 4DLDA 2QS3A 2ZYMA 2AL4A 3GBAA 3H6UA 2ABHA 4NF4B 3PMXA 5H8QB 1B3LA 4GWOA 3RUMA 4K3FA 1NH7A 1NNPA 3PPRA 3ONMA 2CZLA 2FA7A 1P1WA 4FAJA 4LATA 2P0SA 3PUXE 1B1XA 1B4ZA 2QMWA 3SESA 3OEMA 4XKPA 3N6TA 1M5FA 2ZNUA 4KYEA 3R26A 4QF9A 3H6VA 3GBBA 2DSFA 2NUVA 4ELPA 5ISUA 4GFRA 5AA4A 3EQ1A 3FUZA 4Q30B 5FTIA 3B6TA 4R73A 3OSRA 4GQOA 1LAHE 2YLNA 5F7VA 2F34A 2RCAA 1N7WA 4U23A 2PVUA 4KYSA 4IGTA 1ZU0A 3Q26A 3FVNA 3FIRA 1B2HA 2LAOA 1DOTA 3TTMA 3G3KA 4JSDA 4NE4A 3CFLA 3E9XA 3FJGA 4DE8A 2BJJX 4U21A 3EPEA 5DVJA 4KD5A 4H65A 3V83A 2F8DA 3OENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1V A;  2I3W A;  3MP6 A;  2Y7P A;  1SW4 A;  3CFZ A;  4GD5 A;  3W9V A;  1BTJ A;  3G3J A;  4N6P A;  4F2O A;  1NNF A;  3EN3 A;  1JQF A;  1H44 A;  3JZJ A;  1A54 A;  4OTE A;  4PFW A;  1PEB A;  4JDF A;  2HZK A;  4YMB A;  4I62 A;  1UTB B;  4P0G A;  3TPA A;  2QS1 A;  1GVC A;  4YIC A;  1SW2 A;  1FQA A;  5FHM A;  1ZTY A;  3UA8 A;  3EF7 A;  4IO4 A;  3K01 A;  3KZG A;  1XVX A;  1US4 A;  2H5Y A;  2F7B A;  3EHS A;  5H8N B;  4F1Y A;  4DDD A;  4PFU A;  2Z8D A;  2DP8 A;  2Q8J A;  1B52 A;  5CMM A;  5DEX A;  4RPN A;  2HEU A;  4F22 A;  4C0R A;  3ILU B;  3CSG A;  4OER A;  1PB9 A;  1URS A;  5LOM A;  1YPN A;  3IB0 A;  2V25 A;  2ZXT A;  2GFE A;  4KPT A;  3MC2 A;  3M3K A;  3UK4 A;  2RC9 A;  2VGQ A;  3C33 A;  5CMC A;  2DVZ A;  2XD3 A;  2HAV A;  3TUS A;  1XHY A;  4QFL A;  3V8X B;  2W7Y A;  4ZEK A;  1P1O A;  3K1P A;  3K4U A;  3Q27 A;  3V5A A;  3FAS A;  4F1U A;  1VFD A;  2PT1 A;  2UYE A;  3C32 A;  4U4X A;  3TQL A;  1B7Z A;  3HHF A;  5I2N A;  1FTL A;  3E3K A;  4F29 A;  1H43 A;  1II5 A;  2IA4 A;  1MH4 A;  3I5O A;  4JSO A;  2O1L A;  3RLF E;  2DXY A;  3TZA A;  1QUJ A;  2ESN A;  4G68 C;  1IXC A;  4FOR A;  4C1U A;  3FVO A;  3PUY E;  2P2A A;  3H4Z A;  3EHU A;  3PMW A;  4IO5 A;  2AL5 A;  1EZO A;  1HSL A;  1A40 A;  4R6K A;  3TMG A;  1SW1 A;  1HSJ A;  3T66 A;  4ZE8 A;  4OZ9 A;  2XXU A;  3T9U A;  1PBP A;  3TAJ A;  5KCJ B;  2HQ0 A;  1H45 A;  2XX9 A;  1B4H A;  3SEU A;  3O9P A;  5EHM A;  1Y4T A;  4DZ1 A;  2QRY A;  3FGS A;  5CC2 A;  4H1X A;  5I58 B;  1SVX B;  4TOZ A;  3DP4 A;  2V3U A;  1CE2 A;  1EZ9 A;  3O28 A;  2FYI A;  2UVG A;  4FE8 A;  1VFE A;  5I56 A;  1MM6 A;  3D4C A;  4R2F A;  1QKB A;  1ELJ A;  3A3C A;  5ITO A;  1VR5 A;  4RXL A;  4G8M A;  4ZZE A;  1N84 A;  5F1Q A;  5AA2 D;  3FVK A;  4MF3 A;  4H5F A;  3K0V A;  2O7U A;  3IO6 A;  1B40 A;  3O2A A;  3LC8 A;  4DXU A;  1DSN A;  4DCY A;  3FJM A;  4YB6 A;  4GVO A;  3BKI B;  1I6A A;  3MZ9 A;  5EYF A;  3IX1 A;  3IK6 B;  5HPQ A;  1UTH B;  4ZS9 A;  4PQJ A;  3TCF A;  1MDQ A;  4LZ8 A;  4LP2 B;  3TKD A;  4DXC A;  3CG3 A;  1MG1 A;  1MQH A;  3SKP A;  2O1M A;  4LUB A;  4G68 A;  4IO7 A;  3USD A;  1B58 A;  4EDP A;  1IXH A;  1EU8 A;  3UN6 A;  3QSL A;  3HO7 A;  4BDL A;  1FTJ A;  1POY 1;  2ANJ A;  3LSL A;  3T96 B;  1UIV A;  4WEP A;  1OIB A;  1VSO A;  4LON B;  1ZKB A;  1QKA A;  5FHO A;  2RC8 A;  4LQ5 A;  4GL0 A;  1OLC A;  3O6G A;  1AL3 A;  3K02 A;  4OEV A;  1B5H A;  4GLI A;  4BDQ A;  1AH5 A;  5HBC A;  4ELR A;  1TT1 A;  1R6Z A;  3VV5 A;  5H8F B;  4F3S A;  2O6A A;  1P99 A;  2VD3 A;  2V3Q A;  3UOR A;  1B7U A;  1MH3 A;  3VVF A;  1MXZ A;  1PC3 A;  2YPN A;  2QPQ A;  4OVJ A;  4R75 A;  4JB7 A;  2XXQ A;  4X1D A;  1NNK A;  2GRV A;  1XVY A;  4F39 A;  3RNN A;  1JEV A;  2DWJ A;  4IO6 A;  1WVJ A;  4R6H A;  5DVF A;  2RF1 A;  1IXI A;  2I0B A;  4MLQ A;  4LQ2 A;  2XX7 A;  4Q8R A;  2ONK E;  2F7A A;  2NOO A;  2GHB A;  2UVI A;  2F6P A;  1SBP A;  1SYH A;  1A7L A;  2QS2 A;  3TOD A;  4G2Z A;  2ZMB A;  1Y9U A;  3MP1 A;  3TEL A;  2NXO A;  3R6U A;  2D3I A;  4IY5 A;  4GRK A;  3TTL A;  3HV1 A;  2XXP A;  2A5S A;  3VLW A;  4RA1 A;  3KN3 A;  5I59 A;  1DMB A;  4EF1 A;  3HCQ A;  5K2X A;  2OK2 A;  3S9L C;  4THI A;  4PP0 A;  4F3G A;  4RPO A;  4AB5 A;  3C34 A;  1B3H A;  5I57 B;  3DEL B;  5I2K B;  4EQ9 A;  1QUI A;  4BDO A;  2O7I A;  4QFO A;  4R2B A;  2X7Q A;  4OES A;  3IO4 A;  3UP9 A;  2OZZ A;  2HAU A;  5AA3 A;  1FCK A;  5ICQ A;  3ILT B;  2Y7I A;  3KN7 A;  2X26 A;  1M5B A;  2ZYK A;  3R7X A;  1M5E A;  2Y7K A;  3RQT A;  1R9Q A;  3MJN A;  1VE4 A;  4DXB A;  1Y4C A;  2Z8F A;  4NED A;  1Z7M E;  1ANF A;  4ELO A;  3RPW A;  4F3B A;  4YB7 A;  2DVC A;  1MXX A;  1JEU A;  3A09 A;  2ZYN A;  1PBQ A;  1IXG A;  4KCD A;  3MQ9 A;  4YZZ A;  3IB1 A;  5ICT A;  4WKM A;  4DIG A;  3BBR A;  4N13 A;  5CBR A;  3S9E A;  1NMU A;  3H06 B;  3IOW A;  2DS9 A;  3EHT A;  1O64 A;  4O3A A;  4ONY A;  4XKN A;  1N76 A;  4FJP A;  5DTB A;  5CM6 A;  3AXF A;  2OWT A;  1NNT A;  2Z8E A;  1SDX A;  4I1D A;  4YKJ A;  1A8F A;  1R9L A;  3H6T A;  3QK6 A;  1TFD A;  4UA8 A;  3T9V A;  1MXW A;  2RCB A;  3IJO B;  1WDN A;  3K1N A;  4NF5 A;  1B0L A;  4ESX A;  4RNS A;  4ELQ A;  1LB8 A;  1MDP 1;  3KJ7 A;  3CFX A;  3VVD A;  3VFJ A;  2ONS A;  3MAM A;  3UIF A;  3C31 A;  1B51 A;  2I4B A;  3SET A;  4GL8 A;  2XHD A;  4R9G A;  2OCU A;  4IO3 A;  3IJX B;  2ALU A;  4TQU Q;  3TYH A;  4OHN A;  1D4N A;  4YB5 A;  2G29 A;  1FQE A;  3LUY A;  3L6G A;  3T22 A;  2QL3 A;  4F19 A;  3RGY A;  4G8N A;  3QAX A;  4HCY A;  2A5T A;  2F7C A;  1M5D A;  2Y7R A;  3CG1 A;  4QHQ A;  4Q0C A;  3KOT A;  3IL1 B;  4JWO A;  4NF6 B;  4JXI A;  1OLA A;  4NF8 B;  2I6E A;  4IY6 A;  4OFJ A;  5B7D A;  3M3L A;  3SDF A;  1MPC A;  4ZZA A;  1N7X A;  3MZB A;  4ZEC A;  3RT6 B;  1FQC A;  3MUQ A;  5JTY B;  1H76 A;  4R6Y A;  1IZ1 A;  1GR2 A;  1JW1 A;  2DE3 A;  3TCG A;  5TPA B;  4XIG Q;  1MY2 A;  3OEL A;  5DVI A;  1BLF A;  3E4R A;  2XXW A;  4R72 A;  4QFN A;  2DE4 A;  4FED A;  2DWH A;  3KSJ A;  4YKI A;  3H3G A;  3MP8 A;  4QSD A;  1MQG A;  1MY0 A;  4R9F A;  1MY1 A;  4MLV A;  5H8H A;  2HXW A;  4PFY A;  2GH9 A;  5KDT B;  3PD8 A;  3W15 C;  2VD2 A;  5TP9 B;  3HPI A;  2ONR A;  4BLA A;  3TTR A;  1Y20 A;  4ND9 A;  5CMK A;  1QW0 A;  1SD3 A;  4OFO A;  1TWY A;  4EQ7 A;  1N0T A;  1NKX A;  3IAZ A;  3TCH A;  3T93 B;  3HHG A;  4KCC A;  3QUF A;  4OYV A;  1QJM A;  4H8J A;  3OMB A;  1MXU A;  2VP1 A;  4GXA A;  1FW0 A;  3DP6 A;  2D5W A;  4G8H A;  2UYF A;  3ZSF A;  4QSE A;  4G77 A;  3ODB A;  2IEE A;  4OXV A;  4P11 A;  4C1T A;  1I69 A;  3FXR A;  4H5G A;  5AA4 B;  2XXR A;  3LSW A;  4NF4 A;  1MPD A;  5H8Q A;  2R71 A;  1T0K A;  2PBW A;  1PB8 A;  3MVY A;  3VE1 B;  1B3F A;  1ZMG A;  4RY1 A;  3DLN A;  2X7P A;  4KYD A;  1R1N A;  3U92 A;  3SEY A;  4MH5 A;  3CRB A;  1F9B A;  3ECR A;  3KN8 A;  4MBP A;  1FQD A;  2VOZ A;  3G3F A;  1B5J A;  1AIV A;  2HFB A;  2DE2 A;  3PGF A;  3D4G A;  4TLL B;  3Q29 A;  4LZ7 A;  2F97 A;  1ZIU A;  1B3G A;  1NFT A;  4X9T A;  2UVH A;  3FXQ A;  2Q89 A;  2AYS A;  4N07 A;  3CIJ A;  4E0X A;  1Y3Q A;  3S9M C;  1ZLQ A;  5K2Y A;  2THI A;  2PMS A;  1Y1Z A;  4ZDM A;  1B05 A;  3S4U A;  2DOJ A;  1Q1K A;  1XOC A;  2OWS A;  5CBS A;  2GHA A;  1SI0 A;  1B32 A;  4YKK A;  3RN8 A;  3C9H A;  1NH8 A;  5DYH A;  2E1S A;  3KBR A;  3T9X B;  1MS7 A;  3W9W A;  1MPB A;  2I49 A;  4XTC Q;  3VXC A;  3GZG A;  4KR5 A;  3N94 A;  3OO8 A;  2ZYO A;  4FEC A;  4YU0 A;  2RKM A;  1UTB A;  4U1O A;  4H67 A;  4NMY A;  1RYX A;  4F2Q A;  1ZJL A;  4ZEB A;  3VVE A;  1P1N A;  5ELV A;  3S2V A;  1M5C A;  2WKY A;  3U8Q A;  2Y7W A;  4RK2 A;  3LBS A;  2I3V A;  2Z23 A;  1MY4 A;  5H8N A;  3THI A;  1I6Q A;  1DPP A;  2OJT A;  1OVB A;  2XXI A;  1QVS A;  1ZBM A;  4LZ5 A;  3C35 A;  1Q35 A;  4FIM A;  4PE5 B;  2DWA A;  3KOS A;  1TFA A;  4M4G A;  2ZNS A;  4EQB A;  1QUL A;  4OEU A;  5I2N B;  1PDA A;  3VDF A;  2OLB A;  3ZS6 A;  3UGW A;  3TFL A;  5EHS A;  5KZT A;  4RK9 A;  2O69 A;  4IO2 A;  2CMO A;  1LAG E;  3JV9 A;  1SI1 A;  2Q2A A;  3B6Q A;  4BDM A;  1B9J A;  2XD2 A;  3GLB A;  1B7H A;  4RYA A;  3OO6 A;  4U22 A;  1N04 A;  4EUO A;  3MVX A;  3KJT A;  3IOT A;  4KHZ E;  3MW0 A;  1MRP A;  4R74 A;  4F3P A;  4U2R A;  4GIZ A;  1Y3P A;  5L9M A;  3MVW A;  1S50 A;  1LLS A;  3FD3 A;  1MXY A;  4Z0I A;  2B65 A;  1LB9 A;  3TTK A;  5I84 A;  3Q28 A;  3RTF B;  1D3K A;  2XXX A;  2KLF A;  2R9J A;  3OO7 A;  4YMA A;  4X1B A;  3BFT A;  1IIT A;  4NTL A;  1WOD A;  4POX A;  1SQY A;  3OOA A;  1TXF A;  4GXS B;  3PPO A;  1B0H A;  4E0W A;  3CI8 A;  4NWD A;  5I56 B;  4I9D A;  3RY3 A;  2G93 A;  5ITP A;  4ESW A;  5AA2 B;  1LBB A;  2RIN A;  1N3W A;  5FTH A;  2UVJ A;  5KCJ A;  2V84 A;  4ZED A;  3PU5 A;  4EXK A;  3IB2 A;  4JWY A;  1JVX A;  1FTO A;  3FV2 A;  4HW8 A;  2Y84 A;  2YJP A;  4G68 B;  1LFI A;  3RTW B;  1NL5 A;  5I58 A;  2E0S A;  2F78 A;  4OWD A;  2M8C A;  3O97 A;  2F35 A;  1A55 A;  1LAF E;  4Z7E A;  2F6G A;  1B46 A;  5A5X B;  3L6H A;  5B70 A;  1GGG A;  1J1N A;  4OFL A;  3K6V A;  4TLM B;  3VLV A;  4ECF A;  1Y3N A;  1N3X A;  3N26 A;  1PB7 A;  1FQB A;  1USY E;  3LR1 A;  1HSE A;  1UTH A;  2V93 A;  2I58 A;  1QUK A;  1OQH A;  4LA9 A;  4U4S A;  2I4C A;  1SW5 A;  1JNF A;  3CR9 A;  3B6W A;  5CI5 A;  1B6H A;  1USY H;  3B7D A;  3KG2 A;  5DT6 A;  2PX1 A;  3RT8 A;  1JW4 A;  4LVQ A;  1AOV A;  1B3E A;  3P7I A;  2DWI A;  1BIY A;  3HST A;  1D9Y A;  4I8C A;  1L5T A;  4WXJ A;  4ZEI A;  3FV1 A;  2VHA A;  3M3F A;  3IOR A;  5L9S A;  1DPE A;  1OVT A;  1RYO A;  4QFK A;  2I48 A;  1S7Y A;  4HCW A;  3JYR A;  1LST A;  3N6U A;  2UXA A;  2DQV A;  3K2D A;  5H8F A;  4G4P A;  5FHN A;  4OQO A;  4POW A;  4X48 A;  5H8S A;  1URG A;  1Z7N E;  1MQD A;  4RJZ A;  4JBZ A;  1MQI A;  1JVY A;  1LBC A;  4F31 B;  4KFQ A;  3Q25 A;  2ZNT A;  4DCX A;  5I59 B;  3FAT A;  2O51 A;  1YCJ A;  4QSC A;  4JWX A;  5TU0 A;  2QMX A;  5L8D A;  2I0C A;  4IB2 A;  2REJ A;  3PPQ A;  3TDJ A;  1MXV A;  2QSX A;  2H25 A;  2XXY A;  2PT2 A;  2HZL A;  1LFH A;  3LSX A;  3SEX A;  3PD9 A;  2B3B A;  1FTM A;  1EZP A;  3N5L A;  1GV8 A;  4XXU A;  1IEJ A;  1MQJ A;  3TQW A;  3C4M A;  4HS7 A;  3I6V A;  3MWB A;  3I3V A;  1OQG A;  2DYX A;  4P0I A;  1LAX A;  3MBP A;  4NWC A;  1D9V A;  1P1Q A;  3H6W A;  3MPL A;  5I57 A;  3U72 A;  5I2K A;  1IUD A;  1LCT A;  2V3T A;  3VXB A;  3S9N C;  2FNC A;  3O6I A;  5L9O A;  4QRZ A;  4F18 A;  2XXH A;  1POT A;  1US5 A;  2PYY A;  3PPP A;  3OSQ A;  3SEV A;  3K6W A;  3O29 A;  4PFT A;  1Y1M A;  3KGC A;  4FEB A;  1EH3 A;  1FQF A;  4YAH X;  2XXT A;  4XKR A;  1XS5 A;  1YTV A;  1YAE A;  1RKM A;  3U94 A;  4XKQ A;  2H98 A;  4EF2 A;  2H4I A;  2D21 A;  1MM7 A;  1O7T A;  4OEN A;  5AA2 A;  4NF5 B;  1P1U A;  3OEK A;  1B1H A;  1O63 A;  1UIU A;  2R6G E;  3CVG A;  1H3D A;  4HTG A;  3PUW E;  3WAF A;  5AE4 A;  1BP5 A;  3G3G A;  5M2V A;  3FZV A;  4ISU A;  3FJ7 A;  3H03 A;  4EXL A;  4ZE9 A;  4UAC A;  3OXN A;  1AMF A;  5BWJ A;  3KFM A;  3O6H A;  1DTG A;  4O3B A;  3G7W A;  4WED A;  2F36 A;  2AIX A;  2O84 X;  3ZKK A;  3KEI A;  4PET A;  3IOV A;  1IIW A;  5A5X A;  2H99 A;  2Q2C A;  5BUU A;  3K00 A;  3E13 X;  5J1D A;  2XX8 A;  1GTK A;  4QFP A;  3CSB A;  1LFG A;  5CMB A;  3OD7 A;  1JW5 A;  4IGR A;  4M1V A;  4L17 A;  3LSF B;  3MZ1 A;  2A5T B;  3M8U A;  5DEX B;  3U93 A;  2DXR A;  1B5I A;  3IOU A;  3VLU A;  3TTN A;  3BFU A;  3H7M A;  2Q9T A;  4AB6 A;  2H9B A;  5IKB A;  1KWH A;  4YKP A;  3K1M A;  2NVU B;  2O68 A;  3U1O A;  4KQP A;  1SYI A;  3PV0 E;  1A99 A;  4Q5T A;  3TEP A;  3PUV E;  3V89 B;  3DM0 A;  3WAE A;  1I6B A;  4O3C A;  4FAT A;  5HM4 B;  3HN0 A;  3O66 A;  1UQW A;  4BDN A;  3QUJ A;  3A3U A;  4NF6 A;  4H6D A;  4NF8 A;  3QYT A;  1LCF A;  3IR1 A;  2P1S A;  2QJE A;  2Z22 A;  1CB6 A;  4MFI A;  2RC7 A;  3DP8 A;  3OO9 A;  1FTK A;  1S9T A;  3PUZ E;  1XC1 A;  4H8I A;  4U1Z A;  3K6U A;  1LGB C;  2Q88 A;  4H0W A;  5H8H B;  5AA1 A;  4AQ4 A;  1URD A;  2OBG A;  5JEI A;  2HCA A;  4ZEF A;  4GOT A;  2QS4 A;  3PMV A;  3G3I A;  3SEW A;  2XXV A;  4GF8 A;  3K6X A;  4KI0 E;  5JTY A;  1DTZ A;  3KSX A;  1XT8 A;  4OET A;  3PPN A;  1BKA A;  3T9H B;  3SER A;  3QXM A;  5TPA A;  3F11 A;  5CRY A;  4BDR A;  1ATG A;  1IQ7 A;  2B3F A;  3MPK A;  1OMP A;  5JK4 A;  1MY3 A;  3FVG A;  3FXU A;  3QIM A;  2REG A;  3ZKL A;  4OMB A;  3MVZ A;  5KDT A;  1A8E A;  3GXA A;  5TP9 A;  2F5X A;  3C36 A;  3G3H A;  1JET A;  2NWJ A;  5IAI A;  4DLD A;  2QS3 A;  2ZYM A;  2AL4 A;  3GBA A;  3H6U A;  2ABH A;  4NF4 B;  3PMX A;  5H8Q B;  1B3L A;  4GWO A;  3RUM A;  4K3F A;  1NH7 A;  1NNP A;  3PPR A;  3ONM A;  2CZL A;  2FA7 A;  1P1W A;  4FAJ A;  4LAT A;  2P0S A;  3PUX E;  1B1X A;  1B4Z A;  2QMW A;  3SES A;  3OEM A;  4XKP A;  3N6T A;  1M5F A;  2ZNU A;  4KYE A;  3R26 A;  4QF9 A;  3H6V A;  3GBB A;  2DSF A;  2NUV A;  4ELP A;  5ISU A;  4GFR A;  5AA4 A;  3EQ1 A;  3FUZ A;  4Q30 B;  5FTI A;  3B6T A;  4R73 A;  3OSR A;  4GQO A;  1LAH E;  2YLN A;  5F7V A;  2F34 A;  2RCA A;  1N7W A;  4U23 A;  2PVU A;  4KYS A;  4IGT A;  1ZU0 A;  3Q26 A;  3FVN A;  3FIR A;  1B2H A;  2LAO A;  1DOT A;  3TTM A;  3G3K A;  4JSD A;  4NE4 A;  3CFL A;  3E9X A;  3FJG A;  4DE8 A;  2BJJ X;  4U21 A;  3EPE A;  5DVJ A;  4KD5 A;  4H65 A;  3V83 A;  2F8D A;  3OEN A; 
#chains in the Genus database with same CATH topology
 4F1V A;  2I3W A;  3MP6 A;  2Y7P A;  5EQ9 A;  2QFL A;  1SW4 A;  3CFZ A;  4GD5 A;  3W9V A;  1BTJ A;  3G3J A;  4N6P A;  4F2O A;  5ET5 A;  1NNF A;  3EN3 A;  1JQF A;  1H44 A;  3ISP A;  3JZJ A;  1A54 A;  4OTE A;  4PFW A;  1PEB A;  4JDF A;  2HZK A;  4YMB A;  4I62 A;  1KZ8 A;  1UTB B;  4P0G A;  3TPA A;  2QS1 A;  3MST A;  1GVC A;  4YIC A;  1SW2 A;  1FQA A;  4LN5 A;  5FHM A;  1ZTY A;  3UA8 A;  3EF7 A;  4IO4 A;  3K01 A;  3KZG A;  1XVX A;  1US4 A;  2H5Y A;  2F7B A;  5IZ3 A;  3EHS A;  5H8N B;  4F1Y A;  4DDD A;  4PFU A;  2Z8D A;  2DP8 A;  2Q8J A;  1NV6 A;  1B52 A;  2XWV A;  5CMM A;  5DEX A;  4RPN A;  5I7I A;  2HEU A;  4HXV A;  4F22 A;  4C0R A;  3ILU B;  3CSG A;  4OER A;  4I40 A;  1PB9 A;  4MNI A;  1URS A;  5LOM A;  1YPN A;  2GQ1 A;  3IB0 A;  2WBD A;  2V4C A;  4OVT A;  4PDD A;  2V25 A;  2ZXT A;  4PGN A;  2GFE A;  5IZZ A;  3FXB A;  4KPT A;  3MC2 A;  3M3K A;  3UK4 A;  2RC9 A;  2VGQ A;  3C33 A;  5CMC A;  1NUW A;  3IFC A;  2DVZ A;  2FIX A;  2XD3 A;  2HAV A;  3TUS A;  5LTC A;  1XHY A;  4QFL A;  3V8X B;  2W7Y A;  4ZEK A;  1P1O A;  3K1P A;  3K4U A;  3Q27 A;  3V5A A;  3FAS A;  4X04 A;  4F1U A;  1VFD A;  2PT1 A;  4P1L A;  2UYE A;  3C32 A;  4JVD A;  4U4X A;  3TQL A;  1B7Z A;  3HHF A;  5I2N A;  1FTL A;  3E3K A;  4F29 A;  1H43 A;  1II5 A;  2IA4 A;  1MH4 A;  1FBG A;  3I5O A;  4JSO A;  1NV5 A;  2Y5K A;  2O1L A;  3RLF E;  1LBV A;  2DXY A;  3TZA A;  1QUJ A;  2ESN A;  4G68 C;  1IXC A;  4FOR A;  4C1U A;  3FVO A;  3PUY E;  2P2A A;  3H4Z A;  3EHU A;  2ZZW A;  3PMW A;  4IO5 A;  2AL5 A;  1YZ0 A;  1EZO A;  1HSL A;  1A40 A;  4R6K A;  2Y5L A;  3TMG A;  1SW1 A;  1HSJ A;  5EQ8 A;  4GX6 A;  4PCD A;  3T66 A;  4ZE8 A;  4NX1 A;  4OZ9 A;  2XXU A;  3T9U A;  1PBP A;  3TAJ A;  3D1R A;  5KCJ B;  2HQ0 A;  4P1E A;  3BIG A;  1H45 A;  2XX9 A;  1B4H A;  3SEU A;  3O9P A;  5EHM A;  1Y4T A;  4DZ1 A;  2QRY A;  3FGS A;  5CC2 A;  4PBQ A;  4H1X A;  5I58 B;  1SVX B;  4TOZ A;  3DP4 A;  2JJK A;  2V3U A;  2OX3 A;  5J16 A;  1CE2 A;  1EZ9 A;  3O28 A;  2FYI A;  1LBW A;  2UVG A;  4FE8 A;  1VFE A;  5I56 A;  1MM6 A;  3D4C A;  4R2F A;  1QKB A;  1ELJ A;  3A3C A;  5IM2 A;  5ITO A;  1VR5 A;  4RXL A;  4G8M A;  4ZZE A;  1N84 A;  2WYP A;  5F1Q A;  5AA2 D;  3FVK A;  4MF3 A;  4H5F A;  3K0V A;  2O7U A;  3IO6 A;  1B40 A;  3O2A A;  3LC8 A;  4DXU A;  1DSN A;  4DCY A;  3FJM A;  4YB6 A;  4GVO A;  3BKI B;  1I6A A;  3MZ9 A;  5EYF A;  3IX1 A;  3IK6 B;  2Q8M A;  5HPQ A;  1UTH B;  4ZS9 A;  4PQJ A;  4PE3 A;  3TCF A;  3LUZ A;  1MDQ A;  4LZ8 A;  4LP2 B;  3TKD A;  4DXC A;  3CG3 A;  1MG1 A;  4MNC A;  1MQH A;  3HFU A;  3SKP A;  2O1M A;  4LUB A;  4G68 A;  4IO7 A;  3USD A;  2WYK A;  4PF6 A;  1B58 A;  4EDP A;  4N4U A;  1IXH A;  1EU8 A;  3UN6 A;  3QSL A;  3HO7 A;  4BDL A;  1FTJ A;  1POY 1;  2ANJ A;  3LSL A;  1UIV A;  3T96 B;  4WEP A;  1OIB A;  1VSO A;  1NV4 A;  2HPG A;  4LON B;  1ZKB A;  1LBZ A;  1QKA A;  5FHO A;  4MCO A;  2RC8 A;  4LQ5 A;  2F3B A;  4GL0 A;  1OLC A;  1EYJ A;  3O6G A;  1AL3 A;  3K02 A;  4OEV A;  1B5H A;  1NUY A;  4GLI A;  4BDQ A;  1AH5 A;  1FPI A;  5HBC A;  4ELR A;  1FBE A;  1TT1 A;  1LBX A;  1R6Z A;  3VV5 A;  4N81 A;  5H8F B;  5IZ1 A;  4F3S A;  2O6A A;  1P99 A;  2VD3 A;  2V3Q A;  3UOR A;  1B7U A;  1MH3 A;  3VVF A;  1MXZ A;  1PC3 A;  2YPN A;  2QPQ A;  4OVJ A;  4R75 A;  4JB7 A;  5IGA A;  2XXQ A;  4X1D A;  1NNK A;  2GRV A;  1XVY A;  4F39 A;  3RNN A;  1JEV A;  2DWJ A;  4IO6 A;  1WVJ A;  4R6H A;  5DVF A;  2RF1 A;  1IXI A;  2P3V A;  2I0B A;  4MLQ A;  4LQ2 A;  2XX7 A;  4Q8R A;  2ONK E;  2F7A A;  2NOO A;  2GHB A;  2UVI A;  2F6P A;  1SBP A;  1SYH A;  2QVU A;  1A7L A;  1KA1 A;  2QS2 A;  1FBD A;  3TOD A;  4G2Z A;  1NV7 A;  2ZMB A;  4GWW A;  1Y9U A;  3MP1 A;  4H46 A;  3TEL A;  2NXO A;  3R6U A;  2D3I A;  4IY5 A;  4GRK A;  3TTL A;  3HV1 A;  4I3Y A;  2XXP A;  2A5S A;  3VLW A;  4RA1 A;  3KN3 A;  5I59 A;  1DMB A;  4EF1 A;  3HCQ A;  2B4M A;  5K2X A;  1G0I A;  2OK2 A;  3S9L C;  4THI A;  4PP0 A;  4F3G A;  4RPO A;  4AB5 A;  1G0H A;  3C34 A;  3FBP A;  1B3H A;  5I57 B;  3DEL B;  5I2K B;  4GBW A;  4EQ9 A;  1QUI A;  4BDO A;  2R8T A;  2O7I A;  4QFO A;  4R2B A;  2X7Q A;  4OES A;  3IO4 A;  3UP9 A;  2OZZ A;  2HAU A;  5AA3 A;  1FCK A;  1FRP A;  5I5P A;  5ICQ A;  3ILT B;  2Y7I A;  3KN7 A;  2X26 A;  1M5B A;  2ZYK A;  1YYZ A;  3R7X A;  1M5E A;  2Y7K A;  1FBH A;  3RQT A;  1R9Q A;  3MJN A;  1VE4 A;  3EKI A;  4DXB A;  1Y4C A;  2Z8F A;  4NED A;  1ANF A;  1Z7M E;  4ELO A;  3RPW A;  4F3B A;  4YB7 A;  2DVC A;  1MXX A;  1JEU A;  3A09 A;  2ZYN A;  1PBQ A;  1IXG A;  4KCD A;  3MQ9 A;  4YZZ A;  3IB1 A;  4O7I A;  5ICT A;  4WKM A;  4DIG A;  3BBR A;  4N13 A;  5CBR A;  3S9E A;  1NMU A;  3H06 B;  3IOW A;  2DS9 A;  3EHT A;  1O64 A;  4O3A A;  4ONY A;  4XKN A;  1N76 A;  4FJP A;  5DTB A;  1IMC A;  5CM6 A;  3AXF A;  5ET8 A;  2OWT A;  1NNT A;  2Z8E A;  1SDX A;  4I1D A;  4HE1 A;  5FBP A;  4YKJ A;  4HE2 A;  1A8F A;  1R9L A;  3H6T A;  4N6D A;  3QK6 A;  1TFD A;  4UA8 A;  3T9V A;  1MXW A;  3NOH A;  2RCB A;  3IJO B;  4X8R A;  1WDN A;  3K1N A;  4NF5 A;  4NG7 A;  1B0L A;  2FHY A;  4ESX A;  4RNS A;  4ELQ A;  1LB8 A;  1MDP 1;  3KJ7 A;  3CFX A;  3VVD A;  3VFJ A;  2ONS A;  3MAM A;  3UIF A;  3C31 A;  1B51 A;  2I4B A;  3SET A;  4GL8 A;  2XHD A;  4P47 A;  4R9G A;  2OCU A;  4IO3 A;  3IJX B;  2ALU A;  4TQU Q;  3TYH A;  4OHN A;  4N15 A;  1D4N A;  4YB5 A;  2G29 A;  1FQE A;  3LUY A;  3L6G A;  4PFI A;  3T22 A;  2QL3 A;  4F19 A;  3RGY A;  4G8N A;  3QAX A;  3MYU A;  4HCY A;  2A5T A;  2F7C A;  1M5D A;  2Y7R A;  3CG1 A;  4QHQ A;  4Q0C A;  4QBA A;  3KOT A;  3IL1 B;  4JWO A;  4NF6 B;  4JXI A;  1FBF A;  4NF0 A;  1OLA A;  4O94 A;  4NF8 B;  2I6E A;  4IY6 A;  1K9Z A;  4OFJ A;  5B7D A;  3M3L A;  3SDF A;  1MPC A;  4PDH A;  4ZZA A;  4DI4 B;  1N7X A;  3MZB A;  4PBH A;  2PFY A;  4ZEC A;  3RT6 B;  1FQC A;  3MUQ A;  5JTY B;  1H76 A;  4R6Y A;  1IZ1 A;  1GR2 A;  2CZI A;  1JW1 A;  1LEV A;  2DE3 A;  3TCG A;  5TPA B;  4XIG Q;  1MY2 A;  3OEL A;  4GX4 A;  2VT5 A;  1BLF A;  5DVI A;  3E4R A;  2XXW A;  4R72 A;  4QFN A;  2DE4 A;  4FED A;  2DWH A;  3KSJ A;  4YKI A;  3H3G A;  3MP8 A;  4QSD A;  1MQG A;  1MY0 A;  4R9F A;  1MY1 A;  1NUX A;  4MLV A;  5H8H A;  2HXW A;  4PFY A;  2GH9 A;  5EQ7 A;  5KDT B;  3PD8 A;  3W15 C;  2VD2 A;  4N8Y A;  5TP9 B;  3HPI A;  2ONR A;  4BLA A;  3TTR A;  1Y20 A;  4P3L A;  1Q9D A;  4ND9 A;  3RPL B;  5CMK A;  1QW0 A;  1SD3 A;  4OFO A;  1TWY A;  4EQ7 A;  1N0T A;  1NKX A;  1KA0 A;  3IAZ A;  3T93 B;  3TCH A;  3HHG A;  4KCC A;  3QUF A;  4OYV A;  1QJM A;  2PFZ A;  4H8J A;  3CHG A;  2HHM A;  1XI6 A;  3OMB A;  2KQZ A;  1MXU A;  2VP1 A;  4GXA A;  1FW0 A;  1FBP A;  3DP6 A;  2D5W A;  4G8H A;  3ROJ A;  2UYF A;  3ZSF A;  4QSE A;  4G77 A;  1CNQ A;  3ODB A;  2IEE A;  4OXV A;  4P11 A;  4C1T A;  1I69 A;  3FXR A;  4H5G A;  5AA4 B;  2XXR A;  1EYK A;  3LSW A;  4NF4 A;  1MPD A;  5H8Q A;  2R71 A;  1T0K A;  2PBW A;  1PB8 A;  3RYD A;  3MVY A;  1BK4 A;  4AS4 A;  3VE1 B;  1B3F A;  1ZMG A;  4RY1 A;  3DLN A;  2X7P A;  2MKZ A;  4KYD A;  4PTK A;  1R1N A;  4XEQ A;  2XXK A;  3U92 A;  4GX3 A;  3SEY A;  4MH5 A;  1FPK A;  3CRB A;  1F9B A;  3ECR A;  2PCR A;  3KN8 A;  4MBP A;  4MNP A;  1FQD A;  2VOZ A;  3G3F A;  1B5J A;  1AIV A;  3KBZ A;  2HFB A;  4I3E A;  2DE2 A;  3PGF A;  3D4G A;  4TLL B;  2XWI A;  3Q29 A;  4LZ7 A;  2F97 A;  1ZIU A;  1B3G A;  1NFT A;  4GWZ A;  4X9T A;  2UVH A;  4PC9 A;  3FXQ A;  2Q89 A;  5EYG A;  2AYS A;  4N07 A;  4P56 A;  2KR0 A;  3CIJ A;  2F3D A;  4E0X A;  1Y3Q A;  3S9M C;  1ZLQ A;  5K2Y A;  2THI A;  2PMS A;  1Y1Z A;  4ZDM A;  1B05 A;  2WBB A;  2QVV A;  3S4U A;  2DOJ A;  1NUZ A;  1Q1K A;  2P3N A;  1XOC A;  2ZZX A;  2OWS A;  5CBS A;  5IZ3 B;  2GHA A;  2FIE A;  1SI0 A;  1B32 A;  4YKK A;  3RN8 A;  1JP4 A;  1NH8 A;  3C9H A;  5DYH A;  1NI9 A;  2E1S A;  3IFA A;  3KBR A;  3T9X B;  1MS7 A;  1IMB A;  3W9W A;  1MPB A;  2I49 A;  4MJO A;  4XTC Q;  3VXC A;  3GZG A;  4KR5 A;  3N94 A;  3OO8 A;  2ZYO A;  4FEC A;  4YU0 A;  1FPG A;  2RKM A;  1DK4 A;  2DDK A;  2CZK A;  1UTB A;  4U1O A;  1IME A;  4H67 A;  4NMY A;  1RYX A;  4F2Q A;  3U65 A;  1ZJL A;  4ZEB A;  3VVE A;  1P1N A;  5ELV A;  3S2V A;  1M5C A;  2WKY A;  3U8Q A;  2Y7W A;  4RK2 A;  3LBS A;  2I3V A;  2Z23 A;  1MY4 A;  5H8N A;  3THI A;  1I6Q A;  1DPP A;  2OJT A;  1OVB A;  2XXI A;  1QVS A;  1YXI A;  1ZBM A;  4LZ5 A;  3C35 A;  1Q35 A;  1RDZ A;  4FIM A;  2DWA A;  4PE5 B;  3KOS A;  1TFA A;  4GWY A;  4PAK A;  4M4G A;  2ZNS A;  4EQB A;  1QUL A;  4OVR A;  4XF5 A;  2WEF A;  4OEU A;  5I2N B;  1PDA A;  3VDF A;  2OLB A;  3ZS6 A;  3UGW A;  4NAP A;  3TFL A;  5EHS A;  5KZT A;  4RK9 A;  2O69 A;  4IO2 A;  2CMO A;  1LAG E;  1EYI A;  3JV9 A;  1SI1 A;  3E79 A;  2Q2A A;  3B6Q A;  4BDM A;  1B9J A;  2XD2 A;  3GLB A;  1B7H A;  4RYA A;  3OO6 A;  4UAB A;  4U22 A;  1N04 A;  4EUO A;  3MVX A;  3KJT A;  3IOT A;  4KHZ E;  3MW0 A;  1MRP A;  4R74 A;  4F3P A;  4U2R A;  5EQA A;  4GIZ A;  1Y3P A;  4PAF A;  5L9M A;  3MVW A;  4GWS A;  1S50 A;  1LLS A;  3FD3 A;  1MXY A;  4Z0I A;  2B65 A;  1LB9 A;  3TTK A;  5I84 A;  1FTA A;  3Q28 A;  3RTF B;  1D3K A;  2XXX A;  2KLF A;  2R9J A;  3OO7 A;  4YMA A;  4X1B A;  3BFT A;  1IIT A;  4NTL A;  2L5V A;  4JVI A;  1WOD A;  4POX A;  1SQY A;  5ET7 A;  3OOA A;  1TXF A;  4GXS B;  3PPO A;  1B0H A;  3PTY A;  1FPE A;  4E0W A;  3CI8 A;  3T1B A;  4NWD A;  2FBP A;  5I56 B;  4I9D A;  4NN3 A;  3RY3 A;  2G93 A;  5ITP A;  4ESW A;  5AA2 B;  1LBB A;  2RIN A;  1N3W A;  4JVC A;  5FTH A;  2UVJ A;  5KCJ A;  2V84 A;  4ZED A;  3PU5 A;  4EXK A;  4IR8 A;  3IB2 A;  4JWY A;  1JVX A;  3SZP A;  1FTO A;  3FV2 A;  4HW8 A;  2Y84 A;  2YJP A;  4G68 B;  1LFI A;  3RTW B;  1NL5 A;  5I58 A;  2E0S A;  2F78 A;  4OWD A;  2M8C A;  3O97 A;  2F35 A;  1A55 A;  1LAF E;  4Z7E A;  2F6G A;  1B46 A;  3KC1 A;  5A5X B;  3L6H A;  3B50 A;  5B70 A;  1GGG A;  1J1N A;  4OFL A;  3K6V A;  4TLM B;  3VLV A;  4ECF A;  1Y3N A;  1N3X A;  3N26 A;  1PB7 A;  1FQB A;  1USY E;  3LR1 A;  1HSE A;  1UTH A;  2V93 A;  2I58 A;  1QUK A;  1OQH A;  4LA9 A;  4U4S A;  2I4C A;  4G61 A;  4GBV A;  1SW5 A;  1JNF A;  3CR9 A;  3B6W A;  5CI5 A;  1B6H A;  1USY H;  1INP A;  3B7D A;  3KG2 A;  3KC0 A;  5DT6 A;  2PX1 A;  3RT8 A;  1AWB A;  1JW4 A;  4LVQ A;  1AOV A;  1B3E A;  3P7I A;  1FPJ A;  2DWI A;  1BIY A;  2FVZ A;  3HST A;  1D9Y A;  4I8C A;  1L5T A;  4WXJ A;  4ZEI A;  3FV1 A;  2VHA A;  4GWU A;  3M3F A;  4HE0 A;  3IOR A;  5L9S A;  3A29 A;  1DPE A;  1OVT A;  1RYO A;  4QFK A;  2I48 A;  2XWK A;  1S7Y A;  4HCW A;  3JYR A;  1FPF A;  1LST A;  3N6U A;  2UXA A;  2DQV A;  3K2D A;  5H8F A;  4G4P A;  5FHN A;  4OQO A;  4POW A;  4KXP A;  4X48 A;  5H8S A;  1URG A;  4MMP A;  4PF8 A;  1Z7N E;  1MQD A;  4RJZ A;  4JBZ A;  1MQI A;  1JVY A;  1LBC A;  4OVS A;  4F31 B;  4KFQ A;  1FPB A;  3Q25 A;  2ZNT A;  4DCX A;  5I59 B;  4PFR A;  3FAT A;  2O51 A;  1YCJ A;  4QSC A;  4JWX A;  5TU0 A;  2QMX A;  5L8D A;  4PGP A;  2I0C A;  4IB2 A;  2REJ A;  3PPQ A;  4P8B A;  3TDJ A;  2QVR A;  4P9K A;  1MXV A;  2QSX A;  5I3S A;  2H25 A;  2XXY A;  1RDX A;  2PT2 A;  2ZZV A;  2HZL A;  1LFH A;  3LSX A;  3SEX A;  3PD9 A;  2B3B A;  1FTM A;  1EZP A;  3N5L A;  1GV8 A;  1DCU A;  4XXU A;  1IEJ A;  1MQJ A;  4O7M A;  3TQW A;  3C4M A;  4HS7 A;  5DW8 A;  3I6V A;  5T3J A;  3MWB A;  2Q74 A;  3I3V A;  5ESY A;  1OQG A;  2DYX A;  4P0I A;  1LAX A;  3MBP A;  4NWC A;  1D9V A;  1P1Q A;  1LBY A;  3H6W A;  4MIJ A;  1NV3 A;  3MPL A;  5I57 A;  3U72 A;  5I2K A;  1FJ9 A;  1IUD A;  1LCT A;  2V3T A;  3VXB A;  4AS5 A;  2CEX A;  3S9N C;  2FNC A;  4XFE A;  3O6I A;  5L9O A;  4QRZ A;  4F18 A;  2XXH A;  4OAN A;  3GYY A;  1POT A;  1QGX A;  1US5 A;  2PYY A;  3PPP A;  3OSQ A;  1NV2 A;  3SEV A;  3K6W A;  3O29 A;  4PFT A;  1Y1M A;  3KGC A;  4FEB A;  1EH3 A;  1FQF A;  4YAH X;  2XXT A;  4XKR A;  4PFB A;  1XS5 A;  1YTV A;  1YAE A;  1RKM A;  2VPN A;  3U94 A;  4XKQ A;  2H98 A;  4EF2 A;  2H4I A;  2D21 A;  1FJ6 A;  1MM7 A;  1O7T A;  4OEN A;  5AA2 A;  4NF5 B;  1P1U A;  3OEK A;  1B1H A;  1O63 A;  1UIU A;  2R6G E;  4N17 A;  3CVG A;  1H3D A;  4HTG A;  3PUW E;  3WAF A;  5AE4 A;  4MX6 A;  1BP5 A;  3G3G A;  5M2V A;  3FZV A;  4ISU A;  1FPL A;  3FJ7 A;  3H03 A;  4EXL A;  4ZE9 A;  4UAC A;  3OXN A;  1AMF A;  1SPI A;  5BWJ A;  3KFM A;  3O6H A;  1DTG A;  4O3B A;  2HXR A;  3G7W A;  4WED A;  2F36 A;  2AIX A;  1IMA A;  2O84 X;  3ZKK A;  3KEI A;  4PET A;  4N91 A;  3IOV A;  1IIW A;  5A5X A;  3E78 A;  2H99 A;  2Q2C A;  5BUU A;  3K00 A;  3E13 X;  4O8M A;  5J1D A;  2XX8 A;  1GTK A;  4QFP A;  3CSB A;  1LFG A;  5CMB A;  3OD7 A;  1JW5 A;  4IGR A;  4M1V A;  4L17 A;  5ET6 A;  3LSF B;  3MZ1 A;  2A5T B;  4QXD A;  3M8U A;  4NGU A;  5DEX B;  3U93 A;  2DXR A;  1B5I A;  1FPD A;  4OA4 A;  3IOU A;  3VLU A;  3TTN A;  3BFU A;  3H7M A;  2Q9T A;  4AB6 A;  2H9B A;  5IKB A;  1KWH A;  4YKP A;  2WX9 A;  1FBC A;  3K1M A;  2NVU B;  2O68 A;  3U1O A;  4KQP A;  3LV0 A;  1SYI A;  3PV0 E;  4N8G A;  4N6K A;  1A99 A;  4Q5T A;  3T0J A;  3QMF A;  3TEP A;  3PUV E;  3V89 B;  3DM0 A;  3WAE A;  1I6B A;  4O3C A;  4FAT A;  4H45 A;  5HM4 B;  3HN0 A;  3O66 A;  1UQW A;  4BDN A;  3QUJ A;  3A3U A;  4NF6 A;  4H6D A;  4FBP A;  4NF8 A;  3QYT A;  1LCF A;  3IR1 A;  2P1S A;  2B4L A;  2QJE A;  2Z22 A;  5EYH A;  1CB6 A;  4MFI A;  2RC7 A;  3DP8 A;  3OO9 A;  4NHB A;  1FTK A;  1S9T A;  3PUZ E;  1VDW A;  1XC1 A;  4H8I A;  4U1Z A;  4MAG A;  5A5L A;  3K6U A;  1LGB C;  1K9Y A;  4DI3 D;  2Q88 A;  4H0W A;  5H8H B;  5AA1 A;  4AQ4 A;  1URD A;  2OBG A;  5JEI A;  2HCA A;  4ZEF A;  4GOT A;  2QS4 A;  3PMV A;  3B8B A;  3G3I A;  3SEW A;  2XXV A;  4GF8 A;  3K6X A;  4KI0 E;  5JTY A;  1IMF A;  1DTZ A;  3KSX A;  1XT8 A;  4OVP A;  4OET A;  2OWZ A;  2BJI A;  3PPN A;  1BKA A;  3T9H B;  3SER A;  3BIH A;  3QXM A;  4NQ8 A;  5TPA A;  3F11 A;  5CRY A;  2CZH A;  4BDR A;  1ATG A;  1IQ7 A;  2B3F A;  1DBZ A;  3MPK A;  1OMP A;  5JK4 A;  2XWO A;  1MY3 A;  3FVG A;  3FXU A;  3QIM A;  2REG A;  3ZKL A;  4OMB A;  3MVZ A;  5KDT A;  1A8E A;  3GXA A;  5TP9 A;  2F5X A;  3C36 A;  3G3H A;  1JET A;  2NWJ A;  5IAI A;  4DLD A;  2QS3 A;  2ZYM A;  4PAI A;  2AL4 A;  3GBA A;  3H6U A;  1RDY A;  2CEY A;  2ABH A;  4NF4 B;  3RPL A;  3PMX A;  5H8Q B;  1B3L A;  4GWO A;  3RUM A;  4K3F A;  1IMD A;  1NH7 A;  1NNP A;  3PPR A;  3ONM A;  2CZL A;  2FA7 A;  1P1W A;  4FAJ A;  4LAT A;  2P0S A;  3PUX E;  1B1X A;  1B4Z A;  1NV1 A;  2QMW A;  3SES A;  1FSA A;  3OEM A;  4XKP A;  3N6T A;  1M5F A;  2ZNU A;  4KYE A;  4GWX A;  3R26 A;  4QF9 A;  3H6V A;  3GBB A;  2DSF A;  2NUV A;  4ELP A;  4MEV A;  5ISU A;  4GFR A;  5AA4 A;  5LDZ A;  3EQ1 A;  4OVQ A;  3FUZ A;  4Q30 B;  5FTI A;  3B6T A;  4R73 A;  3OSR A;  4GQO A;  1LAH E;  2YLN A;  5F7V A;  1D9Q A;  2F34 A;  2RCA A;  1N7W A;  5F24 A;  4U23 A;  2PVU A;  4KYS A;  2XA5 A;  4IGT A;  1ZU0 A;  3Q26 A;  3FVN A;  3FIR A;  4MHF A;  1B2H A;  2LAO A;  1DOT A;  3TTM A;  3G3K A;  4JSD A;  4NE4 A;  3CFL A;  3E9X A;  3FJG A;  4DE8 A;  2BJJ X;  4U21 A;  3EPE A;  5DVJ A;  2VPO A;  4KD5 A;  1NV0 A;  4H65 A;  3V83 A;  2F8D A;  3OEN A; 
#chains in the Genus database with same CATH homology
 4F1V A;  2I3W A;  3MP6 A;  2Y7P A;  1SW4 A;  3CFZ A;  4GD5 A;  3W9V A;  1BTJ A;  3G3J A;  4N6P A;  4F2O A;  1NNF A;  3EN3 A;  1JQF A;  1H44 A;  3JZJ A;  1A54 A;  4OTE A;  4PFW A;  1PEB A;  4JDF A;  2HZK A;  4YMB A;  4I62 A;  1UTB B;  4P0G A;  3TPA A;  2QS1 A;  1GVC A;  4YIC A;  1SW2 A;  1FQA A;  5FHM A;  1ZTY A;  3UA8 A;  3EF7 A;  4IO4 A;  3K01 A;  3KZG A;  1XVX A;  1US4 A;  2H5Y A;  2F7B A;  3EHS A;  5H8N B;  4F1Y A;  4DDD A;  4PFU A;  2Z8D A;  2DP8 A;  2Q8J A;  1B52 A;  5CMM A;  5DEX A;  4RPN A;  2HEU A;  4F22 A;  4C0R A;  3ILU B;  3CSG A;  4OER A;  1PB9 A;  1URS A;  5LOM A;  1YPN A;  3IB0 A;  2V25 A;  2ZXT A;  2GFE A;  4KPT A;  3MC2 A;  3M3K A;  3UK4 A;  2RC9 A;  2VGQ A;  3C33 A;  5CMC A;  2DVZ A;  2XD3 A;  2HAV A;  3TUS A;  1XHY A;  4QFL A;  3V8X B;  2W7Y A;  4ZEK A;  1P1O A;  3K1P A;  3K4U A;  3Q27 A;  3V5A A;  3FAS A;  4F1U A;  1VFD A;  2PT1 A;  2UYE A;  3C32 A;  4U4X A;  3TQL A;  1B7Z A;  3HHF A;  5I2N A;  1FTL A;  3E3K A;  4F29 A;  1H43 A;  1II5 A;  2IA4 A;  1MH4 A;  3I5O A;  4JSO A;  2O1L A;  3RLF E;  2DXY A;  3TZA A;  1QUJ A;  2ESN A;  4G68 C;  1IXC A;  4FOR A;  4C1U A;  3FVO A;  3PUY E;  2P2A A;  3H4Z A;  3EHU A;  3PMW A;  4IO5 A;  2AL5 A;  1EZO A;  1HSL A;  1A40 A;  4R6K A;  3TMG A;  1SW1 A;  1HSJ A;  3T66 A;  4ZE8 A;  4OZ9 A;  2XXU A;  3T9U A;  1PBP A;  3TAJ A;  5KCJ B;  2HQ0 A;  1H45 A;  2XX9 A;  1B4H A;  3SEU A;  3O9P A;  5EHM A;  1Y4T A;  4DZ1 A;  2QRY A;  3FGS A;  5CC2 A;  4H1X A;  5I58 B;  1SVX B;  4TOZ A;  3DP4 A;  2V3U A;  1CE2 A;  1EZ9 A;  3O28 A;  2FYI A;  2UVG A;  4FE8 A;  1VFE A;  5I56 A;  1MM6 A;  3D4C A;  4R2F A;  1QKB A;  1ELJ A;  3A3C A;  5ITO A;  1VR5 A;  4RXL A;  4G8M A;  4ZZE A;  1N84 A;  5F1Q A;  5AA2 D;  3FVK A;  4MF3 A;  4H5F A;  3K0V A;  2O7U A;  3IO6 A;  1B40 A;  3O2A A;  3LC8 A;  4DXU A;  1DSN A;  4DCY A;  3FJM A;  4YB6 A;  4GVO A;  3BKI B;  1I6A A;  3MZ9 A;  5EYF A;  3IX1 A;  3IK6 B;  5HPQ A;  1UTH B;  4ZS9 A;  4PQJ A;  3TCF A;  1MDQ A;  4LZ8 A;  4LP2 B;  3TKD A;  4DXC A;  3CG3 A;  1MG1 A;  1MQH A;  3SKP A;  2O1M A;  4LUB A;  4G68 A;  4IO7 A;  3USD A;  1B58 A;  4EDP A;  1IXH A;  1EU8 A;  3UN6 A;  3QSL A;  3HO7 A;  4BDL A;  1FTJ A;  1POY 1;  2ANJ A;  3LSL A;  3T96 B;  1UIV A;  4WEP A;  1OIB A;  1VSO A;  4LON B;  1ZKB A;  1QKA A;  5FHO A;  2RC8 A;  4LQ5 A;  4GL0 A;  1OLC A;  3O6G A;  1AL3 A;  3K02 A;  4OEV A;  1B5H A;  4GLI A;  4BDQ A;  1AH5 A;  5HBC A;  4ELR A;  1TT1 A;  1R6Z A;  3VV5 A;  5H8F B;  4F3S A;  2O6A A;  1P99 A;  2VD3 A;  2V3Q A;  3UOR A;  1B7U A;  1MH3 A;  3VVF A;  1MXZ A;  1PC3 A;  2YPN A;  2QPQ A;  4OVJ A;  4R75 A;  4JB7 A;  2XXQ A;  4X1D A;  1NNK A;  2GRV A;  1XVY A;  4F39 A;  3RNN A;  1JEV A;  2DWJ A;  4IO6 A;  1WVJ A;  4R6H A;  5DVF A;  2RF1 A;  1IXI A;  2I0B A;  4MLQ A;  4LQ2 A;  2XX7 A;  4Q8R A;  2ONK E;  2F7A A;  2NOO A;  2GHB A;  2UVI A;  2F6P A;  1SBP A;  1SYH A;  1A7L A;  2QS2 A;  3TOD A;  4G2Z A;  2ZMB A;  1Y9U A;  3MP1 A;  3TEL A;  2NXO A;  3R6U A;  2D3I A;  4IY5 A;  4GRK A;  3TTL A;  3HV1 A;  2XXP A;  2A5S A;  3VLW A;  4RA1 A;  3KN3 A;  5I59 A;  1DMB A;  4EF1 A;  3HCQ A;  5K2X A;  2OK2 A;  3S9L C;  4THI A;  4PP0 A;  4F3G A;  4RPO A;  4AB5 A;  3C34 A;  1B3H A;  5I57 B;  3DEL B;  5I2K B;  4EQ9 A;  1QUI A;  4BDO A;  2O7I A;  4QFO A;  4R2B A;  2X7Q A;  4OES A;  3IO4 A;  3UP9 A;  2OZZ A;  2HAU A;  5AA3 A;  1FCK A;  5ICQ A;  3ILT B;  2Y7I A;  3KN7 A;  2X26 A;  1M5B A;  2ZYK A;  3R7X A;  1M5E A;  2Y7K A;  3RQT A;  1R9Q A;  3MJN A;  1VE4 A;  4DXB A;  1Y4C A;  2Z8F A;  4NED A;  1Z7M E;  1ANF A;  4ELO A;  3RPW A;  4F3B A;  4YB7 A;  2DVC A;  1MXX A;  1JEU A;  3A09 A;  2ZYN A;  1PBQ A;  1IXG A;  4KCD A;  3MQ9 A;  4YZZ A;  3IB1 A;  5ICT A;  4WKM A;  4DIG A;  3BBR A;  4N13 A;  5CBR A;  3S9E A;  1NMU A;  3H06 B;  3IOW A;  2DS9 A;  3EHT A;  1O64 A;  4O3A A;  4ONY A;  4XKN A;  1N76 A;  4FJP A;  5DTB A;  5CM6 A;  3AXF A;  2OWT A;  1NNT A;  2Z8E A;  1SDX A;  4I1D A;  4YKJ A;  1A8F A;  1R9L A;  3H6T A;  3QK6 A;  1TFD A;  4UA8 A;  3T9V A;  1MXW A;  2RCB A;  3IJO B;  1WDN A;  3K1N A;  4NF5 A;  1B0L A;  4ESX A;  4RNS A;  4ELQ A;  1LB8 A;  1MDP 1;  3KJ7 A;  3CFX A;  3VVD A;  3VFJ A;  2ONS A;  3MAM A;  3UIF A;  3C31 A;  1B51 A;  2I4B A;  3SET A;  4GL8 A;  2XHD A;  4R9G A;  2OCU A;  4IO3 A;  3IJX B;  2ALU A;  4TQU Q;  3TYH A;  4OHN A;  1D4N A;  4YB5 A;  2G29 A;  1FQE A;  3LUY A;  3L6G A;  3T22 A;  2QL3 A;  4F19 A;  3RGY A;  4G8N A;  3QAX A;  4HCY A;  2A5T A;  2F7C A;  1M5D A;  2Y7R A;  3CG1 A;  4QHQ A;  4Q0C A;  3KOT A;  3IL1 B;  4JWO A;  4NF6 B;  4JXI A;  1OLA A;  4NF8 B;  2I6E A;  4IY6 A;  4OFJ A;  5B7D A;  3M3L A;  3SDF A;  1MPC A;  4ZZA A;  1N7X A;  3MZB A;  4ZEC A;  3RT6 B;  1FQC A;  3MUQ A;  5JTY B;  1H76 A;  4R6Y A;  1IZ1 A;  1GR2 A;  1JW1 A;  2DE3 A;  3TCG A;  5TPA B;  4XIG Q;  1MY2 A;  3OEL A;  5DVI A;  1BLF A;  3E4R A;  2XXW A;  4R72 A;  4QFN A;  2DE4 A;  4FED A;  2DWH A;  3KSJ A;  4YKI A;  3H3G A;  3MP8 A;  4QSD A;  1MQG A;  1MY0 A;  4R9F A;  1MY1 A;  4MLV A;  5H8H A;  2HXW A;  4PFY A;  2GH9 A;  5KDT B;  3PD8 A;  3W15 C;  2VD2 A;  5TP9 B;  3HPI A;  2ONR A;  4BLA A;  3TTR A;  1Y20 A;  4ND9 A;  5CMK A;  1QW0 A;  1SD3 A;  4OFO A;  1TWY A;  4EQ7 A;  1N0T A;  1NKX A;  3IAZ A;  3TCH A;  3T93 B;  3HHG A;  4KCC A;  3QUF A;  4OYV A;  1QJM A;  4H8J A;  3OMB A;  1MXU A;  2VP1 A;  4GXA A;  1FW0 A;  3DP6 A;  2D5W A;  4G8H A;  2UYF A;  3ZSF A;  4QSE A;  4G77 A;  3ODB A;  2IEE A;  4OXV A;  4P11 A;  4C1T A;  1I69 A;  3FXR A;  4H5G A;  5AA4 B;  2XXR A;  3LSW A;  4NF4 A;  1MPD A;  5H8Q A;  2R71 A;  1T0K A;  2PBW A;  1PB8 A;  3MVY A;  3VE1 B;  1B3F A;  1ZMG A;  4RY1 A;  3DLN A;  2X7P A;  4KYD A;  1R1N A;  3U92 A;  3SEY A;  4MH5 A;  3CRB A;  1F9B A;  3ECR A;  3KN8 A;  4MBP A;  1FQD A;  2VOZ A;  3G3F A;  1B5J A;  1AIV A;  2HFB A;  2DE2 A;  3PGF A;  3D4G A;  4TLL B;  3Q29 A;  4LZ7 A;  2F97 A;  1ZIU A;  1B3G A;  1NFT A;  4X9T A;  2UVH A;  3FXQ A;  2Q89 A;  2AYS A;  4N07 A;  3CIJ A;  4E0X A;  1Y3Q A;  3S9M C;  1ZLQ A;  5K2Y A;  2THI A;  2PMS A;  1Y1Z A;  4ZDM A;  1B05 A;  3S4U A;  2DOJ A;  1Q1K A;  1XOC A;  2OWS A;  5CBS A;  2GHA A;  1SI0 A;  1B32 A;  4YKK A;  3RN8 A;  3C9H A;  1NH8 A;  5DYH A;  2E1S A;  3KBR A;  3T9X B;  1MS7 A;  3W9W A;  1MPB A;  2I49 A;  4XTC Q;  3VXC A;  3GZG A;  4KR5 A;  3N94 A;  3OO8 A;  2ZYO A;  4FEC A;  4YU0 A;  2RKM A;  1UTB A;  4U1O A;  4H67 A;  4NMY A;  1RYX A;  4F2Q A;  1ZJL A;  4ZEB A;  3VVE A;  1P1N A;  5ELV A;  3S2V A;  1M5C A;  2WKY A;  3U8Q A;  2Y7W A;  4RK2 A;  3LBS A;  2I3V A;  2Z23 A;  1MY4 A;  5H8N A;  3THI A;  1I6Q A;  1DPP A;  2OJT A;  1OVB A;  2XXI A;  1QVS A;  1ZBM A;  4LZ5 A;  3C35 A;  1Q35 A;  4FIM A;  4PE5 B;  2DWA A;  3KOS A;  1TFA A;  4M4G A;  2ZNS A;  4EQB A;  1QUL A;  4OEU A;  5I2N B;  1PDA A;  3VDF A;  2OLB A;  3ZS6 A;  3UGW A;  3TFL A;  5EHS A;  5KZT A;  4RK9 A;  2O69 A;  4IO2 A;  2CMO A;  1LAG E;  3JV9 A;  1SI1 A;  2Q2A A;  3B6Q A;  4BDM A;  1B9J A;  2XD2 A;  3GLB A;  1B7H A;  4RYA A;  3OO6 A;  4U22 A;  1N04 A;  4EUO A;  3MVX A;  3KJT A;  3IOT A;  4KHZ E;  3MW0 A;  1MRP A;  4R74 A;  4F3P A;  4U2R A;  4GIZ A;  1Y3P A;  5L9M A;  3MVW A;  1S50 A;  1LLS A;  3FD3 A;  1MXY A;  4Z0I A;  2B65 A;  1LB9 A;  3TTK A;  5I84 A;  3Q28 A;  3RTF B;  1D3K A;  2XXX A;  2KLF A;  2R9J A;  3OO7 A;  4YMA A;  4X1B A;  3BFT A;  1IIT A;  4NTL A;  1WOD A;  4POX A;  1SQY A;  3OOA A;  1TXF A;  4GXS B;  3PPO A;  1B0H A;  4E0W A;  3CI8 A;  4NWD A;  5I56 B;  4I9D A;  3RY3 A;  2G93 A;  5ITP A;  4ESW A;  5AA2 B;  1LBB A;  2RIN A;  1N3W A;  5FTH A;  2UVJ A;  5KCJ A;  2V84 A;  4ZED A;  3PU5 A;  4EXK A;  3IB2 A;  4JWY A;  1JVX A;  1FTO A;  3FV2 A;  4HW8 A;  2Y84 A;  2YJP A;  4G68 B;  1LFI A;  3RTW B;  1NL5 A;  5I58 A;  2E0S A;  2F78 A;  4OWD A;  2M8C A;  3O97 A;  2F35 A;  1A55 A;  1LAF E;  4Z7E A;  2F6G A;  1B46 A;  5A5X B;  3L6H A;  5B70 A;  1GGG A;  1J1N A;  4OFL A;  3K6V A;  4TLM B;  3VLV A;  4ECF A;  1Y3N A;  1N3X A;  3N26 A;  1PB7 A;  1FQB A;  1USY E;  3LR1 A;  1HSE A;  1UTH A;  2V93 A;  2I58 A;  1QUK A;  1OQH A;  4LA9 A;  4U4S A;  2I4C A;  1SW5 A;  1JNF A;  3CR9 A;  3B6W A;  5CI5 A;  1B6H A;  1USY H;  3B7D A;  3KG2 A;  5DT6 A;  2PX1 A;  3RT8 A;  1JW4 A;  4LVQ A;  1AOV A;  1B3E A;  3P7I A;  2DWI A;  1BIY A;  3HST A;  1D9Y A;  4I8C A;  1L5T A;  4WXJ A;  4ZEI A;  3FV1 A;  2VHA A;  3M3F A;  3IOR A;  5L9S A;  1DPE A;  1OVT A;  1RYO A;  4QFK A;  2I48 A;  1S7Y A;  4HCW A;  3JYR A;  1LST A;  3N6U A;  2UXA A;  2DQV A;  3K2D A;  5H8F A;  4G4P A;  5FHN A;  4OQO A;  4POW A;  4X48 A;  5H8S A;  1URG A;  1Z7N E;  1MQD A;  4RJZ A;  4JBZ A;  1MQI A;  1JVY A;  1LBC A;  4F31 B;  4KFQ A;  3Q25 A;  2ZNT A;  4DCX A;  5I59 B;  3FAT A;  2O51 A;  1YCJ A;  4QSC A;  4JWX A;  5TU0 A;  2QMX A;  5L8D A;  2I0C A;  4IB2 A;  2REJ A;  3PPQ A;  3TDJ A;  1MXV A;  2QSX A;  2H25 A;  2XXY A;  2PT2 A;  2HZL A;  1LFH A;  3LSX A;  3SEX A;  3PD9 A;  2B3B A;  1FTM A;  1EZP A;  3N5L A;  1GV8 A;  4XXU A;  1IEJ A;  1MQJ A;  3TQW A;  3C4M A;  4HS7 A;  3I6V A;  3MWB A;  3I3V A;  1OQG A;  2DYX A;  4P0I A;  1LAX A;  3MBP A;  4NWC A;  1D9V A;  1P1Q A;  3H6W A;  3MPL A;  5I57 A;  3U72 A;  5I2K A;  1IUD A;  1LCT A;  2V3T A;  3VXB A;  3S9N C;  2FNC A;  3O6I A;  5L9O A;  4QRZ A;  4F18 A;  2XXH A;  1POT A;  1US5 A;  2PYY A;  3PPP A;  3OSQ A;  3SEV A;  3K6W A;  3O29 A;  4PFT A;  1Y1M A;  3KGC A;  4FEB A;  1EH3 A;  1FQF A;  4YAH X;  2XXT A;  4XKR A;  1XS5 A;  1YTV A;  1YAE A;  1RKM A;  3U94 A;  4XKQ A;  2H98 A;  4EF2 A;  2H4I A;  2D21 A;  1MM7 A;  1O7T A;  4OEN A;  5AA2 A;  4NF5 B;  1P1U A;  3OEK A;  1B1H A;  1O63 A;  1UIU A;  2R6G E;  3CVG A;  1H3D A;  4HTG A;  3PUW E;  3WAF A;  5AE4 A;  1BP5 A;  3G3G A;  5M2V A;  3FZV A;  4ISU A;  3FJ7 A;  3H03 A;  4EXL A;  4ZE9 A;  4UAC A;  3OXN A;  1AMF A;  5BWJ A;  3KFM A;  3O6H A;  1DTG A;  4O3B A;  3G7W A;  4WED A;  2F36 A;  2AIX A;  2O84 X;  3ZKK A;  3KEI A;  4PET A;  3IOV A;  1IIW A;  5A5X A;  2H99 A;  2Q2C A;  5BUU A;  3K00 A;  3E13 X;  5J1D A;  2XX8 A;  1GTK A;  4QFP A;  3CSB A;  1LFG A;  5CMB A;  3OD7 A;  1JW5 A;  4IGR A;  4M1V A;  4L17 A;  3LSF B;  3MZ1 A;  2A5T B;  3M8U A;  5DEX B;  3U93 A;  2DXR A;  1B5I A;  3IOU A;  3VLU A;  3TTN A;  3BFU A;  3H7M A;  2Q9T A;  4AB6 A;  2H9B A;  5IKB A;  1KWH A;  4YKP A;  3K1M A;  2NVU B;  2O68 A;  3U1O A;  4KQP A;  1SYI A;  3PV0 E;  1A99 A;  4Q5T A;  3TEP A;  3PUV E;  3V89 B;  3DM0 A;  3WAE A;  1I6B A;  4O3C A;  4FAT A;  5HM4 B;  3HN0 A;  3O66 A;  1UQW A;  4BDN A;  3QUJ A;  3A3U A;  4NF6 A;  4H6D A;  4NF8 A;  3QYT A;  1LCF A;  3IR1 A;  2P1S A;  2QJE A;  2Z22 A;  1CB6 A;  4MFI A;  2RC7 A;  3DP8 A;  3OO9 A;  1FTK A;  1S9T A;  3PUZ E;  1XC1 A;  4H8I A;  4U1Z A;  3K6U A;  1LGB C;  2Q88 A;  4H0W A;  5H8H B;  5AA1 A;  4AQ4 A;  1URD A;  2OBG A;  5JEI A;  2HCA A;  4ZEF A;  4GOT A;  2QS4 A;  3PMV A;  3G3I A;  3SEW A;  2XXV A;  4GF8 A;  3K6X A;  4KI0 E;  5JTY A;  1DTZ A;  3KSX A;  1XT8 A;  4OET A;  3PPN A;  1BKA A;  3T9H B;  3SER A;  3QXM A;  5TPA A;  3F11 A;  5CRY A;  4BDR A;  1ATG A;  1IQ7 A;  2B3F A;  3MPK A;  1OMP A;  5JK4 A;  1MY3 A;  3FVG A;  3FXU A;  3QIM A;  2REG A;  3ZKL A;  4OMB A;  3MVZ A;  5KDT A;  1A8E A;  3GXA A;  5TP9 A;  2F5X A;  3C36 A;  3G3H A;  1JET A;  2NWJ A;  5IAI A;  4DLD A;  2QS3 A;  2ZYM A;  2AL4 A;  3GBA A;  3H6U A;  2ABH A;  4NF4 B;  3PMX A;  5H8Q B;  1B3L A;  4GWO A;  3RUM A;  4K3F A;  1NH7 A;  1NNP A;  3PPR A;  3ONM A;  2CZL A;  2FA7 A;  1P1W A;  4FAJ A;  4LAT A;  2P0S A;  3PUX E;  1B1X A;  1B4Z A;  2QMW A;  3SES A;  3OEM A;  4XKP A;  3N6T A;  1M5F A;  2ZNU A;  4KYE A;  3R26 A;  4QF9 A;  3H6V A;  3GBB A;  2DSF A;  2NUV A;  4ELP A;  5ISU A;  4GFR A;  5AA4 A;  3EQ1 A;  3FUZ A;  4Q30 B;  5FTI A;  3B6T A;  4R73 A;  3OSR A;  4GQO A;  1LAH E;  2YLN A;  5F7V A;  2F34 A;  2RCA A;  1N7W A;  4U23 A;  2PVU A;  4KYS A;  4IGT A;  1ZU0 A;  3Q26 A;  3FVN A;  3FIR A;  1B2H A;  2LAO A;  1DOT A;  3TTM A;  3G3K A;  4JSD A;  4NE4 A;  3CFL A;  3E9X A;  3FJG A;  4DE8 A;  2BJJ X;  4U21 A;  3EPE A;  5DVJ A;  4KD5 A;  4H65 A;  3V83 A;  2F8D A;  3OEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...