1B1XA

Structure of diferric mare lactoferrin at 2.62a resolution
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords LACTOFERRIN
publication title Three-dimensional structure of mare diferric lactoferrin at 2.6 A resolution.
pubmed doi rcsb
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1xA03
2AL4A 2PT2A 4YAHX 4EXLA 3IORA 2ZNTA 2HZLA 4EQ9A 2DE3A 3OO7A 5I57B 3TZAA 1LFIA 1QKBA 4F3SA 3U94A 1MS7A 3QK6A 3SKPA 3IB1A 1B4HA 5AA2A 3U72A 2Z8EA 1CE2A 1H76A 1P1OA 3MVYA 1AL3A 2ZYNA 1O63A 2RC7A 1A8FA 1P1WA 3PU5A 4PETA 3RT6B 2HEUA 1FQBA 4F19A 1I6QA 4G4PA 3PD8A 3TTKA 2R9JA 4G77A 2F35A 1DPPA 4KPTA 4KR5A 5L9OA 1ANFA 2B65A 2I4CA 1S9TA 4NEDA 1LAFE 3OELA 4MH5A 4ECFA 1ZMGA 5CMBA 4AB5A 3GBBA 2Y7IA 1NL5A 4WEPA 4H1XA 5K2XA 3CSBA 2DOJA 1SI1A 3CG3A 2OWTA 5DTBA 4JDFA 4IO4A 3SEVA 1Y3QA 2AIXA 1LCFA 2KLFA 3PUZE 4KCCA 1NMUA 3FVOA 3T93B 2QRYA 5AA4B 4ZDMA 4X9TA 3C4MA 2O6AA 1N7XA 3K00A 2FA7A 4GL0A 4XKQA 3HSTA 3MBPA 4EXKA 3TFLA 5H8FA 3G3FA 1PEBA 4Q0CA 5IAIA 4G8MA 4FEBA 4H8JA 4DCYA 5CMCA 4FIMA 1R9LA 3T9UA 1JEUA 3H3GA 1MQGA 3FZVA 4ZECA 3C32A 2RCAA 2ANJA 1QJMA 1SD3A 5L8DA 4EQBA 4QSEA 1F9BA 4KYDA 3K6VA 1XOCA 2FNCA 4NF4B 3PGFA 3PD9A 1PBQA 3H06B 2CMOA 3OMBA 3H6VA 5AA4A 2O1MA 4NTLA 3FXQA 4IO2A 1B0LA 1MM7A 3M3LA 3O29A 3BBRA 3MZ9A 3K0VA 4R9FA 2H4IA 2XD3A 2PT1A 5ICTA 3I3VA 4RPNA 1P1UA 3W9WA 1LCTA 1MY3A 1LBCA 2XXPA 3MP6A 3IO4A 2XX9A 2ZYMA 3PUVE 5ITOA 3K1PA 3T9XB 4OEUA 4LQ5A 1N7WA 3IB0A 1L5TA 3C34A 3IX1A 1HSEA 3K1NA 2CZLA 3ILUB 5DVFA 3D4GA 2ABHA 2DVCA 4K3FA 3TQWA 3BFUA 1S7YA 3G3HA 2HZKA 2F7CA 4O3AA 2G93A 4YB5A 1HSJA 1B1HA 2ZXTA 1M5BA 3U1OA 1MPDA 4DDDA 1URSA 3R7XA 3UK4A 3O6IA 3KSXA 1IITA 1BP5A 1MH3A 4RNSA 1B5IA 1H44A 4R72A 3CR9A 4Q5TA 2IA4A 1POY1 3C33A 3OO8A 4NE4A 4XXUA 3O6HA 3H7MA 4OFLA 1BLFA 3V8XB 1ZKBA 2OLBA 1XVXA 1FW0A 3K1MA 4F29A 3O66A 2LAOA 3CSGA 3FJMA 3PMVA 3S9MC 2RF1A 2UYFA 2Y84A 3Q26A 1NKXA 1B05A 2HAUA 4KHZE 3CFZA 1IXIA 2WKYA 4FATA 1DPEA 1A55A 3V5AA 4R6HA 5TP9B 2THIA 5FHMA 4JB7A 2XXXA 2ZYKA 3MVWA 3IK6B 2XHDA 2REJA 1SW5A 1BIYA 4KI0E 4RA1A 4ESWA 5ITPA 2QS2A 1Y9UA 2DVZA 2H99A 3UN6A 4NF5B 3PUXE 2V3QA 2O1LA 5ELVA 4ZEFA 5K2YA 2XXTA 1PC3A 3MJNA 3SEUA 2G29A 3PPNA 2I3WA 4U21A 1IEJA 4LQ2A 1MH4A 1FTMA 2ZNSA 4KQPA 3USDA 4BLAA 4ZZAA 4KYSA 1B1XA 1ZLQA 1MXZA 1MXVA 5TPAB 3N94A 1B9JA 1JW5A 1IXCA 2F5XA 2W7YA 2D21A 2HQ0A 3I6VA 4EDPA 3G3IA 3RNNA 1UTHB 3B6QA 2UVGA 1B5HA 3S9EA 1QUJA 5ISUA 2QS3A 2QS4A 3FV2A 4PFUA 2O84X 4UACA 3LR1A 3DP8A 2HAVA 4PQJA 3ZKKA 1MY2A 4TOZA 1PB8A 4N07A 4QF9A 5I59B 2DYXA 3IO6A 1FTOA 1B3HA 3M3FA 3A3CA 4GL8A 3VE1B 1Z7NE 3WAEA 1EU8A 3E4RA 4H6DA 4NF5A 2VD2A 1QKAA 2OCUA 4F3PA 3MC2A 1NFTA 3KFMA 3OEKA 1O7TA 1D3KA 2NXOA 2V3UA 3L6GA 4DLDA 3IL1B 5AE4A 1ZJLA 2I6EA 1Q1KA 1SBPA 2PMSA 4HCWA 1QUIA 4OFOA 2XXQA 3SESA 2IEEA 5I58B 5BWJA 3VLUA 1Y4TA 1VE4A 1SYIA 3QIMA 5TPAA 4FORA 4IO5A 1RYOA 3A3UA 3MPLA 3IOTA 1B32A 4PFTA 4N6PA 3PPRA 4DCXA 1UTHA 3JV9A 4RYAA 3QYTA 4OYVA 1SVXB 1ZIUA 2OZZA 4I1DA 3MVXA 4X48A 3TCFA 1DMBA 4F31B 2DWHA 2X7QA 3E9XA 3ZKLA 3S9NC 3MW0A 3N6TA 1MXXA 1M5CA 1FQCA 3PPOA 1JW1A 4RPOA 1H45A 5KCJB 3UGWA 3EHTA 3TPAA 5EHSA 4EUOA 2ZMBA 3KJTA 4GLIA 1LBBA 2I48A 4OMBA 4F18A 1Y3NA 1IQ7A 1M5EA 1YCJA 5I58A 3C36A 3KJ7A 3RUMA 1LFHA 3ILTB 2PYYA 3H6WA 1R9QA 5BUUA 1URGA 1N76A 1DSNA 2O7IA 2I0BA 2O68A 3FATA 1LGBC 2QL3A 5DT6A 1OVBA 1TFDA 5KDTB 2UVHA 4QFPA 1JVYA 2GHAA 3RN8A 1B3GA 4QHQA 5H8FB 4GOTA 1HSLA 3IOUA 1H43A 5KCJA 3RT8A 3CFLA 4U2RA 4IB2A 3IB2A 4XIGQ 3MAMA 3PMXA 5FHNA 2XX7A 4F3GA 3JZJA 1M5DA 3TUSA 4ND9A 4Z0IA 1A8EA 3AXFA 5CRYA 2DXRA 3Q25A 3VLWA 4GXAA 3UA8A 4WKMA 1N84A 1SW1A 4R6YA 2P1SA 5EYFA 2H25A 4LUBA 1TT1A 5HBCA 3B6WA 3EHUA 3TKDA 3TELA 5KDTA 4F3BA 2DS9A 4QFLA 3OSQA 4RY1A 1T0KA 3FIRA 3W9VA 1YTVA 3FASA 2PX1A 3TAJA 4DXCA 3BFTA 4JSDA 3UORA 2UXAA 3N6UA 2Z8DA 2RKMA 4RJZA 1ZBMA 3C9HA 4QFNA 2AL5A 2PBWA 3OO9A 1UTBA 3HHFA 3TEPA 1XHYA 4R2BA 4GXSB 3H4ZA 4PP0A 1QUKA 2ZNUA 2DXYA 1CB6A 1EZOA 4YB7A 4TLMB 4DXUA 4LATA 5DEXA 1EZ9A 1P1NA 4HW8A 1NH7A 4Q8RA 1LLSA 3MZBA 2OJTA 3FVGA 3PUWE 3O6GA 4BDRA 1N0TA 3PMWA 1I6AA 4LZ7A 3CFXA 4XKPA 4RXLA 1US5A 1MQIA 4H0WA 4YMBA 3C31A 2YPNA 5H8QA 5CMKA 3V83A 1PB9A 5H8SA 3OSRA 3DP6A 4YKJA 1OIBA 1SW2A 2QSXA 2VGQA 2XXYA 4EF2A 3KN3A 3M8UA 2UVJA 4XKRA 1IXHA 1DTZA 4IO3A 5M2VA 1FQFA 4TQUQ 2XX8A 3WAFA 1NNPA 2QPQA 3O28A 4YU0A 3SDFA 5EHMA 4O3CA 1AMFA 2P2AA 3TTNA 3Q28A 3MZ1A 4GFRA 4HS7A 2OWSA 4R9GA 3MPKA 1B3FA 3K02A 2ZYOA 5I2KB 3SEXA 2V25A 1JW4A 2NUVA 2DWJA 2F36A 4GF8A 1XT8A 5DVIA 4NF8A 2X26A 3V89B 2XXRA 2GHBA 1SI0A 3VV5A 3LSFB 1SDXA 4OQOA 1N3XA 3GBAA 3EF7A 2RINA 3B7DA 3TTMA 2O51A 4IY6A 2ONKE 5FHOA 1O64A 2VHAA 3G3JA 4F1VA 3KBRA 1GV8A 3PUYE 4ONYA 1GTKA 4WXJA 1US4A 3FXUA 1N04A 4LP2B 4BDLA 2OBGA 2F7AA 2XXVA 5ICQA 1LB9A 4YICA 1MXWA 4U4XA 5I2KA 1SYHA 4P0GA 4F2OA 1FTJA 2VOZA 3K2DA 3RTWB 2XD2A 4GRKA 5H8HB 4ISUA 3T9VA 3LC8A 1B40A 2BJJX 4NWCA 4TLLB 3G7WA 4PE5B 1QULA 5L9MA 3T66A 4BDQA 3TODA 3ODBA 2VD3A 1ELJA 2AYSA 2F7BA 3EPEA 1LB8A 3T96B 3HO7A 1MPBA 2ONSA 1XVYA 2Y7KA 2D3IA 1B7HA 2V3TA 5A5XB 1JVXA 2I58A 1P1QA 3JYRA 4G8HA 2XXUA 2ONRA 5CC2A 5IKBA 1MQJA 4E0WA 2B3FA 3LSXA 4IO6A 4QFKA 1GVCA 5HPQA 1B3EA 1Y1ZA 2X7PA 4KYEA 5H8HA 4EQ7A 3MP1A 2O69A 3QUJA 1WDNA 4C1UA 3VFJA 1NH8A 2A5TB 2Y7RA 3RQTA 4G2ZA 5AA3A 1USYH 4ZZEA 2H9BA 1NNKA 4G8NA 3FUZA 1A99A 1FQAA 3S2VA 5TU0A 4F22A 1DTGA 3HHGA 1AH5A 2RCBA 5A5XA 3DM0A 2UYEA 3D4CA 1LAHE 1LFGA 3DP4A 4AQ4A 4JBZA 3E13X 3O9PA 3EN3A 1OMPA 2XXWA 3ZS6A 1EH3A 3RPWA 4JWYA 2ESNA 3FV1A 4I62A 3VVFA 1TWYA 3LSLA 4JWXA 2F8DA 4OFJA 4R75A 3UP9A 4XKNA 4YKIA 3I5OA 4I8CA 3FD3A 4H8IA 2A5TA 1NNFA 1I69A 3QSLA 3OOAA 4PFYA 3VXBA 1XC1A 2Q88A 4H5GA 4OENA 1Q35A 3O2AA 3K4UA 4NMYA 1MXUA 1D9YA 4R6KA 2NWJA 3R26A 4BDOA 3MWBA 5I2NA 4ZEBA 1A40A 3PV0E 3VVDA 1AIVA 4LZ5A 4KFQA 1AOVA 5I56A 5CI5A 1OQHA 1P99A 3KN8A 2REGA 3OENA 4IY5A 3VDFA 3KGCA 5AA1A 2F6PA 4NF6A 2H5YA 4HTGA 2NVUB 3VLVA 2Z22A 4H67A 2PVUA 4THIA 2Q8JA 4GWOA 4UA8A 3LBSA 3R6UA 2V84A 3KG2A 3L6HA 4LA9A 1B7ZA 2GRVA 2RC8A 1VR5A 3IR1A 4ESXA 2GH9A 4HCYA 3OEMA 4F1UA 3IAZA 1Y4CA 5JK4A 4OWDA 3G3GA 2DP8A 3M3KA 4OHNA 1UTBB 4OESA 3HV1A 4OXVA 1H3DA 2YLNA 3FXRA 4AB6A 1QW0A 2B3BA 1GGGA 5I84A 2I49A 1OLAA 3KOTA 5H8NB 2Q9TA 1LSTA 2FYIA 5I57A 3DLNA 5DEXB 3OXNA 3ZSFA 1FQEA 2I0CA 4OZ9A 4BDMA 4U1ZA 1ZTYA 3TQLA 4RK2A 3FVNA 4H5FA 2QJEA 5DVJA 1MQDA 1PBPA 4P11A 3OD7A 3S4UA 3RY3A 1VSOA 4F39A 1MY1A 1EZPA 3ONMA 3IJOB 5JTYB 3IOVA 2E0SA 4Q30B 5CBSA 3SETA 3CRBA 3TYHA 4ELOA 4MFIA 2YJPA 4M4GA 3W15C 3MQ9A 1FTKA 1Y1MA 1ZU0A 3C35A 4FAJA 3RLFE 5H8QB 4EF1A 2DSFA 1SQYA 4YKPA 4OETA 2HFBA 3FJ7A 3Q29A 4LZ8A 4IO7A 2GFEA 2NOOA 1PB7A 4U22A 1B2HA 2D5WA 1PDAA 2M8CA 3K6XA 5H8NA 5KZTA 4OTEA 1B5JA 3P7IA 4QRZA 1A7LA 1MRPA 3DELB 1R1NA 4KD5A 4YB6A 3H6UA 1OVTA 1B6HA 3PPQA 1FCKA 3SEYA 4ZS9A 2F34A 3LUYA 4G68C 4JXIA 3TDJA 2DWIA 5JTYA 1RYXA 2H98A 4GD5A 4F2QA 1OLCA 1USYE 1QVSA 4NF8B 3VXCA 4FEDA 5B7DA 1JQFA 3T9HB 4DZ1A 1MQHA 4GVOA 4R2FA 1UQWA 1DOTA 1OQGA 3MUQA 1M5FA 1FTLA 3U93A 3GZGA 4N13A 2I3VA 3E3KA 4DXBA 5LOMA 1JNFA 1B3LA 1D4NA 1Y3PA 3U92A 3RGYA 1YPNA 1YAEA 1B46A 1WODA 4PFWA 4U23A 3RTFB 4JWOA 4NF4A 4X1BA 4Z7EA 4P0IA 3FGSA 1KWHA 4G68B 2QS1A 4BDNA 1IUDA 3KZGA 3A09A 4X1DA 3Q27A 1Y20A 1UIVA 1A54A 2Q89A 1TFAA 2RC9A 1MY4A 1SW4A 1JEVA 2DE4A 4QFOA 4GQOA 1IZ1A 4FECA 3HN0A 4GIZA 1MG1A 3CG1A 1R6ZA 3F11A 2A5SA 2Q2AA 4R73A 4I9DA 3EQ1A 4XTCQ 3TCGA 1MDQA 1IIWA 5L9SA 2F97A 2DE2A 3GXAA 1MXYA 3HCQA 4ZEIA 3TCHA 3KEIA 1I6BA 1URDA 1N3WA 1B4ZA 3OO6A 4QSDA 1B51A 1B7UA 4JSOA 4OVJA 1FQDA 2F78A 4LVQA 3LSWA 2OK2A 1J1NA 1II5A 3IOWA 4RK9A 2Z8FA 4C1TA 4G68A 3U8QA 4ELQA 5DYHA 3KN7A 5B70A 2E1SA 1B0HA 4L17A 5FTIA 4FJPA 3HPIA 3PPPA 4C0RA 3H03A 4FE8A 1UIUA 2P0SA 2DWAA 5JEIA 5CM6A 3N5LA 3SEWA 4H65A 4YZZA 5J1DA 2Z23A 1GR2A 4R74A 3ECRA 3K6WA 5AA2D 4MBPA 3O97A 3H6TA 2UVIA 3FVKA 3T22A 2R71A 3KSJA 4MLVA 3EHSA 3MVZA 1BKAA 2I4BA 2Y7WA 1XS5A 2R6GE 4DE8A 3TMGA 4POXA 5CBRA 1MDP1 4DIGA 3B6TA 1MPCA 5CMMA 4ZE8A 1VFDA 2HCAA 1Z7ME 3FJGA 3THIA 1B58A 3CIJA 5F1QA 4POWA 5TP9A 4MLQA 4O3BA 3K6UA 2ALUA 4U4SA 4WEDA 1POTA 1D9VA 1RKMA 2Y7PA 3TTLA 4ELPA 2V93A 4LONB 5I2NB 3GLBA 1TXFA 3TTRA 1WVJA 3QAXA 4YKKA 5F7VA 1NNTA 5I56B 3QUFA 2O7UA 3IJXB 3MP8A 5FTHA 4ZEKA 1JETA 3CVGA 4IGRA 3SERA 2XXHA 4QSCA 2VP1A 3UIFA 3S9LC 1B52A 1IXGA 1VFEA 4YMAA 4NF6B 1ATGA 4MF3A 3VVEA 1LAXA 2DQVA 4OERA 4M1VA 3QXMA 4ZEDA 2F6GA 4U1OA 5AA2B 2XXIA 3KOSA 1MM6A 4IGTA 5HM4B 2HXWA 3BKIB 3G3KA 2QMXA 1S50A 2Q2CA 2QMWA 4OEVA 5I59A 3K01A 1BTJA 4ELRA 3N26A 4ZE9A 4E0XA 1MY0A 3CI8A 4KCDA 4F1YA 1LAGE 4NWDA
chains in the Genus database with same CATH superfamily
2AL4A 4P56A 2PT2A 4YAHX 4EXLA 3IORA 2ZNTA 4HE2A 2HZLA 2XWOA 4EQ9A 2DE3A 3OO7A 5I57B 4GWXA 3TZAA 1LFIA 1QKBA 4F3SA 1FBCA 2WBBA 3U94A 1MS7A 2CEXA 3QK6A 3SKPA 3IB1A 1B4HA 5AA2A 3U72A 2Z8EA 1CE2A 1H76A 1P1OA 3MVYA 1AL3A 2ZYNA 4P1LA 1O63A 2RC7A 1A8FA 5EYGA 1P1WA 3PU5A 4PETA 3RT6B 5DW8A 2HEUA 1FQBA 4F19A 1I6QA 1FBEA 4G4PA 3PD8A 3TTKA 2R9JA 5EQ8A 1SPIA 4G77A 2F35A 1DPPA 4KPTA 4KR5A 5L9OA 1ANFA 2B65A 2I4CA 1S9TA 4NEDA 1LAFE 3OELA 4MH5A 4ECFA 1ZMGA 5CMBA 4AB5A 3GBBA 2Y7IA 1NL5A 4WEPA 4H1XA 2WX9A 5K2XA 1DBZA 3CSBA 2DOJA 1SI1A 4MCOA 3CG3A 2BJIA 2OWTA 5DTBA 4JDFA 4IO4A 3SEVA 1Y3QA 2AIXA 1LCFA 2KLFA 3PUZE 4KCCA 1NMUA 3FVOA 3T93B 2QRYA 5AA4B 4ZDMA 4X9TA 1NV0A 2KQZA 3C4MA 2O6AA 1N7XA 3K00A 2FA7A 2B4LA 3CHGA 4GL0A 4XKQA 3HSTA 3MBPA 4N17A 4EXKA 3TFLA 5H8FA 3BIGA 3G3FA 4O7MA 1PEBA 2XA5A 4Q0CA 1IMAA 5IAIA 4G8MA 4FEBA 4H8JA 4DCYA 5CMCA 4FIMA 1R9LA 3T9UA 1JEUA 2HPGA 3H3GA 1MQGA 3FZVA 3RPLB 4ZECA 3C32A 2RCAA 2ANJA 1QJMA 4PBHA 1SD3A 5L8DA 4EQBA 4QSEA 1F9BA 4KYDA 1EYIA 3K6VA 1XOCA 2FNCA 3NOHA 4NF4B 3PGFA 3PD9A 1PBQA 3H06B 2CMOA 3OMBA 3H6VA 5AA4A 1NUZA 2O1MA 4GBVA 4NTLA 3FXQA 4LN5A 4IO2A 1B0LA 1MM7A 3M3LA 3O29A 3BBRA 3MZ9A 3K0VA 4R9FA 2H4IA 2XD3A 2PT1A 5LDZA 5ICTA 3I3VA 4RPNA 1P1UA 3W9WA 2HXRA 1LCTA 1MY3A 1LBCA 2XXPA 3MP6A 3IO4A 2XX9A 2ZYMA 3PUVE 5ITOA 5IZ3B 3K1PA 3T9XB 4OEUA 4LQ5A 1FSAA 1N7WA 3IB0A 1L5TA 3C34A 3IX1A 1HSEA 3K1NA 2CZLA 3ILUB 5DVFA 3PTYA 3D4GA 2ABHA 2DVCA 4N81A 4K3FA 1NI9A 3TQWA 4QBAA 1NUWA 3BFUA 1S7YA 3G3HA 2HZKA 2F7CA 4O3AA 2VPNA 2G93A 4YB5A 2QVUA 1HSJA 1B1HA 2ZXTA 1M5BA 3U1OA 1MPDA 4DDDA 1URSA 3R7XA 3UK4A 3O6IA 3KSXA 1IITA 1BP5A 1MH3A 4RNSA 1FPGA 1B5IA 4OANA 1H44A 4R72A 4Q5TA 3CR9A 2IA4A 1POY1 3C33A 3OO8A 4NE4A 4XXUA 3O6HA 2PFZA 3H7MA 4OFLA 1BLFA 3KBZA 3V8XB 1ZKBA 3MYUA 2Y5KA 2OLBA 1XVXA 1FW0A 5IZ3A 3K1MA 4F29A 3O66A 2LAOA 3CSGA 3FJMA 3PMVA 4MHFA 3S9MC 2RF1A 2UYFA 2Y84A 3Q26A 1NKXA 1B05A 2HAUA 4KHZE 3CFZA 1IXIA 2WKYA 4FATA 1DPEA 1A55A 3V5AA 4R6HA 5TP9B 2THIA 5FHMA 4JB7A 2XXXA 2ZYKA 3MVWA 3IK6B 2XHDA 2REJA 1SW5A 5A5LA 1BIYA 4KI0E 4RA1A 4ESWA 5ITPA 3FBPA 1FJ9A 4NX1A 4DI3D 2QS2A 1Y9UA 2DVZA 2H99A 4O94A 1NV7A 3UN6A 2HHMA 4NF5B 3PUXE 2V3QA 2O1LA 5ELVA 4ZEFA 5K2YA 2XXTA 1PC3A 3MJNA 3SEUA 2G29A 4QXDA 3PPNA 2I3WA 4U21A 1IEJA 4JVDA 4LQ2A 1MH4A 1FTMA 2ZNSA 4KQPA 3USDA 1YYZA 4BLAA 4ZZAA 4KYSA 1B1XA 4XFEA 1ZLQA 1MXZA 1MXVA 5TPAB 3N94A 1B9JA 1JW5A 1IXCA 2F5XA 2W7YA 2D21A 2HQ0A 3I6VA 4EDPA 3G3IA 3RNNA 1AWBA 1UTHB 3B6QA 2UVGA 4UABA 1B5HA 3S9EA 1QUJA 5ISUA 2ZZWA 2QS3A 2QS4A 2XWKA 3FV2A 4PFUA 2O84X 4UACA 3LR1A 3DP8A 2HAVA 4PQJA 3ZKKA 4HE0A 1MY2A 4TOZA 1PB8A 4N07A 4QF9A 5I59B 2DYXA 3ISPA 4PF8A 3IO6A 1FTOA 1B3HA 3M3FA 3A3CA 4GL8A 3VE1B 1Z7NE 3WAEA 1EU8A 3E4RA 1FPKA 4H6DA 4N15A 4NF5A 1FBPA 2VD2A 1QKAA 2OCUA 4F3PA 3MC2A 1NFTA 3KFMA 1LBVA 3OEKA 1O7TA 1D3KA 4NAPA 2NXOA 2V3UA 3L6GA 4DLDA 4XF5A 3IL1B 5AE4A 1ZJLA 2I6EA 1Q1KA 1SBPA 2PMSA 4HCWA 1QUIA 4OFOA 2XXQA 3SESA 2IEEA 5I58B 5BWJA 3VLUA 1Y4TA 1VE4A 1SYIA 3QIMA 5TPAA 4FORA 4IO5A 1FJ6A 1RYOA 3A3UA 4GX3A 3MPLA 3IOTA 1B32A 4PFTA 4N6PA 3PPRA 4H46A 4DCXA 1UTHA 4PGNA 3JV9A 4RYAA 3QYTA 4OYVA 2Q8MA 1SVXB 4P47A 1ZIUA 2OZZA 4I1DA 3MVXA 4X48A 3TCFA 1DMBA 3SZPA 4F31B 2DWHA 2X7QA 3E9XA 3ZKLA 3S9NC 3MW0A 3N6TA 1MXXA 3ROJA 2ZZXA 3RYDA 5LTCA 1M5CA 1FQCA 3PPOA 1JW1A 4RPOA 1H45A 5KCJB 3UGWA 3EHTA 3TPAA 5EHSA 4EUOA 2ZMBA 3KJTA 4GLIA 1LBBA 2I48A 4OMBA 3GYYA 4F18A 1DCUA 1Y3NA 5I3SA 1G0IA 1IQ7A 1M5EA 1YCJA 2VT5A 1FRPA 5I58A 2FIXA 3C36A 3KJ7A 3RUMA 1LFHA 3ILTB 3T0JA 2PYYA 3H6WA 1R9QA 5BUUA 1URGA 1N76A 1DSNA 2O7IA 2I0BA 2O68A 3FATA 1LGBC 2QL3A 5EQ9A 5DT6A 1OVBA 1TFDA 5EQAA 5KDTB 2UVHA 5F24A 4QFPA 1JVYA 2GHAA 4GWZA 3RN8A 5IGAA 1B3GA 4QHQA 5H8FB 1CNQA 4GOTA 1HSLA 4N91A 3IOUA 2QVVA 1FPEA 1H43A 5KCJA 3RT8A 3CFLA 2FVZA 4U2RA 4IB2A 3IB2A 4XIGQ 4NHBA 3MAMA 3PMXA 5FHNA 2XX7A 1NV2A 4H45A 4F3GA 3JZJA 1M5DA 4NGUA 3TUSA 4ND9A 4Z0IA 1A8EA 3AXFA 5CRYA 2FIEA 2DXRA 3Q25A 2F3DA 4O8MA 3VLWA 4GXAA 3UA8A 1FBGA 3MSTA 4WKMA 4MNCA 1N84A 1SW1A 4R6YA 2P1SA 5EYFA 2H25A 4LUBA 1TT1A 5HBCA 3B6WA 1DK4A 3EHUA 3TKDA 3TELA 5KDTA 4F3BA 2DS9A 4QFLA 3BIHA 3OSQA 1RDXA 4RY1A 1T0KA 3FIRA 3W9VA 1YTVA 3FASA 2PX1A 3HFUA 3TAJA 4P8BA 4DXCA 3BFTA 4JSDA 3UORA 2UXAA 2CZHA 3N6UA 2Z8DA 2RKMA 4RJZA 1ZBMA 3C9HA 4QFNA 2AL5A 2PBWA 2OWZA 3OO9A 1LBWA 1UTBA 3HHFA 3A29A 2JJKA 3TEPA 1XHYA 2P3NA 1LBYA 4PFIA 4R2BA 4GXSB 3H4ZA 4PP0A 4PBQA 1QUKA 2ZNUA 4N6DA 2DXYA 1CB6A 1EZOA 4YB7A 4OVSA 4TLMB 4DXUA 4LATA 5DEXA 1EZ9A 1P1NA 4HW8A 5I5PA 1NH7A 5IZ1A 4Q8RA 1LLSA 1D9QA 3MZBA 2OJTA 3QMFA 4MNIA 3FVGA 2MKZA 3PUWE 3U65A 1NUYA 3O6GA 4BDRA 1N0TA 3PMWA 2QVRA 4N4UA 3IFAA 1I6AA 4LZ7A 3CFXA 4XKPA 4RXLA 1IMEA 1NV1A 1US5A 1MQIA 4H0WA 4YMBA 3C31A 2YPNA 4PGPA 5H8QA 5CMKA 3V83A 1FBHA 1PB9A 5H8SA 3OSRA 3DP6A 4YKJA 1OIBA 1SW2A 2QSXA 5T3JA 2VGQA 2XXYA 2VPOA 3E79A 5J16A 4EF2A 3KN3A 3M8UA 2UVJA 4XKRA 1IXHA 5I7IA 1DTZA 4OVTA 4IO3A 5M2VA 1FQFA 4TQUQ 2XX8A 5IZZA 3WAFA 1NNPA 2B4MA 2QPQA 3O28A 4YU0A 3SDFA 5EHMA 4O3CA 1AMFA 2P2AA 3TTNA 4HE1A 2R8TA 3Q28A 3MZ1A 4GFRA 4HS7A 2OWSA 4R9GA 3MPKA 1B3FA 3K02A 2FHYA 2ZYOA 5I2KB 3SEXA 4P3LA 2V25A 4N8GA 1JW4A 2NUVA 5ET7A 2DWJA 2F36A 4GF8A 1XT8A 5DVIA 4NF8A 2X26A 3V89B 2XXRA 2GHBA 1SI0A 3VV5A 3LSFB 1SDXA 4OQOA 1N3XA 3GBAA 3EF7A 2RINA 3B7DA 3TTMA 1IMCA 2O51A 4IY6A 2ONKE 5FHOA 1O64A 2VHAA 3G3JA 4F1VA 3KBRA 1GV8A 3PUYE 3T1BA 4ONYA 1GTKA 4WXJA 1US4A 3FXUA 1N04A 2KR0A 4LP2B 4BDLA 2OBGA 2F7AA 2XXVA 4PAKA 5ICQA 1LB9A 4YICA 1MXWA 4U4XA 5I2KA 1SYHA 4P0GA 4F2OA 1FTJA 2VOZA 4PTKA 3K2DA 3RTWB 2XD2A 4NG7A 4N6KA 3E78A 4GRKA 5H8HB 4ISUA 3T9VA 3LV0A 3LC8A 1B40A 2BJJX 4NWCA 4TLLB 3G7WA 4PE5B 1QULA 5L9MA 3T66A 4BDQA 3TODA 3ODBA 2VD3A 4OVQA 1ELJA 2AYSA 2F7BA 3EPEA 1LB8A 4N8YA 3T96B 3HO7A 1MPBA 2ONSA 3D1RA 1XVYA 2Y7KA 2D3IA 1B7HA 2V3TA 4FBPA 5A5XB 1JVXA 2I58A 1P1QA 3JYRA 4G8HA 2XXUA 2ONRA 5CC2A 5IKBA 1MQJA 4E0WA 2B3FA 4OA4A 3LSXA 2XXKA 4IO6A 5IM2A 2V4CA 2CZIA 4QFKA 1GVCA 2Y5LA 5HPQA 1B3EA 1Y1ZA 2X7PA 4KYEA 5H8HA 4EQ7A 4DI4B 3MP1A 4GWYA 2O69A 3QUJA 1WDNA 1FPFA 4C1UA 3VFJA 3KC0A 1NH8A 2A5TB 2Y7RA 3RQTA 4G2ZA 5AA3A 1USYH 4ZZEA 2H9BA 1NNKA 1NV6A 4G8NA 3FUZA 1INPA 1A99A 1FQAA 3S2VA 4NQ8A 5TU0A 4F22A 2CZKA 1DTGA 3HHGA 1AH5A 4GX4A 4JVCA 2RCBA 5A5XA 3DM0A 2UYEA 3D4CA 1LAHE 1LFGA 3DP4A 4AQ4A 4JBZA 5EYHA 3E13X 3O9PA 4PC9A 1QGXA 3EN3A 1OMPA 2WYKA 2DDKA 2XXWA 3ZS6A 1EH3A 3RPWA 4OVPA 4JWYA 2ESNA 3FV1A 4I62A 4I40A 2GQ1A 3VVFA 1TWYA 5FBPA 3LSLA 4JWXA 2F8DA 4OFJA 4R75A 3UP9A 4XKNA 1KZ8A 4YKIA 3I5OA 4I8CA 3FD3A 4H8IA 2A5TA 1NNFA 1I69A 3QSLA 3OOAA 4PFYA 3VXBA 1XC1A 2Q88A 1FBFA 4H5GA 4OENA 1Q35A 3O2AA 3K4UA 4NMYA 1MXUA 1D9YA 4R6KA 2NWJA 3R26A 4BDOA 3MWBA 5I2NA 4ZEBA 1A40A 3PV0E 3VVDA 1AIVA 4LZ5A 4KFQA 1AOVA 5I56A 5CI5A 1OQHA 1P99A 3KN8A 2REGA 3OENA 4IY5A 2CEYA 3VDFA 3KGCA 5AA1A 2QFLA 2F6PA 4NF6A 2H5YA 4HTGA 2NVUB 3VLVA 2Z22A 4H67A 1LEVA 2PVUA 4THIA 2Q8JA 4GWOA 4UA8A 3LBSA 3R6UA 4G61A 2V84A 3KG2A 3L6HA 4LA9A 1B7ZA 2GRVA 2RC8A 1VR5A 3IR1A 4ESXA 2GH9A 4HCYA 3OEMA 4F1UA 4MJOA 3IAZA 1Y4CA 5JK4A 4OWDA 5ET8A 3G3GA 2DP8A 3M3KA 4OHNA 1UTBB 4OESA 3HV1A 4OXVA 1H3DA 2XWIA 2YLNA 3FXRA 4AB6A 1KA1A 1QW0A 2B3BA 1GGGA 5I84A 2I49A 5EQ7A 1OLAA 3KOTA 5H8NB 2Q9TA 2P3VA 1XI6A 1LSTA 4I3EA 2FYIA 5I57A 3DLNA 5DEXB 2PFYA 3OXNA 3ZSFA 4MAGA 1FQEA 1BK4A 2I0CA 4OZ9A 1RDZA 4BDMA 4GBWA 4U1ZA 2F3BA 1ZTYA 3TQLA 4RK2A 3FVNA 4H5FA 2QJEA 5DVJA 1MQDA 1PBPA 4P11A 3OD7A 3S4UA 3RY3A 1VSOA 1IMDA 4HXVA 4F39A 1MY1A 1EZPA 3ONMA 3IJOB 5JTYB 3IOVA 2E0SA 4Q30B 5CBSA 3SETA 3CRBA 3TYHA 1FPDA 1LBZA 4ELOA 4MFIA 2YJPA 1IMBA 4M4GA 3W15C 3MQ9A 2WBDA 1FTKA 4MIJA 1Y1MA 1ZU0A 3C35A 4FAJA 3IFCA 3RLFE 5H8QB 4EF1A 2DSFA 4P1EA 1SQYA 4YKPA 4MNPA 2HFBA 3FJ7A 1NV5A 4OETA 3Q29A 3KC1A 4IO7A 4LZ8A 2GFEA 2NOOA 1NV3A 1PB7A 4U22A 1B2HA 2D5WA 1PDAA 2M8CA 1JP4A 3K6XA 5H8NA 5KZTA 4OTEA 1RDYA 1B5JA 4PFRA 3P7IA 4QRZA 1A7LA 1MRPA 3DELB 4MX6A 1R1NA 4KD5A 4YB6A 3H6UA 1OVTA 1B6HA 3PPQA 1FCKA 3SEYA 4ZS9A 2F34A 3LUYA 2L5VA 4G68C 4JXIA 3TDJA 2DWIA 5JTYA 1RYXA 2H98A 4GD5A 4F2QA 1OLCA 1USYE 4PE3A 1QVSA 1NUXA 4NF8B 3VXCA 4FEDA 5B7DA 1JQFA 3T9HB 4DZ1A 1MQHA 3EKIA 4GVOA 4R2FA 1UQWA 1DOTA 1OQGA 3MUQA 1K9ZA 1M5FA 1FTLA 1FTAA 3U93A 3GZGA 4N13A 2I3VA 3E3KA 4DXBA 5LOMA 1JNFA 1B3LA 1D4NA 1Y3PA 2WEFA 3U92A 2OX3A 3RGYA 4MEVA 1YPNA 4PAIA 3RPLA 1YAEA 4X04A 5ESYA 1B46A 1WODA 4PFWA 4MMPA 4U23A 3RTFB 4JWOA 4NF4A 4X1BA 4Z7EA 4P0IA 1Q9DA 3FGSA 1KWHA 4G68B 2QS1A 1EYJA 4BDNA 1IUDA 4PDHA 3KZGA 3A09A 4X1DA 3Q27A 1Y20A 1UIVA 4KXPA 1A54A 2Q89A 1TFAA 2RC9A 1MY4A 1SW4A 1JEVA 2DE4A 1K9YA 4QFOA 4AS4A 1FPBA 4GQOA 1IZ1A 4FECA 3HN0A 4GIZA 1LBXA 1MG1A 1FPIA 4NN3A 3CG1A 1R6ZA 4XEQA 3F11A 2A5SA 2Q2AA 4R73A 1YZ0A 4I9DA 3EQ1A 4O7IA 4XTCQ 3TCGA 1MDQA 1IIWA 4X8RA 5L9SA 2F97A 2DE2A 3GXAA 1MXYA 3HCQA 4ZEIA 3TCHA 3KEIA 4PFBA 4P9KA 3FXBA 1I6BA 1URDA 1N3WA 1B4ZA 3OO6A 1IMFA 1KA0A 4QSDA 1B51A 1B7UA 4JSOA 4OVJA 1FQDA 2F78A 4LVQA 3LSWA 2OK2A 1J1NA 1II5A 3IOWA 4RK9A 2Z8FA 4C1TA 4G68A 3U8QA 4ELQA 5DYHA 3KN7A 5B70A 2E1SA 1B0HA 4L17A 4PAFA 5FTIA 4FJPA 4JVIA 3HPIA 3PPPA 3B50A 4C0RA 3H03A 4FE8A 4OVRA 1UIUA 2P0SA 2DWAA 5JEIA 5CM6A 3N5LA 3SEWA 4H65A 4YZZA 5J1DA 2Z23A 1GR2A 4R74A 3ECRA 3K6WA 5AA2D 4MBPA 1FPLA 3O97A 3H6TA 4IR8A 2UVIA 3FVKA 3T22A 2R71A 3KSJA 4MLVA 4I3YA 3EHSA 3MVZA 1BKAA 2I4BA 2Y7WA 1G0HA 1XS5A 1VDWA 2R6GE 4DE8A 1FPJA 3TMGA 2ZZVA 4POXA 5ET6A 5CBRA 1YXIA 1MDP1 4DIGA 3B6TA 1MPCA 5CMMA 4ZE8A 1VFDA 2XWVA 2HCAA 1Z7ME 3FJGA 4GX6A 3THIA 1B58A 3CIJA 4GWUA 5F1QA 3LUZA 2WYPA 4POWA 5TP9A 4MLQA 4GWSA 4O3BA 3K6UA 4PF6A 2ALUA 4U4SA 4WEDA 1POTA 1D9VA 1RKMA 2Y7PA 1FBDA 3TTLA 5ET5A 4ELPA 2V93A 4LONB 5I2NB 3GLBA 1TXFA 3TTRA 1WVJA 3QAXA 4YKKA 5F7VA 1NNTA 5I56B 3QUFA 2O7UA 2FBPA 3IJXB 3MP8A 5FTHA 4GWWA 4NF0A 4ZEKA 1JETA 3CVGA 4IGRA 3SERA 2XXHA 4QSCA 2VP1A 3UIFA 3S9LC 1B52A 1IXGA 1VFEA 4YMAA 4NF6B 4PCDA 1ATGA 4MF3A 3VVEA 1LAXA 1NV4A 2DQVA 4OERA 4M1VA 3QXMA 4ZEDA 2F6GA 4U1OA 5AA2B 2XXIA 3KOSA 1MM6A 4PDDA 2PCRA 4IGTA 5HM4B 2HXWA 3BKIB 3G3KA 2QMXA 1S50A 2Q2CA 1EYKA 2QMWA 4OEVA 5I59A 3K01A 1BTJA 4ELRA 3N26A 4ZE9A 4E0XA 4AS5A 1MY0A 3CI8A 4KCDA 3B8BA 1LAGE 4F1YA 4NWDA 2Q74A
chains in the Genus database with same CATH topology
2AL4A 2PT2A 4YAHX 4EXLA 3IORA 2ZNTA 2HZLA 4EQ9A 2DE3A 3OO7A 5I57B 3TZAA 1LFIA 1QKBA 4F3SA 3U94A 1MS7A 3QK6A 3SKPA 3IB1A 1B4HA 5AA2A 3U72A 2Z8EA 1CE2A 1H76A 1P1OA 3MVYA 1AL3A 2ZYNA 1O63A 2RC7A 1A8FA 1P1WA 3PU5A 4PETA 3RT6B 2HEUA 1FQBA 4F19A 1I6QA 4G4PA 3PD8A 3TTKA 2R9JA 4G77A 2F35A 1DPPA 4KPTA 4KR5A 5L9OA 1ANFA 2B65A 2I4CA 1S9TA 4NEDA 1LAFE 3OELA 4MH5A 4ECFA 1ZMGA 5CMBA 4AB5A 3GBBA 2Y7IA 1NL5A 4WEPA 4H1XA 5K2XA 3CSBA 2DOJA 1SI1A 3CG3A 2OWTA 5DTBA 4JDFA 4IO4A 3SEVA 1Y3QA 2AIXA 1LCFA 2KLFA 3PUZE 4KCCA 1NMUA 3FVOA 3T93B 2QRYA 5AA4B 4ZDMA 4X9TA 3C4MA 2O6AA 1N7XA 3K00A 2FA7A 4GL0A 4XKQA 3HSTA 3MBPA 4EXKA 3TFLA 5H8FA 3G3FA 1PEBA 4Q0CA 5IAIA 4G8MA 4FEBA 4H8JA 4DCYA 5CMCA 4FIMA 1R9LA 3T9UA 1JEUA 3H3GA 1MQGA 3FZVA 4ZECA 3C32A 2RCAA 2ANJA 1QJMA 1SD3A 5L8DA 4EQBA 4QSEA 1F9BA 4KYDA 3K6VA 1XOCA 2FNCA 4NF4B 3PGFA 3PD9A 1PBQA 3H06B 2CMOA 3OMBA 3H6VA 5AA4A 2O1MA 4NTLA 3FXQA 4IO2A 1B0LA 1MM7A 3M3LA 3O29A 3BBRA 3MZ9A 3K0VA 4R9FA 2H4IA 2XD3A 2PT1A 5ICTA 3I3VA 4RPNA 1P1UA 3W9WA 1LCTA 1MY3A 1LBCA 2XXPA 3MP6A 3IO4A 2XX9A 2ZYMA 3PUVE 5ITOA 3K1PA 3T9XB 4OEUA 4LQ5A 1N7WA 3IB0A 1L5TA 3C34A 3IX1A 1HSEA 3K1NA 2CZLA 3ILUB 5DVFA 3D4GA 2ABHA 2DVCA 4K3FA 3TQWA 3BFUA 1S7YA 3G3HA 2HZKA 2F7CA 4O3AA 2G93A 4YB5A 1HSJA 1B1HA 2ZXTA 1M5BA 3U1OA 1MPDA 4DDDA 1URSA 3R7XA 3UK4A 3O6IA 3KSXA 1IITA 1BP5A 1MH3A 4RNSA 1B5IA 1H44A 4R72A 3CR9A 4Q5TA 2IA4A 1POY1 3C33A 3OO8A 4NE4A 4XXUA 3O6HA 3H7MA 4OFLA 1BLFA 3V8XB 1ZKBA 2OLBA 1XVXA 1FW0A 3K1MA 4F29A 3O66A 2LAOA 3CSGA 3FJMA 3PMVA 3S9MC 2RF1A 2UYFA 2Y84A 3Q26A 1NKXA 1B05A 2HAUA 4KHZE 3CFZA 1IXIA 2WKYA 4FATA 1DPEA 1A55A 3V5AA 4R6HA 5TP9B 2THIA 5FHMA 4JB7A 2XXXA 2ZYKA 3MVWA 3IK6B 2XHDA 2REJA 1SW5A 1BIYA 4KI0E 4RA1A 4ESWA 5ITPA 2QS2A 1Y9UA 2DVZA 2H99A 3UN6A 4NF5B 3PUXE 2V3QA 2O1LA 5ELVA 4ZEFA 5K2YA 2XXTA 1PC3A 3MJNA 3SEUA 2G29A 3PPNA 2I3WA 4U21A 1IEJA 4LQ2A 1MH4A 1FTMA 2ZNSA 4KQPA 3USDA 4BLAA 4ZZAA 4KYSA 1B1XA 1ZLQA 1MXZA 1MXVA 5TPAB 3N94A 1B9JA 1JW5A 1IXCA 2F5XA 2W7YA 2D21A 2HQ0A 3I6VA 4EDPA 3G3IA 3RNNA 1UTHB 3B6QA 2UVGA 1B5HA 3S9EA 1QUJA 5ISUA 2QS3A 2QS4A 3FV2A 4PFUA 2O84X 4UACA 3LR1A 3DP8A 2HAVA 4PQJA 3ZKKA 1MY2A 4TOZA 1PB8A 4N07A 4QF9A 5I59B 2DYXA 3IO6A 1FTOA 1B3HA 3M3FA 3A3CA 4GL8A 3VE1B 1Z7NE 3WAEA 1EU8A 3E4RA 4H6DA 4NF5A 2VD2A 1QKAA 2OCUA 4F3PA 3MC2A 1NFTA 3KFMA 3OEKA 1O7TA 1D3KA 2NXOA 2V3UA 3L6GA 4DLDA 3IL1B 5AE4A 1ZJLA 2I6EA 1Q1KA 1SBPA 2PMSA 4HCWA 1QUIA 4OFOA 2XXQA 3SESA 2IEEA 5I58B 5BWJA 3VLUA 1Y4TA 1VE4A 1SYIA 3QIMA 5TPAA 4FORA 4IO5A 1RYOA 3A3UA 3MPLA 3IOTA 1B32A 4PFTA 4N6PA 3PPRA 4DCXA 1UTHA 3JV9A 4RYAA 3QYTA 4OYVA 1SVXB 1ZIUA 2OZZA 4I1DA 3MVXA 4X48A 3TCFA 1DMBA 4F31B 2DWHA 2X7QA 3E9XA 3ZKLA 3S9NC 3MW0A 3N6TA 1MXXA 1M5CA 1FQCA 3PPOA 1JW1A 4RPOA 1H45A 5KCJB 3UGWA 3EHTA 3TPAA 5EHSA 4EUOA 2ZMBA 3KJTA 4GLIA 1LBBA 2I48A 4OMBA 4F18A 1Y3NA 1IQ7A 1M5EA 1YCJA 5I58A 3C36A 3KJ7A 3RUMA 1LFHA 3ILTB 2PYYA 3H6WA 1R9QA 5BUUA 1URGA 1N76A 1DSNA 2O7IA 2I0BA 2O68A 3FATA 1LGBC 2QL3A 5DT6A 1OVBA 1TFDA 5KDTB 2UVHA 4QFPA 1JVYA 2GHAA 3RN8A 1B3GA 4QHQA 5H8FB 4GOTA 1HSLA 3IOUA 1H43A 5KCJA 3RT8A 3CFLA 4U2RA 4IB2A 3IB2A 4XIGQ 3MAMA 3PMXA 5FHNA 2XX7A 4F3GA 3JZJA 1M5DA 3TUSA 4ND9A 4Z0IA 1A8EA 3AXFA 5CRYA 2DXRA 3Q25A 3VLWA 4GXAA 3UA8A 4WKMA 1N84A 1SW1A 4R6YA 2P1SA 5EYFA 2H25A 4LUBA 1TT1A 5HBCA 3B6WA 3EHUA 3TKDA 3TELA 5KDTA 4F3BA 2DS9A 4QFLA 3OSQA 4RY1A 1T0KA 3FIRA 3W9VA 1YTVA 3FASA 2PX1A 3TAJA 4DXCA 3BFTA 4JSDA 3UORA 2UXAA 3N6UA 2Z8DA 2RKMA 4RJZA 1ZBMA 3C9HA 4QFNA 2AL5A 2PBWA 3OO9A 1UTBA 3HHFA 3TEPA 1XHYA 4R2BA 4GXSB 3H4ZA 4PP0A 1QUKA 2ZNUA 2DXYA 1CB6A 1EZOA 4YB7A 4TLMB 4DXUA 4LATA 5DEXA 1EZ9A 1P1NA 4HW8A 1NH7A 4Q8RA 1LLSA 3MZBA 2OJTA 3FVGA 3PUWE 3O6GA 4BDRA 1N0TA 3PMWA 1I6AA 4LZ7A 3CFXA 4XKPA 4RXLA 1US5A 1MQIA 4H0WA 4YMBA 3C31A 2YPNA 5H8QA 5CMKA 3V83A 1PB9A 5H8SA 3OSRA 3DP6A 4YKJA 1OIBA 1SW2A 2QSXA 2VGQA 2XXYA 4EF2A 3KN3A 3M8UA 2UVJA 4XKRA 1IXHA 1DTZA 4IO3A 5M2VA 1FQFA 4TQUQ 2XX8A 3WAFA 1NNPA 2QPQA 3O28A 4YU0A 3SDFA 5EHMA 4O3CA 1AMFA 2P2AA 3TTNA 3Q28A 3MZ1A 4GFRA 4HS7A 2OWSA 4R9GA 3MPKA 1B3FA 3K02A 2ZYOA 5I2KB 3SEXA 2V25A 1JW4A 2NUVA 2DWJA 2F36A 4GF8A 1XT8A 5DVIA 4NF8A 2X26A 3V89B 2XXRA 2GHBA 1SI0A 3VV5A 3LSFB 1SDXA 4OQOA 1N3XA 3GBAA 3EF7A 2RINA 3B7DA 3TTMA 2O51A 4IY6A 2ONKE 5FHOA 1O64A 2VHAA 3G3JA 4F1VA 3KBRA 1GV8A 3PUYE 4ONYA 1GTKA 4WXJA 1US4A 3FXUA 1N04A 4LP2B 4BDLA 2OBGA 2F7AA 2XXVA 5ICQA 1LB9A 4YICA 1MXWA 4U4XA 5I2KA 1SYHA 4P0GA 4F2OA 1FTJA 2VOZA 3K2DA 3RTWB 2XD2A 4GRKA 5H8HB 4ISUA 3T9VA 3LC8A 1B40A 2BJJX 4NWCA 4TLLB 3G7WA 4PE5B 1QULA 5L9MA 3T66A 4BDQA 3TODA 3ODBA 2VD3A 1ELJA 2AYSA 2F7BA 3EPEA 1LB8A 3T96B 3HO7A 1MPBA 2ONSA 1XVYA 2Y7KA 2D3IA 1B7HA 2V3TA 5A5XB 1JVXA 2I58A 1P1QA 3JYRA 4G8HA 2XXUA 2ONRA 5CC2A 5IKBA 1MQJA 4E0WA 2B3FA 3LSXA 4IO6A 4QFKA 1GVCA 5HPQA 1B3EA 1Y1ZA 2X7PA 4KYEA 5H8HA 4EQ7A 3MP1A 2O69A 3QUJA 1WDNA 4C1UA 3VFJA 1NH8A 2A5TB 2Y7RA 3RQTA 4G2ZA 5AA3A 1USYH 4ZZEA 2H9BA 1NNKA 4G8NA 3FUZA 1A99A 1FQAA 3S2VA 5TU0A 4F22A 1DTGA 3HHGA 1AH5A 2RCBA 5A5XA 3DM0A 2UYEA 3D4CA 1LAHE 1LFGA 3DP4A 4AQ4A 4JBZA 3E13X 3O9PA 3EN3A 1OMPA 2XXWA 3ZS6A 1EH3A 3RPWA 4JWYA 2ESNA 3FV1A 4I62A 3VVFA 1TWYA 3LSLA 4JWXA 2F8DA 4OFJA 4R75A 3UP9A 4XKNA 4YKIA 3I5OA 4I8CA 3FD3A 4H8IA 2A5TA 1NNFA 1I69A 3QSLA 3OOAA 4PFYA 3VXBA 1XC1A 2Q88A 4H5GA 4OENA 1Q35A 3O2AA 3K4UA 4NMYA 1MXUA 1D9YA 4R6KA 2NWJA 3R26A 4BDOA 3MWBA 5I2NA 4ZEBA 1A40A 3PV0E 3VVDA 1AIVA 4LZ5A 4KFQA 1AOVA 5I56A 5CI5A 1OQHA 1P99A 3KN8A 2REGA 3OENA 4IY5A 3VDFA 3KGCA 5AA1A 2F6PA 4NF6A 2H5YA 4HTGA 2NVUB 3VLVA 2Z22A 4H67A 2PVUA 4THIA 2Q8JA 4GWOA 4UA8A 3LBSA 3R6UA 2V84A 3KG2A 3L6HA 4LA9A 1B7ZA 2GRVA 2RC8A 1VR5A 3IR1A 4ESXA 2GH9A 4HCYA 3OEMA 4F1UA 3IAZA 1Y4CA 5JK4A 4OWDA 3G3GA 2DP8A 3M3KA 4OHNA 1UTBB 4OESA 3HV1A 4OXVA 1H3DA 2YLNA 3FXRA 4AB6A 1QW0A 2B3BA 1GGGA 5I84A 2I49A 1OLAA 3KOTA 5H8NB 2Q9TA 1LSTA 2FYIA 5I57A 3DLNA 5DEXB 3OXNA 3ZSFA 1FQEA 2I0CA 4OZ9A 4BDMA 4U1ZA 1ZTYA 3TQLA 4RK2A 3FVNA 4H5FA 2QJEA 5DVJA 1MQDA 1PBPA 4P11A 3OD7A 3S4UA 3RY3A 1VSOA 4F39A 1MY1A 1EZPA 3ONMA 3IJOB 5JTYB 3IOVA 2E0SA 4Q30B 5CBSA 3SETA 3CRBA 3TYHA 4ELOA 4MFIA 2YJPA 4M4GA 3W15C 3MQ9A 1FTKA 1Y1MA 1ZU0A 3C35A 4FAJA 3RLFE 5H8QB 4EF1A 2DSFA 1SQYA 4YKPA 4OETA 2HFBA 3FJ7A 3Q29A 4LZ8A 4IO7A 2GFEA 2NOOA 1PB7A 4U22A 1B2HA 2D5WA 1PDAA 2M8CA 3K6XA 5H8NA 5KZTA 4OTEA 1B5JA 3P7IA 4QRZA 1A7LA 1MRPA 3DELB 1R1NA 4KD5A 4YB6A 3H6UA 1OVTA 1B6HA 3PPQA 1FCKA 3SEYA 4ZS9A 2F34A 3LUYA 4G68C 4JXIA 3TDJA 2DWIA 5JTYA 1RYXA 2H98A 4GD5A 4F2QA 1OLCA 1USYE 1QVSA 4NF8B 3VXCA 4FEDA 5B7DA 1JQFA 3T9HB 4DZ1A 1MQHA 4GVOA 4R2FA 1UQWA 1DOTA 1OQGA 3MUQA 1M5FA 1FTLA 3U93A 3GZGA 4N13A 2I3VA 3E3KA 4DXBA 5LOMA 1JNFA 1B3LA 1D4NA 1Y3PA 3U92A 3RGYA 1YPNA 1YAEA 1B46A 1WODA 4PFWA 4U23A 3RTFB 4JWOA 4NF4A 4X1BA 4Z7EA 4P0IA 3FGSA 1KWHA 4G68B 2QS1A 4BDNA 1IUDA 3KZGA 3A09A 4X1DA 3Q27A 1Y20A 1UIVA 1A54A 2Q89A 1TFAA 2RC9A 1MY4A 1SW4A 1JEVA 2DE4A 4QFOA 4GQOA 1IZ1A 4FECA 3HN0A 4GIZA 1MG1A 3CG1A 1R6ZA 3F11A 2A5SA 2Q2AA 4R73A 4I9DA 3EQ1A 4XTCQ 3TCGA 1MDQA 1IIWA 5L9SA 2F97A 2DE2A 3GXAA 1MXYA 3HCQA 4ZEIA 3TCHA 3KEIA 1I6BA 1URDA 1N3WA 1B4ZA 3OO6A 4QSDA 1B51A 1B7UA 4JSOA 4OVJA 1FQDA 2F78A 4LVQA 3LSWA 2OK2A 1J1NA 1II5A 3IOWA 4RK9A 2Z8FA 4C1TA 4G68A 3U8QA 4ELQA 5DYHA 3KN7A 5B70A 2E1SA 1B0HA 4L17A 5FTIA 4FJPA 3HPIA 3PPPA 4C0RA 3H03A 4FE8A 1UIUA 2P0SA 2DWAA 5JEIA 5CM6A 3N5LA 3SEWA 4H65A 4YZZA 5J1DA 2Z23A 1GR2A 4R74A 3ECRA 3K6WA 5AA2D 4MBPA 3O97A 3H6TA 2UVIA 3FVKA 3T22A 2R71A 3KSJA 4MLVA 3EHSA 3MVZA 1BKAA 2I4BA 2Y7WA 1XS5A 2R6GE 4DE8A 3TMGA 4POXA 5CBRA 1MDP1 4DIGA 3B6TA 1MPCA 5CMMA 4ZE8A 1VFDA 2HCAA 1Z7ME 3FJGA 3THIA 1B58A 3CIJA 5F1QA 4POWA 5TP9A 4MLQA 4O3BA 3K6UA 2ALUA 4U4SA 4WEDA 1POTA 1D9VA 1RKMA 2Y7PA 3TTLA 4ELPA 2V93A 4LONB 5I2NB 3GLBA 1TXFA 3TTRA 1WVJA 3QAXA 4YKKA 5F7VA 1NNTA 5I56B 3QUFA 2O7UA 3IJXB 3MP8A 5FTHA 4ZEKA 1JETA 3CVGA 4IGRA 3SERA 2XXHA 4QSCA 2VP1A 3UIFA 3S9LC 1B52A 1IXGA 1VFEA 4YMAA 4NF6B 1ATGA 4MF3A 3VVEA 1LAXA 2DQVA 4OERA 4M1VA 3QXMA 4ZEDA 2F6GA 4U1OA 5AA2B 2XXIA 3KOSA 1MM6A 4IGTA 5HM4B 2HXWA 3BKIB 3G3KA 2QMXA 1S50A 2Q2CA 2QMWA 4OEVA 5I59A 3K01A 1BTJA 4ELRA 3N26A 4ZE9A 4E0XA 1MY0A 3CI8A 4KCDA 4F1YA 1LAGE 4NWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL4 A;  2PT2 A;  4YAH X;  4EXL A;  3IOR A;  2ZNT A;  2HZL A;  4EQ9 A;  2DE3 A;  3OO7 A;  5I57 B;  3TZA A;  1LFI A;  1QKB A;  4F3S A;  3U94 A;  1MS7 A;  3QK6 A;  3SKP A;  3IB1 A;  1B4H A;  5AA2 A;  3U72 A;  2Z8E A;  1CE2 A;  1H76 A;  1P1O A;  3MVY A;  1AL3 A;  2ZYN A;  1O63 A;  2RC7 A;  1A8F A;  1P1W A;  3PU5 A;  4PET A;  3RT6 B;  2HEU A;  1FQB A;  4F19 A;  1I6Q A;  4G4P A;  3PD8 A;  3TTK A;  2R9J A;  4G77 A;  2F35 A;  1DPP A;  4KPT A;  4KR5 A;  5L9O A;  1ANF A;  2B65 A;  2I4C A;  1S9T A;  4NED A;  1LAF E;  3OEL A;  4MH5 A;  4ECF A;  1ZMG A;  5CMB A;  4AB5 A;  3GBB A;  2Y7I A;  1NL5 A;  4WEP A;  4H1X A;  5K2X A;  3CSB A;  2DOJ A;  1SI1 A;  3CG3 A;  2OWT A;  5DTB A;  4JDF A;  4IO4 A;  3SEV A;  1Y3Q A;  2AIX A;  1LCF A;  2KLF A;  3PUZ E;  4KCC A;  1NMU A;  3FVO A;  3T93 B;  2QRY A;  5AA4 B;  4ZDM A;  4X9T A;  3C4M A;  2O6A A;  1N7X A;  3K00 A;  2FA7 A;  4GL0 A;  4XKQ A;  3HST A;  3MBP A;  4EXK A;  3TFL A;  5H8F A;  3G3F A;  1PEB A;  4Q0C A;  5IAI A;  4G8M A;  4FEB A;  4H8J A;  4DCY A;  5CMC A;  4FIM A;  1R9L A;  3T9U A;  1JEU A;  3H3G A;  1MQG A;  3FZV A;  4ZEC A;  3C32 A;  2RCA A;  2ANJ A;  1QJM A;  1SD3 A;  5L8D A;  4EQB A;  4QSE A;  1F9B A;  4KYD A;  3K6V A;  1XOC A;  2FNC A;  4NF4 B;  3PGF A;  3PD9 A;  1PBQ A;  3H06 B;  2CMO A;  3OMB A;  3H6V A;  5AA4 A;  2O1M A;  4NTL A;  3FXQ A;  4IO2 A;  1B0L A;  1MM7 A;  3M3L A;  3O29 A;  3BBR A;  3MZ9 A;  3K0V A;  4R9F A;  2H4I A;  2XD3 A;  2PT1 A;  5ICT A;  3I3V A;  4RPN A;  1P1U A;  3W9W A;  1LCT A;  1MY3 A;  1LBC A;  2XXP A;  3MP6 A;  3IO4 A;  2XX9 A;  2ZYM A;  3PUV E;  5ITO A;  3K1P A;  3T9X B;  4OEU A;  4LQ5 A;  1N7W A;  3IB0 A;  1L5T A;  3C34 A;  3IX1 A;  1HSE A;  3K1N A;  2CZL A;  3ILU B;  5DVF A;  3D4G A;  2ABH A;  2DVC A;  4K3F A;  3TQW A;  3BFU A;  1S7Y A;  3G3H A;  2HZK A;  2F7C A;  4O3A A;  2G93 A;  4YB5 A;  1HSJ A;  1B1H A;  2ZXT A;  1M5B A;  3U1O A;  1MPD A;  4DDD A;  1URS A;  3R7X A;  3UK4 A;  3O6I A;  3KSX A;  1IIT A;  1BP5 A;  1MH3 A;  4RNS A;  1B5I A;  1H44 A;  4R72 A;  3CR9 A;  4Q5T A;  2IA4 A;  1POY 1;  3C33 A;  3OO8 A;  4NE4 A;  4XXU A;  3O6H A;  3H7M A;  4OFL A;  1BLF A;  3V8X B;  1ZKB A;  2OLB A;  1XVX A;  1FW0 A;  3K1M A;  4F29 A;  3O66 A;  2LAO A;  3CSG A;  3FJM A;  3PMV A;  3S9M C;  2RF1 A;  2UYF A;  2Y84 A;  3Q26 A;  1NKX A;  1B05 A;  2HAU A;  4KHZ E;  3CFZ A;  1IXI A;  2WKY A;  4FAT A;  1DPE A;  1A55 A;  3V5A A;  4R6H A;  5TP9 B;  2THI A;  5FHM A;  4JB7 A;  2XXX A;  2ZYK A;  3MVW A;  3IK6 B;  2XHD A;  2REJ A;  1SW5 A;  1BIY A;  4KI0 E;  4RA1 A;  4ESW A;  5ITP A;  2QS2 A;  1Y9U A;  2DVZ A;  2H99 A;  3UN6 A;  4NF5 B;  3PUX E;  2V3Q A;  2O1L A;  5ELV A;  4ZEF A;  5K2Y A;  2XXT A;  1PC3 A;  3MJN A;  3SEU A;  2G29 A;  3PPN A;  2I3W A;  4U21 A;  1IEJ A;  4LQ2 A;  1MH4 A;  1FTM A;  2ZNS A;  4KQP A;  3USD A;  4BLA A;  4ZZA A;  4KYS A;  1B1X A;  1ZLQ A;  1MXZ A;  1MXV A;  5TPA B;  3N94 A;  1B9J A;  1JW5 A;  1IXC A;  2F5X A;  2W7Y A;  2D21 A;  2HQ0 A;  3I6V A;  4EDP A;  3G3I A;  3RNN A;  1UTH B;  3B6Q A;  2UVG A;  1B5H A;  3S9E A;  1QUJ A;  5ISU A;  2QS3 A;  2QS4 A;  3FV2 A;  4PFU A;  2O84 X;  4UAC A;  3LR1 A;  3DP8 A;  2HAV A;  4PQJ A;  3ZKK A;  1MY2 A;  4TOZ A;  1PB8 A;  4N07 A;  4QF9 A;  5I59 B;  2DYX A;  3IO6 A;  1FTO A;  1B3H A;  3M3F A;  3A3C A;  4GL8 A;  3VE1 B;  1Z7N E;  3WAE A;  1EU8 A;  3E4R A;  4H6D A;  4NF5 A;  2VD2 A;  1QKA A;  2OCU A;  4F3P A;  3MC2 A;  1NFT A;  3KFM A;  3OEK A;  1O7T A;  1D3K A;  2NXO A;  2V3U A;  3L6G A;  4DLD A;  3IL1 B;  5AE4 A;  1ZJL A;  2I6E A;  1Q1K A;  1SBP A;  2PMS A;  4HCW A;  1QUI A;  4OFO A;  2XXQ A;  3SES A;  2IEE A;  5I58 B;  5BWJ A;  3VLU A;  1Y4T A;  1VE4 A;  1SYI A;  3QIM A;  5TPA A;  4FOR A;  4IO5 A;  1RYO A;  3A3U A;  3MPL A;  3IOT A;  1B32 A;  4PFT A;  4N6P A;  3PPR A;  4DCX A;  1UTH A;  3JV9 A;  4RYA A;  3QYT A;  4OYV A;  1SVX B;  1ZIU A;  2OZZ A;  4I1D A;  3MVX A;  4X48 A;  3TCF A;  1DMB A;  4F31 B;  2DWH A;  2X7Q A;  3E9X A;  3ZKL A;  3S9N C;  3MW0 A;  3N6T A;  1MXX A;  1M5C A;  1FQC A;  3PPO A;  1JW1 A;  4RPO A;  1H45 A;  5KCJ B;  3UGW A;  3EHT A;  3TPA A;  5EHS A;  4EUO A;  2ZMB A;  3KJT A;  4GLI A;  1LBB A;  2I48 A;  4OMB A;  4F18 A;  1Y3N A;  1IQ7 A;  1M5E A;  1YCJ A;  5I58 A;  3C36 A;  3KJ7 A;  3RUM A;  1LFH A;  3ILT B;  2PYY A;  3H6W A;  1R9Q A;  5BUU A;  1URG A;  1N76 A;  1DSN A;  2O7I A;  2I0B A;  2O68 A;  3FAT A;  1LGB C;  2QL3 A;  5DT6 A;  1OVB A;  1TFD A;  5KDT B;  2UVH A;  4QFP A;  1JVY A;  2GHA A;  3RN8 A;  1B3G A;  4QHQ A;  5H8F B;  4GOT A;  1HSL A;  3IOU A;  1H43 A;  5KCJ A;  3RT8 A;  3CFL A;  4U2R A;  4IB2 A;  3IB2 A;  4XIG Q;  3MAM A;  3PMX A;  5FHN A;  2XX7 A;  4F3G A;  3JZJ A;  1M5D A;  3TUS A;  4ND9 A;  4Z0I A;  1A8E A;  3AXF A;  5CRY A;  2DXR A;  3Q25 A;  3VLW A;  4GXA A;  3UA8 A;  4WKM A;  1N84 A;  1SW1 A;  4R6Y A;  2P1S A;  5EYF A;  2H25 A;  4LUB A;  1TT1 A;  5HBC A;  3B6W A;  3EHU A;  3TKD A;  3TEL A;  5KDT A;  4F3B A;  2DS9 A;  4QFL A;  3OSQ A;  4RY1 A;  1T0K A;  3FIR A;  3W9V A;  1YTV A;  3FAS A;  2PX1 A;  3TAJ A;  4DXC A;  3BFT A;  4JSD A;  3UOR A;  2UXA A;  3N6U A;  2Z8D A;  2RKM A;  4RJZ A;  1ZBM A;  3C9H A;  4QFN A;  2AL5 A;  2PBW A;  3OO9 A;  1UTB A;  3HHF A;  3TEP A;  1XHY A;  4R2B A;  4GXS B;  3H4Z A;  4PP0 A;  1QUK A;  2ZNU A;  2DXY A;  1CB6 A;  1EZO A;  4YB7 A;  4TLM B;  4DXU A;  4LAT A;  5DEX A;  1EZ9 A;  1P1N A;  4HW8 A;  1NH7 A;  4Q8R A;  1LLS A;  3MZB A;  2OJT A;  3FVG A;  3PUW E;  3O6G A;  4BDR A;  1N0T A;  3PMW A;  1I6A A;  4LZ7 A;  3CFX A;  4XKP A;  4RXL A;  1US5 A;  1MQI A;  4H0W A;  4YMB A;  3C31 A;  2YPN A;  5H8Q A;  5CMK A;  3V83 A;  1PB9 A;  5H8S A;  3OSR A;  3DP6 A;  4YKJ A;  1OIB A;  1SW2 A;  2QSX A;  2VGQ A;  2XXY A;  4EF2 A;  3KN3 A;  3M8U A;  2UVJ A;  4XKR A;  1IXH A;  1DTZ A;  4IO3 A;  5M2V A;  1FQF A;  4TQU Q;  2XX8 A;  3WAF A;  1NNP A;  2QPQ A;  3O28 A;  4YU0 A;  3SDF A;  5EHM A;  4O3C A;  1AMF A;  2P2A A;  3TTN A;  3Q28 A;  3MZ1 A;  4GFR A;  4HS7 A;  2OWS A;  4R9G A;  3MPK A;  1B3F A;  3K02 A;  2ZYO A;  5I2K B;  3SEX A;  2V25 A;  1JW4 A;  2NUV A;  2DWJ A;  2F36 A;  4GF8 A;  1XT8 A;  5DVI A;  4NF8 A;  2X26 A;  3V89 B;  2XXR A;  2GHB A;  1SI0 A;  3VV5 A;  3LSF B;  1SDX A;  4OQO A;  1N3X A;  3GBA A;  3EF7 A;  2RIN A;  3B7D A;  3TTM A;  2O51 A;  4IY6 A;  2ONK E;  5FHO A;  1O64 A;  2VHA A;  3G3J A;  4F1V A;  3KBR A;  1GV8 A;  3PUY E;  4ONY A;  1GTK A;  4WXJ A;  1US4 A;  3FXU A;  1N04 A;  4LP2 B;  4BDL A;  2OBG A;  2F7A A;  2XXV A;  5ICQ A;  1LB9 A;  4YIC A;  1MXW A;  4U4X A;  5I2K A;  1SYH A;  4P0G A;  4F2O A;  1FTJ A;  2VOZ A;  3K2D A;  3RTW B;  2XD2 A;  4GRK A;  5H8H B;  4ISU A;  3T9V A;  3LC8 A;  1B40 A;  2BJJ X;  4NWC A;  4TLL B;  3G7W A;  4PE5 B;  1QUL A;  5L9M A;  3T66 A;  4BDQ A;  3TOD A;  3ODB A;  2VD3 A;  1ELJ A;  2AYS A;  2F7B A;  3EPE A;  1LB8 A;  3T96 B;  3HO7 A;  1MPB A;  2ONS A;  1XVY A;  2Y7K A;  2D3I A;  1B7H A;  2V3T A;  5A5X B;  1JVX A;  2I58 A;  1P1Q A;  3JYR A;  4G8H A;  2XXU A;  2ONR A;  5CC2 A;  5IKB A;  1MQJ A;  4E0W A;  2B3F A;  3LSX A;  4IO6 A;  4QFK A;  1GVC A;  5HPQ A;  1B3E A;  1Y1Z A;  2X7P A;  4KYE A;  5H8H A;  4EQ7 A;  3MP1 A;  2O69 A;  3QUJ A;  1WDN A;  4C1U A;  3VFJ A;  1NH8 A;  2A5T B;  2Y7R A;  3RQT A;  4G2Z A;  5AA3 A;  1USY H;  4ZZE A;  2H9B A;  1NNK A;  4G8N A;  3FUZ A;  1A99 A;  1FQA A;  3S2V A;  5TU0 A;  4F22 A;  1DTG A;  3HHG A;  1AH5 A;  2RCB A;  5A5X A;  3DM0 A;  2UYE A;  3D4C A;  1LAH E;  1LFG A;  3DP4 A;  4AQ4 A;  4JBZ A;  3E13 X;  3O9P A;  3EN3 A;  1OMP A;  2XXW A;  3ZS6 A;  1EH3 A;  3RPW A;  4JWY A;  2ESN A;  3FV1 A;  4I62 A;  3VVF A;  1TWY A;  3LSL A;  4JWX A;  2F8D A;  4OFJ A;  4R75 A;  3UP9 A;  4XKN A;  4YKI A;  3I5O A;  4I8C A;  3FD3 A;  4H8I A;  2A5T A;  1NNF A;  1I69 A;  3QSL A;  3OOA A;  4PFY A;  3VXB A;  1XC1 A;  2Q88 A;  4H5G A;  4OEN A;  1Q35 A;  3O2A A;  3K4U A;  4NMY A;  1MXU A;  1D9Y A;  4R6K A;  2NWJ A;  3R26 A;  4BDO A;  3MWB A;  5I2N A;  4ZEB A;  1A40 A;  3PV0 E;  3VVD A;  1AIV A;  4LZ5 A;  4KFQ A;  1AOV A;  5I56 A;  5CI5 A;  1OQH A;  1P99 A;  3KN8 A;  2REG A;  3OEN A;  4IY5 A;  3VDF A;  3KGC A;  5AA1 A;  2F6P A;  4NF6 A;  2H5Y A;  4HTG A;  2NVU B;  3VLV A;  2Z22 A;  4H67 A;  2PVU A;  4THI A;  2Q8J A;  4GWO A;  4UA8 A;  3LBS A;  3R6U A;  2V84 A;  3KG2 A;  3L6H A;  4LA9 A;  1B7Z A;  2GRV A;  2RC8 A;  1VR5 A;  3IR1 A;  4ESX A;  2GH9 A;  4HCY A;  3OEM A;  4F1U A;  3IAZ A;  1Y4C A;  5JK4 A;  4OWD A;  3G3G A;  2DP8 A;  3M3K A;  4OHN A;  1UTB B;  4OES A;  3HV1 A;  4OXV A;  1H3D A;  2YLN A;  3FXR A;  4AB6 A;  1QW0 A;  2B3B A;  1GGG A;  5I84 A;  2I49 A;  1OLA A;  3KOT A;  5H8N B;  2Q9T A;  1LST A;  2FYI A;  5I57 A;  3DLN A;  5DEX B;  3OXN A;  3ZSF A;  1FQE A;  2I0C A;  4OZ9 A;  4BDM A;  4U1Z A;  1ZTY A;  3TQL A;  4RK2 A;  3FVN A;  4H5F A;  2QJE A;  5DVJ A;  1MQD A;  1PBP A;  4P11 A;  3OD7 A;  3S4U A;  3RY3 A;  1VSO A;  4F39 A;  1MY1 A;  1EZP A;  3ONM A;  3IJO B;  5JTY B;  3IOV A;  2E0S A;  4Q30 B;  5CBS A;  3SET A;  3CRB A;  3TYH A;  4ELO A;  4MFI A;  2YJP A;  4M4G A;  3W15 C;  3MQ9 A;  1FTK A;  1Y1M A;  1ZU0 A;  3C35 A;  4FAJ A;  3RLF E;  5H8Q B;  4EF1 A;  2DSF A;  1SQY A;  4YKP A;  4OET A;  2HFB A;  3FJ7 A;  3Q29 A;  4LZ8 A;  4IO7 A;  2GFE A;  2NOO A;  1PB7 A;  4U22 A;  1B2H A;  2D5W A;  1PDA A;  2M8C A;  3K6X A;  5H8N A;  5KZT A;  4OTE A;  1B5J A;  3P7I A;  4QRZ A;  1A7L A;  1MRP A;  3DEL B;  1R1N A;  4KD5 A;  4YB6 A;  3H6U A;  1OVT A;  1B6H A;  3PPQ A;  1FCK A;  3SEY A;  4ZS9 A;  2F34 A;  3LUY A;  4G68 C;  4JXI A;  3TDJ A;  2DWI A;  5JTY A;  1RYX A;  2H98 A;  4GD5 A;  4F2Q A;  1OLC A;  1USY E;  1QVS A;  4NF8 B;  3VXC A;  4FED A;  5B7D A;  1JQF A;  3T9H B;  4DZ1 A;  1MQH A;  4GVO A;  4R2F A;  1UQW A;  1DOT A;  1OQG A;  3MUQ A;  1M5F A;  1FTL A;  3U93 A;  3GZG A;  4N13 A;  2I3V A;  3E3K A;  4DXB A;  5LOM A;  1JNF A;  1B3L A;  1D4N A;  1Y3P A;  3U92 A;  3RGY A;  1YPN A;  1YAE A;  1B46 A;  1WOD A;  4PFW A;  4U23 A;  3RTF B;  4JWO A;  4NF4 A;  4X1B A;  4Z7E A;  4P0I A;  3FGS A;  1KWH A;  4G68 B;  2QS1 A;  4BDN A;  1IUD A;  3KZG A;  3A09 A;  4X1D A;  3Q27 A;  1Y20 A;  1UIV A;  1A54 A;  2Q89 A;  1TFA A;  2RC9 A;  1MY4 A;  1SW4 A;  1JEV A;  2DE4 A;  4QFO A;  4GQO A;  1IZ1 A;  4FEC A;  3HN0 A;  4GIZ A;  1MG1 A;  3CG1 A;  1R6Z A;  3F11 A;  2A5S A;  2Q2A A;  4R73 A;  4I9D A;  3EQ1 A;  4XTC Q;  3TCG A;  1MDQ A;  1IIW A;  5L9S A;  2F97 A;  2DE2 A;  3GXA A;  1MXY A;  3HCQ A;  4ZEI A;  3TCH A;  3KEI A;  1I6B A;  1URD A;  1N3W A;  1B4Z A;  3OO6 A;  4QSD A;  1B51 A;  1B7U A;  4JSO A;  4OVJ A;  1FQD A;  2F78 A;  4LVQ A;  3LSW A;  2OK2 A;  1J1N A;  1II5 A;  3IOW A;  4RK9 A;  2Z8F A;  4C1T A;  4G68 A;  3U8Q A;  4ELQ A;  5DYH A;  3KN7 A;  5B70 A;  2E1S A;  1B0H A;  4L17 A;  5FTI A;  4FJP A;  3HPI A;  3PPP A;  4C0R A;  3H03 A;  4FE8 A;  1UIU A;  2P0S A;  2DWA A;  5JEI A;  5CM6 A;  3N5L A;  3SEW A;  4H65 A;  4YZZ A;  5J1D A;  2Z23 A;  1GR2 A;  4R74 A;  3ECR A;  3K6W A;  5AA2 D;  4MBP A;  3O97 A;  3H6T A;  2UVI A;  3FVK A;  3T22 A;  2R71 A;  3KSJ A;  4MLV A;  3EHS A;  3MVZ A;  1BKA A;  2I4B A;  2Y7W A;  1XS5 A;  2R6G E;  4DE8 A;  3TMG A;  4POX A;  5CBR A;  1MDP 1;  4DIG A;  3B6T A;  1MPC A;  5CMM A;  4ZE8 A;  1VFD A;  2HCA A;  1Z7M E;  3FJG A;  3THI A;  1B58 A;  3CIJ A;  5F1Q A;  4POW A;  5TP9 A;  4MLQ A;  4O3B A;  3K6U A;  2ALU A;  4U4S A;  4WED A;  1POT A;  1D9V A;  1RKM A;  2Y7P A;  3TTL A;  4ELP A;  2V93 A;  4LON B;  5I2N B;  3GLB A;  1TXF A;  3TTR A;  1WVJ A;  3QAX A;  4YKK A;  5F7V A;  1NNT A;  5I56 B;  3QUF A;  2O7U A;  3IJX B;  3MP8 A;  5FTH A;  4ZEK A;  1JET A;  3CVG A;  4IGR A;  3SER A;  2XXH A;  4QSC A;  2VP1 A;  3UIF A;  3S9L C;  1B52 A;  1IXG A;  1VFE A;  4YMA A;  4NF6 B;  1ATG A;  4MF3 A;  3VVE A;  1LAX A;  2DQV A;  4OER A;  4M1V A;  3QXM A;  4ZED A;  2F6G A;  4U1O A;  5AA2 B;  2XXI A;  3KOS A;  1MM6 A;  4IGT A;  5HM4 B;  2HXW A;  3BKI B;  3G3K A;  2QMX A;  1S50 A;  2Q2C A;  2QMW A;  4OEV A;  5I59 A;  3K01 A;  1BTJ A;  4ELR A;  3N26 A;  4ZE9 A;  4E0X A;  1MY0 A;  3CI8 A;  4KCD A;  4F1Y A;  1LAG E;  4NWD A; 
#chains in the Genus database with same CATH topology
 2AL4 A;  4P56 A;  2PT2 A;  4YAH X;  4EXL A;  3IOR A;  2ZNT A;  4HE2 A;  2HZL A;  2XWO A;  4EQ9 A;  2DE3 A;  3OO7 A;  5I57 B;  4GWX A;  3TZA A;  1LFI A;  1QKB A;  4F3S A;  1FBC A;  2WBB A;  3U94 A;  1MS7 A;  2CEX A;  3QK6 A;  3SKP A;  3IB1 A;  1B4H A;  5AA2 A;  3U72 A;  2Z8E A;  1CE2 A;  1H76 A;  1P1O A;  3MVY A;  1AL3 A;  2ZYN A;  4P1L A;  1O63 A;  2RC7 A;  1A8F A;  5EYG A;  1P1W A;  3PU5 A;  4PET A;  3RT6 B;  5DW8 A;  2HEU A;  1FQB A;  4F19 A;  1I6Q A;  1FBE A;  4G4P A;  3PD8 A;  3TTK A;  2R9J A;  5EQ8 A;  1SPI A;  4G77 A;  2F35 A;  1DPP A;  4KPT A;  4KR5 A;  5L9O A;  1ANF A;  2B65 A;  2I4C A;  1S9T A;  4NED A;  1LAF E;  3OEL A;  4MH5 A;  4ECF A;  1ZMG A;  5CMB A;  4AB5 A;  3GBB A;  2Y7I A;  1NL5 A;  4WEP A;  4H1X A;  2WX9 A;  5K2X A;  1DBZ A;  3CSB A;  2DOJ A;  1SI1 A;  4MCO A;  3CG3 A;  2BJI A;  2OWT A;  5DTB A;  4JDF A;  4IO4 A;  3SEV A;  1Y3Q A;  2AIX A;  1LCF A;  2KLF A;  3PUZ E;  4KCC A;  1NMU A;  3FVO A;  3T93 B;  2QRY A;  5AA4 B;  4ZDM A;  4X9T A;  1NV0 A;  2KQZ A;  3C4M A;  2O6A A;  1N7X A;  3K00 A;  2FA7 A;  2B4L A;  3CHG A;  4GL0 A;  4XKQ A;  3HST A;  3MBP A;  4N17 A;  4EXK A;  3TFL A;  5H8F A;  3BIG A;  3G3F A;  4O7M A;  1PEB A;  2XA5 A;  4Q0C A;  1IMA A;  5IAI A;  4G8M A;  4FEB A;  4H8J A;  4DCY A;  5CMC A;  4FIM A;  1R9L A;  3T9U A;  1JEU A;  2HPG A;  3H3G A;  1MQG A;  3FZV A;  3RPL B;  4ZEC A;  3C32 A;  2RCA A;  2ANJ A;  1QJM A;  4PBH A;  1SD3 A;  5L8D A;  4EQB A;  4QSE A;  1F9B A;  4KYD A;  1EYI A;  3K6V A;  1XOC A;  2FNC A;  3NOH A;  4NF4 B;  3PGF A;  3PD9 A;  1PBQ A;  3H06 B;  2CMO A;  3OMB A;  3H6V A;  5AA4 A;  1NUZ A;  2O1M A;  4GBV A;  4NTL A;  3FXQ A;  4LN5 A;  4IO2 A;  1B0L A;  1MM7 A;  3M3L A;  3O29 A;  3BBR A;  3MZ9 A;  3K0V A;  4R9F A;  2H4I A;  2XD3 A;  2PT1 A;  5LDZ A;  5ICT A;  3I3V A;  4RPN A;  1P1U A;  3W9W A;  2HXR A;  1LCT A;  1MY3 A;  1LBC A;  2XXP A;  3MP6 A;  3IO4 A;  2XX9 A;  2ZYM A;  3PUV E;  5ITO A;  5IZ3 B;  3K1P A;  3T9X B;  4OEU A;  4LQ5 A;  1FSA A;  1N7W A;  3IB0 A;  1L5T A;  3C34 A;  3IX1 A;  1HSE A;  3K1N A;  2CZL A;  3ILU B;  5DVF A;  3PTY A;  3D4G A;  2ABH A;  2DVC A;  4N81 A;  4K3F A;  1NI9 A;  3TQW A;  4QBA A;  1NUW A;  3BFU A;  1S7Y A;  3G3H A;  2HZK A;  2F7C A;  4O3A A;  2VPN A;  2G93 A;  4YB5 A;  2QVU A;  1HSJ A;  1B1H A;  2ZXT A;  1M5B A;  3U1O A;  1MPD A;  4DDD A;  1URS A;  3R7X A;  3UK4 A;  3O6I A;  3KSX A;  1IIT A;  1BP5 A;  1MH3 A;  4RNS A;  1FPG A;  1B5I A;  4OAN A;  1H44 A;  4R72 A;  4Q5T A;  3CR9 A;  2IA4 A;  1POY 1;  3C33 A;  3OO8 A;  4NE4 A;  4XXU A;  3O6H A;  2PFZ A;  3H7M A;  4OFL A;  1BLF A;  3KBZ A;  3V8X B;  1ZKB A;  3MYU A;  2Y5K A;  2OLB A;  1XVX A;  1FW0 A;  5IZ3 A;  3K1M A;  4F29 A;  3O66 A;  2LAO A;  3CSG A;  3FJM A;  3PMV A;  4MHF A;  3S9M C;  2RF1 A;  2UYF A;  2Y84 A;  3Q26 A;  1NKX A;  1B05 A;  2HAU A;  4KHZ E;  3CFZ A;  1IXI A;  2WKY A;  4FAT A;  1DPE A;  1A55 A;  3V5A A;  4R6H A;  5TP9 B;  2THI A;  5FHM A;  4JB7 A;  2XXX A;  2ZYK A;  3MVW A;  3IK6 B;  2XHD A;  2REJ A;  1SW5 A;  5A5L A;  1BIY A;  4KI0 E;  4RA1 A;  4ESW A;  5ITP A;  3FBP A;  1FJ9 A;  4NX1 A;  4DI3 D;  2QS2 A;  1Y9U A;  2DVZ A;  2H99 A;  4O94 A;  1NV7 A;  3UN6 A;  2HHM A;  4NF5 B;  3PUX E;  2V3Q A;  2O1L A;  5ELV A;  4ZEF A;  5K2Y A;  2XXT A;  1PC3 A;  3MJN A;  3SEU A;  2G29 A;  4QXD A;  3PPN A;  2I3W A;  4U21 A;  1IEJ A;  4JVD A;  4LQ2 A;  1MH4 A;  1FTM A;  2ZNS A;  4KQP A;  3USD A;  1YYZ A;  4BLA A;  4ZZA A;  4KYS A;  1B1X A;  4XFE A;  1ZLQ A;  1MXZ A;  1MXV A;  5TPA B;  3N94 A;  1B9J A;  1JW5 A;  1IXC A;  2F5X A;  2W7Y A;  2D21 A;  2HQ0 A;  3I6V A;  4EDP A;  3G3I A;  3RNN A;  1AWB A;  1UTH B;  3B6Q A;  2UVG A;  4UAB A;  1B5H A;  3S9E A;  1QUJ A;  5ISU A;  2ZZW A;  2QS3 A;  2QS4 A;  2XWK A;  3FV2 A;  4PFU A;  2O84 X;  4UAC A;  3LR1 A;  3DP8 A;  2HAV A;  4PQJ A;  3ZKK A;  4HE0 A;  1MY2 A;  4TOZ A;  1PB8 A;  4N07 A;  4QF9 A;  5I59 B;  2DYX A;  3ISP A;  4PF8 A;  3IO6 A;  1FTO A;  1B3H A;  3M3F A;  3A3C A;  4GL8 A;  3VE1 B;  1Z7N E;  3WAE A;  1EU8 A;  3E4R A;  1FPK A;  4H6D A;  4N15 A;  4NF5 A;  1FBP A;  2VD2 A;  1QKA A;  2OCU A;  4F3P A;  3MC2 A;  1NFT A;  3KFM A;  1LBV A;  3OEK A;  1O7T A;  1D3K A;  4NAP A;  2NXO A;  2V3U A;  3L6G A;  4DLD A;  4XF5 A;  3IL1 B;  5AE4 A;  1ZJL A;  2I6E A;  1Q1K A;  1SBP A;  2PMS A;  4HCW A;  1QUI A;  4OFO A;  2XXQ A;  3SES A;  2IEE A;  5I58 B;  5BWJ A;  3VLU A;  1Y4T A;  1VE4 A;  1SYI A;  3QIM A;  5TPA A;  4FOR A;  4IO5 A;  1FJ6 A;  1RYO A;  3A3U A;  4GX3 A;  3MPL A;  3IOT A;  1B32 A;  4PFT A;  4N6P A;  3PPR A;  4H46 A;  4DCX A;  1UTH A;  4PGN A;  3JV9 A;  4RYA A;  3QYT A;  4OYV A;  2Q8M A;  1SVX B;  4P47 A;  1ZIU A;  2OZZ A;  4I1D A;  3MVX A;  4X48 A;  3TCF A;  1DMB A;  3SZP A;  4F31 B;  2DWH A;  2X7Q A;  3E9X A;  3ZKL A;  3S9N C;  3MW0 A;  3N6T A;  1MXX A;  3ROJ A;  2ZZX A;  3RYD A;  5LTC A;  1M5C A;  1FQC A;  3PPO A;  1JW1 A;  4RPO A;  1H45 A;  5KCJ B;  3UGW A;  3EHT A;  3TPA A;  5EHS A;  4EUO A;  2ZMB A;  3KJT A;  4GLI A;  1LBB A;  2I48 A;  4OMB A;  3GYY A;  4F18 A;  1DCU A;  1Y3N A;  5I3S A;  1G0I A;  1IQ7 A;  1M5E A;  1YCJ A;  2VT5 A;  1FRP A;  5I58 A;  2FIX A;  3C36 A;  3KJ7 A;  3RUM A;  1LFH A;  3ILT B;  3T0J A;  2PYY A;  3H6W A;  1R9Q A;  5BUU A;  1URG A;  1N76 A;  1DSN A;  2O7I A;  2I0B A;  2O68 A;  3FAT A;  1LGB C;  2QL3 A;  5EQ9 A;  5DT6 A;  1OVB A;  1TFD A;  5EQA A;  5KDT B;  2UVH A;  5F24 A;  4QFP A;  1JVY A;  2GHA A;  4GWZ A;  3RN8 A;  5IGA A;  1B3G A;  4QHQ A;  5H8F B;  1CNQ A;  4GOT A;  1HSL A;  4N91 A;  3IOU A;  2QVV A;  1FPE A;  1H43 A;  5KCJ A;  3RT8 A;  3CFL A;  2FVZ A;  4U2R A;  4IB2 A;  3IB2 A;  4XIG Q;  4NHB A;  3MAM A;  3PMX A;  5FHN A;  2XX7 A;  1NV2 A;  4H45 A;  4F3G A;  3JZJ A;  1M5D A;  4NGU A;  3TUS A;  4ND9 A;  4Z0I A;  1A8E A;  3AXF A;  5CRY A;  2FIE A;  2DXR A;  3Q25 A;  2F3D A;  4O8M A;  3VLW A;  4GXA A;  3UA8 A;  1FBG A;  3MST A;  4WKM A;  4MNC A;  1N84 A;  1SW1 A;  4R6Y A;  2P1S A;  5EYF A;  2H25 A;  4LUB A;  1TT1 A;  5HBC A;  3B6W A;  1DK4 A;  3EHU A;  3TKD A;  3TEL A;  5KDT A;  4F3B A;  2DS9 A;  4QFL A;  3BIH A;  3OSQ A;  1RDX A;  4RY1 A;  1T0K A;  3FIR A;  3W9V A;  1YTV A;  3FAS A;  2PX1 A;  3HFU A;  3TAJ A;  4P8B A;  4DXC A;  3BFT A;  4JSD A;  3UOR A;  2UXA A;  2CZH A;  3N6U A;  2Z8D A;  2RKM A;  4RJZ A;  1ZBM A;  3C9H A;  4QFN A;  2AL5 A;  2PBW A;  2OWZ A;  3OO9 A;  1LBW A;  1UTB A;  3HHF A;  3A29 A;  2JJK A;  3TEP A;  1XHY A;  2P3N A;  1LBY A;  4PFI A;  4R2B A;  4GXS B;  3H4Z A;  4PP0 A;  4PBQ A;  1QUK A;  2ZNU A;  4N6D A;  2DXY A;  1CB6 A;  1EZO A;  4YB7 A;  4OVS A;  4TLM B;  4DXU A;  4LAT A;  5DEX A;  1EZ9 A;  1P1N A;  4HW8 A;  5I5P A;  1NH7 A;  5IZ1 A;  4Q8R A;  1LLS A;  1D9Q A;  3MZB A;  2OJT A;  3QMF A;  4MNI A;  3FVG A;  2MKZ A;  3PUW E;  3U65 A;  1NUY A;  3O6G A;  4BDR A;  1N0T A;  3PMW A;  2QVR A;  4N4U A;  3IFA A;  1I6A A;  4LZ7 A;  3CFX A;  4XKP A;  4RXL A;  1IME A;  1NV1 A;  1US5 A;  1MQI A;  4H0W A;  4YMB A;  3C31 A;  2YPN A;  4PGP A;  5H8Q A;  5CMK A;  3V83 A;  1FBH A;  1PB9 A;  5H8S A;  3OSR A;  3DP6 A;  4YKJ A;  1OIB A;  1SW2 A;  2QSX A;  5T3J A;  2VGQ A;  2XXY A;  2VPO A;  3E79 A;  5J16 A;  4EF2 A;  3KN3 A;  3M8U A;  2UVJ A;  4XKR A;  1IXH A;  5I7I A;  1DTZ A;  4OVT A;  4IO3 A;  5M2V A;  1FQF A;  4TQU Q;  2XX8 A;  5IZZ A;  3WAF A;  1NNP A;  2B4M A;  2QPQ A;  3O28 A;  4YU0 A;  3SDF A;  5EHM A;  4O3C A;  1AMF A;  2P2A A;  3TTN A;  4HE1 A;  2R8T A;  3Q28 A;  3MZ1 A;  4GFR A;  4HS7 A;  2OWS A;  4R9G A;  3MPK A;  1B3F A;  3K02 A;  2FHY A;  2ZYO A;  5I2K B;  3SEX A;  4P3L A;  2V25 A;  4N8G A;  1JW4 A;  2NUV A;  5ET7 A;  2DWJ A;  2F36 A;  4GF8 A;  1XT8 A;  5DVI A;  4NF8 A;  2X26 A;  3V89 B;  2XXR A;  2GHB A;  1SI0 A;  3VV5 A;  3LSF B;  1SDX A;  4OQO A;  1N3X A;  3GBA A;  3EF7 A;  2RIN A;  3B7D A;  3TTM A;  1IMC A;  2O51 A;  4IY6 A;  2ONK E;  5FHO A;  1O64 A;  2VHA A;  3G3J A;  4F1V A;  3KBR A;  1GV8 A;  3PUY E;  3T1B A;  4ONY A;  1GTK A;  4WXJ A;  1US4 A;  3FXU A;  1N04 A;  2KR0 A;  4LP2 B;  4BDL A;  2OBG A;  2F7A A;  2XXV A;  4PAK A;  5ICQ A;  1LB9 A;  4YIC A;  1MXW A;  4U4X A;  5I2K A;  1SYH A;  4P0G A;  4F2O A;  1FTJ A;  2VOZ A;  4PTK A;  3K2D A;  3RTW B;  2XD2 A;  4NG7 A;  4N6K A;  3E78 A;  4GRK A;  5H8H B;  4ISU A;  3T9V A;  3LV0 A;  3LC8 A;  1B40 A;  2BJJ X;  4NWC A;  4TLL B;  3G7W A;  4PE5 B;  1QUL A;  5L9M A;  3T66 A;  4BDQ A;  3TOD A;  3ODB A;  2VD3 A;  4OVQ A;  1ELJ A;  2AYS A;  2F7B A;  3EPE A;  1LB8 A;  4N8Y A;  3T96 B;  3HO7 A;  1MPB A;  2ONS A;  3D1R A;  1XVY A;  2Y7K A;  2D3I A;  1B7H A;  2V3T A;  4FBP A;  5A5X B;  1JVX A;  2I58 A;  1P1Q A;  3JYR A;  4G8H A;  2XXU A;  2ONR A;  5CC2 A;  5IKB A;  1MQJ A;  4E0W A;  2B3F A;  4OA4 A;  3LSX A;  2XXK A;  4IO6 A;  5IM2 A;  2V4C A;  2CZI A;  4QFK A;  1GVC A;  2Y5L A;  5HPQ A;  1B3E A;  1Y1Z A;  2X7P A;  4KYE A;  5H8H A;  4EQ7 A;  4DI4 B;  3MP1 A;  4GWY A;  2O69 A;  3QUJ A;  1WDN A;  1FPF A;  4C1U A;  3VFJ A;  3KC0 A;  1NH8 A;  2A5T B;  2Y7R A;  3RQT A;  4G2Z A;  5AA3 A;  1USY H;  4ZZE A;  2H9B A;  1NNK A;  1NV6 A;  4G8N A;  3FUZ A;  1INP A;  1A99 A;  1FQA A;  3S2V A;  4NQ8 A;  5TU0 A;  4F22 A;  2CZK A;  1DTG A;  3HHG A;  1AH5 A;  4GX4 A;  4JVC A;  2RCB A;  5A5X A;  3DM0 A;  2UYE A;  3D4C A;  1LAH E;  1LFG A;  3DP4 A;  4AQ4 A;  4JBZ A;  5EYH A;  3E13 X;  3O9P A;  4PC9 A;  1QGX A;  3EN3 A;  1OMP A;  2WYK A;  2DDK A;  2XXW A;  3ZS6 A;  1EH3 A;  3RPW A;  4OVP A;  4JWY A;  2ESN A;  3FV1 A;  4I62 A;  4I40 A;  2GQ1 A;  3VVF A;  1TWY A;  5FBP A;  3LSL A;  4JWX A;  2F8D A;  4OFJ A;  4R75 A;  3UP9 A;  4XKN A;  1KZ8 A;  4YKI A;  3I5O A;  4I8C A;  3FD3 A;  4H8I A;  2A5T A;  1NNF A;  1I69 A;  3QSL A;  3OOA A;  4PFY A;  3VXB A;  1XC1 A;  2Q88 A;  1FBF A;  4H5G A;  4OEN A;  1Q35 A;  3O2A A;  3K4U A;  4NMY A;  1MXU A;  1D9Y A;  4R6K A;  2NWJ A;  3R26 A;  4BDO A;  3MWB A;  5I2N A;  4ZEB A;  1A40 A;  3PV0 E;  3VVD A;  1AIV A;  4LZ5 A;  4KFQ A;  1AOV A;  5I56 A;  5CI5 A;  1OQH A;  1P99 A;  3KN8 A;  2REG A;  3OEN A;  4IY5 A;  2CEY A;  3VDF A;  3KGC A;  5AA1 A;  2QFL A;  2F6P A;  4NF6 A;  2H5Y A;  4HTG A;  2NVU B;  3VLV A;  2Z22 A;  4H67 A;  1LEV A;  2PVU A;  4THI A;  2Q8J A;  4GWO A;  4UA8 A;  3LBS A;  3R6U A;  4G61 A;  2V84 A;  3KG2 A;  3L6H A;  4LA9 A;  1B7Z A;  2GRV A;  2RC8 A;  1VR5 A;  3IR1 A;  4ESX A;  2GH9 A;  4HCY A;  3OEM A;  4F1U A;  4MJO A;  3IAZ A;  1Y4C A;  5JK4 A;  4OWD A;  5ET8 A;  3G3G A;  2DP8 A;  3M3K A;  4OHN A;  1UTB B;  4OES A;  3HV1 A;  4OXV A;  1H3D A;  2XWI A;  2YLN A;  3FXR A;  4AB6 A;  1KA1 A;  1QW0 A;  2B3B A;  1GGG A;  5I84 A;  2I49 A;  5EQ7 A;  1OLA A;  3KOT A;  5H8N B;  2Q9T A;  2P3V A;  1XI6 A;  1LST A;  4I3E A;  2FYI A;  5I57 A;  3DLN A;  5DEX B;  2PFY A;  3OXN A;  3ZSF A;  4MAG A;  1FQE A;  1BK4 A;  2I0C A;  4OZ9 A;  1RDZ A;  4BDM A;  4GBW A;  4U1Z A;  2F3B A;  1ZTY A;  3TQL A;  4RK2 A;  3FVN A;  4H5F A;  2QJE A;  5DVJ A;  1MQD A;  1PBP A;  4P11 A;  3OD7 A;  3S4U A;  3RY3 A;  1VSO A;  1IMD A;  4HXV A;  4F39 A;  1MY1 A;  1EZP A;  3ONM A;  3IJO B;  5JTY B;  3IOV A;  2E0S A;  4Q30 B;  5CBS A;  3SET A;  3CRB A;  3TYH A;  1FPD A;  1LBZ A;  4ELO A;  4MFI A;  2YJP A;  1IMB A;  4M4G A;  3W15 C;  3MQ9 A;  2WBD A;  1FTK A;  4MIJ A;  1Y1M A;  1ZU0 A;  3C35 A;  4FAJ A;  3IFC A;  3RLF E;  5H8Q B;  4EF1 A;  2DSF A;  4P1E A;  1SQY A;  4YKP A;  4MNP A;  2HFB A;  3FJ7 A;  1NV5 A;  4OET A;  3Q29 A;  3KC1 A;  4IO7 A;  4LZ8 A;  2GFE A;  2NOO A;  1NV3 A;  1PB7 A;  4U22 A;  1B2H A;  2D5W A;  1PDA A;  2M8C A;  1JP4 A;  3K6X A;  5H8N A;  5KZT A;  4OTE A;  1RDY A;  1B5J A;  4PFR A;  3P7I A;  4QRZ A;  1A7L A;  1MRP A;  3DEL B;  4MX6 A;  1R1N A;  4KD5 A;  4YB6 A;  3H6U A;  1OVT A;  1B6H A;  3PPQ A;  1FCK A;  3SEY A;  4ZS9 A;  2F34 A;  3LUY A;  2L5V A;  4G68 C;  4JXI A;  3TDJ A;  2DWI A;  5JTY A;  1RYX A;  2H98 A;  4GD5 A;  4F2Q A;  1OLC A;  1USY E;  4PE3 A;  1QVS A;  1NUX A;  4NF8 B;  3VXC A;  4FED A;  5B7D A;  1JQF A;  3T9H B;  4DZ1 A;  1MQH A;  3EKI A;  4GVO A;  4R2F A;  1UQW A;  1DOT A;  1OQG A;  3MUQ A;  1K9Z A;  1M5F A;  1FTL A;  1FTA A;  3U93 A;  3GZG A;  4N13 A;  2I3V A;  3E3K A;  4DXB A;  5LOM A;  1JNF A;  1B3L A;  1D4N A;  1Y3P A;  2WEF A;  3U92 A;  2OX3 A;  3RGY A;  4MEV A;  1YPN A;  4PAI A;  3RPL A;  1YAE A;  4X04 A;  5ESY A;  1B46 A;  1WOD A;  4PFW A;  4MMP A;  4U23 A;  3RTF B;  4JWO A;  4NF4 A;  4X1B A;  4Z7E A;  4P0I A;  1Q9D A;  3FGS A;  1KWH A;  4G68 B;  2QS1 A;  1EYJ A;  4BDN A;  1IUD A;  4PDH A;  3KZG A;  3A09 A;  4X1D A;  3Q27 A;  1Y20 A;  1UIV A;  4KXP A;  1A54 A;  2Q89 A;  1TFA A;  2RC9 A;  1MY4 A;  1SW4 A;  1JEV A;  2DE4 A;  1K9Y A;  4QFO A;  4AS4 A;  1FPB A;  4GQO A;  1IZ1 A;  4FEC A;  3HN0 A;  4GIZ A;  1LBX A;  1MG1 A;  1FPI A;  4NN3 A;  3CG1 A;  1R6Z A;  4XEQ A;  3F11 A;  2A5S A;  2Q2A A;  4R73 A;  1YZ0 A;  4I9D A;  3EQ1 A;  4O7I A;  4XTC Q;  3TCG A;  1MDQ A;  1IIW A;  4X8R A;  5L9S A;  2F97 A;  2DE2 A;  3GXA A;  1MXY A;  3HCQ A;  4ZEI A;  3TCH A;  3KEI A;  4PFB A;  4P9K A;  3FXB A;  1I6B A;  1URD A;  1N3W A;  1B4Z A;  3OO6 A;  1IMF A;  1KA0 A;  4QSD A;  1B51 A;  1B7U A;  4JSO A;  4OVJ A;  1FQD A;  2F78 A;  4LVQ A;  3LSW A;  2OK2 A;  1J1N A;  1II5 A;  3IOW A;  4RK9 A;  2Z8F A;  4C1T A;  4G68 A;  3U8Q A;  4ELQ A;  5DYH A;  3KN7 A;  5B70 A;  2E1S A;  1B0H A;  4L17 A;  4PAF A;  5FTI A;  4FJP A;  4JVI A;  3HPI A;  3PPP A;  3B50 A;  4C0R A;  3H03 A;  4FE8 A;  4OVR A;  1UIU A;  2P0S A;  2DWA A;  5JEI A;  5CM6 A;  3N5L A;  3SEW A;  4H65 A;  4YZZ A;  5J1D A;  2Z23 A;  1GR2 A;  4R74 A;  3ECR A;  3K6W A;  5AA2 D;  4MBP A;  1FPL A;  3O97 A;  3H6T A;  4IR8 A;  2UVI A;  3FVK A;  3T22 A;  2R71 A;  3KSJ A;  4MLV A;  4I3Y A;  3EHS A;  3MVZ A;  1BKA A;  2I4B A;  2Y7W A;  1G0H A;  1XS5 A;  1VDW A;  2R6G E;  4DE8 A;  1FPJ A;  3TMG A;  2ZZV A;  4POX A;  5ET6 A;  5CBR A;  1YXI A;  1MDP 1;  4DIG A;  3B6T A;  1MPC A;  5CMM A;  4ZE8 A;  1VFD A;  2XWV A;  2HCA A;  1Z7M E;  3FJG A;  4GX6 A;  3THI A;  1B58 A;  3CIJ A;  4GWU A;  5F1Q A;  3LUZ A;  2WYP A;  4POW A;  5TP9 A;  4MLQ A;  4GWS A;  4O3B A;  3K6U A;  4PF6 A;  2ALU A;  4U4S A;  4WED A;  1POT A;  1D9V A;  1RKM A;  2Y7P A;  1FBD A;  3TTL A;  5ET5 A;  4ELP A;  2V93 A;  4LON B;  5I2N B;  3GLB A;  1TXF A;  3TTR A;  1WVJ A;  3QAX A;  4YKK A;  5F7V A;  1NNT A;  5I56 B;  3QUF A;  2O7U A;  2FBP A;  3IJX B;  3MP8 A;  5FTH A;  4GWW A;  4NF0 A;  4ZEK A;  1JET A;  3CVG A;  4IGR A;  3SER A;  2XXH A;  4QSC A;  2VP1 A;  3UIF A;  3S9L C;  1B52 A;  1IXG A;  1VFE A;  4YMA A;  4NF6 B;  4PCD A;  1ATG A;  4MF3 A;  3VVE A;  1LAX A;  1NV4 A;  2DQV A;  4OER A;  4M1V A;  3QXM A;  4ZED A;  2F6G A;  4U1O A;  5AA2 B;  2XXI A;  3KOS A;  1MM6 A;  4PDD A;  2PCR A;  4IGT A;  5HM4 B;  2HXW A;  3BKI B;  3G3K A;  2QMX A;  1S50 A;  2Q2C A;  1EYK A;  2QMW A;  4OEV A;  5I59 A;  3K01 A;  1BTJ A;  4ELR A;  3N26 A;  4ZE9 A;  4E0X A;  4AS5 A;  1MY0 A;  3CI8 A;  4KCD A;  3B8B A;  1LAG E;  4F1Y A;  4NWD A;  2Q74 A; 
#chains in the Genus database with same CATH homology
 2AL4 A;  2PT2 A;  4YAH X;  4EXL A;  3IOR A;  2ZNT A;  2HZL A;  4EQ9 A;  2DE3 A;  3OO7 A;  5I57 B;  3TZA A;  1LFI A;  1QKB A;  4F3S A;  3U94 A;  1MS7 A;  3QK6 A;  3SKP A;  3IB1 A;  1B4H A;  5AA2 A;  3U72 A;  2Z8E A;  1CE2 A;  1H76 A;  1P1O A;  3MVY A;  1AL3 A;  2ZYN A;  1O63 A;  2RC7 A;  1A8F A;  1P1W A;  3PU5 A;  4PET A;  3RT6 B;  2HEU A;  1FQB A;  4F19 A;  1I6Q A;  4G4P A;  3PD8 A;  3TTK A;  2R9J A;  4G77 A;  2F35 A;  1DPP A;  4KPT A;  4KR5 A;  5L9O A;  1ANF A;  2B65 A;  2I4C A;  1S9T A;  4NED A;  1LAF E;  3OEL A;  4MH5 A;  4ECF A;  1ZMG A;  5CMB A;  4AB5 A;  3GBB A;  2Y7I A;  1NL5 A;  4WEP A;  4H1X A;  5K2X A;  3CSB A;  2DOJ A;  1SI1 A;  3CG3 A;  2OWT A;  5DTB A;  4JDF A;  4IO4 A;  3SEV A;  1Y3Q A;  2AIX A;  1LCF A;  2KLF A;  3PUZ E;  4KCC A;  1NMU A;  3FVO A;  3T93 B;  2QRY A;  5AA4 B;  4ZDM A;  4X9T A;  3C4M A;  2O6A A;  1N7X A;  3K00 A;  2FA7 A;  4GL0 A;  4XKQ A;  3HST A;  3MBP A;  4EXK A;  3TFL A;  5H8F A;  3G3F A;  1PEB A;  4Q0C A;  5IAI A;  4G8M A;  4FEB A;  4H8J A;  4DCY A;  5CMC A;  4FIM A;  1R9L A;  3T9U A;  1JEU A;  3H3G A;  1MQG A;  3FZV A;  4ZEC A;  3C32 A;  2RCA A;  2ANJ A;  1QJM A;  1SD3 A;  5L8D A;  4EQB A;  4QSE A;  1F9B A;  4KYD A;  3K6V A;  1XOC A;  2FNC A;  4NF4 B;  3PGF A;  3PD9 A;  1PBQ A;  3H06 B;  2CMO A;  3OMB A;  3H6V A;  5AA4 A;  2O1M A;  4NTL A;  3FXQ A;  4IO2 A;  1B0L A;  1MM7 A;  3M3L A;  3O29 A;  3BBR A;  3MZ9 A;  3K0V A;  4R9F A;  2H4I A;  2XD3 A;  2PT1 A;  5ICT A;  3I3V A;  4RPN A;  1P1U A;  3W9W A;  1LCT A;  1MY3 A;  1LBC A;  2XXP A;  3MP6 A;  3IO4 A;  2XX9 A;  2ZYM A;  3PUV E;  5ITO A;  3K1P A;  3T9X B;  4OEU A;  4LQ5 A;  1N7W A;  3IB0 A;  1L5T A;  3C34 A;  3IX1 A;  1HSE A;  3K1N A;  2CZL A;  3ILU B;  5DVF A;  3D4G A;  2ABH A;  2DVC A;  4K3F A;  3TQW A;  3BFU A;  1S7Y A;  3G3H A;  2HZK A;  2F7C A;  4O3A A;  2G93 A;  4YB5 A;  1HSJ A;  1B1H A;  2ZXT A;  1M5B A;  3U1O A;  1MPD A;  4DDD A;  1URS A;  3R7X A;  3UK4 A;  3O6I A;  3KSX A;  1IIT A;  1BP5 A;  1MH3 A;  4RNS A;  1B5I A;  1H44 A;  4R72 A;  3CR9 A;  4Q5T A;  2IA4 A;  1POY 1;  3C33 A;  3OO8 A;  4NE4 A;  4XXU A;  3O6H A;  3H7M A;  4OFL A;  1BLF A;  3V8X B;  1ZKB A;  2OLB A;  1XVX A;  1FW0 A;  3K1M A;  4F29 A;  3O66 A;  2LAO A;  3CSG A;  3FJM A;  3PMV A;  3S9M C;  2RF1 A;  2UYF A;  2Y84 A;  3Q26 A;  1NKX A;  1B05 A;  2HAU A;  4KHZ E;  3CFZ A;  1IXI A;  2WKY A;  4FAT A;  1DPE A;  1A55 A;  3V5A A;  4R6H A;  5TP9 B;  2THI A;  5FHM A;  4JB7 A;  2XXX A;  2ZYK A;  3MVW A;  3IK6 B;  2XHD A;  2REJ A;  1SW5 A;  1BIY A;  4KI0 E;  4RA1 A;  4ESW A;  5ITP A;  2QS2 A;  1Y9U A;  2DVZ A;  2H99 A;  3UN6 A;  4NF5 B;  3PUX E;  2V3Q A;  2O1L A;  5ELV A;  4ZEF A;  5K2Y A;  2XXT A;  1PC3 A;  3MJN A;  3SEU A;  2G29 A;  3PPN A;  2I3W A;  4U21 A;  1IEJ A;  4LQ2 A;  1MH4 A;  1FTM A;  2ZNS A;  4KQP A;  3USD A;  4BLA A;  4ZZA A;  4KYS A;  1B1X A;  1ZLQ A;  1MXZ A;  1MXV A;  5TPA B;  3N94 A;  1B9J A;  1JW5 A;  1IXC A;  2F5X A;  2W7Y A;  2D21 A;  2HQ0 A;  3I6V A;  4EDP A;  3G3I A;  3RNN A;  1UTH B;  3B6Q A;  2UVG A;  1B5H A;  3S9E A;  1QUJ A;  5ISU A;  2QS3 A;  2QS4 A;  3FV2 A;  4PFU A;  2O84 X;  4UAC A;  3LR1 A;  3DP8 A;  2HAV A;  4PQJ A;  3ZKK A;  1MY2 A;  4TOZ A;  1PB8 A;  4N07 A;  4QF9 A;  5I59 B;  2DYX A;  3IO6 A;  1FTO A;  1B3H A;  3M3F A;  3A3C A;  4GL8 A;  3VE1 B;  1Z7N E;  3WAE A;  1EU8 A;  3E4R A;  4H6D A;  4NF5 A;  2VD2 A;  1QKA A;  2OCU A;  4F3P A;  3MC2 A;  1NFT A;  3KFM A;  3OEK A;  1O7T A;  1D3K A;  2NXO A;  2V3U A;  3L6G A;  4DLD A;  3IL1 B;  5AE4 A;  1ZJL A;  2I6E A;  1Q1K A;  1SBP A;  2PMS A;  4HCW A;  1QUI A;  4OFO A;  2XXQ A;  3SES A;  2IEE A;  5I58 B;  5BWJ A;  3VLU A;  1Y4T A;  1VE4 A;  1SYI A;  3QIM A;  5TPA A;  4FOR A;  4IO5 A;  1RYO A;  3A3U A;  3MPL A;  3IOT A;  1B32 A;  4PFT A;  4N6P A;  3PPR A;  4DCX A;  1UTH A;  3JV9 A;  4RYA A;  3QYT A;  4OYV A;  1SVX B;  1ZIU A;  2OZZ A;  4I1D A;  3MVX A;  4X48 A;  3TCF A;  1DMB A;  4F31 B;  2DWH A;  2X7Q A;  3E9X A;  3ZKL A;  3S9N C;  3MW0 A;  3N6T A;  1MXX A;  1M5C A;  1FQC A;  3PPO A;  1JW1 A;  4RPO A;  1H45 A;  5KCJ B;  3UGW A;  3EHT A;  3TPA A;  5EHS A;  4EUO A;  2ZMB A;  3KJT A;  4GLI A;  1LBB A;  2I48 A;  4OMB A;  4F18 A;  1Y3N A;  1IQ7 A;  1M5E A;  1YCJ A;  5I58 A;  3C36 A;  3KJ7 A;  3RUM A;  1LFH A;  3ILT B;  2PYY A;  3H6W A;  1R9Q A;  5BUU A;  1URG A;  1N76 A;  1DSN A;  2O7I A;  2I0B A;  2O68 A;  3FAT A;  1LGB C;  2QL3 A;  5DT6 A;  1OVB A;  1TFD A;  5KDT B;  2UVH A;  4QFP A;  1JVY A;  2GHA A;  3RN8 A;  1B3G A;  4QHQ A;  5H8F B;  4GOT A;  1HSL A;  3IOU A;  1H43 A;  5KCJ A;  3RT8 A;  3CFL A;  4U2R A;  4IB2 A;  3IB2 A;  4XIG Q;  3MAM A;  3PMX A;  5FHN A;  2XX7 A;  4F3G A;  3JZJ A;  1M5D A;  3TUS A;  4ND9 A;  4Z0I A;  1A8E A;  3AXF A;  5CRY A;  2DXR A;  3Q25 A;  3VLW A;  4GXA A;  3UA8 A;  4WKM A;  1N84 A;  1SW1 A;  4R6Y A;  2P1S A;  5EYF A;  2H25 A;  4LUB A;  1TT1 A;  5HBC A;  3B6W A;  3EHU A;  3TKD A;  3TEL A;  5KDT A;  4F3B A;  2DS9 A;  4QFL A;  3OSQ A;  4RY1 A;  1T0K A;  3FIR A;  3W9V A;  1YTV A;  3FAS A;  2PX1 A;  3TAJ A;  4DXC A;  3BFT A;  4JSD A;  3UOR A;  2UXA A;  3N6U A;  2Z8D A;  2RKM A;  4RJZ A;  1ZBM A;  3C9H A;  4QFN A;  2AL5 A;  2PBW A;  3OO9 A;  1UTB A;  3HHF A;  3TEP A;  1XHY A;  4R2B A;  4GXS B;  3H4Z A;  4PP0 A;  1QUK A;  2ZNU A;  2DXY A;  1CB6 A;  1EZO A;  4YB7 A;  4TLM B;  4DXU A;  4LAT A;  5DEX A;  1EZ9 A;  1P1N A;  4HW8 A;  1NH7 A;  4Q8R A;  1LLS A;  3MZB A;  2OJT A;  3FVG A;  3PUW E;  3O6G A;  4BDR A;  1N0T A;  3PMW A;  1I6A A;  4LZ7 A;  3CFX A;  4XKP A;  4RXL A;  1US5 A;  1MQI A;  4H0W A;  4YMB A;  3C31 A;  2YPN A;  5H8Q A;  5CMK A;  3V83 A;  1PB9 A;  5H8S A;  3OSR A;  3DP6 A;  4YKJ A;  1OIB A;  1SW2 A;  2QSX A;  2VGQ A;  2XXY A;  4EF2 A;  3KN3 A;  3M8U A;  2UVJ A;  4XKR A;  1IXH A;  1DTZ A;  4IO3 A;  5M2V A;  1FQF A;  4TQU Q;  2XX8 A;  3WAF A;  1NNP A;  2QPQ A;  3O28 A;  4YU0 A;  3SDF A;  5EHM A;  4O3C A;  1AMF A;  2P2A A;  3TTN A;  3Q28 A;  3MZ1 A;  4GFR A;  4HS7 A;  2OWS A;  4R9G A;  3MPK A;  1B3F A;  3K02 A;  2ZYO A;  5I2K B;  3SEX A;  2V25 A;  1JW4 A;  2NUV A;  2DWJ A;  2F36 A;  4GF8 A;  1XT8 A;  5DVI A;  4NF8 A;  2X26 A;  3V89 B;  2XXR A;  2GHB A;  1SI0 A;  3VV5 A;  3LSF B;  1SDX A;  4OQO A;  1N3X A;  3GBA A;  3EF7 A;  2RIN A;  3B7D A;  3TTM A;  2O51 A;  4IY6 A;  2ONK E;  5FHO A;  1O64 A;  2VHA A;  3G3J A;  4F1V A;  3KBR A;  1GV8 A;  3PUY E;  4ONY A;  1GTK A;  4WXJ A;  1US4 A;  3FXU A;  1N04 A;  4LP2 B;  4BDL A;  2OBG A;  2F7A A;  2XXV A;  5ICQ A;  1LB9 A;  4YIC A;  1MXW A;  4U4X A;  5I2K A;  1SYH A;  4P0G A;  4F2O A;  1FTJ A;  2VOZ A;  3K2D A;  3RTW B;  2XD2 A;  4GRK A;  5H8H B;  4ISU A;  3T9V A;  3LC8 A;  1B40 A;  2BJJ X;  4NWC A;  4TLL B;  3G7W A;  4PE5 B;  1QUL A;  5L9M A;  3T66 A;  4BDQ A;  3TOD A;  3ODB A;  2VD3 A;  1ELJ A;  2AYS A;  2F7B A;  3EPE A;  1LB8 A;  3T96 B;  3HO7 A;  1MPB A;  2ONS A;  1XVY A;  2Y7K A;  2D3I A;  1B7H A;  2V3T A;  5A5X B;  1JVX A;  2I58 A;  1P1Q A;  3JYR A;  4G8H A;  2XXU A;  2ONR A;  5CC2 A;  5IKB A;  1MQJ A;  4E0W A;  2B3F A;  3LSX A;  4IO6 A;  4QFK A;  1GVC A;  5HPQ A;  1B3E A;  1Y1Z A;  2X7P A;  4KYE A;  5H8H A;  4EQ7 A;  3MP1 A;  2O69 A;  3QUJ A;  1WDN A;  4C1U A;  3VFJ A;  1NH8 A;  2A5T B;  2Y7R A;  3RQT A;  4G2Z A;  5AA3 A;  1USY H;  4ZZE A;  2H9B A;  1NNK A;  4G8N A;  3FUZ A;  1A99 A;  1FQA A;  3S2V A;  5TU0 A;  4F22 A;  1DTG A;  3HHG A;  1AH5 A;  2RCB A;  5A5X A;  3DM0 A;  2UYE A;  3D4C A;  1LAH E;  1LFG A;  3DP4 A;  4AQ4 A;  4JBZ A;  3E13 X;  3O9P A;  3EN3 A;  1OMP A;  2XXW A;  3ZS6 A;  1EH3 A;  3RPW A;  4JWY A;  2ESN A;  3FV1 A;  4I62 A;  3VVF A;  1TWY A;  3LSL A;  4JWX A;  2F8D A;  4OFJ A;  4R75 A;  3UP9 A;  4XKN A;  4YKI A;  3I5O A;  4I8C A;  3FD3 A;  4H8I A;  2A5T A;  1NNF A;  1I69 A;  3QSL A;  3OOA A;  4PFY A;  3VXB A;  1XC1 A;  2Q88 A;  4H5G A;  4OEN A;  1Q35 A;  3O2A A;  3K4U A;  4NMY A;  1MXU A;  1D9Y A;  4R6K A;  2NWJ A;  3R26 A;  4BDO A;  3MWB A;  5I2N A;  4ZEB A;  1A40 A;  3PV0 E;  3VVD A;  1AIV A;  4LZ5 A;  4KFQ A;  1AOV A;  5I56 A;  5CI5 A;  1OQH A;  1P99 A;  3KN8 A;  2REG A;  3OEN A;  4IY5 A;  3VDF A;  3KGC A;  5AA1 A;  2F6P A;  4NF6 A;  2H5Y A;  4HTG A;  2NVU B;  3VLV A;  2Z22 A;  4H67 A;  2PVU A;  4THI A;  2Q8J A;  4GWO A;  4UA8 A;  3LBS A;  3R6U A;  2V84 A;  3KG2 A;  3L6H A;  4LA9 A;  1B7Z A;  2GRV A;  2RC8 A;  1VR5 A;  3IR1 A;  4ESX A;  2GH9 A;  4HCY A;  3OEM A;  4F1U A;  3IAZ A;  1Y4C A;  5JK4 A;  4OWD A;  3G3G A;  2DP8 A;  3M3K A;  4OHN A;  1UTB B;  4OES A;  3HV1 A;  4OXV A;  1H3D A;  2YLN A;  3FXR A;  4AB6 A;  1QW0 A;  2B3B A;  1GGG A;  5I84 A;  2I49 A;  1OLA A;  3KOT A;  5H8N B;  2Q9T A;  1LST A;  2FYI A;  5I57 A;  3DLN A;  5DEX B;  3OXN A;  3ZSF A;  1FQE A;  2I0C A;  4OZ9 A;  4BDM A;  4U1Z A;  1ZTY A;  3TQL A;  4RK2 A;  3FVN A;  4H5F A;  2QJE A;  5DVJ A;  1MQD A;  1PBP A;  4P11 A;  3OD7 A;  3S4U A;  3RY3 A;  1VSO A;  4F39 A;  1MY1 A;  1EZP A;  3ONM A;  3IJO B;  5JTY B;  3IOV A;  2E0S A;  4Q30 B;  5CBS A;  3SET A;  3CRB A;  3TYH A;  4ELO A;  4MFI A;  2YJP A;  4M4G A;  3W15 C;  3MQ9 A;  1FTK A;  1Y1M A;  1ZU0 A;  3C35 A;  4FAJ A;  3RLF E;  5H8Q B;  4EF1 A;  2DSF A;  1SQY A;  4YKP A;  4OET A;  2HFB A;  3FJ7 A;  3Q29 A;  4LZ8 A;  4IO7 A;  2GFE A;  2NOO A;  1PB7 A;  4U22 A;  1B2H A;  2D5W A;  1PDA A;  2M8C A;  3K6X A;  5H8N A;  5KZT A;  4OTE A;  1B5J A;  3P7I A;  4QRZ A;  1A7L A;  1MRP A;  3DEL B;  1R1N A;  4KD5 A;  4YB6 A;  3H6U A;  1OVT A;  1B6H A;  3PPQ A;  1FCK A;  3SEY A;  4ZS9 A;  2F34 A;  3LUY A;  4G68 C;  4JXI A;  3TDJ A;  2DWI A;  5JTY A;  1RYX A;  2H98 A;  4GD5 A;  4F2Q A;  1OLC A;  1USY E;  1QVS A;  4NF8 B;  3VXC A;  4FED A;  5B7D A;  1JQF A;  3T9H B;  4DZ1 A;  1MQH A;  4GVO A;  4R2F A;  1UQW A;  1DOT A;  1OQG A;  3MUQ A;  1M5F A;  1FTL A;  3U93 A;  3GZG A;  4N13 A;  2I3V A;  3E3K A;  4DXB A;  5LOM A;  1JNF A;  1B3L A;  1D4N A;  1Y3P A;  3U92 A;  3RGY A;  1YPN A;  1YAE A;  1B46 A;  1WOD A;  4PFW A;  4U23 A;  3RTF B;  4JWO A;  4NF4 A;  4X1B A;  4Z7E A;  4P0I A;  3FGS A;  1KWH A;  4G68 B;  2QS1 A;  4BDN A;  1IUD A;  3KZG A;  3A09 A;  4X1D A;  3Q27 A;  1Y20 A;  1UIV A;  1A54 A;  2Q89 A;  1TFA A;  2RC9 A;  1MY4 A;  1SW4 A;  1JEV A;  2DE4 A;  4QFO A;  4GQO A;  1IZ1 A;  4FEC A;  3HN0 A;  4GIZ A;  1MG1 A;  3CG1 A;  1R6Z A;  3F11 A;  2A5S A;  2Q2A A;  4R73 A;  4I9D A;  3EQ1 A;  4XTC Q;  3TCG A;  1MDQ A;  1IIW A;  5L9S A;  2F97 A;  2DE2 A;  3GXA A;  1MXY A;  3HCQ A;  4ZEI A;  3TCH A;  3KEI A;  1I6B A;  1URD A;  1N3W A;  1B4Z A;  3OO6 A;  4QSD A;  1B51 A;  1B7U A;  4JSO A;  4OVJ A;  1FQD A;  2F78 A;  4LVQ A;  3LSW A;  2OK2 A;  1J1N A;  1II5 A;  3IOW A;  4RK9 A;  2Z8F A;  4C1T A;  4G68 A;  3U8Q A;  4ELQ A;  5DYH A;  3KN7 A;  5B70 A;  2E1S A;  1B0H A;  4L17 A;  5FTI A;  4FJP A;  3HPI A;  3PPP A;  4C0R A;  3H03 A;  4FE8 A;  1UIU A;  2P0S A;  2DWA A;  5JEI A;  5CM6 A;  3N5L A;  3SEW A;  4H65 A;  4YZZ A;  5J1D A;  2Z23 A;  1GR2 A;  4R74 A;  3ECR A;  3K6W A;  5AA2 D;  4MBP A;  3O97 A;  3H6T A;  2UVI A;  3FVK A;  3T22 A;  2R71 A;  3KSJ A;  4MLV A;  3EHS A;  3MVZ A;  1BKA A;  2I4B A;  2Y7W A;  1XS5 A;  2R6G E;  4DE8 A;  3TMG A;  4POX A;  5CBR A;  1MDP 1;  4DIG A;  3B6T A;  1MPC A;  5CMM A;  4ZE8 A;  1VFD A;  2HCA A;  1Z7M E;  3FJG A;  3THI A;  1B58 A;  3CIJ A;  5F1Q A;  4POW A;  5TP9 A;  4MLQ A;  4O3B A;  3K6U A;  2ALU A;  4U4S A;  4WED A;  1POT A;  1D9V A;  1RKM A;  2Y7P A;  3TTL A;  4ELP A;  2V93 A;  4LON B;  5I2N B;  3GLB A;  1TXF A;  3TTR A;  1WVJ A;  3QAX A;  4YKK A;  5F7V A;  1NNT A;  5I56 B;  3QUF A;  2O7U A;  3IJX B;  3MP8 A;  5FTH A;  4ZEK A;  1JET A;  3CVG A;  4IGR A;  3SER A;  2XXH A;  4QSC A;  2VP1 A;  3UIF A;  3S9L C;  1B52 A;  1IXG A;  1VFE A;  4YMA A;  4NF6 B;  1ATG A;  4MF3 A;  3VVE A;  1LAX A;  2DQV A;  4OER A;  4M1V A;  3QXM A;  4ZED A;  2F6G A;  4U1O A;  5AA2 B;  2XXI A;  3KOS A;  1MM6 A;  4IGT A;  5HM4 B;  2HXW A;  3BKI B;  3G3K A;  2QMX A;  1S50 A;  2Q2C A;  2QMW A;  4OEV A;  5I59 A;  3K01 A;  1BTJ A;  4ELR A;  3N26 A;  4ZE9 A;  4E0X A;  1MY0 A;  3CI8 A;  4KCD A;  4F1Y A;  1LAG E;  4NWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...