3K4UA

Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
233
structure length
233
Chain Sequence
LRGELRVGLEPGYLPFEMKDKKGNVIGFDVDLAREMAKAMGVKLKLVPTSWDGLIPGLVTEKFDIIISGMTISQERNLRVNFVEPYIVVGQSLLVKKGLEKGVKSYKDLDKPELTLVTKFGVSAEYAAKRLFKNAKLKTYDTEAEAVQEVLNGKADMFIFDLPFNVAFMAQKGQGYLVHLDTSLTYEPLGWAIKKGDPDFLNWLNHFLAQIKHDGSYDELYERWFVDTKWLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF putative binding component of ABC transporter from Wolinella succinogenes DSM 1740 complexed with lysine
rcsb
source organism Wolinella succinogenes
molecule tags Transport protein
molecule keywords BINDING COMPONENT OF ABC TRANSPORTER
total genus 65
structure length 233
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k4uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k4uA02
1MXZA 3PPQA 3VFJA 3VDFA 3G7WA 3MAMA 4Q8RA 3TEPA 3LSLA 3MZBA 1IXCA 1M5DA 4ND9A 1MS7A 2ALUA 3H6WA 5I58B 2QMXA 1DPEA 5FHNA 3O6IA 4C0RA 1AL3A 2I0CA 5KCJB 1LAGE 2Q8JA 3MUQA 4NF8B 2PMSA 4G68A 1QULA 3ODBA 4L17A 1FTLA 3OSRA 1JW4A 2VP1A 4LZ8A 2OWSA 2G93A 3WAFA 1SW5A 3OENA 4AQ4A 1O7TA 1TXFA 2A5SA 3EPEA 1IXHA 2DWHA 4FE8A 3OO8A 3W9VA 4RPOA 1QUKA 1LFHA 3RUMA 1FQFA 3JYRA 1DPPA 1NNPA 2F97A 1J1NA 2XX7A 3GBBA 1WODA 1BIYA 3K6VA 3OSQA 3RQTA 5AA3A 1FQCA 2OJTA 2X7QA 4DCYA 4I62A 3L6GA 5BUUA 5FTIA 5ITPA 4GD5A 4R9FA 3UIFA 3S9LC 1FQEA 1N0TA 1D4NA 4NF6A 3A3CA 5DVFA 3W15C 3OEMA 2OZZA 4RJZA 2REJA 3IJXB 1FQBA 4ECFA 4WEPA 3CSGA 2ZNSA 3GLBA 3PGFA 2HAVA 4FEBA 1VFEA 4KI0E 3U94A 3UA8A 1ZMGA 3IX1A 3MZ9A 4BDRA 1OQGA 2Q2CA 1VE4A 2XXVA 3BKIB 1SW2A 2XXHA 2ONSA 1II5A 3KSXA 3O29A 4KD5A 4NF5A 4YB5A 5I84A 3I3VA 1P1OA 3O28A 4H65A 1QVSA 4U22A 2PX1A 3KN8A 1XVYA 1B40A 4R6HA 4RPNA 1FTJA 1RYOA 1HSEA 4EF1A 4F1VA 4FATA 4GFRA 4OESA 2HEUA 3KOSA 3O9PA 1ZU0A 4KPTA 3K6UA 1PB8A 3JZJA 1B6HA 1MY2A 1Y9UA 3DLNA 1N3WA 3K4UA 3MP6A 1POTA 1Y3QA 3V8XB 1YAEA 1JETA 1PBQA 1P1UA 4KYDA 3ZSFA 2F78A 1DTGA 2QS2A 2RC8A 3H6TA 2Q89A 4XKPA 4F3BA 3TELA 4NE4A 4DE8A 1EZ9A 2F7BA 1TWYA 3PPNA 3N6TA 5FHOA 3T66A 3V83A 5I57A 2B3FA 2D5WA 3DM0A 3MVYA 5ISUA 3RTFB 3VLVA 3N6UA 1JW5A 4R73A 2UVGA 1IZ1A 1SBPA 1R9QA 1UTHB 4YB7A 4ZDMA 3CI8A 3PD9A 4JSDA 2Y7WA 3MVXA 1Y4TA 1IEJA 3DELB 4OXVA 3Q29A 1R1NA 5H8NA 3QYTA 1H3DA 3R6UA 3EF7A 3QIMA 4F3SA 4O3CA 4HS7A 1XHYA 3TPAA 1OVTA 3T22A 3KOTA 5IKBA 4LZ5A 4Q0CA 3LSFB 3O2AA 1VFDA 4R6KA 4U21A 2ZYMA 3EHTA 3FJGA 3I6VA 3IB1A 3Q26A 4K3FA 4LQ5A 4O3AA 1B3EA 2RINA 3N5LA 3FVKA 4KCCA 4XKQA 4RYAA 4OYVA 3JV9A 3RPWA 1FTOA 1MQDA 4TQUQ 5KZTA 5AA4A 1LFIA 4OVJA 4X1DA 1LCTA 2ONKE 4ZEBA 1M5BA 1OMPA 4GQOA 4IY5A 1PDAA 4OFJA 1A8EA 1LAFE 2O6AA 2PT2A 2XXWA 4MLQA 1B0LA 4YAHX 4ELPA 2ABHA 3KG2A 2XX9A 3KJTA 4G77A 3K2DA 3MC2A 1SW4A 1MM7A 4YZZA 2FNCA 1NL5A 4LZ7A 1GTKA 4LP2B 4WEDA 1MY3A 5TP9A 1XT8A 3MQ9A 1FCKA 4MBPA 4ZEIA 4ONYA 3SEWA 2Z8EA 1B51A 2YJPA 4P0IA 3TODA 3UORA 4XTCQ 5F1QA 4F29A 4X48A 3TQLA 2THIA 2HZKA 5CI5A 1XOCA 1TFAA 2HAUA 4FECA 3CFXA 3ILUB 4JWXA 3N94A 1LFGA 4NF8A 3SEVA 5JEIA 2ZNTA 4OFOA 1NNTA 1URGA 2PYYA 1NNKA 3E3KA 2DP8A 1KWHA 4M4GA 4M1VA 3FATA 1WVJA 3G3JA 4YICA 3TQWA 2PBWA 4QRZA 1M5CA 4IGRA 4YKKA 2VHAA 3CG3A 2UXAA 4EQBA 1US4A 2OCUA 1SYIA 1B05A 3U72A 1POY1 3HHGA 3IB0A 3K6XA 4TLMB 3RLFE 3TKDA 2F36A 4DXCA 4JWOA 2QS4A 2RF1A 1IXIA 1B3LA 4F2QA 3PD8A 1MQGA 5I2KA 2Q2AA 1SI0A 3M3FA 1H45A 4KR5A 2F35A 2H4IA 1N7XA 4NWCA 3VLWA 3KZGA 4F18A 1D9VA 2B65A 5TU0A 4NMYA 2XD3A 4IO7A 4O3BA 1CB6A 4N07A 1S9TA 4RA1A 1UTBA 4AB5A 1PEBA 2VGQA 1MPBA 3PPPA 4QFKA 3FJMA 4YKJA 4XKNA 1YPNA 1MRPA 2DWIA 2DXRA 5KCJA 3FASA 2XXYA 4GLIA 1LCFA 2V3TA 3T93B 1TFDA 2ZYNA 3FUZA 2HCAA 4PP0A 4H67A 3HV1A 1B7UA 4QSDA 5CMMA 3V5AA 3V89B 2XHDA 5FTHA 3IO4A 2ONRA 3OO7A 1XC1A 3FVGA 3MVZA 4GXSB 1MY1A 3H6VA 1QUJA 3DP4A 4ISUA 4QFLA 4WXJA 1MY0A 3G3HA 4U23A 3TTKA 3TUSA 2Y7RA 1H44A 1B4HA 1QKBA 2F34A 4JBZA 1DTZA 3G3KA 1B7HA 3PU5A 3QUJA 3T9VA 2RCBA 5A5XA 1OLAA 3LBSA 2QJEA 4KYSA 5ICTA 4EXLA 5I57B 1N04A 5I56A 2P2AA 1ZKBA 5CMCA 2Z23A 1LSTA 5TPAB 3C9HA 3HCQA 4MFIA 3VE1B 4E0XA 5IAIA 1AOVA 2UVIA 4OEUA 4DCXA 5DEXB 3SERA 3TCGA 4LONB 3C4MA 3KGCA 3PMVA 2P1SA 4RNSA 2XXRA 2XXTA 3CSBA 3FGSA 5J1DA 2B3BA 4R75A 1QUIA 3FVOA 5H8HB 1URSA 1ZBMA 1B2HA 1DMBA 2I3WA 2V84A 3K1PA 3PMXA 4DDDA 1JVYA 1MXWA 1Y3PA 2I6EA 4KQPA 3TDJA 1OVBA 5EHSA 1SQYA 1B5IA 1IITA 1IXGA 1ZJLA 4RK2A 3K6WA 2G29A 4NF4A 5A5XB 5CMBA 3PV0E 3GZGA 4OTEA 4PFWA 3VVEA 3O6GA 3H7MA 3VV5A 5DT6A 4GIZA 2GHAA 3GXAA 4G68B 4MLVA 4THIA 4BDNA 3VXBA 2ZMBA 1JQFA 2DE2A 1D9YA 1ELJA 2VD3A 4U1OA 3U92A 3P7IA 4F31B 1R6ZA 1MXXA 2R9JA 2VD2A 3B6QA 3CFZA 4H8IA 3OEKA 4LQ2A 1B58A 3S9NC 1Q35A 3TTMA 2KLFA 3T9HB 2REGA 2FYIA 3TYHA 2GHBA 5I58A 1QKAA 1JEVA 4QFOA 4U4SA 3H6UA 3SEXA 1UQWA 4TOZA 4H5FA 4Z0IA 2F7CA 5H8FB 3U1OA 1F9BA 1UIUA 3SETA 1YTVA 2YPNA 3M3KA 4GXAA 3TAJA 4ZS9A 5FHMA 1OQHA 3IAZA 1USYH 1PB9A 2O68A 2H25A 2A5TB 4ZE9A 5K2XA 2IEEA 5AA1A 4OETA 1MQJA 2QRYA 4XKRA 2H5YA 4EUOA 5CC2A 2GFEA 3CR9A 3EN3A 3FZVA 5AA2D 2O1MA 2DS9A 3FXUA 5EHMA 1B4ZA 2ESNA 3ZKLA 2I58A 1N3XA 2R71A 1N7WA 3C36A 2ZXTA 3C31A 3K1MA 3FD3A 5DTBA 2H98A 1MY4A 3FV2A 3KN3A 3OMBA 4I9DA 4IB2A 2XXQA 4QSEA 3PPOA 3K0VA 4YU0A 3SESA 3O6HA 4OENA 3VLUA 4BLAA 5AA2A 3MP8A 4F3GA 1SVXB 2DWJA 2DYXA 1MDP1 1B3GA 1LAXA 3CVGA 3FJ7A 2XXXA 3IK6B 3LSWA 1BLFA 1Y4CA 3HHFA 4RK9A 5L8DA 4R9GA 4QFPA 1AMFA 3QK6A 1P1NA 3K1NA 1JVXA 3OO9A 5JTYA 1EZPA 1B7ZA 1M5EA 1Q1KA 3A09A 3PUXE 4IO2A 4NF5B 4HTGA 2O7UA 3MP1A 2IA4A 4OHNA 2YLNA 4PFUA 4P11A 3RN8A 1ATGA 3CRBA 4N6PA 3H06B 1A40A 4IY6A 1M5FA 1I69A 2H9BA 4GWOA 1HSJA 2DE3A 4HCYA 4XIGQ 3RT6B 4F3PA 3F11A 3LSXA 4F1YA 2LAOA 4YMBA 1A99A 3C35A 1Z7ME 4BDLA 4FIMA 1AH5A 4F1UA 5KDTB 3PUZE 2RCAA 2F6PA 4NTLA 3U93A 1FQDA 1MH4A 2NUVA 1YCJA 3OOAA 5I2KB 1GVCA 1MH3A 3T9XB 5CBSA 1B9JA 2ZYKA 5CMKA 1UIVA 1I6AA 1IUDA 3D4CA 4RXLA 2I4BA 4JB7A 5L9MA 1FQAA 2E1SA 2QMWA 3OD7A 4N13A 1FTKA 1B0HA 4IO6A 1NH8A 3S4UA 3QSLA 4PE5B 4R2BA 2ZNUA 4G8NA 3R26A 4POXA 5I2NA 1QJMA 3SKPA 4QFNA 1MPDA 4C1TA 2E0SA 4X9TA 4R2FA 5H8SA 5I56B 4JDFA 3D4GA 4H1XA 4X1BA 1OLCA 3S9MC 2AL5A 4OQOA 4QHQA 1MG1A 3H3GA 3MZ1A 2OK2A 4GF8A 4AB6A 3LUYA 4ZEDA 3QAXA 5KDTA 1S50A 3IOTA 2DVCA 3TTNA 4R72A 4F39A 1Z7NE 3EQ1A 2RKMA 4JWYA 2I48A 4IO4A 4GVOA 3BFTA 1LBBA 3G3FA 4U4XA 4DLDA 5AA4B 3C32A 4PFYA 1MQIA 2O84X 3MPLA 3K00A 3MWBA 4IGTA 5H8QB 4F19A 4G68C 2UYEA 3FXQA 1SD3A 4P0GA 2AYSA 4OERA 1A7LA 4WKMA 4NF6B 5EYFA 5K2YA 2Z8FA 3SDFA 3UN6A 4QF9A 5DVIA 3PUYE 1UTBB 3EHUA 3G3GA 2D21A 3SEYA 3UP9A 2DQVA 1LGBC 4H8JA 2NXOA 2I49A 5H8FA 4ZZAA 5BWJA 5ICQA 1JW1A 2Z22A 1P99A 3HSTA 3ILTB 1P1WA 4IO5A 1B5HA 4YB6A 3MPKA 4I1DA 5ELVA 3OXNA 4H6DA 3K01A 2DE4A 5DYHA 2OBGA 1LB8A 1JEUA 1NH7A 4G8MA 1Y20A 2DOJA 3B6TA 3KFMA 2NWJA 2BJJX 3TCHA 4PQJA 1XVXA 3HN0A 4OMBA 3IOVA 1B32A 3B7DA 3KEIA 3PPRA 2OLBA 4DIGA 1FTMA 3UK4A 3CG1A 3FIRA 2X26A 4ZEKA 2RC9A 2Y7KA 3CFLA 1D3KA 3ONMA 4KFQA 1BKAA 2A5TA 4G8HA 4BDOA 3AXFA 1O63A 2X7PA 1H43A 1PBPA 4R74A 2Y7PA 1LAHE 2P0SA 1JNFA 2D3IA 2QL3A 2W7YA 3C34A 2UYFA 4G4PA 4IO3A 3A3UA 4MH5A 4YKPA 4YMAA 3Q25A 1LB9A 1B52A 3H4ZA 5TP9B 1N84A 5AE4A 1T0KA 2GH9A 1R9LA 1B3FA 2XXIA 3VVFA 3MVWA 3RTWB 1A55A 3M3LA 3RT8A 4ELRA 4QSCA 1PC3A 1P1QA 2QS1A 4HCWA 1NMUA 3FVNA 4LA9A 1TT1A 4OEVA 2R6GE 2M8CA 4I8CA 4OZ9A 4OFLA 3EHSA 5LOMA 3DP6A 1LBCA 4ESWA 3LC8A 3I5OA 3Q27A 1ANFA 1EU8A 2DSFA 1EZOA 2DWAA 1B3HA 2CMOA 2F8DA 4LATA 5HBCA 1QW0A 3IL1B 3KBRA 4FORA 1MXVA 4H0WA 4KYEA 4ZEFA 4U2RA 1URDA 3PUVE 1CE2A 3OELA 4UACA 2FA7A 3GBAA 1L5TA 5CM6A 2UVJA 2Q88A 5M2VA 3PMWA 1MM6A 2PVUA 1ZLQA 4POWA 3TTRA 3VVDA 2V3UA 3QXMA 1S7YA 1SI1A 1SYHA 3LR1A 3IO6A 3VXCA 3IOWA 1I6QA 2F6GA 2HQ0A 4PFTA 4JSOA 2WKYA 1B1HA 1H76A 2RC7A 5TPAA 1BTJA 1DSNA 4KHZE 1RKMA 2DVZA 1DOTA 1GV8A 3IR1A 3TMGA 4EXKA 2F5XA 3HO7A 1OIBA 2QS3A 3SEUA 5I59A 2NOOA 3OO6A 3M8UA 2I0BA 1B46A 1I6BA 4E0WA 3MBPA 3TTLA 1SW1A 3S9EA 3E9XA 4R6YA 3WAEA 4DXUA 3U8QA 1Y1MA 1B5JA 4LVQA 4BDQA 2QSXA 3H03A 3G3IA 2QPQA 1A8FA 4Q5TA 3E4RA 1GGGA 3O66A 5ITOA 3T96B 5DEXA 1BP5A 4KCDA 3THIA 3CIJA 3ZKKA 3UGWA 3R7XA 1VSOA 4GL8A 1USYE 2V93A 3W9WA 4Z7EA 1MXUA 5I59B 3IJOB 1LLSA 3O97A 5CBRA 2Q9TA 3MW0A 4EQ9A 3S2VA 5B7DA 2I4CA 1ZIUA 2I3VA 3IORA 3Q28A 5F7VA 1Y1ZA 3ZS6A 1NFTA 3RY3A 3ECRA 4NWDA 5HM4B 5I2NB 1IIWA 2HFBA 3KSJA 1Y3NA 4GL0A 4YKIA 4C1UA 4DZ1A 5DVJA 1HSLA 2CZLA 3USDA 4BDMA 5CRYA 1AIVA 3TZAA 5HPQA 4PETA 4MF3A 3T9UA 1O64A 3RNNA 3TCFA 2HXWA 1RYXA 2DXYA 2O7IA 2PT1A 1UTHA 2XXUA 3MJNA 4ELQA 4LUBA 4ESXA 5AA2B 1MQHA 2XX8A 5H8NB 2XD2A 4F22A 1VR5A 2OWTA 3FXRA 1EH3A 1US5A 4F2OA 2AL4A 1MXYA 4RY1A 4ZECA 2Y7IA 3IB2A 2XXPA 3KJ7A 1ZTYA 2VOZA 3BBRA 1N76A 4JXIA 2AIXA 2ZYOA 3KN7A 4NF4B 3HPIA 5L9SA 1B1XA 1NNFA 2H99A 1GR2A 2V25A 3BFUA 3L6HA 4GOTA 4Q30B 5H8QA 2O69A 4ZZEA 4EQ7A 4U1ZA 1MPCA 5JK4A 4NEDA 3K02A 3N26A 3QUFA 1NKXA 5H8HA 2Y84A 4FJPA 2HZLA 4XXUA 5B70A 3RGYA 2ANJA 4FEDA 3FV1A 4EDPA 4ZE8A 4EF2A 1IQ7A 2Z8DA 3DP8A 4G2ZA 4TLLB 2NVUB 3PUWE 4DXBA 5JTYB 4FAJA 2V3QA 3B6WA 2O1LA 2F7AA 2UVHA 1PB7A 4H5GA 2O51A 5L9OA 3IOUA 1WDNA 1SDXA 1XS5A 4GRKA 4HW8A 4ELOA 3E13X 2GRVA 4UA8A 1FW0A 3TFLA 1A54A 4OWDA 1MDQA 3C33A
chains in the Genus database with same CATH superfamily
3VFJA 3G7WA 2ALUA 5I58B 4C0RA 1AL3A 5KCJB 1LAGE 2Q8JA 4NF8B 1QULA 2VP1A 4LZ8A 2OWSA 2G93A 3OENA 1O7TA 2A5SA 3EPEA 2DWHA 4RPOA 1QUKA 3RUMA 1NNPA 2F97A 1J1NA 2CZIA 2XX7A 3GBBA 1BIYA 3RQTA 1FQCA 2OJTA 3L6GA 4GD5A 1FQEA 4NF6A 3OEMA 4RJZA 3PGFA 3GLBA 1ZMGA 2XXVA 2ONSA 3O29A 3KSXA 4PF8A 3I3VA 1XVYA 3KC1A 4H46A 4GFRA 4KPTA 3JZJA 1B6HA 2QVRA 1POTA 3MP6A 3ZSFA 2RC8A 1DTGA 1EZ9A 3V83A 2D5WA 3MVYA 4MEVA 2UVGA 4PGPA 1JP4A 3CI8A 3PD9A 4JSDA 2Y7WA 1Y4TA 3Q29A 4N8YA 3EF7A 3QIMA 5IKBA 4O3CA 4Q0CA 4XKNA 3I6VA 4LQ5A 4GWYA 3SEUA 5CBSA 4KCCA 1FTOA 1MQDA 4TQUQ 5AA4A 1LCTA 2WBBA 4ZEBA 4GQOA 4IY5A 1A8EA 1LAFE 2PT2A 1B0LA 2ABHA 3KJTA 4P47A 1BK4A 2FNCA 1NL5A 4WEDA 4ZEIA 3UORA 4XTCQ 5F1QA 4X48A 1XOCA 2HAUA 3CFXA 3ILUB 2FIXA 2PYYA 1NNKA 4M4GA 3CG3A 4PTKA 1US4A 1SYIA 1B05A 3HHGA 3PD8A 2Q2AA 4NWCA 4F18A 1D9VA 4NMYA 2XD3A 4O3BA 4N07A 1S9TA 4AB5A 1PEBA 1YPNA 2DXRA 1LCFA 3T93B 2HCAA 2ONRA 3H6VA 1QUJA 3DP4A 3G3HA 2F34A 1B7HA 3PU5A 2RCBA 2QJEA 3MYUA 2P2AA 1ZKBA 5CMCA 4MFIA 3VE1B 4OEUA 4DCXA 5DEXB 3TCGA 3NOHA 3C4MA 2ZZWA 1QUIA 2F3BA 1B5IA 1IITA 5A5XB 4OTEA 3VVEA 1IMAA 5DT6A 2XWKA 3GXAA 4MLVA 3VXBA 1D9YA 1ELJA 4U1OA 3P7IA 1G0IA 4AS5A 1B58A 2KLFA 2REGA 2FYIA 3H6UA 5H8FB 4Z0IA 4ZS9A 5FHMA 1USYH 2O68A 2H25A 5K2XA 3LUZA 2ESNA 2I58A 1N7WA 2ZXTA 3C31A 3FD3A 4JVIA 4OANA 4IB2A 2XXQA 3K0VA 4OENA 4BLAA 1MDP1 1B3GA 3IK6B 5L8DA 2XXXA 3OO9A 1B7ZA 3A09A 5EQ9A 4X04A 3CRBA 4N6PA 3H06B 1A40A 4GWOA 4F3PA 1HSJA 3F11A 3LSXA 1Z7ME 1AH5A 4F1UA 2RCAA 2F6PA 5ET6A 1MH3A 1FBHA 1UIVA 4O8MA 4N17A 4JB7A 4RXLA 2QMWA 3QSLA 4R2BA 2ZNUA 3R26A 4R2FA 4NGUA 5I56B 2FIEA 3S9MC 2AL5A 4GF8A 3QAXA 5KDTA 4NAPA 2RKMA 4MCOA 1LBBA 4G68C 1NUZA 4NHBA 5ET5A 1A7LA 4WKMA 1UTBB 2Y5KA 2DQVA 1LGBC 2NXOA 2I49A 4ZZAA 5ICQA 1P1WA 5ELVA 2OBGA 1LB8A 4GBWA 4PAIA 1XVXA 3HN0A 2OLBA 5LTCA 3CG1A 2X26A 4O94A 3CFLA 1D3KA 2A5TA 1O63A 2X7PA 2Y7PA 3SEWA 2P0SA 2D3IA 4YKPA 1B52A 1N84A 1LBWA 3MVWA 4MNPA 3E79A 3RT8A 4ELRA 2QS1A 4LA9A 5IZ1A 2M8CA 4I8CA 3DP6A 4ESWA 1IMCA 2F8DA 4GBVA 1FPBA 4PE3A 4DI4B 3PUVE 5CM6A 3VVDA 2PVUA 1ZLQA 2V3UA 3QXMA 1S7YA 1KA1A 1YZ0A 2OWZA 1FJ9A 1RKMA 4UABA 3HO7A 1OIBA 4MNIA 3MBPA 3WAEA 4DXUA 1FBDA 4BDQA 4N91A 1YXIA 1GGGA 3O66A 5ITOA 3UGWA 3MW0A 3IORA 5HM4B 1IIWA 3KSJA 1Y3NA 4YKIA 4C1UA 5DVJA 1Q9DA 5HPQA 4PETA 1KZ8A 3T9UA 1O64A 2O7IA 4ELQA 2XX8A 2XD2A 3FXRA 4F2OA 2AL4A 1MXYA 4ZECA 2Y7IA 4JXIA 4NF4B 2H99A 1GR2A 4EQ7A 1K9ZA 4XXUA 2WX9A 4FAJA 2NVUB 3PUWE 4PBHA 2V3QA 2O1LA 2UVHA 1PB7A 4H5GA 5L9OA 4GRKA 4HW8A 3E13X 3TEPA 3MAMA 4Q8RA 3MZBA 2PFZA 1IXCA 1M5DA 1MS7A 2QVUA 1DPEA 2I0CA 4G68A 3OSRA 3WAFA 1IXHA 1FQFA 3JYRA 1DPPA 1WODA 5BUUA 5FTIA 5ITPA 4R9FA 1N0TA 3A3CA 5EQ7A 2OZZA 3IJXB 4WEPA 3CSGA 2ZNSA 3MZ9A 3BKIB 1SW2A 2XXHA 4NF5A 1II5A 4YB5A 5I84A 4U22A 1P1OA 3O28A 4H65A 2PX1A 4EF1A 1B40A 1HSEA 4FATA 3KOSA 3O9PA 1PB8A 4N6KA 4KXPA 3K4UA 1N3WA 3V8XB 1PBQA 1P1UA 2QS2A 4NN3A 3PPNA 5ISUA 2KQZA 3DM0A 1JW5A 4YB7A 4ZDMA 2Y5LA 4HE0A 4GX4A 3MVXA 4OXVA 5EQAA 2BJIA 1XHYA 3KOTA 3LSFB 1VFDA 3Q26A 3EHTA 4K3FA 4O3AA 4XKQA 2RINA 3N5LA 4RYAA 5KZTA 2ONKE 1M5BA 1OMPA 1PDAA 4ELPA 2O6AA 1SW4A 4LZ7A 4GWZA 4LP2B 1XT8A 4MBPA 3TPAA 4ONYA 1B51A 4F29A 2THIA 4XEQA 4FECA 4JWXA 4M1VA 1WVJA 3KBZA 5EQ8A 2OCUA 3U72A 2VPOA 3TKDA 3K6XA 3RLFE 1B3LA 4HXVA 4KR5A 1N7XA 3KZGA 2B65A 5TU0A 1UTBA 3FJMA 5KCJA 4GLIA 3E78A 3FUZA 4QSDA 5FTHA 3IO4A 1NUYA 4ISUA 3TUSA 4JBZA 1DTZA 4IR8A 1OLAA 2MKZA 4GX3A 5I56A 2XWIA 3C9HA 3HCQA 2Q74A 4E0XA 5IAIA 2UVIA 3MSTA 1D9QA 1FPJA 2P1SA 5J1DA 3FGSA 2B3BA 3FVOA 1URSA 1B2HA 4DDDA 1JVYA 1MXWA 1IXGA 1ZJLA 4NF4A 4PFIA 4P1LA 4PFWA 3H7MA 4LN5A 4G68B 4THIA 2ZMBA 4F31B 1R6ZA 1MXXA 1DBZA 4H8IA 1Q35A 2P3VA 3T9HB 5I58A 4X8RA 4QFOA 1JEVA 1UQWA 4H5FA 3SETA 1UIUA 3T1BA 2YPNA 3IAZA 4ZE9A 2IEEA 1MQJA 3EN3A 3FZVA 2DS9A 3FXUA 2R71A 3C36A 3A29A 3K1MA 5J16A 5DTBA 3KN3A 3OMBA 4QSEA 1IMFA 3PPOA 3U65A 2DYXA 5I7IA 1LAXA 4RK9A 1P1NA 1EZPA 1Q1KA 5I59B 4HTGA 2O7UA 4PFUA 4P11A 4IY6A 4HCYA 3RT6B 4F1YA 4BDLA 3PUZE 2Q8MA 2NUVA 1GVCA 5CMKA 3D4CA 2I4BA 5L9MA 1NH8A 1AWBA 4POXA 1QJMA 3SKPA 4C1TA 2E0SA 4X9TA 4H1XA 4NQ8A 4QHQA 3H3GA 2OK2A 5IGAA 2DVCA 1Z7NE 2I48A 5I3SA 4DLDA 3IFCA 2O84X 5IZ3A 3MPLA 4P0GA 4NF6B 5K2YA 3SDFA 3UN6A 4QF9A 3G3GA 2D21A 4H45A 2OX3A 1FPEA 1NH7A 3KFMA 2BJJX 5IZZA 3ISPA 3PPRA 3KEIA 4DIGA 4GWWA 2RC9A 2Y7KA 3ONMA 4KFQA 3AXFA 4R74A 1LAHE 4N6DA 3SESA 4IO3A 4G4PA 1LB9A 5AE4A 3VVFA 2R8TA 3RTWB 4MNCA 1FBPA 1LBZA 4HCWA 3EHSA 1RDYA 1EU8A 1B3HA 2CMOA 1QW0A 3IL1B 3KBRA 4H0WA 4ZEFA 1NV6A 4P56A 1CE2A 1NUWA 2FA7A 4POWA 3VXCA 3LR1A 1SYHA 1I6QA 4JSOA 2WKYA 1H76A 2DVZA 1DOTA 4OVSA 4EXKA 2F5XA 4N4UA 1B46A 3TTLA 4LVQA 2QPQA 1A8FA 3E4RA 3THIA 1LBXA 1LLSA 2Q9TA 2F3DA 1ZIUA 3EKIA 2I3VA 3ZS6A 1NFTA 2ZZVA 3LV0A 4GL0A 4BDMA 3RNNA 3TCFA 2HXWA 2DXYA 2PT1A 1IMBA 3KC0A 2OWTA 1FBEA 3KJ7A 1ZTYA 2VOZA 3KN7A 1NNFA 2O69A 4MHFA 5JK4A 1NKXA 2Y84A 4FJPA 2HZLA 4XFEA 2ANJA 3DP8A 4G2ZA 5JTYB 2F7AA 2O51A 1WDNA 5AA2B 1A54A 3PPQA 3LSLA 4ND9A 2HPGA 2QMXA 3MUQA 3RYDA 3ODBA 4L17A 1SW5A 4AQ4A 4I3YA 4PFBA 3OSQA 2X7QA 4DCYA 5FBPA 3UIFA 3W15C 2B4MA 1FQBA 4FEBA 4KI0E 3UA8A 4BDRA 4N81A 1VE4A 4KD5A 1QVSA 4F1VA 4RPNA 1FTJA 4OVRA 4P9KA 1ZU0A 3GYYA 3K6UA 1QGXA 1Y3QA 4DI3D 1YAEA 2F78A 3H6TA 4NG7A 4PDDA 4NE4A 2F7BA 1TWYA 5I57A 3RTFB 1KA0A 4R73A 1IZ1A 1SBPA 3BIHA 1R1NA 5H8NA 4OA4A 5IZ3B 2KR0A 1H3DA 4F3SA 4NX1A 4LZ5A 4R6KA 2ZYMA 2VT5A 3RPLA 1B3EA 4OYVA 5ET7A 1LFIA 4GWXA 4OFJA 2XXWA 4MLQA 4YAHX 2XX9A 4G77A 3MC2A 4YZZA 1MM7A 1GTKA 1NV3A 3MQ9A 2Z8EA 4P0IA 3TQLA 5CI5A 4NF8A 3N94A 3PTYA 2ZNTA 1NNTA 1URGA 3E3KA 1KWHA 3TQWA 4YICA 1M5CA 4YKKA 1DK4A 1NV7A 4TLMB 2F36A 4JWOA 2RF1A 1IXIA 4F2QA 1XI6A 1SI0A 4O7IA 4IO7A 1CB6A 2VGQA 4QFKA 4YKJA 1MRPA 2DWIA 2XXYA 2V3TA 1TFDA 2ZYNA 4PP0A 3HV1A 1B7UA 3OO7A 3FVGA 3TTKA 1MY0A 4U23A 5LDZA 2Y7RA 1B4HA 1QKBA 3T9VA 5ICTA 4EXLA 2Z23A 1EYIA 5ET8A 5TPAB 1FBCA 1AOVA 4LONB 1IMEA 3KGCA 2XXTA 3CSBA 1FPGA 4R75A 5H8HB 1ZBMA 2I3WA 1DMBA 3PMXA 4KQPA 2I6EA 1OVBA 1SQYA 4RK2A 2G29A 4P8BA 2HHMA 5CMBA 3PV0E 1FBGA 4JVCA 3O6GA 3VV5A 2GHAA 5F24A 4BDNA 2VD3A 2R9JA 2VD2A 3CFZA 3OEKA 4LQ2A 3TTMA 4O7MA 2GHBA 1DCUA 4TOZA 1YTVA 3M3KA 1FPLA 1PB9A 2A5TB 4XKRA 4EUOA 2H5YA 2GFEA 5AA2D 3ZKLA 2CZHA 4I9DA 1MY4A 3FV2A 3VLUA 4GOTA 3CVGA 3FJ7A 1Y4CA 3HHFA 4R9GA 3QK6A 1JVXA 1M5EA 4IO2A 4NF5B 3RN8A 1M5FA 1I69A 2H9BA 2DE3A 2LAOA 4NF0A 4NTLA 4I3EA 1YCJA 5I2KB 3D1RA 1B9JA 4HE2A 4P3LA 1IMDA 1IUDA 1FQAA 2E1SA 3OD7A 2HXRA 4G8NA 5I2NA 1FPFA 3FXBA 1MPDA 4GX6A 3D4GA 4X1BA 1OLCA 4ZEDA 1MG1A 3MZ1A 4AB6A 4MX6A 3IOTA 3TTNA 4R72A 3EQ1A 4JWYA 4IO4A 3BFTA 5AA4B 4PFYA 1EYJA 1LEVA 3K00A 3MWBA 5H8QB 1NV2A 4F19A 1SD3A 4OERA 5EYFA 2Z8FA 5DVIA 2QVVA 3EHUA 3SEYA 4H8JA 5BWJA 1INPA 1JW1A 4PFRA 4I1DA 4H6DA 3K01A 2DE4A 1JEUA 3B6TA 4GWUA 4PQJA 3IFAA 1B32A 3B7DA 4OVTA 4XF5A 3UK4A 1RDXA 4BDOA 1BKAA 4G8HA 2V4CA 2W7YA 2QL3A 3C34A 4YMAA 3Q25A 3H4ZA 2L5VA 1R9LA 2XXIA 1A55A 4QSCA 1P1QA 1NMUA 4OZ9A 5LOMA 1LBCA 3I5OA 1ANFA 2DSFA 2DWAA 4PCDA 4FORA 1MXVA 3OELA 4UACA 3GBAA 5M2VA 1SI1A 3IOWA 2F6GA 2HQ0A 2RC7A 5TPAA 1BTJA 1DSNA 4KHZE 1GV8A 3IR1A 1NUXA 2I0BA 1I6BA 4E0WA 3E9XA 3U8QA 1Y1MA 1B5JA 3H03A 3G3IA 4Q5TA 3T96B 5DEXA 4KCDA 3R7XA 1USYE 3W9WA 4Z7EA 1FTAA 3O97A 5CBRA 3S2VA 5B7DA 2I4CA 3Q28A 3BIGA 3RY3A 4NWDA 4MJOA 4DZ1A 3USDA 5CRYA 1AIVA 4MF3A 1RYXA 1UTHA 2XXUA 3MJNA 1MQHA 4F22A 1EH3A 2XXPA 2AIXA 1LBYA 2ZYOA 3HPIA 3BFUA 3L6HA 4Q30B 2V25A 4ZZEA 1FPKA 3K02A 3N26A 3QUFA 5B70A 3RGYA 4FEDA 4EDPA 4ZE8A 4DXBA 3B6WA 1SDXA 1XS5A 1RDZA 3TFLA 2GRVA 4UA8A 2XHDA 4OWDA 1MDQA 3C33A 1MXZA 3VDFA 5IM2A 2DDKA 4HE1A 3H6WA 1FSAA 5FHNA 3O6IA 1YYZA 2PMSA 1FTLA 1JW4A 1TXFA 2FHYA 1LFHA 4FE8A 3OO8A 3W9VA 3K6VA 5AA3A 4I62A 3S9LC 5DVFA 1D4NA 2QFLA 2XA5A 2REJA 4ECFA 2HAVA 3U94A 1VFEA 3IX1A 1OQGA 2Q2CA 3KN8A 4R6HA 1RYOA 1FPIA 4OESA 2HEUA 1MY2A 1Y9UA 3DLNA 4N15A 1JETA 4KYDA 2Q89A 4XKPA 4F3BA 3TELA 4DE8A 3N6TA 5FHOA 3T66A 2B3FA 3VLVA 3N6UA 4PAKA 1R9QA 1UTHB 4MAGA 2P3NA 4AS4A 1IEJA 3DELB 1FJ6A 3QYTA 3R6UA 4HS7A 1OVTA 3T22A 3O2AA 4U21A 3FJGA 3IB1A 3FVKA 3RPWA 3JV9A 4GWSA 4OVJA 4X1DA 4PC9A 3KG2A 3K2DA 4PF6A 2XWVA 1MY3A 5TP9A 1FCKA 2B4LA 2YJPA 3TODA 2PCRA 2HZKA 4PBQA 1TFAA 3SEVA 1LFGA 4I40A 5JEIA 1FBFA 4OFOA 2DP8A 3FATA 3G3JA 2PBWA 4QRZA 4IGRA 2VHAA 2UXAA 4EQBA 1POY1 3IB0A 4DXCA 2QS4A 1MQGA 2CZKA 3M3FA 1H45A 2F35A 2H4IA 3VLWA 4N8GA 4RA1A 3PPPA 1MPBA 3FASA 2CEYA 5CMMA 4H67A 3V89B 3V5AA 3QMFA 1NV1A 1XC1A 3MVZA 4GXSB 1MY1A 4WXJA 4QFLA 1H44A 1VDWA 3G3KA 3QUJA 5I5PA 5A5XA 4KYSA 3LBSA 5I57B 1N04A 1LSTA 3B8BA 1LBVA 4OVPA 3SERA 3PMVA 4RNSA 2XXRA 2V84A 3K1PA 1Y3PA 3TDJA 5EHSA 3K6WA 2GQ1A 3CHGA 3GZGA 2WBDA 4GIZA 4JVDA 1JQFA 2DE2A 2WYKA 3U92A 5EYGA 3B6QA 4MIJA 3S9NC 1FRPA 3TYHA 1QKAA 3SEXA 4U4SA 3U1OA 2F7CA 1F9BA 4GXAA 3TAJA 1OQHA 5AA1A 4OETA 2QRYA 5CC2A 3CR9A 2O1MA 5EHMA 1B4ZA 1N3XA 2H98A 4YU0A 5I2KA 4P1EA 3O6HA 5AA2A 3MP8A 4F3GA 1SVXB 2DWJA 3LSWA 1BLFA 4QFPA 1AMFA 3K1NA 5JTYA 4PDHA 3PUXE 4OHNA 3MP1A 2IA4A 2YLNA 1ATGA 4QBAA 4XIGQ 4PGNA 4YMBA 1A99A 3C35A 3ROJA 4FIMA 5T3JA 5KDTB 1NV5A 3U93A 1FQDA 1MH4A 3OOAA 3T9XB 2ZYKA 2PFYA 1I6AA 4N13A 1EYKA 1FTKA 1B0HA 4IO6A 3S4UA 4PE5B 4QFNA 5H8SA 4JDFA 1CNQA 4OQOA 3LUYA 4FBPA 1S50A 4F39A 4GVOA 3G3FA 4U4XA 3C32A 1MQIA 2JJKA 2FVZA 4IGTA 2UYEA 3FXQA 1NI9A 2AYSA 2XWOA 3PUYE 3UP9A 5H8FA 2WYPA 2Z22A 1P99A 3HSTA 3ILTB 1K9YA 4IO5A 1B5HA 4YB6A 3MPKA 3OXNA 5DYHA 2VPNA 4G8MA 1Y20A 2DOJA 5EYHA 2NWJA 3TCHA 4OMBA 3IOVA 1FTMA 1G0HA 3FIRA 1FPDA 4ZEKA 1SPIA 5A5LA 3HFUA 1H43A 1PBPA 1JNFA 4MH5A 2UYFA 3A3UA 3RPLB 5DW8A 4G61A 5TP9B 1T0KA 2GH9A 1B3FA 3M3LA 1PC3A 3FVNA 1TT1A 4OEVA 2R6GE 4OFLA 3LC8A 3Q27A 1EZOA 4LATA 5HBCA 4KYEA 4U2RA 1URDA 1L5TA 2UVJA 2Q88A 3TTRA 3PMWA 1MM6A 3IO6A 2ZZXA 4PFTA 1B1HA 2WEFA 3TMGA 2QS3A 5I59A 2NOOA 3OO6A 3M8UA 4MMPA 1SW1A 3S9EA 1NV4A 4R6YA 5ESYA 4OVQA 1NV0A 2QSXA 2CEXA 1BP5A 3CIJA 3ZKKA 3B50A 1VSOA 4GL8A 2V93A 1MXUA 3IJOB 4EQ9A 4PAFA 5F7VA 1Y1ZA 3ECRA 5I2NB 2HFBA 1HSLA 2CZLA 3TZAA 3T0JA 4LUBA 4ESXA 4QXDA 5H8NB 3FBPA 1VR5A 1US5A 4RY1A 3IB2A 3SZPA 3BBRA 1N76A 5L9SA 1B1XA 2XXKA 5H8QA 4U1ZA 1MPCA 4NEDA 5H8HA 2FBPA 3FV1A 4EF2A 1IQ7A 2Z8DA 4TLLB 3IOUA 4ELOA 1FW0A
chains in the Genus database with same CATH topology
1MXZA 3PPQA 3VFJA 3VDFA 3G7WA 3MAMA 4Q8RA 3TEPA 3LSLA 3MZBA 1IXCA 1M5DA 4ND9A 1MS7A 2ALUA 3H6WA 5I58B 2QMXA 1DPEA 5FHNA 3O6IA 4C0RA 1AL3A 2I0CA 5KCJB 1LAGE 2Q8JA 3MUQA 4NF8B 2PMSA 4G68A 1QULA 3ODBA 4L17A 1FTLA 3OSRA 1JW4A 2VP1A 4LZ8A 2OWSA 2G93A 3WAFA 1SW5A 3OENA 4AQ4A 1O7TA 1TXFA 2A5SA 3EPEA 1IXHA 2DWHA 4FE8A 3OO8A 3W9VA 4RPOA 1QUKA 1LFHA 3RUMA 1FQFA 3JYRA 1DPPA 1NNPA 2F97A 1J1NA 2XX7A 3GBBA 1WODA 1BIYA 3K6VA 3OSQA 3RQTA 5AA3A 1FQCA 2OJTA 2X7QA 4DCYA 4I62A 3L6GA 5BUUA 5FTIA 5ITPA 4GD5A 4R9FA 3UIFA 3S9LC 1FQEA 1N0TA 1D4NA 4NF6A 3A3CA 5DVFA 3W15C 3OEMA 2OZZA 4RJZA 2REJA 3IJXB 1FQBA 4ECFA 4WEPA 3CSGA 2ZNSA 3GLBA 3PGFA 2HAVA 4FEBA 1VFEA 4KI0E 3U94A 3UA8A 1ZMGA 3IX1A 3MZ9A 4BDRA 1OQGA 2Q2CA 1VE4A 2XXVA 3BKIB 1SW2A 2XXHA 2ONSA 1II5A 3KSXA 3O29A 4KD5A 4NF5A 4YB5A 5I84A 3I3VA 1P1OA 3O28A 4H65A 1QVSA 4U22A 2PX1A 3KN8A 1XVYA 1B40A 4R6HA 4RPNA 1FTJA 1RYOA 1HSEA 4EF1A 4F1VA 4FATA 4GFRA 4OESA 2HEUA 3KOSA 3O9PA 1ZU0A 4KPTA 3K6UA 1PB8A 3JZJA 1B6HA 1MY2A 1Y9UA 3DLNA 1N3WA 3K4UA 3MP6A 1POTA 1Y3QA 3V8XB 1YAEA 1JETA 1PBQA 1P1UA 4KYDA 3ZSFA 2F78A 1DTGA 2QS2A 2RC8A 3H6TA 2Q89A 4XKPA 4F3BA 3TELA 4NE4A 4DE8A 1EZ9A 2F7BA 1TWYA 3PPNA 3N6TA 5FHOA 3T66A 3V83A 5I57A 2B3FA 2D5WA 3DM0A 3MVYA 5ISUA 3RTFB 3VLVA 3N6UA 1JW5A 4R73A 2UVGA 1IZ1A 1SBPA 1R9QA 1UTHB 4YB7A 4ZDMA 3CI8A 3PD9A 4JSDA 2Y7WA 3MVXA 1Y4TA 1IEJA 3DELB 4OXVA 3Q29A 1R1NA 5H8NA 3QYTA 1H3DA 3R6UA 3EF7A 3QIMA 4F3SA 4O3CA 4HS7A 1XHYA 3TPAA 1OVTA 3T22A 3KOTA 5IKBA 4LZ5A 4Q0CA 3LSFB 3O2AA 1VFDA 4R6KA 4U21A 2ZYMA 3EHTA 3FJGA 3I6VA 3IB1A 3Q26A 4K3FA 4LQ5A 4O3AA 1B3EA 2RINA 3N5LA 3FVKA 4KCCA 4XKQA 4RYAA 4OYVA 3JV9A 3RPWA 1FTOA 1MQDA 4TQUQ 5KZTA 5AA4A 1LFIA 4OVJA 4X1DA 1LCTA 2ONKE 4ZEBA 1M5BA 1OMPA 4GQOA 4IY5A 1PDAA 4OFJA 1A8EA 1LAFE 2O6AA 2PT2A 2XXWA 4MLQA 1B0LA 4YAHX 4ELPA 2ABHA 3KG2A 2XX9A 3KJTA 4G77A 3K2DA 3MC2A 1SW4A 1MM7A 4YZZA 2FNCA 1NL5A 4LZ7A 1GTKA 4LP2B 4WEDA 1MY3A 5TP9A 1XT8A 3MQ9A 1FCKA 4MBPA 4ZEIA 4ONYA 3SEWA 2Z8EA 1B51A 2YJPA 4P0IA 3TODA 3UORA 4XTCQ 5F1QA 4F29A 4X48A 3TQLA 2THIA 2HZKA 5CI5A 1XOCA 1TFAA 2HAUA 4FECA 3CFXA 3ILUB 4JWXA 3N94A 1LFGA 4NF8A 3SEVA 5JEIA 2ZNTA 4OFOA 1NNTA 1URGA 2PYYA 1NNKA 3E3KA 2DP8A 1KWHA 4M4GA 4M1VA 3FATA 1WVJA 3G3JA 4YICA 3TQWA 2PBWA 4QRZA 1M5CA 4IGRA 4YKKA 2VHAA 3CG3A 2UXAA 4EQBA 1US4A 2OCUA 1SYIA 1B05A 3U72A 1POY1 3HHGA 3IB0A 3K6XA 4TLMB 3RLFE 3TKDA 2F36A 4DXCA 4JWOA 2QS4A 2RF1A 1IXIA 1B3LA 4F2QA 3PD8A 1MQGA 5I2KA 2Q2AA 1SI0A 3M3FA 1H45A 4KR5A 2F35A 2H4IA 1N7XA 4NWCA 3VLWA 3KZGA 4F18A 1D9VA 2B65A 5TU0A 4NMYA 2XD3A 4IO7A 4O3BA 1CB6A 4N07A 1S9TA 4RA1A 1UTBA 4AB5A 1PEBA 2VGQA 1MPBA 3PPPA 4QFKA 3FJMA 4YKJA 4XKNA 1YPNA 1MRPA 2DWIA 2DXRA 5KCJA 3FASA 2XXYA 4GLIA 1LCFA 2V3TA 3T93B 1TFDA 2ZYNA 3FUZA 2HCAA 4PP0A 4H67A 3HV1A 1B7UA 4QSDA 5CMMA 3V5AA 3V89B 2XHDA 5FTHA 3IO4A 2ONRA 3OO7A 1XC1A 3FVGA 3MVZA 4GXSB 1MY1A 3H6VA 1QUJA 3DP4A 4ISUA 4QFLA 4WXJA 1MY0A 3G3HA 4U23A 3TTKA 3TUSA 2Y7RA 1H44A 1B4HA 1QKBA 2F34A 4JBZA 1DTZA 3G3KA 1B7HA 3PU5A 3QUJA 3T9VA 2RCBA 5A5XA 1OLAA 3LBSA 2QJEA 4KYSA 5ICTA 4EXLA 5I57B 1N04A 5I56A 2P2AA 1ZKBA 5CMCA 2Z23A 1LSTA 5TPAB 3C9HA 3HCQA 4MFIA 3VE1B 4E0XA 5IAIA 1AOVA 2UVIA 4OEUA 4DCXA 5DEXB 3SERA 3TCGA 4LONB 3C4MA 3KGCA 3PMVA 2P1SA 4RNSA 2XXRA 2XXTA 3CSBA 3FGSA 5J1DA 2B3BA 4R75A 1QUIA 3FVOA 5H8HB 1URSA 1ZBMA 1B2HA 1DMBA 2I3WA 2V84A 3K1PA 3PMXA 4DDDA 1JVYA 1MXWA 1Y3PA 2I6EA 4KQPA 3TDJA 1OVBA 5EHSA 1SQYA 1B5IA 1IITA 1IXGA 1ZJLA 4RK2A 3K6WA 2G29A 4NF4A 5A5XB 5CMBA 3PV0E 3GZGA 4OTEA 4PFWA 3VVEA 3O6GA 3H7MA 3VV5A 5DT6A 4GIZA 2GHAA 3GXAA 4G68B 4MLVA 4THIA 4BDNA 3VXBA 2ZMBA 1JQFA 2DE2A 1D9YA 1ELJA 2VD3A 4U1OA 3U92A 3P7IA 4F31B 1R6ZA 1MXXA 2R9JA 2VD2A 3B6QA 3CFZA 4H8IA 3OEKA 4LQ2A 1B58A 3S9NC 1Q35A 3TTMA 2KLFA 3T9HB 2REGA 2FYIA 3TYHA 2GHBA 5I58A 1QKAA 1JEVA 4QFOA 4U4SA 3H6UA 3SEXA 1UQWA 4TOZA 4H5FA 4Z0IA 2F7CA 5H8FB 3U1OA 1F9BA 1UIUA 3SETA 1YTVA 2YPNA 3M3KA 4GXAA 3TAJA 4ZS9A 5FHMA 1OQHA 3IAZA 1USYH 1PB9A 2O68A 2H25A 2A5TB 4ZE9A 5K2XA 2IEEA 5AA1A 4OETA 1MQJA 2QRYA 4XKRA 2H5YA 4EUOA 5CC2A 2GFEA 3CR9A 3EN3A 3FZVA 5AA2D 2O1MA 2DS9A 3FXUA 5EHMA 1B4ZA 2ESNA 3ZKLA 2I58A 1N3XA 2R71A 1N7WA 3C36A 2ZXTA 3C31A 3K1MA 3FD3A 5DTBA 2H98A 1MY4A 3FV2A 3KN3A 3OMBA 4I9DA 4IB2A 2XXQA 4QSEA 3PPOA 3K0VA 4YU0A 3SESA 3O6HA 4OENA 3VLUA 4BLAA 5AA2A 3MP8A 4F3GA 1SVXB 2DWJA 2DYXA 1MDP1 1B3GA 1LAXA 3CVGA 3FJ7A 2XXXA 3IK6B 3LSWA 1BLFA 1Y4CA 3HHFA 4RK9A 5L8DA 4R9GA 4QFPA 1AMFA 3QK6A 1P1NA 3K1NA 1JVXA 3OO9A 5JTYA 1EZPA 1B7ZA 1M5EA 1Q1KA 3A09A 3PUXE 4IO2A 4NF5B 4HTGA 2O7UA 3MP1A 2IA4A 4OHNA 2YLNA 4PFUA 4P11A 3RN8A 1ATGA 3CRBA 4N6PA 3H06B 1A40A 4IY6A 1M5FA 1I69A 2H9BA 4GWOA 1HSJA 2DE3A 4HCYA 4XIGQ 3RT6B 4F3PA 3F11A 3LSXA 4F1YA 2LAOA 4YMBA 1A99A 3C35A 1Z7ME 4BDLA 4FIMA 1AH5A 4F1UA 5KDTB 3PUZE 2RCAA 2F6PA 4NTLA 3U93A 1FQDA 1MH4A 2NUVA 1YCJA 3OOAA 5I2KB 1GVCA 1MH3A 3T9XB 5CBSA 1B9JA 2ZYKA 5CMKA 1UIVA 1I6AA 1IUDA 3D4CA 4RXLA 2I4BA 4JB7A 5L9MA 1FQAA 2E1SA 2QMWA 3OD7A 4N13A 1FTKA 1B0HA 4IO6A 1NH8A 3S4UA 3QSLA 4PE5B 4R2BA 2ZNUA 4G8NA 3R26A 4POXA 5I2NA 1QJMA 3SKPA 4QFNA 1MPDA 4C1TA 2E0SA 4X9TA 4R2FA 5H8SA 5I56B 4JDFA 3D4GA 4H1XA 4X1BA 1OLCA 3S9MC 2AL5A 4OQOA 4QHQA 1MG1A 3H3GA 3MZ1A 2OK2A 4GF8A 4AB6A 3LUYA 4ZEDA 3QAXA 5KDTA 1S50A 3IOTA 2DVCA 3TTNA 4R72A 4F39A 1Z7NE 3EQ1A 2RKMA 4JWYA 2I48A 4IO4A 4GVOA 3BFTA 1LBBA 3G3FA 4U4XA 4DLDA 5AA4B 3C32A 4PFYA 1MQIA 2O84X 3MPLA 3K00A 3MWBA 4IGTA 5H8QB 4F19A 4G68C 2UYEA 3FXQA 1SD3A 4P0GA 2AYSA 4OERA 1A7LA 4WKMA 4NF6B 5EYFA 5K2YA 2Z8FA 3SDFA 3UN6A 4QF9A 5DVIA 3PUYE 1UTBB 3EHUA 3G3GA 2D21A 3SEYA 3UP9A 2DQVA 1LGBC 4H8JA 2NXOA 2I49A 5H8FA 4ZZAA 5BWJA 5ICQA 1JW1A 2Z22A 1P99A 3HSTA 3ILTB 1P1WA 4IO5A 1B5HA 4YB6A 3MPKA 4I1DA 5ELVA 3OXNA 4H6DA 3K01A 2DE4A 5DYHA 2OBGA 1LB8A 1JEUA 1NH7A 4G8MA 1Y20A 2DOJA 3B6TA 3KFMA 2NWJA 2BJJX 3TCHA 4PQJA 1XVXA 3HN0A 4OMBA 3IOVA 1B32A 3B7DA 3KEIA 3PPRA 2OLBA 4DIGA 1FTMA 3UK4A 3CG1A 3FIRA 2X26A 4ZEKA 2RC9A 2Y7KA 3CFLA 1D3KA 3ONMA 4KFQA 1BKAA 2A5TA 4G8HA 4BDOA 3AXFA 1O63A 2X7PA 1H43A 1PBPA 4R74A 2Y7PA 1LAHE 2P0SA 1JNFA 2D3IA 2QL3A 2W7YA 3C34A 2UYFA 4G4PA 4IO3A 3A3UA 4MH5A 4YKPA 4YMAA 3Q25A 1LB9A 1B52A 3H4ZA 5TP9B 1N84A 5AE4A 1T0KA 2GH9A 1R9LA 1B3FA 2XXIA 3VVFA 3MVWA 3RTWB 1A55A 3M3LA 3RT8A 4ELRA 4QSCA 1PC3A 1P1QA 2QS1A 4HCWA 1NMUA 3FVNA 4LA9A 1TT1A 4OEVA 2R6GE 2M8CA 4I8CA 4OZ9A 4OFLA 3EHSA 5LOMA 3DP6A 1LBCA 4ESWA 3LC8A 3I5OA 3Q27A 1ANFA 1EU8A 2DSFA 1EZOA 2DWAA 1B3HA 2CMOA 2F8DA 4LATA 5HBCA 1QW0A 3IL1B 3KBRA 4FORA 1MXVA 4H0WA 4KYEA 4ZEFA 4U2RA 1URDA 3PUVE 1CE2A 3OELA 4UACA 2FA7A 3GBAA 1L5TA 5CM6A 2UVJA 2Q88A 5M2VA 3PMWA 1MM6A 2PVUA 1ZLQA 4POWA 3TTRA 3VVDA 2V3UA 3QXMA 1S7YA 1SI1A 1SYHA 3LR1A 3IO6A 3VXCA 3IOWA 1I6QA 2F6GA 2HQ0A 4PFTA 4JSOA 2WKYA 1B1HA 1H76A 2RC7A 5TPAA 1BTJA 1DSNA 4KHZE 1RKMA 2DVZA 1DOTA 1GV8A 3IR1A 3TMGA 4EXKA 2F5XA 3HO7A 1OIBA 2QS3A 3SEUA 5I59A 2NOOA 3OO6A 3M8UA 2I0BA 1B46A 1I6BA 4E0WA 3MBPA 3TTLA 1SW1A 3S9EA 3E9XA 4R6YA 3WAEA 4DXUA 3U8QA 1Y1MA 1B5JA 4LVQA 4BDQA 2QSXA 3H03A 3G3IA 2QPQA 1A8FA 4Q5TA 3E4RA 1GGGA 3O66A 5ITOA 3T96B 5DEXA 1BP5A 4KCDA 3THIA 3CIJA 3ZKKA 3UGWA 3R7XA 1VSOA 4GL8A 1USYE 2V93A 3W9WA 4Z7EA 1MXUA 5I59B 3IJOB 1LLSA 3O97A 5CBRA 2Q9TA 3MW0A 4EQ9A 3S2VA 5B7DA 2I4CA 1ZIUA 2I3VA 3IORA 3Q28A 5F7VA 1Y1ZA 3ZS6A 1NFTA 3RY3A 3ECRA 4NWDA 5HM4B 5I2NB 1IIWA 2HFBA 3KSJA 1Y3NA 4GL0A 4YKIA 4C1UA 4DZ1A 5DVJA 1HSLA 2CZLA 3USDA 4BDMA 5CRYA 1AIVA 3TZAA 5HPQA 4PETA 4MF3A 3T9UA 1O64A 3RNNA 3TCFA 2HXWA 1RYXA 2DXYA 2O7IA 2PT1A 1UTHA 2XXUA 3MJNA 4ELQA 4LUBA 4ESXA 5AA2B 1MQHA 2XX8A 5H8NB 2XD2A 4F22A 1VR5A 2OWTA 3FXRA 1EH3A 1US5A 4F2OA 2AL4A 1MXYA 4RY1A 4ZECA 2Y7IA 3IB2A 2XXPA 3KJ7A 1ZTYA 2VOZA 3BBRA 1N76A 4JXIA 2AIXA 2ZYOA 3KN7A 4NF4B 3HPIA 5L9SA 1B1XA 1NNFA 2H99A 1GR2A 2V25A 3BFUA 3L6HA 4GOTA 4Q30B 5H8QA 2O69A 4ZZEA 4EQ7A 4U1ZA 1MPCA 5JK4A 4NEDA 3K02A 3N26A 3QUFA 1NKXA 5H8HA 2Y84A 4FJPA 2HZLA 4XXUA 5B70A 3RGYA 2ANJA 4FEDA 3FV1A 4EDPA 4ZE8A 4EF2A 1IQ7A 2Z8DA 3DP8A 4G2ZA 4TLLB 2NVUB 3PUWE 4DXBA 5JTYB 4FAJA 2V3QA 3B6WA 2O1LA 2F7AA 2UVHA 1PB7A 4H5GA 2O51A 5L9OA 3IOUA 1WDNA 1SDXA 1XS5A 4GRKA 4HW8A 4ELOA 3E13X 2GRVA 4UA8A 1FW0A 3TFLA 1A54A 4OWDA 1MDQA 3C33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXZ A;  3PPQ A;  3VFJ A;  3VDF A;  3G7W A;  3MAM A;  4Q8R A;  3TEP A;  3LSL A;  3MZB A;  1IXC A;  1M5D A;  4ND9 A;  1MS7 A;  2ALU A;  3H6W A;  5I58 B;  2QMX A;  1DPE A;  5FHN A;  3O6I A;  4C0R A;  1AL3 A;  2I0C A;  5KCJ B;  1LAG E;  2Q8J A;  3MUQ A;  4NF8 B;  2PMS A;  4G68 A;  1QUL A;  3ODB A;  4L17 A;  1FTL A;  3OSR A;  1JW4 A;  2VP1 A;  4LZ8 A;  2OWS A;  2G93 A;  3WAF A;  1SW5 A;  3OEN A;  4AQ4 A;  1O7T A;  1TXF A;  2A5S A;  3EPE A;  1IXH A;  2DWH A;  4FE8 A;  3OO8 A;  3W9V A;  4RPO A;  1QUK A;  1LFH A;  3RUM A;  1FQF A;  3JYR A;  1DPP A;  1NNP A;  2F97 A;  1J1N A;  2XX7 A;  3GBB A;  1WOD A;  1BIY A;  3K6V A;  3OSQ A;  3RQT A;  5AA3 A;  1FQC A;  2OJT A;  2X7Q A;  4DCY A;  4I62 A;  3L6G A;  5BUU A;  5FTI A;  5ITP A;  4GD5 A;  4R9F A;  3UIF A;  3S9L C;  1FQE A;  1N0T A;  1D4N A;  4NF6 A;  3A3C A;  5DVF A;  3W15 C;  3OEM A;  2OZZ A;  4RJZ A;  2REJ A;  3IJX B;  1FQB A;  4ECF A;  4WEP A;  3CSG A;  2ZNS A;  3GLB A;  3PGF A;  2HAV A;  4FEB A;  1VFE A;  4KI0 E;  3U94 A;  3UA8 A;  1ZMG A;  3IX1 A;  3MZ9 A;  4BDR A;  1OQG A;  2Q2C A;  1VE4 A;  2XXV A;  3BKI B;  1SW2 A;  2XXH A;  2ONS A;  1II5 A;  3KSX A;  3O29 A;  4KD5 A;  4NF5 A;  4YB5 A;  5I84 A;  3I3V A;  1P1O A;  3O28 A;  4H65 A;  1QVS A;  4U22 A;  2PX1 A;  3KN8 A;  1XVY A;  1B40 A;  4R6H A;  4RPN A;  1FTJ A;  1RYO A;  1HSE A;  4EF1 A;  4F1V A;  4FAT A;  4GFR A;  4OES A;  2HEU A;  3KOS A;  3O9P A;  1ZU0 A;  4KPT A;  3K6U A;  1PB8 A;  3JZJ A;  1B6H A;  1MY2 A;  1Y9U A;  3DLN A;  1N3W A;  3K4U A;  3MP6 A;  1POT A;  1Y3Q A;  3V8X B;  1YAE A;  1JET A;  1PBQ A;  1P1U A;  4KYD A;  3ZSF A;  2F78 A;  1DTG A;  2QS2 A;  2RC8 A;  3H6T A;  2Q89 A;  4XKP A;  4F3B A;  3TEL A;  4NE4 A;  4DE8 A;  1EZ9 A;  2F7B A;  1TWY A;  3PPN A;  3N6T A;  5FHO A;  3T66 A;  3V83 A;  5I57 A;  2B3F A;  2D5W A;  3DM0 A;  3MVY A;  5ISU A;  3RTF B;  3VLV A;  3N6U A;  1JW5 A;  4R73 A;  2UVG A;  1IZ1 A;  1SBP A;  1R9Q A;  1UTH B;  4YB7 A;  4ZDM A;  3CI8 A;  3PD9 A;  4JSD A;  2Y7W A;  3MVX A;  1Y4T A;  1IEJ A;  3DEL B;  4OXV A;  3Q29 A;  1R1N A;  5H8N A;  3QYT A;  1H3D A;  3R6U A;  3EF7 A;  3QIM A;  4F3S A;  4O3C A;  4HS7 A;  1XHY A;  3TPA A;  1OVT A;  3T22 A;  3KOT A;  5IKB A;  4LZ5 A;  4Q0C A;  3LSF B;  3O2A A;  1VFD A;  4R6K A;  4U21 A;  2ZYM A;  3EHT A;  3FJG A;  3I6V A;  3IB1 A;  3Q26 A;  4K3F A;  4LQ5 A;  4O3A A;  1B3E A;  2RIN A;  3N5L A;  3FVK A;  4KCC A;  4XKQ A;  4RYA A;  4OYV A;  3JV9 A;  3RPW A;  1FTO A;  1MQD A;  4TQU Q;  5KZT A;  5AA4 A;  1LFI A;  4OVJ A;  4X1D A;  1LCT A;  2ONK E;  4ZEB A;  1M5B A;  1OMP A;  4GQO A;  4IY5 A;  1PDA A;  4OFJ A;  1A8E A;  1LAF E;  2O6A A;  2PT2 A;  2XXW A;  4MLQ A;  1B0L A;  4YAH X;  4ELP A;  2ABH A;  3KG2 A;  2XX9 A;  3KJT A;  4G77 A;  3K2D A;  3MC2 A;  1SW4 A;  1MM7 A;  4YZZ A;  2FNC A;  1NL5 A;  4LZ7 A;  1GTK A;  4LP2 B;  4WED A;  1MY3 A;  5TP9 A;  1XT8 A;  3MQ9 A;  1FCK A;  4MBP A;  4ZEI A;  4ONY A;  3SEW A;  2Z8E A;  1B51 A;  2YJP A;  4P0I A;  3TOD A;  3UOR A;  4XTC Q;  5F1Q A;  4F29 A;  4X48 A;  3TQL A;  2THI A;  2HZK A;  5CI5 A;  1XOC A;  1TFA A;  2HAU A;  4FEC A;  3CFX A;  3ILU B;  4JWX A;  3N94 A;  1LFG A;  4NF8 A;  3SEV A;  5JEI A;  2ZNT A;  4OFO A;  1NNT A;  1URG A;  2PYY A;  1NNK A;  3E3K A;  2DP8 A;  1KWH A;  4M4G A;  4M1V A;  3FAT A;  1WVJ A;  3G3J A;  4YIC A;  3TQW A;  2PBW A;  4QRZ A;  1M5C A;  4IGR A;  4YKK A;  2VHA A;  3CG3 A;  2UXA A;  4EQB A;  1US4 A;  2OCU A;  1SYI A;  1B05 A;  3U72 A;  1POY 1;  3HHG A;  3IB0 A;  3K6X A;  4TLM B;  3RLF E;  3TKD A;  2F36 A;  4DXC A;  4JWO A;  2QS4 A;  2RF1 A;  1IXI A;  1B3L A;  4F2Q A;  3PD8 A;  1MQG A;  5I2K A;  2Q2A A;  1SI0 A;  3M3F A;  1H45 A;  4KR5 A;  2F35 A;  2H4I A;  1N7X A;  4NWC A;  3VLW A;  3KZG A;  4F18 A;  1D9V A;  2B65 A;  5TU0 A;  4NMY A;  2XD3 A;  4IO7 A;  4O3B A;  1CB6 A;  4N07 A;  1S9T A;  4RA1 A;  1UTB A;  4AB5 A;  1PEB A;  2VGQ A;  1MPB A;  3PPP A;  4QFK A;  3FJM A;  4YKJ A;  4XKN A;  1YPN A;  1MRP A;  2DWI A;  2DXR A;  5KCJ A;  3FAS A;  2XXY A;  4GLI A;  1LCF A;  2V3T A;  3T93 B;  1TFD A;  2ZYN A;  3FUZ A;  2HCA A;  4PP0 A;  4H67 A;  3HV1 A;  1B7U A;  4QSD A;  5CMM A;  3V5A A;  3V89 B;  2XHD A;  5FTH A;  3IO4 A;  2ONR A;  3OO7 A;  1XC1 A;  3FVG A;  3MVZ A;  4GXS B;  1MY1 A;  3H6V A;  1QUJ A;  3DP4 A;  4ISU A;  4QFL A;  4WXJ A;  1MY0 A;  3G3H A;  4U23 A;  3TTK A;  3TUS A;  2Y7R A;  1H44 A;  1B4H A;  1QKB A;  2F34 A;  4JBZ A;  1DTZ A;  3G3K A;  1B7H A;  3PU5 A;  3QUJ A;  3T9V A;  2RCB A;  5A5X A;  1OLA A;  3LBS A;  2QJE A;  4KYS A;  5ICT A;  4EXL A;  5I57 B;  1N04 A;  5I56 A;  2P2A A;  1ZKB A;  5CMC A;  2Z23 A;  1LST A;  5TPA B;  3C9H A;  3HCQ A;  4MFI A;  3VE1 B;  4E0X A;  5IAI A;  1AOV A;  2UVI A;  4OEU A;  4DCX A;  5DEX B;  3SER A;  3TCG A;  4LON B;  3C4M A;  3KGC A;  3PMV A;  2P1S A;  4RNS A;  2XXR A;  2XXT A;  3CSB A;  3FGS A;  5J1D A;  2B3B A;  4R75 A;  1QUI A;  3FVO A;  5H8H B;  1URS A;  1ZBM A;  1B2H A;  1DMB A;  2I3W A;  2V84 A;  3K1P A;  3PMX A;  4DDD A;  1JVY A;  1MXW A;  1Y3P A;  2I6E A;  4KQP A;  3TDJ A;  1OVB A;  5EHS A;  1SQY A;  1B5I A;  1IIT A;  1IXG A;  1ZJL A;  4RK2 A;  3K6W A;  2G29 A;  4NF4 A;  5A5X B;  5CMB A;  3PV0 E;  3GZG A;  4OTE A;  4PFW A;  3VVE A;  3O6G A;  3H7M A;  3VV5 A;  5DT6 A;  4GIZ A;  2GHA A;  3GXA A;  4G68 B;  4MLV A;  4THI A;  4BDN A;  3VXB A;  2ZMB A;  1JQF A;  2DE2 A;  1D9Y A;  1ELJ A;  2VD3 A;  4U1O A;  3U92 A;  3P7I A;  4F31 B;  1R6Z A;  1MXX A;  2R9J A;  2VD2 A;  3B6Q A;  3CFZ A;  4H8I A;  3OEK A;  4LQ2 A;  1B58 A;  3S9N C;  1Q35 A;  3TTM A;  2KLF A;  3T9H B;  2REG A;  2FYI A;  3TYH A;  2GHB A;  5I58 A;  1QKA A;  1JEV A;  4QFO A;  4U4S A;  3H6U A;  3SEX A;  1UQW A;  4TOZ A;  4H5F A;  4Z0I A;  2F7C A;  5H8F B;  3U1O A;  1F9B A;  1UIU A;  3SET A;  1YTV A;  2YPN A;  3M3K A;  4GXA A;  3TAJ A;  4ZS9 A;  5FHM A;  1OQH A;  3IAZ A;  1USY H;  1PB9 A;  2O68 A;  2H25 A;  2A5T B;  4ZE9 A;  5K2X A;  2IEE A;  5AA1 A;  4OET A;  1MQJ A;  2QRY A;  4XKR A;  2H5Y A;  4EUO A;  5CC2 A;  2GFE A;  3CR9 A;  3EN3 A;  3FZV A;  5AA2 D;  2O1M A;  2DS9 A;  3FXU A;  5EHM A;  1B4Z A;  2ESN A;  3ZKL A;  2I58 A;  1N3X A;  2R71 A;  1N7W A;  3C36 A;  2ZXT A;  3C31 A;  3K1M A;  3FD3 A;  5DTB A;  2H98 A;  1MY4 A;  3FV2 A;  3KN3 A;  3OMB A;  4I9D A;  4IB2 A;  2XXQ A;  4QSE A;  3PPO A;  3K0V A;  4YU0 A;  3SES A;  3O6H A;  4OEN A;  3VLU A;  4BLA A;  5AA2 A;  3MP8 A;  4F3G A;  1SVX B;  2DWJ A;  2DYX A;  1MDP 1;  1B3G A;  1LAX A;  3CVG A;  3FJ7 A;  2XXX A;  3IK6 B;  3LSW A;  1BLF A;  1Y4C A;  3HHF A;  4RK9 A;  5L8D A;  4R9G A;  4QFP A;  1AMF A;  3QK6 A;  1P1N A;  3K1N A;  1JVX A;  3OO9 A;  5JTY A;  1EZP A;  1B7Z A;  1M5E A;  1Q1K A;  3A09 A;  3PUX E;  4IO2 A;  4NF5 B;  4HTG A;  2O7U A;  3MP1 A;  2IA4 A;  4OHN A;  2YLN A;  4PFU A;  4P11 A;  3RN8 A;  1ATG A;  3CRB A;  4N6P A;  3H06 B;  1A40 A;  4IY6 A;  1M5F A;  1I69 A;  2H9B A;  4GWO A;  1HSJ A;  2DE3 A;  4HCY A;  4XIG Q;  3RT6 B;  4F3P A;  3F11 A;  3LSX A;  4F1Y A;  2LAO A;  4YMB A;  1A99 A;  3C35 A;  1Z7M E;  4BDL A;  4FIM A;  1AH5 A;  4F1U A;  5KDT B;  3PUZ E;  2RCA A;  2F6P A;  4NTL A;  3U93 A;  1FQD A;  1MH4 A;  2NUV A;  1YCJ A;  3OOA A;  5I2K B;  1GVC A;  1MH3 A;  3T9X B;  5CBS A;  1B9J A;  2ZYK A;  5CMK A;  1UIV A;  1I6A A;  1IUD A;  3D4C A;  4RXL A;  2I4B A;  4JB7 A;  5L9M A;  1FQA A;  2E1S A;  2QMW A;  3OD7 A;  4N13 A;  1FTK A;  1B0H A;  4IO6 A;  1NH8 A;  3S4U A;  3QSL A;  4PE5 B;  4R2B A;  2ZNU A;  4G8N A;  3R26 A;  4POX A;  5I2N A;  1QJM A;  3SKP A;  4QFN A;  1MPD A;  4C1T A;  2E0S A;  4X9T A;  4R2F A;  5H8S A;  5I56 B;  4JDF A;  3D4G A;  4H1X A;  4X1B A;  1OLC A;  3S9M C;  2AL5 A;  4OQO A;  4QHQ A;  1MG1 A;  3H3G A;  3MZ1 A;  2OK2 A;  4GF8 A;  4AB6 A;  3LUY A;  4ZED A;  3QAX A;  5KDT A;  1S50 A;  3IOT A;  2DVC A;  3TTN A;  4R72 A;  4F39 A;  1Z7N E;  3EQ1 A;  2RKM A;  4JWY A;  2I48 A;  4IO4 A;  4GVO A;  3BFT A;  1LBB A;  3G3F A;  4U4X A;  4DLD A;  5AA4 B;  3C32 A;  4PFY A;  1MQI A;  2O84 X;  3MPL A;  3K00 A;  3MWB A;  4IGT A;  5H8Q B;  4F19 A;  4G68 C;  2UYE A;  3FXQ A;  1SD3 A;  4P0G A;  2AYS A;  4OER A;  1A7L A;  4WKM A;  4NF6 B;  5EYF A;  5K2Y A;  2Z8F A;  3SDF A;  3UN6 A;  4QF9 A;  5DVI A;  3PUY E;  1UTB B;  3EHU A;  3G3G A;  2D21 A;  3SEY A;  3UP9 A;  2DQV A;  1LGB C;  4H8J A;  2NXO A;  2I49 A;  5H8F A;  4ZZA A;  5BWJ A;  5ICQ A;  1JW1 A;  2Z22 A;  1P99 A;  3HST A;  3ILT B;  1P1W A;  4IO5 A;  1B5H A;  4YB6 A;  3MPK A;  4I1D A;  5ELV A;  3OXN A;  4H6D A;  3K01 A;  2DE4 A;  5DYH A;  2OBG A;  1LB8 A;  1JEU A;  1NH7 A;  4G8M A;  1Y20 A;  2DOJ A;  3B6T A;  3KFM A;  2NWJ A;  2BJJ X;  3TCH A;  4PQJ A;  1XVX A;  3HN0 A;  4OMB A;  3IOV A;  1B32 A;  3B7D A;  3KEI A;  3PPR A;  2OLB A;  4DIG A;  1FTM A;  3UK4 A;  3CG1 A;  3FIR A;  2X26 A;  4ZEK A;  2RC9 A;  2Y7K A;  3CFL A;  1D3K A;  3ONM A;  4KFQ A;  1BKA A;  2A5T A;  4G8H A;  4BDO A;  3AXF A;  1O63 A;  2X7P A;  1H43 A;  1PBP A;  4R74 A;  2Y7P A;  1LAH E;  2P0S A;  1JNF A;  2D3I A;  2QL3 A;  2W7Y A;  3C34 A;  2UYF A;  4G4P A;  4IO3 A;  3A3U A;  4MH5 A;  4YKP A;  4YMA A;  3Q25 A;  1LB9 A;  1B52 A;  3H4Z A;  5TP9 B;  1N84 A;  5AE4 A;  1T0K A;  2GH9 A;  1R9L A;  1B3F A;  2XXI A;  3VVF A;  3MVW A;  3RTW B;  1A55 A;  3M3L A;  3RT8 A;  4ELR A;  4QSC A;  1PC3 A;  1P1Q A;  2QS1 A;  4HCW A;  1NMU A;  3FVN A;  4LA9 A;  1TT1 A;  4OEV A;  2R6G E;  2M8C A;  4I8C A;  4OZ9 A;  4OFL A;  3EHS A;  5LOM A;  3DP6 A;  1LBC A;  4ESW A;  3LC8 A;  3I5O A;  3Q27 A;  1ANF A;  1EU8 A;  2DSF A;  1EZO A;  2DWA A;  1B3H A;  2CMO A;  2F8D A;  4LAT A;  5HBC A;  1QW0 A;  3IL1 B;  3KBR A;  4FOR A;  1MXV A;  4H0W A;  4KYE A;  4ZEF A;  4U2R A;  1URD A;  3PUV E;  1CE2 A;  3OEL A;  4UAC A;  2FA7 A;  3GBA A;  1L5T A;  5CM6 A;  2UVJ A;  2Q88 A;  5M2V A;  3PMW A;  1MM6 A;  2PVU A;  1ZLQ A;  4POW A;  3TTR A;  3VVD A;  2V3U A;  3QXM A;  1S7Y A;  1SI1 A;  1SYH A;  3LR1 A;  3IO6 A;  3VXC A;  3IOW A;  1I6Q A;  2F6G A;  2HQ0 A;  4PFT A;  4JSO A;  2WKY A;  1B1H A;  1H76 A;  2RC7 A;  5TPA A;  1BTJ A;  1DSN A;  4KHZ E;  1RKM A;  2DVZ A;  1DOT A;  1GV8 A;  3IR1 A;  3TMG A;  4EXK A;  2F5X A;  3HO7 A;  1OIB A;  2QS3 A;  3SEU A;  5I59 A;  2NOO A;  3OO6 A;  3M8U A;  2I0B A;  1B46 A;  1I6B A;  4E0W A;  3MBP A;  3TTL A;  1SW1 A;  3S9E A;  3E9X A;  4R6Y A;  3WAE A;  4DXU A;  3U8Q A;  1Y1M A;  1B5J A;  4LVQ A;  4BDQ A;  2QSX A;  3H03 A;  3G3I A;  2QPQ A;  1A8F A;  4Q5T A;  3E4R A;  1GGG A;  3O66 A;  5ITO A;  3T96 B;  5DEX A;  1BP5 A;  4KCD A;  3THI A;  3CIJ A;  3ZKK A;  3UGW A;  3R7X A;  1VSO A;  4GL8 A;  1USY E;  2V93 A;  3W9W A;  4Z7E A;  1MXU A;  5I59 B;  3IJO B;  1LLS A;  3O97 A;  5CBR A;  2Q9T A;  3MW0 A;  4EQ9 A;  3S2V A;  5B7D A;  2I4C A;  1ZIU A;  2I3V A;  3IOR A;  3Q28 A;  5F7V A;  1Y1Z A;  3ZS6 A;  1NFT A;  3RY3 A;  3ECR A;  4NWD A;  5HM4 B;  5I2N B;  1IIW A;  2HFB A;  3KSJ A;  1Y3N A;  4GL0 A;  4YKI A;  4C1U A;  4DZ1 A;  5DVJ A;  1HSL A;  2CZL A;  3USD A;  4BDM A;  5CRY A;  1AIV A;  3TZA A;  5HPQ A;  4PET A;  4MF3 A;  3T9U A;  1O64 A;  3RNN A;  3TCF A;  2HXW A;  1RYX A;  2DXY A;  2O7I A;  2PT1 A;  1UTH A;  2XXU A;  3MJN A;  4ELQ A;  4LUB A;  4ESX A;  5AA2 B;  1MQH A;  2XX8 A;  5H8N B;  2XD2 A;  4F22 A;  1VR5 A;  2OWT A;  3FXR A;  1EH3 A;  1US5 A;  4F2O A;  2AL4 A;  1MXY A;  4RY1 A;  4ZEC A;  2Y7I A;  3IB2 A;  2XXP A;  3KJ7 A;  1ZTY A;  2VOZ A;  3BBR A;  1N76 A;  4JXI A;  2AIX A;  2ZYO A;  3KN7 A;  4NF4 B;  3HPI A;  5L9S A;  1B1X A;  1NNF A;  2H99 A;  1GR2 A;  2V25 A;  3BFU A;  3L6H A;  4GOT A;  4Q30 B;  5H8Q A;  2O69 A;  4ZZE A;  4EQ7 A;  4U1Z A;  1MPC A;  5JK4 A;  4NED A;  3K02 A;  3N26 A;  3QUF A;  1NKX A;  5H8H A;  2Y84 A;  4FJP A;  2HZL A;  4XXU A;  5B70 A;  3RGY A;  2ANJ A;  4FED A;  3FV1 A;  4EDP A;  4ZE8 A;  4EF2 A;  1IQ7 A;  2Z8D A;  3DP8 A;  4G2Z A;  4TLL B;  2NVU B;  3PUW E;  4DXB A;  5JTY B;  4FAJ A;  2V3Q A;  3B6W A;  2O1L A;  2F7A A;  2UVH A;  1PB7 A;  4H5G A;  2O51 A;  5L9O A;  3IOU A;  1WDN A;  1SDX A;  1XS5 A;  4GRK A;  4HW8 A;  4ELO A;  3E13 X;  2GRV A;  4UA8 A;  1FW0 A;  3TFL A;  1A54 A;  4OWD A;  1MDQ A;  3C33 A; 
#chains in the Genus database with same CATH topology
 3VFJ A;  3G7W A;  2ALU A;  5I58 B;  4C0R A;  1AL3 A;  5KCJ B;  1LAG E;  2Q8J A;  4NF8 B;  1QUL A;  2VP1 A;  4LZ8 A;  2OWS A;  2G93 A;  3OEN A;  1O7T A;  2A5S A;  3EPE A;  2DWH A;  4RPO A;  1QUK A;  3RUM A;  1NNP A;  2F97 A;  1J1N A;  2CZI A;  2XX7 A;  3GBB A;  1BIY A;  3RQT A;  1FQC A;  2OJT A;  3L6G A;  4GD5 A;  1FQE A;  4NF6 A;  3OEM A;  4RJZ A;  3PGF A;  3GLB A;  1ZMG A;  2XXV A;  2ONS A;  3O29 A;  3KSX A;  4PF8 A;  3I3V A;  1XVY A;  3KC1 A;  4H46 A;  4GFR A;  4KPT A;  3JZJ A;  1B6H A;  2QVR A;  1POT A;  3MP6 A;  3ZSF A;  2RC8 A;  1DTG A;  1EZ9 A;  3V83 A;  2D5W A;  3MVY A;  4MEV A;  2UVG A;  4PGP A;  1JP4 A;  3CI8 A;  3PD9 A;  4JSD A;  2Y7W A;  1Y4T A;  3Q29 A;  4N8Y A;  3EF7 A;  3QIM A;  5IKB A;  4O3C A;  4Q0C A;  4XKN A;  3I6V A;  4LQ5 A;  4GWY A;  3SEU A;  5CBS A;  4KCC A;  1FTO A;  1MQD A;  4TQU Q;  5AA4 A;  1LCT A;  2WBB A;  4ZEB A;  4GQO A;  4IY5 A;  1A8E A;  1LAF E;  2PT2 A;  1B0L A;  2ABH A;  3KJT A;  4P47 A;  1BK4 A;  2FNC A;  1NL5 A;  4WED A;  4ZEI A;  3UOR A;  4XTC Q;  5F1Q A;  4X48 A;  1XOC A;  2HAU A;  3CFX A;  3ILU B;  2FIX A;  2PYY A;  1NNK A;  4M4G A;  3CG3 A;  4PTK A;  1US4 A;  1SYI A;  1B05 A;  3HHG A;  3PD8 A;  2Q2A A;  4NWC A;  4F18 A;  1D9V A;  4NMY A;  2XD3 A;  4O3B A;  4N07 A;  1S9T A;  4AB5 A;  1PEB A;  1YPN A;  2DXR A;  1LCF A;  3T93 B;  2HCA A;  2ONR A;  3H6V A;  1QUJ A;  3DP4 A;  3G3H A;  2F34 A;  1B7H A;  3PU5 A;  2RCB A;  2QJE A;  3MYU A;  2P2A A;  1ZKB A;  5CMC A;  4MFI A;  3VE1 B;  4OEU A;  4DCX A;  5DEX B;  3TCG A;  3NOH A;  3C4M A;  2ZZW A;  1QUI A;  2F3B A;  1B5I A;  1IIT A;  5A5X B;  4OTE A;  3VVE A;  1IMA A;  5DT6 A;  2XWK A;  3GXA A;  4MLV A;  3VXB A;  1D9Y A;  1ELJ A;  4U1O A;  3P7I A;  1G0I A;  4AS5 A;  1B58 A;  2KLF A;  2REG A;  2FYI A;  3H6U A;  5H8F B;  4Z0I A;  4ZS9 A;  5FHM A;  1USY H;  2O68 A;  2H25 A;  5K2X A;  3LUZ A;  2ESN A;  2I58 A;  1N7W A;  2ZXT A;  3C31 A;  3FD3 A;  4JVI A;  4OAN A;  4IB2 A;  2XXQ A;  3K0V A;  4OEN A;  4BLA A;  1MDP 1;  1B3G A;  3IK6 B;  5L8D A;  2XXX A;  3OO9 A;  1B7Z A;  3A09 A;  5EQ9 A;  4X04 A;  3CRB A;  4N6P A;  3H06 B;  1A40 A;  4GWO A;  4F3P A;  1HSJ A;  3F11 A;  3LSX A;  1Z7M E;  1AH5 A;  4F1U A;  2RCA A;  2F6P A;  5ET6 A;  1MH3 A;  1FBH A;  1UIV A;  4O8M A;  4N17 A;  4JB7 A;  4RXL A;  2QMW A;  3QSL A;  4R2B A;  2ZNU A;  3R26 A;  4R2F A;  4NGU A;  5I56 B;  2FIE A;  3S9M C;  2AL5 A;  4GF8 A;  3QAX A;  5KDT A;  4NAP A;  2RKM A;  4MCO A;  1LBB A;  4G68 C;  1NUZ A;  4NHB A;  5ET5 A;  1A7L A;  4WKM A;  1UTB B;  2Y5K A;  2DQV A;  1LGB C;  2NXO A;  2I49 A;  4ZZA A;  5ICQ A;  1P1W A;  5ELV A;  2OBG A;  1LB8 A;  4GBW A;  4PAI A;  1XVX A;  3HN0 A;  2OLB A;  5LTC A;  3CG1 A;  2X26 A;  4O94 A;  3CFL A;  1D3K A;  2A5T A;  1O63 A;  2X7P A;  2Y7P A;  3SEW A;  2P0S A;  2D3I A;  4YKP A;  1B52 A;  1N84 A;  1LBW A;  3MVW A;  4MNP A;  3E79 A;  3RT8 A;  4ELR A;  2QS1 A;  4LA9 A;  5IZ1 A;  2M8C A;  4I8C A;  3DP6 A;  4ESW A;  1IMC A;  2F8D A;  4GBV A;  1FPB A;  4PE3 A;  4DI4 B;  3PUV E;  5CM6 A;  3VVD A;  2PVU A;  1ZLQ A;  2V3U A;  3QXM A;  1S7Y A;  1KA1 A;  1YZ0 A;  2OWZ A;  1FJ9 A;  1RKM A;  4UAB A;  3HO7 A;  1OIB A;  4MNI A;  3MBP A;  3WAE A;  4DXU A;  1FBD A;  4BDQ A;  4N91 A;  1YXI A;  1GGG A;  3O66 A;  5ITO A;  3UGW A;  3MW0 A;  3IOR A;  5HM4 B;  1IIW A;  3KSJ A;  1Y3N A;  4YKI A;  4C1U A;  5DVJ A;  1Q9D A;  5HPQ A;  4PET A;  1KZ8 A;  3T9U A;  1O64 A;  2O7I A;  4ELQ A;  2XX8 A;  2XD2 A;  3FXR A;  4F2O A;  2AL4 A;  1MXY A;  4ZEC A;  2Y7I A;  4JXI A;  4NF4 B;  2H99 A;  1GR2 A;  4EQ7 A;  1K9Z A;  4XXU A;  2WX9 A;  4FAJ A;  2NVU B;  3PUW E;  4PBH A;  2V3Q A;  2O1L A;  2UVH A;  1PB7 A;  4H5G A;  5L9O A;  4GRK A;  4HW8 A;  3E13 X;  3TEP A;  3MAM A;  4Q8R A;  3MZB A;  2PFZ A;  1IXC A;  1M5D A;  1MS7 A;  2QVU A;  1DPE A;  2I0C A;  4G68 A;  3OSR A;  3WAF A;  1IXH A;  1FQF A;  3JYR A;  1DPP A;  1WOD A;  5BUU A;  5FTI A;  5ITP A;  4R9F A;  1N0T A;  3A3C A;  5EQ7 A;  2OZZ A;  3IJX B;  4WEP A;  3CSG A;  2ZNS A;  3MZ9 A;  3BKI B;  1SW2 A;  2XXH A;  4NF5 A;  1II5 A;  4YB5 A;  5I84 A;  4U22 A;  1P1O A;  3O28 A;  4H65 A;  2PX1 A;  4EF1 A;  1B40 A;  1HSE A;  4FAT A;  3KOS A;  3O9P A;  1PB8 A;  4N6K A;  4KXP A;  3K4U A;  1N3W A;  3V8X B;  1PBQ A;  1P1U A;  2QS2 A;  4NN3 A;  3PPN A;  5ISU A;  2KQZ A;  3DM0 A;  1JW5 A;  4YB7 A;  4ZDM A;  2Y5L A;  4HE0 A;  4GX4 A;  3MVX A;  4OXV A;  5EQA A;  2BJI A;  1XHY A;  3KOT A;  3LSF B;  1VFD A;  3Q26 A;  3EHT A;  4K3F A;  4O3A A;  4XKQ A;  2RIN A;  3N5L A;  4RYA A;  5KZT A;  2ONK E;  1M5B A;  1OMP A;  1PDA A;  4ELP A;  2O6A A;  1SW4 A;  4LZ7 A;  4GWZ A;  4LP2 B;  1XT8 A;  4MBP A;  3TPA A;  4ONY A;  1B51 A;  4F29 A;  2THI A;  4XEQ A;  4FEC A;  4JWX A;  4M1V A;  1WVJ A;  3KBZ A;  5EQ8 A;  2OCU A;  3U72 A;  2VPO A;  3TKD A;  3K6X A;  3RLF E;  1B3L A;  4HXV A;  4KR5 A;  1N7X A;  3KZG A;  2B65 A;  5TU0 A;  1UTB A;  3FJM A;  5KCJ A;  4GLI A;  3E78 A;  3FUZ A;  4QSD A;  5FTH A;  3IO4 A;  1NUY A;  4ISU A;  3TUS A;  4JBZ A;  1DTZ A;  4IR8 A;  1OLA A;  2MKZ A;  4GX3 A;  5I56 A;  2XWI A;  3C9H A;  3HCQ A;  2Q74 A;  4E0X A;  5IAI A;  2UVI A;  3MST A;  1D9Q A;  1FPJ A;  2P1S A;  5J1D A;  3FGS A;  2B3B A;  3FVO A;  1URS A;  1B2H A;  4DDD A;  1JVY A;  1MXW A;  1IXG A;  1ZJL A;  4NF4 A;  4PFI A;  4P1L A;  4PFW A;  3H7M A;  4LN5 A;  4G68 B;  4THI A;  2ZMB A;  4F31 B;  1R6Z A;  1MXX A;  1DBZ A;  4H8I A;  1Q35 A;  2P3V A;  3T9H B;  5I58 A;  4X8R A;  4QFO A;  1JEV A;  1UQW A;  4H5F A;  3SET A;  1UIU A;  3T1B A;  2YPN A;  3IAZ A;  4ZE9 A;  2IEE A;  1MQJ A;  3EN3 A;  3FZV A;  2DS9 A;  3FXU A;  2R71 A;  3C36 A;  3A29 A;  3K1M A;  5J16 A;  5DTB A;  3KN3 A;  3OMB A;  4QSE A;  1IMF A;  3PPO A;  3U65 A;  2DYX A;  5I7I A;  1LAX A;  4RK9 A;  1P1N A;  1EZP A;  1Q1K A;  5I59 B;  4HTG A;  2O7U A;  4PFU A;  4P11 A;  4IY6 A;  4HCY A;  3RT6 B;  4F1Y A;  4BDL A;  3PUZ E;  2Q8M A;  2NUV A;  1GVC A;  5CMK A;  3D4C A;  2I4B A;  5L9M A;  1NH8 A;  1AWB A;  4POX A;  1QJM A;  3SKP A;  4C1T A;  2E0S A;  4X9T A;  4H1X A;  4NQ8 A;  4QHQ A;  3H3G A;  2OK2 A;  5IGA A;  2DVC A;  1Z7N E;  2I48 A;  5I3S A;  4DLD A;  3IFC A;  2O84 X;  5IZ3 A;  3MPL A;  4P0G A;  4NF6 B;  5K2Y A;  3SDF A;  3UN6 A;  4QF9 A;  3G3G A;  2D21 A;  4H45 A;  2OX3 A;  1FPE A;  1NH7 A;  3KFM A;  2BJJ X;  5IZZ A;  3ISP A;  3PPR A;  3KEI A;  4DIG A;  4GWW A;  2RC9 A;  2Y7K A;  3ONM A;  4KFQ A;  3AXF A;  4R74 A;  1LAH E;  4N6D A;  3SES A;  4IO3 A;  4G4P A;  1LB9 A;  5AE4 A;  3VVF A;  2R8T A;  3RTW B;  4MNC A;  1FBP A;  1LBZ A;  4HCW A;  3EHS A;  1RDY A;  1EU8 A;  1B3H A;  2CMO A;  1QW0 A;  3IL1 B;  3KBR A;  4H0W A;  4ZEF A;  1NV6 A;  4P56 A;  1CE2 A;  1NUW A;  2FA7 A;  4POW A;  3VXC A;  3LR1 A;  1SYH A;  1I6Q A;  4JSO A;  2WKY A;  1H76 A;  2DVZ A;  1DOT A;  4OVS A;  4EXK A;  2F5X A;  4N4U A;  1B46 A;  3TTL A;  4LVQ A;  2QPQ A;  1A8F A;  3E4R A;  3THI A;  1LBX A;  1LLS A;  2Q9T A;  2F3D A;  1ZIU A;  3EKI A;  2I3V A;  3ZS6 A;  1NFT A;  2ZZV A;  3LV0 A;  4GL0 A;  4BDM A;  3RNN A;  3TCF A;  2HXW A;  2DXY A;  2PT1 A;  1IMB A;  3KC0 A;  2OWT A;  1FBE A;  3KJ7 A;  1ZTY A;  2VOZ A;  3KN7 A;  1NNF A;  2O69 A;  4MHF A;  5JK4 A;  1NKX A;  2Y84 A;  4FJP A;  2HZL A;  4XFE A;  2ANJ A;  3DP8 A;  4G2Z A;  5JTY B;  2F7A A;  2O51 A;  1WDN A;  5AA2 B;  1A54 A;  3PPQ A;  3LSL A;  4ND9 A;  2HPG A;  2QMX A;  3MUQ A;  3RYD A;  3ODB A;  4L17 A;  1SW5 A;  4AQ4 A;  4I3Y A;  4PFB A;  3OSQ A;  2X7Q A;  4DCY A;  5FBP A;  3UIF A;  3W15 C;  2B4M A;  1FQB A;  4FEB A;  4KI0 E;  3UA8 A;  4BDR A;  4N81 A;  1VE4 A;  4KD5 A;  1QVS A;  4F1V A;  4RPN A;  1FTJ A;  4OVR A;  4P9K A;  1ZU0 A;  3GYY A;  3K6U A;  1QGX A;  1Y3Q A;  4DI3 D;  1YAE A;  2F78 A;  3H6T A;  4NG7 A;  4PDD A;  4NE4 A;  2F7B A;  1TWY A;  5I57 A;  3RTF B;  1KA0 A;  4R73 A;  1IZ1 A;  1SBP A;  3BIH A;  1R1N A;  5H8N A;  4OA4 A;  5IZ3 B;  2KR0 A;  1H3D A;  4F3S A;  4NX1 A;  4LZ5 A;  4R6K A;  2ZYM A;  2VT5 A;  3RPL A;  1B3E A;  4OYV A;  5ET7 A;  1LFI A;  4GWX A;  4OFJ A;  2XXW A;  4MLQ A;  4YAH X;  2XX9 A;  4G77 A;  3MC2 A;  4YZZ A;  1MM7 A;  1GTK A;  1NV3 A;  3MQ9 A;  2Z8E A;  4P0I A;  3TQL A;  5CI5 A;  4NF8 A;  3N94 A;  3PTY A;  2ZNT A;  1NNT A;  1URG A;  3E3K A;  1KWH A;  3TQW A;  4YIC A;  1M5C A;  4YKK A;  1DK4 A;  1NV7 A;  4TLM B;  2F36 A;  4JWO A;  2RF1 A;  1IXI A;  4F2Q A;  1XI6 A;  1SI0 A;  4O7I A;  4IO7 A;  1CB6 A;  2VGQ A;  4QFK A;  4YKJ A;  1MRP A;  2DWI A;  2XXY A;  2V3T A;  1TFD A;  2ZYN A;  4PP0 A;  3HV1 A;  1B7U A;  3OO7 A;  3FVG A;  3TTK A;  1MY0 A;  4U23 A;  5LDZ A;  2Y7R A;  1B4H A;  1QKB A;  3T9V A;  5ICT A;  4EXL A;  2Z23 A;  1EYI A;  5ET8 A;  5TPA B;  1FBC A;  1AOV A;  4LON B;  1IME A;  3KGC A;  2XXT A;  3CSB A;  1FPG A;  4R75 A;  5H8H B;  1ZBM A;  2I3W A;  1DMB A;  3PMX A;  4KQP A;  2I6E A;  1OVB A;  1SQY A;  4RK2 A;  2G29 A;  4P8B A;  2HHM A;  5CMB A;  3PV0 E;  1FBG A;  4JVC A;  3O6G A;  3VV5 A;  2GHA A;  5F24 A;  4BDN A;  2VD3 A;  2R9J A;  2VD2 A;  3CFZ A;  3OEK A;  4LQ2 A;  3TTM A;  4O7M A;  2GHB A;  1DCU A;  4TOZ A;  1YTV A;  3M3K A;  1FPL A;  1PB9 A;  2A5T B;  4XKR A;  4EUO A;  2H5Y A;  2GFE A;  5AA2 D;  3ZKL A;  2CZH A;  4I9D A;  1MY4 A;  3FV2 A;  3VLU A;  4GOT A;  3CVG A;  3FJ7 A;  1Y4C A;  3HHF A;  4R9G A;  3QK6 A;  1JVX A;  1M5E A;  4IO2 A;  4NF5 B;  3RN8 A;  1M5F A;  1I69 A;  2H9B A;  2DE3 A;  2LAO A;  4NF0 A;  4NTL A;  4I3E A;  1YCJ A;  5I2K B;  3D1R A;  1B9J A;  4HE2 A;  4P3L A;  1IMD A;  1IUD A;  1FQA A;  2E1S A;  3OD7 A;  2HXR A;  4G8N A;  5I2N A;  1FPF A;  3FXB A;  1MPD A;  4GX6 A;  3D4G A;  4X1B A;  1OLC A;  4ZED A;  1MG1 A;  3MZ1 A;  4AB6 A;  4MX6 A;  3IOT A;  3TTN A;  4R72 A;  3EQ1 A;  4JWY A;  4IO4 A;  3BFT A;  5AA4 B;  4PFY A;  1EYJ A;  1LEV A;  3K00 A;  3MWB A;  5H8Q B;  1NV2 A;  4F19 A;  1SD3 A;  4OER A;  5EYF A;  2Z8F A;  5DVI A;  2QVV A;  3EHU A;  3SEY A;  4H8J A;  5BWJ A;  1INP A;  1JW1 A;  4PFR A;  4I1D A;  4H6D A;  3K01 A;  2DE4 A;  1JEU A;  3B6T A;  4GWU A;  4PQJ A;  3IFA A;  1B32 A;  3B7D A;  4OVT A;  4XF5 A;  3UK4 A;  1RDX A;  4BDO A;  1BKA A;  4G8H A;  2V4C A;  2W7Y A;  2QL3 A;  3C34 A;  4YMA A;  3Q25 A;  3H4Z A;  2L5V A;  1R9L A;  2XXI A;  1A55 A;  4QSC A;  1P1Q A;  1NMU A;  4OZ9 A;  5LOM A;  1LBC A;  3I5O A;  1ANF A;  2DSF A;  2DWA A;  4PCD A;  4FOR A;  1MXV A;  3OEL A;  4UAC A;  3GBA A;  5M2V A;  1SI1 A;  3IOW A;  2F6G A;  2HQ0 A;  2RC7 A;  5TPA A;  1BTJ A;  1DSN A;  4KHZ E;  1GV8 A;  3IR1 A;  1NUX A;  2I0B A;  1I6B A;  4E0W A;  3E9X A;  3U8Q A;  1Y1M A;  1B5J A;  3H03 A;  3G3I A;  4Q5T A;  3T96 B;  5DEX A;  4KCD A;  3R7X A;  1USY E;  3W9W A;  4Z7E A;  1FTA A;  3O97 A;  5CBR A;  3S2V A;  5B7D A;  2I4C A;  3Q28 A;  3BIG A;  3RY3 A;  4NWD A;  4MJO A;  4DZ1 A;  3USD A;  5CRY A;  1AIV A;  4MF3 A;  1RYX A;  1UTH A;  2XXU A;  3MJN A;  1MQH A;  4F22 A;  1EH3 A;  2XXP A;  2AIX A;  1LBY A;  2ZYO A;  3HPI A;  3BFU A;  3L6H A;  4Q30 B;  2V25 A;  4ZZE A;  1FPK A;  3K02 A;  3N26 A;  3QUF A;  5B70 A;  3RGY A;  4FED A;  4EDP A;  4ZE8 A;  4DXB A;  3B6W A;  1SDX A;  1XS5 A;  1RDZ A;  3TFL A;  2GRV A;  4UA8 A;  2XHD A;  4OWD A;  1MDQ A;  3C33 A;  1MXZ A;  3VDF A;  5IM2 A;  2DDK A;  4HE1 A;  3H6W A;  1FSA A;  5FHN A;  3O6I A;  1YYZ A;  2PMS A;  1FTL A;  1JW4 A;  1TXF A;  2FHY A;  1LFH A;  4FE8 A;  3OO8 A;  3W9V A;  3K6V A;  5AA3 A;  4I62 A;  3S9L C;  5DVF A;  1D4N A;  2QFL A;  2XA5 A;  2REJ A;  4ECF A;  2HAV A;  3U94 A;  1VFE A;  3IX1 A;  1OQG A;  2Q2C A;  3KN8 A;  4R6H A;  1RYO A;  1FPI A;  4OES A;  2HEU A;  1MY2 A;  1Y9U A;  3DLN A;  4N15 A;  1JET A;  4KYD A;  2Q89 A;  4XKP A;  4F3B A;  3TEL A;  4DE8 A;  3N6T A;  5FHO A;  3T66 A;  2B3F A;  3VLV A;  3N6U A;  4PAK A;  1R9Q A;  1UTH B;  4MAG A;  2P3N A;  4AS4 A;  1IEJ A;  3DEL B;  1FJ6 A;  3QYT A;  3R6U A;  4HS7 A;  1OVT A;  3T22 A;  3O2A A;  4U21 A;  3FJG A;  3IB1 A;  3FVK A;  3RPW A;  3JV9 A;  4GWS A;  4OVJ A;  4X1D A;  4PC9 A;  3KG2 A;  3K2D A;  4PF6 A;  2XWV A;  1MY3 A;  5TP9 A;  1FCK A;  2B4L A;  2YJP A;  3TOD A;  2PCR A;  2HZK A;  4PBQ A;  1TFA A;  3SEV A;  1LFG A;  4I40 A;  5JEI A;  1FBF A;  4OFO A;  2DP8 A;  3FAT A;  3G3J A;  2PBW A;  4QRZ A;  4IGR A;  2VHA A;  2UXA A;  4EQB A;  1POY 1;  3IB0 A;  4DXC A;  2QS4 A;  1MQG A;  2CZK A;  3M3F A;  1H45 A;  2F35 A;  2H4I A;  3VLW A;  4N8G A;  4RA1 A;  3PPP A;  1MPB A;  3FAS A;  2CEY A;  5CMM A;  4H67 A;  3V89 B;  3V5A A;  3QMF A;  1NV1 A;  1XC1 A;  3MVZ A;  4GXS B;  1MY1 A;  4WXJ A;  4QFL A;  1H44 A;  1VDW A;  3G3K A;  3QUJ A;  5I5P A;  5A5X A;  4KYS A;  3LBS A;  5I57 B;  1N04 A;  1LST A;  3B8B A;  1LBV A;  4OVP A;  3SER A;  3PMV A;  4RNS A;  2XXR A;  2V84 A;  3K1P A;  1Y3P A;  3TDJ A;  5EHS A;  3K6W A;  2GQ1 A;  3CHG A;  3GZG A;  2WBD A;  4GIZ A;  4JVD A;  1JQF A;  2DE2 A;  2WYK A;  3U92 A;  5EYG A;  3B6Q A;  4MIJ A;  3S9N C;  1FRP A;  3TYH A;  1QKA A;  3SEX A;  4U4S A;  3U1O A;  2F7C A;  1F9B A;  4GXA A;  3TAJ A;  1OQH A;  5AA1 A;  4OET A;  2QRY A;  5CC2 A;  3CR9 A;  2O1M A;  5EHM A;  1B4Z A;  1N3X A;  2H98 A;  4YU0 A;  5I2K A;  4P1E A;  3O6H A;  5AA2 A;  3MP8 A;  4F3G A;  1SVX B;  2DWJ A;  3LSW A;  1BLF A;  4QFP A;  1AMF A;  3K1N A;  5JTY A;  4PDH A;  3PUX E;  4OHN A;  3MP1 A;  2IA4 A;  2YLN A;  1ATG A;  4QBA A;  4XIG Q;  4PGN A;  4YMB A;  1A99 A;  3C35 A;  3ROJ A;  4FIM A;  5T3J A;  5KDT B;  1NV5 A;  3U93 A;  1FQD A;  1MH4 A;  3OOA A;  3T9X B;  2ZYK A;  2PFY A;  1I6A A;  4N13 A;  1EYK A;  1FTK A;  1B0H A;  4IO6 A;  3S4U A;  4PE5 B;  4QFN A;  5H8S A;  4JDF A;  1CNQ A;  4OQO A;  3LUY A;  4FBP A;  1S50 A;  4F39 A;  4GVO A;  3G3F A;  4U4X A;  3C32 A;  1MQI A;  2JJK A;  2FVZ A;  4IGT A;  2UYE A;  3FXQ A;  1NI9 A;  2AYS A;  2XWO A;  3PUY E;  3UP9 A;  5H8F A;  2WYP A;  2Z22 A;  1P99 A;  3HST A;  3ILT B;  1K9Y A;  4IO5 A;  1B5H A;  4YB6 A;  3MPK A;  3OXN A;  5DYH A;  2VPN A;  4G8M A;  1Y20 A;  2DOJ A;  5EYH A;  2NWJ A;  3TCH A;  4OMB A;  3IOV A;  1FTM A;  1G0H A;  3FIR A;  1FPD A;  4ZEK A;  1SPI A;  5A5L A;  3HFU A;  1H43 A;  1PBP A;  1JNF A;  4MH5 A;  2UYF A;  3A3U A;  3RPL B;  5DW8 A;  4G61 A;  5TP9 B;  1T0K A;  2GH9 A;  1B3F A;  3M3L A;  1PC3 A;  3FVN A;  1TT1 A;  4OEV A;  2R6G E;  4OFL A;  3LC8 A;  3Q27 A;  1EZO A;  4LAT A;  5HBC A;  4KYE A;  4U2R A;  1URD A;  1L5T A;  2UVJ A;  2Q88 A;  3TTR A;  3PMW A;  1MM6 A;  3IO6 A;  2ZZX A;  4PFT A;  1B1H A;  2WEF A;  3TMG A;  2QS3 A;  5I59 A;  2NOO A;  3OO6 A;  3M8U A;  4MMP A;  1SW1 A;  3S9E A;  1NV4 A;  4R6Y A;  5ESY A;  4OVQ A;  1NV0 A;  2QSX A;  2CEX A;  1BP5 A;  3CIJ A;  3ZKK A;  3B50 A;  1VSO A;  4GL8 A;  2V93 A;  1MXU A;  3IJO B;  4EQ9 A;  4PAF A;  5F7V A;  1Y1Z A;  3ECR A;  5I2N B;  2HFB A;  1HSL A;  2CZL A;  3TZA A;  3T0J A;  4LUB A;  4ESX A;  4QXD A;  5H8N B;  3FBP A;  1VR5 A;  1US5 A;  4RY1 A;  3IB2 A;  3SZP A;  3BBR A;  1N76 A;  5L9S A;  1B1X A;  2XXK A;  5H8Q A;  4U1Z A;  1MPC A;  4NED A;  5H8H A;  2FBP A;  3FV1 A;  4EF2 A;  1IQ7 A;  2Z8D A;  4TLL B;  3IOU A;  4ELO A;  1FW0 A; 
#chains in the Genus database with same CATH homology
 1MXZ A;  3PPQ A;  3VFJ A;  3VDF A;  3G7W A;  3MAM A;  4Q8R A;  3TEP A;  3LSL A;  3MZB A;  1IXC A;  1M5D A;  4ND9 A;  1MS7 A;  2ALU A;  3H6W A;  5I58 B;  2QMX A;  1DPE A;  5FHN A;  3O6I A;  4C0R A;  1AL3 A;  2I0C A;  5KCJ B;  1LAG E;  2Q8J A;  3MUQ A;  4NF8 B;  2PMS A;  4G68 A;  1QUL A;  3ODB A;  4L17 A;  1FTL A;  3OSR A;  1JW4 A;  2VP1 A;  4LZ8 A;  2OWS A;  2G93 A;  3WAF A;  1SW5 A;  3OEN A;  4AQ4 A;  1O7T A;  1TXF A;  2A5S A;  3EPE A;  1IXH A;  2DWH A;  4FE8 A;  3OO8 A;  3W9V A;  4RPO A;  1QUK A;  1LFH A;  3RUM A;  1FQF A;  3JYR A;  1DPP A;  1NNP A;  2F97 A;  1J1N A;  2XX7 A;  3GBB A;  1WOD A;  1BIY A;  3K6V A;  3OSQ A;  3RQT A;  5AA3 A;  1FQC A;  2OJT A;  2X7Q A;  4DCY A;  4I62 A;  3L6G A;  5BUU A;  5FTI A;  5ITP A;  4GD5 A;  4R9F A;  3UIF A;  3S9L C;  1FQE A;  1N0T A;  1D4N A;  4NF6 A;  3A3C A;  5DVF A;  3W15 C;  3OEM A;  2OZZ A;  4RJZ A;  2REJ A;  3IJX B;  1FQB A;  4ECF A;  4WEP A;  3CSG A;  2ZNS A;  3GLB A;  3PGF A;  2HAV A;  4FEB A;  1VFE A;  4KI0 E;  3U94 A;  3UA8 A;  1ZMG A;  3IX1 A;  3MZ9 A;  4BDR A;  1OQG A;  2Q2C A;  1VE4 A;  2XXV A;  3BKI B;  1SW2 A;  2XXH A;  2ONS A;  1II5 A;  3KSX A;  3O29 A;  4KD5 A;  4NF5 A;  4YB5 A;  5I84 A;  3I3V A;  1P1O A;  3O28 A;  4H65 A;  1QVS A;  4U22 A;  2PX1 A;  3KN8 A;  1XVY A;  1B40 A;  4R6H A;  4RPN A;  1FTJ A;  1RYO A;  1HSE A;  4EF1 A;  4F1V A;  4FAT A;  4GFR A;  4OES A;  2HEU A;  3KOS A;  3O9P A;  1ZU0 A;  4KPT A;  3K6U A;  1PB8 A;  3JZJ A;  1B6H A;  1MY2 A;  1Y9U A;  3DLN A;  1N3W A;  3K4U A;  3MP6 A;  1POT A;  1Y3Q A;  3V8X B;  1YAE A;  1JET A;  1PBQ A;  1P1U A;  4KYD A;  3ZSF A;  2F78 A;  1DTG A;  2QS2 A;  2RC8 A;  3H6T A;  2Q89 A;  4XKP A;  4F3B A;  3TEL A;  4NE4 A;  4DE8 A;  1EZ9 A;  2F7B A;  1TWY A;  3PPN A;  3N6T A;  5FHO A;  3T66 A;  3V83 A;  5I57 A;  2B3F A;  2D5W A;  3DM0 A;  3MVY A;  5ISU A;  3RTF B;  3VLV A;  3N6U A;  1JW5 A;  4R73 A;  2UVG A;  1IZ1 A;  1SBP A;  1R9Q A;  1UTH B;  4YB7 A;  4ZDM A;  3CI8 A;  3PD9 A;  4JSD A;  2Y7W A;  3MVX A;  1Y4T A;  1IEJ A;  3DEL B;  4OXV A;  3Q29 A;  1R1N A;  5H8N A;  3QYT A;  1H3D A;  3R6U A;  3EF7 A;  3QIM A;  4F3S A;  4O3C A;  4HS7 A;  1XHY A;  3TPA A;  1OVT A;  3T22 A;  3KOT A;  5IKB A;  4LZ5 A;  4Q0C A;  3LSF B;  3O2A A;  1VFD A;  4R6K A;  4U21 A;  2ZYM A;  3EHT A;  3FJG A;  3I6V A;  3IB1 A;  3Q26 A;  4K3F A;  4LQ5 A;  4O3A A;  1B3E A;  2RIN A;  3N5L A;  3FVK A;  4KCC A;  4XKQ A;  4RYA A;  4OYV A;  3JV9 A;  3RPW A;  1FTO A;  1MQD A;  4TQU Q;  5KZT A;  5AA4 A;  1LFI A;  4OVJ A;  4X1D A;  1LCT A;  2ONK E;  4ZEB A;  1M5B A;  1OMP A;  4GQO A;  4IY5 A;  1PDA A;  4OFJ A;  1A8E A;  1LAF E;  2O6A A;  2PT2 A;  2XXW A;  4MLQ A;  1B0L A;  4YAH X;  4ELP A;  2ABH A;  3KG2 A;  2XX9 A;  3KJT A;  4G77 A;  3K2D A;  3MC2 A;  1SW4 A;  1MM7 A;  4YZZ A;  2FNC A;  1NL5 A;  4LZ7 A;  1GTK A;  4LP2 B;  4WED A;  1MY3 A;  5TP9 A;  1XT8 A;  3MQ9 A;  1FCK A;  4MBP A;  4ZEI A;  4ONY A;  3SEW A;  2Z8E A;  1B51 A;  2YJP A;  4P0I A;  3TOD A;  3UOR A;  4XTC Q;  5F1Q A;  4F29 A;  4X48 A;  3TQL A;  2THI A;  2HZK A;  5CI5 A;  1XOC A;  1TFA A;  2HAU A;  4FEC A;  3CFX A;  3ILU B;  4JWX A;  3N94 A;  1LFG A;  4NF8 A;  3SEV A;  5JEI A;  2ZNT A;  4OFO A;  1NNT A;  1URG A;  2PYY A;  1NNK A;  3E3K A;  2DP8 A;  1KWH A;  4M4G A;  4M1V A;  3FAT A;  1WVJ A;  3G3J A;  4YIC A;  3TQW A;  2PBW A;  4QRZ A;  1M5C A;  4IGR A;  4YKK A;  2VHA A;  3CG3 A;  2UXA A;  4EQB A;  1US4 A;  2OCU A;  1SYI A;  1B05 A;  3U72 A;  1POY 1;  3HHG A;  3IB0 A;  3K6X A;  4TLM B;  3RLF E;  3TKD A;  2F36 A;  4DXC A;  4JWO A;  2QS4 A;  2RF1 A;  1IXI A;  1B3L A;  4F2Q A;  3PD8 A;  1MQG A;  5I2K A;  2Q2A A;  1SI0 A;  3M3F A;  1H45 A;  4KR5 A;  2F35 A;  2H4I A;  1N7X A;  4NWC A;  3VLW A;  3KZG A;  4F18 A;  1D9V A;  2B65 A;  5TU0 A;  4NMY A;  2XD3 A;  4IO7 A;  4O3B A;  1CB6 A;  4N07 A;  1S9T A;  4RA1 A;  1UTB A;  4AB5 A;  1PEB A;  2VGQ A;  1MPB A;  3PPP A;  4QFK A;  3FJM A;  4YKJ A;  4XKN A;  1YPN A;  1MRP A;  2DWI A;  2DXR A;  5KCJ A;  3FAS A;  2XXY A;  4GLI A;  1LCF A;  2V3T A;  3T93 B;  1TFD A;  2ZYN A;  3FUZ A;  2HCA A;  4PP0 A;  4H67 A;  3HV1 A;  1B7U A;  4QSD A;  5CMM A;  3V5A A;  3V89 B;  2XHD A;  5FTH A;  3IO4 A;  2ONR A;  3OO7 A;  1XC1 A;  3FVG A;  3MVZ A;  4GXS B;  1MY1 A;  3H6V A;  1QUJ A;  3DP4 A;  4ISU A;  4QFL A;  4WXJ A;  1MY0 A;  3G3H A;  4U23 A;  3TTK A;  3TUS A;  2Y7R A;  1H44 A;  1B4H A;  1QKB A;  2F34 A;  4JBZ A;  1DTZ A;  3G3K A;  1B7H A;  3PU5 A;  3QUJ A;  3T9V A;  2RCB A;  5A5X A;  1OLA A;  3LBS A;  2QJE A;  4KYS A;  5ICT A;  4EXL A;  5I57 B;  1N04 A;  5I56 A;  2P2A A;  1ZKB A;  5CMC A;  2Z23 A;  1LST A;  5TPA B;  3C9H A;  3HCQ A;  4MFI A;  3VE1 B;  4E0X A;  5IAI A;  1AOV A;  2UVI A;  4OEU A;  4DCX A;  5DEX B;  3SER A;  3TCG A;  4LON B;  3C4M A;  3KGC A;  3PMV A;  2P1S A;  4RNS A;  2XXR A;  2XXT A;  3CSB A;  3FGS A;  5J1D A;  2B3B A;  4R75 A;  1QUI A;  3FVO A;  5H8H B;  1URS A;  1ZBM A;  1B2H A;  1DMB A;  2I3W A;  2V84 A;  3K1P A;  3PMX A;  4DDD A;  1JVY A;  1MXW A;  1Y3P A;  2I6E A;  4KQP A;  3TDJ A;  1OVB A;  5EHS A;  1SQY A;  1B5I A;  1IIT A;  1IXG A;  1ZJL A;  4RK2 A;  3K6W A;  2G29 A;  4NF4 A;  5A5X B;  5CMB A;  3PV0 E;  3GZG A;  4OTE A;  4PFW A;  3VVE A;  3O6G A;  3H7M A;  3VV5 A;  5DT6 A;  4GIZ A;  2GHA A;  3GXA A;  4G68 B;  4MLV A;  4THI A;  4BDN A;  3VXB A;  2ZMB A;  1JQF A;  2DE2 A;  1D9Y A;  1ELJ A;  2VD3 A;  4U1O A;  3U92 A;  3P7I A;  4F31 B;  1R6Z A;  1MXX A;  2R9J A;  2VD2 A;  3B6Q A;  3CFZ A;  4H8I A;  3OEK A;  4LQ2 A;  1B58 A;  3S9N C;  1Q35 A;  3TTM A;  2KLF A;  3T9H B;  2REG A;  2FYI A;  3TYH A;  2GHB A;  5I58 A;  1QKA A;  1JEV A;  4QFO A;  4U4S A;  3H6U A;  3SEX A;  1UQW A;  4TOZ A;  4H5F A;  4Z0I A;  2F7C A;  5H8F B;  3U1O A;  1F9B A;  1UIU A;  3SET A;  1YTV A;  2YPN A;  3M3K A;  4GXA A;  3TAJ A;  4ZS9 A;  5FHM A;  1OQH A;  3IAZ A;  1USY H;  1PB9 A;  2O68 A;  2H25 A;  2A5T B;  4ZE9 A;  5K2X A;  2IEE A;  5AA1 A;  4OET A;  1MQJ A;  2QRY A;  4XKR A;  2H5Y A;  4EUO A;  5CC2 A;  2GFE A;  3CR9 A;  3EN3 A;  3FZV A;  5AA2 D;  2O1M A;  2DS9 A;  3FXU A;  5EHM A;  1B4Z A;  2ESN A;  3ZKL A;  2I58 A;  1N3X A;  2R71 A;  1N7W A;  3C36 A;  2ZXT A;  3C31 A;  3K1M A;  3FD3 A;  5DTB A;  2H98 A;  1MY4 A;  3FV2 A;  3KN3 A;  3OMB A;  4I9D A;  4IB2 A;  2XXQ A;  4QSE A;  3PPO A;  3K0V A;  4YU0 A;  3SES A;  3O6H A;  4OEN A;  3VLU A;  4BLA A;  5AA2 A;  3MP8 A;  4F3G A;  1SVX B;  2DWJ A;  2DYX A;  1MDP 1;  1B3G A;  1LAX A;  3CVG A;  3FJ7 A;  2XXX A;  3IK6 B;  3LSW A;  1BLF A;  1Y4C A;  3HHF A;  4RK9 A;  5L8D A;  4R9G A;  4QFP A;  1AMF A;  3QK6 A;  1P1N A;  3K1N A;  1JVX A;  3OO9 A;  5JTY A;  1EZP A;  1B7Z A;  1M5E A;  1Q1K A;  3A09 A;  3PUX E;  4IO2 A;  4NF5 B;  4HTG A;  2O7U A;  3MP1 A;  2IA4 A;  4OHN A;  2YLN A;  4PFU A;  4P11 A;  3RN8 A;  1ATG A;  3CRB A;  4N6P A;  3H06 B;  1A40 A;  4IY6 A;  1M5F A;  1I69 A;  2H9B A;  4GWO A;  1HSJ A;  2DE3 A;  4HCY A;  4XIG Q;  3RT6 B;  4F3P A;  3F11 A;  3LSX A;  4F1Y A;  2LAO A;  4YMB A;  1A99 A;  3C35 A;  1Z7M E;  4BDL A;  4FIM A;  1AH5 A;  4F1U A;  5KDT B;  3PUZ E;  2RCA A;  2F6P A;  4NTL A;  3U93 A;  1FQD A;  1MH4 A;  2NUV A;  1YCJ A;  3OOA A;  5I2K B;  1GVC A;  1MH3 A;  3T9X B;  5CBS A;  1B9J A;  2ZYK A;  5CMK A;  1UIV A;  1I6A A;  1IUD A;  3D4C A;  4RXL A;  2I4B A;  4JB7 A;  5L9M A;  1FQA A;  2E1S A;  2QMW A;  3OD7 A;  4N13 A;  1FTK A;  1B0H A;  4IO6 A;  1NH8 A;  3S4U A;  3QSL A;  4PE5 B;  4R2B A;  2ZNU A;  4G8N A;  3R26 A;  4POX A;  5I2N A;  1QJM A;  3SKP A;  4QFN A;  1MPD A;  4C1T A;  2E0S A;  4X9T A;  4R2F A;  5H8S A;  5I56 B;  4JDF A;  3D4G A;  4H1X A;  4X1B A;  1OLC A;  3S9M C;  2AL5 A;  4OQO A;  4QHQ A;  1MG1 A;  3H3G A;  3MZ1 A;  2OK2 A;  4GF8 A;  4AB6 A;  3LUY A;  4ZED A;  3QAX A;  5KDT A;  1S50 A;  3IOT A;  2DVC A;  3TTN A;  4R72 A;  4F39 A;  1Z7N E;  3EQ1 A;  2RKM A;  4JWY A;  2I48 A;  4IO4 A;  4GVO A;  3BFT A;  1LBB A;  3G3F A;  4U4X A;  4DLD A;  5AA4 B;  3C32 A;  4PFY A;  1MQI A;  2O84 X;  3MPL A;  3K00 A;  3MWB A;  4IGT A;  5H8Q B;  4F19 A;  4G68 C;  2UYE A;  3FXQ A;  1SD3 A;  4P0G A;  2AYS A;  4OER A;  1A7L A;  4WKM A;  4NF6 B;  5EYF A;  5K2Y A;  2Z8F A;  3SDF A;  3UN6 A;  4QF9 A;  5DVI A;  3PUY E;  1UTB B;  3EHU A;  3G3G A;  2D21 A;  3SEY A;  3UP9 A;  2DQV A;  1LGB C;  4H8J A;  2NXO A;  2I49 A;  5H8F A;  4ZZA A;  5BWJ A;  5ICQ A;  1JW1 A;  2Z22 A;  1P99 A;  3HST A;  3ILT B;  1P1W A;  4IO5 A;  1B5H A;  4YB6 A;  3MPK A;  4I1D A;  5ELV A;  3OXN A;  4H6D A;  3K01 A;  2DE4 A;  5DYH A;  2OBG A;  1LB8 A;  1JEU A;  1NH7 A;  4G8M A;  1Y20 A;  2DOJ A;  3B6T A;  3KFM A;  2NWJ A;  2BJJ X;  3TCH A;  4PQJ A;  1XVX A;  3HN0 A;  4OMB A;  3IOV A;  1B32 A;  3B7D A;  3KEI A;  3PPR A;  2OLB A;  4DIG A;  1FTM A;  3UK4 A;  3CG1 A;  3FIR A;  2X26 A;  4ZEK A;  2RC9 A;  2Y7K A;  3CFL A;  1D3K A;  3ONM A;  4KFQ A;  1BKA A;  2A5T A;  4G8H A;  4BDO A;  3AXF A;  1O63 A;  2X7P A;  1H43 A;  1PBP A;  4R74 A;  2Y7P A;  1LAH E;  2P0S A;  1JNF A;  2D3I A;  2QL3 A;  2W7Y A;  3C34 A;  2UYF A;  4G4P A;  4IO3 A;  3A3U A;  4MH5 A;  4YKP A;  4YMA A;  3Q25 A;  1LB9 A;  1B52 A;  3H4Z A;  5TP9 B;  1N84 A;  5AE4 A;  1T0K A;  2GH9 A;  1R9L A;  1B3F A;  2XXI A;  3VVF A;  3MVW A;  3RTW B;  1A55 A;  3M3L A;  3RT8 A;  4ELR A;  4QSC A;  1PC3 A;  1P1Q A;  2QS1 A;  4HCW A;  1NMU A;  3FVN A;  4LA9 A;  1TT1 A;  4OEV A;  2R6G E;  2M8C A;  4I8C A;  4OZ9 A;  4OFL A;  3EHS A;  5LOM A;  3DP6 A;  1LBC A;  4ESW A;  3LC8 A;  3I5O A;  3Q27 A;  1ANF A;  1EU8 A;  2DSF A;  1EZO A;  2DWA A;  1B3H A;  2CMO A;  2F8D A;  4LAT A;  5HBC A;  1QW0 A;  3IL1 B;  3KBR A;  4FOR A;  1MXV A;  4H0W A;  4KYE A;  4ZEF A;  4U2R A;  1URD A;  3PUV E;  1CE2 A;  3OEL A;  4UAC A;  2FA7 A;  3GBA A;  1L5T A;  5CM6 A;  2UVJ A;  2Q88 A;  5M2V A;  3PMW A;  1MM6 A;  2PVU A;  1ZLQ A;  4POW A;  3TTR A;  3VVD A;  2V3U A;  3QXM A;  1S7Y A;  1SI1 A;  1SYH A;  3LR1 A;  3IO6 A;  3VXC A;  3IOW A;  1I6Q A;  2F6G A;  2HQ0 A;  4PFT A;  4JSO A;  2WKY A;  1B1H A;  1H76 A;  2RC7 A;  5TPA A;  1BTJ A;  1DSN A;  4KHZ E;  1RKM A;  2DVZ A;  1DOT A;  1GV8 A;  3IR1 A;  3TMG A;  4EXK A;  2F5X A;  3HO7 A;  1OIB A;  2QS3 A;  3SEU A;  5I59 A;  2NOO A;  3OO6 A;  3M8U A;  2I0B A;  1B46 A;  1I6B A;  4E0W A;  3MBP A;  3TTL A;  1SW1 A;  3S9E A;  3E9X A;  4R6Y A;  3WAE A;  4DXU A;  3U8Q A;  1Y1M A;  1B5J A;  4LVQ A;  4BDQ A;  2QSX A;  3H03 A;  3G3I A;  2QPQ A;  1A8F A;  4Q5T A;  3E4R A;  1GGG A;  3O66 A;  5ITO A;  3T96 B;  5DEX A;  1BP5 A;  4KCD A;  3THI A;  3CIJ A;  3ZKK A;  3UGW A;  3R7X A;  1VSO A;  4GL8 A;  1USY E;  2V93 A;  3W9W A;  4Z7E A;  1MXU A;  5I59 B;  3IJO B;  1LLS A;  3O97 A;  5CBR A;  2Q9T A;  3MW0 A;  4EQ9 A;  3S2V A;  5B7D A;  2I4C A;  1ZIU A;  2I3V A;  3IOR A;  3Q28 A;  5F7V A;  1Y1Z A;  3ZS6 A;  1NFT A;  3RY3 A;  3ECR A;  4NWD A;  5HM4 B;  5I2N B;  1IIW A;  2HFB A;  3KSJ A;  1Y3N A;  4GL0 A;  4YKI A;  4C1U A;  4DZ1 A;  5DVJ A;  1HSL A;  2CZL A;  3USD A;  4BDM A;  5CRY A;  1AIV A;  3TZA A;  5HPQ A;  4PET A;  4MF3 A;  3T9U A;  1O64 A;  3RNN A;  3TCF A;  2HXW A;  1RYX A;  2DXY A;  2O7I A;  2PT1 A;  1UTH A;  2XXU A;  3MJN A;  4ELQ A;  4LUB A;  4ESX A;  5AA2 B;  1MQH A;  2XX8 A;  5H8N B;  2XD2 A;  4F22 A;  1VR5 A;  2OWT A;  3FXR A;  1EH3 A;  1US5 A;  4F2O A;  2AL4 A;  1MXY A;  4RY1 A;  4ZEC A;  2Y7I A;  3IB2 A;  2XXP A;  3KJ7 A;  1ZTY A;  2VOZ A;  3BBR A;  1N76 A;  4JXI A;  2AIX A;  2ZYO A;  3KN7 A;  4NF4 B;  3HPI A;  5L9S A;  1B1X A;  1NNF A;  2H99 A;  1GR2 A;  2V25 A;  3BFU A;  3L6H A;  4GOT A;  4Q30 B;  5H8Q A;  2O69 A;  4ZZE A;  4EQ7 A;  4U1Z A;  1MPC A;  5JK4 A;  4NED A;  3K02 A;  3N26 A;  3QUF A;  1NKX A;  5H8H A;  2Y84 A;  4FJP A;  2HZL A;  4XXU A;  5B70 A;  3RGY A;  2ANJ A;  4FED A;  3FV1 A;  4EDP A;  4ZE8 A;  4EF2 A;  1IQ7 A;  2Z8D A;  3DP8 A;  4G2Z A;  4TLL B;  2NVU B;  3PUW E;  4DXB A;  5JTY B;  4FAJ A;  2V3Q A;  3B6W A;  2O1L A;  2F7A A;  2UVH A;  1PB7 A;  4H5G A;  2O51 A;  5L9O A;  3IOU A;  1WDN A;  1SDX A;  1XS5 A;  4GRK A;  4HW8 A;  4ELO A;  3E13 X;  2GRV A;  4UA8 A;  1FW0 A;  3TFL A;  1A54 A;  4OWD A;  1MDQ A;  3C33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...