3K4UA

Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
233
structure length
233
Chain Sequence
LRGELRVGLEPGYLPFEMKDKKGNVIGFDVDLAREMAKAMGVKLKLVPTSWDGLIPGLVTEKFDIIISGMTISQERNLRVNFVEPYIVVGQSLLVKKGLEKGVKSYKDLDKPELTLVTKFGVSAEYAAKRLFKNAKLKTYDTEAEAVQEVLNGKADMFIFDLPFNVAFMAQKGQGYLVHLDTSLTYEPLGWAIKKGDPDFLNWLNHFLAQIKHDGSYDELYERWFVDTKWLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords BINDING COMPONENT OF ABC TRANSPORTER
publication title CRYSTAL STRUCTURE OF putative binding component of ABC transporter from Wolinella succinogenes DSM 1740 complexed with lysine
rcsb
source organism Wolinella succinogenes
total genus 65
structure length 233
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k4uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k4uA02
1WODA 1NH8A 5AA2A 2AL4A 2DYXA 3RT8A 3S9MC 3PMVA 5JK4A 3ILTB 3VLVA 3S9EA 2D5WA 4RPNA 4G2ZA 1EZOA 3QYTA 3O6IA 4HCYA 1MPCA 4Z0IA 1SI1A 3U92A 1FTJA 5DEXA 1OVBA 1PB8A 1US5A 3KJ7A 3N5LA 1USYH 2H25A 1JEVA 3V89B 4ECFA 1SDXA 5H8NB 1NNKA 4Z7EA 1DPEA 3TQWA 4MF3A 4TQUQ 3JZJA 3K01A 3USDA 1POY1 1PB9A 2F7AA 4NE4A 4WKMA 4PFTA 1LBBA 1LB9A 4Q0CA 5AA3A 1FQFA 4NF5A 2F7BA 2Z8FA 4G68A 3CSBA 2XXXA 2Z23A 5F7VA 2DOJA 4NF8B 4R9FA 1GR2A 1FQDA 2GH9A 3VLUA 5J1DA 3K00A 1PBPA 3M3KA 2V84A 2Y7IA 3G3GA 4TLMB 3FZVA 2V25A 2XXRA 5CC2A 2DP8A 3K4UA 1KWHA 1SW2A 2V3QA 2XHDA 3IJOB 4DCYA 1UIVA 3UGWA 4JB7A 4PFYA 2KLFA 3TCGA 4BDRA 4PP0A 2LAOA 4G68C 5K2YA 4RK2A 1O7TA 2I3WA 5A5XB 4E0XA 2QMWA 4RNSA 2HEUA 4FECA 3O29A 3RTFB 1N0TA 4JDFA 4PFWA 4UACA 4G8NA 1LAGE 1P1NA 1A54A 1ATGA 3MUQA 1A55A 3D4GA 5CRYA 4P11A 4RA1A 4ZDMA 5I57B 1FTKA 3RT6B 1NNTA 2ZNSA 1LFGA 1RKMA 4I9DA 2HQ0A 1B3EA 5KCJB 1QKBA 1B4HA 3C35A 1FW0A 3C9HA 4LZ8A 3H6UA 4EF1A 4ELQA 3W9WA 2VHAA 3H6WA 2DSFA 3RTWB 3UORA 2VP1A 3A09A 2Q8JA 1MH3A 5TPAB 1YAEA 3W9VA 1AH5A 3K1MA 3TCFA 1CE2A 4U23A 2RC8A 4IY6A 3FATA 3B7DA 1OVTA 3VXBA 3SEWA 1B2HA 2X26A 1QULA 2ONKE 4JWOA 2H5YA 4DLDA 2BJJX 3GZGA 3PUXE 2ABHA 4EF2A 4R2BA 4P0IA 5CI5A 1M5EA 3IAZA 1Z7NE 3G3JA 2Z8DA 3PUWE 1L5TA 1I6AA 2OCUA 2NVUB 3KSJA 4U21A 2AIXA 4WEPA 1N04A 3TMGA 4LZ7A 1N3XA 1RYOA 1P1UA 4JWYA 4F2OA 4YB7A 1NL5A 1ELJA 3K6XA 1DSNA 3TZAA 2AL5A 2I3VA 3SERA 3RUMA 1XT8A 1MDQA 3OEMA 3FVGA 1O64A 1AIVA 5ITOA 2I4BA 1ZIUA 5AA2D 2UYFA 5I58A 2V93A 1XS5A 3I5OA 2H99A 3ODBA 1I6QA 3T66A 3EN3A 1MG1A 4R6KA 2YJPA 4U1ZA 3K1PA 1R6ZA 4F3BA 4RK9A 1P1QA 2QL3A 3RNNA 3C36A 3MC2A 3FASA 1SBPA 1SYHA 4X48A 2ZNTA 4EXLA 5DVIA 3O28A 4YU0A 4EXKA 2DVCA 4FJPA 4WEDA 4NTLA 1B7UA 4OXVA 4BDMA 4GOTA 3HCQA 4GD5A 1FQEA 2Y7PA 4MFIA 3SEYA 3U8QA 3O2AA 5IKBA 5CMCA 2OBGA 3DLNA 1MXYA 1QVSA 2UVGA 1N76A 2X7PA 3K6WA 1Y4CA 3EHSA 3SKPA 3DELB 3O6HA 2XD2A 1B58A 5ELVA 3LR1A 2OK2A 4XTCQ 1DTZA 2QRYA 3KZGA 2DVZA 3IOWA 2O6AA 3O6GA 1P1OA 4MBPA 4POXA 4OEVA 3OOAA 3HO7A 1FTLA 1AMFA 1DPPA 3FIRA 3EHTA 5H8FA 1B32A 1LAXA 2Z8EA 3IB2A 4YMAA 2RC7A 4ZEBA 2I0CA 3D4CA 3C4MA 4OERA 3V5AA 3VE1B 2UYEA 3S2VA 3H7MA 2ZXTA 5H8QB 3LUYA 4H0WA 4QF9A 1LAHE 1UQWA 4GRKA 4ND9A 2F6PA 3B6WA 1MY4A 1TXFA 1PBQA 4YMBA 4KFQA 1XVYA 2QS1A 4QSEA 3L6GA 1OLCA 3G3HA 4F2QA 3S9NC 3DP6A 3M8UA 1IEJA 1LGBC 3JYRA 3CSGA 3FXQA 4XKRA 1B0HA 4KI0E 1Y9UA 3QK6A 1B3GA 3HV1A 4JSDA 1TFAA 5I2NB 3B6TA 2FA7A 2F36A 3Q29A 3PPQA 1BTJA 3RY3A 1H76A 5AA4B 3CFZA 3RGYA 2THIA 4OTEA 3VFJA 5BUUA 5DVJA 1QUKA 3CG1A 4F3GA 1A8EA 1SI0A 4OFLA 4R72A 2V3UA 4DDDA 2X7QA 2E0SA 5B70A 4ZS9A 3IR1A 4LP2B 1MY3A 1S9TA 3EF7A 3MP1A 4GLIA 4IY5A 1WDNA 5H8NA 2GRVA 1GV8A 4GVOA 5L9SA 1MQHA 3JV9A 3TTNA 4ZEKA 3OEKA 3SEVA 1MM6A 5ITPA 5KDTB 1TFDA 1IIWA 4GL0A 4H65A 5CBSA 2H98A 4AQ4A 3IL1B 1IXGA 1GVCA 2Y7RA 4IGRA 3PD9A 2XD3A 3S9LC 4NF8A 1B1HA 3Q27A 3FVNA 4Q8RA 5L8DA 3KGCA 3I3VA 2G29A 2ZYKA 3VLWA 5KZTA 3CI8A 1LCFA 1XVXA 1NH7A 1JQFA 2Z22A 4LQ2A 4UA8A 1FTOA 4GIZA 3GLBA 4RPOA 3KJTA 3LSFB 3PPPA 3LBSA 3KN3A 3MPKA 4GXAA 4NWCA 1NNPA 4X9TA 1UTBB 4DIGA 3EPEA 4YKPA 1QUJA 2D3IA 1QUIA 3HN0A 2O68A 4RY1A 5A5XA 1CB6A 4RYAA 2VD3A 3KEIA 1ZBMA 3MVXA 2DXYA 1FQCA 1Y1ZA 2XXPA 3FJGA 5HBCA 1B6HA 4PE5B 4L17A 5ICTA 3OO6A 2PX1A 4U4SA 4IO4A 1B3LA 2XXQA 3VVDA 2NOOA 5HPQA 3ZKLA 2Q9TA 1Y3PA 5I57A 4F29A 1JETA 2G93A 1Y1MA 2RC9A 3TUSA 4BLAA 1B3FA 5KCJA 3TKDA 2YPNA 2Y7KA 4YKIA 1ZTYA 4GL8A 1NNFA 4ZZAA 4ZE8A 4QFOA 5TPAA 1TT1A 1B4ZA 2CZLA 2VGQA 4ZECA 4MH5A 2DXRA 3U72A 4O3BA 3MWBA 1VSOA 3IOTA 3KBRA 3MZ9A 4OVJA 1NKXA 1N7WA 1PB7A 4XKPA 3Q26A 4R73A 3V83A 1ZJLA 4XXUA 2QS4A 1MY2A 1D4NA 3GBAA 1F9BA 3K02A 4KYDA 3KG2A 1LCTA 4LONB 1OQHA 1OQGA 2XX9A 1UIUA 2I4CA 5JTYB 1T0KA 4FATA 3MBPA 1MY1A 3LSWA 3K1NA 1HSLA 2IEEA 3U93A 1FQBA 5I59B 4DXUA 1MM7A 4NEDA 2ZNUA 3FVKA 5I56B 3TTMA 2XXHA 3FVOA 4JXIA 3QUFA 2FNCA 4H6DA 4ZEDA 3IOVA 1LFIA 3Q25A 3LSXA 2I49A 2A5SA 3IORA 3TPAA 2QPQA 4FAJA 1MXVA 3KSXA 3R26A 1GTKA 3SEUA 2NUVA 3KFMA 2O1MA 3PUZE 1H3DA 3C31A 3MZBA 1PDAA 2OZZA 1MQJA 3T9HB 4F22A 2P1SA 5ISUA 3FUZA 3QXMA 3PMWA 3HPIA 2PMSA 3TCHA 2ONRA 3OXNA 3TTKA 4KD5A 3DP4A 5CMKA 3PU5A 2XXYA 4EDPA 2W7YA 1B7HA 4IO5A 2F97A 3UK4A 3G7WA 4NF4B 1MXUA 3UIFA 4ESXA 1VR5A 3RN8A 3FXUA 3ILUB 4KHZE 3A3UA 2Q89A 2F35A 5CMMA 1VE4A 1B46A 3GBBA 2HZLA 1A99A 3U94A 3CIJA 2XXTA 1N7XA 4AB6A 5FTHA 2F8DA 3K0VA 4HTGA 1SYIA 2FYIA 4HCWA 2YLNA 1FTMA 3FV2A 3H4ZA 3TAJA 3K6VA 5H8QA 2DWAA 4P0GA 2R71A 5LOMA 3PD8A 2F6GA 4U2RA 4DXCA 3QSLA 3R6UA 3B6QA 1JW4A 5CBRA 1M5BA 4POWA 1ZMGA 1A40A 3UP9A 5DTBA 3S4UA 1N84A 3LSLA 1UTHB 4F3PA 1IXHA 4F18A 5AA1A 4RJZA 3KN8A 5I2NA 5H8HB 1B5HA 1ZLQA 4JBZA 3H03A 1MY0A 2HXWA 3O66A 4QHQA 3TODA 3TTRA 1MH4A 4LUBA 1YPNA 5AA4A 5JEIA 2O7UA 4YKJA 3IB1A 3F11A 1SVXB 2A5TB 3OSQA 3T9UA 3VVFA 2DE3A 5B7DA 2V3TA 3C34A 3O97A 4GFRA 3T96B 2XX7A 2Q2CA 4MLVA 3AXFA 4R75A 4I62A 2RKMA 4C1TA 3T9XB 1HSJA 2O51A 4R6HA 4HS7A 3P7IA 4F31B 3G3KA 3U1OA 4NWDA 1SW5A 3CRBA 4OWDA 1O63A 1B5JA 1ZU0A 3MW0A 4YKKA 4F3SA 5FHOA 4JSOA 3PMXA 2F5XA 2Q88A 4FEDA 4U4XA 3N94A 4G8MA 4H1XA 5KDTA 1BP5A 3ZSFA 3M3FA 4QRZA 5EHMA 1Y20A 1LB8A 1NMUA 4NF6B 2ZYNA 1A7LA 3G3FA 1R9LA 3HSTA 4LA9A 2PYYA 3RPWA 2UVHA 3THIA 1YTVA 4XKQA 1US4A 5I2KB 3KN7A 3FV1A 3R7XA 1R9QA 5L9OA 3IX1A 1I6BA 1EZ9A 1MPBA 2I48A 3E9XA 4R9GA 2Y84A 4QSCA 1JVXA 3QUJA 2RCAA 4QFKA 1OIBA 3TFLA 4ZEFA 2NXOA 1NFTA 3N26A 4JWXA 2XXWA 2HAVA 4ESWA 1B05A 2B3BA 1UTBA 4BDOA 4PQJA 2R6GE 1OMPA 3CFXA 2O69A 1SQYA 1B7ZA 4X1BA 5K2XA 4TLLB 3N6UA 4OETA 1JNFA 5M2VA 1JEUA 4ZE9A 4F1UA 4OQOA 4YAHX 5H8SA 5TP9B 3OO8A 3FJMA 3MVYA 1LLSA 2DQVA 5BWJA 4QSDA 2XXVA 2HFBA 5EHSA 2B3FA 1SW4A 1GGGA 4OZ9A 1EZPA 3MVWA 4Q30B 2RCBA 2REGA 3Q28A 4R2FA 1H45A 4PFUA 4ONYA 4THIA 3FJ7A 3E3KA 4QFNA 1M5FA 3PPRA 1FCKA 1MDP1 1DTGA 5F1QA 3TYHA 5DYHA 2HCAA 2ZMBA 2DS9A 5AA2B 3MJNA 1URGA 4KYSA 1HSEA 3CR9A 1IXCA 2M8CA 2PT2A 3ZS6A 3LC8A 4HW8A 3WAFA 4ELRA 1B51A 2AYSA 3BKIB 3IO6A 3VV5A 4OENA 1PEBA 4ZZEA 1S50A 1URDA 2H9BA 3E4RA 2ALUA 5DEXB 4QFLA 5JTYA 3MPLA 3PPOA 1H44A 3PUVE 4EQ7A 1P1WA 3C32A 1B9JA 2OLBA 4F39A 1XC1A 2E1SA 1P99A 3RQTA 5I59A 4R6YA 4ELOA 2I6EA 1B3HA 4ZEIA 1SW1A 1MPDA 1XHYA 5I56A 3DP8A 2XX8A 3VXCA 2NWJA 3IJXB 3M3LA 4AB5A 4NF5B 3ONMA 4G68B 5FTIA 2VD2A 3KOSA 4H8IA 2REJA 4MLQA 3WAEA 4I1DA 1PC3A 3TELA 3ECRA 1VFDA 1Q35A 4LZ5A 1POTA 2DE2A 3GXAA 3SETA 4DCXA 4IB2A 4C0RA 3EQ1A 4O3CA 1QKAA 4QFPA 3TTLA 2O7IA 4R74A 1J1NA 1M5CA 4BDLA 4DXBA 3MVZA 2GHAA 4IO6A 3BBRA 1I69A 3A3CA 3QIMA 4KQPA 3IOUA 2ZYOA 3IK6B 4ELPA 1URSA 4H8JA 5FHMA 4BDQA 3L6HA 1AOVA 2ONSA 3T93B 4NF4A 3PV0E 4KYEA 2HZKA 1YCJA 4OHNA 1Y3NA 4OFOA 4IO3A 1D3KA 4TOZA 1JW5A 3H3GA 3HHGA 3MP6A 3VVEA 4OFJA 4XIGQ 1R1NA 1XOCA 3MP8A 2I58A 2PBWA 2P2AA 4NMYA 3PUYE 3V8XB 4KCDA 3UN6A 1H43A 3O9PA 1Z7ME 4OEUA 3HHFA 3SESA 2Q2AA 2UVJA 1A8FA 3K6UA 4G4PA 3IO4A 1WVJA 2B65A 1MXWA 5DVFA 5ICQA 5CMBA 4IO2A 2O84X 3RLFE 4FEBA 1Y4TA 5EYFA 3EHUA 5FHNA 4RXLA 4BDNA 5IAIA 4OMBA 3K2DA 4EUOA 1DOTA 3T22A 4FORA 2UXAA 4PETA 1MS7A 3TQLA 1UTHA 3OO7A 3TDJA 2WKYA 5H8HA 4IO7A 4EQBA 3FD3A 1B40A 2ANJA 2QJEA 3TEPA 4LVQA 4K3FA 1Q1KA 2GHBA 4FIMA 3W15C 4F19A 3QAXA 2F78A 3MZ1A 3H06B 2OJTA 4YB6A 4YICA 2A5TA 3FGSA 1MXXA 3IB0A 1TWYA 2DWHA 2QSXA 2QS3A 3VDFA 1MQIA 3SEXA 3OO9A 1LSTA 4M4GA 1B5IA 2DWJA 2QS2A 1B1XA 4H5FA 1AL3A 3PPNA 3E13X 4ISUA 4G8HA 3BFTA 4LQ5A 1IQ7A 1D9YA 3OMBA 1QJMA 1USYE 4KCCA 1IITA 3SDFA 5I58B 1EU8A 1JW1A 1B52A 3OENA 1M5DA 2PVUA 3PGFA 1EH3A 4KPTA 4EQ9A 4NF6A 1D9VA 1BIYA 2O1LA 1IZ1A 1FQAA 1DMBA 4FE8A 2Y7WA 4DE8A 2ZYMA 1RYXA 5I84A 4N6PA 4LATA 2R9JA 5L9MA 4G77A 5I2KA 2I0BA 1IUDA 1LAFE 1MQDA 1LBCA 3OSRA 4C1UA 2RINA 3CG3A 2H4IA 2UVIA 4E0WA 4WXJA 3I6VA 4U1OA 4F1VA 5HM4B 4YB5A 2XXUA 3BFUA 2ESNA 2OWSA 3T9VA 3H6VA 1ZKBA 2XXIA 2HAUA 1MRPA 4DZ1A 3DM0A 3CFLA 2DWIA 4N13A 5AE4A 3C33A 4H5GA 4I8CA 1N3WA 4GQOA 2OWTA 1VFEA 3H6TA 1Y3QA 2DE4A 2F7CA 3OELA 5TP9A 2GFEA 4OYVA 4O3AA 4Q5TA 5H8FB 2VOZA 2RF1A 1IXIA 1LFHA 2D21A 4GF8A 3N6TA 1QW0A 2P0SA 4KR5A 2CMOA 2IA4A 4F1YA 5CM6A 1OLAA 4OESA 3OD7A 4M1VA 1MXZA 1JVYA 4GXSB 5TU0A 3ZKKA 3KOTA 1B0LA 4U22A 3CVGA 3G3IA 3UA8A 1BKAA 3MQ9A 3MAMA 4H67A 1ANFA 1II5A 2QMXA 4IGTA 3FXRA 4GWOA 2F34A 1S7YA 5DT6A 1BLFA 4YZZA 4X1DA 4XKNA 1SD3A 1MQGA 2PT1A 4N07A
chains in the Genus database with same CATH superfamily
1WODA 1NH8A 5AA2A 2AL4A 2DYXA 3RT8A 3S9MC 3PMVA 5JK4A 3ILTB 4HXVA 3VLVA 3S9EA 2D5WA 4RPNA 4G2ZA 1EZOA 3QYTA 3O6IA 4HCYA 1FJ6A 1MPCA 4Z0IA 5T3JA 1SI1A 3U92A 1FTJA 4JVDA 2QVVA 5DEXA 2XWKA 1OVBA 1PB8A 1US5A 3KJ7A 3N5LA 1USYH 1LEVA 2H25A 3MSTA 1JEVA 2L5VA 3B50A 3V89B 4ECFA 1SDXA 4MCOA 5H8NB 1NNKA 4Z7EA 1DPEA 3TQWA 1FTAA 4MF3A 4TQUQ 3HFUA 4PCDA 3JZJA 3K01A 3USDA 1POY1 1PB9A 2F7AA 4NE4A 4WKMA 4PFTA 1LBBA 1LB9A 4Q0CA 5AA3A 1FQFA 4NF5A 2F7BA 2Z8FA 3PTYA 4G68A 4LN5A 2HPGA 3CSBA 5EQ9A 2XXXA 2Z23A 5F7VA 2DOJA 4NF8B 3RYDA 4R9FA 1GR2A 1FQDA 5DW8A 2GH9A 3VLUA 4PE3A 5J1DA 5F24A 4XFEA 3K00A 1PBPA 3M3KA 2V84A 2Y7IA 3G3GA 4TLMB 4N8GA 3FZVA 2V25A 2XXRA 5CC2A 2DP8A 3K4UA 1KWHA 1SW2A 2V3QA 2XHDA 3IJOB 4DCYA 1UIVA 3UGWA 4JB7A 3SZPA 4PFYA 2KLFA 3TCGA 4BDRA 3E79A 4PP0A 2F3BA 2LAOA 4G68C 5K2YA 4RK2A 1FJ9A 1O7TA 2ZZWA 2I3WA 5A5XB 4E0XA 2QMWA 4RNSA 2ZZXA 2HEUA 4FECA 3O29A 3RTFB 1N0TA 4JDFA 4PFWA 4UACA 4G8NA 1LAGE 1P1NA 1A54A 1ATGA 3MUQA 1A55A 3D4GA 5CRYA 4P11A 4RA1A 4ZDMA 4AS4A 5I57B 1FTKA 3RT6B 4XEQA 1NNTA 2ZNSA 1LFGA 4MMPA 1RKMA 4I9DA 2HQ0A 1B3EA 5KCJB 1QKBA 1B4HA 3C35A 1FW0A 3C9HA 4LZ8A 4GX6A 3H6UA 4EF1A 4ELQA 2OWZA 1NI9A 3W9WA 2VHAA 3H6WA 2DSFA 3RTWB 3UORA 2CEXA 2VP1A 4P8BA 3A09A 2Q8JA 1MH3A 5TPAB 1LBXA 4JVIA 1YAEA 3W9VA 3NOHA 1AH5A 3K1MA 3TCFA 2HHMA 1CE2A 4U23A 2RC8A 4IY6A 3FATA 3B7DA 1OVTA 3VXBA 3SEWA 1B2HA 2X26A 4X8RA 1QULA 2ONKE 4JWOA 2H5YA 4DLDA 2BJJX 3GZGA 3PUXE 2ABHA 4EF2A 4R2BA 4UABA 4P0IA 5CI5A 2Q8MA 1M5EA 3IAZA 1Z7NE 3G3JA 2Z8DA 3PUWE 1L5TA 1I6AA 2OCUA 2NVUB 3KSJA 4U21A 2AIXA 2QVUA 4MAGA 2WYPA 4WEPA 1N04A 3TMGA 4LZ7A 1N3XA 1RYOA 1P1UA 4JWYA 4F2OA 4YB7A 1NL5A 1ELJA 3K6XA 1DSNA 3TZAA 2AL5A 3EKIA 2I3VA 3SERA 3RUMA 4GWSA 1XT8A 1MDQA 3OEMA 3FVGA 1O64A 1AIVA 5ITOA 1KA0A 2I4BA 1ZIUA 5AA2D 2UYFA 5I58A 5I7IA 2V93A 1XS5A 3I5OA 2H99A 3ODBA 1I6QA 3T66A 3EN3A 1MG1A 4R6KA 1EYIA 1FBHA 1RDZA 2YJPA 4U1ZA 3K1PA 1NUZA 1R6ZA 4F3BA 4OVTA 4RK9A 1P1QA 2QL3A 3RNNA 3C36A 3MC2A 3FASA 1SBPA 1SYHA 4X48A 4DI3D 2ZNTA 5IZ3B 2P3NA 4EXLA 5DVIA 3O28A 4YU0A 4EXKA 2DVCA 4FJPA 4P3LA 4WEDA 4NTLA 1B7UA 1FPJA 4OXVA 4BDMA 4GOTA 3HCQA 4GD5A 1FQEA 2Y7PA 4MFIA 3SEYA 3U8QA 3O2AA 5IKBA 5CMCA 2OBGA 3DLNA 1MXYA 1QVSA 2UVGA 1N76A 2X7PA 3K6WA 1Y4CA 3EHSA 1NUWA 5EYHA 3SKPA 3DELB 3O6HA 3KC1A 2XD2A 1B58A 5ELVA 3LR1A 2OK2A 4XTCQ 4QXDA 4OVRA 1DTZA 2QRYA 3KZGA 2DVZA 3IOWA 2O6AA 2WBDA 3O6GA 1P1OA 4MBPA 4POXA 4OEVA 3U65A 3OOAA 3HO7A 1G0IA 1FTLA 1AMFA 1DPPA 4P9KA 3FIRA 3EHTA 5H8FA 1B32A 1LAXA 2Z8EA 3IB2A 4YMAA 2RC7A 4ZEBA 2I0CA 3D4CA 4NQ8A 3C4MA 4OERA 3V5AA 3VE1B 2UYEA 3S2VA 3H7MA 2ZXTA 5H8QB 3LUYA 4H0WA 4QF9A 1LAHE 4GX4A 1UQWA 4GRKA 4ND9A 4PGPA 2B4LA 2F6PA 3B6WA 1MY4A 2ZZVA 1TXFA 1PBQA 4YMBA 4KFQA 1XVYA 2QS1A 4QSEA 3L6GA 1OLCA 3G3HA 4N17A 4F2QA 3S9NC 3DP6A 3M8UA 3ROJA 1IEJA 1LGBC 3JYRA 3CSGA 3FXQA 4XKRA 1B0HA 4KI0E 1IMEA 1Y9UA 3QK6A 1B3GA 3HV1A 4JSDA 1TFAA 5I2NB 3B6TA 2FA7A 2F36A 3Q29A 3PPQA 1BTJA 3RY3A 1H76A 5AA4B 3CFZA 3RGYA 2THIA 1FPEA 4OVSA 4OTEA 3VFJA 3D1RA 1FBCA 5BUUA 5DVJA 1QUKA 3CG1A 3T1BA 4F3GA 1A8EA 1SI0A 4OFLA 3BIGA 4R72A 2V3UA 4DDDA 2X7QA 2E0SA 5B70A 2FVZA 4ZS9A 4AS5A 3IR1A 4LP2B 1MY3A 1S9TA 3EF7A 3MP1A 4GLIA 4IY5A 1WDNA 5H8NA 2GRVA 1GV8A 4GVOA 4NHBA 5L9SA 1MQHA 3JV9A 3TTNA 4ZEKA 1IMCA 3OEKA 3SEVA 1MM6A 5ITPA 5KDTB 1TFDA 1IIWA 3KBZA 4GL0A 4H65A 5CBSA 2H98A 4AQ4A 3IL1B 1IXGA 4N4UA 1NV5A 1GVCA 2CZIA 2Y7RA 4IGRA 3PD9A 2XD3A 3S9LC 4NF8A 1B1HA 3Q27A 3FVNA 4Q8RA 5L8DA 1RDXA 3KGCA 3I3VA 2G29A 2ZYKA 3VLWA 5KZTA 3CI8A 1LCFA 4OVPA 1XVXA 1NH7A 1JQFA 2Z22A 4LQ2A 4UA8A 1FTOA 4GIZA 4H46A 3GLBA 1INPA 4RPOA 3KJTA 4OVQA 3LSFB 3PPPA 3LBSA 3KN3A 3MPKA 4GXAA 4NWCA 1NNPA 1G0HA 4X9TA 1UTBB 4DIGA 3EPEA 4YKPA 1JP4A 1QUJA 2D3IA 1QUIA 3HN0A 2O68A 4RY1A 5A5XA 1CB6A 4RYAA 2VD3A 3KEIA 1ZBMA 3MVXA 2DXYA 1FQCA 1Y1ZA 2XXPA 3FJGA 5HBCA 2JJKA 1B6HA 4PE5B 4L17A 5ICTA 3OO6A 2PX1A 2KQZA 3LV0A 4U4SA 4IO4A 1B3LA 2XXQA 3VVDA 2NOOA 5HPQA 3ZKLA 2Q9TA 1Y3PA 5I57A 4F29A 1JETA 2G93A 1Y1MA 5EYGA 2RC9A 3TUSA 2Y5KA 3FXBA 4PBHA 1B3FA 4BLAA 5KCJA 5IZ1A 3TKDA 2YPNA 2Y7KA 4YKIA 1ZTYA 2PCRA 1NV7A 4GL8A 1NNFA 4ZZAA 4PTKA 4QFOA 4ZE8A 2WYKA 4GX3A 5TPAA 3MYUA 1TT1A 1IMFA 1B4ZA 2CZLA 2VGQA 5ET8A 4ZECA 4MH5A 2DXRA 1FPDA 3U72A 4O3BA 3MWBA 1NV6A 1VSOA 3IOTA 3KBRA 3MZ9A 4OVJA 1NKXA 1SPIA 4OA4A 1N7WA 1PB7A 4MIJA 2FIXA 3QMFA 4XKPA 3Q26A 4R73A 3V83A 3IFCA 1ZJLA 3LUZA 3B8BA 4XXUA 2QS4A 5IM2A 4P1LA 1MY2A 1D4NA 2CEYA 3GBAA 4NF0A 1F9BA 3K02A 4KYDA 3KG2A 1LCTA 2P3VA 4LONB 5FBPA 1OQHA 1OQGA 2XX9A 1UIUA 2I4CA 5JTYB 1T0KA 4FATA 3MBPA 4PDDA 2WBBA 1MY1A 4PF6A 3LSWA 3K1NA 1HSLA 2IEEA 4PDHA 3U93A 1FQBA 5I59B 4DXUA 1MM7A 2FBPA 4NEDA 2ZNUA 3FVKA 4GWUA 5I56B 3TTMA 2XXHA 4IR8A 3FVOA 4JXIA 4DI4B 3QUFA 2FNCA 4H6DA 3RPLB 1FPKA 4ZEDA 3IOVA 1LFIA 1FPBA 3Q25A 3LSXA 2I49A 2A5SA 3IORA 3TPAA 2QPQA 4FAJA 1MXVA 3KSXA 3R26A 1GTKA 3SEUA 2NUVA 1LBZA 3KFMA 2O1MA 3PUZE 1H3DA 3C31A 3MZBA 1FSAA 1PDAA 2OZZA 4GWXA 5IZ3A 1MQJA 3T9HB 2XWOA 4F22A 2P1SA 5ISUA 3FUZA 3QXMA 3PMWA 3HPIA 2PMSA 3TCHA 2ONRA 3OXNA 3ISPA 3TTKA 4KD5A 3DP4A 5CMKA 3PU5A 2XXYA 1XI6A 1QGXA 4EDPA 2W7YA 1B7HA 1VDWA 4IO5A 4P1EA 2F97A 3UK4A 3G7WA 4NF4B 1MXUA 2VPOA 3UIFA 4ESXA 1VR5A 3RN8A 3FXUA 1FBGA 3ILUB 4KHZE 3A3UA 2Q89A 2F35A 1NUXA 4I3YA 5CMMA 1VE4A 1B46A 3GBBA 2HZLA 4N6KA 4PF8A 1A99A 3U94A 4KXPA 3CIJA 2XXTA 1N7XA 4AB6A 5FTHA 2F8DA 3K0VA 4HTGA 1SYIA 2FYIA 4I40A 4HCWA 4GWWA 1DCUA 2YLNA 1FTMA 4PC9A 3FV2A 3H4ZA 3TAJA 3K6VA 5H8QA 2DWAA 4P0GA 2R71A 5LOMA 4NAPA 3PD8A 2F6GA 4U2RA 4DXCA 4MJOA 1LBWA 3QSLA 3R6UA 3B6QA 4PFIA 2XWIA 5IGAA 1JW4A 4FBPA 5CBRA 1M5BA 4POWA 1ZMGA 1A40A 3UP9A 5DTBA 3S4UA 1NUYA 1N84A 3LSLA 1UTHB 4F3PA 5J16A 1IXHA 4F18A 5AA1A 4RJZA 3KN8A 5I2NA 5H8HB 5I3SA 1B5HA 1ZLQA 3FBPA 4JBZA 1KZ8A 3H03A 1MY0A 2HXWA 3O66A 4QHQA 3TODA 3TTRA 1MH4A 4LUBA 1YPNA 5AA4A 5JEIA 2O7UA 1LBVA 4YKJA 3IB1A 3F11A 1SVXB 2A5TB 3OSQA 3T9UA 3VVFA 2DE3A 4O7MA 5B7DA 2V3TA 2FIEA 3C34A 3O97A 4GFRA 3T96B 2XX7A 2Q2CA 4MLVA 3AXFA 4R75A 4I62A 2RKMA 4C1TA 3T9XB 1HSJA 2O51A 4R6HA 4HS7A 3P7IA 4F31B 4N15A 3G3KA 3U1OA 4NWDA 1SW5A 3CRBA 4OWDA 1O63A 1B5JA 1ZU0A 3MW0A 4YKKA 4F3SA 5FHOA 1EYJA 4PFRA 4JSOA 3PMXA 2F5XA 2Q88A 4FEDA 4U4XA 3N94A 4G8MA 4H1XA 5KDTA 1BP5A 3ZSFA 3M3FA 4QRZA 5EHMA 1Y20A 1LB8A 5A5LA 1NMUA 4NF6B 2ZYNA 1A7LA 1IMAA 3G3FA 1R9LA 3HSTA 4LA9A 2PYYA 4MNIA 3RPWA 2UVHA 2Q74A 3THIA 1YTVA 4XKQA 1US4A 5I2KB 2V4CA 3KN7A 3FV1A 1NV3A 5IZZA 3R7XA 1R9QA 4HE0A 5L9OA 3IX1A 2R8TA 5ESYA 1FBDA 1I6BA 1EZ9A 1MPBA 2I48A 3E9XA 1IMBA 4R9GA 2CZKA 2GQ1A 2Y84A 4QSCA 1JVXA 3QUJA 1FPLA 2RCAA 4QFKA 1OIBA 3TFLA 4ZEFA 2NXOA 1NFTA 3N26A 4JWXA 2XXWA 2HAVA 1DK4A 4ESWA 1B05A 1YZ0A 2B3BA 1UTBA 4BDOA 4PQJA 2R6GE 1OMPA 1K9YA 3CFXA 2O69A 1SQYA 1B7ZA 4GBWA 4X1BA 5K2XA 4TLLB 3N6UA 4OETA 1JNFA 2VPNA 5M2VA 4MX6A 1JEUA 4ZE9A 4F1UA 4OQOA 4YAHX 5H8SA 5TP9B 3OO8A 5EQ7A 3FJMA 3MVYA 2OX3A 1LLSA 2DQVA 5BWJA 4NX1A 4QSDA 2XXVA 1KA1A 3KC0A 2HFBA 5EHSA 2B3FA 1SW4A 1GGGA 4OZ9A 1EZPA 4O7IA 3MVWA 4Q30B 2RCBA 2REGA 3Q28A 4R2FA 4XF5A 1H45A 4PFUA 2WEFA 4HE1A 4ONYA 4THIA 3IFAA 3FJ7A 3E3KA 5ET5A 4QFNA 1M5FA 3PPRA 1FCKA 1MDP1 1DTGA 5F1QA 1CNQA 3TYHA 5DYHA 2HCAA 2ZMBA 2DS9A 5EQ8A 5AA2B 3MJNA 1URGA 4KYSA 1HSEA 3CR9A 1IXCA 2M8CA 2PT2A 3ZS6A 3LC8A 4HW8A 1LBYA 3WAFA 4ELRA 1B51A 2AYSA 3BKIB 3IO6A 3VV5A 2F3DA 4OENA 1PEBA 1FPFA 4OANA 4ZZEA 1S50A 1URDA 2H9BA 3E4RA 2ALUA 5DEXB 4QFLA 5JTYA 3MPLA 3PPOA 1H44A 2QFLA 4N8YA 3PUVE 2MKZA 4EQ7A 1P1WA 3C32A 1B9JA 2CZHA 2OLBA 4F39A 1XC1A 2E1SA 1P99A 5LTCA 3RQTA 5I59A 4R6YA 4ELOA 2BJIA 2I6EA 3CHGA 1YYZA 1B3HA 4G61A 4ZEIA 1K9ZA 1SW1A 1MPDA 1XHYA 5I56A 3DP8A 2XX8A 4GBVA 3VXCA 2PFYA 1EYKA 2NWJA 3IJXB 3M3LA 3RPLA 4NF5B 3ONMA 4AB5A 4G68B 5FTIA 2VD2A 3KOSA 4H8IA 2REJA 4MLQA 3WAEA 4I1DA 4HE2A 1PC3A 3TELA 3ECRA 1VFDA 5I5PA 1Q35A 4LZ5A 1POTA 4MEVA 2DE2A 3GXAA 3SETA 4DCXA 4IB2A 4C0RA 3EQ1A 4O3CA 1QKAA 5ET7A 1NV0A 4QFPA 3TTLA 2O7IA 4JVCA 4R74A 1J1NA 1M5CA 4BDLA 4DXBA 3MVZA 2GHAA 4IO6A 3BBRA 1I69A 3A3CA 3QIMA 4KQPA 1DBZA 3IOUA 2ZYOA 3IK6B 3BIHA 2Y5LA 3GYYA 4ELPA 1NV4A 1URSA 4H8JA 1FBFA 2PFZA 5FHMA 4BDQA 3L6HA 1AOVA 2ONSA 3T93B 4NF4A 4GWZA 3PV0E 4KYEA 2HZKA 4H45A 1YCJA 4OHNA 4N91A 1Y3NA 4N6DA 4OFOA 1AWBA 2HXRA 4IO3A 1D3KA 4TOZA 1JW5A 3H3GA 3HHGA 3MP6A 3VVEA 4OFJA 1YXIA 4XIGQ 1R1NA 1XOCA 3MP8A 2I58A 2PBWA 2P2AA 4NMYA 3PUYE 3V8XB 4KCDA 3UN6A 1H43A 4X04A 3O9PA 1Z7ME 4OEUA 3HHFA 3SESA 2Q2AA 2UVJA 1A8FA 3K6UA 4G4PA 3IO4A 1WVJA 2B65A 4PFBA 1MXWA 4NG7A 3T0JA 5DVFA 5ICQA 5CMBA 4IO2A 2O84X 3RLFE 4FEBA 1Y4TA 5EYFA 3EHUA 5FHNA 4RXLA 4BDNA 4NN3A 5IAIA 4OMBA 3K2DA 1NV1A 4EUOA 1DOTA 3T22A 4FORA 3E78A 2UXAA 4P47A 4PETA 1MS7A 3TQLA 1UTHA 3OO7A 3TDJA 2WKYA 5H8HA 4O8MA 1FPGA 4IO7A 4EQBA 3FD3A 1B40A 2ANJA 2QJEA 3TEPA 4LVQA 4K3FA 1Q1KA 2GHBA 4FIMA 3W15C 4F19A 3QAXA 2F78A 3MZ1A 4N81A 3H06B 2OJTA 4YB6A 4YICA 2A5TA 3FGSA 1MXXA 3IB0A 1TWYA 2DWHA 2QSXA 2QS3A 3VDFA 1MQIA 2KR0A 3SEXA 3OO9A 1LSTA 4M4GA 1B5IA 2DWJA 2QS2A 1B1XA 4H5FA 1AL3A 3PPNA 3E13X 1FBPA 4ISUA 4G8HA 3BFTA 4LQ5A 1IQ7A 1D9YA 3OMBA 2WX9A 1QJMA 4GWYA 1USYE 4KCCA 1IITA 3SDFA 4I3EA 5I58B 1EU8A 1JW1A 1B52A 3OENA 1M5DA 2PVUA 5ET6A 3PGFA 1EH3A 4KPTA 4EQ9A 4NF6A 1D9VA 1BIYA 2O1LA 1IZ1A 1FQAA 4PAFA 4PAIA 1DMBA 4FE8A 4PBQA 2FHYA 2Y7WA 4DE8A 2ZYMA 1RYXA 4PAKA 5I84A 4N6PA 4LATA 2R9JA 1Q9DA 5L9MA 1FBEA 4G77A 5I2KA 2I0BA 1IUDA 1NV2A 1LAFE 1MQDA 1LBCA 3OSRA 4C1UA 2RINA 3CG3A 2H4IA 2UVIA 4E0WA 4WXJA 3I6VA 4U1OA 4F1VA 5HM4B 4YB5A 2XXUA 3BFUA 2ESNA 1IMDA 2OWSA 3T9VA 3H6VA 1ZKBA 2XXIA 2HAUA 1MRPA 1D9QA 4DZ1A 3DM0A 3CFLA 2B4MA 2DWIA 4N13A 5AE4A 3C33A 4H5GA 4I8CA 1N3WA 4GQOA 2OWTA 4MHFA 2DDKA 1VFEA 3H6TA 2VT5A 1Y3QA 4PGNA 2DE4A 2F7CA 3OELA 3A29A 5TP9A 2GFEA 4OYVA 4O3AA 4Q5TA 5H8FB 2VOZA 2RF1A 1IXIA 5EQAA 1LFHA 2D21A 4GF8A 3N6TA 1QW0A 2P0SA 4KR5A 2CMOA 1FPIA 2IA4A 4F1YA 5CM6A 2QVRA 1FRPA 1OLAA 4OESA 3OD7A 4M1VA 1MXZA 1JVYA 4MNPA 4P56A 4GXSB 1BK4A 5TU0A 3ZKKA 3KOTA 1B0LA 2XXKA 4U22A 3CVGA 2XWVA 3G3IA 3UA8A 1BKAA 1RDYA 3MQ9A 3MAMA 4H67A 1ANFA 1II5A 5LDZA 2QMXA 4IGTA 4O94A 3FXRA 4GWOA 2F34A 1S7YA 4MNCA 5DT6A 1BLFA 4YZZA 4X1DA 4XKNA 1SD3A 4QBAA 4NGUA 2XA5A 1MQGA 2PT1A 4N07A
chains in the Genus database with same CATH topology
1WODA 1NH8A 5AA2A 2AL4A 2DYXA 3RT8A 3S9MC 3PMVA 5JK4A 3ILTB 3VLVA 3S9EA 2D5WA 4RPNA 4G2ZA 1EZOA 3QYTA 3O6IA 4HCYA 1MPCA 4Z0IA 1SI1A 3U92A 1FTJA 5DEXA 1OVBA 1PB8A 1US5A 3KJ7A 3N5LA 1USYH 2H25A 1JEVA 3V89B 4ECFA 1SDXA 5H8NB 1NNKA 4Z7EA 1DPEA 3TQWA 4MF3A 4TQUQ 3JZJA 3K01A 3USDA 1POY1 1PB9A 2F7AA 4NE4A 4WKMA 4PFTA 1LBBA 1LB9A 4Q0CA 5AA3A 1FQFA 4NF5A 2F7BA 2Z8FA 4G68A 3CSBA 2XXXA 2Z23A 5F7VA 2DOJA 4NF8B 4R9FA 1GR2A 1FQDA 2GH9A 3VLUA 5J1DA 3K00A 1PBPA 3M3KA 2V84A 2Y7IA 3G3GA 4TLMB 3FZVA 2V25A 2XXRA 5CC2A 2DP8A 3K4UA 1KWHA 1SW2A 2V3QA 2XHDA 3IJOB 4DCYA 1UIVA 3UGWA 4JB7A 4PFYA 2KLFA 3TCGA 4BDRA 4PP0A 2LAOA 4G68C 5K2YA 4RK2A 1O7TA 2I3WA 5A5XB 4E0XA 2QMWA 4RNSA 2HEUA 4FECA 3O29A 3RTFB 1N0TA 4JDFA 4PFWA 4UACA 4G8NA 1LAGE 1P1NA 1A54A 1ATGA 3MUQA 1A55A 3D4GA 5CRYA 4P11A 4RA1A 4ZDMA 5I57B 1FTKA 3RT6B 1NNTA 2ZNSA 1LFGA 1RKMA 4I9DA 2HQ0A 1B3EA 5KCJB 1QKBA 1B4HA 3C35A 1FW0A 3C9HA 4LZ8A 3H6UA 4EF1A 4ELQA 3W9WA 2VHAA 3H6WA 2DSFA 3RTWB 3UORA 2VP1A 3A09A 2Q8JA 1MH3A 5TPAB 1YAEA 3W9VA 1AH5A 3K1MA 3TCFA 1CE2A 4U23A 2RC8A 4IY6A 3FATA 3B7DA 1OVTA 3VXBA 3SEWA 1B2HA 2X26A 1QULA 2ONKE 4JWOA 2H5YA 4DLDA 2BJJX 3GZGA 3PUXE 2ABHA 4EF2A 4R2BA 4P0IA 5CI5A 1M5EA 3IAZA 1Z7NE 3G3JA 2Z8DA 3PUWE 1L5TA 1I6AA 2OCUA 2NVUB 3KSJA 4U21A 2AIXA 4WEPA 1N04A 3TMGA 4LZ7A 1N3XA 1RYOA 1P1UA 4JWYA 4F2OA 4YB7A 1NL5A 1ELJA 3K6XA 1DSNA 3TZAA 2AL5A 2I3VA 3SERA 3RUMA 1XT8A 1MDQA 3OEMA 3FVGA 1O64A 1AIVA 5ITOA 2I4BA 1ZIUA 5AA2D 2UYFA 5I58A 2V93A 1XS5A 3I5OA 2H99A 3ODBA 1I6QA 3T66A 3EN3A 1MG1A 4R6KA 2YJPA 4U1ZA 3K1PA 1R6ZA 4F3BA 4RK9A 1P1QA 2QL3A 3RNNA 3C36A 3MC2A 3FASA 1SBPA 1SYHA 4X48A 2ZNTA 4EXLA 5DVIA 3O28A 4YU0A 4EXKA 2DVCA 4FJPA 4WEDA 4NTLA 1B7UA 4OXVA 4BDMA 4GOTA 3HCQA 4GD5A 1FQEA 2Y7PA 4MFIA 3SEYA 3U8QA 3O2AA 5IKBA 5CMCA 2OBGA 3DLNA 1MXYA 1QVSA 2UVGA 1N76A 2X7PA 3K6WA 1Y4CA 3EHSA 3SKPA 3DELB 3O6HA 2XD2A 1B58A 5ELVA 3LR1A 2OK2A 4XTCQ 1DTZA 2QRYA 3KZGA 2DVZA 3IOWA 2O6AA 3O6GA 1P1OA 4MBPA 4POXA 4OEVA 3OOAA 3HO7A 1FTLA 1AMFA 1DPPA 3FIRA 3EHTA 5H8FA 1B32A 1LAXA 2Z8EA 3IB2A 4YMAA 2RC7A 4ZEBA 2I0CA 3D4CA 3C4MA 4OERA 3V5AA 3VE1B 2UYEA 3S2VA 3H7MA 2ZXTA 5H8QB 3LUYA 4H0WA 4QF9A 1LAHE 1UQWA 4GRKA 4ND9A 2F6PA 3B6WA 1MY4A 1TXFA 1PBQA 4YMBA 4KFQA 1XVYA 2QS1A 4QSEA 3L6GA 1OLCA 3G3HA 4F2QA 3S9NC 3DP6A 3M8UA 1IEJA 1LGBC 3JYRA 3CSGA 3FXQA 4XKRA 1B0HA 4KI0E 1Y9UA 3QK6A 1B3GA 3HV1A 4JSDA 1TFAA 5I2NB 3B6TA 2FA7A 2F36A 3Q29A 3PPQA 1BTJA 3RY3A 1H76A 5AA4B 3CFZA 3RGYA 2THIA 4OTEA 3VFJA 5BUUA 5DVJA 1QUKA 3CG1A 4F3GA 1A8EA 1SI0A 4OFLA 4R72A 2V3UA 4DDDA 2X7QA 2E0SA 5B70A 4ZS9A 3IR1A 4LP2B 1MY3A 1S9TA 3EF7A 3MP1A 4GLIA 4IY5A 1WDNA 5H8NA 2GRVA 1GV8A 4GVOA 5L9SA 1MQHA 3JV9A 3TTNA 4ZEKA 3OEKA 3SEVA 1MM6A 5ITPA 5KDTB 1TFDA 1IIWA 4GL0A 4H65A 5CBSA 2H98A 4AQ4A 3IL1B 1IXGA 1GVCA 2Y7RA 4IGRA 3PD9A 2XD3A 3S9LC 4NF8A 1B1HA 3Q27A 3FVNA 4Q8RA 5L8DA 3KGCA 3I3VA 2G29A 2ZYKA 3VLWA 5KZTA 3CI8A 1LCFA 1XVXA 1NH7A 1JQFA 2Z22A 4LQ2A 4UA8A 1FTOA 4GIZA 3GLBA 4RPOA 3KJTA 3LSFB 3PPPA 3LBSA 3KN3A 3MPKA 4GXAA 4NWCA 1NNPA 4X9TA 1UTBB 4DIGA 3EPEA 4YKPA 1QUJA 2D3IA 1QUIA 3HN0A 2O68A 4RY1A 5A5XA 1CB6A 4RYAA 2VD3A 3KEIA 1ZBMA 3MVXA 2DXYA 1FQCA 1Y1ZA 2XXPA 3FJGA 5HBCA 1B6HA 4PE5B 4L17A 5ICTA 3OO6A 2PX1A 4U4SA 4IO4A 1B3LA 2XXQA 3VVDA 2NOOA 5HPQA 3ZKLA 2Q9TA 1Y3PA 5I57A 4F29A 1JETA 2G93A 1Y1MA 2RC9A 3TUSA 4BLAA 1B3FA 5KCJA 3TKDA 2YPNA 2Y7KA 4YKIA 1ZTYA 4GL8A 1NNFA 4ZZAA 4ZE8A 4QFOA 5TPAA 1TT1A 1B4ZA 2CZLA 2VGQA 4ZECA 4MH5A 2DXRA 3U72A 4O3BA 3MWBA 1VSOA 3IOTA 3KBRA 3MZ9A 4OVJA 1NKXA 1N7WA 1PB7A 4XKPA 3Q26A 4R73A 3V83A 1ZJLA 4XXUA 2QS4A 1MY2A 1D4NA 3GBAA 1F9BA 3K02A 4KYDA 3KG2A 1LCTA 4LONB 1OQHA 1OQGA 2XX9A 1UIUA 2I4CA 5JTYB 1T0KA 4FATA 3MBPA 1MY1A 3LSWA 3K1NA 1HSLA 2IEEA 3U93A 1FQBA 5I59B 4DXUA 1MM7A 4NEDA 2ZNUA 3FVKA 5I56B 3TTMA 2XXHA 3FVOA 4JXIA 3QUFA 2FNCA 4H6DA 4ZEDA 3IOVA 1LFIA 3Q25A 3LSXA 2I49A 2A5SA 3IORA 3TPAA 2QPQA 4FAJA 1MXVA 3KSXA 3R26A 1GTKA 3SEUA 2NUVA 3KFMA 2O1MA 3PUZE 1H3DA 3C31A 3MZBA 1PDAA 2OZZA 1MQJA 3T9HB 4F22A 2P1SA 5ISUA 3FUZA 3QXMA 3PMWA 3HPIA 2PMSA 3TCHA 2ONRA 3OXNA 3TTKA 4KD5A 3DP4A 5CMKA 3PU5A 2XXYA 4EDPA 2W7YA 1B7HA 4IO5A 2F97A 3UK4A 3G7WA 4NF4B 1MXUA 3UIFA 4ESXA 1VR5A 3RN8A 3FXUA 3ILUB 4KHZE 3A3UA 2Q89A 2F35A 5CMMA 1VE4A 1B46A 3GBBA 2HZLA 1A99A 3U94A 3CIJA 2XXTA 1N7XA 4AB6A 5FTHA 2F8DA 3K0VA 4HTGA 1SYIA 2FYIA 4HCWA 2YLNA 1FTMA 3FV2A 3H4ZA 3TAJA 3K6VA 5H8QA 2DWAA 4P0GA 2R71A 5LOMA 3PD8A 2F6GA 4U2RA 4DXCA 3QSLA 3R6UA 3B6QA 1JW4A 5CBRA 1M5BA 4POWA 1ZMGA 1A40A 3UP9A 5DTBA 3S4UA 1N84A 3LSLA 1UTHB 4F3PA 1IXHA 4F18A 5AA1A 4RJZA 3KN8A 5I2NA 5H8HB 1B5HA 1ZLQA 4JBZA 3H03A 1MY0A 2HXWA 3O66A 4QHQA 3TODA 3TTRA 1MH4A 4LUBA 1YPNA 5AA4A 5JEIA 2O7UA 4YKJA 3IB1A 3F11A 1SVXB 2A5TB 3OSQA 3T9UA 3VVFA 2DE3A 5B7DA 2V3TA 3C34A 3O97A 4GFRA 3T96B 2XX7A 2Q2CA 4MLVA 3AXFA 4R75A 4I62A 2RKMA 4C1TA 3T9XB 1HSJA 2O51A 4R6HA 4HS7A 3P7IA 4F31B 3G3KA 3U1OA 4NWDA 1SW5A 3CRBA 4OWDA 1O63A 1B5JA 1ZU0A 3MW0A 4YKKA 4F3SA 5FHOA 4JSOA 3PMXA 2F5XA 2Q88A 4FEDA 4U4XA 3N94A 4G8MA 4H1XA 5KDTA 1BP5A 3ZSFA 3M3FA 4QRZA 5EHMA 1Y20A 1LB8A 1NMUA 4NF6B 2ZYNA 1A7LA 3G3FA 1R9LA 3HSTA 4LA9A 2PYYA 3RPWA 2UVHA 3THIA 1YTVA 4XKQA 1US4A 5I2KB 3KN7A 3FV1A 3R7XA 1R9QA 5L9OA 3IX1A 1I6BA 1EZ9A 1MPBA 2I48A 3E9XA 4R9GA 2Y84A 4QSCA 1JVXA 3QUJA 2RCAA 4QFKA 1OIBA 3TFLA 4ZEFA 2NXOA 1NFTA 3N26A 4JWXA 2XXWA 2HAVA 4ESWA 1B05A 2B3BA 1UTBA 4BDOA 4PQJA 2R6GE 1OMPA 3CFXA 2O69A 1SQYA 1B7ZA 4X1BA 5K2XA 4TLLB 3N6UA 4OETA 1JNFA 5M2VA 1JEUA 4ZE9A 4F1UA 4OQOA 4YAHX 5H8SA 5TP9B 3OO8A 3FJMA 3MVYA 1LLSA 2DQVA 5BWJA 4QSDA 2XXVA 2HFBA 5EHSA 2B3FA 1SW4A 1GGGA 4OZ9A 1EZPA 3MVWA 4Q30B 2RCBA 2REGA 3Q28A 4R2FA 1H45A 4PFUA 4ONYA 4THIA 3FJ7A 3E3KA 4QFNA 1M5FA 3PPRA 1FCKA 1MDP1 1DTGA 5F1QA 3TYHA 5DYHA 2HCAA 2ZMBA 2DS9A 5AA2B 3MJNA 1URGA 4KYSA 1HSEA 3CR9A 1IXCA 2M8CA 2PT2A 3ZS6A 3LC8A 4HW8A 3WAFA 4ELRA 1B51A 2AYSA 3BKIB 3IO6A 3VV5A 4OENA 1PEBA 4ZZEA 1S50A 1URDA 2H9BA 3E4RA 2ALUA 5DEXB 4QFLA 5JTYA 3MPLA 3PPOA 1H44A 3PUVE 4EQ7A 1P1WA 3C32A 1B9JA 2OLBA 4F39A 1XC1A 2E1SA 1P99A 3RQTA 5I59A 4R6YA 4ELOA 2I6EA 1B3HA 4ZEIA 1SW1A 1MPDA 1XHYA 5I56A 3DP8A 2XX8A 3VXCA 2NWJA 3IJXB 3M3LA 4AB5A 4NF5B 3ONMA 4G68B 5FTIA 2VD2A 3KOSA 4H8IA 2REJA 4MLQA 3WAEA 4I1DA 1PC3A 3TELA 3ECRA 1VFDA 1Q35A 4LZ5A 1POTA 2DE2A 3GXAA 3SETA 4DCXA 4IB2A 4C0RA 3EQ1A 4O3CA 1QKAA 4QFPA 3TTLA 2O7IA 4R74A 1J1NA 1M5CA 4BDLA 4DXBA 3MVZA 2GHAA 4IO6A 3BBRA 1I69A 3A3CA 3QIMA 4KQPA 3IOUA 2ZYOA 3IK6B 4ELPA 1URSA 4H8JA 5FHMA 4BDQA 3L6HA 1AOVA 2ONSA 3T93B 4NF4A 3PV0E 4KYEA 2HZKA 1YCJA 4OHNA 1Y3NA 4OFOA 4IO3A 1D3KA 4TOZA 1JW5A 3H3GA 3HHGA 3MP6A 3VVEA 4OFJA 4XIGQ 1R1NA 1XOCA 3MP8A 2I58A 2PBWA 2P2AA 4NMYA 3PUYE 3V8XB 4KCDA 3UN6A 1H43A 3O9PA 1Z7ME 4OEUA 3HHFA 3SESA 2Q2AA 2UVJA 1A8FA 3K6UA 4G4PA 3IO4A 1WVJA 2B65A 1MXWA 5DVFA 5ICQA 5CMBA 4IO2A 2O84X 3RLFE 4FEBA 1Y4TA 5EYFA 3EHUA 5FHNA 4RXLA 4BDNA 5IAIA 4OMBA 3K2DA 4EUOA 1DOTA 3T22A 4FORA 2UXAA 4PETA 1MS7A 3TQLA 1UTHA 3OO7A 3TDJA 2WKYA 5H8HA 4IO7A 4EQBA 3FD3A 1B40A 2ANJA 2QJEA 3TEPA 4LVQA 4K3FA 1Q1KA 2GHBA 4FIMA 3W15C 4F19A 3QAXA 2F78A 3MZ1A 3H06B 2OJTA 4YB6A 4YICA 2A5TA 3FGSA 1MXXA 3IB0A 1TWYA 2DWHA 2QSXA 2QS3A 3VDFA 1MQIA 3SEXA 3OO9A 1LSTA 4M4GA 1B5IA 2DWJA 2QS2A 1B1XA 4H5FA 1AL3A 3PPNA 3E13X 4ISUA 4G8HA 3BFTA 4LQ5A 1IQ7A 1D9YA 3OMBA 1QJMA 1USYE 4KCCA 1IITA 3SDFA 5I58B 1EU8A 1JW1A 1B52A 3OENA 1M5DA 2PVUA 3PGFA 1EH3A 4KPTA 4EQ9A 4NF6A 1D9VA 1BIYA 2O1LA 1IZ1A 1FQAA 1DMBA 4FE8A 2Y7WA 4DE8A 2ZYMA 1RYXA 5I84A 4N6PA 4LATA 2R9JA 5L9MA 4G77A 5I2KA 2I0BA 1IUDA 1LAFE 1MQDA 1LBCA 3OSRA 4C1UA 2RINA 3CG3A 2H4IA 2UVIA 4E0WA 4WXJA 3I6VA 4U1OA 4F1VA 5HM4B 4YB5A 2XXUA 3BFUA 2ESNA 2OWSA 3T9VA 3H6VA 1ZKBA 2XXIA 2HAUA 1MRPA 4DZ1A 3DM0A 3CFLA 2DWIA 4N13A 5AE4A 3C33A 4H5GA 4I8CA 1N3WA 4GQOA 2OWTA 1VFEA 3H6TA 1Y3QA 2DE4A 2F7CA 3OELA 5TP9A 2GFEA 4OYVA 4O3AA 4Q5TA 5H8FB 2VOZA 2RF1A 1IXIA 1LFHA 2D21A 4GF8A 3N6TA 1QW0A 2P0SA 4KR5A 2CMOA 2IA4A 4F1YA 5CM6A 1OLAA 4OESA 3OD7A 4M1VA 1MXZA 1JVYA 4GXSB 5TU0A 3ZKKA 3KOTA 1B0LA 4U22A 3CVGA 3G3IA 3UA8A 1BKAA 3MQ9A 3MAMA 4H67A 1ANFA 1II5A 2QMXA 4IGTA 3FXRA 4GWOA 2F34A 1S7YA 5DT6A 1BLFA 4YZZA 4X1DA 4XKNA 1SD3A 1MQGA 2PT1A 4N07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOD A;  1NH8 A;  5AA2 A;  2AL4 A;  2DYX A;  3RT8 A;  3S9M C;  3PMV A;  5JK4 A;  3ILT B;  3VLV A;  3S9E A;  2D5W A;  4RPN A;  4G2Z A;  1EZO A;  3QYT A;  3O6I A;  4HCY A;  1MPC A;  4Z0I A;  1SI1 A;  3U92 A;  1FTJ A;  5DEX A;  1OVB A;  1PB8 A;  1US5 A;  3KJ7 A;  3N5L A;  1USY H;  2H25 A;  1JEV A;  3V89 B;  4ECF A;  1SDX A;  5H8N B;  1NNK A;  4Z7E A;  1DPE A;  3TQW A;  4MF3 A;  4TQU Q;  3JZJ A;  3K01 A;  3USD A;  1POY 1;  1PB9 A;  2F7A A;  4NE4 A;  4WKM A;  4PFT A;  1LBB A;  1LB9 A;  4Q0C A;  5AA3 A;  1FQF A;  4NF5 A;  2F7B A;  2Z8F A;  4G68 A;  3CSB A;  2XXX A;  2Z23 A;  5F7V A;  2DOJ A;  4NF8 B;  4R9F A;  1GR2 A;  1FQD A;  2GH9 A;  3VLU A;  5J1D A;  3K00 A;  1PBP A;  3M3K A;  2V84 A;  2Y7I A;  3G3G A;  4TLM B;  3FZV A;  2V25 A;  2XXR A;  5CC2 A;  2DP8 A;  3K4U A;  1KWH A;  1SW2 A;  2V3Q A;  2XHD A;  3IJO B;  4DCY A;  1UIV A;  3UGW A;  4JB7 A;  4PFY A;  2KLF A;  3TCG A;  4BDR A;  4PP0 A;  2LAO A;  4G68 C;  5K2Y A;  4RK2 A;  1O7T A;  2I3W A;  5A5X B;  4E0X A;  2QMW A;  4RNS A;  2HEU A;  4FEC A;  3O29 A;  3RTF B;  1N0T A;  4JDF A;  4PFW A;  4UAC A;  4G8N A;  1LAG E;  1P1N A;  1A54 A;  1ATG A;  3MUQ A;  1A55 A;  3D4G A;  5CRY A;  4P11 A;  4RA1 A;  4ZDM A;  5I57 B;  1FTK A;  3RT6 B;  1NNT A;  2ZNS A;  1LFG A;  1RKM A;  4I9D A;  2HQ0 A;  1B3E A;  5KCJ B;  1QKB A;  1B4H A;  3C35 A;  1FW0 A;  3C9H A;  4LZ8 A;  3H6U A;  4EF1 A;  4ELQ A;  3W9W A;  2VHA A;  3H6W A;  2DSF A;  3RTW B;  3UOR A;  2VP1 A;  3A09 A;  2Q8J A;  1MH3 A;  5TPA B;  1YAE A;  3W9V A;  1AH5 A;  3K1M A;  3TCF A;  1CE2 A;  4U23 A;  2RC8 A;  4IY6 A;  3FAT A;  3B7D A;  1OVT A;  3VXB A;  3SEW A;  1B2H A;  2X26 A;  1QUL A;  2ONK E;  4JWO A;  2H5Y A;  4DLD A;  2BJJ X;  3GZG A;  3PUX E;  2ABH A;  4EF2 A;  4R2B A;  4P0I A;  5CI5 A;  1M5E A;  3IAZ A;  1Z7N E;  3G3J A;  2Z8D A;  3PUW E;  1L5T A;  1I6A A;  2OCU A;  2NVU B;  3KSJ A;  4U21 A;  2AIX A;  4WEP A;  1N04 A;  3TMG A;  4LZ7 A;  1N3X A;  1RYO A;  1P1U A;  4JWY A;  4F2O A;  4YB7 A;  1NL5 A;  1ELJ A;  3K6X A;  1DSN A;  3TZA A;  2AL5 A;  2I3V A;  3SER A;  3RUM A;  1XT8 A;  1MDQ A;  3OEM A;  3FVG A;  1O64 A;  1AIV A;  5ITO A;  2I4B A;  1ZIU A;  5AA2 D;  2UYF A;  5I58 A;  2V93 A;  1XS5 A;  3I5O A;  2H99 A;  3ODB A;  1I6Q A;  3T66 A;  3EN3 A;  1MG1 A;  4R6K A;  2YJP A;  4U1Z A;  3K1P A;  1R6Z A;  4F3B A;  4RK9 A;  1P1Q A;  2QL3 A;  3RNN A;  3C36 A;  3MC2 A;  3FAS A;  1SBP A;  1SYH A;  4X48 A;  2ZNT A;  4EXL A;  5DVI A;  3O28 A;  4YU0 A;  4EXK A;  2DVC A;  4FJP A;  4WED A;  4NTL A;  1B7U A;  4OXV A;  4BDM A;  4GOT A;  3HCQ A;  4GD5 A;  1FQE A;  2Y7P A;  4MFI A;  3SEY A;  3U8Q A;  3O2A A;  5IKB A;  5CMC A;  2OBG A;  3DLN A;  1MXY A;  1QVS A;  2UVG A;  1N76 A;  2X7P A;  3K6W A;  1Y4C A;  3EHS A;  3SKP A;  3DEL B;  3O6H A;  2XD2 A;  1B58 A;  5ELV A;  3LR1 A;  2OK2 A;  4XTC Q;  1DTZ A;  2QRY A;  3KZG A;  2DVZ A;  3IOW A;  2O6A A;  3O6G A;  1P1O A;  4MBP A;  4POX A;  4OEV A;  3OOA A;  3HO7 A;  1FTL A;  1AMF A;  1DPP A;  3FIR A;  3EHT A;  5H8F A;  1B32 A;  1LAX A;  2Z8E A;  3IB2 A;  4YMA A;  2RC7 A;  4ZEB A;  2I0C A;  3D4C A;  3C4M A;  4OER A;  3V5A A;  3VE1 B;  2UYE A;  3S2V A;  3H7M A;  2ZXT A;  5H8Q B;  3LUY A;  4H0W A;  4QF9 A;  1LAH E;  1UQW A;  4GRK A;  4ND9 A;  2F6P A;  3B6W A;  1MY4 A;  1TXF A;  1PBQ A;  4YMB A;  4KFQ A;  1XVY A;  2QS1 A;  4QSE A;  3L6G A;  1OLC A;  3G3H A;  4F2Q A;  3S9N C;  3DP6 A;  3M8U A;  1IEJ A;  1LGB C;  3JYR A;  3CSG A;  3FXQ A;  4XKR A;  1B0H A;  4KI0 E;  1Y9U A;  3QK6 A;  1B3G A;  3HV1 A;  4JSD A;  1TFA A;  5I2N B;  3B6T A;  2FA7 A;  2F36 A;  3Q29 A;  3PPQ A;  1BTJ A;  3RY3 A;  1H76 A;  5AA4 B;  3CFZ A;  3RGY A;  2THI A;  4OTE A;  3VFJ A;  5BUU A;  5DVJ A;  1QUK A;  3CG1 A;  4F3G A;  1A8E A;  1SI0 A;  4OFL A;  4R72 A;  2V3U A;  4DDD A;  2X7Q A;  2E0S A;  5B70 A;  4ZS9 A;  3IR1 A;  4LP2 B;  1MY3 A;  1S9T A;  3EF7 A;  3MP1 A;  4GLI A;  4IY5 A;  1WDN A;  5H8N A;  2GRV A;  1GV8 A;  4GVO A;  5L9S A;  1MQH A;  3JV9 A;  3TTN A;  4ZEK A;  3OEK A;  3SEV A;  1MM6 A;  5ITP A;  5KDT B;  1TFD A;  1IIW A;  4GL0 A;  4H65 A;  5CBS A;  2H98 A;  4AQ4 A;  3IL1 B;  1IXG A;  1GVC A;  2Y7R A;  4IGR A;  3PD9 A;  2XD3 A;  3S9L C;  4NF8 A;  1B1H A;  3Q27 A;  3FVN A;  4Q8R A;  5L8D A;  3KGC A;  3I3V A;  2G29 A;  2ZYK A;  3VLW A;  5KZT A;  3CI8 A;  1LCF A;  1XVX A;  1NH7 A;  1JQF A;  2Z22 A;  4LQ2 A;  4UA8 A;  1FTO A;  4GIZ A;  3GLB A;  4RPO A;  3KJT A;  3LSF B;  3PPP A;  3LBS A;  3KN3 A;  3MPK A;  4GXA A;  4NWC A;  1NNP A;  4X9T A;  1UTB B;  4DIG A;  3EPE A;  4YKP A;  1QUJ A;  2D3I A;  1QUI A;  3HN0 A;  2O68 A;  4RY1 A;  5A5X A;  1CB6 A;  4RYA A;  2VD3 A;  3KEI A;  1ZBM A;  3MVX A;  2DXY A;  1FQC A;  1Y1Z A;  2XXP A;  3FJG A;  5HBC A;  1B6H A;  4PE5 B;  4L17 A;  5ICT A;  3OO6 A;  2PX1 A;  4U4S A;  4IO4 A;  1B3L A;  2XXQ A;  3VVD A;  2NOO A;  5HPQ A;  3ZKL A;  2Q9T A;  1Y3P A;  5I57 A;  4F29 A;  1JET A;  2G93 A;  1Y1M A;  2RC9 A;  3TUS A;  4BLA A;  1B3F A;  5KCJ A;  3TKD A;  2YPN A;  2Y7K A;  4YKI A;  1ZTY A;  4GL8 A;  1NNF A;  4ZZA A;  4ZE8 A;  4QFO A;  5TPA A;  1TT1 A;  1B4Z A;  2CZL A;  2VGQ A;  4ZEC A;  4MH5 A;  2DXR A;  3U72 A;  4O3B A;  3MWB A;  1VSO A;  3IOT A;  3KBR A;  3MZ9 A;  4OVJ A;  1NKX A;  1N7W A;  1PB7 A;  4XKP A;  3Q26 A;  4R73 A;  3V83 A;  1ZJL A;  4XXU A;  2QS4 A;  1MY2 A;  1D4N A;  3GBA A;  1F9B A;  3K02 A;  4KYD A;  3KG2 A;  1LCT A;  4LON B;  1OQH A;  1OQG A;  2XX9 A;  1UIU A;  2I4C A;  5JTY B;  1T0K A;  4FAT A;  3MBP A;  1MY1 A;  3LSW A;  3K1N A;  1HSL A;  2IEE A;  3U93 A;  1FQB A;  5I59 B;  4DXU A;  1MM7 A;  4NED A;  2ZNU A;  3FVK A;  5I56 B;  3TTM A;  2XXH A;  3FVO A;  4JXI A;  3QUF A;  2FNC A;  4H6D A;  4ZED A;  3IOV A;  1LFI A;  3Q25 A;  3LSX A;  2I49 A;  2A5S A;  3IOR A;  3TPA A;  2QPQ A;  4FAJ A;  1MXV A;  3KSX A;  3R26 A;  1GTK A;  3SEU A;  2NUV A;  3KFM A;  2O1M A;  3PUZ E;  1H3D A;  3C31 A;  3MZB A;  1PDA A;  2OZZ A;  1MQJ A;  3T9H B;  4F22 A;  2P1S A;  5ISU A;  3FUZ A;  3QXM A;  3PMW A;  3HPI A;  2PMS A;  3TCH A;  2ONR A;  3OXN A;  3TTK A;  4KD5 A;  3DP4 A;  5CMK A;  3PU5 A;  2XXY A;  4EDP A;  2W7Y A;  1B7H A;  4IO5 A;  2F97 A;  3UK4 A;  3G7W A;  4NF4 B;  1MXU A;  3UIF A;  4ESX A;  1VR5 A;  3RN8 A;  3FXU A;  3ILU B;  4KHZ E;  3A3U A;  2Q89 A;  2F35 A;  5CMM A;  1VE4 A;  1B46 A;  3GBB A;  2HZL A;  1A99 A;  3U94 A;  3CIJ A;  2XXT A;  1N7X A;  4AB6 A;  5FTH A;  2F8D A;  3K0V A;  4HTG A;  1SYI A;  2FYI A;  4HCW A;  2YLN A;  1FTM A;  3FV2 A;  3H4Z A;  3TAJ A;  3K6V A;  5H8Q A;  2DWA A;  4P0G A;  2R71 A;  5LOM A;  3PD8 A;  2F6G A;  4U2R A;  4DXC A;  3QSL A;  3R6U A;  3B6Q A;  1JW4 A;  5CBR A;  1M5B A;  4POW A;  1ZMG A;  1A40 A;  3UP9 A;  5DTB A;  3S4U A;  1N84 A;  3LSL A;  1UTH B;  4F3P A;  1IXH A;  4F18 A;  5AA1 A;  4RJZ A;  3KN8 A;  5I2N A;  5H8H B;  1B5H A;  1ZLQ A;  4JBZ A;  3H03 A;  1MY0 A;  2HXW A;  3O66 A;  4QHQ A;  3TOD A;  3TTR A;  1MH4 A;  4LUB A;  1YPN A;  5AA4 A;  5JEI A;  2O7U A;  4YKJ A;  3IB1 A;  3F11 A;  1SVX B;  2A5T B;  3OSQ A;  3T9U A;  3VVF A;  2DE3 A;  5B7D A;  2V3T A;  3C34 A;  3O97 A;  4GFR A;  3T96 B;  2XX7 A;  2Q2C A;  4MLV A;  3AXF A;  4R75 A;  4I62 A;  2RKM A;  4C1T A;  3T9X B;  1HSJ A;  2O51 A;  4R6H A;  4HS7 A;  3P7I A;  4F31 B;  3G3K A;  3U1O A;  4NWD A;  1SW5 A;  3CRB A;  4OWD A;  1O63 A;  1B5J A;  1ZU0 A;  3MW0 A;  4YKK A;  4F3S A;  5FHO A;  4JSO A;  3PMX A;  2F5X A;  2Q88 A;  4FED A;  4U4X A;  3N94 A;  4G8M A;  4H1X A;  5KDT A;  1BP5 A;  3ZSF A;  3M3F A;  4QRZ A;  5EHM A;  1Y20 A;  1LB8 A;  1NMU A;  4NF6 B;  2ZYN A;  1A7L A;  3G3F A;  1R9L A;  3HST A;  4LA9 A;  2PYY A;  3RPW A;  2UVH A;  3THI A;  1YTV A;  4XKQ A;  1US4 A;  5I2K B;  3KN7 A;  3FV1 A;  3R7X A;  1R9Q A;  5L9O A;  3IX1 A;  1I6B A;  1EZ9 A;  1MPB A;  2I48 A;  3E9X A;  4R9G A;  2Y84 A;  4QSC A;  1JVX A;  3QUJ A;  2RCA A;  4QFK A;  1OIB A;  3TFL A;  4ZEF A;  2NXO A;  1NFT A;  3N26 A;  4JWX A;  2XXW A;  2HAV A;  4ESW A;  1B05 A;  2B3B A;  1UTB A;  4BDO A;  4PQJ A;  2R6G E;  1OMP A;  3CFX A;  2O69 A;  1SQY A;  1B7Z A;  4X1B A;  5K2X A;  4TLL B;  3N6U A;  4OET A;  1JNF A;  5M2V A;  1JEU A;  4ZE9 A;  4F1U A;  4OQO A;  4YAH X;  5H8S A;  5TP9 B;  3OO8 A;  3FJM A;  3MVY A;  1LLS A;  2DQV A;  5BWJ A;  4QSD A;  2XXV A;  2HFB A;  5EHS A;  2B3F A;  1SW4 A;  1GGG A;  4OZ9 A;  1EZP A;  3MVW A;  4Q30 B;  2RCB A;  2REG A;  3Q28 A;  4R2F A;  1H45 A;  4PFU A;  4ONY A;  4THI A;  3FJ7 A;  3E3K A;  4QFN A;  1M5F A;  3PPR A;  1FCK A;  1MDP 1;  1DTG A;  5F1Q A;  3TYH A;  5DYH A;  2HCA A;  2ZMB A;  2DS9 A;  5AA2 B;  3MJN A;  1URG A;  4KYS A;  1HSE A;  3CR9 A;  1IXC A;  2M8C A;  2PT2 A;  3ZS6 A;  3LC8 A;  4HW8 A;  3WAF A;  4ELR A;  1B51 A;  2AYS A;  3BKI B;  3IO6 A;  3VV5 A;  4OEN A;  1PEB A;  4ZZE A;  1S50 A;  1URD A;  2H9B A;  3E4R A;  2ALU A;  5DEX B;  4QFL A;  5JTY A;  3MPL A;  3PPO A;  1H44 A;  3PUV E;  4EQ7 A;  1P1W A;  3C32 A;  1B9J A;  2OLB A;  4F39 A;  1XC1 A;  2E1S A;  1P99 A;  3RQT A;  5I59 A;  4R6Y A;  4ELO A;  2I6E A;  1B3H A;  4ZEI A;  1SW1 A;  1MPD A;  1XHY A;  5I56 A;  3DP8 A;  2XX8 A;  3VXC A;  2NWJ A;  3IJX B;  3M3L A;  4AB5 A;  4NF5 B;  3ONM A;  4G68 B;  5FTI A;  2VD2 A;  3KOS A;  4H8I A;  2REJ A;  4MLQ A;  3WAE A;  4I1D A;  1PC3 A;  3TEL A;  3ECR A;  1VFD A;  1Q35 A;  4LZ5 A;  1POT A;  2DE2 A;  3GXA A;  3SET A;  4DCX A;  4IB2 A;  4C0R A;  3EQ1 A;  4O3C A;  1QKA A;  4QFP A;  3TTL A;  2O7I A;  4R74 A;  1J1N A;  1M5C A;  4BDL A;  4DXB A;  3MVZ A;  2GHA A;  4IO6 A;  3BBR A;  1I69 A;  3A3C A;  3QIM A;  4KQP A;  3IOU A;  2ZYO A;  3IK6 B;  4ELP A;  1URS A;  4H8J A;  5FHM A;  4BDQ A;  3L6H A;  1AOV A;  2ONS A;  3T93 B;  4NF4 A;  3PV0 E;  4KYE A;  2HZK A;  1YCJ A;  4OHN A;  1Y3N A;  4OFO A;  4IO3 A;  1D3K A;  4TOZ A;  1JW5 A;  3H3G A;  3HHG A;  3MP6 A;  3VVE A;  4OFJ A;  4XIG Q;  1R1N A;  1XOC A;  3MP8 A;  2I58 A;  2PBW A;  2P2A A;  4NMY A;  3PUY E;  3V8X B;  4KCD A;  3UN6 A;  1H43 A;  3O9P A;  1Z7M E;  4OEU A;  3HHF A;  3SES A;  2Q2A A;  2UVJ A;  1A8F A;  3K6U A;  4G4P A;  3IO4 A;  1WVJ A;  2B65 A;  1MXW A;  5DVF A;  5ICQ A;  5CMB A;  4IO2 A;  2O84 X;  3RLF E;  4FEB A;  1Y4T A;  5EYF A;  3EHU A;  5FHN A;  4RXL A;  4BDN A;  5IAI A;  4OMB A;  3K2D A;  4EUO A;  1DOT A;  3T22 A;  4FOR A;  2UXA A;  4PET A;  1MS7 A;  3TQL A;  1UTH A;  3OO7 A;  3TDJ A;  2WKY A;  5H8H A;  4IO7 A;  4EQB A;  3FD3 A;  1B40 A;  2ANJ A;  2QJE A;  3TEP A;  4LVQ A;  4K3F A;  1Q1K A;  2GHB A;  4FIM A;  3W15 C;  4F19 A;  3QAX A;  2F78 A;  3MZ1 A;  3H06 B;  2OJT A;  4YB6 A;  4YIC A;  2A5T A;  3FGS A;  1MXX A;  3IB0 A;  1TWY A;  2DWH A;  2QSX A;  2QS3 A;  3VDF A;  1MQI A;  3SEX A;  3OO9 A;  1LST A;  4M4G A;  1B5I A;  2DWJ A;  2QS2 A;  1B1X A;  4H5F A;  1AL3 A;  3PPN A;  3E13 X;  4ISU A;  4G8H A;  3BFT A;  4LQ5 A;  1IQ7 A;  1D9Y A;  3OMB A;  1QJM A;  1USY E;  4KCC A;  1IIT A;  3SDF A;  5I58 B;  1EU8 A;  1JW1 A;  1B52 A;  3OEN A;  1M5D A;  2PVU A;  3PGF A;  1EH3 A;  4KPT A;  4EQ9 A;  4NF6 A;  1D9V A;  1BIY A;  2O1L A;  1IZ1 A;  1FQA A;  1DMB A;  4FE8 A;  2Y7W A;  4DE8 A;  2ZYM A;  1RYX A;  5I84 A;  4N6P A;  4LAT A;  2R9J A;  5L9M A;  4G77 A;  5I2K A;  2I0B A;  1IUD A;  1LAF E;  1MQD A;  1LBC A;  3OSR A;  4C1U A;  2RIN A;  3CG3 A;  2H4I A;  2UVI A;  4E0W A;  4WXJ A;  3I6V A;  4U1O A;  4F1V A;  5HM4 B;  4YB5 A;  2XXU A;  3BFU A;  2ESN A;  2OWS A;  3T9V A;  3H6V A;  1ZKB A;  2XXI A;  2HAU A;  1MRP A;  4DZ1 A;  3DM0 A;  3CFL A;  2DWI A;  4N13 A;  5AE4 A;  3C33 A;  4H5G A;  4I8C A;  1N3W A;  4GQO A;  2OWT A;  1VFE A;  3H6T A;  1Y3Q A;  2DE4 A;  2F7C A;  3OEL A;  5TP9 A;  2GFE A;  4OYV A;  4O3A A;  4Q5T A;  5H8F B;  2VOZ A;  2RF1 A;  1IXI A;  1LFH A;  2D21 A;  4GF8 A;  3N6T A;  1QW0 A;  2P0S A;  4KR5 A;  2CMO A;  2IA4 A;  4F1Y A;  5CM6 A;  1OLA A;  4OES A;  3OD7 A;  4M1V A;  1MXZ A;  1JVY A;  4GXS B;  5TU0 A;  3ZKK A;  3KOT A;  1B0L A;  4U22 A;  3CVG A;  3G3I A;  3UA8 A;  1BKA A;  3MQ9 A;  3MAM A;  4H67 A;  1ANF A;  1II5 A;  2QMX A;  4IGT A;  3FXR A;  4GWO A;  2F34 A;  1S7Y A;  5DT6 A;  1BLF A;  4YZZ A;  4X1D A;  4XKN A;  1SD3 A;  1MQG A;  2PT1 A;  4N07 A; 
#chains in the Genus database with same CATH topology
 1WOD A;  1NH8 A;  5AA2 A;  2AL4 A;  2DYX A;  3RT8 A;  3S9M C;  3PMV A;  5JK4 A;  3ILT B;  4HXV A;  3VLV A;  3S9E A;  2D5W A;  4RPN A;  4G2Z A;  1EZO A;  3QYT A;  3O6I A;  4HCY A;  1FJ6 A;  1MPC A;  4Z0I A;  5T3J A;  1SI1 A;  3U92 A;  1FTJ A;  4JVD A;  2QVV A;  5DEX A;  2XWK A;  1OVB A;  1PB8 A;  1US5 A;  3KJ7 A;  3N5L A;  1USY H;  1LEV A;  2H25 A;  3MST A;  1JEV A;  2L5V A;  3B50 A;  3V89 B;  4ECF A;  1SDX A;  4MCO A;  5H8N B;  1NNK A;  4Z7E A;  1DPE A;  3TQW A;  1FTA A;  4MF3 A;  4TQU Q;  3HFU A;  4PCD A;  3JZJ A;  3K01 A;  3USD A;  1POY 1;  1PB9 A;  2F7A A;  4NE4 A;  4WKM A;  4PFT A;  1LBB A;  1LB9 A;  4Q0C A;  5AA3 A;  1FQF A;  4NF5 A;  2F7B A;  2Z8F A;  3PTY A;  4G68 A;  4LN5 A;  2HPG A;  3CSB A;  5EQ9 A;  2XXX A;  2Z23 A;  5F7V A;  2DOJ A;  4NF8 B;  3RYD A;  4R9F A;  1GR2 A;  1FQD A;  5DW8 A;  2GH9 A;  3VLU A;  4PE3 A;  5J1D A;  5F24 A;  4XFE A;  3K00 A;  1PBP A;  3M3K A;  2V84 A;  2Y7I A;  3G3G A;  4TLM B;  4N8G A;  3FZV A;  2V25 A;  2XXR A;  5CC2 A;  2DP8 A;  3K4U A;  1KWH A;  1SW2 A;  2V3Q A;  2XHD A;  3IJO B;  4DCY A;  1UIV A;  3UGW A;  4JB7 A;  3SZP A;  4PFY A;  2KLF A;  3TCG A;  4BDR A;  3E79 A;  4PP0 A;  2F3B A;  2LAO A;  4G68 C;  5K2Y A;  4RK2 A;  1FJ9 A;  1O7T A;  2ZZW A;  2I3W A;  5A5X B;  4E0X A;  2QMW A;  4RNS A;  2ZZX A;  2HEU A;  4FEC A;  3O29 A;  3RTF B;  1N0T A;  4JDF A;  4PFW A;  4UAC A;  4G8N A;  1LAG E;  1P1N A;  1A54 A;  1ATG A;  3MUQ A;  1A55 A;  3D4G A;  5CRY A;  4P11 A;  4RA1 A;  4ZDM A;  4AS4 A;  5I57 B;  1FTK A;  3RT6 B;  4XEQ A;  1NNT A;  2ZNS A;  1LFG A;  4MMP A;  1RKM A;  4I9D A;  2HQ0 A;  1B3E A;  5KCJ B;  1QKB A;  1B4H A;  3C35 A;  1FW0 A;  3C9H A;  4LZ8 A;  4GX6 A;  3H6U A;  4EF1 A;  4ELQ A;  2OWZ A;  1NI9 A;  3W9W A;  2VHA A;  3H6W A;  2DSF A;  3RTW B;  3UOR A;  2CEX A;  2VP1 A;  4P8B A;  3A09 A;  2Q8J A;  1MH3 A;  5TPA B;  1LBX A;  4JVI A;  1YAE A;  3W9V A;  3NOH A;  1AH5 A;  3K1M A;  3TCF A;  2HHM A;  1CE2 A;  4U23 A;  2RC8 A;  4IY6 A;  3FAT A;  3B7D A;  1OVT A;  3VXB A;  3SEW A;  1B2H A;  2X26 A;  4X8R A;  1QUL A;  2ONK E;  4JWO A;  2H5Y A;  4DLD A;  2BJJ X;  3GZG A;  3PUX E;  2ABH A;  4EF2 A;  4R2B A;  4UAB A;  4P0I A;  5CI5 A;  2Q8M A;  1M5E A;  3IAZ A;  1Z7N E;  3G3J A;  2Z8D A;  3PUW E;  1L5T A;  1I6A A;  2OCU A;  2NVU B;  3KSJ A;  4U21 A;  2AIX A;  2QVU A;  4MAG A;  2WYP A;  4WEP A;  1N04 A;  3TMG A;  4LZ7 A;  1N3X A;  1RYO A;  1P1U A;  4JWY A;  4F2O A;  4YB7 A;  1NL5 A;  1ELJ A;  3K6X A;  1DSN A;  3TZA A;  2AL5 A;  3EKI A;  2I3V A;  3SER A;  3RUM A;  4GWS A;  1XT8 A;  1MDQ A;  3OEM A;  3FVG A;  1O64 A;  1AIV A;  5ITO A;  1KA0 A;  2I4B A;  1ZIU A;  5AA2 D;  2UYF A;  5I58 A;  5I7I A;  2V93 A;  1XS5 A;  3I5O A;  2H99 A;  3ODB A;  1I6Q A;  3T66 A;  3EN3 A;  1MG1 A;  4R6K A;  1EYI A;  1FBH A;  1RDZ A;  2YJP A;  4U1Z A;  3K1P A;  1NUZ A;  1R6Z A;  4F3B A;  4OVT A;  4RK9 A;  1P1Q A;  2QL3 A;  3RNN A;  3C36 A;  3MC2 A;  3FAS A;  1SBP A;  1SYH A;  4X48 A;  4DI3 D;  2ZNT A;  5IZ3 B;  2P3N A;  4EXL A;  5DVI A;  3O28 A;  4YU0 A;  4EXK A;  2DVC A;  4FJP A;  4P3L A;  4WED A;  4NTL A;  1B7U A;  1FPJ A;  4OXV A;  4BDM A;  4GOT A;  3HCQ A;  4GD5 A;  1FQE A;  2Y7P A;  4MFI A;  3SEY A;  3U8Q A;  3O2A A;  5IKB A;  5CMC A;  2OBG A;  3DLN A;  1MXY A;  1QVS A;  2UVG A;  1N76 A;  2X7P A;  3K6W A;  1Y4C A;  3EHS A;  1NUW A;  5EYH A;  3SKP A;  3DEL B;  3O6H A;  3KC1 A;  2XD2 A;  1B58 A;  5ELV A;  3LR1 A;  2OK2 A;  4XTC Q;  4QXD A;  4OVR A;  1DTZ A;  2QRY A;  3KZG A;  2DVZ A;  3IOW A;  2O6A A;  2WBD A;  3O6G A;  1P1O A;  4MBP A;  4POX A;  4OEV A;  3U65 A;  3OOA A;  3HO7 A;  1G0I A;  1FTL A;  1AMF A;  1DPP A;  4P9K A;  3FIR A;  3EHT A;  5H8F A;  1B32 A;  1LAX A;  2Z8E A;  3IB2 A;  4YMA A;  2RC7 A;  4ZEB A;  2I0C A;  3D4C A;  4NQ8 A;  3C4M A;  4OER A;  3V5A A;  3VE1 B;  2UYE A;  3S2V A;  3H7M A;  2ZXT A;  5H8Q B;  3LUY A;  4H0W A;  4QF9 A;  1LAH E;  4GX4 A;  1UQW A;  4GRK A;  4ND9 A;  4PGP A;  2B4L A;  2F6P A;  3B6W A;  1MY4 A;  2ZZV A;  1TXF A;  1PBQ A;  4YMB A;  4KFQ A;  1XVY A;  2QS1 A;  4QSE A;  3L6G A;  1OLC A;  3G3H A;  4N17 A;  4F2Q A;  3S9N C;  3DP6 A;  3M8U A;  3ROJ A;  1IEJ A;  1LGB C;  3JYR A;  3CSG A;  3FXQ A;  4XKR A;  1B0H A;  4KI0 E;  1IME A;  1Y9U A;  3QK6 A;  1B3G A;  3HV1 A;  4JSD A;  1TFA A;  5I2N B;  3B6T A;  2FA7 A;  2F36 A;  3Q29 A;  3PPQ A;  1BTJ A;  3RY3 A;  1H76 A;  5AA4 B;  3CFZ A;  3RGY A;  2THI A;  1FPE A;  4OVS A;  4OTE A;  3VFJ A;  3D1R A;  1FBC A;  5BUU A;  5DVJ A;  1QUK A;  3CG1 A;  3T1B A;  4F3G A;  1A8E A;  1SI0 A;  4OFL A;  3BIG A;  4R72 A;  2V3U A;  4DDD A;  2X7Q A;  2E0S A;  5B70 A;  2FVZ A;  4ZS9 A;  4AS5 A;  3IR1 A;  4LP2 B;  1MY3 A;  1S9T A;  3EF7 A;  3MP1 A;  4GLI A;  4IY5 A;  1WDN A;  5H8N A;  2GRV A;  1GV8 A;  4GVO A;  4NHB A;  5L9S A;  1MQH A;  3JV9 A;  3TTN A;  4ZEK A;  1IMC A;  3OEK A;  3SEV A;  1MM6 A;  5ITP A;  5KDT B;  1TFD A;  1IIW A;  3KBZ A;  4GL0 A;  4H65 A;  5CBS A;  2H98 A;  4AQ4 A;  3IL1 B;  1IXG A;  4N4U A;  1NV5 A;  1GVC A;  2CZI A;  2Y7R A;  4IGR A;  3PD9 A;  2XD3 A;  3S9L C;  4NF8 A;  1B1H A;  3Q27 A;  3FVN A;  4Q8R A;  5L8D A;  1RDX A;  3KGC A;  3I3V A;  2G29 A;  2ZYK A;  3VLW A;  5KZT A;  3CI8 A;  1LCF A;  4OVP A;  1XVX A;  1NH7 A;  1JQF A;  2Z22 A;  4LQ2 A;  4UA8 A;  1FTO A;  4GIZ A;  4H46 A;  3GLB A;  1INP A;  4RPO A;  3KJT A;  4OVQ A;  3LSF B;  3PPP A;  3LBS A;  3KN3 A;  3MPK A;  4GXA A;  4NWC A;  1NNP A;  1G0H A;  4X9T A;  1UTB B;  4DIG A;  3EPE A;  4YKP A;  1JP4 A;  1QUJ A;  2D3I A;  1QUI A;  3HN0 A;  2O68 A;  4RY1 A;  5A5X A;  1CB6 A;  4RYA A;  2VD3 A;  3KEI A;  1ZBM A;  3MVX A;  2DXY A;  1FQC A;  1Y1Z A;  2XXP A;  3FJG A;  5HBC A;  2JJK A;  1B6H A;  4PE5 B;  4L17 A;  5ICT A;  3OO6 A;  2PX1 A;  2KQZ A;  3LV0 A;  4U4S A;  4IO4 A;  1B3L A;  2XXQ A;  3VVD A;  2NOO A;  5HPQ A;  3ZKL A;  2Q9T A;  1Y3P A;  5I57 A;  4F29 A;  1JET A;  2G93 A;  1Y1M A;  5EYG A;  2RC9 A;  3TUS A;  2Y5K A;  3FXB A;  4PBH A;  1B3F A;  4BLA A;  5KCJ A;  5IZ1 A;  3TKD A;  2YPN A;  2Y7K A;  4YKI A;  1ZTY A;  2PCR A;  1NV7 A;  4GL8 A;  1NNF A;  4ZZA A;  4PTK A;  4QFO A;  4ZE8 A;  2WYK A;  4GX3 A;  5TPA A;  3MYU A;  1TT1 A;  1IMF A;  1B4Z A;  2CZL A;  2VGQ A;  5ET8 A;  4ZEC A;  4MH5 A;  2DXR A;  1FPD A;  3U72 A;  4O3B A;  3MWB A;  1NV6 A;  1VSO A;  3IOT A;  3KBR A;  3MZ9 A;  4OVJ A;  1NKX A;  1SPI A;  4OA4 A;  1N7W A;  1PB7 A;  4MIJ A;  2FIX A;  3QMF A;  4XKP A;  3Q26 A;  4R73 A;  3V83 A;  3IFC A;  1ZJL A;  3LUZ A;  3B8B A;  4XXU A;  2QS4 A;  5IM2 A;  4P1L A;  1MY2 A;  1D4N A;  2CEY A;  3GBA A;  4NF0 A;  1F9B A;  3K02 A;  4KYD A;  3KG2 A;  1LCT A;  2P3V A;  4LON B;  5FBP A;  1OQH A;  1OQG A;  2XX9 A;  1UIU A;  2I4C A;  5JTY B;  1T0K A;  4FAT A;  3MBP A;  4PDD A;  2WBB A;  1MY1 A;  4PF6 A;  3LSW A;  3K1N A;  1HSL A;  2IEE A;  4PDH A;  3U93 A;  1FQB A;  5I59 B;  4DXU A;  1MM7 A;  2FBP A;  4NED A;  2ZNU A;  3FVK A;  4GWU A;  5I56 B;  3TTM A;  2XXH A;  4IR8 A;  3FVO A;  4JXI A;  4DI4 B;  3QUF A;  2FNC A;  4H6D A;  3RPL B;  1FPK A;  4ZED A;  3IOV A;  1LFI A;  1FPB A;  3Q25 A;  3LSX A;  2I49 A;  2A5S A;  3IOR A;  3TPA A;  2QPQ A;  4FAJ A;  1MXV A;  3KSX A;  3R26 A;  1GTK A;  3SEU A;  2NUV A;  1LBZ A;  3KFM A;  2O1M A;  3PUZ E;  1H3D A;  3C31 A;  3MZB A;  1FSA A;  1PDA A;  2OZZ A;  4GWX A;  5IZ3 A;  1MQJ A;  3T9H B;  2XWO A;  4F22 A;  2P1S A;  5ISU A;  3FUZ A;  3QXM A;  3PMW A;  3HPI A;  2PMS A;  3TCH A;  2ONR A;  3OXN A;  3ISP A;  3TTK A;  4KD5 A;  3DP4 A;  5CMK A;  3PU5 A;  2XXY A;  1XI6 A;  1QGX A;  4EDP A;  2W7Y A;  1B7H A;  1VDW A;  4IO5 A;  4P1E A;  2F97 A;  3UK4 A;  3G7W A;  4NF4 B;  1MXU A;  2VPO A;  3UIF A;  4ESX A;  1VR5 A;  3RN8 A;  3FXU A;  1FBG A;  3ILU B;  4KHZ E;  3A3U A;  2Q89 A;  2F35 A;  1NUX A;  4I3Y A;  5CMM A;  1VE4 A;  1B46 A;  3GBB A;  2HZL A;  4N6K A;  4PF8 A;  1A99 A;  3U94 A;  4KXP A;  3CIJ A;  2XXT A;  1N7X A;  4AB6 A;  5FTH A;  2F8D A;  3K0V A;  4HTG A;  1SYI A;  2FYI A;  4I40 A;  4HCW A;  4GWW A;  1DCU A;  2YLN A;  1FTM A;  4PC9 A;  3FV2 A;  3H4Z A;  3TAJ A;  3K6V A;  5H8Q A;  2DWA A;  4P0G A;  2R71 A;  5LOM A;  4NAP A;  3PD8 A;  2F6G A;  4U2R A;  4DXC A;  4MJO A;  1LBW A;  3QSL A;  3R6U A;  3B6Q A;  4PFI A;  2XWI A;  5IGA A;  1JW4 A;  4FBP A;  5CBR A;  1M5B A;  4POW A;  1ZMG A;  1A40 A;  3UP9 A;  5DTB A;  3S4U A;  1NUY A;  1N84 A;  3LSL A;  1UTH B;  4F3P A;  5J16 A;  1IXH A;  4F18 A;  5AA1 A;  4RJZ A;  3KN8 A;  5I2N A;  5H8H B;  5I3S A;  1B5H A;  1ZLQ A;  3FBP A;  4JBZ A;  1KZ8 A;  3H03 A;  1MY0 A;  2HXW A;  3O66 A;  4QHQ A;  3TOD A;  3TTR A;  1MH4 A;  4LUB A;  1YPN A;  5AA4 A;  5JEI A;  2O7U A;  1LBV A;  4YKJ A;  3IB1 A;  3F11 A;  1SVX B;  2A5T B;  3OSQ A;  3T9U A;  3VVF A;  2DE3 A;  4O7M A;  5B7D A;  2V3T A;  2FIE A;  3C34 A;  3O97 A;  4GFR A;  3T96 B;  2XX7 A;  2Q2C A;  4MLV A;  3AXF A;  4R75 A;  4I62 A;  2RKM A;  4C1T A;  3T9X B;  1HSJ A;  2O51 A;  4R6H A;  4HS7 A;  3P7I A;  4F31 B;  4N15 A;  3G3K A;  3U1O A;  4NWD A;  1SW5 A;  3CRB A;  4OWD A;  1O63 A;  1B5J A;  1ZU0 A;  3MW0 A;  4YKK A;  4F3S A;  5FHO A;  1EYJ A;  4PFR A;  4JSO A;  3PMX A;  2F5X A;  2Q88 A;  4FED A;  4U4X A;  3N94 A;  4G8M A;  4H1X A;  5KDT A;  1BP5 A;  3ZSF A;  3M3F A;  4QRZ A;  5EHM A;  1Y20 A;  1LB8 A;  5A5L A;  1NMU A;  4NF6 B;  2ZYN A;  1A7L A;  1IMA A;  3G3F A;  1R9L A;  3HST A;  4LA9 A;  2PYY A;  4MNI A;  3RPW A;  2UVH A;  2Q74 A;  3THI A;  1YTV A;  4XKQ A;  1US4 A;  5I2K B;  2V4C A;  3KN7 A;  3FV1 A;  1NV3 A;  5IZZ A;  3R7X A;  1R9Q A;  4HE0 A;  5L9O A;  3IX1 A;  2R8T A;  5ESY A;  1FBD A;  1I6B A;  1EZ9 A;  1MPB A;  2I48 A;  3E9X A;  1IMB A;  4R9G A;  2CZK A;  2GQ1 A;  2Y84 A;  4QSC A;  1JVX A;  3QUJ A;  1FPL A;  2RCA A;  4QFK A;  1OIB A;  3TFL A;  4ZEF A;  2NXO A;  1NFT A;  3N26 A;  4JWX A;  2XXW A;  2HAV A;  1DK4 A;  4ESW A;  1B05 A;  1YZ0 A;  2B3B A;  1UTB A;  4BDO A;  4PQJ A;  2R6G E;  1OMP A;  1K9Y A;  3CFX A;  2O69 A;  1SQY A;  1B7Z A;  4GBW A;  4X1B A;  5K2X A;  4TLL B;  3N6U A;  4OET A;  1JNF A;  2VPN A;  5M2V A;  4MX6 A;  1JEU A;  4ZE9 A;  4F1U A;  4OQO A;  4YAH X;  5H8S A;  5TP9 B;  3OO8 A;  5EQ7 A;  3FJM A;  3MVY A;  2OX3 A;  1LLS A;  2DQV A;  5BWJ A;  4NX1 A;  4QSD A;  2XXV A;  1KA1 A;  3KC0 A;  2HFB A;  5EHS A;  2B3F A;  1SW4 A;  1GGG A;  4OZ9 A;  1EZP A;  4O7I A;  3MVW A;  4Q30 B;  2RCB A;  2REG A;  3Q28 A;  4R2F A;  4XF5 A;  1H45 A;  4PFU A;  2WEF A;  4HE1 A;  4ONY A;  4THI A;  3IFA A;  3FJ7 A;  3E3K A;  5ET5 A;  4QFN A;  1M5F A;  3PPR A;  1FCK A;  1MDP 1;  1DTG A;  5F1Q A;  1CNQ A;  3TYH A;  5DYH A;  2HCA A;  2ZMB A;  2DS9 A;  5EQ8 A;  5AA2 B;  3MJN A;  1URG A;  4KYS A;  1HSE A;  3CR9 A;  1IXC A;  2M8C A;  2PT2 A;  3ZS6 A;  3LC8 A;  4HW8 A;  1LBY A;  3WAF A;  4ELR A;  1B51 A;  2AYS A;  3BKI B;  3IO6 A;  3VV5 A;  2F3D A;  4OEN A;  1PEB A;  1FPF A;  4OAN A;  4ZZE A;  1S50 A;  1URD A;  2H9B A;  3E4R A;  2ALU A;  5DEX B;  4QFL A;  5JTY A;  3MPL A;  3PPO A;  1H44 A;  2QFL A;  4N8Y A;  3PUV E;  2MKZ A;  4EQ7 A;  1P1W A;  3C32 A;  1B9J A;  2CZH A;  2OLB A;  4F39 A;  1XC1 A;  2E1S A;  1P99 A;  5LTC A;  3RQT A;  5I59 A;  4R6Y A;  4ELO A;  2BJI A;  2I6E A;  3CHG A;  1YYZ A;  1B3H A;  4G61 A;  4ZEI A;  1K9Z A;  1SW1 A;  1MPD A;  1XHY A;  5I56 A;  3DP8 A;  2XX8 A;  4GBV A;  3VXC A;  2PFY A;  1EYK A;  2NWJ A;  3IJX B;  3M3L A;  3RPL A;  4NF5 B;  3ONM A;  4AB5 A;  4G68 B;  5FTI A;  2VD2 A;  3KOS A;  4H8I A;  2REJ A;  4MLQ A;  3WAE A;  4I1D A;  4HE2 A;  1PC3 A;  3TEL A;  3ECR A;  1VFD A;  5I5P A;  1Q35 A;  4LZ5 A;  1POT A;  4MEV A;  2DE2 A;  3GXA A;  3SET A;  4DCX A;  4IB2 A;  4C0R A;  3EQ1 A;  4O3C A;  1QKA A;  5ET7 A;  1NV0 A;  4QFP A;  3TTL A;  2O7I A;  4JVC A;  4R74 A;  1J1N A;  1M5C A;  4BDL A;  4DXB A;  3MVZ A;  2GHA A;  4IO6 A;  3BBR A;  1I69 A;  3A3C A;  3QIM A;  4KQP A;  1DBZ A;  3IOU A;  2ZYO A;  3IK6 B;  3BIH A;  2Y5L A;  3GYY A;  4ELP A;  1NV4 A;  1URS A;  4H8J A;  1FBF A;  2PFZ A;  5FHM A;  4BDQ A;  3L6H A;  1AOV A;  2ONS A;  3T93 B;  4NF4 A;  4GWZ A;  3PV0 E;  4KYE A;  2HZK A;  4H45 A;  1YCJ A;  4OHN A;  4N91 A;  1Y3N A;  4N6D A;  4OFO A;  1AWB A;  2HXR A;  4IO3 A;  1D3K A;  4TOZ A;  1JW5 A;  3H3G A;  3HHG A;  3MP6 A;  3VVE A;  4OFJ A;  1YXI A;  4XIG Q;  1R1N A;  1XOC A;  3MP8 A;  2I58 A;  2PBW A;  2P2A A;  4NMY A;  3PUY E;  3V8X B;  4KCD A;  3UN6 A;  1H43 A;  4X04 A;  3O9P A;  1Z7M E;  4OEU A;  3HHF A;  3SES A;  2Q2A A;  2UVJ A;  1A8F A;  3K6U A;  4G4P A;  3IO4 A;  1WVJ A;  2B65 A;  4PFB A;  1MXW A;  4NG7 A;  3T0J A;  5DVF A;  5ICQ A;  5CMB A;  4IO2 A;  2O84 X;  3RLF E;  4FEB A;  1Y4T A;  5EYF A;  3EHU A;  5FHN A;  4RXL A;  4BDN A;  4NN3 A;  5IAI A;  4OMB A;  3K2D A;  1NV1 A;  4EUO A;  1DOT A;  3T22 A;  4FOR A;  3E78 A;  2UXA A;  4P47 A;  4PET A;  1MS7 A;  3TQL A;  1UTH A;  3OO7 A;  3TDJ A;  2WKY A;  5H8H A;  4O8M A;  1FPG A;  4IO7 A;  4EQB A;  3FD3 A;  1B40 A;  2ANJ A;  2QJE A;  3TEP A;  4LVQ A;  4K3F A;  1Q1K A;  2GHB A;  4FIM A;  3W15 C;  4F19 A;  3QAX A;  2F78 A;  3MZ1 A;  4N81 A;  3H06 B;  2OJT A;  4YB6 A;  4YIC A;  2A5T A;  3FGS A;  1MXX A;  3IB0 A;  1TWY A;  2DWH A;  2QSX A;  2QS3 A;  3VDF A;  1MQI A;  2KR0 A;  3SEX A;  3OO9 A;  1LST A;  4M4G A;  1B5I A;  2DWJ A;  2QS2 A;  1B1X A;  4H5F A;  1AL3 A;  3PPN A;  3E13 X;  1FBP A;  4ISU A;  4G8H A;  3BFT A;  4LQ5 A;  1IQ7 A;  1D9Y A;  3OMB A;  2WX9 A;  1QJM A;  4GWY A;  1USY E;  4KCC A;  1IIT A;  3SDF A;  4I3E A;  5I58 B;  1EU8 A;  1JW1 A;  1B52 A;  3OEN A;  1M5D A;  2PVU A;  5ET6 A;  3PGF A;  1EH3 A;  4KPT A;  4EQ9 A;  4NF6 A;  1D9V A;  1BIY A;  2O1L A;  1IZ1 A;  1FQA A;  4PAF A;  4PAI A;  1DMB A;  4FE8 A;  4PBQ A;  2FHY A;  2Y7W A;  4DE8 A;  2ZYM A;  1RYX A;  4PAK A;  5I84 A;  4N6P A;  4LAT A;  2R9J A;  1Q9D A;  5L9M A;  1FBE A;  4G77 A;  5I2K A;  2I0B A;  1IUD A;  1NV2 A;  1LAF E;  1MQD A;  1LBC A;  3OSR A;  4C1U A;  2RIN A;  3CG3 A;  2H4I A;  2UVI A;  4E0W A;  4WXJ A;  3I6V A;  4U1O A;  4F1V A;  5HM4 B;  4YB5 A;  2XXU A;  3BFU A;  2ESN A;  1IMD A;  2OWS A;  3T9V A;  3H6V A;  1ZKB A;  2XXI A;  2HAU A;  1MRP A;  1D9Q A;  4DZ1 A;  3DM0 A;  3CFL A;  2B4M A;  2DWI A;  4N13 A;  5AE4 A;  3C33 A;  4H5G A;  4I8C A;  1N3W A;  4GQO A;  2OWT A;  4MHF A;  2DDK A;  1VFE A;  3H6T A;  2VT5 A;  1Y3Q A;  4PGN A;  2DE4 A;  2F7C A;  3OEL A;  3A29 A;  5TP9 A;  2GFE A;  4OYV A;  4O3A A;  4Q5T A;  5H8F B;  2VOZ A;  2RF1 A;  1IXI A;  5EQA A;  1LFH A;  2D21 A;  4GF8 A;  3N6T A;  1QW0 A;  2P0S A;  4KR5 A;  2CMO A;  1FPI A;  2IA4 A;  4F1Y A;  5CM6 A;  2QVR A;  1FRP A;  1OLA A;  4OES A;  3OD7 A;  4M1V A;  1MXZ A;  1JVY A;  4MNP A;  4P56 A;  4GXS B;  1BK4 A;  5TU0 A;  3ZKK A;  3KOT A;  1B0L A;  2XXK A;  4U22 A;  3CVG A;  2XWV A;  3G3I A;  3UA8 A;  1BKA A;  1RDY A;  3MQ9 A;  3MAM A;  4H67 A;  1ANF A;  1II5 A;  5LDZ A;  2QMX A;  4IGT A;  4O94 A;  3FXR A;  4GWO A;  2F34 A;  1S7Y A;  4MNC A;  5DT6 A;  1BLF A;  4YZZ A;  4X1D A;  4XKN A;  1SD3 A;  4QBA A;  4NGU A;  2XA5 A;  1MQG A;  2PT1 A;  4N07 A; 
#chains in the Genus database with same CATH homology
 1WOD A;  1NH8 A;  5AA2 A;  2AL4 A;  2DYX A;  3RT8 A;  3S9M C;  3PMV A;  5JK4 A;  3ILT B;  3VLV A;  3S9E A;  2D5W A;  4RPN A;  4G2Z A;  1EZO A;  3QYT A;  3O6I A;  4HCY A;  1MPC A;  4Z0I A;  1SI1 A;  3U92 A;  1FTJ A;  5DEX A;  1OVB A;  1PB8 A;  1US5 A;  3KJ7 A;  3N5L A;  1USY H;  2H25 A;  1JEV A;  3V89 B;  4ECF A;  1SDX A;  5H8N B;  1NNK A;  4Z7E A;  1DPE A;  3TQW A;  4MF3 A;  4TQU Q;  3JZJ A;  3K01 A;  3USD A;  1POY 1;  1PB9 A;  2F7A A;  4NE4 A;  4WKM A;  4PFT A;  1LBB A;  1LB9 A;  4Q0C A;  5AA3 A;  1FQF A;  4NF5 A;  2F7B A;  2Z8F A;  4G68 A;  3CSB A;  2XXX A;  2Z23 A;  5F7V A;  2DOJ A;  4NF8 B;  4R9F A;  1GR2 A;  1FQD A;  2GH9 A;  3VLU A;  5J1D A;  3K00 A;  1PBP A;  3M3K A;  2V84 A;  2Y7I A;  3G3G A;  4TLM B;  3FZV A;  2V25 A;  2XXR A;  5CC2 A;  2DP8 A;  3K4U A;  1KWH A;  1SW2 A;  2V3Q A;  2XHD A;  3IJO B;  4DCY A;  1UIV A;  3UGW A;  4JB7 A;  4PFY A;  2KLF A;  3TCG A;  4BDR A;  4PP0 A;  2LAO A;  4G68 C;  5K2Y A;  4RK2 A;  1O7T A;  2I3W A;  5A5X B;  4E0X A;  2QMW A;  4RNS A;  2HEU A;  4FEC A;  3O29 A;  3RTF B;  1N0T A;  4JDF A;  4PFW A;  4UAC A;  4G8N A;  1LAG E;  1P1N A;  1A54 A;  1ATG A;  3MUQ A;  1A55 A;  3D4G A;  5CRY A;  4P11 A;  4RA1 A;  4ZDM A;  5I57 B;  1FTK A;  3RT6 B;  1NNT A;  2ZNS A;  1LFG A;  1RKM A;  4I9D A;  2HQ0 A;  1B3E A;  5KCJ B;  1QKB A;  1B4H A;  3C35 A;  1FW0 A;  3C9H A;  4LZ8 A;  3H6U A;  4EF1 A;  4ELQ A;  3W9W A;  2VHA A;  3H6W A;  2DSF A;  3RTW B;  3UOR A;  2VP1 A;  3A09 A;  2Q8J A;  1MH3 A;  5TPA B;  1YAE A;  3W9V A;  1AH5 A;  3K1M A;  3TCF A;  1CE2 A;  4U23 A;  2RC8 A;  4IY6 A;  3FAT A;  3B7D A;  1OVT A;  3VXB A;  3SEW A;  1B2H A;  2X26 A;  1QUL A;  2ONK E;  4JWO A;  2H5Y A;  4DLD A;  2BJJ X;  3GZG A;  3PUX E;  2ABH A;  4EF2 A;  4R2B A;  4P0I A;  5CI5 A;  1M5E A;  3IAZ A;  1Z7N E;  3G3J A;  2Z8D A;  3PUW E;  1L5T A;  1I6A A;  2OCU A;  2NVU B;  3KSJ A;  4U21 A;  2AIX A;  4WEP A;  1N04 A;  3TMG A;  4LZ7 A;  1N3X A;  1RYO A;  1P1U A;  4JWY A;  4F2O A;  4YB7 A;  1NL5 A;  1ELJ A;  3K6X A;  1DSN A;  3TZA A;  2AL5 A;  2I3V A;  3SER A;  3RUM A;  1XT8 A;  1MDQ A;  3OEM A;  3FVG A;  1O64 A;  1AIV A;  5ITO A;  2I4B A;  1ZIU A;  5AA2 D;  2UYF A;  5I58 A;  2V93 A;  1XS5 A;  3I5O A;  2H99 A;  3ODB A;  1I6Q A;  3T66 A;  3EN3 A;  1MG1 A;  4R6K A;  2YJP A;  4U1Z A;  3K1P A;  1R6Z A;  4F3B A;  4RK9 A;  1P1Q A;  2QL3 A;  3RNN A;  3C36 A;  3MC2 A;  3FAS A;  1SBP A;  1SYH A;  4X48 A;  2ZNT A;  4EXL A;  5DVI A;  3O28 A;  4YU0 A;  4EXK A;  2DVC A;  4FJP A;  4WED A;  4NTL A;  1B7U A;  4OXV A;  4BDM A;  4GOT A;  3HCQ A;  4GD5 A;  1FQE A;  2Y7P A;  4MFI A;  3SEY A;  3U8Q A;  3O2A A;  5IKB A;  5CMC A;  2OBG A;  3DLN A;  1MXY A;  1QVS A;  2UVG A;  1N76 A;  2X7P A;  3K6W A;  1Y4C A;  3EHS A;  3SKP A;  3DEL B;  3O6H A;  2XD2 A;  1B58 A;  5ELV A;  3LR1 A;  2OK2 A;  4XTC Q;  1DTZ A;  2QRY A;  3KZG A;  2DVZ A;  3IOW A;  2O6A A;  3O6G A;  1P1O A;  4MBP A;  4POX A;  4OEV A;  3OOA A;  3HO7 A;  1FTL A;  1AMF A;  1DPP A;  3FIR A;  3EHT A;  5H8F A;  1B32 A;  1LAX A;  2Z8E A;  3IB2 A;  4YMA A;  2RC7 A;  4ZEB A;  2I0C A;  3D4C A;  3C4M A;  4OER A;  3V5A A;  3VE1 B;  2UYE A;  3S2V A;  3H7M A;  2ZXT A;  5H8Q B;  3LUY A;  4H0W A;  4QF9 A;  1LAH E;  1UQW A;  4GRK A;  4ND9 A;  2F6P A;  3B6W A;  1MY4 A;  1TXF A;  1PBQ A;  4YMB A;  4KFQ A;  1XVY A;  2QS1 A;  4QSE A;  3L6G A;  1OLC A;  3G3H A;  4F2Q A;  3S9N C;  3DP6 A;  3M8U A;  1IEJ A;  1LGB C;  3JYR A;  3CSG A;  3FXQ A;  4XKR A;  1B0H A;  4KI0 E;  1Y9U A;  3QK6 A;  1B3G A;  3HV1 A;  4JSD A;  1TFA A;  5I2N B;  3B6T A;  2FA7 A;  2F36 A;  3Q29 A;  3PPQ A;  1BTJ A;  3RY3 A;  1H76 A;  5AA4 B;  3CFZ A;  3RGY A;  2THI A;  4OTE A;  3VFJ A;  5BUU A;  5DVJ A;  1QUK A;  3CG1 A;  4F3G A;  1A8E A;  1SI0 A;  4OFL A;  4R72 A;  2V3U A;  4DDD A;  2X7Q A;  2E0S A;  5B70 A;  4ZS9 A;  3IR1 A;  4LP2 B;  1MY3 A;  1S9T A;  3EF7 A;  3MP1 A;  4GLI A;  4IY5 A;  1WDN A;  5H8N A;  2GRV A;  1GV8 A;  4GVO A;  5L9S A;  1MQH A;  3JV9 A;  3TTN A;  4ZEK A;  3OEK A;  3SEV A;  1MM6 A;  5ITP A;  5KDT B;  1TFD A;  1IIW A;  4GL0 A;  4H65 A;  5CBS A;  2H98 A;  4AQ4 A;  3IL1 B;  1IXG A;  1GVC A;  2Y7R A;  4IGR A;  3PD9 A;  2XD3 A;  3S9L C;  4NF8 A;  1B1H A;  3Q27 A;  3FVN A;  4Q8R A;  5L8D A;  3KGC A;  3I3V A;  2G29 A;  2ZYK A;  3VLW A;  5KZT A;  3CI8 A;  1LCF A;  1XVX A;  1NH7 A;  1JQF A;  2Z22 A;  4LQ2 A;  4UA8 A;  1FTO A;  4GIZ A;  3GLB A;  4RPO A;  3KJT A;  3LSF B;  3PPP A;  3LBS A;  3KN3 A;  3MPK A;  4GXA A;  4NWC A;  1NNP A;  4X9T A;  1UTB B;  4DIG A;  3EPE A;  4YKP A;  1QUJ A;  2D3I A;  1QUI A;  3HN0 A;  2O68 A;  4RY1 A;  5A5X A;  1CB6 A;  4RYA A;  2VD3 A;  3KEI A;  1ZBM A;  3MVX A;  2DXY A;  1FQC A;  1Y1Z A;  2XXP A;  3FJG A;  5HBC A;  1B6H A;  4PE5 B;  4L17 A;  5ICT A;  3OO6 A;  2PX1 A;  4U4S A;  4IO4 A;  1B3L A;  2XXQ A;  3VVD A;  2NOO A;  5HPQ A;  3ZKL A;  2Q9T A;  1Y3P A;  5I57 A;  4F29 A;  1JET A;  2G93 A;  1Y1M A;  2RC9 A;  3TUS A;  4BLA A;  1B3F A;  5KCJ A;  3TKD A;  2YPN A;  2Y7K A;  4YKI A;  1ZTY A;  4GL8 A;  1NNF A;  4ZZA A;  4ZE8 A;  4QFO A;  5TPA A;  1TT1 A;  1B4Z A;  2CZL A;  2VGQ A;  4ZEC A;  4MH5 A;  2DXR A;  3U72 A;  4O3B A;  3MWB A;  1VSO A;  3IOT A;  3KBR A;  3MZ9 A;  4OVJ A;  1NKX A;  1N7W A;  1PB7 A;  4XKP A;  3Q26 A;  4R73 A;  3V83 A;  1ZJL A;  4XXU A;  2QS4 A;  1MY2 A;  1D4N A;  3GBA A;  1F9B A;  3K02 A;  4KYD A;  3KG2 A;  1LCT A;  4LON B;  1OQH A;  1OQG A;  2XX9 A;  1UIU A;  2I4C A;  5JTY B;  1T0K A;  4FAT A;  3MBP A;  1MY1 A;  3LSW A;  3K1N A;  1HSL A;  2IEE A;  3U93 A;  1FQB A;  5I59 B;  4DXU A;  1MM7 A;  4NED A;  2ZNU A;  3FVK A;  5I56 B;  3TTM A;  2XXH A;  3FVO A;  4JXI A;  3QUF A;  2FNC A;  4H6D A;  4ZED A;  3IOV A;  1LFI A;  3Q25 A;  3LSX A;  2I49 A;  2A5S A;  3IOR A;  3TPA A;  2QPQ A;  4FAJ A;  1MXV A;  3KSX A;  3R26 A;  1GTK A;  3SEU A;  2NUV A;  3KFM A;  2O1M A;  3PUZ E;  1H3D A;  3C31 A;  3MZB A;  1PDA A;  2OZZ A;  1MQJ A;  3T9H B;  4F22 A;  2P1S A;  5ISU A;  3FUZ A;  3QXM A;  3PMW A;  3HPI A;  2PMS A;  3TCH A;  2ONR A;  3OXN A;  3TTK A;  4KD5 A;  3DP4 A;  5CMK A;  3PU5 A;  2XXY A;  4EDP A;  2W7Y A;  1B7H A;  4IO5 A;  2F97 A;  3UK4 A;  3G7W A;  4NF4 B;  1MXU A;  3UIF A;  4ESX A;  1VR5 A;  3RN8 A;  3FXU A;  3ILU B;  4KHZ E;  3A3U A;  2Q89 A;  2F35 A;  5CMM A;  1VE4 A;  1B46 A;  3GBB A;  2HZL A;  1A99 A;  3U94 A;  3CIJ A;  2XXT A;  1N7X A;  4AB6 A;  5FTH A;  2F8D A;  3K0V A;  4HTG A;  1SYI A;  2FYI A;  4HCW A;  2YLN A;  1FTM A;  3FV2 A;  3H4Z A;  3TAJ A;  3K6V A;  5H8Q A;  2DWA A;  4P0G A;  2R71 A;  5LOM A;  3PD8 A;  2F6G A;  4U2R A;  4DXC A;  3QSL A;  3R6U A;  3B6Q A;  1JW4 A;  5CBR A;  1M5B A;  4POW A;  1ZMG A;  1A40 A;  3UP9 A;  5DTB A;  3S4U A;  1N84 A;  3LSL A;  1UTH B;  4F3P A;  1IXH A;  4F18 A;  5AA1 A;  4RJZ A;  3KN8 A;  5I2N A;  5H8H B;  1B5H A;  1ZLQ A;  4JBZ A;  3H03 A;  1MY0 A;  2HXW A;  3O66 A;  4QHQ A;  3TOD A;  3TTR A;  1MH4 A;  4LUB A;  1YPN A;  5AA4 A;  5JEI A;  2O7U A;  4YKJ A;  3IB1 A;  3F11 A;  1SVX B;  2A5T B;  3OSQ A;  3T9U A;  3VVF A;  2DE3 A;  5B7D A;  2V3T A;  3C34 A;  3O97 A;  4GFR A;  3T96 B;  2XX7 A;  2Q2C A;  4MLV A;  3AXF A;  4R75 A;  4I62 A;  2RKM A;  4C1T A;  3T9X B;  1HSJ A;  2O51 A;  4R6H A;  4HS7 A;  3P7I A;  4F31 B;  3G3K A;  3U1O A;  4NWD A;  1SW5 A;  3CRB A;  4OWD A;  1O63 A;  1B5J A;  1ZU0 A;  3MW0 A;  4YKK A;  4F3S A;  5FHO A;  4JSO A;  3PMX A;  2F5X A;  2Q88 A;  4FED A;  4U4X A;  3N94 A;  4G8M A;  4H1X A;  5KDT A;  1BP5 A;  3ZSF A;  3M3F A;  4QRZ A;  5EHM A;  1Y20 A;  1LB8 A;  1NMU A;  4NF6 B;  2ZYN A;  1A7L A;  3G3F A;  1R9L A;  3HST A;  4LA9 A;  2PYY A;  3RPW A;  2UVH A;  3THI A;  1YTV A;  4XKQ A;  1US4 A;  5I2K B;  3KN7 A;  3FV1 A;  3R7X A;  1R9Q A;  5L9O A;  3IX1 A;  1I6B A;  1EZ9 A;  1MPB A;  2I48 A;  3E9X A;  4R9G A;  2Y84 A;  4QSC A;  1JVX A;  3QUJ A;  2RCA A;  4QFK A;  1OIB A;  3TFL A;  4ZEF A;  2NXO A;  1NFT A;  3N26 A;  4JWX A;  2XXW A;  2HAV A;  4ESW A;  1B05 A;  2B3B A;  1UTB A;  4BDO A;  4PQJ A;  2R6G E;  1OMP A;  3CFX A;  2O69 A;  1SQY A;  1B7Z A;  4X1B A;  5K2X A;  4TLL B;  3N6U A;  4OET A;  1JNF A;  5M2V A;  1JEU A;  4ZE9 A;  4F1U A;  4OQO A;  4YAH X;  5H8S A;  5TP9 B;  3OO8 A;  3FJM A;  3MVY A;  1LLS A;  2DQV A;  5BWJ A;  4QSD A;  2XXV A;  2HFB A;  5EHS A;  2B3F A;  1SW4 A;  1GGG A;  4OZ9 A;  1EZP A;  3MVW A;  4Q30 B;  2RCB A;  2REG A;  3Q28 A;  4R2F A;  1H45 A;  4PFU A;  4ONY A;  4THI A;  3FJ7 A;  3E3K A;  4QFN A;  1M5F A;  3PPR A;  1FCK A;  1MDP 1;  1DTG A;  5F1Q A;  3TYH A;  5DYH A;  2HCA A;  2ZMB A;  2DS9 A;  5AA2 B;  3MJN A;  1URG A;  4KYS A;  1HSE A;  3CR9 A;  1IXC A;  2M8C A;  2PT2 A;  3ZS6 A;  3LC8 A;  4HW8 A;  3WAF A;  4ELR A;  1B51 A;  2AYS A;  3BKI B;  3IO6 A;  3VV5 A;  4OEN A;  1PEB A;  4ZZE A;  1S50 A;  1URD A;  2H9B A;  3E4R A;  2ALU A;  5DEX B;  4QFL A;  5JTY A;  3MPL A;  3PPO A;  1H44 A;  3PUV E;  4EQ7 A;  1P1W A;  3C32 A;  1B9J A;  2OLB A;  4F39 A;  1XC1 A;  2E1S A;  1P99 A;  3RQT A;  5I59 A;  4R6Y A;  4ELO A;  2I6E A;  1B3H A;  4ZEI A;  1SW1 A;  1MPD A;  1XHY A;  5I56 A;  3DP8 A;  2XX8 A;  3VXC A;  2NWJ A;  3IJX B;  3M3L A;  4AB5 A;  4NF5 B;  3ONM A;  4G68 B;  5FTI A;  2VD2 A;  3KOS A;  4H8I A;  2REJ A;  4MLQ A;  3WAE A;  4I1D A;  1PC3 A;  3TEL A;  3ECR A;  1VFD A;  1Q35 A;  4LZ5 A;  1POT A;  2DE2 A;  3GXA A;  3SET A;  4DCX A;  4IB2 A;  4C0R A;  3EQ1 A;  4O3C A;  1QKA A;  4QFP A;  3TTL A;  2O7I A;  4R74 A;  1J1N A;  1M5C A;  4BDL A;  4DXB A;  3MVZ A;  2GHA A;  4IO6 A;  3BBR A;  1I69 A;  3A3C A;  3QIM A;  4KQP A;  3IOU A;  2ZYO A;  3IK6 B;  4ELP A;  1URS A;  4H8J A;  5FHM A;  4BDQ A;  3L6H A;  1AOV A;  2ONS A;  3T93 B;  4NF4 A;  3PV0 E;  4KYE A;  2HZK A;  1YCJ A;  4OHN A;  1Y3N A;  4OFO A;  4IO3 A;  1D3K A;  4TOZ A;  1JW5 A;  3H3G A;  3HHG A;  3MP6 A;  3VVE A;  4OFJ A;  4XIG Q;  1R1N A;  1XOC A;  3MP8 A;  2I58 A;  2PBW A;  2P2A A;  4NMY A;  3PUY E;  3V8X B;  4KCD A;  3UN6 A;  1H43 A;  3O9P A;  1Z7M E;  4OEU A;  3HHF A;  3SES A;  2Q2A A;  2UVJ A;  1A8F A;  3K6U A;  4G4P A;  3IO4 A;  1WVJ A;  2B65 A;  1MXW A;  5DVF A;  5ICQ A;  5CMB A;  4IO2 A;  2O84 X;  3RLF E;  4FEB A;  1Y4T A;  5EYF A;  3EHU A;  5FHN A;  4RXL A;  4BDN A;  5IAI A;  4OMB A;  3K2D A;  4EUO A;  1DOT A;  3T22 A;  4FOR A;  2UXA A;  4PET A;  1MS7 A;  3TQL A;  1UTH A;  3OO7 A;  3TDJ A;  2WKY A;  5H8H A;  4IO7 A;  4EQB A;  3FD3 A;  1B40 A;  2ANJ A;  2QJE A;  3TEP A;  4LVQ A;  4K3F A;  1Q1K A;  2GHB A;  4FIM A;  3W15 C;  4F19 A;  3QAX A;  2F78 A;  3MZ1 A;  3H06 B;  2OJT A;  4YB6 A;  4YIC A;  2A5T A;  3FGS A;  1MXX A;  3IB0 A;  1TWY A;  2DWH A;  2QSX A;  2QS3 A;  3VDF A;  1MQI A;  3SEX A;  3OO9 A;  1LST A;  4M4G A;  1B5I A;  2DWJ A;  2QS2 A;  1B1X A;  4H5F A;  1AL3 A;  3PPN A;  3E13 X;  4ISU A;  4G8H A;  3BFT A;  4LQ5 A;  1IQ7 A;  1D9Y A;  3OMB A;  1QJM A;  1USY E;  4KCC A;  1IIT A;  3SDF A;  5I58 B;  1EU8 A;  1JW1 A;  1B52 A;  3OEN A;  1M5D A;  2PVU A;  3PGF A;  1EH3 A;  4KPT A;  4EQ9 A;  4NF6 A;  1D9V A;  1BIY A;  2O1L A;  1IZ1 A;  1FQA A;  1DMB A;  4FE8 A;  2Y7W A;  4DE8 A;  2ZYM A;  1RYX A;  5I84 A;  4N6P A;  4LAT A;  2R9J A;  5L9M A;  4G77 A;  5I2K A;  2I0B A;  1IUD A;  1LAF E;  1MQD A;  1LBC A;  3OSR A;  4C1U A;  2RIN A;  3CG3 A;  2H4I A;  2UVI A;  4E0W A;  4WXJ A;  3I6V A;  4U1O A;  4F1V A;  5HM4 B;  4YB5 A;  2XXU A;  3BFU A;  2ESN A;  2OWS A;  3T9V A;  3H6V A;  1ZKB A;  2XXI A;  2HAU A;  1MRP A;  4DZ1 A;  3DM0 A;  3CFL A;  2DWI A;  4N13 A;  5AE4 A;  3C33 A;  4H5G A;  4I8C A;  1N3W A;  4GQO A;  2OWT A;  1VFE A;  3H6T A;  1Y3Q A;  2DE4 A;  2F7C A;  3OEL A;  5TP9 A;  2GFE A;  4OYV A;  4O3A A;  4Q5T A;  5H8F B;  2VOZ A;  2RF1 A;  1IXI A;  1LFH A;  2D21 A;  4GF8 A;  3N6T A;  1QW0 A;  2P0S A;  4KR5 A;  2CMO A;  2IA4 A;  4F1Y A;  5CM6 A;  1OLA A;  4OES A;  3OD7 A;  4M1V A;  1MXZ A;  1JVY A;  4GXS B;  5TU0 A;  3ZKK A;  3KOT A;  1B0L A;  4U22 A;  3CVG A;  3G3I A;  3UA8 A;  1BKA A;  3MQ9 A;  3MAM A;  4H67 A;  1ANF A;  1II5 A;  2QMX A;  4IGT A;  3FXR A;  4GWO A;  2F34 A;  1S7Y A;  5DT6 A;  1BLF A;  4YZZ A;  4X1D A;  4XKN A;  1SD3 A;  1MQG A;  2PT1 A;  4N07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...