5F7VA

Abc substrate-binding protein lmo0181 from listeria monocytogenes in complex with cycloalternan
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
390
structure length
388
Chain Sequence
DKTEITYYQFSAPGKALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKGVLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVEYPTADWTWKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTETTINSPENVEALTHLTNEVTDSKVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPFKWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWELPATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDSTPEKALKNSEDNINKTMGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cycloalternan binding protein
molecule keywords Lmo0181 protein
publication title Structure to function of an alpha-glucan metabolic pathway that promotes Listeria monocytogenes pathogenesis.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
total genus 136
structure length 388
sequence length 390
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5f7vA00
4U1ZA 4H8JA 2AL4A 3TTNA 3HO7A 3G3GA 5F7VA 4BDOA 3T93B 1B0LA 5ISUA 1BLFA 1LAXA 3QK6A 1FQFA 2YPNA 4Q8RA 4FATA 2Q88A 3IOTA 3TAJA 5EYFA 5FTIA 5ITOA 4X1BA 5H8HB 4NF4B 3OSRA 3MWBA 3RQTA 2F36A 3PPNA 3JV9A 4WKMA 5CMCA 5CM6A 4LQ5A 1SI0A 3MVZA 3QSLA 3PPQA 4F3BA 4DCXA 1R9QA 2QS4A 1A55A 3ONMA 4DZ1A 2PT2A 2H5YA 3WAEA 1LB8A 3H6UA 2DE4A 2PT1A 4BLAA 3C34A 1B4ZA 4Z7EA 4R6KA 3ECRA 4OXVA 2B3BA 2F97A 1M5FA 5H8HA 4NF4A 1DOTA 2NWJA 1OVBA 2XXYA 5CMMA 3IJXB 1B5JA 4RYAA 4C1TA 2NOOA 2O6AA 3UGWA 2XXRA 5M2VA 4QFLA 4YAHX 1SW1A 4ZE8A 3IOVA 3MVWA 2CMOA 4HCWA 5KDTB 4EF2A 3DP8A 4OHNA 3UA8A 3H3GA 4ZEBA 2IEEA 1LSTA 3O66A 5EHMA 2F5XA 1FQEA 3PMWA 4RNSA 4DXUA 3TCHA 3SERA 2OWTA 1MPCA 2ESNA 5FHNA 1LCFA 4OFOA 2VOZA 2RKMA 1A7LA 2Z22A 2DWIA 2ZYNA 3KJ7A 2Q8JA 2XXHA 3H06B 3PUYE 2QS3A 4LATA 2M8CA 5H8QB 4DCYA 1H45A 3D4GA 2XX7A 3KBRA 4ISUA 3O6IA 3RT6B 3RUMA 4G4PA 3VE1B 5KDTA 2R6GE 1N7XA 4ESWA 4KQPA 4GD5A 3MAMA 2R9JA 1ZJLA 4PP0A 4YICA 2Z8DA 4R9GA 5CC2A 3V89B 4KHZE 1N04A 3VVFA 5FHOA 1LGBC 4F2OA 3FXUA 1FCKA 4XXUA 1POY1 3MVXA 5A5XB 2HZKA 5DT6A 1Z7ME 3JYRA 4DE8A 4FECA 3N26A 5H8QA 4U4XA 1MQJA 2X7QA 3K1PA 4OENA 4EQ9A 1FTLA 4IO4A 3GLBA 1B05A 4LQ2A 3W9VA 2DP8A 5H8FB 3GZGA 2HZLA 2I58A 2UVHA 3RT8A 4Q5TA 2CZLA 1M5DA 2PMSA 4IO5A 4PFUA 1URDA 4FIMA 1UTHB 3CG1A 3DELB 4ELQA 3FXRA 5A5XA 1FQCA 1Y4TA 4TLLB 1WDNA 4FEBA 3OSQA 3QUJA 2RC9A 4H5GA 3OELA 1OIBA 4JWOA 2H9BA 3GXAA 3T9VA 5CI5A 4NF5B 1ZLQA 1A54A 4OWDA 2D21A 5H8FA 2E1SA 2UVGA 4WEDA 4OZ9A 3FASA 3O9PA 2VGQA 2DWHA 3EHSA 3U93A 3ZKLA 3FUZA 2Z23A 4I8CA 3OO8A 3MPKA 3DP6A 4ZS9A 1P1WA 1UTHA 5F1QA 1B58A 1OQHA 1FQDA 2GH9A 1VFEA 3RGYA 4F22A 1POTA 1ZMGA 1MY4A 2XX9A 3O6GA 2Y7RA 5I58B 4RA1A 2H98A 3SETA 1B4HA 2I3WA 3SKPA 4RY1A 4NF5A 1ELJA 1JVXA 2O84X 3G3FA 1IZ1A 1R1NA 2O51A 2DXYA 3UP9A 3HHFA 3K6VA 3THIA 1P1OA 3PUZE 4C1UA 4LUBA 1QKBA 1TT1A 2I48A 1N84A 4IO7A 2ABHA 1AH5A 1B2HA 2RF1A 2XXTA 4YMBA 1OVTA 1SYHA 3O97A 1FTJA 1VR5A 4GLIA 4ZDMA 5HPQA 4K3FA 1YAEA 3E3KA 2KLFA 3TZAA 1JVYA 5I58A 3EHUA 3TODA 3QAXA 3U8QA 5L9SA 1LAGE 5CMBA 3L6HA 1IXCA 4NMYA 4XTCQ 5AA4B 2O68A 1EZ9A 3IOWA 1MXYA 1NNFA 3VVDA 4IY5A 1UIVA 3LSWA 4POXA 3V5AA 1EZPA 3T66A 1IXHA 3MZ9A 4JWYA 4G2ZA 4F19A 2R71A 4YZZA 4O3CA 3QXMA 4GL8A 4XKNA 1I6QA 2I6EA 3CSBA 1XS5A 3Q26A 1P1QA 2Y7WA 5AA4A 1LFGA 1FTKA 4OTEA 2NXOA 2W7YA 3P7IA 1S9TA 4G68A 4EDPA 3CR9A 2V3UA 1PDAA 4R75A 5JK4A 4QSCA 5FHMA 2E0SA 4QF9A 5H8NB 1B3HA 5AE4A 3OMBA 4RJZA 4X9TA 4F2QA 4FORA 3E9XA 4GF8A 4QHQA 4PETA 2G93A 1Q35A 4OMBA 3HCQA 3K02A 1PBQA 1RKMA 4ECFA 4YB6A 1NFTA 2PYYA 3N94A 4BDRA 3HV1A 3V8XB 1MH3A 3IL1B 4Q0CA 3FVGA 3MQ9A 3MJNA 1MH4A 3S4UA 4XKPA 2XXIA 4FAJA 1LCTA 4XKRA 4I9DA 3TCFA 1FW0A 5H8NA 5K2XA 1RYOA 1MY1A 2X26A 4RK9A 2DWJA 3K6WA 5I2NA 1B5HA 1D9YA 1MXUA 4NE4A 2I0CA 3TYHA 4GRKA 4YKJA 3HPIA 3S9LC 2UVJA 3CSGA 3A3CA 4QFPA 4F29A 2QL3A 1DTGA 4KD5A 2Q2CA 2I0BA 1O63A 1JEUA 4U21A 5CBSA 2V93A 3H7MA 4BDMA 4G8HA 4JDFA 3C4MA 2UVIA 4IO6A 5I56B 4P0GA 2ZNSA 1QW0A 4ZEDA 1MXWA 3ILTB 1O64A 2UYEA 1S50A 2QS1A 4G68C 4THIA 2DS9A 4G8MA 2AYSA 1L5TA 1XHYA 3Q27A 4PFTA 3CIJA 4ZE9A 4EQBA 3LUYA 2H25A 3A09A 3CVGA 1OLAA 4QSDA 1DPPA 1B46A 2Y84A 1D3KA 2XXUA 3H6WA 2P2AA 5JEIA 4LA9A 3TEPA 1XT8A 4E0XA 2GFEA 2DXRA 4Z0IA 3OENA 5I56A 3RTWB 2Z8FA 3CI8A 5L9MA 4F3SA 3S9NC 5ICQA 4ELPA 2P0SA 2ZNTA 4NWDA 1TFDA 3FVOA 3TPAA 2PBWA 2F35A 3K4UA 2Q89A 2NUVA 4YKKA 1URGA 4R2FA 3IJOB 3DM0A 3QYTA 4P0IA 2F6PA 1PC3A 2FNCA 3FD3A 4PE5B 3U94A 2RC8A 1IITA 3FJGA 1US5A 3TDJA 4GIZA 3RPWA 3FV1A 4FJPA 1PBPA 3SEWA 3OO7A 4MF3A 4GVOA 2V84A 3C36A 2LAOA 4IGTA 4LVQA 3M8UA 1QVSA 4OQOA 2F7CA 4JWXA 1MQIA 3OO9A 4LZ5A 3TQLA 3A3UA 3EQ1A 1GVCA 1B3GA 3PUVE 4YB7A 5I2KB 4F39A 2F7BA 2QPQA 3TKDA 3C32A 4JB7A 3VXCA 2O1LA 1OQGA 2PVUA 4AB6A 3HSTA 1N3XA 1CB6A 2GRVA 4DXBA 3IB1A 3W15C 3KOTA 4IO3A 3ZS6A 4FEDA 4N07A 1M5BA 4R72A 3DP4A 1WVJA 2F8DA 1PEBA 1MXVA 3KN3A 1LFIA 4BDNA 3Q29A 4XKQA 2BJJX 4R73A 3CFZA 5I2KA 1GGGA 4LZ7A 2O7IA 1FQBA 3U92A 2RCBA 1NNPA 1H43A 4OFJA 1IQ7A 2XXVA 4GWOA 5L8DA 3GBBA 4DXCA 1TFAA 3CFXA 1Z7NE 2P1SA 3FIRA 4ONYA 3Q28A 3Q25A 1GTKA 2O7UA 1JW1A 1XC1A 4DIGA 2OWSA 4H8IA 4EUOA 3K2DA 5FTHA 2ONKE 1IXIA 3H03A 2XXQA 4FE8A 2THIA 4U22A 5B7DA 4GFRA 3V83A 1LBCA 2Q9TA 1WODA 1MY0A 2AL5A 3BKIB 3PMXA 4M4GA 2REGA 5CMKA 5DVFA 2VD2A 1ANFA 2RC7A 1NNTA 3K00A 5CBRA 4H0WA 1IUDA 2DSFA 2Y7PA 4IO2A 3USDA 3QIMA 1ZU0A 1D4NA 5AA2D 1SYIA 2HQ0A 1MXXA 1XOCA 4OYVA 2OJTA 2Z8EA 1QULA 1QUIA 1MY3A 1A8FA 5TP9B 5B70A 1LB9A 4OESA 3BBRA 1Y3QA 2ONRA 3MP8A 3I3VA 1EH3A 3R26A 4OERA 3S9EA 3T9UA 3DLNA 4L17A 5K2YA 1SI1A 2FA7A 1OLCA 4JXIA 2ZXTA 5LOMA 1B3LA 4MBPA 4F3GA 1UQWA 2ONSA 3K0VA 4G68B 4LONB 2XHDA 3I5OA 1MDQA 3F11A 4H67A 3SEVA 1BIYA 1Q1KA 3MP1A 2QSXA 1MS7A 1MPBA 2RINA 3M3FA 4GL0A 1URSA 4KFQA 5TP9A 3K1MA 4UA8A 3FATA 2ANJA 4YMAA 3U72A 4KI0E 3KN8A 2H4IA 1R9LA 1MY2A 1AIVA 3PU5A 4O3AA 1MQGA 4GQOA 4GXAA 4TLMB 1FTOA 1DPEA 3U1OA 4OEUA 3MPLA 2D5WA 1MQHA 4JBZA 4QFKA 1BTJA 3SEYA 3N6TA 2I49A 1SDXA 1H76A 1Y20A 3B6WA 4M1VA 1BP5A 3FJMA 2UYFA 1OMPA 5DEXB 4F1YA 2I3VA 5AA2B 4YKIA 3PPRA 3EPEA 2ALUA 2Y7IA 4RXLA 1LLSA 3KZGA 4O3BA 1MRPA 2A5SA 5I2NB 1I69A 4DDDA 5HM4B 1JETA 5JTYA 4ZEKA 4KPTA 1A99A 3MVYA 3KSXA 3H6TA 3TCGA 4RPNA 5DVJA 3PPPA 1GR2A 2REJA 1LAFE 3OOAA 2F34A 5DEXA 5AA2A 1USYE 2HXWA 4LZ8A 2DE2A 4ZEIA 3FJ7A 2QRYA 2HFBA 3IAZA 2PX1A 2QMXA 2XXPA 5KZTA 4QFOA 3ODBA 1Y3NA 3K1NA 4IY6A 2I4BA 1SW5A 3GBAA 1N76A 2G29A 2YLNA 2VHAA 1T0KA 1IIWA 1R6ZA 2O69A 3MZBA 3MP6A 3OD7A 1II5A 1JW5A 3MW0A 2Q2AA 1B7HA 3MC2A 3FV2A 3TTMA 1EZOA 4WEPA 4RPOA 3HN0A 3IR1A 3VVEA 2QMWA 1QJMA 4BDLA 4EF1A 3C31A 3IB0A 2V25A 1AMFA 3MBPA 4U1OA 5J1DA 3LC8A 4R9FA 1J1NA 1ZTYA 2WKYA 3IK6B 3KEIA 4PFWA 5I57A 3I6VA 2UXAA 3ILUB 2OBGA 3G3JA 3C33A 5L9OA 3JZJA 4Q30B 2F7AA 4POWA 2DVZA 1N0TA 4ELOA 4KCDA 3LSXA 1DMBA 2DQVA 1HSEA 1B32A 3WAFA 1VE4A 3RN8A 4NWCA 4EXKA 1CE2A 2DVCA 5TU0A 4U23A 1AOVA 3W9WA 5CRYA 1DTZA 2X7PA 4YU0A 5TPAB 3B6QA 4U2RA 1B5IA 3KN7A 3TELA 2AIXA 4PQJA 4ESXA 3RNNA 1JW4A 2B65A 2V3QA 2O1MA 3KGCA 3IX1A 3T96B 1SD3A 4X1DA 1PB9A 3KSJA 4H5FA 3T22A 1MM6A 3QUFA 3IOUA 2OLBA 3R6UA 1XVYA 3UK4A 2ZNUA 2GHBA 1SQYA 4JSOA 4HCYA 5TPAA 3K01A 4ZZEA 4UACA 3PUXE 5IAIA 1MQDA 3KG2A 4I62A 1Y4CA 4IGRA 1MM7A 5ICTA 2V3TA 1P1NA 3T9XB 3KJTA 5H8SA 1Y1MA 1UIUA 4ZZAA 3S2VA 2H99A 1Y9UA 4YKPA 5EHSA 3VLVA 1M5EA 1LBBA 2ZYMA 4QFNA 3TMGA 3LSLA 4G77A 4KYDA 1TWYA 1B1XA 1GV8A 1VFDA 3KFMA 3FZVA 4NTLA 3E13X 3LSFB 3EF7A 4QRZA 1HSLA 1XVXA 3PMVA 3IORA 5AA3A 1EU8A 3PUWE 1QKAA 3O28A 3G7WA 3RLFE 3N6UA 4F1VA 3N5LA 4H6DA 2I4CA 3SDFA 4KCCA 2A5TB 1SW2A 5DTBA 1B3EA 4AQ4A 3MZ1A 3HHGA 1JQFA 4TOZA 1JEVA 3LBSA 5DVIA 2DYXA 4BDQA 1B52A 4HTGA 3ZKKA 3S9MC 1I6BA 1PB8A 1BKAA 1RYXA 4DLDA 1YPNA 3PV0E 1M5CA 3UN6A 1SVXB 1ZKBA 3G3IA 4P11A 4AB5A 2XXXA 4C0RA 2F78A 2XD3A 1FQAA 4ELRA 3TFLA 3PGFA 2OCUA 1PB7A 5BWJA 3UIFA 2A5TA 1DSNA 2XX8A 3O2AA 4ND9A 3VLUA 3EHTA 3B6TA 1MPDA 4GOTA 1B3FA 2B3FA 3ZSFA 3E4RA 1MG1A 1H44A 4N13A 3PPOA 2ZYOA 3MUQA 2FYIA 1HSJA 4GXSB 1NNKA 1YCJA 3FVNA 4ZECA 3IB2A 2YJPA 3M3LA 4PFYA 1SBPA 4RK2A 3VXBA 4OVJA 2Y7KA 3VFJA 4MH5A 1Y1ZA 4F3PA 2HEUA 4H65A 1F9BA 3G3HA 3RY3A 4H1XA 1A8EA 1JNFA 4IB2A 1H3DA 5I84A 1D9VA 4OETA 1MDP1 3IO4A 2ZMBA 4NF6B 1UTBB 1LFHA 1P99A 4G8NA 1YTVA 1I6AA 1NKXA 4EXLA 3SEUA 3H4ZA 4HS7A 3OEMA 5KCJB 3VDFA 2OK2A 3OEKA 4N6PA 3KOSA 3O29A 1B6HA 2HAUA 4KYSA 4OFLA 4MLQA 1QUJA 2ZYKA 1KWHA 4MLVA 3O6HA 1IEJA 3K6XA 4R6HA 2VD3A 1SW4A 4KYEA 4E0WA 4WXJA 2HAVA 2DOJA 3TTLA 1Y3PA 3TTRA 1N3WA 4OEVA 5ELVA 1IXGA 3AXFA 4NF6A 1UTBA 4NF8B 1B1HA 1A40A 3H6VA 3PD8A 3BFTA 3FXQA 5I59B 5JTYB 1NMUA 2VP1A 3C9HA 2F6GA 2DWAA 5KCJA 4JSDA 1AL3A 4YB5A 3PD9A 2QJEA 3B7DA 1LAHE 4U4SA 4MFIA 4NEDA 3RTFB 3CRBA 5ITPA 3SESA 4LP2B 1US4A 4XIGQ 4QSEA 1FTMA 5IKBA 1ZIUA 1NL5A 3EN3A 3LR1A 3FVKA 3VLWA 1ZBMA 3IO6A 4NF8A 4TQUQ 3TTKA 1B40A 5I59A 5BUUA 3TQWA 2XXWA 3OO6A 1MXZA 4I1DA 3CFLA 1NH7A 1B51A 1NH8A 1USYH 3VV5A 4R2BA 1O7TA 1B7ZA 4F18A 4X48A 1VSOA 3BFUA 3OXNA 1TXFA 4F31B 2QS2A 2IA4A 2DE3A 1QUKA 1B9JA 1N7WA 2D3IA 3SEXA 4R74A 5DYHA 4R6YA 2HCAA 3CG3A 3M3KA 1B7UA 4HW8A 3C35A 1ATGA 3T9HB 2RCAA 3FGSA 5HBCA 3G3KA 2OZZA 4EQ7A 3R7XA 4F1UA 3L6GA 5AA1A 2NVUB 1B0HA 3D4CA 4KR5A 2XD2A 3TUSA 5I57B 1S7YA 2GHAA 3K6UA 1P1UA 3UORA 4ZEFA
chains in the Genus database with same CATH superfamily
4U1ZA 4H8JA 2AL4A 3TTNA 3HO7A 3G3GA 5F7VA 4BDOA 3T93B 5FBPA 1B0LA 5ISUA 1BLFA 1LAXA 3QK6A 1FQFA 2YPNA 4Q8RA 2Q74A 4FATA 2Q88A 3IOTA 3TAJA 5EYFA 5FTIA 5ITOA 4X1BA 4GWWA 5H8HB 4NF4B 3OSRA 3MWBA 2WX9A 1EYJA 3RQTA 2F36A 3PPNA 2CZHA 3JV9A 4WKMA 5CMCA 5CM6A 2WYKA 4LQ5A 1SI0A 3MVZA 3QSLA 3PPQA 2KQZA 4F3BA 2GQ1A 4DCXA 3GYYA 1R9QA 2QS4A 1A55A 3ONMA 4DZ1A 2PT2A 2H5YA 3WAEA 4O7IA 1LB8A 3H6UA 2VPNA 2DE4A 2PT1A 4BLAA 3C34A 1B4ZA 4Z7EA 4R6KA 3ECRA 4OXVA 2B3BA 2FHYA 2F97A 1M5FA 4N8YA 5H8HA 4NF4A 4NF0A 1DOTA 2NWJA 4MNCA 1OVBA 2XXYA 1FBGA 5CMMA 3IJXB 1B5JA 4GBWA 3B8BA 4RYAA 4C1TA 2NOOA 2O6AA 3UGWA 4PTKA 2XXRA 1FPEA 5M2VA 4QBAA 4QFLA 4YAHX 1SW1A 4PGPA 4ZE8A 3IOVA 3MVWA 2CMOA 4HCWA 4JVCA 4EF2A 5KDTB 3DP8A 4OHNA 3UA8A 3H3GA 2B4MA 4ZEBA 2IEEA 1LSTA 3O66A 5EHMA 2F5XA 1FQEA 2Y5KA 3PMWA 4RNSA 4DXUA 3TCHA 1FTAA 3SERA 2KR0A 2OWTA 1MPCA 2ESNA 5FHNA 1LCFA 4OFOA 4PAIA 2VOZA 2RKMA 1A7LA 2Z22A 2DWIA 4N91A 4GWSA 2ZYNA 3KJ7A 3NOHA 3ISPA 2Q8JA 2XXHA 3H06B 3PUYE 2QS3A 2CZKA 5F24A 4OVPA 4LATA 2M8CA 4OANA 5H8QB 4DCYA 1H45A 3D4GA 2XX7A 3KBRA 4ISUA 3O6IA 3RT6B 3RUMA 4G4PA 3VE1B 5KDTA 2R6GE 1N7XA 4ESWA 4KQPA 4GD5A 3MAMA 2R9JA 1ZJLA 4PP0A 4YICA 2Z8DA 4R9GA 5CC2A 3V89B 4FBPA 4KHZE 4N8GA 1N04A 3VVFA 5FHOA 1LGBC 4F2OA 3FXUA 1FCKA 4XXUA 4GWXA 4NG7A 1POY1 3MVXA 5A5XB 2HZKA 5DT6A 1NV7A 1Z7ME 3JYRA 4DE8A 2QVVA 4FECA 3N26A 5H8QA 4U4XA 1MQJA 2X7QA 3K1PA 4OENA 4EQ9A 1FTLA 2PFZA 4IO4A 1IMBA 4N15A 3GLBA 1B05A 4LQ2A 4PF8A 3W9VA 2DP8A 5H8FB 2P3NA 1NUZA 3GZGA 1KA1A 4MEVA 2HZLA 2I58A 2UVHA 3RT8A 4PDDA 3BIGA 1NUWA 4Q5TA 2CZLA 1M5DA 2PMSA 4IO5A 4PFUA 1URDA 4FIMA 4MMPA 1UTHB 3CG1A 3DELB 4ELQA 1KZ8A 3FXRA 5A5XA 1FQCA 1Y4TA 4TLLB 1WDNA 4FEBA 3OSQA 3QUJA 2RC9A 4H5GA 3OELA 1OIBA 4JWOA 2H9BA 4HE0A 3GXAA 3T9VA 5CI5A 4NF5B 1ZLQA 1A54A 4OWDA 2D21A 5H8FA 3T1BA 2E1SA 2UVGA 4WEDA 4OZ9A 3FASA 3O9PA 2VGQA 2DWHA 3EHSA 1Q9DA 3U93A 4P47A 3ZKLA 3FUZA 2Z23A 4I8CA 2JJKA 3OO8A 3MPKA 3DP6A 4ZS9A 4LN5A 1P1WA 1UTHA 5F1QA 1B58A 1OQHA 1FQDA 2GH9A 4DI3D 1VFEA 3RGYA 4F22A 4OVSA 1POTA 1ZMGA 1MY4A 3IFAA 2XX9A 3O6GA 2Y7RA 5I58B 4RA1A 2H98A 3SETA 1B4HA 2I3WA 3SKPA 4RY1A 1FBCA 4NF5A 1ELJA 4O94A 1JVXA 2O84X 3G3FA 1IZ1A 1R1NA 2O51A 2DXYA 3UP9A 3HHFA 3K6VA 3THIA 1P1OA 3PUZE 4C1UA 4LUBA 1QKBA 1TT1A 2I48A 1N84A 4IO7A 2ABHA 1AH5A 1B2HA 2RF1A 4HE2A 2XXTA 4YMBA 1OVTA 1SYHA 3O97A 1FTJA 1VR5A 4GLIA 4ZDMA 5HPQA 4K3FA 1YAEA 3E3KA 2KLFA 3TZAA 1JVYA 1FPFA 5I58A 4P1LA 3EHUA 3TODA 3QAXA 3U8QA 5L9SA 1LAGE 1JP4A 5CMBA 3L6HA 1IXCA 4NMYA 4XTCQ 5AA4B 2O68A 4AS5A 1EZ9A 3IOWA 2Y5LA 3KC1A 1MXYA 1NV2A 4P8BA 1NNFA 3VVDA 4IY5A 1UIVA 3LSWA 4POXA 3V5AA 1EZPA 3FXBA 1IXHA 3T66A 3MZ9A 4JWYA 4G2ZA 4F19A 2R71A 4YZZA 4O3CA 4PAFA 2CEXA 3QXMA 4GL8A 4XKNA 1I6QA 2I6EA 3CSBA 1XS5A 3Q26A 1NUXA 1RDZA 1P1QA 4X04A 2Y7WA 5AA4A 1LFGA 1FTKA 3PTYA 4OTEA 2NXOA 2W7YA 3P7IA 1S9TA 4G68A 4EDPA 3CR9A 2V3UA 1PDAA 2WBDA 4R75A 5JK4A 4QSCA 5FHMA 3BIHA 5IZZA 2E0SA 4QF9A 2XWIA 5H8NB 2ZZWA 4IR8A 4PCDA 4PBHA 1B3HA 5AE4A 1LEVA 3OMBA 4RJZA 4X9TA 4F2QA 4FORA 3E9XA 4GF8A 4QHQA 4PETA 2G93A 1Q35A 4OMBA 3HCQA 3K02A 1PBQA 1RKMA 5J16A 4ECFA 4YB6A 1NFTA 4PFBA 1XI6A 2PYYA 3N94A 2MKZA 4BDRA 2B4LA 3HV1A 3V8XB 1MH3A 3IL1B 4Q0CA 1RDXA 3FVGA 3MQ9A 3MJNA 4P3LA 1MH4A 3S4UA 4XKPA 4I3YA 2XXIA 4FAJA 1LCTA 5EQ7A 5EYHA 4XKRA 4I9DA 3TCFA 1FW0A 5IM2A 5H8NA 5K2XA 1RYOA 1MY1A 2X26A 4GWZA 4RK9A 2DWJA 1G0IA 3K6WA 5I2NA 1B5HA 1D9YA 1MXUA 4DI4B 1LBZA 4NE4A 2I0CA 1DK4A 3TYHA 4GRKA 4OVRA 1FBHA 2XA5A 4YKJA 3HPIA 1D9QA 3S9LC 2UVJA 2ZZVA 3CSGA 2F3DA 3A3CA 4QFPA 4F29A 2QL3A 1DTGA 4KD5A 2Q2CA 2I0BA 1O63A 1JEUA 4PDHA 2VT5A 4U21A 5CBSA 2V93A 1FBEA 4O7MA 1QGXA 3H7MA 4BDMA 4G8HA 2FBPA 4JDFA 3C4MA 2UVIA 4IO6A 5I56B 3B50A 4P0GA 2ZNSA 1DCUA 1QW0A 4ZEDA 1MXWA 3ILTB 1O64A 2UYEA 1S50A 2QS1A 2CEYA 4G68C 4THIA 2DS9A 4G8MA 2AYSA 1L5TA 1XHYA 3Q27A 4PFTA 3CIJA 4ZE9A 4EQBA 3LUYA 2H25A 3A09A 3CVGA 1OLAA 4QSDA 1DPPA 1B46A 2FVZA 2Y84A 1D3KA 2XXUA 3H6WA 2P2AA 5JEIA 4X8RA 4LA9A 2XWVA 1XT8A 3TEPA 4E0XA 2GFEA 2DXRA 4Z0IA 3OENA 5I56A 4KXPA 3MSTA 4JVIA 3RTWB 2Z8FA 3CI8A 5L9MA 4F3SA 2FIEA 3S9NC 5ICQA 1FRPA 4ELPA 1BK4A 2P0SA 2ZNTA 4NWDA 2WBBA 1TFDA 3FVOA 3TPAA 2PBWA 2F35A 3K4UA 2Q89A 2NUVA 4YKKA 1URGA 4R2FA 3IJOB 4OVTA 3DM0A 3QYTA 4P0IA 2F6PA 1PC3A 3IFCA 5EYGA 2FNCA 3FD3A 4PE5B 3U94A 2RC8A 1IITA 3FJGA 1US5A 3KBZA 3TDJA 4GIZA 3RPWA 3FV1A 4FJPA 1PBPA 3SEWA 5ESYA 1EYKA 3OO7A 4MF3A 4GVOA 2V84A 1SPIA 3C36A 2LAOA 5ET5A 4LVQA 4IGTA 4GWUA 3M8UA 1QVSA 4OQOA 2F7CA 4JWXA 1MQIA 3OO9A 4LZ5A 3TQLA 3A3UA 1NV4A 3EQ1A 1GVCA 1B3GA 3PUVE 4YB7A 5I2KB 4F39A 2F7BA 1DBZA 2QPQA 3TKDA 1CNQA 3C32A 4JB7A 3VXCA 2O1LA 1IMAA 1OQGA 2PVUA 4AB6A 3HSTA 1N3XA 4N4UA 1CB6A 1IMDA 1LBWA 2GRVA 4DXBA 3IB1A 4P56A 5IZ3B 3W15C 3KOTA 4IO3A 3ZS6A 4FEDA 4N07A 1M5BA 4R72A 3DP4A 1WVJA 2F8DA 1PEBA 5EQ9A 1MXVA 3KN3A 1LFIA 5LDZA 4BDNA 3Q29A 5EQ8A 4XKQA 2BJJX 4R73A 3CFZA 5I2KA 1GGGA 1NI9A 4LZ7A 2O7IA 1FQBA 3U92A 2RCBA 1NNPA 1H43A 4OFJA 1IQ7A 2XXVA 2OX3A 4GWOA 4PAKA 5L8DA 5IZ3A 3GBBA 4OVQA 4DXCA 1TFAA 3CFXA 1Z7NE 2P1SA 3FIRA 4ONYA 3Q28A 3Q25A 2QVRA 1GTKA 2O7UA 1JW1A 1XC1A 4DIGA 2OWSA 2VPOA 4H8IA 4MIJA 4EUOA 3K2DA 5FTHA 2ONKE 1IXIA 3H03A 2XXQA 3CHGA 4FE8A 2THIA 3T0JA 4U22A 5B7DA 4GFRA 2BJIA 4P1EA 3V83A 1LBCA 2Q9TA 1WODA 1MY0A 3A29A 2AL5A 3BKIB 3PMXA 4M4GA 2REGA 5CMKA 5DVFA 4HXVA 2VD2A 1ANFA 2RC7A 1K9YA 1NNTA 3K00A 5CBRA 4H0WA 1IUDA 2DSFA 2Y7PA 4IO2A 3USDA 3QIMA 1ZU0A 1D4NA 5AA2D 1SYIA 2HQ0A 1MXXA 1XOCA 4OYVA 2OJTA 2Z8EA 1QULA 1QUIA 1MY3A 1A8FA 5TP9B 5B70A 1LB9A 4OESA 3BBRA 1Y3QA 2ONRA 3MP8A 3I3VA 1EH3A 3R26A 4OERA 3S9EA 4G61A 3T9UA 3DLNA 4L17A 5EQAA 5K2YA 1SI1A 2FA7A 1OLCA 4JXIA 2F3BA 2ZXTA 5LOMA 1B3LA 4MBPA 4F3GA 1UQWA 2ONSA 3K0VA 4G68B 4LONB 2XHDA 3I5OA 1MDQA 3F11A 4H67A 3SEVA 1BIYA 1Q1KA 2DDKA 3MP1A 2QSXA 1MS7A 1MPBA 2RINA 3RPLA 3M3FA 4GL0A 1URSA 2ZZXA 4KFQA 4NX1A 5TP9A 3K1MA 4UA8A 3FATA 2ANJA 4YMAA 3U72A 4KI0E 3KN8A 2H4IA 1R9LA 5ET7A 1MY2A 1AIVA 3PU5A 4O3AA 1MQGA 4GQOA 4GXAA 4TLMB 1FTOA 1IMFA 1DPEA 3U1OA 4OEUA 3MPLA 2D5WA 1NUYA 1MQHA 4QFKA 4JBZA 2CZIA 1BTJA 3SEYA 3N6TA 2I49A 4AS4A 1SDXA 1H76A 1Y20A 3B6WA 4M1VA 1G0HA 1BP5A 3FJMA 2UYFA 1OMPA 5DEXB 4F1YA 2I3VA 5AA2B 3EKIA 4YKIA 3PPRA 5A5LA 3EPEA 2ALUA 2Y7IA 4RXLA 1LLSA 3KZGA 4O3BA 1MRPA 2A5SA 1AWBA 5I2NB 1FBPA 1I69A 4DDDA 5HM4B 1JETA 5JTYA 1FPLA 4ZEKA 4KPTA 1A99A 3MVYA 3KSXA 3H6TA 4I3EA 4GX3A 3TCGA 4MHFA 3E79A 4RPNA 5DVJA 3PPPA 1GR2A 4N6DA 5LTCA 2REJA 1LAFE 3OOAA 2F34A 5DEXA 4I40A 5AA2A 1USYE 2HXWA 1FSAA 4LZ8A 1LBVA 2XWKA 2DE2A 4MJOA 4ZEIA 3FJ7A 2QRYA 4H46A 2HFBA 3IAZA 2PX1A 2QVUA 2QMXA 2XXPA 1LBXA 4QFOA 5KZTA 3ODBA 1Y3NA 3ROJA 1FPBA 3K1NA 2HPGA 4IY6A 2I4BA 1SW5A 3GBAA 1NV3A 1N76A 2G29A 3MYUA 2YLNA 2VHAA 1T0KA 1IIWA 1R6ZA 2O69A 3MZBA 3MP6A 3OD7A 1II5A 1JW5A 3KC0A 4HE1A 3MW0A 2Q2AA 1B7HA 3MC2A 3FV2A 3TTMA 4P9KA 1EZOA 4WEPA 5T3JA 4RPOA 3HN0A 3IR1A 3VVEA 2QMWA 4PFRA 1QJMA 4BDLA 4EF1A 4MNIA 2L5VA 3C31A 1NV6A 3IB0A 2V25A 1AMFA 3MBPA 4U1OA 5J1DA 4GX4A 3LC8A 4NAPA 1NV1A 4R9FA 1J1NA 1ZTYA 2WKYA 3IK6B 3KEIA 4PFWA 4MAGA 5I57A 3I6VA 2UXAA 3ILUB 2OBGA 3G3JA 3C33A 5L9OA 3JZJA 4Q30B 2F7AA 4POWA 2DVZA 1N0TA 4ELOA 4NQ8A 4KCDA 3LSXA 1DMBA 2DQVA 1HSEA 1FPKA 1B32A 3WAFA 1VE4A 3RN8A 4NWCA 4EXKA 1CE2A 2DVCA 5TU0A 4U23A 1AOVA 3W9WA 5CRYA 4QXDA 1DTZA 2X7PA 4MCOA 4NHBA 4YU0A 2OWZA 5TPAB 3B6QA 4U2RA 1INPA 1B5IA 3KN7A 3TELA 1FBFA 2AIXA 4PQJA 4ESXA 3RNNA 1JW4A 2V4CA 2B65A 4UABA 2V3QA 2O1MA 4GBVA 3KGCA 3IX1A 3T96B 1NV5A 1SD3A 1FPJA 4X1DA 1PB9A 3KSJA 4H5FA 3T22A 1FPDA 1MM6A 3QUFA 5IGAA 3IOUA 2OLBA 3SZPA 5I3SA 3R6UA 1XVYA 2FIXA 3UK4A 2ZNUA 2GHBA 1SQYA 4JSOA 4HCYA 5TPAA 3K01A 4ZZEA 4UACA 3PUXE 2WYPA 5IAIA 4XF5A 1MQDA 3KG2A 4I62A 1Y4CA 4IGRA 1MM7A 5ICTA 2V3TA 1P1NA 3T9XB 3KJTA 5H8SA 1Y1MA 1UIUA 4ZZAA 1IMEA 1IMCA 3S2VA 2H99A 1RDYA 3E78A 1Y9UA 4YKPA 5EHSA 4NN3A 3VLVA 1M5EA 1LBBA 2ZYMA 4QFNA 3TMGA 2XWOA 3LSLA 4G77A 4KYDA 1TWYA 1B1XA 1GV8A 1VFDA 3KFMA 3FZVA 4NTLA 2Q8MA 3E13X 3LSFB 1KA0A 3EF7A 4QRZA 1HSLA 1XVXA 3PMVA 3IORA 5AA3A 1EU8A 4GX6A 3PUWE 1QKAA 3O28A 3G7WA 3RLFE 1LBYA 3N6UA 4F1VA 3N5LA 4H6DA 2I4CA 3SDFA 4KCCA 2A5TB 1SW2A 5DTBA 1B3EA 4AQ4A 3MZ1A 3HHGA 1JQFA 4TOZA 1JEVA 3LBSA 5DVIA 2DYXA 4BDQA 1B52A 4HTGA 3ZKKA 1YXIA 3S9MC 1I6BA 1PB8A 1BKAA 4MNPA 1RYXA 4H45A 4DLDA 1YPNA 3PV0E 1M5CA 3UN6A 1SVXB 1ZKBA 3G3IA 4P11A 4AB5A 2XXXA 4C0RA 2F78A 2XD3A 1FQAA 4ELRA 3TFLA 3PGFA 2OCUA 1PB7A 5BWJA 2R8TA 3UIFA 4XEQA 2A5TA 1DSNA 2XX8A 3O2AA 2WEFA 4ND9A 3VLUA 3EHTA 3B6TA 1MPDA 4GOTA 1B3FA 2B3FA 3ZSFA 3E4RA 1MG1A 1H44A 4N13A 3PPOA 1K9ZA 1YZ0A 2HHMA 2ZYOA 4OA4A 3MUQA 2FYIA 1HSJA 4GXSB 1NNKA 1YCJA 3FVNA 1NV0A 4ZECA 3IB2A 2YJPA 3M3LA 4RK2A 1SBPA 1VDWA 4PFYA 3VXBA 4NGUA 4OVJA 2Y7KA 2PFYA 3VFJA 4O8MA 4MH5A 3HFUA 1Y1ZA 4F3PA 2HEUA 4H65A 1F9BA 3G3HA 3RY3A 4H1XA 1A8EA 1JNFA 4IB2A 1H3DA 3RPLB 5I84A 1D9VA 4OETA 1MDP1 3IO4A 2ZMBA 4NF6B 1UTBB 1FPGA 2QFLA 1LFHA 1P99A 4G8NA 1YTVA 1I6AA 1NKXA 4EXLA 3SEUA 4HS7A 3H4ZA 3OEMA 4PE3A 5KCJB 3VDFA 2OK2A 3OEKA 4N6PA 3KOSA 3O29A 1B6HA 2HAUA 4KYSA 4OFLA 4MLQA 1QUJA 2ZYKA 1KWHA 5ET8A 4MLVA 3O6HA 3LUZA 3D1RA 1IEJA 3K6XA 4R6HA 2VD3A 1SW4A 4KYEA 4E0WA 5I7IA 4WXJA 2HAVA 2DOJA 3TTLA 1Y3PA 3TTRA 4JVDA 1N3WA 4OEVA 5ELVA 1IXGA 3AXFA 4GWYA 4NF6A 1UTBA 4N81A 4NF8B 4PGNA 1B1HA 1A40A 3H6VA 1FJ9A 2P3VA 3PD8A 3BFTA 5DW8A 4N6KA 3FXQA 5I59B 5JTYB 1NMUA 2VP1A 3C9HA 2F6GA 2DWAA 5KCJA 1YYZA 4JSDA 1AL3A 4N17A 4YB5A 3PD9A 2QJEA 3B7DA 1LAHE 4U4SA 5IZ1A 2HXRA 4MFIA 4NEDA 4PC9A 3RTFB 3CRBA 5ITPA 3SESA 2PCRA 3LV0A 4LP2B 1US4A 4XIGQ 4QSEA 1FTMA 5IKBA 1ZIUA 1NL5A 4PFIA 3EN3A 3LR1A 3FBPA 3FVKA 1ZBMA 3VLWA 3IO6A 4NF8A 4TQUQ 3TTKA 1B40A 5I59A 5BUUA 3TQWA 1FPIA 2XXWA 3OO6A 1MXZA 4XFEA 4I1DA 3CFLA 1NH7A 1B51A 1NH8A 1USYH 3VV5A 4R2BA 1O7TA 1B7ZA 2XXKA 4F18A 4X48A 1VSOA 3BFUA 4MX6A 3OXNA 1FJ6A 1TXFA 4F31B 2QS2A 2IA4A 3U65A 4PF6A 2DE3A 1QUKA 1B9JA 1N7WA 2D3IA 3SEXA 1EYIA 3QMFA 4R74A 5DYHA 4R6YA 2HCAA 3CG3A 3M3KA 1B7UA 4HW8A 3C35A 1ATGA 3T9HB 2RCAA 3FGSA 5HBCA 5I5PA 3G3KA 1FBDA 4PBQA 2OZZA 4EQ7A 3R7XA 3RYDA 4F1UA 3L6GA 5AA1A 2NVUB 1B0HA 3D4CA 4KR5A 2XD2A 3TUSA 5I57B 1S7YA 2GHAA 3K6UA 1P1UA 3UORA 5ET6A 4ZEFA
chains in the Genus database with same CATH topology
4U1ZA 4H8JA 2AL4A 3TTNA 3HO7A 3G3GA 5F7VA 4BDOA 3T93B 1B0LA 5ISUA 1BLFA 1LAXA 3QK6A 1FQFA 2YPNA 4Q8RA 4FATA 2Q88A 3IOTA 3TAJA 5EYFA 5FTIA 5ITOA 4X1BA 5H8HB 4NF4B 3OSRA 3MWBA 3RQTA 2F36A 3PPNA 3JV9A 4WKMA 5CMCA 5CM6A 4LQ5A 1SI0A 3MVZA 3QSLA 3PPQA 4F3BA 4DCXA 1R9QA 2QS4A 1A55A 3ONMA 4DZ1A 2PT2A 2H5YA 3WAEA 1LB8A 3H6UA 2DE4A 2PT1A 4BLAA 3C34A 1B4ZA 4Z7EA 4R6KA 3ECRA 4OXVA 2B3BA 2F97A 1M5FA 5H8HA 4NF4A 1DOTA 2NWJA 1OVBA 2XXYA 5CMMA 3IJXB 1B5JA 4RYAA 4C1TA 2NOOA 2O6AA 3UGWA 2XXRA 5M2VA 4QFLA 4YAHX 1SW1A 4ZE8A 3IOVA 3MVWA 2CMOA 4HCWA 5KDTB 4EF2A 3DP8A 4OHNA 3UA8A 3H3GA 4ZEBA 2IEEA 1LSTA 3O66A 5EHMA 2F5XA 1FQEA 3PMWA 4RNSA 4DXUA 3TCHA 3SERA 2OWTA 1MPCA 2ESNA 5FHNA 1LCFA 4OFOA 2VOZA 2RKMA 1A7LA 2Z22A 2DWIA 2ZYNA 3KJ7A 2Q8JA 2XXHA 3H06B 3PUYE 2QS3A 4LATA 2M8CA 5H8QB 4DCYA 1H45A 3D4GA 2XX7A 3KBRA 4ISUA 3O6IA 3RT6B 3RUMA 4G4PA 3VE1B 5KDTA 2R6GE 1N7XA 4ESWA 4KQPA 4GD5A 3MAMA 2R9JA 1ZJLA 4PP0A 4YICA 2Z8DA 4R9GA 5CC2A 3V89B 4KHZE 1N04A 3VVFA 5FHOA 1LGBC 4F2OA 3FXUA 1FCKA 4XXUA 1POY1 3MVXA 5A5XB 2HZKA 5DT6A 1Z7ME 3JYRA 4DE8A 4FECA 3N26A 5H8QA 4U4XA 1MQJA 2X7QA 3K1PA 4OENA 4EQ9A 1FTLA 4IO4A 3GLBA 1B05A 4LQ2A 3W9VA 2DP8A 5H8FB 3GZGA 2HZLA 2I58A 2UVHA 3RT8A 4Q5TA 2CZLA 1M5DA 2PMSA 4IO5A 4PFUA 1URDA 4FIMA 1UTHB 3CG1A 3DELB 4ELQA 3FXRA 5A5XA 1FQCA 1Y4TA 4TLLB 1WDNA 4FEBA 3OSQA 3QUJA 2RC9A 4H5GA 3OELA 1OIBA 4JWOA 2H9BA 3GXAA 3T9VA 5CI5A 4NF5B 1ZLQA 1A54A 4OWDA 2D21A 5H8FA 2E1SA 2UVGA 4WEDA 4OZ9A 3FASA 3O9PA 2VGQA 2DWHA 3EHSA 3U93A 3ZKLA 3FUZA 2Z23A 4I8CA 3OO8A 3MPKA 3DP6A 4ZS9A 1P1WA 1UTHA 5F1QA 1B58A 1OQHA 1FQDA 2GH9A 1VFEA 3RGYA 4F22A 1POTA 1ZMGA 1MY4A 2XX9A 3O6GA 2Y7RA 5I58B 4RA1A 2H98A 3SETA 1B4HA 2I3WA 3SKPA 4RY1A 4NF5A 1ELJA 1JVXA 2O84X 3G3FA 1IZ1A 1R1NA 2O51A 2DXYA 3UP9A 3HHFA 3K6VA 3THIA 1P1OA 3PUZE 4C1UA 4LUBA 1QKBA 1TT1A 2I48A 1N84A 4IO7A 2ABHA 1AH5A 1B2HA 2RF1A 2XXTA 4YMBA 1OVTA 1SYHA 3O97A 1FTJA 1VR5A 4GLIA 4ZDMA 5HPQA 4K3FA 1YAEA 3E3KA 2KLFA 3TZAA 1JVYA 5I58A 3EHUA 3TODA 3QAXA 3U8QA 5L9SA 1LAGE 5CMBA 3L6HA 1IXCA 4NMYA 4XTCQ 5AA4B 2O68A 1EZ9A 3IOWA 1MXYA 1NNFA 3VVDA 4IY5A 1UIVA 3LSWA 4POXA 3V5AA 1EZPA 3T66A 1IXHA 3MZ9A 4JWYA 4G2ZA 4F19A 2R71A 4YZZA 4O3CA 3QXMA 4GL8A 4XKNA 1I6QA 2I6EA 3CSBA 1XS5A 3Q26A 1P1QA 2Y7WA 5AA4A 1LFGA 1FTKA 4OTEA 2NXOA 2W7YA 3P7IA 1S9TA 4G68A 4EDPA 3CR9A 2V3UA 1PDAA 4R75A 5JK4A 4QSCA 5FHMA 2E0SA 4QF9A 5H8NB 1B3HA 5AE4A 3OMBA 4RJZA 4X9TA 4F2QA 4FORA 3E9XA 4GF8A 4QHQA 4PETA 2G93A 1Q35A 4OMBA 3HCQA 3K02A 1PBQA 1RKMA 4ECFA 4YB6A 1NFTA 2PYYA 3N94A 4BDRA 3HV1A 3V8XB 1MH3A 3IL1B 4Q0CA 3FVGA 3MQ9A 3MJNA 1MH4A 3S4UA 4XKPA 2XXIA 4FAJA 1LCTA 4XKRA 4I9DA 3TCFA 1FW0A 5H8NA 5K2XA 1RYOA 1MY1A 2X26A 4RK9A 2DWJA 3K6WA 5I2NA 1B5HA 1D9YA 1MXUA 4NE4A 2I0CA 3TYHA 4GRKA 4YKJA 3HPIA 3S9LC 2UVJA 3CSGA 3A3CA 4QFPA 4F29A 2QL3A 1DTGA 4KD5A 2Q2CA 2I0BA 1O63A 1JEUA 4U21A 5CBSA 2V93A 3H7MA 4BDMA 4G8HA 4JDFA 3C4MA 2UVIA 4IO6A 5I56B 4P0GA 2ZNSA 1QW0A 4ZEDA 1MXWA 3ILTB 1O64A 2UYEA 1S50A 2QS1A 4G68C 4THIA 2DS9A 4G8MA 2AYSA 1L5TA 1XHYA 3Q27A 4PFTA 3CIJA 4ZE9A 4EQBA 3LUYA 2H25A 3A09A 3CVGA 1OLAA 4QSDA 1DPPA 1B46A 2Y84A 1D3KA 2XXUA 3H6WA 2P2AA 5JEIA 4LA9A 3TEPA 1XT8A 4E0XA 2GFEA 2DXRA 4Z0IA 3OENA 5I56A 3RTWB 2Z8FA 3CI8A 5L9MA 4F3SA 3S9NC 5ICQA 4ELPA 2P0SA 2ZNTA 4NWDA 1TFDA 3FVOA 3TPAA 2PBWA 2F35A 3K4UA 2Q89A 2NUVA 4YKKA 1URGA 4R2FA 3IJOB 3DM0A 3QYTA 4P0IA 2F6PA 1PC3A 2FNCA 3FD3A 4PE5B 3U94A 2RC8A 1IITA 3FJGA 1US5A 3TDJA 4GIZA 3RPWA 3FV1A 4FJPA 1PBPA 3SEWA 3OO7A 4MF3A 4GVOA 2V84A 3C36A 2LAOA 4IGTA 4LVQA 3M8UA 1QVSA 4OQOA 2F7CA 4JWXA 1MQIA 3OO9A 4LZ5A 3TQLA 3A3UA 3EQ1A 1GVCA 1B3GA 3PUVE 4YB7A 5I2KB 4F39A 2F7BA 2QPQA 3TKDA 3C32A 4JB7A 3VXCA 2O1LA 1OQGA 2PVUA 4AB6A 3HSTA 1N3XA 1CB6A 2GRVA 4DXBA 3IB1A 3W15C 3KOTA 4IO3A 3ZS6A 4FEDA 4N07A 1M5BA 4R72A 3DP4A 1WVJA 2F8DA 1PEBA 1MXVA 3KN3A 1LFIA 4BDNA 3Q29A 4XKQA 2BJJX 4R73A 3CFZA 5I2KA 1GGGA 4LZ7A 2O7IA 1FQBA 3U92A 2RCBA 1NNPA 1H43A 4OFJA 1IQ7A 2XXVA 4GWOA 5L8DA 3GBBA 4DXCA 1TFAA 3CFXA 1Z7NE 2P1SA 3FIRA 4ONYA 3Q28A 3Q25A 1GTKA 2O7UA 1JW1A 1XC1A 4DIGA 2OWSA 4H8IA 4EUOA 3K2DA 5FTHA 2ONKE 1IXIA 3H03A 2XXQA 4FE8A 2THIA 4U22A 5B7DA 4GFRA 3V83A 1LBCA 2Q9TA 1WODA 1MY0A 2AL5A 3BKIB 3PMXA 4M4GA 2REGA 5CMKA 5DVFA 2VD2A 1ANFA 2RC7A 1NNTA 3K00A 5CBRA 4H0WA 1IUDA 2DSFA 2Y7PA 4IO2A 3USDA 3QIMA 1ZU0A 1D4NA 5AA2D 1SYIA 2HQ0A 1MXXA 1XOCA 4OYVA 2OJTA 2Z8EA 1QULA 1QUIA 1MY3A 1A8FA 5TP9B 5B70A 1LB9A 4OESA 3BBRA 1Y3QA 2ONRA 3MP8A 3I3VA 1EH3A 3R26A 4OERA 3S9EA 3T9UA 3DLNA 4L17A 5K2YA 1SI1A 2FA7A 1OLCA 4JXIA 2ZXTA 5LOMA 1B3LA 4MBPA 4F3GA 1UQWA 2ONSA 3K0VA 4G68B 4LONB 2XHDA 3I5OA 1MDQA 3F11A 4H67A 3SEVA 1BIYA 1Q1KA 3MP1A 2QSXA 1MS7A 1MPBA 2RINA 3M3FA 4GL0A 1URSA 4KFQA 5TP9A 3K1MA 4UA8A 3FATA 2ANJA 4YMAA 3U72A 4KI0E 3KN8A 2H4IA 1R9LA 1MY2A 1AIVA 3PU5A 4O3AA 1MQGA 4GQOA 4GXAA 4TLMB 1FTOA 1DPEA 3U1OA 4OEUA 3MPLA 2D5WA 1MQHA 4JBZA 4QFKA 1BTJA 3SEYA 3N6TA 2I49A 1SDXA 1H76A 1Y20A 3B6WA 4M1VA 1BP5A 3FJMA 2UYFA 1OMPA 5DEXB 4F1YA 2I3VA 5AA2B 4YKIA 3PPRA 3EPEA 2ALUA 2Y7IA 4RXLA 1LLSA 3KZGA 4O3BA 1MRPA 2A5SA 5I2NB 1I69A 4DDDA 5HM4B 1JETA 5JTYA 4ZEKA 4KPTA 1A99A 3MVYA 3KSXA 3H6TA 3TCGA 4RPNA 5DVJA 3PPPA 1GR2A 2REJA 1LAFE 3OOAA 2F34A 5DEXA 5AA2A 1USYE 2HXWA 4LZ8A 2DE2A 4ZEIA 3FJ7A 2QRYA 2HFBA 3IAZA 2PX1A 2QMXA 2XXPA 5KZTA 4QFOA 3ODBA 1Y3NA 3K1NA 4IY6A 2I4BA 1SW5A 3GBAA 1N76A 2G29A 2YLNA 2VHAA 1T0KA 1IIWA 1R6ZA 2O69A 3MZBA 3MP6A 3OD7A 1II5A 1JW5A 3MW0A 2Q2AA 1B7HA 3MC2A 3FV2A 3TTMA 1EZOA 4WEPA 4RPOA 3HN0A 3IR1A 3VVEA 2QMWA 1QJMA 4BDLA 4EF1A 3C31A 3IB0A 2V25A 1AMFA 3MBPA 4U1OA 5J1DA 3LC8A 4R9FA 1J1NA 1ZTYA 2WKYA 3IK6B 3KEIA 4PFWA 5I57A 3I6VA 2UXAA 3ILUB 2OBGA 3G3JA 3C33A 5L9OA 3JZJA 4Q30B 2F7AA 4POWA 2DVZA 1N0TA 4ELOA 4KCDA 3LSXA 1DMBA 2DQVA 1HSEA 1B32A 3WAFA 1VE4A 3RN8A 4NWCA 4EXKA 1CE2A 2DVCA 5TU0A 4U23A 1AOVA 3W9WA 5CRYA 1DTZA 2X7PA 4YU0A 5TPAB 3B6QA 4U2RA 1B5IA 3KN7A 3TELA 2AIXA 4PQJA 4ESXA 3RNNA 1JW4A 2B65A 2V3QA 2O1MA 3KGCA 3IX1A 3T96B 1SD3A 4X1DA 1PB9A 3KSJA 4H5FA 3T22A 1MM6A 3QUFA 3IOUA 2OLBA 3R6UA 1XVYA 3UK4A 2ZNUA 2GHBA 1SQYA 4JSOA 4HCYA 5TPAA 3K01A 4ZZEA 4UACA 3PUXE 5IAIA 1MQDA 3KG2A 4I62A 1Y4CA 4IGRA 1MM7A 5ICTA 2V3TA 1P1NA 3T9XB 3KJTA 5H8SA 1Y1MA 1UIUA 4ZZAA 3S2VA 2H99A 1Y9UA 4YKPA 5EHSA 3VLVA 1M5EA 1LBBA 2ZYMA 4QFNA 3TMGA 3LSLA 4G77A 4KYDA 1TWYA 1B1XA 1GV8A 1VFDA 3KFMA 3FZVA 4NTLA 3E13X 3LSFB 3EF7A 4QRZA 1HSLA 1XVXA 3PMVA 3IORA 5AA3A 1EU8A 3PUWE 1QKAA 3O28A 3G7WA 3RLFE 3N6UA 4F1VA 3N5LA 4H6DA 2I4CA 3SDFA 4KCCA 2A5TB 1SW2A 5DTBA 1B3EA 4AQ4A 3MZ1A 3HHGA 1JQFA 4TOZA 1JEVA 3LBSA 5DVIA 2DYXA 4BDQA 1B52A 4HTGA 3ZKKA 3S9MC 1I6BA 1PB8A 1BKAA 1RYXA 4DLDA 1YPNA 3PV0E 1M5CA 3UN6A 1SVXB 1ZKBA 3G3IA 4P11A 4AB5A 2XXXA 4C0RA 2F78A 2XD3A 1FQAA 4ELRA 3TFLA 3PGFA 2OCUA 1PB7A 5BWJA 3UIFA 2A5TA 1DSNA 2XX8A 3O2AA 4ND9A 3VLUA 3EHTA 3B6TA 1MPDA 4GOTA 1B3FA 2B3FA 3ZSFA 3E4RA 1MG1A 1H44A 4N13A 3PPOA 2ZYOA 3MUQA 2FYIA 1HSJA 4GXSB 1NNKA 1YCJA 3FVNA 4ZECA 3IB2A 2YJPA 3M3LA 4PFYA 1SBPA 4RK2A 3VXBA 4OVJA 2Y7KA 3VFJA 4MH5A 1Y1ZA 4F3PA 2HEUA 4H65A 1F9BA 3G3HA 3RY3A 4H1XA 1A8EA 1JNFA 4IB2A 1H3DA 5I84A 1D9VA 4OETA 1MDP1 3IO4A 2ZMBA 4NF6B 1UTBB 1LFHA 1P99A 4G8NA 1YTVA 1I6AA 1NKXA 4EXLA 3SEUA 3H4ZA 4HS7A 3OEMA 5KCJB 3VDFA 2OK2A 3OEKA 4N6PA 3KOSA 3O29A 1B6HA 2HAUA 4KYSA 4OFLA 4MLQA 1QUJA 2ZYKA 1KWHA 4MLVA 3O6HA 1IEJA 3K6XA 4R6HA 2VD3A 1SW4A 4KYEA 4E0WA 4WXJA 2HAVA 2DOJA 3TTLA 1Y3PA 3TTRA 1N3WA 4OEVA 5ELVA 1IXGA 3AXFA 4NF6A 1UTBA 4NF8B 1B1HA 1A40A 3H6VA 3PD8A 3BFTA 3FXQA 5I59B 5JTYB 1NMUA 2VP1A 3C9HA 2F6GA 2DWAA 5KCJA 4JSDA 1AL3A 4YB5A 3PD9A 2QJEA 3B7DA 1LAHE 4U4SA 4MFIA 4NEDA 3RTFB 3CRBA 5ITPA 3SESA 4LP2B 1US4A 4XIGQ 4QSEA 1FTMA 5IKBA 1ZIUA 1NL5A 3EN3A 3LR1A 3FVKA 3VLWA 1ZBMA 3IO6A 4NF8A 4TQUQ 3TTKA 1B40A 5I59A 5BUUA 3TQWA 2XXWA 3OO6A 1MXZA 4I1DA 3CFLA 1NH7A 1B51A 1NH8A 1USYH 3VV5A 4R2BA 1O7TA 1B7ZA 4F18A 4X48A 1VSOA 3BFUA 3OXNA 1TXFA 4F31B 2QS2A 2IA4A 2DE3A 1QUKA 1B9JA 1N7WA 2D3IA 3SEXA 4R74A 5DYHA 4R6YA 2HCAA 3CG3A 3M3KA 1B7UA 4HW8A 3C35A 1ATGA 3T9HB 2RCAA 3FGSA 5HBCA 3G3KA 2OZZA 4EQ7A 3R7XA 4F1UA 3L6GA 5AA1A 2NVUB 1B0HA 3D4CA 4KR5A 2XD2A 3TUSA 5I57B 1S7YA 2GHAA 3K6UA 1P1UA 3UORA 4ZEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U1Z A;  4H8J A;  2AL4 A;  3TTN A;  3HO7 A;  3G3G A;  5F7V A;  4BDO A;  3T93 B;  1B0L A;  5ISU A;  1BLF A;  1LAX A;  3QK6 A;  1FQF A;  2YPN A;  4Q8R A;  4FAT A;  2Q88 A;  3IOT A;  3TAJ A;  5EYF A;  5FTI A;  5ITO A;  4X1B A;  5H8H B;  4NF4 B;  3OSR A;  3MWB A;  3RQT A;  2F36 A;  3PPN A;  3JV9 A;  4WKM A;  5CMC A;  5CM6 A;  4LQ5 A;  1SI0 A;  3MVZ A;  3QSL A;  3PPQ A;  4F3B A;  4DCX A;  1R9Q A;  2QS4 A;  1A55 A;  3ONM A;  4DZ1 A;  2PT2 A;  2H5Y A;  3WAE A;  1LB8 A;  3H6U A;  2DE4 A;  2PT1 A;  4BLA A;  3C34 A;  1B4Z A;  4Z7E A;  4R6K A;  3ECR A;  4OXV A;  2B3B A;  2F97 A;  1M5F A;  5H8H A;  4NF4 A;  1DOT A;  2NWJ A;  1OVB A;  2XXY A;  5CMM A;  3IJX B;  1B5J A;  4RYA A;  4C1T A;  2NOO A;  2O6A A;  3UGW A;  2XXR A;  5M2V A;  4QFL A;  4YAH X;  1SW1 A;  4ZE8 A;  3IOV A;  3MVW A;  2CMO A;  4HCW A;  5KDT B;  4EF2 A;  3DP8 A;  4OHN A;  3UA8 A;  3H3G A;  4ZEB A;  2IEE A;  1LST A;  3O66 A;  5EHM A;  2F5X A;  1FQE A;  3PMW A;  4RNS A;  4DXU A;  3TCH A;  3SER A;  2OWT A;  1MPC A;  2ESN A;  5FHN A;  1LCF A;  4OFO A;  2VOZ A;  2RKM A;  1A7L A;  2Z22 A;  2DWI A;  2ZYN A;  3KJ7 A;  2Q8J A;  2XXH A;  3H06 B;  3PUY E;  2QS3 A;  4LAT A;  2M8C A;  5H8Q B;  4DCY A;  1H45 A;  3D4G A;  2XX7 A;  3KBR A;  4ISU A;  3O6I A;  3RT6 B;  3RUM A;  4G4P A;  3VE1 B;  5KDT A;  2R6G E;  1N7X A;  4ESW A;  4KQP A;  4GD5 A;  3MAM A;  2R9J A;  1ZJL A;  4PP0 A;  4YIC A;  2Z8D A;  4R9G A;  5CC2 A;  3V89 B;  4KHZ E;  1N04 A;  3VVF A;  5FHO A;  1LGB C;  4F2O A;  3FXU A;  1FCK A;  4XXU A;  1POY 1;  3MVX A;  5A5X B;  2HZK A;  5DT6 A;  1Z7M E;  3JYR A;  4DE8 A;  4FEC A;  3N26 A;  5H8Q A;  4U4X A;  1MQJ A;  2X7Q A;  3K1P A;  4OEN A;  4EQ9 A;  1FTL A;  4IO4 A;  3GLB A;  1B05 A;  4LQ2 A;  3W9V A;  2DP8 A;  5H8F B;  3GZG A;  2HZL A;  2I58 A;  2UVH A;  3RT8 A;  4Q5T A;  2CZL A;  1M5D A;  2PMS A;  4IO5 A;  4PFU A;  1URD A;  4FIM A;  1UTH B;  3CG1 A;  3DEL B;  4ELQ A;  3FXR A;  5A5X A;  1FQC A;  1Y4T A;  4TLL B;  1WDN A;  4FEB A;  3OSQ A;  3QUJ A;  2RC9 A;  4H5G A;  3OEL A;  1OIB A;  4JWO A;  2H9B A;  3GXA A;  3T9V A;  5CI5 A;  4NF5 B;  1ZLQ A;  1A54 A;  4OWD A;  2D21 A;  5H8F A;  2E1S A;  2UVG A;  4WED A;  4OZ9 A;  3FAS A;  3O9P A;  2VGQ A;  2DWH A;  3EHS A;  3U93 A;  3ZKL A;  3FUZ A;  2Z23 A;  4I8C A;  3OO8 A;  3MPK A;  3DP6 A;  4ZS9 A;  1P1W A;  1UTH A;  5F1Q A;  1B58 A;  1OQH A;  1FQD A;  2GH9 A;  1VFE A;  3RGY A;  4F22 A;  1POT A;  1ZMG A;  1MY4 A;  2XX9 A;  3O6G A;  2Y7R A;  5I58 B;  4RA1 A;  2H98 A;  3SET A;  1B4H A;  2I3W A;  3SKP A;  4RY1 A;  4NF5 A;  1ELJ A;  1JVX A;  2O84 X;  3G3F A;  1IZ1 A;  1R1N A;  2O51 A;  2DXY A;  3UP9 A;  3HHF A;  3K6V A;  3THI A;  1P1O A;  3PUZ E;  4C1U A;  4LUB A;  1QKB A;  1TT1 A;  2I48 A;  1N84 A;  4IO7 A;  2ABH A;  1AH5 A;  1B2H A;  2RF1 A;  2XXT A;  4YMB A;  1OVT A;  1SYH A;  3O97 A;  1FTJ A;  1VR5 A;  4GLI A;  4ZDM A;  5HPQ A;  4K3F A;  1YAE A;  3E3K A;  2KLF A;  3TZA A;  1JVY A;  5I58 A;  3EHU A;  3TOD A;  3QAX A;  3U8Q A;  5L9S A;  1LAG E;  5CMB A;  3L6H A;  1IXC A;  4NMY A;  4XTC Q;  5AA4 B;  2O68 A;  1EZ9 A;  3IOW A;  1MXY A;  1NNF A;  3VVD A;  4IY5 A;  1UIV A;  3LSW A;  4POX A;  3V5A A;  1EZP A;  3T66 A;  1IXH A;  3MZ9 A;  4JWY A;  4G2Z A;  4F19 A;  2R71 A;  4YZZ A;  4O3C A;  3QXM A;  4GL8 A;  4XKN A;  1I6Q A;  2I6E A;  3CSB A;  1XS5 A;  3Q26 A;  1P1Q A;  2Y7W A;  5AA4 A;  1LFG A;  1FTK A;  4OTE A;  2NXO A;  2W7Y A;  3P7I A;  1S9T A;  4G68 A;  4EDP A;  3CR9 A;  2V3U A;  1PDA A;  4R75 A;  5JK4 A;  4QSC A;  5FHM A;  2E0S A;  4QF9 A;  5H8N B;  1B3H A;  5AE4 A;  3OMB A;  4RJZ A;  4X9T A;  4F2Q A;  4FOR A;  3E9X A;  4GF8 A;  4QHQ A;  4PET A;  2G93 A;  1Q35 A;  4OMB A;  3HCQ A;  3K02 A;  1PBQ A;  1RKM A;  4ECF A;  4YB6 A;  1NFT A;  2PYY A;  3N94 A;  4BDR A;  3HV1 A;  3V8X B;  1MH3 A;  3IL1 B;  4Q0C A;  3FVG A;  3MQ9 A;  3MJN A;  1MH4 A;  3S4U A;  4XKP A;  2XXI A;  4FAJ A;  1LCT A;  4XKR A;  4I9D A;  3TCF A;  1FW0 A;  5H8N A;  5K2X A;  1RYO A;  1MY1 A;  2X26 A;  4RK9 A;  2DWJ A;  3K6W A;  5I2N A;  1B5H A;  1D9Y A;  1MXU A;  4NE4 A;  2I0C A;  3TYH A;  4GRK A;  4YKJ A;  3HPI A;  3S9L C;  2UVJ A;  3CSG A;  3A3C A;  4QFP A;  4F29 A;  2QL3 A;  1DTG A;  4KD5 A;  2Q2C A;  2I0B A;  1O63 A;  1JEU A;  4U21 A;  5CBS A;  2V93 A;  3H7M A;  4BDM A;  4G8H A;  4JDF A;  3C4M A;  2UVI A;  4IO6 A;  5I56 B;  4P0G A;  2ZNS A;  1QW0 A;  4ZED A;  1MXW A;  3ILT B;  1O64 A;  2UYE A;  1S50 A;  2QS1 A;  4G68 C;  4THI A;  2DS9 A;  4G8M A;  2AYS A;  1L5T A;  1XHY A;  3Q27 A;  4PFT A;  3CIJ A;  4ZE9 A;  4EQB A;  3LUY A;  2H25 A;  3A09 A;  3CVG A;  1OLA A;  4QSD A;  1DPP A;  1B46 A;  2Y84 A;  1D3K A;  2XXU A;  3H6W A;  2P2A A;  5JEI A;  4LA9 A;  3TEP A;  1XT8 A;  4E0X A;  2GFE A;  2DXR A;  4Z0I A;  3OEN A;  5I56 A;  3RTW B;  2Z8F A;  3CI8 A;  5L9M A;  4F3S A;  3S9N C;  5ICQ A;  4ELP A;  2P0S A;  2ZNT A;  4NWD A;  1TFD A;  3FVO A;  3TPA A;  2PBW A;  2F35 A;  3K4U A;  2Q89 A;  2NUV A;  4YKK A;  1URG A;  4R2F A;  3IJO B;  3DM0 A;  3QYT A;  4P0I A;  2F6P A;  1PC3 A;  2FNC A;  3FD3 A;  4PE5 B;  3U94 A;  2RC8 A;  1IIT A;  3FJG A;  1US5 A;  3TDJ A;  4GIZ A;  3RPW A;  3FV1 A;  4FJP A;  1PBP A;  3SEW A;  3OO7 A;  4MF3 A;  4GVO A;  2V84 A;  3C36 A;  2LAO A;  4IGT A;  4LVQ A;  3M8U A;  1QVS A;  4OQO A;  2F7C A;  4JWX A;  1MQI A;  3OO9 A;  4LZ5 A;  3TQL A;  3A3U A;  3EQ1 A;  1GVC A;  1B3G A;  3PUV E;  4YB7 A;  5I2K B;  4F39 A;  2F7B A;  2QPQ A;  3TKD A;  3C32 A;  4JB7 A;  3VXC A;  2O1L A;  1OQG A;  2PVU A;  4AB6 A;  3HST A;  1N3X A;  1CB6 A;  2GRV A;  4DXB A;  3IB1 A;  3W15 C;  3KOT A;  4IO3 A;  3ZS6 A;  4FED A;  4N07 A;  1M5B A;  4R72 A;  3DP4 A;  1WVJ A;  2F8D A;  1PEB A;  1MXV A;  3KN3 A;  1LFI A;  4BDN A;  3Q29 A;  4XKQ A;  2BJJ X;  4R73 A;  3CFZ A;  5I2K A;  1GGG A;  4LZ7 A;  2O7I A;  1FQB A;  3U92 A;  2RCB A;  1NNP A;  1H43 A;  4OFJ A;  1IQ7 A;  2XXV A;  4GWO A;  5L8D A;  3GBB A;  4DXC A;  1TFA A;  3CFX A;  1Z7N E;  2P1S A;  3FIR A;  4ONY A;  3Q28 A;  3Q25 A;  1GTK A;  2O7U A;  1JW1 A;  1XC1 A;  4DIG A;  2OWS A;  4H8I A;  4EUO A;  3K2D A;  5FTH A;  2ONK E;  1IXI A;  3H03 A;  2XXQ A;  4FE8 A;  2THI A;  4U22 A;  5B7D A;  4GFR A;  3V83 A;  1LBC A;  2Q9T A;  1WOD A;  1MY0 A;  2AL5 A;  3BKI B;  3PMX A;  4M4G A;  2REG A;  5CMK A;  5DVF A;  2VD2 A;  1ANF A;  2RC7 A;  1NNT A;  3K00 A;  5CBR A;  4H0W A;  1IUD A;  2DSF A;  2Y7P A;  4IO2 A;  3USD A;  3QIM A;  1ZU0 A;  1D4N A;  5AA2 D;  1SYI A;  2HQ0 A;  1MXX A;  1XOC A;  4OYV A;  2OJT A;  2Z8E A;  1QUL A;  1QUI A;  1MY3 A;  1A8F A;  5TP9 B;  5B70 A;  1LB9 A;  4OES A;  3BBR A;  1Y3Q A;  2ONR A;  3MP8 A;  3I3V A;  1EH3 A;  3R26 A;  4OER A;  3S9E A;  3T9U A;  3DLN A;  4L17 A;  5K2Y A;  1SI1 A;  2FA7 A;  1OLC A;  4JXI A;  2ZXT A;  5LOM A;  1B3L A;  4MBP A;  4F3G A;  1UQW A;  2ONS A;  3K0V A;  4G68 B;  4LON B;  2XHD A;  3I5O A;  1MDQ A;  3F11 A;  4H67 A;  3SEV A;  1BIY A;  1Q1K A;  3MP1 A;  2QSX A;  1MS7 A;  1MPB A;  2RIN A;  3M3F A;  4GL0 A;  1URS A;  4KFQ A;  5TP9 A;  3K1M A;  4UA8 A;  3FAT A;  2ANJ A;  4YMA A;  3U72 A;  4KI0 E;  3KN8 A;  2H4I A;  1R9L A;  1MY2 A;  1AIV A;  3PU5 A;  4O3A A;  1MQG A;  4GQO A;  4GXA A;  4TLM B;  1FTO A;  1DPE A;  3U1O A;  4OEU A;  3MPL A;  2D5W A;  1MQH A;  4JBZ A;  4QFK A;  1BTJ A;  3SEY A;  3N6T A;  2I49 A;  1SDX A;  1H76 A;  1Y20 A;  3B6W A;  4M1V A;  1BP5 A;  3FJM A;  2UYF A;  1OMP A;  5DEX B;  4F1Y A;  2I3V A;  5AA2 B;  4YKI A;  3PPR A;  3EPE A;  2ALU A;  2Y7I A;  4RXL A;  1LLS A;  3KZG A;  4O3B A;  1MRP A;  2A5S A;  5I2N B;  1I69 A;  4DDD A;  5HM4 B;  1JET A;  5JTY A;  4ZEK A;  4KPT A;  1A99 A;  3MVY A;  3KSX A;  3H6T A;  3TCG A;  4RPN A;  5DVJ A;  3PPP A;  1GR2 A;  2REJ A;  1LAF E;  3OOA A;  2F34 A;  5DEX A;  5AA2 A;  1USY E;  2HXW A;  4LZ8 A;  2DE2 A;  4ZEI A;  3FJ7 A;  2QRY A;  2HFB A;  3IAZ A;  2PX1 A;  2QMX A;  2XXP A;  5KZT A;  4QFO A;  3ODB A;  1Y3N A;  3K1N A;  4IY6 A;  2I4B A;  1SW5 A;  3GBA A;  1N76 A;  2G29 A;  2YLN A;  2VHA A;  1T0K A;  1IIW A;  1R6Z A;  2O69 A;  3MZB A;  3MP6 A;  3OD7 A;  1II5 A;  1JW5 A;  3MW0 A;  2Q2A A;  1B7H A;  3MC2 A;  3FV2 A;  3TTM A;  1EZO A;  4WEP A;  4RPO A;  3HN0 A;  3IR1 A;  3VVE A;  2QMW A;  1QJM A;  4BDL A;  4EF1 A;  3C31 A;  3IB0 A;  2V25 A;  1AMF A;  3MBP A;  4U1O A;  5J1D A;  3LC8 A;  4R9F A;  1J1N A;  1ZTY A;  2WKY A;  3IK6 B;  3KEI A;  4PFW A;  5I57 A;  3I6V A;  2UXA A;  3ILU B;  2OBG A;  3G3J A;  3C33 A;  5L9O A;  3JZJ A;  4Q30 B;  2F7A A;  4POW A;  2DVZ A;  1N0T A;  4ELO A;  4KCD A;  3LSX A;  1DMB A;  2DQV A;  1HSE A;  1B32 A;  3WAF A;  1VE4 A;  3RN8 A;  4NWC A;  4EXK A;  1CE2 A;  2DVC A;  5TU0 A;  4U23 A;  1AOV A;  3W9W A;  5CRY A;  1DTZ A;  2X7P A;  4YU0 A;  5TPA B;  3B6Q A;  4U2R A;  1B5I A;  3KN7 A;  3TEL A;  2AIX A;  4PQJ A;  4ESX A;  3RNN A;  1JW4 A;  2B65 A;  2V3Q A;  2O1M A;  3KGC A;  3IX1 A;  3T96 B;  1SD3 A;  4X1D A;  1PB9 A;  3KSJ A;  4H5F A;  3T22 A;  1MM6 A;  3QUF A;  3IOU A;  2OLB A;  3R6U A;  1XVY A;  3UK4 A;  2ZNU A;  2GHB A;  1SQY A;  4JSO A;  4HCY A;  5TPA A;  3K01 A;  4ZZE A;  4UAC A;  3PUX E;  5IAI A;  1MQD A;  3KG2 A;  4I62 A;  1Y4C A;  4IGR A;  1MM7 A;  5ICT A;  2V3T A;  1P1N A;  3T9X B;  3KJT A;  5H8S A;  1Y1M A;  1UIU A;  4ZZA A;  3S2V A;  2H99 A;  1Y9U A;  4YKP A;  5EHS A;  3VLV A;  1M5E A;  1LBB A;  2ZYM A;  4QFN A;  3TMG A;  3LSL A;  4G77 A;  4KYD A;  1TWY A;  1B1X A;  1GV8 A;  1VFD A;  3KFM A;  3FZV A;  4NTL A;  3E13 X;  3LSF B;  3EF7 A;  4QRZ A;  1HSL A;  1XVX A;  3PMV A;  3IOR A;  5AA3 A;  1EU8 A;  3PUW E;  1QKA A;  3O28 A;  3G7W A;  3RLF E;  3N6U A;  4F1V A;  3N5L A;  4H6D A;  2I4C A;  3SDF A;  4KCC A;  2A5T B;  1SW2 A;  5DTB A;  1B3E A;  4AQ4 A;  3MZ1 A;  3HHG A;  1JQF A;  4TOZ A;  1JEV A;  3LBS A;  5DVI A;  2DYX A;  4BDQ A;  1B52 A;  4HTG A;  3ZKK A;  3S9M C;  1I6B A;  1PB8 A;  1BKA A;  1RYX A;  4DLD A;  1YPN A;  3PV0 E;  1M5C A;  3UN6 A;  1SVX B;  1ZKB A;  3G3I A;  4P11 A;  4AB5 A;  2XXX A;  4C0R A;  2F78 A;  2XD3 A;  1FQA A;  4ELR A;  3TFL A;  3PGF A;  2OCU A;  1PB7 A;  5BWJ A;  3UIF A;  2A5T A;  1DSN A;  2XX8 A;  3O2A A;  4ND9 A;  3VLU A;  3EHT A;  3B6T A;  1MPD A;  4GOT A;  1B3F A;  2B3F A;  3ZSF A;  3E4R A;  1MG1 A;  1H44 A;  4N13 A;  3PPO A;  2ZYO A;  3MUQ A;  2FYI A;  1HSJ A;  4GXS B;  1NNK A;  1YCJ A;  3FVN A;  4ZEC A;  3IB2 A;  2YJP A;  3M3L A;  4PFY A;  1SBP A;  4RK2 A;  3VXB A;  4OVJ A;  2Y7K A;  3VFJ A;  4MH5 A;  1Y1Z A;  4F3P A;  2HEU A;  4H65 A;  1F9B A;  3G3H A;  3RY3 A;  4H1X A;  1A8E A;  1JNF A;  4IB2 A;  1H3D A;  5I84 A;  1D9V A;  4OET A;  1MDP 1;  3IO4 A;  2ZMB A;  4NF6 B;  1UTB B;  1LFH A;  1P99 A;  4G8N A;  1YTV A;  1I6A A;  1NKX A;  4EXL A;  3SEU A;  3H4Z A;  4HS7 A;  3OEM A;  5KCJ B;  3VDF A;  2OK2 A;  3OEK A;  4N6P A;  3KOS A;  3O29 A;  1B6H A;  2HAU A;  4KYS A;  4OFL A;  4MLQ A;  1QUJ A;  2ZYK A;  1KWH A;  4MLV A;  3O6H A;  1IEJ A;  3K6X A;  4R6H A;  2VD3 A;  1SW4 A;  4KYE A;  4E0W A;  4WXJ A;  2HAV A;  2DOJ A;  3TTL A;  1Y3P A;  3TTR A;  1N3W A;  4OEV A;  5ELV A;  1IXG A;  3AXF A;  4NF6 A;  1UTB A;  4NF8 B;  1B1H A;  1A40 A;  3H6V A;  3PD8 A;  3BFT A;  3FXQ A;  5I59 B;  5JTY B;  1NMU A;  2VP1 A;  3C9H A;  2F6G A;  2DWA A;  5KCJ A;  4JSD A;  1AL3 A;  4YB5 A;  3PD9 A;  2QJE A;  3B7D A;  1LAH E;  4U4S A;  4MFI A;  4NED A;  3RTF B;  3CRB A;  5ITP A;  3SES A;  4LP2 B;  1US4 A;  4XIG Q;  4QSE A;  1FTM A;  5IKB A;  1ZIU A;  1NL5 A;  3EN3 A;  3LR1 A;  3FVK A;  3VLW A;  1ZBM A;  3IO6 A;  4NF8 A;  4TQU Q;  3TTK A;  1B40 A;  5I59 A;  5BUU A;  3TQW A;  2XXW A;  3OO6 A;  1MXZ A;  4I1D A;  3CFL A;  1NH7 A;  1B51 A;  1NH8 A;  1USY H;  3VV5 A;  4R2B A;  1O7T A;  1B7Z A;  4F18 A;  4X48 A;  1VSO A;  3BFU A;  3OXN A;  1TXF A;  4F31 B;  2QS2 A;  2IA4 A;  2DE3 A;  1QUK A;  1B9J A;  1N7W A;  2D3I A;  3SEX A;  4R74 A;  5DYH A;  4R6Y A;  2HCA A;  3CG3 A;  3M3K A;  1B7U A;  4HW8 A;  3C35 A;  1ATG A;  3T9H B;  2RCA A;  3FGS A;  5HBC A;  3G3K A;  2OZZ A;  4EQ7 A;  3R7X A;  4F1U A;  3L6G A;  5AA1 A;  2NVU B;  1B0H A;  3D4C A;  4KR5 A;  2XD2 A;  3TUS A;  5I57 B;  1S7Y A;  2GHA A;  3K6U A;  1P1U A;  3UOR A;  4ZEF A; 
#chains in the Genus database with same CATH topology
 4U1Z A;  4H8J A;  2AL4 A;  3TTN A;  3HO7 A;  3G3G A;  5F7V A;  4BDO A;  3T93 B;  5FBP A;  1B0L A;  5ISU A;  1BLF A;  1LAX A;  3QK6 A;  1FQF A;  2YPN A;  4Q8R A;  2Q74 A;  4FAT A;  2Q88 A;  3IOT A;  3TAJ A;  5EYF A;  5FTI A;  5ITO A;  4X1B A;  4GWW A;  5H8H B;  4NF4 B;  3OSR A;  3MWB A;  2WX9 A;  1EYJ A;  3RQT A;  2F36 A;  3PPN A;  2CZH A;  3JV9 A;  4WKM A;  5CMC A;  5CM6 A;  2WYK A;  4LQ5 A;  1SI0 A;  3MVZ A;  3QSL A;  3PPQ A;  2KQZ A;  4F3B A;  2GQ1 A;  4DCX A;  3GYY A;  1R9Q A;  2QS4 A;  1A55 A;  3ONM A;  4DZ1 A;  2PT2 A;  2H5Y A;  3WAE A;  4O7I A;  1LB8 A;  3H6U A;  2VPN A;  2DE4 A;  2PT1 A;  4BLA A;  3C34 A;  1B4Z A;  4Z7E A;  4R6K A;  3ECR A;  4OXV A;  2B3B A;  2FHY A;  2F97 A;  1M5F A;  4N8Y A;  5H8H A;  4NF4 A;  4NF0 A;  1DOT A;  2NWJ A;  4MNC A;  1OVB A;  2XXY A;  1FBG A;  5CMM A;  3IJX B;  1B5J A;  4GBW A;  3B8B A;  4RYA A;  4C1T A;  2NOO A;  2O6A A;  3UGW A;  4PTK A;  2XXR A;  1FPE A;  5M2V A;  4QBA A;  4QFL A;  4YAH X;  1SW1 A;  4PGP A;  4ZE8 A;  3IOV A;  3MVW A;  2CMO A;  4HCW A;  4JVC A;  4EF2 A;  5KDT B;  3DP8 A;  4OHN A;  3UA8 A;  3H3G A;  2B4M A;  4ZEB A;  2IEE A;  1LST A;  3O66 A;  5EHM A;  2F5X A;  1FQE A;  2Y5K A;  3PMW A;  4RNS A;  4DXU A;  3TCH A;  1FTA A;  3SER A;  2KR0 A;  2OWT A;  1MPC A;  2ESN A;  5FHN A;  1LCF A;  4OFO A;  4PAI A;  2VOZ A;  2RKM A;  1A7L A;  2Z22 A;  2DWI A;  4N91 A;  4GWS A;  2ZYN A;  3KJ7 A;  3NOH A;  3ISP A;  2Q8J A;  2XXH A;  3H06 B;  3PUY E;  2QS3 A;  2CZK A;  5F24 A;  4OVP A;  4LAT A;  2M8C A;  4OAN A;  5H8Q B;  4DCY A;  1H45 A;  3D4G A;  2XX7 A;  3KBR A;  4ISU A;  3O6I A;  3RT6 B;  3RUM A;  4G4P A;  3VE1 B;  5KDT A;  2R6G E;  1N7X A;  4ESW A;  4KQP A;  4GD5 A;  3MAM A;  2R9J A;  1ZJL A;  4PP0 A;  4YIC A;  2Z8D A;  4R9G A;  5CC2 A;  3V89 B;  4FBP A;  4KHZ E;  4N8G A;  1N04 A;  3VVF A;  5FHO A;  1LGB C;  4F2O A;  3FXU A;  1FCK A;  4XXU A;  4GWX A;  4NG7 A;  1POY 1;  3MVX A;  5A5X B;  2HZK A;  5DT6 A;  1NV7 A;  1Z7M E;  3JYR A;  4DE8 A;  2QVV A;  4FEC A;  3N26 A;  5H8Q A;  4U4X A;  1MQJ A;  2X7Q A;  3K1P A;  4OEN A;  4EQ9 A;  1FTL A;  2PFZ A;  4IO4 A;  1IMB A;  4N15 A;  3GLB A;  1B05 A;  4LQ2 A;  4PF8 A;  3W9V A;  2DP8 A;  5H8F B;  2P3N A;  1NUZ A;  3GZG A;  1KA1 A;  4MEV A;  2HZL A;  2I58 A;  2UVH A;  3RT8 A;  4PDD A;  3BIG A;  1NUW A;  4Q5T A;  2CZL A;  1M5D A;  2PMS A;  4IO5 A;  4PFU A;  1URD A;  4FIM A;  4MMP A;  1UTH B;  3CG1 A;  3DEL B;  4ELQ A;  1KZ8 A;  3FXR A;  5A5X A;  1FQC A;  1Y4T A;  4TLL B;  1WDN A;  4FEB A;  3OSQ A;  3QUJ A;  2RC9 A;  4H5G A;  3OEL A;  1OIB A;  4JWO A;  2H9B A;  4HE0 A;  3GXA A;  3T9V A;  5CI5 A;  4NF5 B;  1ZLQ A;  1A54 A;  4OWD A;  2D21 A;  5H8F A;  3T1B A;  2E1S A;  2UVG A;  4WED A;  4OZ9 A;  3FAS A;  3O9P A;  2VGQ A;  2DWH A;  3EHS A;  1Q9D A;  3U93 A;  4P47 A;  3ZKL A;  3FUZ A;  2Z23 A;  4I8C A;  2JJK A;  3OO8 A;  3MPK A;  3DP6 A;  4ZS9 A;  4LN5 A;  1P1W A;  1UTH A;  5F1Q A;  1B58 A;  1OQH A;  1FQD A;  2GH9 A;  4DI3 D;  1VFE A;  3RGY A;  4F22 A;  4OVS A;  1POT A;  1ZMG A;  1MY4 A;  3IFA A;  2XX9 A;  3O6G A;  2Y7R A;  5I58 B;  4RA1 A;  2H98 A;  3SET A;  1B4H A;  2I3W A;  3SKP A;  4RY1 A;  1FBC A;  4NF5 A;  1ELJ A;  4O94 A;  1JVX A;  2O84 X;  3G3F A;  1IZ1 A;  1R1N A;  2O51 A;  2DXY A;  3UP9 A;  3HHF A;  3K6V A;  3THI A;  1P1O A;  3PUZ E;  4C1U A;  4LUB A;  1QKB A;  1TT1 A;  2I48 A;  1N84 A;  4IO7 A;  2ABH A;  1AH5 A;  1B2H A;  2RF1 A;  4HE2 A;  2XXT A;  4YMB A;  1OVT A;  1SYH A;  3O97 A;  1FTJ A;  1VR5 A;  4GLI A;  4ZDM A;  5HPQ A;  4K3F A;  1YAE A;  3E3K A;  2KLF A;  3TZA A;  1JVY A;  1FPF A;  5I58 A;  4P1L A;  3EHU A;  3TOD A;  3QAX A;  3U8Q A;  5L9S A;  1LAG E;  1JP4 A;  5CMB A;  3L6H A;  1IXC A;  4NMY A;  4XTC Q;  5AA4 B;  2O68 A;  4AS5 A;  1EZ9 A;  3IOW A;  2Y5L A;  3KC1 A;  1MXY A;  1NV2 A;  4P8B A;  1NNF A;  3VVD A;  4IY5 A;  1UIV A;  3LSW A;  4POX A;  3V5A A;  1EZP A;  3FXB A;  1IXH A;  3T66 A;  3MZ9 A;  4JWY A;  4G2Z A;  4F19 A;  2R71 A;  4YZZ A;  4O3C A;  4PAF A;  2CEX A;  3QXM A;  4GL8 A;  4XKN A;  1I6Q A;  2I6E A;  3CSB A;  1XS5 A;  3Q26 A;  1NUX A;  1RDZ A;  1P1Q A;  4X04 A;  2Y7W A;  5AA4 A;  1LFG A;  1FTK A;  3PTY A;  4OTE A;  2NXO A;  2W7Y A;  3P7I A;  1S9T A;  4G68 A;  4EDP A;  3CR9 A;  2V3U A;  1PDA A;  2WBD A;  4R75 A;  5JK4 A;  4QSC A;  5FHM A;  3BIH A;  5IZZ A;  2E0S A;  4QF9 A;  2XWI A;  5H8N B;  2ZZW A;  4IR8 A;  4PCD A;  4PBH A;  1B3H A;  5AE4 A;  1LEV A;  3OMB A;  4RJZ A;  4X9T A;  4F2Q A;  4FOR A;  3E9X A;  4GF8 A;  4QHQ A;  4PET A;  2G93 A;  1Q35 A;  4OMB A;  3HCQ A;  3K02 A;  1PBQ A;  1RKM A;  5J16 A;  4ECF A;  4YB6 A;  1NFT A;  4PFB A;  1XI6 A;  2PYY A;  3N94 A;  2MKZ A;  4BDR A;  2B4L A;  3HV1 A;  3V8X B;  1MH3 A;  3IL1 B;  4Q0C A;  1RDX A;  3FVG A;  3MQ9 A;  3MJN A;  4P3L A;  1MH4 A;  3S4U A;  4XKP A;  4I3Y A;  2XXI A;  4FAJ A;  1LCT A;  5EQ7 A;  5EYH A;  4XKR A;  4I9D A;  3TCF A;  1FW0 A;  5IM2 A;  5H8N A;  5K2X A;  1RYO A;  1MY1 A;  2X26 A;  4GWZ A;  4RK9 A;  2DWJ A;  1G0I A;  3K6W A;  5I2N A;  1B5H A;  1D9Y A;  1MXU A;  4DI4 B;  1LBZ A;  4NE4 A;  2I0C A;  1DK4 A;  3TYH A;  4GRK A;  4OVR A;  1FBH A;  2XA5 A;  4YKJ A;  3HPI A;  1D9Q A;  3S9L C;  2UVJ A;  2ZZV A;  3CSG A;  2F3D A;  3A3C A;  4QFP A;  4F29 A;  2QL3 A;  1DTG A;  4KD5 A;  2Q2C A;  2I0B A;  1O63 A;  1JEU A;  4PDH A;  2VT5 A;  4U21 A;  5CBS A;  2V93 A;  1FBE A;  4O7M A;  1QGX A;  3H7M A;  4BDM A;  4G8H A;  2FBP A;  4JDF A;  3C4M A;  2UVI A;  4IO6 A;  5I56 B;  3B50 A;  4P0G A;  2ZNS A;  1DCU A;  1QW0 A;  4ZED A;  1MXW A;  3ILT B;  1O64 A;  2UYE A;  1S50 A;  2QS1 A;  2CEY A;  4G68 C;  4THI A;  2DS9 A;  4G8M A;  2AYS A;  1L5T A;  1XHY A;  3Q27 A;  4PFT A;  3CIJ A;  4ZE9 A;  4EQB A;  3LUY A;  2H25 A;  3A09 A;  3CVG A;  1OLA A;  4QSD A;  1DPP A;  1B46 A;  2FVZ A;  2Y84 A;  1D3K A;  2XXU A;  3H6W A;  2P2A A;  5JEI A;  4X8R A;  4LA9 A;  2XWV A;  1XT8 A;  3TEP A;  4E0X A;  2GFE A;  2DXR A;  4Z0I A;  3OEN A;  5I56 A;  4KXP A;  3MST A;  4JVI A;  3RTW B;  2Z8F A;  3CI8 A;  5L9M A;  4F3S A;  2FIE A;  3S9N C;  5ICQ A;  1FRP A;  4ELP A;  1BK4 A;  2P0S A;  2ZNT A;  4NWD A;  2WBB A;  1TFD A;  3FVO A;  3TPA A;  2PBW A;  2F35 A;  3K4U A;  2Q89 A;  2NUV A;  4YKK A;  1URG A;  4R2F A;  3IJO B;  4OVT A;  3DM0 A;  3QYT A;  4P0I A;  2F6P A;  1PC3 A;  3IFC A;  5EYG A;  2FNC A;  3FD3 A;  4PE5 B;  3U94 A;  2RC8 A;  1IIT A;  3FJG A;  1US5 A;  3KBZ A;  3TDJ A;  4GIZ A;  3RPW A;  3FV1 A;  4FJP A;  1PBP A;  3SEW A;  5ESY A;  1EYK A;  3OO7 A;  4MF3 A;  4GVO A;  2V84 A;  1SPI A;  3C36 A;  2LAO A;  5ET5 A;  4LVQ A;  4IGT A;  4GWU A;  3M8U A;  1QVS A;  4OQO A;  2F7C A;  4JWX A;  1MQI A;  3OO9 A;  4LZ5 A;  3TQL A;  3A3U A;  1NV4 A;  3EQ1 A;  1GVC A;  1B3G A;  3PUV E;  4YB7 A;  5I2K B;  4F39 A;  2F7B A;  1DBZ A;  2QPQ A;  3TKD A;  1CNQ A;  3C32 A;  4JB7 A;  3VXC A;  2O1L A;  1IMA A;  1OQG A;  2PVU A;  4AB6 A;  3HST A;  1N3X A;  4N4U A;  1CB6 A;  1IMD A;  1LBW A;  2GRV A;  4DXB A;  3IB1 A;  4P56 A;  5IZ3 B;  3W15 C;  3KOT A;  4IO3 A;  3ZS6 A;  4FED A;  4N07 A;  1M5B A;  4R72 A;  3DP4 A;  1WVJ A;  2F8D A;  1PEB A;  5EQ9 A;  1MXV A;  3KN3 A;  1LFI A;  5LDZ A;  4BDN A;  3Q29 A;  5EQ8 A;  4XKQ A;  2BJJ X;  4R73 A;  3CFZ A;  5I2K A;  1GGG A;  1NI9 A;  4LZ7 A;  2O7I A;  1FQB A;  3U92 A;  2RCB A;  1NNP A;  1H43 A;  4OFJ A;  1IQ7 A;  2XXV A;  2OX3 A;  4GWO A;  4PAK A;  5L8D A;  5IZ3 A;  3GBB A;  4OVQ A;  4DXC A;  1TFA A;  3CFX A;  1Z7N E;  2P1S A;  3FIR A;  4ONY A;  3Q28 A;  3Q25 A;  2QVR A;  1GTK A;  2O7U A;  1JW1 A;  1XC1 A;  4DIG A;  2OWS A;  2VPO A;  4H8I A;  4MIJ A;  4EUO A;  3K2D A;  5FTH A;  2ONK E;  1IXI A;  3H03 A;  2XXQ A;  3CHG A;  4FE8 A;  2THI A;  3T0J A;  4U22 A;  5B7D A;  4GFR A;  2BJI A;  4P1E A;  3V83 A;  1LBC A;  2Q9T A;  1WOD A;  1MY0 A;  3A29 A;  2AL5 A;  3BKI B;  3PMX A;  4M4G A;  2REG A;  5CMK A;  5DVF A;  4HXV A;  2VD2 A;  1ANF A;  2RC7 A;  1K9Y A;  1NNT A;  3K00 A;  5CBR A;  4H0W A;  1IUD A;  2DSF A;  2Y7P A;  4IO2 A;  3USD A;  3QIM A;  1ZU0 A;  1D4N A;  5AA2 D;  1SYI A;  2HQ0 A;  1MXX A;  1XOC A;  4OYV A;  2OJT A;  2Z8E A;  1QUL A;  1QUI A;  1MY3 A;  1A8F A;  5TP9 B;  5B70 A;  1LB9 A;  4OES A;  3BBR A;  1Y3Q A;  2ONR A;  3MP8 A;  3I3V A;  1EH3 A;  3R26 A;  4OER A;  3S9E A;  4G61 A;  3T9U A;  3DLN A;  4L17 A;  5EQA A;  5K2Y A;  1SI1 A;  2FA7 A;  1OLC A;  4JXI A;  2F3B A;  2ZXT A;  5LOM A;  1B3L A;  4MBP A;  4F3G A;  1UQW A;  2ONS A;  3K0V A;  4G68 B;  4LON B;  2XHD A;  3I5O A;  1MDQ A;  3F11 A;  4H67 A;  3SEV A;  1BIY A;  1Q1K A;  2DDK A;  3MP1 A;  2QSX A;  1MS7 A;  1MPB A;  2RIN A;  3RPL A;  3M3F A;  4GL0 A;  1URS A;  2ZZX A;  4KFQ A;  4NX1 A;  5TP9 A;  3K1M A;  4UA8 A;  3FAT A;  2ANJ A;  4YMA A;  3U72 A;  4KI0 E;  3KN8 A;  2H4I A;  1R9L A;  5ET7 A;  1MY2 A;  1AIV A;  3PU5 A;  4O3A A;  1MQG A;  4GQO A;  4GXA A;  4TLM B;  1FTO A;  1IMF A;  1DPE A;  3U1O A;  4OEU A;  3MPL A;  2D5W A;  1NUY A;  1MQH A;  4QFK A;  4JBZ A;  2CZI A;  1BTJ A;  3SEY A;  3N6T A;  2I49 A;  4AS4 A;  1SDX A;  1H76 A;  1Y20 A;  3B6W A;  4M1V A;  1G0H A;  1BP5 A;  3FJM A;  2UYF A;  1OMP A;  5DEX B;  4F1Y A;  2I3V A;  5AA2 B;  3EKI A;  4YKI A;  3PPR A;  5A5L A;  3EPE A;  2ALU A;  2Y7I A;  4RXL A;  1LLS A;  3KZG A;  4O3B A;  1MRP A;  2A5S A;  1AWB A;  5I2N B;  1FBP A;  1I69 A;  4DDD A;  5HM4 B;  1JET A;  5JTY A;  1FPL A;  4ZEK A;  4KPT A;  1A99 A;  3MVY A;  3KSX A;  3H6T A;  4I3E A;  4GX3 A;  3TCG A;  4MHF A;  3E79 A;  4RPN A;  5DVJ A;  3PPP A;  1GR2 A;  4N6D A;  5LTC A;  2REJ A;  1LAF E;  3OOA A;  2F34 A;  5DEX A;  4I40 A;  5AA2 A;  1USY E;  2HXW A;  1FSA A;  4LZ8 A;  1LBV A;  2XWK A;  2DE2 A;  4MJO A;  4ZEI A;  3FJ7 A;  2QRY A;  4H46 A;  2HFB A;  3IAZ A;  2PX1 A;  2QVU A;  2QMX A;  2XXP A;  1LBX A;  4QFO A;  5KZT A;  3ODB A;  1Y3N A;  3ROJ A;  1FPB A;  3K1N A;  2HPG A;  4IY6 A;  2I4B A;  1SW5 A;  3GBA A;  1NV3 A;  1N76 A;  2G29 A;  3MYU A;  2YLN A;  2VHA A;  1T0K A;  1IIW A;  1R6Z A;  2O69 A;  3MZB A;  3MP6 A;  3OD7 A;  1II5 A;  1JW5 A;  3KC0 A;  4HE1 A;  3MW0 A;  2Q2A A;  1B7H A;  3MC2 A;  3FV2 A;  3TTM A;  4P9K A;  1EZO A;  4WEP A;  5T3J A;  4RPO A;  3HN0 A;  3IR1 A;  3VVE A;  2QMW A;  4PFR A;  1QJM A;  4BDL A;  4EF1 A;  4MNI A;  2L5V A;  3C31 A;  1NV6 A;  3IB0 A;  2V25 A;  1AMF A;  3MBP A;  4U1O A;  5J1D A;  4GX4 A;  3LC8 A;  4NAP A;  1NV1 A;  4R9F A;  1J1N A;  1ZTY A;  2WKY A;  3IK6 B;  3KEI A;  4PFW A;  4MAG A;  5I57 A;  3I6V A;  2UXA A;  3ILU B;  2OBG A;  3G3J A;  3C33 A;  5L9O A;  3JZJ A;  4Q30 B;  2F7A A;  4POW A;  2DVZ A;  1N0T A;  4ELO A;  4NQ8 A;  4KCD A;  3LSX A;  1DMB A;  2DQV A;  1HSE A;  1FPK A;  1B32 A;  3WAF A;  1VE4 A;  3RN8 A;  4NWC A;  4EXK A;  1CE2 A;  2DVC A;  5TU0 A;  4U23 A;  1AOV A;  3W9W A;  5CRY A;  4QXD A;  1DTZ A;  2X7P A;  4MCO A;  4NHB A;  4YU0 A;  2OWZ A;  5TPA B;  3B6Q A;  4U2R A;  1INP A;  1B5I A;  3KN7 A;  3TEL A;  1FBF A;  2AIX A;  4PQJ A;  4ESX A;  3RNN A;  1JW4 A;  2V4C A;  2B65 A;  4UAB A;  2V3Q A;  2O1M A;  4GBV A;  3KGC A;  3IX1 A;  3T96 B;  1NV5 A;  1SD3 A;  1FPJ A;  4X1D A;  1PB9 A;  3KSJ A;  4H5F A;  3T22 A;  1FPD A;  1MM6 A;  3QUF A;  5IGA A;  3IOU A;  2OLB A;  3SZP A;  5I3S A;  3R6U A;  1XVY A;  2FIX A;  3UK4 A;  2ZNU A;  2GHB A;  1SQY A;  4JSO A;  4HCY A;  5TPA A;  3K01 A;  4ZZE A;  4UAC A;  3PUX E;  2WYP A;  5IAI A;  4XF5 A;  1MQD A;  3KG2 A;  4I62 A;  1Y4C A;  4IGR A;  1MM7 A;  5ICT A;  2V3T A;  1P1N A;  3T9X B;  3KJT A;  5H8S A;  1Y1M A;  1UIU A;  4ZZA A;  1IME A;  1IMC A;  3S2V A;  2H99 A;  1RDY A;  3E78 A;  1Y9U A;  4YKP A;  5EHS A;  4NN3 A;  3VLV A;  1M5E A;  1LBB A;  2ZYM A;  4QFN A;  3TMG A;  2XWO A;  3LSL A;  4G77 A;  4KYD A;  1TWY A;  1B1X A;  1GV8 A;  1VFD A;  3KFM A;  3FZV A;  4NTL A;  2Q8M A;  3E13 X;  3LSF B;  1KA0 A;  3EF7 A;  4QRZ A;  1HSL A;  1XVX A;  3PMV A;  3IOR A;  5AA3 A;  1EU8 A;  4GX6 A;  3PUW E;  1QKA A;  3O28 A;  3G7W A;  3RLF E;  1LBY A;  3N6U A;  4F1V A;  3N5L A;  4H6D A;  2I4C A;  3SDF A;  4KCC A;  2A5T B;  1SW2 A;  5DTB A;  1B3E A;  4AQ4 A;  3MZ1 A;  3HHG A;  1JQF A;  4TOZ A;  1JEV A;  3LBS A;  5DVI A;  2DYX A;  4BDQ A;  1B52 A;  4HTG A;  3ZKK A;  1YXI A;  3S9M C;  1I6B A;  1PB8 A;  1BKA A;  4MNP A;  1RYX A;  4H45 A;  4DLD A;  1YPN A;  3PV0 E;  1M5C A;  3UN6 A;  1SVX B;  1ZKB A;  3G3I A;  4P11 A;  4AB5 A;  2XXX A;  4C0R A;  2F78 A;  2XD3 A;  1FQA A;  4ELR A;  3TFL A;  3PGF A;  2OCU A;  1PB7 A;  5BWJ A;  2R8T A;  3UIF A;  4XEQ A;  2A5T A;  1DSN A;  2XX8 A;  3O2A A;  2WEF A;  4ND9 A;  3VLU A;  3EHT A;  3B6T A;  1MPD A;  4GOT A;  1B3F A;  2B3F A;  3ZSF A;  3E4R A;  1MG1 A;  1H44 A;  4N13 A;  3PPO A;  1K9Z A;  1YZ0 A;  2HHM A;  2ZYO A;  4OA4 A;  3MUQ A;  2FYI A;  1HSJ A;  4GXS B;  1NNK A;  1YCJ A;  3FVN A;  1NV0 A;  4ZEC A;  3IB2 A;  2YJP A;  3M3L A;  4RK2 A;  1SBP A;  1VDW A;  4PFY A;  3VXB A;  4NGU A;  4OVJ A;  2Y7K A;  2PFY A;  3VFJ A;  4O8M A;  4MH5 A;  3HFU A;  1Y1Z A;  4F3P A;  2HEU A;  4H65 A;  1F9B A;  3G3H A;  3RY3 A;  4H1X A;  1A8E A;  1JNF A;  4IB2 A;  1H3D A;  3RPL B;  5I84 A;  1D9V A;  4OET A;  1MDP 1;  3IO4 A;  2ZMB A;  4NF6 B;  1UTB B;  1FPG A;  2QFL A;  1LFH A;  1P99 A;  4G8N A;  1YTV A;  1I6A A;  1NKX A;  4EXL A;  3SEU A;  4HS7 A;  3H4Z A;  3OEM A;  4PE3 A;  5KCJ B;  3VDF A;  2OK2 A;  3OEK A;  4N6P A;  3KOS A;  3O29 A;  1B6H A;  2HAU A;  4KYS A;  4OFL A;  4MLQ A;  1QUJ A;  2ZYK A;  1KWH A;  5ET8 A;  4MLV A;  3O6H A;  3LUZ A;  3D1R A;  1IEJ A;  3K6X A;  4R6H A;  2VD3 A;  1SW4 A;  4KYE A;  4E0W A;  5I7I A;  4WXJ A;  2HAV A;  2DOJ A;  3TTL A;  1Y3P A;  3TTR A;  4JVD A;  1N3W A;  4OEV A;  5ELV A;  1IXG A;  3AXF A;  4GWY A;  4NF6 A;  1UTB A;  4N81 A;  4NF8 B;  4PGN A;  1B1H A;  1A40 A;  3H6V A;  1FJ9 A;  2P3V A;  3PD8 A;  3BFT A;  5DW8 A;  4N6K A;  3FXQ A;  5I59 B;  5JTY B;  1NMU A;  2VP1 A;  3C9H A;  2F6G A;  2DWA A;  5KCJ A;  1YYZ A;  4JSD A;  1AL3 A;  4N17 A;  4YB5 A;  3PD9 A;  2QJE A;  3B7D A;  1LAH E;  4U4S A;  5IZ1 A;  2HXR A;  4MFI A;  4NED A;  4PC9 A;  3RTF B;  3CRB A;  5ITP A;  3SES A;  2PCR A;  3LV0 A;  4LP2 B;  1US4 A;  4XIG Q;  4QSE A;  1FTM A;  5IKB A;  1ZIU A;  1NL5 A;  4PFI A;  3EN3 A;  3LR1 A;  3FBP A;  3FVK A;  1ZBM A;  3VLW A;  3IO6 A;  4NF8 A;  4TQU Q;  3TTK A;  1B40 A;  5I59 A;  5BUU A;  3TQW A;  1FPI A;  2XXW A;  3OO6 A;  1MXZ A;  4XFE A;  4I1D A;  3CFL A;  1NH7 A;  1B51 A;  1NH8 A;  1USY H;  3VV5 A;  4R2B A;  1O7T A;  1B7Z A;  2XXK A;  4F18 A;  4X48 A;  1VSO A;  3BFU A;  4MX6 A;  3OXN A;  1FJ6 A;  1TXF A;  4F31 B;  2QS2 A;  2IA4 A;  3U65 A;  4PF6 A;  2DE3 A;  1QUK A;  1B9J A;  1N7W A;  2D3I A;  3SEX A;  1EYI A;  3QMF A;  4R74 A;  5DYH A;  4R6Y A;  2HCA A;  3CG3 A;  3M3K A;  1B7U A;  4HW8 A;  3C35 A;  1ATG A;  3T9H B;  2RCA A;  3FGS A;  5HBC A;  5I5P A;  3G3K A;  1FBD A;  4PBQ A;  2OZZ A;  4EQ7 A;  3R7X A;  3RYD A;  4F1U A;  3L6G A;  5AA1 A;  2NVU B;  1B0H A;  3D4C A;  4KR5 A;  2XD2 A;  3TUS A;  5I57 B;  1S7Y A;  2GHA A;  3K6U A;  1P1U A;  3UOR A;  5ET6 A;  4ZEF A; 
#chains in the Genus database with same CATH homology
 4U1Z A;  4H8J A;  2AL4 A;  3TTN A;  3HO7 A;  3G3G A;  5F7V A;  4BDO A;  3T93 B;  1B0L A;  5ISU A;  1BLF A;  1LAX A;  3QK6 A;  1FQF A;  2YPN A;  4Q8R A;  4FAT A;  2Q88 A;  3IOT A;  3TAJ A;  5EYF A;  5FTI A;  5ITO A;  4X1B A;  5H8H B;  4NF4 B;  3OSR A;  3MWB A;  3RQT A;  2F36 A;  3PPN A;  3JV9 A;  4WKM A;  5CMC A;  5CM6 A;  4LQ5 A;  1SI0 A;  3MVZ A;  3QSL A;  3PPQ A;  4F3B A;  4DCX A;  1R9Q A;  2QS4 A;  1A55 A;  3ONM A;  4DZ1 A;  2PT2 A;  2H5Y A;  3WAE A;  1LB8 A;  3H6U A;  2DE4 A;  2PT1 A;  4BLA A;  3C34 A;  1B4Z A;  4Z7E A;  4R6K A;  3ECR A;  4OXV A;  2B3B A;  2F97 A;  1M5F A;  5H8H A;  4NF4 A;  1DOT A;  2NWJ A;  1OVB A;  2XXY A;  5CMM A;  3IJX B;  1B5J A;  4RYA A;  4C1T A;  2NOO A;  2O6A A;  3UGW A;  2XXR A;  5M2V A;  4QFL A;  4YAH X;  1SW1 A;  4ZE8 A;  3IOV A;  3MVW A;  2CMO A;  4HCW A;  5KDT B;  4EF2 A;  3DP8 A;  4OHN A;  3UA8 A;  3H3G A;  4ZEB A;  2IEE A;  1LST A;  3O66 A;  5EHM A;  2F5X A;  1FQE A;  3PMW A;  4RNS A;  4DXU A;  3TCH A;  3SER A;  2OWT A;  1MPC A;  2ESN A;  5FHN A;  1LCF A;  4OFO A;  2VOZ A;  2RKM A;  1A7L A;  2Z22 A;  2DWI A;  2ZYN A;  3KJ7 A;  2Q8J A;  2XXH A;  3H06 B;  3PUY E;  2QS3 A;  4LAT A;  2M8C A;  5H8Q B;  4DCY A;  1H45 A;  3D4G A;  2XX7 A;  3KBR A;  4ISU A;  3O6I A;  3RT6 B;  3RUM A;  4G4P A;  3VE1 B;  5KDT A;  2R6G E;  1N7X A;  4ESW A;  4KQP A;  4GD5 A;  3MAM A;  2R9J A;  1ZJL A;  4PP0 A;  4YIC A;  2Z8D A;  4R9G A;  5CC2 A;  3V89 B;  4KHZ E;  1N04 A;  3VVF A;  5FHO A;  1LGB C;  4F2O A;  3FXU A;  1FCK A;  4XXU A;  1POY 1;  3MVX A;  5A5X B;  2HZK A;  5DT6 A;  1Z7M E;  3JYR A;  4DE8 A;  4FEC A;  3N26 A;  5H8Q A;  4U4X A;  1MQJ A;  2X7Q A;  3K1P A;  4OEN A;  4EQ9 A;  1FTL A;  4IO4 A;  3GLB A;  1B05 A;  4LQ2 A;  3W9V A;  2DP8 A;  5H8F B;  3GZG A;  2HZL A;  2I58 A;  2UVH A;  3RT8 A;  4Q5T A;  2CZL A;  1M5D A;  2PMS A;  4IO5 A;  4PFU A;  1URD A;  4FIM A;  1UTH B;  3CG1 A;  3DEL B;  4ELQ A;  3FXR A;  5A5X A;  1FQC A;  1Y4T A;  4TLL B;  1WDN A;  4FEB A;  3OSQ A;  3QUJ A;  2RC9 A;  4H5G A;  3OEL A;  1OIB A;  4JWO A;  2H9B A;  3GXA A;  3T9V A;  5CI5 A;  4NF5 B;  1ZLQ A;  1A54 A;  4OWD A;  2D21 A;  5H8F A;  2E1S A;  2UVG A;  4WED A;  4OZ9 A;  3FAS A;  3O9P A;  2VGQ A;  2DWH A;  3EHS A;  3U93 A;  3ZKL A;  3FUZ A;  2Z23 A;  4I8C A;  3OO8 A;  3MPK A;  3DP6 A;  4ZS9 A;  1P1W A;  1UTH A;  5F1Q A;  1B58 A;  1OQH A;  1FQD A;  2GH9 A;  1VFE A;  3RGY A;  4F22 A;  1POT A;  1ZMG A;  1MY4 A;  2XX9 A;  3O6G A;  2Y7R A;  5I58 B;  4RA1 A;  2H98 A;  3SET A;  1B4H A;  2I3W A;  3SKP A;  4RY1 A;  4NF5 A;  1ELJ A;  1JVX A;  2O84 X;  3G3F A;  1IZ1 A;  1R1N A;  2O51 A;  2DXY A;  3UP9 A;  3HHF A;  3K6V A;  3THI A;  1P1O A;  3PUZ E;  4C1U A;  4LUB A;  1QKB A;  1TT1 A;  2I48 A;  1N84 A;  4IO7 A;  2ABH A;  1AH5 A;  1B2H A;  2RF1 A;  2XXT A;  4YMB A;  1OVT A;  1SYH A;  3O97 A;  1FTJ A;  1VR5 A;  4GLI A;  4ZDM A;  5HPQ A;  4K3F A;  1YAE A;  3E3K A;  2KLF A;  3TZA A;  1JVY A;  5I58 A;  3EHU A;  3TOD A;  3QAX A;  3U8Q A;  5L9S A;  1LAG E;  5CMB A;  3L6H A;  1IXC A;  4NMY A;  4XTC Q;  5AA4 B;  2O68 A;  1EZ9 A;  3IOW A;  1MXY A;  1NNF A;  3VVD A;  4IY5 A;  1UIV A;  3LSW A;  4POX A;  3V5A A;  1EZP A;  3T66 A;  1IXH A;  3MZ9 A;  4JWY A;  4G2Z A;  4F19 A;  2R71 A;  4YZZ A;  4O3C A;  3QXM A;  4GL8 A;  4XKN A;  1I6Q A;  2I6E A;  3CSB A;  1XS5 A;  3Q26 A;  1P1Q A;  2Y7W A;  5AA4 A;  1LFG A;  1FTK A;  4OTE A;  2NXO A;  2W7Y A;  3P7I A;  1S9T A;  4G68 A;  4EDP A;  3CR9 A;  2V3U A;  1PDA A;  4R75 A;  5JK4 A;  4QSC A;  5FHM A;  2E0S A;  4QF9 A;  5H8N B;  1B3H A;  5AE4 A;  3OMB A;  4RJZ A;  4X9T A;  4F2Q A;  4FOR A;  3E9X A;  4GF8 A;  4QHQ A;  4PET A;  2G93 A;  1Q35 A;  4OMB A;  3HCQ A;  3K02 A;  1PBQ A;  1RKM A;  4ECF A;  4YB6 A;  1NFT A;  2PYY A;  3N94 A;  4BDR A;  3HV1 A;  3V8X B;  1MH3 A;  3IL1 B;  4Q0C A;  3FVG A;  3MQ9 A;  3MJN A;  1MH4 A;  3S4U A;  4XKP A;  2XXI A;  4FAJ A;  1LCT A;  4XKR A;  4I9D A;  3TCF A;  1FW0 A;  5H8N A;  5K2X A;  1RYO A;  1MY1 A;  2X26 A;  4RK9 A;  2DWJ A;  3K6W A;  5I2N A;  1B5H A;  1D9Y A;  1MXU A;  4NE4 A;  2I0C A;  3TYH A;  4GRK A;  4YKJ A;  3HPI A;  3S9L C;  2UVJ A;  3CSG A;  3A3C A;  4QFP A;  4F29 A;  2QL3 A;  1DTG A;  4KD5 A;  2Q2C A;  2I0B A;  1O63 A;  1JEU A;  4U21 A;  5CBS A;  2V93 A;  3H7M A;  4BDM A;  4G8H A;  4JDF A;  3C4M A;  2UVI A;  4IO6 A;  5I56 B;  4P0G A;  2ZNS A;  1QW0 A;  4ZED A;  1MXW A;  3ILT B;  1O64 A;  2UYE A;  1S50 A;  2QS1 A;  4G68 C;  4THI A;  2DS9 A;  4G8M A;  2AYS A;  1L5T A;  1XHY A;  3Q27 A;  4PFT A;  3CIJ A;  4ZE9 A;  4EQB A;  3LUY A;  2H25 A;  3A09 A;  3CVG A;  1OLA A;  4QSD A;  1DPP A;  1B46 A;  2Y84 A;  1D3K A;  2XXU A;  3H6W A;  2P2A A;  5JEI A;  4LA9 A;  3TEP A;  1XT8 A;  4E0X A;  2GFE A;  2DXR A;  4Z0I A;  3OEN A;  5I56 A;  3RTW B;  2Z8F A;  3CI8 A;  5L9M A;  4F3S A;  3S9N C;  5ICQ A;  4ELP A;  2P0S A;  2ZNT A;  4NWD A;  1TFD A;  3FVO A;  3TPA A;  2PBW A;  2F35 A;  3K4U A;  2Q89 A;  2NUV A;  4YKK A;  1URG A;  4R2F A;  3IJO B;  3DM0 A;  3QYT A;  4P0I A;  2F6P A;  1PC3 A;  2FNC A;  3FD3 A;  4PE5 B;  3U94 A;  2RC8 A;  1IIT A;  3FJG A;  1US5 A;  3TDJ A;  4GIZ A;  3RPW A;  3FV1 A;  4FJP A;  1PBP A;  3SEW A;  3OO7 A;  4MF3 A;  4GVO A;  2V84 A;  3C36 A;  2LAO A;  4IGT A;  4LVQ A;  3M8U A;  1QVS A;  4OQO A;  2F7C A;  4JWX A;  1MQI A;  3OO9 A;  4LZ5 A;  3TQL A;  3A3U A;  3EQ1 A;  1GVC A;  1B3G A;  3PUV E;  4YB7 A;  5I2K B;  4F39 A;  2F7B A;  2QPQ A;  3TKD A;  3C32 A;  4JB7 A;  3VXC A;  2O1L A;  1OQG A;  2PVU A;  4AB6 A;  3HST A;  1N3X A;  1CB6 A;  2GRV A;  4DXB A;  3IB1 A;  3W15 C;  3KOT A;  4IO3 A;  3ZS6 A;  4FED A;  4N07 A;  1M5B A;  4R72 A;  3DP4 A;  1WVJ A;  2F8D A;  1PEB A;  1MXV A;  3KN3 A;  1LFI A;  4BDN A;  3Q29 A;  4XKQ A;  2BJJ X;  4R73 A;  3CFZ A;  5I2K A;  1GGG A;  4LZ7 A;  2O7I A;  1FQB A;  3U92 A;  2RCB A;  1NNP A;  1H43 A;  4OFJ A;  1IQ7 A;  2XXV A;  4GWO A;  5L8D A;  3GBB A;  4DXC A;  1TFA A;  3CFX A;  1Z7N E;  2P1S A;  3FIR A;  4ONY A;  3Q28 A;  3Q25 A;  1GTK A;  2O7U A;  1JW1 A;  1XC1 A;  4DIG A;  2OWS A;  4H8I A;  4EUO A;  3K2D A;  5FTH A;  2ONK E;  1IXI A;  3H03 A;  2XXQ A;  4FE8 A;  2THI A;  4U22 A;  5B7D A;  4GFR A;  3V83 A;  1LBC A;  2Q9T A;  1WOD A;  1MY0 A;  2AL5 A;  3BKI B;  3PMX A;  4M4G A;  2REG A;  5CMK A;  5DVF A;  2VD2 A;  1ANF A;  2RC7 A;  1NNT A;  3K00 A;  5CBR A;  4H0W A;  1IUD A;  2DSF A;  2Y7P A;  4IO2 A;  3USD A;  3QIM A;  1ZU0 A;  1D4N A;  5AA2 D;  1SYI A;  2HQ0 A;  1MXX A;  1XOC A;  4OYV A;  2OJT A;  2Z8E A;  1QUL A;  1QUI A;  1MY3 A;  1A8F A;  5TP9 B;  5B70 A;  1LB9 A;  4OES A;  3BBR A;  1Y3Q A;  2ONR A;  3MP8 A;  3I3V A;  1EH3 A;  3R26 A;  4OER A;  3S9E A;  3T9U A;  3DLN A;  4L17 A;  5K2Y A;  1SI1 A;  2FA7 A;  1OLC A;  4JXI A;  2ZXT A;  5LOM A;  1B3L A;  4MBP A;  4F3G A;  1UQW A;  2ONS A;  3K0V A;  4G68 B;  4LON B;  2XHD A;  3I5O A;  1MDQ A;  3F11 A;  4H67 A;  3SEV A;  1BIY A;  1Q1K A;  3MP1 A;  2QSX A;  1MS7 A;  1MPB A;  2RIN A;  3M3F A;  4GL0 A;  1URS A;  4KFQ A;  5TP9 A;  3K1M A;  4UA8 A;  3FAT A;  2ANJ A;  4YMA A;  3U72 A;  4KI0 E;  3KN8 A;  2H4I A;  1R9L A;  1MY2 A;  1AIV A;  3PU5 A;  4O3A A;  1MQG A;  4GQO A;  4GXA A;  4TLM B;  1FTO A;  1DPE A;  3U1O A;  4OEU A;  3MPL A;  2D5W A;  1MQH A;  4JBZ A;  4QFK A;  1BTJ A;  3SEY A;  3N6T A;  2I49 A;  1SDX A;  1H76 A;  1Y20 A;  3B6W A;  4M1V A;  1BP5 A;  3FJM A;  2UYF A;  1OMP A;  5DEX B;  4F1Y A;  2I3V A;  5AA2 B;  4YKI A;  3PPR A;  3EPE A;  2ALU A;  2Y7I A;  4RXL A;  1LLS A;  3KZG A;  4O3B A;  1MRP A;  2A5S A;  5I2N B;  1I69 A;  4DDD A;  5HM4 B;  1JET A;  5JTY A;  4ZEK A;  4KPT A;  1A99 A;  3MVY A;  3KSX A;  3H6T A;  3TCG A;  4RPN A;  5DVJ A;  3PPP A;  1GR2 A;  2REJ A;  1LAF E;  3OOA A;  2F34 A;  5DEX A;  5AA2 A;  1USY E;  2HXW A;  4LZ8 A;  2DE2 A;  4ZEI A;  3FJ7 A;  2QRY A;  2HFB A;  3IAZ A;  2PX1 A;  2QMX A;  2XXP A;  5KZT A;  4QFO A;  3ODB A;  1Y3N A;  3K1N A;  4IY6 A;  2I4B A;  1SW5 A;  3GBA A;  1N76 A;  2G29 A;  2YLN A;  2VHA A;  1T0K A;  1IIW A;  1R6Z A;  2O69 A;  3MZB A;  3MP6 A;  3OD7 A;  1II5 A;  1JW5 A;  3MW0 A;  2Q2A A;  1B7H A;  3MC2 A;  3FV2 A;  3TTM A;  1EZO A;  4WEP A;  4RPO A;  3HN0 A;  3IR1 A;  3VVE A;  2QMW A;  1QJM A;  4BDL A;  4EF1 A;  3C31 A;  3IB0 A;  2V25 A;  1AMF A;  3MBP A;  4U1O A;  5J1D A;  3LC8 A;  4R9F A;  1J1N A;  1ZTY A;  2WKY A;  3IK6 B;  3KEI A;  4PFW A;  5I57 A;  3I6V A;  2UXA A;  3ILU B;  2OBG A;  3G3J A;  3C33 A;  5L9O A;  3JZJ A;  4Q30 B;  2F7A A;  4POW A;  2DVZ A;  1N0T A;  4ELO A;  4KCD A;  3LSX A;  1DMB A;  2DQV A;  1HSE A;  1B32 A;  3WAF A;  1VE4 A;  3RN8 A;  4NWC A;  4EXK A;  1CE2 A;  2DVC A;  5TU0 A;  4U23 A;  1AOV A;  3W9W A;  5CRY A;  1DTZ A;  2X7P A;  4YU0 A;  5TPA B;  3B6Q A;  4U2R A;  1B5I A;  3KN7 A;  3TEL A;  2AIX A;  4PQJ A;  4ESX A;  3RNN A;  1JW4 A;  2B65 A;  2V3Q A;  2O1M A;  3KGC A;  3IX1 A;  3T96 B;  1SD3 A;  4X1D A;  1PB9 A;  3KSJ A;  4H5F A;  3T22 A;  1MM6 A;  3QUF A;  3IOU A;  2OLB A;  3R6U A;  1XVY A;  3UK4 A;  2ZNU A;  2GHB A;  1SQY A;  4JSO A;  4HCY A;  5TPA A;  3K01 A;  4ZZE A;  4UAC A;  3PUX E;  5IAI A;  1MQD A;  3KG2 A;  4I62 A;  1Y4C A;  4IGR A;  1MM7 A;  5ICT A;  2V3T A;  1P1N A;  3T9X B;  3KJT A;  5H8S A;  1Y1M A;  1UIU A;  4ZZA A;  3S2V A;  2H99 A;  1Y9U A;  4YKP A;  5EHS A;  3VLV A;  1M5E A;  1LBB A;  2ZYM A;  4QFN A;  3TMG A;  3LSL A;  4G77 A;  4KYD A;  1TWY A;  1B1X A;  1GV8 A;  1VFD A;  3KFM A;  3FZV A;  4NTL A;  3E13 X;  3LSF B;  3EF7 A;  4QRZ A;  1HSL A;  1XVX A;  3PMV A;  3IOR A;  5AA3 A;  1EU8 A;  3PUW E;  1QKA A;  3O28 A;  3G7W A;  3RLF E;  3N6U A;  4F1V A;  3N5L A;  4H6D A;  2I4C A;  3SDF A;  4KCC A;  2A5T B;  1SW2 A;  5DTB A;  1B3E A;  4AQ4 A;  3MZ1 A;  3HHG A;  1JQF A;  4TOZ A;  1JEV A;  3LBS A;  5DVI A;  2DYX A;  4BDQ A;  1B52 A;  4HTG A;  3ZKK A;  3S9M C;  1I6B A;  1PB8 A;  1BKA A;  1RYX A;  4DLD A;  1YPN A;  3PV0 E;  1M5C A;  3UN6 A;  1SVX B;  1ZKB A;  3G3I A;  4P11 A;  4AB5 A;  2XXX A;  4C0R A;  2F78 A;  2XD3 A;  1FQA A;  4ELR A;  3TFL A;  3PGF A;  2OCU A;  1PB7 A;  5BWJ A;  3UIF A;  2A5T A;  1DSN A;  2XX8 A;  3O2A A;  4ND9 A;  3VLU A;  3EHT A;  3B6T A;  1MPD A;  4GOT A;  1B3F A;  2B3F A;  3ZSF A;  3E4R A;  1MG1 A;  1H44 A;  4N13 A;  3PPO A;  2ZYO A;  3MUQ A;  2FYI A;  1HSJ A;  4GXS B;  1NNK A;  1YCJ A;  3FVN A;  4ZEC A;  3IB2 A;  2YJP A;  3M3L A;  4PFY A;  1SBP A;  4RK2 A;  3VXB A;  4OVJ A;  2Y7K A;  3VFJ A;  4MH5 A;  1Y1Z A;  4F3P A;  2HEU A;  4H65 A;  1F9B A;  3G3H A;  3RY3 A;  4H1X A;  1A8E A;  1JNF A;  4IB2 A;  1H3D A;  5I84 A;  1D9V A;  4OET A;  1MDP 1;  3IO4 A;  2ZMB A;  4NF6 B;  1UTB B;  1LFH A;  1P99 A;  4G8N A;  1YTV A;  1I6A A;  1NKX A;  4EXL A;  3SEU A;  3H4Z A;  4HS7 A;  3OEM A;  5KCJ B;  3VDF A;  2OK2 A;  3OEK A;  4N6P A;  3KOS A;  3O29 A;  1B6H A;  2HAU A;  4KYS A;  4OFL A;  4MLQ A;  1QUJ A;  2ZYK A;  1KWH A;  4MLV A;  3O6H A;  1IEJ A;  3K6X A;  4R6H A;  2VD3 A;  1SW4 A;  4KYE A;  4E0W A;  4WXJ A;  2HAV A;  2DOJ A;  3TTL A;  1Y3P A;  3TTR A;  1N3W A;  4OEV A;  5ELV A;  1IXG A;  3AXF A;  4NF6 A;  1UTB A;  4NF8 B;  1B1H A;  1A40 A;  3H6V A;  3PD8 A;  3BFT A;  3FXQ A;  5I59 B;  5JTY B;  1NMU A;  2VP1 A;  3C9H A;  2F6G A;  2DWA A;  5KCJ A;  4JSD A;  1AL3 A;  4YB5 A;  3PD9 A;  2QJE A;  3B7D A;  1LAH E;  4U4S A;  4MFI A;  4NED A;  3RTF B;  3CRB A;  5ITP A;  3SES A;  4LP2 B;  1US4 A;  4XIG Q;  4QSE A;  1FTM A;  5IKB A;  1ZIU A;  1NL5 A;  3EN3 A;  3LR1 A;  3FVK A;  3VLW A;  1ZBM A;  3IO6 A;  4NF8 A;  4TQU Q;  3TTK A;  1B40 A;  5I59 A;  5BUU A;  3TQW A;  2XXW A;  3OO6 A;  1MXZ A;  4I1D A;  3CFL A;  1NH7 A;  1B51 A;  1NH8 A;  1USY H;  3VV5 A;  4R2B A;  1O7T A;  1B7Z A;  4F18 A;  4X48 A;  1VSO A;  3BFU A;  3OXN A;  1TXF A;  4F31 B;  2QS2 A;  2IA4 A;  2DE3 A;  1QUK A;  1B9J A;  1N7W A;  2D3I A;  3SEX A;  4R74 A;  5DYH A;  4R6Y A;  2HCA A;  3CG3 A;  3M3K A;  1B7U A;  4HW8 A;  3C35 A;  1ATG A;  3T9H B;  2RCA A;  3FGS A;  5HBC A;  3G3K A;  2OZZ A;  4EQ7 A;  3R7X A;  4F1U A;  3L6G A;  5AA1 A;  2NVU B;  1B0H A;  3D4C A;  4KR5 A;  2XD2 A;  3TUS A;  5I57 B;  1S7Y A;  2GHA A;  3K6U A;  1P1U A;  3UOR A;  4ZEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...