5F7VA

Abc substrate-binding protein lmo0181 from listeria monocytogenes in complex with cycloalternan
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
390
structure length
388
Chain Sequence
DKTEITYYQFSAPGKALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKGVLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVEYPTADWTWKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTETTINSPENVEALTHLTNEVTDSKVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPFKWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWELPATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDSTPEKALKNSEDNINKTMGFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo0181 protein
publication title Structure to function of an alpha-glucan metabolic pathway that promotes Listeria monocytogenes pathogenesis.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Cycloalternan binding protein
total genus 136
structure length 388
sequence length 390
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5f7vA00
3E4RA 1N84A 4NF4B 2ZXTA 4OFLA 4QFLA 4FAJA 5KDTA 4EXLA 1RKMA 1XS5A 2B65A 2H5YA 2QS2A 1Y4CA 4F18A 3UIFA 4OFJA 3MVYA 3IR1A 1AIVA 3EN3A 4MLVA 2DQVA 2ZYNA 3VDFA 2DVCA 1A8FA 4GXSB 2HZKA 3C31A 1B51A 2H99A 4C1TA 2QS3A 1MXYA 4EUOA 2QPQA 1Z7ME 5AE4A 4Q0CA 3TELA 5JTYB 4KHZE 3D4CA 2VGQA 3G3IA 1FTOA 4GWOA 1PBQA 3PMWA 4POXA 1N3XA 5TU0A 4BDOA 4HW8A 3RLFE 4YICA 3RPWA 3AXFA 4E0XA 1IXIA 3KSXA 1IIWA 4F3GA 3H7MA 2XXTA 3FJ7A 3KOTA 4U22A 3HCQA 1IUDA 3B7DA 1LAXA 2QJEA 1ZMGA 2V25A 5DVFA 2NXOA 4IGTA 5H8QA 3LR1A 3RTWB 4EXKA 2DWAA 4DZ1A 3IB2A 4X9TA 3MW0A 1SW2A 4WEDA 2ONRA 3JZJA 3MBPA 4YKPA 1HSEA 1M5FA 1QKAA 1ANFA 4TOZA 2NVUB 3ONMA 1DPEA 2V3QA 3N6TA 5CRYA 3N6UA 1M5BA 1QULA 3PPQA 2H4IA 4R72A 3KOSA 2REGA 4PQJA 1B7UA 1DOTA 3EHTA 4RY1A 2AYSA 4KYSA 3OSQA 2ZNSA 3CSBA 1LFIA 4EQ7A 3CG1A 5KZTA 4FEDA 3K00A 1EZ9A 3MP6A 1ELJA 3C35A 4YKIA 1O63A 3RY3A 2XXQA 2O68A 2NWJA 1S7YA 5CBRA 1SYIA 4JBZA 1MQIA 4RK2A 1FW0A 2THIA 3KN8A 4PP0A 3FASA 4MBPA 5I2NB 4YKJA 1NMUA 5CC2A 4H5GA 4PETA 1O7TA 4KD5A 1CB6A 4OERA 2ANJA 3K4UA 3IK6B 1TT1A 4R9FA 3R7XA 1WDNA 1GGGA 2F35A 3MPLA 4ZEDA 3ZSFA 3I3VA 1II5A 3ZKKA 1NL5A 5I2KB 2XX8A 2DE3A 1US5A 3H6VA 1DTGA 4GXAA 3RUMA 3TZAA 3FVKA 4XXUA 1IXGA 1FQFA 1DMBA 4TQUQ 4R2BA 4I9DA 1T0KA 1N7XA 3K6WA 4F3PA 3PPOA 2O6AA 3CSGA 3KEIA 4OZ9A 2HEUA 4R2FA 1NKXA 3W9VA 4HS7A 3TKDA 5BWJA 4QF9A 4ESXA 4F22A 1F9BA 1B46A 3HO7A 4R73A 4LZ5A 1Y3NA 1N7WA 3M8UA 2F6GA 4P0IA 3G3FA 2ZYMA 3IOUA 4EQ9A 3IO6A 1PDAA 1QW0A 1B5IA 4KR5A 2YLNA 5JEIA 2ONKE 1YTVA 3BBRA 3DELB 1USYE 4Z7EA 3GXAA 4H65A 3QK6A 4RPNA 3W15C 1A55A 1BTJA 1B5JA 3M3LA 3UGWA 4PFUA 4ZDMA 3ILTB 2QMXA 3QYTA 4YMAA 4MFIA 1POY1 4EF1A 2Y7WA 4R6YA 2XXXA 1NFTA 2E1SA 2UXAA 1NNFA 3FXQA 3SEWA 1JW5A 2FNCA 3FV1A 4RPOA 4BDLA 3TTLA 3V89B 3ECRA 1B0LA 4H8JA 2HCAA 4GFRA 3K6UA 2GFEA 3S9NC 1B05A 1EZOA 2I6EA 2I48A 4JWOA 1URGA 3ZKLA 1EU8A 3MZBA 2I4BA 4LVQA 4AQ4A 3TFLA 3MJNA 4U2RA 4M4GA 3SERA 2AL4A 1UTHA 3U8QA 4IY5A 4MF3A 1UIVA 4U4XA 2Z22A 3TTKA 3G7WA 2B3BA 4OVJA 2DE2A 3RGYA 3LUYA 4KCDA 3VLUA 1N04A 2HAUA 3CRBA 3H4ZA 3T9XB 2Z8DA 3TDJA 5I58A 4OQOA 4JSDA 4P11A 3FD3A 3SETA 2PVUA 3RTFB 4NF4A 2OK2A 2P1SA 1SQYA 3QAXA 3VE1B 5EYFA 4DXUA 3VV5A 5ELVA 2F78A 3L6HA 4LQ5A 3O6GA 3A3UA 1VE4A 3K6XA 3SKPA 1XVYA 2HFBA 5TPAB 4DCYA 1B3LA 5FHMA 2Q2CA 4Z0IA 3CFZA 1QVSA 3WAEA 1JVYA 1JETA 4NF6B 1MDQA 3QXMA 3VXCA 1PB8A 3KSJA 4GQOA 5CMBA 5ITOA 2ALUA 1USYH 3GBAA 1Y1ZA 2QSXA 4TLLB 1B3FA 4DDDA 4XIGQ 4GF8A 4R6KA 5JTYA 1XHYA 2AL5A 3RT8A 4G68C 1JQFA 1P1UA 2D5WA 3LSXA 3DP8A 1OLCA 4IO4A 2V3UA 4IY6A 2XXWA 2P2AA 1PB9A 5ICTA 5HM4B 2F7CA 2PBWA 5H8HB 3KBRA 2VD3A 4KPTA 3DM0A 3IORA 4U1ZA 4ESWA 1ZIUA 1D9VA 5ITPA 3QUJA 4HCYA 2ESNA 2KLFA 2I49A 3EHUA 1NH8A 2W7YA 3MP8A 2X7QA 3S9EA 5DEXB 4N13A 1YAEA 1URDA 4G2ZA 2VHAA 2HXWA 2Z23A 2DOJA 1BIYA 3VVEA 4QRZA 3E9XA 4JSOA 4OETA 3O9PA 3E13X 2DYXA 2ZYKA 3SDFA 2RKMA 3H06B 2HZLA 5H8SA 3PGFA 2UYEA 3LSFB 3RNNA 2GHBA 4N07A 1PC3A 1OVBA 3OENA 3CI8A 4U1OA 3TTRA 1SI1A 4Q8RA 4ONYA 1P1QA 4OESA 4U23A 2XXRA 4QFPA 5H8FB 1LCFA 4PFTA 1A54A 1DPPA 3Q28A 2GH9A 3E3KA 3VLVA 2OBGA 3ZS6A 4M1VA 1KWHA 1ZBMA 4DXCA 3DP4A 2OWTA 2HAVA 4H0WA 5CMKA 4GOTA 3UORA 5EHSA 2ZNUA 5L9OA 3ILUB 3TCGA 1B5HA 1ZTYA 4BDRA 4F3BA 2RF1A 4RJZA 5I2NA 1MM6A 1YCJA 3CG3A 5CMCA 3PUXE 4H67A 4ISUA 2A5TB 3Q29A 4PE5B 3TAJA 4AB5A 3QIMA 1MH3A 3LBSA 1MQDA 3EQ1A 2GRVA 3R26A 1FQBA 4G8NA 2XX9A 5I2KA 1P99A 2RCBA 2D3IA 4QSDA 2REJA 2I3WA 2OWSA 3CIJA 4XKRA 1FQDA 3V8XB 4EF2A 2ZYOA 2Z8EA 3IJXB 3MVZA 1B3HA 3KN3A 1MXUA 5I56B 2H98A 2PMSA 4GL0A 3TTNA 1MS7A 1XOCA 1XT8A 1JVXA 3K1NA 1MPBA 4X1BA 1XC1A 2UYFA 3O66A 2XD3A 4DCXA 2O51A 5CI5A 3N5LA 5A5XA 2I58A 3Q27A 4I62A 3A09A 3IAZA 3SEYA 1BLFA 3FXUA 3OELA 4ZEBA 3U72A 1OQGA 2R6GE 4H1XA 1R9QA 4K3FA 4FORA 4YB6A 2XX7A 3MPKA 1OQHA 4LP2B 3UK4A 4Q5TA 1QUJA 3OO6A 3S4UA 1YPNA 3GBBA 1H44A 4G8HA 5H8NA 4ZE8A 5DYHA 2Q2AA 3OO8A 5FTHA 3C32A 3G3JA 4L17A 2O1MA 1B7HA 4GIZA 4ZE9A 3MQ9A 4U4SA 1FCKA 3UA8A 2Q89A 4EQBA 4IO3A 3CFXA 4MH5A 2Y84A 3LSWA 3S9MC 2R71A 3T66A 1JEVA 2QRYA 2G93A 2VD2A 3VXBA 2O84X 2F97A 3T96B 3EPEA 4ZEIA 3CVGA 3TUSA 1ATGA 2PX1A 4H6DA 2QS4A 4ZEFA 1I69A 1MH4A 1MY0A 3QUFA 1Z7NE 5DVIA 4AB6A 1LLSA 3KZGA 1POTA 4O3AA 1LBCA 4WEPA 4ZZEA 1B9JA 4I8CA 3K01A 5IKBA 4ZECA 1I6QA 1OVTA 3FV2A 1JW4A 5L9MA 1Q35A 3G3GA 5K2YA 4POWA 3TODA 2UVGA 3OD7A 3H6TA 3UN6A 5AA1A 1IEJA 2QMWA 4NE4A 1Y9UA 1B6HA 3CR9A 5BUUA 3PV0E 1URSA 2YPNA 5HBCA 2NUVA 5I57A 5HPQA 4IB2A 5JK4A 3DP6A 4TLMB 3L6GA 2DVZA 3PPPA 4F19A 4GL8A 1LCTA 3I6VA 2V93A 3C33A 5CM6A 2H25A 1AL3A 5DT6A 3V5AA 2X26A 1H76A 2I0CA 3TEPA 2I0BA 1MY1A 3RN8A 5I59B 1GR2A 3Q25A 5AA4B 3C34A 3OXNA 2G29A 3LSLA 4QHQA 4GRKA 2LAOA 4NTLA 2RC8A 1NNKA 4NF6A 3IJOB 4F2QA 3FATA 5IAIA 1LAHE 1Y3PA 2RC7A 5KCJB 1A40A 2XXUA 3PD9A 3USDA 1M5EA 2VOZA 1LBBA 4O3CA 4JXIA 4KQPA 4YAHX 1FTKA 2ABHA 3F11A 4PFYA 4G77A 2NOOA 1UIUA 5AA2D 4F1VA 3FVOA 3Q26A 4RYAA 1B3GA 4DXBA 3IB0A 1UTBA 3FVGA 4MLQA 1Y1MA 1D3KA 4YMBA 4HCWA 1JW1A 3TPAA 3OO7A 4IO2A 1SI0A 3FGSA 5H8HA 5ICQA 4F31B 4FIMA 2IEEA 3HHFA 4ZZAA 3C9HA 3SEVA 3OEKA 3K02A 3H6WA 2DWHA 1IITA 4NF5B 1R9LA 4U21A 5DEXA 3OMBA 1QKBA 3GZGA 2O69A 1RYOA 2F7BA 1A99A 4F1UA 1FTLA 4JWYA 4ZS9A 5L8DA 4O3BA 1FQEA 1LAGE 1P1WA 4LATA 1A7LA 1FQAA 3C36A 2CMOA 4NF8B 4LZ8A 4N6PA 4IO5A 5K2XA 3O97A 2DXYA 3T9UA 3DLNA 4XTCQ 3PUYE 4PFWA 1LGBC 5AA2B 5FTIA 1FTJA 1QUKA 4LONB 4G68B 1HSJA 3B6WA 4OXVA 3PD8A 2WKYA 3HHGA 1MPCA 3TTMA 1S9TA 1SD3A 4OHNA 2Z8FA 1LSTA 3PU5A 3GLBA 5H8FA 1Y3QA 1Y20A 4XKQA 3SESA 3B6QA 3OOAA 1NNTA 2GHAA 1LAFE 3FZVA 1B4HA 4THIA 3KJTA 1GTKA 2Q9TA 3HV1A 2DXRA 3K2DA 1OMPA 3MP1A 3P7IA 5F7VA 3HPIA 3K1PA 1XVXA 3MAMA 2F36A 3O29A 3BFUA 2A5TA 5TP9B 2E0SA 3MWBA 1M5DA 1N0TA 3FVNA 1JNFA 4LA9A 2XXYA 4BDQA 4ELOA 1MQJA 4WKMA 3SEUA 1IXHA 4GLIA 2Y7PA 4HTGA 3JYRA 4LUBA 4NWCA 3LC8A 3T9VA 1WVJA 1SW4A 1N76A 4NEDA 3V83A 3ODBA 2A5SA 1B0HA 4ELRA 4ZEKA 1N3WA 1LFGA 4NMYA 5I56A 2OCUA 4DE8A 4F29A 4IO6A 4F1YA 1B52A 2QL3A 4IGRA 3FJGA 2O7IA 1MY4A 5DTBA 3CFLA 3O2AA 3IOWA 2PT1A 3PMVA 1OLAA 4KYDA 4E0WA 3TQLA 4JWXA 1SDXA 1R1NA 4OENA 4UACA 3U93A 3TCFA 3U92A 1TWYA 4G8MA 1IXCA 4YU0A 1ZU0A 2DP8A 1MRPA 1CE2A 1B2HA 4LZ7A 4RXLA 3T22A 1LB9A 2P0SA 1UQWA 2XXIA 1B58A 4KYEA 3IB1A 4GD5A 2RCAA 3KG2A 1US4A 3T9HB 3H6UA 1TXFA 1D9YA 5KDTB 1I6BA 1TFDA 2Y7RA 1AH5A 1PB7A 3O6HA 1MXZA 1NH7A 2XHDA 1B40A 4OWDA 5DVJA 1P1NA 2Q8JA 1EZPA 5AA3A 3VLWA 2XXPA 4BDNA 3FXRA 1BKAA 3WAFA 3K1MA 2F8DA 2CZLA 4OTEA 3VFJA 2AIXA 2OLBA 3TYHA 4BDMA 3MC2A 4OYVA 4QSEA 4XKPA 1B7ZA 2VP1A 1FTMA 3PPRA 5FHOA 3KN7A 3G3HA 1MPDA 5I84A 3T93B 4RK9A 3PUWE 1LFHA 2F34A 1SYHA 2RINA 3EHSA 4X48A 2DWIA 2M8CA 1Y4TA 1DSNA 2O7UA 1L5TA 4P0GA 1EH3A 3QSLA 3N94A 2PYYA 1B32A 3W9WA 1ZJLA 4OMBA 4EDPA 3MVXA 5ISUA 1VFEA 5FHNA 4KCCA 3K6VA 4F39A 5H8QB 3D4GA 5I59A 5J1DA 1J1NA 5AA4A 3OEMA 3U94A 3FIRA 4DLDA 3VVDA 4QFOA 2I4CA 3EF7A 4QSCA 3JV9A 3TMGA 3FUZA 3OO9A 4KI0E 2DE4A 2F6PA 2IA4A 4DIGA 5KCJA 1AOVA 4QFKA 1LB8A 1R6ZA 3R6UA 3TCHA 4R74A 2PT2A 3OSRA 1VR5A 3M3KA 4R6HA 1S50A 2Y7KA 4RA1A 3FJMA 2O1LA 1MQGA 5F1QA 4F2OA 5EHMA 1H43A 1MDP1 4IO7A 5B70A 3HSTA 5A5XB 3K0VA 2X7PA 3IOVA 2UVIA 4ECFA 1MG1A 4C0RA 2V3TA 1A8EA 4BLAA 4ND9A 2ONSA 4H5FA 2F5XA 1NNPA 2QS1A 4UA8A 2FYIA 5B7DA 1RYXA 3B6TA 4NF5A 2BJJX 3BKIB 2FA7A 4JB7A 5H8NB 2DSFA 3PMXA 4OEUA 4FEBA 1OIBA 5TPAA 3O6IA 1H3DA 1SW5A 1H45A 4NF8A 2OZZA 1JEUA 1AMFA 3N26A 3IOTA 4FE8A 3KJ7A 3TQWA 2OJTA 5AA2A 4YKKA 1MM7A 4FJPA 4G68A 3UP9A 1B3EA 1ZKBA 1MQHA 1I6AA 4YZZA 1GVCA 1SBPA 2ZNTA 2V84A 4RNSA 1B4ZA 1IZ1A 2Q88A 1B1XA 1GV8A 3SEXA 2F7AA 1WODA 1M5CA 4X1DA 1MXXA 2B3FA 2I3VA 3G3KA 4GVOA 5L9SA 4R75A 3S9LC 4OEVA 1MXVA 1PBPA 4LQ2A 3MVWA 5TP9A 3KFMA 3M3FA 4R9GA 2UVHA 3PUZE 4ELPA 1BP5A 1VFDA 1PEBA 3MZ1A 5I57B 1B1HA 3U1OA 3C4MA 3VVFA 4I1DA 2Y7IA 1QJMA 1HSLA 1QUIA 1VSOA 3H3GA 3HN0A 3O28A 4F3SA 4C1UA 1MXWA 4G4PA 4ELQA 2DS9A 5LOMA 4Q30B 5CMMA 3RT6B 3S2VA 5CBSA 1DTZA 2HQ0A 1Q1KA 1MY3A 4XKNA 1TFAA 4FATA 1D4NA 4FECA 4QFNA 3PPNA 3IL1B 3KGCA 4JDFA 5M2VA 1ZLQA 4H8IA 2D21A 1O64A 4NWDA 4YB5A 1UTHB 3A3CA 1FQCA 2XXVA 4KFQA 3RQTA 4YB7A 1MY2A 2RC9A 2H9BA 2R9JA 4WXJA 1SW1A 3PUVE 3I5OA 3IX1A 2DWJA 3MZ9A 4OFOA 1IQ7A 3H03A 1UTBB 3IO4A 1P1OA 2ZMBA 1SVXB 3BFTA 2UVJA 2XXHA 3MUQA 3THIA 5I58B 2YJPA 2XD2A
chains in the Genus database with same CATH superfamily
2FIEA 3E4RA 1N84A 4NF4B 2ZXTA 4OFLA 4QFLA 4FAJA 4PDDA 5KDTA 4EXLA 3BIGA 4PC9A 1RKMA 1XS5A 2B65A 2H5YA 4PCDA 2QS2A 1Y4CA 4F18A 3UIFA 4N8YA 4OFJA 3MVYA 3IR1A 1AIVA 3EN3A 4MLVA 2DQVA 1FBEA 2ZYNA 5T3JA 3VDFA 2DVCA 1A8FA 4GXSB 2HZKA 3C31A 1B51A 2H99A 4C1TA 4G61A 2QS3A 1MXYA 4EUOA 2QPQA 1Z7ME 5AE4A 1EYJA 4Q0CA 3TELA 5JTYB 4KHZE 3D4CA 2VGQA 3G3IA 1FTOA 4GWOA 3PTYA 1PBQA 3PMWA 4POXA 1N3XA 5EQ9A 4AS5A 5TU0A 4BDOA 1K9ZA 1LEVA 4MNPA 4HW8A 3RLFE 4YICA 3RPWA 3AXFA 4E0XA 1FPBA 2MKZA 1IXIA 1RDYA 3KSXA 1IIWA 4F3GA 3H7MA 2XXTA 3FJ7A 3KOTA 4U22A 3HCQA 4N4UA 1IUDA 3B7DA 3FBPA 1FBPA 1LAXA 1YZ0A 2QJEA 1ZMGA 2V25A 2VPOA 5DVFA 2NXOA 4IGTA 5H8QA 2WYPA 3LR1A 3RTWB 4EXKA 2DWAA 4DZ1A 3IB2A 4X9TA 3MW0A 1G0IA 1SW2A 4O8MA 4PF6A 4WEDA 2ONRA 3JZJA 3MBPA 4YKPA 1HSEA 1M5FA 1QKAA 1ANFA 4P1EA 4TOZA 2NVUB 3ONMA 2Y5LA 1DPEA 2V3QA 3N6TA 4N91A 5CRYA 3N6UA 4OVQA 1M5BA 1QULA 3PPQA 4GX3A 1YXIA 2H4IA 4R72A 3KOSA 2REGA 5J16A 4P56A 3BIHA 4LN5A 2WYKA 4PQJA 1B7UA 1DOTA 1FPKA 3EHTA 4RY1A 2AYSA 4KYSA 3OSQA 2ZNSA 3CSBA 1BK4A 3ROJA 1LFIA 4EQ7A 3CG1A 5KZTA 4FEDA 3K00A 1EZ9A 3MP6A 4QBAA 1ELJA 3C35A 3D1RA 4YKIA 1O63A 3RY3A 2XXQA 3RPLA 2O68A 2NWJA 5EYGA 1S7YA 2V4CA 1NI9A 5CBRA 1SYIA 4JBZA 1MQIA 4RK2A 1FW0A 2FBPA 5IGAA 2THIA 3KN8A 4PP0A 4MNIA 3FASA 2B4LA 4MBPA 5I2NB 4YKJA 1NMUA 5CC2A 4H5GA 4PETA 1O7TA 4KD5A 1CB6A 4OERA 2ANJA 3K4UA 3IK6B 1TT1A 4R9FA 3R7XA 2PCRA 1WDNA 1GGGA 2F35A 3MPLA 4ZEDA 4H46A 3ZSFA 3HFUA 3I3VA 1II5A 4OVTA 3ZKKA 3E79A 1NL5A 5I2KB 2XX8A 2DE3A 4JVIA 1US5A 3H6VA 1DTGA 4GXAA 3RUMA 3TZAA 3FVKA 4XXUA 1IXGA 1FQFA 3KC1A 1DMBA 4TQUQ 4P9KA 4R2BA 4I9DA 1T0KA 3IFCA 2XXKA 1N7XA 3K6WA 4F3PA 3PPOA 2O6AA 3CSGA 3KEIA 4OZ9A 2HEUA 4R2FA 1NKXA 5IZZA 3U65A 3W9VA 4HS7A 3TKDA 5BWJA 4QF9A 4ESXA 4F22A 4I40A 1F9BA 1B46A 3HO7A 4R73A 4LZ5A 1Y3NA 1N7WA 3M8UA 2F6GA 4P0IA 3G3FA 2ZYMA 3IOUA 4EQ9A 3IO6A 1PDAA 1QW0A 1B5IA 4KR5A 2YLNA 5JEIA 2ONKE 4IR8A 1YTVA 3BBRA 3DELB 1USYE 4Z7EA 3GXAA 4H65A 3QK6A 4RPNA 3W15C 1A55A 1BTJA 1B5JA 3M3LA 3UGWA 4PFUA 4ZDMA 1NV2A 3ILTB 2QMXA 3QYTA 4YMAA 4MFIA 1POY1 4NN3A 4EF1A 2Y7WA 5LTCA 1VDWA 4QXDA 4R6YA 2XXXA 1NFTA 2E1SA 2UXAA 1NNFA 3FXQA 3SZPA 3SEWA 1JW5A 2FNCA 3FV1A 4RPOA 4BDLA 3TTLA 3V89B 4N81A 3ECRA 1B0LA 2ZZWA 4H8JA 2HCAA 4GFRA 3K6UA 2GFEA 3S9NC 1B05A 1EZOA 2I6EA 2I48A 4JWOA 4NQ8A 1URGA 1SPIA 3ZKLA 1EU8A 3MZBA 2I4BA 2PFZA 4LVQA 4AQ4A 3TFLA 3MJNA 4OVRA 4U2RA 4M4GA 3SERA 2AL4A 1UTHA 3U8QA 4GBVA 4IY5A 4MF3A 2GQ1A 1UIVA 4U4XA 2Z22A 3TTKA 3G7WA 1FPJA 2B3BA 4OVJA 1FBGA 3NOHA 2DE2A 3RGYA 3LUYA 4KCDA 3VLUA 5I5PA 1N04A 2HAUA 2QVVA 3LV0A 3CRBA 3H4ZA 3T9XB 2Z8DA 5EYHA 3TDJA 5I58A 3KC0A 1QGXA 4OQOA 4JSDA 4P11A 3FD3A 3SETA 2OX3A 1EYIA 2PVUA 3RTFB 4NF4A 2OK2A 2P1SA 5EQ8A 1SQYA 3QAXA 3VE1B 5EYFA 4DXUA 3VV5A 5ELVA 2F78A 3L6HA 4LQ5A 3O6GA 1LBYA 3A3UA 1VE4A 3K6XA 3SKPA 1XVYA 2HFBA 5I7IA 5TPAB 2R8TA 4DCYA 1B3LA 5FHMA 2Q2CA 4Z0IA 3CFZA 1QVSA 3WAEA 1JVYA 1JETA 4HE2A 4NF6B 1MDQA 3QXMA 3VXCA 1PB8A 3KSJA 4GQOA 5CMBA 5ITOA 1KA0A 1USYH 2ALUA 3GBAA 1Y1ZA 2QSXA 2HPGA 4TLLB 1B3FA 4DDDA 4XIGQ 4GF8A 2XWVA 4R6KA 5JTYA 1XHYA 2FIXA 2AL5A 3RT8A 4G68C 1JQFA 1P1UA 2D5WA 3LSXA 5A5LA 3DP8A 1OLCA 4IO4A 2V3UA 4IY6A 2XXWA 4PFIA 2P2AA 1PB9A 5ICTA 5HM4B 5ET6A 2F7CA 2PBWA 1FJ6A 3KBRA 5H8HB 1FPEA 2VD3A 4KPTA 3DM0A 3IORA 4U1ZA 4ESWA 1ZIUA 1D9VA 5ITPA 3QUJA 4MAGA 5ET8A 4HCYA 2WBDA 4NF0A 2ESNA 2KLFA 2CEXA 2I49A 3EHUA 1NH8A 2W7YA 3MP8A 2X7QA 3S9EA 5DEXB 4N13A 1YAEA 1URDA 4G2ZA 4I3EA 5DW8A 2VHAA 2HXWA 2Z23A 2DOJA 1BIYA 3VVEA 4QRZA 3E9XA 4JSOA 4OETA 4GWWA 3O9PA 1EYKA 3E13X 3QMFA 2DYXA 2ZYKA 3SDFA 2RKMA 3H06B 2HZLA 3MYUA 5H8SA 3PGFA 4XFEA 2UYEA 3LSFB 3RNNA 2GHBA 4N07A 2Q74A 1PC3A 1OVBA 3OENA 2OWZA 3CI8A 5ET5A 4U1OA 2KR0A 3TTRA 1FBHA 1SI1A 4Q8RA 4ONYA 1FPDA 4GWZA 4FBPA 1P1QA 4OESA 4U23A 2XXRA 4QFPA 5H8FB 1LCFA 4PFTA 1A54A 1DPPA 3Q28A 2GH9A 4PBQA 3E3KA 3VLVA 1FBCA 2OBGA 3ZS6A 4M1VA 1KWHA 1ZBMA 4DXCA 3DP4A 2OWTA 2HAVA 4H0WA 5CMKA 4GOTA 3UORA 5EHSA 2ZNUA 5L9OA 3ILUB 3TCGA 1B5HA 1ZTYA 4BDRA 4F3BA 2RF1A 4RJZA 5I2NA 1MM6A 1YCJA 3CG3A 5CMCA 3PUXE 4H67A 4ISUA 2A5TB 3Q29A 4PE5B 3TAJA 4AB5A 3QIMA 1MH3A 3LBSA 1MQDA 3EQ1A 2GRVA 3T0JA 3R26A 1IMBA 2FHYA 1FQBA 4KXPA 4G8NA 4MJOA 2XX9A 5I2KA 1P99A 2RCBA 2D3IA 4QSDA 2REJA 2I3WA 2QVUA 2OWSA 3CIJA 5IM2A 1IMCA 4XKRA 1FQDA 3V8XB 4EF2A 2ZYOA 2Z8EA 3IJXB 3MVZA 1B3HA 3KN3A 4GWSA 1MXUA 2XWOA 5I56B 2H98A 2PMSA 4GL0A 3TTNA 1MS7A 1XOCA 1XT8A 2VT5A 1JVXA 3K1NA 1MPBA 4X1BA 1XC1A 2UYFA 3O66A 2XD3A 4DCXA 2O51A 4H45A 5I3SA 5CI5A 3N5LA 5A5XA 2I58A 3Q27A 4I62A 3A09A 2L5VA 3IAZA 3SEYA 4OVSA 4GWYA 1BLFA 3FXUA 3OELA 4ZEBA 3U72A 1OQGA 2R6GE 4H1XA 1R9QA 4K3FA 4FORA 4YB6A 1NV7A 1DCUA 2XX7A 2P3VA 3MPKA 1OQHA 4PAKA 4LP2B 3UK4A 4P8BA 4Q5TA 1QUJA 3OO6A 3S4UA 1YPNA 3GBBA 1H44A 4G8HA 5H8NA 4ZE8A 5DYHA 2Q2AA 3OO8A 5FTHA 3C32A 3G3JA 4L17A 2O1MA 4HXVA 1B7HA 3EKIA 4GIZA 4ZE9A 3MQ9A 4U4SA 1FCKA 3UA8A 2Q89A 4EQBA 4IO3A 3CFXA 4GWXA 4MH5A 2Y84A 3LSWA 3S9MC 2R71A 3T66A 1JEVA 2QRYA 1NV3A 2G93A 2VD2A 3B50A 3VXBA 2O84X 2F97A 3T96B 3EPEA 4ZEIA 3CVGA 3TUSA 1ATGA 2PX1A 4H6DA 2QS4A 4ZEFA 1I69A 4NG7A 1MH4A 1MY0A 3QUFA 1Z7NE 1FPGA 1RDXA 5DVIA 4AB6A 1LLSA 1NV0A 2WBBA 4PE3A 3KZGA 1POTA 4O3AA 1LBCA 4GBWA 4WEPA 4ZZEA 1B9JA 4I8CA 3K01A 5IKBA 2KQZA 4HE0A 4ZECA 1I6QA 1OVTA 3FV2A 1JW4A 5L9MA 1NV5A 1Q35A 3B8BA 3G3GA 5K2YA 4POWA 3TODA 2UVGA 2ZZXA 3H6TA 3OD7A 3UN6A 5AA1A 1IEJA 2QMWA 4NE4A 1Y9UA 1B6HA 4OVPA 3CR9A 1D9QA 5BUUA 3PV0E 1URSA 2YPNA 5HBCA 2NUVA 3IFAA 5F24A 5I57A 5HPQA 4IB2A 5JK4A 5IZ3B 3DP6A 4TLMB 3L6GA 2DVZA 3PPPA 4F19A 4GL8A 1LCTA 3I6VA 2V93A 3C33A 5CM6A 3CHGA 2H25A 1AL3A 5DT6A 3V5AA 2X26A 2CZIA 1H76A 2I0CA 3TEPA 5EQAA 2I0BA 4GWUA 1MY1A 3RN8A 5I59B 1FSAA 1GR2A 3Q25A 5AA4B 3C34A 3OXNA 2G29A 3LSLA 4QHQA 4GRKA 2LAOA 4NTLA 2RC8A 1NNKA 4NF6A 3IJOB 4F2QA 3FATA 5IAIA 1LAHE 1Y3PA 2RC7A 5KCJB 1A40A 1RDZA 2XXUA 3PD9A 3USDA 1LBXA 1M5EA 2VOZA 1LBBA 5IZ1A 5FBPA 4O3CA 4JXIA 4KQPA 4YAHX 1FTKA 2ABHA 2PFYA 3F11A 4N8GA 4PFYA 4G77A 2NOOA 1UIUA 1FPLA 5AA2D 4F1VA 3FVOA 3Q26A 1NUXA 4RYAA 1B3GA 4DXBA 3IB0A 1UTBA 4P47A 3FVGA 4MLQA 1Y1MA 2F3DA 1D3KA 4YMBA 4HCWA 1JW1A 3TPAA 3OO7A 4IO2A 1SI0A 3FGSA 5H8HA 4MEVA 5ICQA 4F31B 4FIMA 2IEEA 3HHFA 4ZZAA 1IMEA 4MNCA 3C9HA 3SEVA 3OEKA 2XA5A 3K02A 4HE1A 3H6WA 2DWHA 1IITA 4NF5B 1R9LA 2F3BA 4U21A 4N6DA 5DEXA 3OMBA 1QKBA 3GZGA 2O69A 1RYOA 2F7BA 1A99A 4F1UA 1FTLA 4JWYA 4ZS9A 5L8DA 4O3BA 1NV1A 1FQEA 1LAGE 1P1WA 4LATA 1A7LA 1FQAA 3C36A 2CMOA 4NF8B 4GX6A 4LZ8A 4N6PA 4IO5A 4P1LA 5K2XA 3O97A 1DBZA 4AS4A 3T1BA 2DXYA 3T9UA 3DLNA 4XTCQ 3PUYE 4PFWA 1LGBC 3LUZA 5AA2B 5FTIA 1FTJA 1QUKA 4LONB 4MCOA 2Q8MA 4G68B 1HSJA 3B6WA 4OXVA 5ESYA 3PD8A 2WKYA 3HHGA 1MPCA 3TTMA 1S9TA 1SD3A 4OHNA 2Z8FA 1LSTA 3PU5A 3GLBA 5H8FA 1Y3QA 1Y20A 4XKQA 3SESA 5EQ7A 3B6QA 1FPFA 3OOAA 4O7MA 1NNTA 2GHAA 1LAFE 3FZVA 4N15A 1B4HA 4THIA 3KJTA 1GTKA 2Q9TA 1G0HA 3HV1A 2DXRA 3K2DA 1OMPA 3MP1A 3P7IA 5F7VA 5LDZA 3HPIA 3K1PA 1XVXA 3MAMA 2F36A 3O29A 3BFUA 2A5TA 5TP9B 2E0SA 4O7IA 1JP4A 3MWBA 1M5DA 1N0TA 3FVNA 1JNFA 4LA9A 2XXYA 4BDQA 4ELOA 1MQJA 4WKMA 3SEUA 1IXHA 4GLIA 2Y7PA 4HTGA 3JYRA 4LUBA 4NWCA 3LC8A 5ET7A 3T9VA 4NHBA 1WVJA 1SW4A 1N76A 3GYYA 2ZZVA 4NEDA 3V83A 3ODBA 2A5SA 1B0HA 4DI4B 4ELRA 1FJ9A 4ZEKA 1N3WA 1LFGA 4NMYA 5I56A 2OCUA 2HHMA 4DE8A 2QVRA 4F29A 4PGNA 4X04A 4IO6A 4F1YA 4UABA 1B52A 2QL3A 4IGRA 4JVCA 4MX6A 4I3YA 3FJGA 2O7IA 1MY4A 5DTBA 3CFLA 3O2AA 1NV6A 2XWKA 2PT1A 3IOWA 3PMVA 4MHFA 2HXRA 1OLAA 4KYDA 4E0WA 3TQLA 4PFBA 4JWXA 1SDXA 4PAIA 4NGUA 1R1NA 4OENA 4UACA 3U93A 3TCFA 3U92A 1TWYA 4G8MA 4XEQA 1IXCA 4YU0A 1ZU0A 2DP8A 1MRPA 1CE2A 1B2HA 2B4MA 4PAFA 4LZ7A 4RXLA 1LBWA 3T22A 1LB9A 2WEFA 2WX9A 2P0SA 1UQWA 2XXIA 4N6KA 1B58A 4KYEA 3IB1A 4GD5A 2RCAA 3KG2A 1CNQA 1US4A 3T9HB 3H6UA 1NV4A 1TXFA 1D9YA 5KDTB 1I6BA 1TFDA 2Y7RA 1AH5A 3A29A 1PB7A 3O6HA 1MXZA 1NH7A 2XHDA 3FXBA 1B40A 4OWDA 5DVJA 1P1NA 2Q8JA 1KA1A 1EZPA 5AA3A 3VLWA 2XXPA 4BDNA 3FXRA 1BKAA 3WAFA 3K1MA 2F8DA 2CZLA 4OTEA 4PF8A 3VFJA 2AIXA 2OLBA 3TYHA 4BDMA 3MC2A 4OYVA 4QSEA 2VP1A 1B7ZA 4XKPA 1FTMA 3PPRA 4OA4A 5FHOA 1Q9DA 3KN7A 4PFRA 3G3HA 2Y5KA 4MMPA 1MPDA 5I84A 3T93B 1NUZA 4RK9A 1IMFA 3PUWE 1LFHA 2F34A 1SYHA 2RINA 2XWIA 3EHSA 4X48A 2DWIA 2M8CA 1Y4TA 1DSNA 2O7UA 4PDHA 1L5TA 4P0GA 1EH3A 5IZ3A 3QSLA 3N94A 2PYYA 1NUYA 3MSTA 1B32A 3W9WA 1ZJLA 4OMBA 4EDPA 3MVXA 3E78A 5ISUA 1VFEA 5FHNA 4KCCA 3K6VA 4F39A 4N17A 5H8QB 1IMDA 3D4GA 1FRPA 4JVDA 5I59A 5J1DA 1J1NA 5AA4A 3OEMA 3U94A 3FIRA 4DLDA 3VVDA 4QFOA 2I4CA 3EF7A 4QSCA 3JV9A 3TMGA 3FUZA 3OO9A 4KI0E 2DE4A 2F6PA 2IA4A 4DIGA 5KCJA 1AOVA 4QFKA 1LB8A 1R6ZA 3R6UA 2QFLA 4R74A 3TCHA 2PT2A 3OSRA 1VR5A 3M3KA 4R6HA 1S50A 2Y7KA 4RA1A 3FJMA 2O1LA 1MQGA 5F1QA 4F2OA 4DI3D 5EHMA 2BJIA 1H43A 1MDP1 4MIJA 4IO7A 4GX4A 5B70A 2P3NA 4XF5A 3HSTA 5A5XB 3K0VA 2X7PA 3IOVA 1NUWA 3RPLB 2UVIA 4ECFA 1MG1A 1LBZA 2JJKA 4C0RA 2V3TA 1A8EA 4NAPA 4BLAA 4ND9A 2ONSA 4H5FA 2F5XA 1NNPA 4NX1A 2QS1A 4UA8A 2FYIA 5B7DA 3RYDA 1RYXA 3B6TA 4NF5A 4O94A 2BJJX 3BKIB 4P3LA 2FA7A 4JB7A 5H8NB 2DSFA 3PMXA 4OEUA 3KBZA 4FEBA 1OIBA 1IMAA 5TPAA 3O6IA 1INPA 1YYZA 1H3DA 1SW5A 1H45A 4NF8A 2OZZA 1JEUA 1AMFA 3N26A 3IOTA 2DDKA 1LBVA 4FE8A 3KJ7A 3TQWA 2OJTA 5AA2A 4YKKA 1MM7A 4FJPA 4G68A 3UP9A 1B3EA 4PGPA 1ZKBA 1MQHA 1I6AA 4YZZA 1GVCA 1SBPA 2ZNTA 1K9YA 2V84A 4RNSA 1B4ZA 2Q88A 1IZ1A 1B1XA 1GV8A 3SEXA 2F7AA 1WODA 4PTKA 1M5CA 4X1DA 1MXXA 2B3FA 2I3VA 3ISPA 1DK4A 3G3KA 1AWBA 4GVOA 5L9SA 4R75A 1XI6A 3S9LC 4OEVA 1MXVA 1PBPA 4LQ2A 3MVWA 5TP9A 3KFMA 3M3FA 4R9GA 2UVHA 3PUZE 4ELPA 1BP5A 1VFDA 1PEBA 3MZ1A 5I57B 1B1HA 3U1OA 3C4MA 3VVFA 1KZ8A 4I1DA 2Y7IA 1QJMA 1HSLA 1QUIA 1VSOA 2FVZA 3H3GA 3HN0A 3O28A 4F3SA 4C1UA 1MXWA 4G4PA 4ELQA 2DS9A 5LOMA 2CZHA 4Q30B 5CMMA 3RT6B 3S2VA 5CBSA 1DTZA 1FBFA 2HQ0A 1Q1KA 1MY3A 4XKNA 1TFAA 4FATA 1D4NA 4FECA 4QFNA 3PPNA 3IL1B 3KGCA 4JDFA 4H8IA 1ZLQA 2CZKA 5M2VA 1FTAA 2D21A 1O64A 4NWDA 4PBHA 4YB5A 1UTHB 3A3CA 1FQCA 2XXVA 4KFQA 1FPIA 3RQTA 2VPNA 4YB7A 1MY2A 2RC9A 1FBDA 2H9BA 2R9JA 4WXJA 1SW1A 3PUVE 3I5OA 3IX1A 2DWJA 3MZ9A 4OFOA 4X8RA 1IQ7A 3H03A 1UTBB 3IO4A 1P1OA 2ZMBA 1SVXB 3BFTA 2UVJA 2XXHA 4OANA 3MUQA 3THIA 2CEYA 5I58B 2YJPA 2XD2A
chains in the Genus database with same CATH topology
3E4RA 1N84A 4NF4B 2ZXTA 4OFLA 4QFLA 4FAJA 5KDTA 4EXLA 1RKMA 1XS5A 2B65A 2H5YA 2QS2A 1Y4CA 4F18A 3UIFA 4OFJA 3MVYA 3IR1A 1AIVA 3EN3A 4MLVA 2DQVA 2ZYNA 3VDFA 2DVCA 1A8FA 4GXSB 2HZKA 3C31A 1B51A 2H99A 4C1TA 2QS3A 1MXYA 4EUOA 2QPQA 1Z7ME 5AE4A 4Q0CA 3TELA 5JTYB 4KHZE 3D4CA 2VGQA 3G3IA 1FTOA 4GWOA 1PBQA 3PMWA 4POXA 1N3XA 5TU0A 4BDOA 4HW8A 3RLFE 4YICA 3RPWA 3AXFA 4E0XA 1IXIA 3KSXA 1IIWA 4F3GA 3H7MA 2XXTA 3FJ7A 3KOTA 4U22A 3HCQA 1IUDA 3B7DA 1LAXA 2QJEA 1ZMGA 2V25A 5DVFA 2NXOA 4IGTA 5H8QA 3LR1A 3RTWB 4EXKA 2DWAA 4DZ1A 3IB2A 4X9TA 3MW0A 1SW2A 4WEDA 2ONRA 3JZJA 3MBPA 4YKPA 1HSEA 1M5FA 1QKAA 1ANFA 4TOZA 2NVUB 3ONMA 1DPEA 2V3QA 3N6TA 5CRYA 3N6UA 1M5BA 1QULA 3PPQA 2H4IA 4R72A 3KOSA 2REGA 4PQJA 1B7UA 1DOTA 3EHTA 4RY1A 2AYSA 4KYSA 3OSQA 2ZNSA 3CSBA 1LFIA 4EQ7A 3CG1A 5KZTA 4FEDA 3K00A 1EZ9A 3MP6A 1ELJA 3C35A 4YKIA 1O63A 3RY3A 2XXQA 2O68A 2NWJA 1S7YA 5CBRA 1SYIA 4JBZA 1MQIA 4RK2A 1FW0A 2THIA 3KN8A 4PP0A 3FASA 4MBPA 5I2NB 4YKJA 1NMUA 5CC2A 4H5GA 4PETA 1O7TA 4KD5A 1CB6A 4OERA 2ANJA 3K4UA 3IK6B 1TT1A 4R9FA 3R7XA 1WDNA 1GGGA 2F35A 3MPLA 4ZEDA 3ZSFA 3I3VA 1II5A 3ZKKA 1NL5A 5I2KB 2XX8A 2DE3A 1US5A 3H6VA 1DTGA 4GXAA 3RUMA 3TZAA 3FVKA 4XXUA 1IXGA 1FQFA 1DMBA 4TQUQ 4R2BA 4I9DA 1T0KA 1N7XA 3K6WA 4F3PA 3PPOA 2O6AA 3CSGA 3KEIA 4OZ9A 2HEUA 4R2FA 1NKXA 3W9VA 4HS7A 3TKDA 5BWJA 4QF9A 4ESXA 4F22A 1F9BA 1B46A 3HO7A 4R73A 4LZ5A 1Y3NA 1N7WA 3M8UA 2F6GA 4P0IA 3G3FA 2ZYMA 3IOUA 4EQ9A 3IO6A 1PDAA 1QW0A 1B5IA 4KR5A 2YLNA 5JEIA 2ONKE 1YTVA 3BBRA 3DELB 1USYE 4Z7EA 3GXAA 4H65A 3QK6A 4RPNA 3W15C 1A55A 1BTJA 1B5JA 3M3LA 3UGWA 4PFUA 4ZDMA 3ILTB 2QMXA 3QYTA 4YMAA 4MFIA 1POY1 4EF1A 2Y7WA 4R6YA 2XXXA 1NFTA 2E1SA 2UXAA 1NNFA 3FXQA 3SEWA 1JW5A 2FNCA 3FV1A 4RPOA 4BDLA 3TTLA 3V89B 3ECRA 1B0LA 4H8JA 2HCAA 4GFRA 3K6UA 2GFEA 3S9NC 1B05A 1EZOA 2I6EA 2I48A 4JWOA 1URGA 3ZKLA 1EU8A 3MZBA 2I4BA 4LVQA 4AQ4A 3TFLA 3MJNA 4U2RA 4M4GA 3SERA 2AL4A 1UTHA 3U8QA 4IY5A 4MF3A 1UIVA 4U4XA 2Z22A 3TTKA 3G7WA 2B3BA 4OVJA 2DE2A 3RGYA 3LUYA 4KCDA 3VLUA 1N04A 2HAUA 3CRBA 3H4ZA 3T9XB 2Z8DA 3TDJA 5I58A 4OQOA 4JSDA 4P11A 3FD3A 3SETA 2PVUA 3RTFB 4NF4A 2OK2A 2P1SA 1SQYA 3QAXA 3VE1B 5EYFA 4DXUA 3VV5A 5ELVA 2F78A 3L6HA 4LQ5A 3O6GA 3A3UA 1VE4A 3K6XA 3SKPA 1XVYA 2HFBA 5TPAB 4DCYA 1B3LA 5FHMA 2Q2CA 4Z0IA 3CFZA 1QVSA 3WAEA 1JVYA 1JETA 4NF6B 1MDQA 3QXMA 3VXCA 1PB8A 3KSJA 4GQOA 5CMBA 5ITOA 2ALUA 1USYH 3GBAA 1Y1ZA 2QSXA 4TLLB 1B3FA 4DDDA 4XIGQ 4GF8A 4R6KA 5JTYA 1XHYA 2AL5A 3RT8A 4G68C 1JQFA 1P1UA 2D5WA 3LSXA 3DP8A 1OLCA 4IO4A 2V3UA 4IY6A 2XXWA 2P2AA 1PB9A 5ICTA 5HM4B 2F7CA 2PBWA 5H8HB 3KBRA 2VD3A 4KPTA 3DM0A 3IORA 4U1ZA 4ESWA 1ZIUA 1D9VA 5ITPA 3QUJA 4HCYA 2ESNA 2KLFA 2I49A 3EHUA 1NH8A 2W7YA 3MP8A 2X7QA 3S9EA 5DEXB 4N13A 1YAEA 1URDA 4G2ZA 2VHAA 2HXWA 2Z23A 2DOJA 1BIYA 3VVEA 4QRZA 3E9XA 4JSOA 4OETA 3O9PA 3E13X 2DYXA 2ZYKA 3SDFA 2RKMA 3H06B 2HZLA 5H8SA 3PGFA 2UYEA 3LSFB 3RNNA 2GHBA 4N07A 1PC3A 1OVBA 3OENA 3CI8A 4U1OA 3TTRA 1SI1A 4Q8RA 4ONYA 1P1QA 4OESA 4U23A 2XXRA 4QFPA 5H8FB 1LCFA 4PFTA 1A54A 1DPPA 3Q28A 2GH9A 3E3KA 3VLVA 2OBGA 3ZS6A 4M1VA 1KWHA 1ZBMA 4DXCA 3DP4A 2OWTA 2HAVA 4H0WA 5CMKA 4GOTA 3UORA 5EHSA 2ZNUA 5L9OA 3ILUB 3TCGA 1B5HA 1ZTYA 4BDRA 4F3BA 2RF1A 4RJZA 5I2NA 1MM6A 1YCJA 3CG3A 5CMCA 3PUXE 4H67A 4ISUA 2A5TB 3Q29A 4PE5B 3TAJA 4AB5A 3QIMA 1MH3A 3LBSA 1MQDA 3EQ1A 2GRVA 3R26A 1FQBA 4G8NA 2XX9A 5I2KA 1P99A 2RCBA 2D3IA 4QSDA 2REJA 2I3WA 2OWSA 3CIJA 4XKRA 1FQDA 3V8XB 4EF2A 2ZYOA 2Z8EA 3IJXB 3MVZA 1B3HA 3KN3A 1MXUA 5I56B 2H98A 2PMSA 4GL0A 3TTNA 1MS7A 1XOCA 1XT8A 1JVXA 3K1NA 1MPBA 4X1BA 1XC1A 2UYFA 3O66A 2XD3A 4DCXA 2O51A 5CI5A 3N5LA 5A5XA 2I58A 3Q27A 4I62A 3A09A 3IAZA 3SEYA 1BLFA 3FXUA 3OELA 4ZEBA 3U72A 1OQGA 2R6GE 4H1XA 1R9QA 4K3FA 4FORA 4YB6A 2XX7A 3MPKA 1OQHA 4LP2B 3UK4A 4Q5TA 1QUJA 3OO6A 3S4UA 1YPNA 3GBBA 1H44A 4G8HA 5H8NA 4ZE8A 5DYHA 2Q2AA 3OO8A 5FTHA 3C32A 3G3JA 4L17A 2O1MA 1B7HA 4GIZA 4ZE9A 3MQ9A 4U4SA 1FCKA 3UA8A 2Q89A 4EQBA 4IO3A 3CFXA 4MH5A 2Y84A 3LSWA 3S9MC 2R71A 3T66A 1JEVA 2QRYA 2G93A 2VD2A 3VXBA 2O84X 2F97A 3T96B 3EPEA 4ZEIA 3CVGA 3TUSA 1ATGA 2PX1A 4H6DA 2QS4A 4ZEFA 1I69A 1MH4A 1MY0A 3QUFA 1Z7NE 5DVIA 4AB6A 1LLSA 3KZGA 1POTA 4O3AA 1LBCA 4WEPA 4ZZEA 1B9JA 4I8CA 3K01A 5IKBA 4ZECA 1I6QA 1OVTA 3FV2A 1JW4A 5L9MA 1Q35A 3G3GA 5K2YA 4POWA 3TODA 2UVGA 3OD7A 3H6TA 3UN6A 5AA1A 1IEJA 2QMWA 4NE4A 1Y9UA 1B6HA 3CR9A 5BUUA 3PV0E 1URSA 2YPNA 5HBCA 2NUVA 5I57A 5HPQA 4IB2A 5JK4A 3DP6A 4TLMB 3L6GA 2DVZA 3PPPA 4F19A 4GL8A 1LCTA 3I6VA 2V93A 3C33A 5CM6A 2H25A 1AL3A 5DT6A 3V5AA 2X26A 1H76A 2I0CA 3TEPA 2I0BA 1MY1A 3RN8A 5I59B 1GR2A 3Q25A 5AA4B 3C34A 3OXNA 2G29A 3LSLA 4QHQA 4GRKA 2LAOA 4NTLA 2RC8A 1NNKA 4NF6A 3IJOB 4F2QA 3FATA 5IAIA 1LAHE 1Y3PA 2RC7A 5KCJB 1A40A 2XXUA 3PD9A 3USDA 1M5EA 2VOZA 1LBBA 4O3CA 4JXIA 4KQPA 4YAHX 1FTKA 2ABHA 3F11A 4PFYA 4G77A 2NOOA 1UIUA 5AA2D 4F1VA 3FVOA 3Q26A 4RYAA 1B3GA 4DXBA 3IB0A 1UTBA 3FVGA 4MLQA 1Y1MA 1D3KA 4YMBA 4HCWA 1JW1A 3TPAA 3OO7A 4IO2A 1SI0A 3FGSA 5H8HA 5ICQA 4F31B 4FIMA 2IEEA 3HHFA 4ZZAA 3C9HA 3SEVA 3OEKA 3K02A 3H6WA 2DWHA 1IITA 4NF5B 1R9LA 4U21A 5DEXA 3OMBA 1QKBA 3GZGA 2O69A 1RYOA 2F7BA 1A99A 4F1UA 1FTLA 4JWYA 4ZS9A 5L8DA 4O3BA 1FQEA 1LAGE 1P1WA 4LATA 1A7LA 1FQAA 3C36A 2CMOA 4NF8B 4LZ8A 4N6PA 4IO5A 5K2XA 3O97A 2DXYA 3T9UA 3DLNA 4XTCQ 3PUYE 4PFWA 1LGBC 5AA2B 5FTIA 1FTJA 1QUKA 4LONB 4G68B 1HSJA 3B6WA 4OXVA 3PD8A 2WKYA 3HHGA 1MPCA 3TTMA 1S9TA 1SD3A 4OHNA 2Z8FA 1LSTA 3PU5A 3GLBA 5H8FA 1Y3QA 1Y20A 4XKQA 3SESA 3B6QA 3OOAA 1NNTA 2GHAA 1LAFE 3FZVA 1B4HA 4THIA 3KJTA 1GTKA 2Q9TA 3HV1A 2DXRA 3K2DA 1OMPA 3MP1A 3P7IA 5F7VA 3HPIA 3K1PA 1XVXA 3MAMA 2F36A 3O29A 3BFUA 2A5TA 5TP9B 2E0SA 3MWBA 1M5DA 1N0TA 3FVNA 1JNFA 4LA9A 2XXYA 4BDQA 4ELOA 1MQJA 4WKMA 3SEUA 1IXHA 4GLIA 2Y7PA 4HTGA 3JYRA 4LUBA 4NWCA 3LC8A 3T9VA 1WVJA 1SW4A 1N76A 4NEDA 3V83A 3ODBA 2A5SA 1B0HA 4ELRA 4ZEKA 1N3WA 1LFGA 4NMYA 5I56A 2OCUA 4DE8A 4F29A 4IO6A 4F1YA 1B52A 2QL3A 4IGRA 3FJGA 2O7IA 1MY4A 5DTBA 3CFLA 3O2AA 3IOWA 2PT1A 3PMVA 1OLAA 4KYDA 4E0WA 3TQLA 4JWXA 1SDXA 1R1NA 4OENA 4UACA 3U93A 3TCFA 3U92A 1TWYA 4G8MA 1IXCA 4YU0A 1ZU0A 2DP8A 1MRPA 1CE2A 1B2HA 4LZ7A 4RXLA 3T22A 1LB9A 2P0SA 1UQWA 2XXIA 1B58A 4KYEA 3IB1A 4GD5A 2RCAA 3KG2A 1US4A 3T9HB 3H6UA 1TXFA 1D9YA 5KDTB 1I6BA 1TFDA 2Y7RA 1AH5A 1PB7A 3O6HA 1MXZA 1NH7A 2XHDA 1B40A 4OWDA 5DVJA 1P1NA 2Q8JA 1EZPA 5AA3A 3VLWA 2XXPA 4BDNA 3FXRA 1BKAA 3WAFA 3K1MA 2F8DA 2CZLA 4OTEA 3VFJA 2AIXA 2OLBA 3TYHA 4BDMA 3MC2A 4OYVA 4QSEA 4XKPA 1B7ZA 2VP1A 1FTMA 3PPRA 5FHOA 3KN7A 3G3HA 1MPDA 5I84A 3T93B 4RK9A 3PUWE 1LFHA 2F34A 1SYHA 2RINA 3EHSA 4X48A 2DWIA 2M8CA 1Y4TA 1DSNA 2O7UA 1L5TA 4P0GA 1EH3A 3QSLA 3N94A 2PYYA 1B32A 3W9WA 1ZJLA 4OMBA 4EDPA 3MVXA 5ISUA 1VFEA 5FHNA 4KCCA 3K6VA 4F39A 5H8QB 3D4GA 5I59A 5J1DA 1J1NA 5AA4A 3OEMA 3U94A 3FIRA 4DLDA 3VVDA 4QFOA 2I4CA 3EF7A 4QSCA 3JV9A 3TMGA 3FUZA 3OO9A 4KI0E 2DE4A 2F6PA 2IA4A 4DIGA 5KCJA 1AOVA 4QFKA 1LB8A 1R6ZA 3R6UA 3TCHA 4R74A 2PT2A 3OSRA 1VR5A 3M3KA 4R6HA 1S50A 2Y7KA 4RA1A 3FJMA 2O1LA 1MQGA 5F1QA 4F2OA 5EHMA 1H43A 1MDP1 4IO7A 5B70A 3HSTA 5A5XB 3K0VA 2X7PA 3IOVA 2UVIA 4ECFA 1MG1A 4C0RA 2V3TA 1A8EA 4BLAA 4ND9A 2ONSA 4H5FA 2F5XA 1NNPA 2QS1A 4UA8A 2FYIA 5B7DA 1RYXA 3B6TA 4NF5A 2BJJX 3BKIB 2FA7A 4JB7A 5H8NB 2DSFA 3PMXA 4OEUA 4FEBA 1OIBA 5TPAA 3O6IA 1H3DA 1SW5A 1H45A 4NF8A 2OZZA 1JEUA 1AMFA 3N26A 3IOTA 4FE8A 3KJ7A 3TQWA 2OJTA 5AA2A 4YKKA 1MM7A 4FJPA 4G68A 3UP9A 1B3EA 1ZKBA 1MQHA 1I6AA 4YZZA 1GVCA 1SBPA 2ZNTA 2V84A 4RNSA 1B4ZA 1IZ1A 2Q88A 1B1XA 1GV8A 3SEXA 2F7AA 1WODA 1M5CA 4X1DA 1MXXA 2B3FA 2I3VA 3G3KA 4GVOA 5L9SA 4R75A 3S9LC 4OEVA 1MXVA 1PBPA 4LQ2A 3MVWA 5TP9A 3KFMA 3M3FA 4R9GA 2UVHA 3PUZE 4ELPA 1BP5A 1VFDA 1PEBA 3MZ1A 5I57B 1B1HA 3U1OA 3C4MA 3VVFA 4I1DA 2Y7IA 1QJMA 1HSLA 1QUIA 1VSOA 3H3GA 3HN0A 3O28A 4F3SA 4C1UA 1MXWA 4G4PA 4ELQA 2DS9A 5LOMA 4Q30B 5CMMA 3RT6B 3S2VA 5CBSA 1DTZA 2HQ0A 1Q1KA 1MY3A 4XKNA 1TFAA 4FATA 1D4NA 4FECA 4QFNA 3PPNA 3IL1B 3KGCA 4JDFA 5M2VA 1ZLQA 4H8IA 2D21A 1O64A 4NWDA 4YB5A 1UTHB 3A3CA 1FQCA 2XXVA 4KFQA 3RQTA 4YB7A 1MY2A 2RC9A 2H9BA 2R9JA 4WXJA 1SW1A 3PUVE 3I5OA 3IX1A 2DWJA 3MZ9A 4OFOA 1IQ7A 3H03A 1UTBB 3IO4A 1P1OA 2ZMBA 1SVXB 3BFTA 2UVJA 2XXHA 3MUQA 3THIA 5I58B 2YJPA 2XD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4R A;  1N84 A;  4NF4 B;  2ZXT A;  4OFL A;  4QFL A;  4FAJ A;  5KDT A;  4EXL A;  1RKM A;  1XS5 A;  2B65 A;  2H5Y A;  2QS2 A;  1Y4C A;  4F18 A;  3UIF A;  4OFJ A;  3MVY A;  3IR1 A;  1AIV A;  3EN3 A;  4MLV A;  2DQV A;  2ZYN A;  3VDF A;  2DVC A;  1A8F A;  4GXS B;  2HZK A;  3C31 A;  1B51 A;  2H99 A;  4C1T A;  2QS3 A;  1MXY A;  4EUO A;  2QPQ A;  1Z7M E;  5AE4 A;  4Q0C A;  3TEL A;  5JTY B;  4KHZ E;  3D4C A;  2VGQ A;  3G3I A;  1FTO A;  4GWO A;  1PBQ A;  3PMW A;  4POX A;  1N3X A;  5TU0 A;  4BDO A;  4HW8 A;  3RLF E;  4YIC A;  3RPW A;  3AXF A;  4E0X A;  1IXI A;  3KSX A;  1IIW A;  4F3G A;  3H7M A;  2XXT A;  3FJ7 A;  3KOT A;  4U22 A;  3HCQ A;  1IUD A;  3B7D A;  1LAX A;  2QJE A;  1ZMG A;  2V25 A;  5DVF A;  2NXO A;  4IGT A;  5H8Q A;  3LR1 A;  3RTW B;  4EXK A;  2DWA A;  4DZ1 A;  3IB2 A;  4X9T A;  3MW0 A;  1SW2 A;  4WED A;  2ONR A;  3JZJ A;  3MBP A;  4YKP A;  1HSE A;  1M5F A;  1QKA A;  1ANF A;  4TOZ A;  2NVU B;  3ONM A;  1DPE A;  2V3Q A;  3N6T A;  5CRY A;  3N6U A;  1M5B A;  1QUL A;  3PPQ A;  2H4I A;  4R72 A;  3KOS A;  2REG A;  4PQJ A;  1B7U A;  1DOT A;  3EHT A;  4RY1 A;  2AYS A;  4KYS A;  3OSQ A;  2ZNS A;  3CSB A;  1LFI A;  4EQ7 A;  3CG1 A;  5KZT A;  4FED A;  3K00 A;  1EZ9 A;  3MP6 A;  1ELJ A;  3C35 A;  4YKI A;  1O63 A;  3RY3 A;  2XXQ A;  2O68 A;  2NWJ A;  1S7Y A;  5CBR A;  1SYI A;  4JBZ A;  1MQI A;  4RK2 A;  1FW0 A;  2THI A;  3KN8 A;  4PP0 A;  3FAS A;  4MBP A;  5I2N B;  4YKJ A;  1NMU A;  5CC2 A;  4H5G A;  4PET A;  1O7T A;  4KD5 A;  1CB6 A;  4OER A;  2ANJ A;  3K4U A;  3IK6 B;  1TT1 A;  4R9F A;  3R7X A;  1WDN A;  1GGG A;  2F35 A;  3MPL A;  4ZED A;  3ZSF A;  3I3V A;  1II5 A;  3ZKK A;  1NL5 A;  5I2K B;  2XX8 A;  2DE3 A;  1US5 A;  3H6V A;  1DTG A;  4GXA A;  3RUM A;  3TZA A;  3FVK A;  4XXU A;  1IXG A;  1FQF A;  1DMB A;  4TQU Q;  4R2B A;  4I9D A;  1T0K A;  1N7X A;  3K6W A;  4F3P A;  3PPO A;  2O6A A;  3CSG A;  3KEI A;  4OZ9 A;  2HEU A;  4R2F A;  1NKX A;  3W9V A;  4HS7 A;  3TKD A;  5BWJ A;  4QF9 A;  4ESX A;  4F22 A;  1F9B A;  1B46 A;  3HO7 A;  4R73 A;  4LZ5 A;  1Y3N A;  1N7W A;  3M8U A;  2F6G A;  4P0I A;  3G3F A;  2ZYM A;  3IOU A;  4EQ9 A;  3IO6 A;  1PDA A;  1QW0 A;  1B5I A;  4KR5 A;  2YLN A;  5JEI A;  2ONK E;  1YTV A;  3BBR A;  3DEL B;  1USY E;  4Z7E A;  3GXA A;  4H65 A;  3QK6 A;  4RPN A;  3W15 C;  1A55 A;  1BTJ A;  1B5J A;  3M3L A;  3UGW A;  4PFU A;  4ZDM A;  3ILT B;  2QMX A;  3QYT A;  4YMA A;  4MFI A;  1POY 1;  4EF1 A;  2Y7W A;  4R6Y A;  2XXX A;  1NFT A;  2E1S A;  2UXA A;  1NNF A;  3FXQ A;  3SEW A;  1JW5 A;  2FNC A;  3FV1 A;  4RPO A;  4BDL A;  3TTL A;  3V89 B;  3ECR A;  1B0L A;  4H8J A;  2HCA A;  4GFR A;  3K6U A;  2GFE A;  3S9N C;  1B05 A;  1EZO A;  2I6E A;  2I48 A;  4JWO A;  1URG A;  3ZKL A;  1EU8 A;  3MZB A;  2I4B A;  4LVQ A;  4AQ4 A;  3TFL A;  3MJN A;  4U2R A;  4M4G A;  3SER A;  2AL4 A;  1UTH A;  3U8Q A;  4IY5 A;  4MF3 A;  1UIV A;  4U4X A;  2Z22 A;  3TTK A;  3G7W A;  2B3B A;  4OVJ A;  2DE2 A;  3RGY A;  3LUY A;  4KCD A;  3VLU A;  1N04 A;  2HAU A;  3CRB A;  3H4Z A;  3T9X B;  2Z8D A;  3TDJ A;  5I58 A;  4OQO A;  4JSD A;  4P11 A;  3FD3 A;  3SET A;  2PVU A;  3RTF B;  4NF4 A;  2OK2 A;  2P1S A;  1SQY A;  3QAX A;  3VE1 B;  5EYF A;  4DXU A;  3VV5 A;  5ELV A;  2F78 A;  3L6H A;  4LQ5 A;  3O6G A;  3A3U A;  1VE4 A;  3K6X A;  3SKP A;  1XVY A;  2HFB A;  5TPA B;  4DCY A;  1B3L A;  5FHM A;  2Q2C A;  4Z0I A;  3CFZ A;  1QVS A;  3WAE A;  1JVY A;  1JET A;  4NF6 B;  1MDQ A;  3QXM A;  3VXC A;  1PB8 A;  3KSJ A;  4GQO A;  5CMB A;  5ITO A;  2ALU A;  1USY H;  3GBA A;  1Y1Z A;  2QSX A;  4TLL B;  1B3F A;  4DDD A;  4XIG Q;  4GF8 A;  4R6K A;  5JTY A;  1XHY A;  2AL5 A;  3RT8 A;  4G68 C;  1JQF A;  1P1U A;  2D5W A;  3LSX A;  3DP8 A;  1OLC A;  4IO4 A;  2V3U A;  4IY6 A;  2XXW A;  2P2A A;  1PB9 A;  5ICT A;  5HM4 B;  2F7C A;  2PBW A;  5H8H B;  3KBR A;  2VD3 A;  4KPT A;  3DM0 A;  3IOR A;  4U1Z A;  4ESW A;  1ZIU A;  1D9V A;  5ITP A;  3QUJ A;  4HCY A;  2ESN A;  2KLF A;  2I49 A;  3EHU A;  1NH8 A;  2W7Y A;  3MP8 A;  2X7Q A;  3S9E A;  5DEX B;  4N13 A;  1YAE A;  1URD A;  4G2Z A;  2VHA A;  2HXW A;  2Z23 A;  2DOJ A;  1BIY A;  3VVE A;  4QRZ A;  3E9X A;  4JSO A;  4OET A;  3O9P A;  3E13 X;  2DYX A;  2ZYK A;  3SDF A;  2RKM A;  3H06 B;  2HZL A;  5H8S A;  3PGF A;  2UYE A;  3LSF B;  3RNN A;  2GHB A;  4N07 A;  1PC3 A;  1OVB A;  3OEN A;  3CI8 A;  4U1O A;  3TTR A;  1SI1 A;  4Q8R A;  4ONY A;  1P1Q A;  4OES A;  4U23 A;  2XXR A;  4QFP A;  5H8F B;  1LCF A;  4PFT A;  1A54 A;  1DPP A;  3Q28 A;  2GH9 A;  3E3K A;  3VLV A;  2OBG A;  3ZS6 A;  4M1V A;  1KWH A;  1ZBM A;  4DXC A;  3DP4 A;  2OWT A;  2HAV A;  4H0W A;  5CMK A;  4GOT A;  3UOR A;  5EHS A;  2ZNU A;  5L9O A;  3ILU B;  3TCG A;  1B5H A;  1ZTY A;  4BDR A;  4F3B A;  2RF1 A;  4RJZ A;  5I2N A;  1MM6 A;  1YCJ A;  3CG3 A;  5CMC A;  3PUX E;  4H67 A;  4ISU A;  2A5T B;  3Q29 A;  4PE5 B;  3TAJ A;  4AB5 A;  3QIM A;  1MH3 A;  3LBS A;  1MQD A;  3EQ1 A;  2GRV A;  3R26 A;  1FQB A;  4G8N A;  2XX9 A;  5I2K A;  1P99 A;  2RCB A;  2D3I A;  4QSD A;  2REJ A;  2I3W A;  2OWS A;  3CIJ A;  4XKR A;  1FQD A;  3V8X B;  4EF2 A;  2ZYO A;  2Z8E A;  3IJX B;  3MVZ A;  1B3H A;  3KN3 A;  1MXU A;  5I56 B;  2H98 A;  2PMS A;  4GL0 A;  3TTN A;  1MS7 A;  1XOC A;  1XT8 A;  1JVX A;  3K1N A;  1MPB A;  4X1B A;  1XC1 A;  2UYF A;  3O66 A;  2XD3 A;  4DCX A;  2O51 A;  5CI5 A;  3N5L A;  5A5X A;  2I58 A;  3Q27 A;  4I62 A;  3A09 A;  3IAZ A;  3SEY A;  1BLF A;  3FXU A;  3OEL A;  4ZEB A;  3U72 A;  1OQG A;  2R6G E;  4H1X A;  1R9Q A;  4K3F A;  4FOR A;  4YB6 A;  2XX7 A;  3MPK A;  1OQH A;  4LP2 B;  3UK4 A;  4Q5T A;  1QUJ A;  3OO6 A;  3S4U A;  1YPN A;  3GBB A;  1H44 A;  4G8H A;  5H8N A;  4ZE8 A;  5DYH A;  2Q2A A;  3OO8 A;  5FTH A;  3C32 A;  3G3J A;  4L17 A;  2O1M A;  1B7H A;  4GIZ A;  4ZE9 A;  3MQ9 A;  4U4S A;  1FCK A;  3UA8 A;  2Q89 A;  4EQB A;  4IO3 A;  3CFX A;  4MH5 A;  2Y84 A;  3LSW A;  3S9M C;  2R71 A;  3T66 A;  1JEV A;  2QRY A;  2G93 A;  2VD2 A;  3VXB A;  2O84 X;  2F97 A;  3T96 B;  3EPE A;  4ZEI A;  3CVG A;  3TUS A;  1ATG A;  2PX1 A;  4H6D A;  2QS4 A;  4ZEF A;  1I69 A;  1MH4 A;  1MY0 A;  3QUF A;  1Z7N E;  5DVI A;  4AB6 A;  1LLS A;  3KZG A;  1POT A;  4O3A A;  1LBC A;  4WEP A;  4ZZE A;  1B9J A;  4I8C A;  3K01 A;  5IKB A;  4ZEC A;  1I6Q A;  1OVT A;  3FV2 A;  1JW4 A;  5L9M A;  1Q35 A;  3G3G A;  5K2Y A;  4POW A;  3TOD A;  2UVG A;  3OD7 A;  3H6T A;  3UN6 A;  5AA1 A;  1IEJ A;  2QMW A;  4NE4 A;  1Y9U A;  1B6H A;  3CR9 A;  5BUU A;  3PV0 E;  1URS A;  2YPN A;  5HBC A;  2NUV A;  5I57 A;  5HPQ A;  4IB2 A;  5JK4 A;  3DP6 A;  4TLM B;  3L6G A;  2DVZ A;  3PPP A;  4F19 A;  4GL8 A;  1LCT A;  3I6V A;  2V93 A;  3C33 A;  5CM6 A;  2H25 A;  1AL3 A;  5DT6 A;  3V5A A;  2X26 A;  1H76 A;  2I0C A;  3TEP A;  2I0B A;  1MY1 A;  3RN8 A;  5I59 B;  1GR2 A;  3Q25 A;  5AA4 B;  3C34 A;  3OXN A;  2G29 A;  3LSL A;  4QHQ A;  4GRK A;  2LAO A;  4NTL A;  2RC8 A;  1NNK A;  4NF6 A;  3IJO B;  4F2Q A;  3FAT A;  5IAI A;  1LAH E;  1Y3P A;  2RC7 A;  5KCJ B;  1A40 A;  2XXU A;  3PD9 A;  3USD A;  1M5E A;  2VOZ A;  1LBB A;  4O3C A;  4JXI A;  4KQP A;  4YAH X;  1FTK A;  2ABH A;  3F11 A;  4PFY A;  4G77 A;  2NOO A;  1UIU A;  5AA2 D;  4F1V A;  3FVO A;  3Q26 A;  4RYA A;  1B3G A;  4DXB A;  3IB0 A;  1UTB A;  3FVG A;  4MLQ A;  1Y1M A;  1D3K A;  4YMB A;  4HCW A;  1JW1 A;  3TPA A;  3OO7 A;  4IO2 A;  1SI0 A;  3FGS A;  5H8H A;  5ICQ A;  4F31 B;  4FIM A;  2IEE A;  3HHF A;  4ZZA A;  3C9H A;  3SEV A;  3OEK A;  3K02 A;  3H6W A;  2DWH A;  1IIT A;  4NF5 B;  1R9L A;  4U21 A;  5DEX A;  3OMB A;  1QKB A;  3GZG A;  2O69 A;  1RYO A;  2F7B A;  1A99 A;  4F1U A;  1FTL A;  4JWY A;  4ZS9 A;  5L8D A;  4O3B A;  1FQE A;  1LAG E;  1P1W A;  4LAT A;  1A7L A;  1FQA A;  3C36 A;  2CMO A;  4NF8 B;  4LZ8 A;  4N6P A;  4IO5 A;  5K2X A;  3O97 A;  2DXY A;  3T9U A;  3DLN A;  4XTC Q;  3PUY E;  4PFW A;  1LGB C;  5AA2 B;  5FTI A;  1FTJ A;  1QUK A;  4LON B;  4G68 B;  1HSJ A;  3B6W A;  4OXV A;  3PD8 A;  2WKY A;  3HHG A;  1MPC A;  3TTM A;  1S9T A;  1SD3 A;  4OHN A;  2Z8F A;  1LST A;  3PU5 A;  3GLB A;  5H8F A;  1Y3Q A;  1Y20 A;  4XKQ A;  3SES A;  3B6Q A;  3OOA A;  1NNT A;  2GHA A;  1LAF E;  3FZV A;  1B4H A;  4THI A;  3KJT A;  1GTK A;  2Q9T A;  3HV1 A;  2DXR A;  3K2D A;  1OMP A;  3MP1 A;  3P7I A;  5F7V A;  3HPI A;  3K1P A;  1XVX A;  3MAM A;  2F36 A;  3O29 A;  3BFU A;  2A5T A;  5TP9 B;  2E0S A;  3MWB A;  1M5D A;  1N0T A;  3FVN A;  1JNF A;  4LA9 A;  2XXY A;  4BDQ A;  4ELO A;  1MQJ A;  4WKM A;  3SEU A;  1IXH A;  4GLI A;  2Y7P A;  4HTG A;  3JYR A;  4LUB A;  4NWC A;  3LC8 A;  3T9V A;  1WVJ A;  1SW4 A;  1N76 A;  4NED A;  3V83 A;  3ODB A;  2A5S A;  1B0H A;  4ELR A;  4ZEK A;  1N3W A;  1LFG A;  4NMY A;  5I56 A;  2OCU A;  4DE8 A;  4F29 A;  4IO6 A;  4F1Y A;  1B52 A;  2QL3 A;  4IGR A;  3FJG A;  2O7I A;  1MY4 A;  5DTB A;  3CFL A;  3O2A A;  3IOW A;  2PT1 A;  3PMV A;  1OLA A;  4KYD A;  4E0W A;  3TQL A;  4JWX A;  1SDX A;  1R1N A;  4OEN A;  4UAC A;  3U93 A;  3TCF A;  3U92 A;  1TWY A;  4G8M A;  1IXC A;  4YU0 A;  1ZU0 A;  2DP8 A;  1MRP A;  1CE2 A;  1B2H A;  4LZ7 A;  4RXL A;  3T22 A;  1LB9 A;  2P0S A;  1UQW A;  2XXI A;  1B58 A;  4KYE A;  3IB1 A;  4GD5 A;  2RCA A;  3KG2 A;  1US4 A;  3T9H B;  3H6U A;  1TXF A;  1D9Y A;  5KDT B;  1I6B A;  1TFD A;  2Y7R A;  1AH5 A;  1PB7 A;  3O6H A;  1MXZ A;  1NH7 A;  2XHD A;  1B40 A;  4OWD A;  5DVJ A;  1P1N A;  2Q8J A;  1EZP A;  5AA3 A;  3VLW A;  2XXP A;  4BDN A;  3FXR A;  1BKA A;  3WAF A;  3K1M A;  2F8D A;  2CZL A;  4OTE A;  3VFJ A;  2AIX A;  2OLB A;  3TYH A;  4BDM A;  3MC2 A;  4OYV A;  4QSE A;  4XKP A;  1B7Z A;  2VP1 A;  1FTM A;  3PPR A;  5FHO A;  3KN7 A;  3G3H A;  1MPD A;  5I84 A;  3T93 B;  4RK9 A;  3PUW E;  1LFH A;  2F34 A;  1SYH A;  2RIN A;  3EHS A;  4X48 A;  2DWI A;  2M8C A;  1Y4T A;  1DSN A;  2O7U A;  1L5T A;  4P0G A;  1EH3 A;  3QSL A;  3N94 A;  2PYY A;  1B32 A;  3W9W A;  1ZJL A;  4OMB A;  4EDP A;  3MVX A;  5ISU A;  1VFE A;  5FHN A;  4KCC A;  3K6V A;  4F39 A;  5H8Q B;  3D4G A;  5I59 A;  5J1D A;  1J1N A;  5AA4 A;  3OEM A;  3U94 A;  3FIR A;  4DLD A;  3VVD A;  4QFO A;  2I4C A;  3EF7 A;  4QSC A;  3JV9 A;  3TMG A;  3FUZ A;  3OO9 A;  4KI0 E;  2DE4 A;  2F6P A;  2IA4 A;  4DIG A;  5KCJ A;  1AOV A;  4QFK A;  1LB8 A;  1R6Z A;  3R6U A;  3TCH A;  4R74 A;  2PT2 A;  3OSR A;  1VR5 A;  3M3K A;  4R6H A;  1S50 A;  2Y7K A;  4RA1 A;  3FJM A;  2O1L A;  1MQG A;  5F1Q A;  4F2O A;  5EHM A;  1H43 A;  1MDP 1;  4IO7 A;  5B70 A;  3HST A;  5A5X B;  3K0V A;  2X7P A;  3IOV A;  2UVI A;  4ECF A;  1MG1 A;  4C0R A;  2V3T A;  1A8E A;  4BLA A;  4ND9 A;  2ONS A;  4H5F A;  2F5X A;  1NNP A;  2QS1 A;  4UA8 A;  2FYI A;  5B7D A;  1RYX A;  3B6T A;  4NF5 A;  2BJJ X;  3BKI B;  2FA7 A;  4JB7 A;  5H8N B;  2DSF A;  3PMX A;  4OEU A;  4FEB A;  1OIB A;  5TPA A;  3O6I A;  1H3D A;  1SW5 A;  1H45 A;  4NF8 A;  2OZZ A;  1JEU A;  1AMF A;  3N26 A;  3IOT A;  4FE8 A;  3KJ7 A;  3TQW A;  2OJT A;  5AA2 A;  4YKK A;  1MM7 A;  4FJP A;  4G68 A;  3UP9 A;  1B3E A;  1ZKB A;  1MQH A;  1I6A A;  4YZZ A;  1GVC A;  1SBP A;  2ZNT A;  2V84 A;  4RNS A;  1B4Z A;  1IZ1 A;  2Q88 A;  1B1X A;  1GV8 A;  3SEX A;  2F7A A;  1WOD A;  1M5C A;  4X1D A;  1MXX A;  2B3F A;  2I3V A;  3G3K A;  4GVO A;  5L9S A;  4R75 A;  3S9L C;  4OEV A;  1MXV A;  1PBP A;  4LQ2 A;  3MVW A;  5TP9 A;  3KFM A;  3M3F A;  4R9G A;  2UVH A;  3PUZ E;  4ELP A;  1BP5 A;  1VFD A;  1PEB A;  3MZ1 A;  5I57 B;  1B1H A;  3U1O A;  3C4M A;  3VVF A;  4I1D A;  2Y7I A;  1QJM A;  1HSL A;  1QUI A;  1VSO A;  3H3G A;  3HN0 A;  3O28 A;  4F3S A;  4C1U A;  1MXW A;  4G4P A;  4ELQ A;  2DS9 A;  5LOM A;  4Q30 B;  5CMM A;  3RT6 B;  3S2V A;  5CBS A;  1DTZ A;  2HQ0 A;  1Q1K A;  1MY3 A;  4XKN A;  1TFA A;  4FAT A;  1D4N A;  4FEC A;  4QFN A;  3PPN A;  3IL1 B;  3KGC A;  4JDF A;  5M2V A;  1ZLQ A;  4H8I A;  2D21 A;  1O64 A;  4NWD A;  4YB5 A;  1UTH B;  3A3C A;  1FQC A;  2XXV A;  4KFQ A;  3RQT A;  4YB7 A;  1MY2 A;  2RC9 A;  2H9B A;  2R9J A;  4WXJ A;  1SW1 A;  3PUV E;  3I5O A;  3IX1 A;  2DWJ A;  3MZ9 A;  4OFO A;  1IQ7 A;  3H03 A;  1UTB B;  3IO4 A;  1P1O A;  2ZMB A;  1SVX B;  3BFT A;  2UVJ A;  2XXH A;  3MUQ A;  3THI A;  5I58 B;  2YJP A;  2XD2 A; 
#chains in the Genus database with same CATH topology
 2FIE A;  3E4R A;  1N84 A;  4NF4 B;  2ZXT A;  4OFL A;  4QFL A;  4FAJ A;  4PDD A;  5KDT A;  4EXL A;  3BIG A;  4PC9 A;  1RKM A;  1XS5 A;  2B65 A;  2H5Y A;  4PCD A;  2QS2 A;  1Y4C A;  4F18 A;  3UIF A;  4N8Y A;  4OFJ A;  3MVY A;  3IR1 A;  1AIV A;  3EN3 A;  4MLV A;  2DQV A;  1FBE A;  2ZYN A;  5T3J A;  3VDF A;  2DVC A;  1A8F A;  4GXS B;  2HZK A;  3C31 A;  1B51 A;  2H99 A;  4C1T A;  4G61 A;  2QS3 A;  1MXY A;  4EUO A;  2QPQ A;  1Z7M E;  5AE4 A;  1EYJ A;  4Q0C A;  3TEL A;  5JTY B;  4KHZ E;  3D4C A;  2VGQ A;  3G3I A;  1FTO A;  4GWO A;  3PTY A;  1PBQ A;  3PMW A;  4POX A;  1N3X A;  5EQ9 A;  4AS5 A;  5TU0 A;  4BDO A;  1K9Z A;  1LEV A;  4MNP A;  4HW8 A;  3RLF E;  4YIC A;  3RPW A;  3AXF A;  4E0X A;  1FPB A;  2MKZ A;  1IXI A;  1RDY A;  3KSX A;  1IIW A;  4F3G A;  3H7M A;  2XXT A;  3FJ7 A;  3KOT A;  4U22 A;  3HCQ A;  4N4U A;  1IUD A;  3B7D A;  3FBP A;  1FBP A;  1LAX A;  1YZ0 A;  2QJE A;  1ZMG A;  2V25 A;  2VPO A;  5DVF A;  2NXO A;  4IGT A;  5H8Q A;  2WYP A;  3LR1 A;  3RTW B;  4EXK A;  2DWA A;  4DZ1 A;  3IB2 A;  4X9T A;  3MW0 A;  1G0I A;  1SW2 A;  4O8M A;  4PF6 A;  4WED A;  2ONR A;  3JZJ A;  3MBP A;  4YKP A;  1HSE A;  1M5F A;  1QKA A;  1ANF A;  4P1E A;  4TOZ A;  2NVU B;  3ONM A;  2Y5L A;  1DPE A;  2V3Q A;  3N6T A;  4N91 A;  5CRY A;  3N6U A;  4OVQ A;  1M5B A;  1QUL A;  3PPQ A;  4GX3 A;  1YXI A;  2H4I A;  4R72 A;  3KOS A;  2REG A;  5J16 A;  4P56 A;  3BIH A;  4LN5 A;  2WYK A;  4PQJ A;  1B7U A;  1DOT A;  1FPK A;  3EHT A;  4RY1 A;  2AYS A;  4KYS A;  3OSQ A;  2ZNS A;  3CSB A;  1BK4 A;  3ROJ A;  1LFI A;  4EQ7 A;  3CG1 A;  5KZT A;  4FED A;  3K00 A;  1EZ9 A;  3MP6 A;  4QBA A;  1ELJ A;  3C35 A;  3D1R A;  4YKI A;  1O63 A;  3RY3 A;  2XXQ A;  3RPL A;  2O68 A;  2NWJ A;  5EYG A;  1S7Y A;  2V4C A;  1NI9 A;  5CBR A;  1SYI A;  4JBZ A;  1MQI A;  4RK2 A;  1FW0 A;  2FBP A;  5IGA A;  2THI A;  3KN8 A;  4PP0 A;  4MNI A;  3FAS A;  2B4L A;  4MBP A;  5I2N B;  4YKJ A;  1NMU A;  5CC2 A;  4H5G A;  4PET A;  1O7T A;  4KD5 A;  1CB6 A;  4OER A;  2ANJ A;  3K4U A;  3IK6 B;  1TT1 A;  4R9F A;  3R7X A;  2PCR A;  1WDN A;  1GGG A;  2F35 A;  3MPL A;  4ZED A;  4H46 A;  3ZSF A;  3HFU A;  3I3V A;  1II5 A;  4OVT A;  3ZKK A;  3E79 A;  1NL5 A;  5I2K B;  2XX8 A;  2DE3 A;  4JVI A;  1US5 A;  3H6V A;  1DTG A;  4GXA A;  3RUM A;  3TZA A;  3FVK A;  4XXU A;  1IXG A;  1FQF A;  3KC1 A;  1DMB A;  4TQU Q;  4P9K A;  4R2B A;  4I9D A;  1T0K A;  3IFC A;  2XXK A;  1N7X A;  3K6W A;  4F3P A;  3PPO A;  2O6A A;  3CSG A;  3KEI A;  4OZ9 A;  2HEU A;  4R2F A;  1NKX A;  5IZZ A;  3U65 A;  3W9V A;  4HS7 A;  3TKD A;  5BWJ A;  4QF9 A;  4ESX A;  4F22 A;  4I40 A;  1F9B A;  1B46 A;  3HO7 A;  4R73 A;  4LZ5 A;  1Y3N A;  1N7W A;  3M8U A;  2F6G A;  4P0I A;  3G3F A;  2ZYM A;  3IOU A;  4EQ9 A;  3IO6 A;  1PDA A;  1QW0 A;  1B5I A;  4KR5 A;  2YLN A;  5JEI A;  2ONK E;  4IR8 A;  1YTV A;  3BBR A;  3DEL B;  1USY E;  4Z7E A;  3GXA A;  4H65 A;  3QK6 A;  4RPN A;  3W15 C;  1A55 A;  1BTJ A;  1B5J A;  3M3L A;  3UGW A;  4PFU A;  4ZDM A;  1NV2 A;  3ILT B;  2QMX A;  3QYT A;  4YMA A;  4MFI A;  1POY 1;  4NN3 A;  4EF1 A;  2Y7W A;  5LTC A;  1VDW A;  4QXD A;  4R6Y A;  2XXX A;  1NFT A;  2E1S A;  2UXA A;  1NNF A;  3FXQ A;  3SZP A;  3SEW A;  1JW5 A;  2FNC A;  3FV1 A;  4RPO A;  4BDL A;  3TTL A;  3V89 B;  4N81 A;  3ECR A;  1B0L A;  2ZZW A;  4H8J A;  2HCA A;  4GFR A;  3K6U A;  2GFE A;  3S9N C;  1B05 A;  1EZO A;  2I6E A;  2I48 A;  4JWO A;  4NQ8 A;  1URG A;  1SPI A;  3ZKL A;  1EU8 A;  3MZB A;  2I4B A;  2PFZ A;  4LVQ A;  4AQ4 A;  3TFL A;  3MJN A;  4OVR A;  4U2R A;  4M4G A;  3SER A;  2AL4 A;  1UTH A;  3U8Q A;  4GBV A;  4IY5 A;  4MF3 A;  2GQ1 A;  1UIV A;  4U4X A;  2Z22 A;  3TTK A;  3G7W A;  1FPJ A;  2B3B A;  4OVJ A;  1FBG A;  3NOH A;  2DE2 A;  3RGY A;  3LUY A;  4KCD A;  3VLU A;  5I5P A;  1N04 A;  2HAU A;  2QVV A;  3LV0 A;  3CRB A;  3H4Z A;  3T9X B;  2Z8D A;  5EYH A;  3TDJ A;  5I58 A;  3KC0 A;  1QGX A;  4OQO A;  4JSD A;  4P11 A;  3FD3 A;  3SET A;  2OX3 A;  1EYI A;  2PVU A;  3RTF B;  4NF4 A;  2OK2 A;  2P1S A;  5EQ8 A;  1SQY A;  3QAX A;  3VE1 B;  5EYF A;  4DXU A;  3VV5 A;  5ELV A;  2F78 A;  3L6H A;  4LQ5 A;  3O6G A;  1LBY A;  3A3U A;  1VE4 A;  3K6X A;  3SKP A;  1XVY A;  2HFB A;  5I7I A;  5TPA B;  2R8T A;  4DCY A;  1B3L A;  5FHM A;  2Q2C A;  4Z0I A;  3CFZ A;  1QVS A;  3WAE A;  1JVY A;  1JET A;  4HE2 A;  4NF6 B;  1MDQ A;  3QXM A;  3VXC A;  1PB8 A;  3KSJ A;  4GQO A;  5CMB A;  5ITO A;  1KA0 A;  1USY H;  2ALU A;  3GBA A;  1Y1Z A;  2QSX A;  2HPG A;  4TLL B;  1B3F A;  4DDD A;  4XIG Q;  4GF8 A;  2XWV A;  4R6K A;  5JTY A;  1XHY A;  2FIX A;  2AL5 A;  3RT8 A;  4G68 C;  1JQF A;  1P1U A;  2D5W A;  3LSX A;  5A5L A;  3DP8 A;  1OLC A;  4IO4 A;  2V3U A;  4IY6 A;  2XXW A;  4PFI A;  2P2A A;  1PB9 A;  5ICT A;  5HM4 B;  5ET6 A;  2F7C A;  2PBW A;  1FJ6 A;  3KBR A;  5H8H B;  1FPE A;  2VD3 A;  4KPT A;  3DM0 A;  3IOR A;  4U1Z A;  4ESW A;  1ZIU A;  1D9V A;  5ITP A;  3QUJ A;  4MAG A;  5ET8 A;  4HCY A;  2WBD A;  4NF0 A;  2ESN A;  2KLF A;  2CEX A;  2I49 A;  3EHU A;  1NH8 A;  2W7Y A;  3MP8 A;  2X7Q A;  3S9E A;  5DEX B;  4N13 A;  1YAE A;  1URD A;  4G2Z A;  4I3E A;  5DW8 A;  2VHA A;  2HXW A;  2Z23 A;  2DOJ A;  1BIY A;  3VVE A;  4QRZ A;  3E9X A;  4JSO A;  4OET A;  4GWW A;  3O9P A;  1EYK A;  3E13 X;  3QMF A;  2DYX A;  2ZYK A;  3SDF A;  2RKM A;  3H06 B;  2HZL A;  3MYU A;  5H8S A;  3PGF A;  4XFE A;  2UYE A;  3LSF B;  3RNN A;  2GHB A;  4N07 A;  2Q74 A;  1PC3 A;  1OVB A;  3OEN A;  2OWZ A;  3CI8 A;  5ET5 A;  4U1O A;  2KR0 A;  3TTR A;  1FBH A;  1SI1 A;  4Q8R A;  4ONY A;  1FPD A;  4GWZ A;  4FBP A;  1P1Q A;  4OES A;  4U23 A;  2XXR A;  4QFP A;  5H8F B;  1LCF A;  4PFT A;  1A54 A;  1DPP A;  3Q28 A;  2GH9 A;  4PBQ A;  3E3K A;  3VLV A;  1FBC A;  2OBG A;  3ZS6 A;  4M1V A;  1KWH A;  1ZBM A;  4DXC A;  3DP4 A;  2OWT A;  2HAV A;  4H0W A;  5CMK A;  4GOT A;  3UOR A;  5EHS A;  2ZNU A;  5L9O A;  3ILU B;  3TCG A;  1B5H A;  1ZTY A;  4BDR A;  4F3B A;  2RF1 A;  4RJZ A;  5I2N A;  1MM6 A;  1YCJ A;  3CG3 A;  5CMC A;  3PUX E;  4H67 A;  4ISU A;  2A5T B;  3Q29 A;  4PE5 B;  3TAJ A;  4AB5 A;  3QIM A;  1MH3 A;  3LBS A;  1MQD A;  3EQ1 A;  2GRV A;  3T0J A;  3R26 A;  1IMB A;  2FHY A;  1FQB A;  4KXP A;  4G8N A;  4MJO A;  2XX9 A;  5I2K A;  1P99 A;  2RCB A;  2D3I A;  4QSD A;  2REJ A;  2I3W A;  2QVU A;  2OWS A;  3CIJ A;  5IM2 A;  1IMC A;  4XKR A;  1FQD A;  3V8X B;  4EF2 A;  2ZYO A;  2Z8E A;  3IJX B;  3MVZ A;  1B3H A;  3KN3 A;  4GWS A;  1MXU A;  2XWO A;  5I56 B;  2H98 A;  2PMS A;  4GL0 A;  3TTN A;  1MS7 A;  1XOC A;  1XT8 A;  2VT5 A;  1JVX A;  3K1N A;  1MPB A;  4X1B A;  1XC1 A;  2UYF A;  3O66 A;  2XD3 A;  4DCX A;  2O51 A;  4H45 A;  5I3S A;  5CI5 A;  3N5L A;  5A5X A;  2I58 A;  3Q27 A;  4I62 A;  3A09 A;  2L5V A;  3IAZ A;  3SEY A;  4OVS A;  4GWY A;  1BLF A;  3FXU A;  3OEL A;  4ZEB A;  3U72 A;  1OQG A;  2R6G E;  4H1X A;  1R9Q A;  4K3F A;  4FOR A;  4YB6 A;  1NV7 A;  1DCU A;  2XX7 A;  2P3V A;  3MPK A;  1OQH A;  4PAK A;  4LP2 B;  3UK4 A;  4P8B A;  4Q5T A;  1QUJ A;  3OO6 A;  3S4U A;  1YPN A;  3GBB A;  1H44 A;  4G8H A;  5H8N A;  4ZE8 A;  5DYH A;  2Q2A A;  3OO8 A;  5FTH A;  3C32 A;  3G3J A;  4L17 A;  2O1M A;  4HXV A;  1B7H A;  3EKI A;  4GIZ A;  4ZE9 A;  3MQ9 A;  4U4S A;  1FCK A;  3UA8 A;  2Q89 A;  4EQB A;  4IO3 A;  3CFX A;  4GWX A;  4MH5 A;  2Y84 A;  3LSW A;  3S9M C;  2R71 A;  3T66 A;  1JEV A;  2QRY A;  1NV3 A;  2G93 A;  2VD2 A;  3B50 A;  3VXB A;  2O84 X;  2F97 A;  3T96 B;  3EPE A;  4ZEI A;  3CVG A;  3TUS A;  1ATG A;  2PX1 A;  4H6D A;  2QS4 A;  4ZEF A;  1I69 A;  4NG7 A;  1MH4 A;  1MY0 A;  3QUF A;  1Z7N E;  1FPG A;  1RDX A;  5DVI A;  4AB6 A;  1LLS A;  1NV0 A;  2WBB A;  4PE3 A;  3KZG A;  1POT A;  4O3A A;  1LBC A;  4GBW A;  4WEP A;  4ZZE A;  1B9J A;  4I8C A;  3K01 A;  5IKB A;  2KQZ A;  4HE0 A;  4ZEC A;  1I6Q A;  1OVT A;  3FV2 A;  1JW4 A;  5L9M A;  1NV5 A;  1Q35 A;  3B8B A;  3G3G A;  5K2Y A;  4POW A;  3TOD A;  2UVG A;  2ZZX A;  3H6T A;  3OD7 A;  3UN6 A;  5AA1 A;  1IEJ A;  2QMW A;  4NE4 A;  1Y9U A;  1B6H A;  4OVP A;  3CR9 A;  1D9Q A;  5BUU A;  3PV0 E;  1URS A;  2YPN A;  5HBC A;  2NUV A;  3IFA A;  5F24 A;  5I57 A;  5HPQ A;  4IB2 A;  5JK4 A;  5IZ3 B;  3DP6 A;  4TLM B;  3L6G A;  2DVZ A;  3PPP A;  4F19 A;  4GL8 A;  1LCT A;  3I6V A;  2V93 A;  3C33 A;  5CM6 A;  3CHG A;  2H25 A;  1AL3 A;  5DT6 A;  3V5A A;  2X26 A;  2CZI A;  1H76 A;  2I0C A;  3TEP A;  5EQA A;  2I0B A;  4GWU A;  1MY1 A;  3RN8 A;  5I59 B;  1FSA A;  1GR2 A;  3Q25 A;  5AA4 B;  3C34 A;  3OXN A;  2G29 A;  3LSL A;  4QHQ A;  4GRK A;  2LAO A;  4NTL A;  2RC8 A;  1NNK A;  4NF6 A;  3IJO B;  4F2Q A;  3FAT A;  5IAI A;  1LAH E;  1Y3P A;  2RC7 A;  5KCJ B;  1A40 A;  1RDZ A;  2XXU A;  3PD9 A;  3USD A;  1LBX A;  1M5E A;  2VOZ A;  1LBB A;  5IZ1 A;  5FBP A;  4O3C A;  4JXI A;  4KQP A;  4YAH X;  1FTK A;  2ABH A;  2PFY A;  3F11 A;  4N8G A;  4PFY A;  4G77 A;  2NOO A;  1UIU A;  1FPL A;  5AA2 D;  4F1V A;  3FVO A;  3Q26 A;  1NUX A;  4RYA A;  1B3G A;  4DXB A;  3IB0 A;  1UTB A;  4P47 A;  3FVG A;  4MLQ A;  1Y1M A;  2F3D A;  1D3K A;  4YMB A;  4HCW A;  1JW1 A;  3TPA A;  3OO7 A;  4IO2 A;  1SI0 A;  3FGS A;  5H8H A;  4MEV A;  5ICQ A;  4F31 B;  4FIM A;  2IEE A;  3HHF A;  4ZZA A;  1IME A;  4MNC A;  3C9H A;  3SEV A;  3OEK A;  2XA5 A;  3K02 A;  4HE1 A;  3H6W A;  2DWH A;  1IIT A;  4NF5 B;  1R9L A;  2F3B A;  4U21 A;  4N6D A;  5DEX A;  3OMB A;  1QKB A;  3GZG A;  2O69 A;  1RYO A;  2F7B A;  1A99 A;  4F1U A;  1FTL A;  4JWY A;  4ZS9 A;  5L8D A;  4O3B A;  1NV1 A;  1FQE A;  1LAG E;  1P1W A;  4LAT A;  1A7L A;  1FQA A;  3C36 A;  2CMO A;  4NF8 B;  4GX6 A;  4LZ8 A;  4N6P A;  4IO5 A;  4P1L A;  5K2X A;  3O97 A;  1DBZ A;  4AS4 A;  3T1B A;  2DXY A;  3T9U A;  3DLN A;  4XTC Q;  3PUY E;  4PFW A;  1LGB C;  3LUZ A;  5AA2 B;  5FTI A;  1FTJ A;  1QUK A;  4LON B;  4MCO A;  2Q8M A;  4G68 B;  1HSJ A;  3B6W A;  4OXV A;  5ESY A;  3PD8 A;  2WKY A;  3HHG A;  1MPC A;  3TTM A;  1S9T A;  1SD3 A;  4OHN A;  2Z8F A;  1LST A;  3PU5 A;  3GLB A;  5H8F A;  1Y3Q A;  1Y20 A;  4XKQ A;  3SES A;  5EQ7 A;  3B6Q A;  1FPF A;  3OOA A;  4O7M A;  1NNT A;  2GHA A;  1LAF E;  3FZV A;  4N15 A;  1B4H A;  4THI A;  3KJT A;  1GTK A;  2Q9T A;  1G0H A;  3HV1 A;  2DXR A;  3K2D A;  1OMP A;  3MP1 A;  3P7I A;  5F7V A;  5LDZ A;  3HPI A;  3K1P A;  1XVX A;  3MAM A;  2F36 A;  3O29 A;  3BFU A;  2A5T A;  5TP9 B;  2E0S A;  4O7I A;  1JP4 A;  3MWB A;  1M5D A;  1N0T A;  3FVN A;  1JNF A;  4LA9 A;  2XXY A;  4BDQ A;  4ELO A;  1MQJ A;  4WKM A;  3SEU A;  1IXH A;  4GLI A;  2Y7P A;  4HTG A;  3JYR A;  4LUB A;  4NWC A;  3LC8 A;  5ET7 A;  3T9V A;  4NHB A;  1WVJ A;  1SW4 A;  1N76 A;  3GYY A;  2ZZV A;  4NED A;  3V83 A;  3ODB A;  2A5S A;  1B0H A;  4DI4 B;  4ELR A;  1FJ9 A;  4ZEK A;  1N3W A;  1LFG A;  4NMY A;  5I56 A;  2OCU A;  2HHM A;  4DE8 A;  2QVR A;  4F29 A;  4PGN A;  4X04 A;  4IO6 A;  4F1Y A;  4UAB A;  1B52 A;  2QL3 A;  4IGR A;  4JVC A;  4MX6 A;  4I3Y A;  3FJG A;  2O7I A;  1MY4 A;  5DTB A;  3CFL A;  3O2A A;  1NV6 A;  2XWK A;  2PT1 A;  3IOW A;  3PMV A;  4MHF A;  2HXR A;  1OLA A;  4KYD A;  4E0W A;  3TQL A;  4PFB A;  4JWX A;  1SDX A;  4PAI A;  4NGU A;  1R1N A;  4OEN A;  4UAC A;  3U93 A;  3TCF A;  3U92 A;  1TWY A;  4G8M A;  4XEQ A;  1IXC A;  4YU0 A;  1ZU0 A;  2DP8 A;  1MRP A;  1CE2 A;  1B2H A;  2B4M A;  4PAF A;  4LZ7 A;  4RXL A;  1LBW A;  3T22 A;  1LB9 A;  2WEF A;  2WX9 A;  2P0S A;  1UQW A;  2XXI A;  4N6K A;  1B58 A;  4KYE A;  3IB1 A;  4GD5 A;  2RCA A;  3KG2 A;  1CNQ A;  1US4 A;  3T9H B;  3H6U A;  1NV4 A;  1TXF A;  1D9Y A;  5KDT B;  1I6B A;  1TFD A;  2Y7R A;  1AH5 A;  3A29 A;  1PB7 A;  3O6H A;  1MXZ A;  1NH7 A;  2XHD A;  3FXB A;  1B40 A;  4OWD A;  5DVJ A;  1P1N A;  2Q8J A;  1KA1 A;  1EZP A;  5AA3 A;  3VLW A;  2XXP A;  4BDN A;  3FXR A;  1BKA A;  3WAF A;  3K1M A;  2F8D A;  2CZL A;  4OTE A;  4PF8 A;  3VFJ A;  2AIX A;  2OLB A;  3TYH A;  4BDM A;  3MC2 A;  4OYV A;  4QSE A;  2VP1 A;  1B7Z A;  4XKP A;  1FTM A;  3PPR A;  4OA4 A;  5FHO A;  1Q9D A;  3KN7 A;  4PFR A;  3G3H A;  2Y5K A;  4MMP A;  1MPD A;  5I84 A;  3T93 B;  1NUZ A;  4RK9 A;  1IMF A;  3PUW E;  1LFH A;  2F34 A;  1SYH A;  2RIN A;  2XWI A;  3EHS A;  4X48 A;  2DWI A;  2M8C A;  1Y4T A;  1DSN A;  2O7U A;  4PDH A;  1L5T A;  4P0G A;  1EH3 A;  5IZ3 A;  3QSL A;  3N94 A;  2PYY A;  1NUY A;  3MST A;  1B32 A;  3W9W A;  1ZJL A;  4OMB A;  4EDP A;  3MVX A;  3E78 A;  5ISU A;  1VFE A;  5FHN A;  4KCC A;  3K6V A;  4F39 A;  4N17 A;  5H8Q B;  1IMD A;  3D4G A;  1FRP A;  4JVD A;  5I59 A;  5J1D A;  1J1N A;  5AA4 A;  3OEM A;  3U94 A;  3FIR A;  4DLD A;  3VVD A;  4QFO A;  2I4C A;  3EF7 A;  4QSC A;  3JV9 A;  3TMG A;  3FUZ A;  3OO9 A;  4KI0 E;  2DE4 A;  2F6P A;  2IA4 A;  4DIG A;  5KCJ A;  1AOV A;  4QFK A;  1LB8 A;  1R6Z A;  3R6U A;  2QFL A;  4R74 A;  3TCH A;  2PT2 A;  3OSR A;  1VR5 A;  3M3K A;  4R6H A;  1S50 A;  2Y7K A;  4RA1 A;  3FJM A;  2O1L A;  1MQG A;  5F1Q A;  4F2O A;  4DI3 D;  5EHM A;  2BJI A;  1H43 A;  1MDP 1;  4MIJ A;  4IO7 A;  4GX4 A;  5B70 A;  2P3N A;  4XF5 A;  3HST A;  5A5X B;  3K0V A;  2X7P A;  3IOV A;  1NUW A;  3RPL B;  2UVI A;  4ECF A;  1MG1 A;  1LBZ A;  2JJK A;  4C0R A;  2V3T A;  1A8E A;  4NAP A;  4BLA A;  4ND9 A;  2ONS A;  4H5F A;  2F5X A;  1NNP A;  4NX1 A;  2QS1 A;  4UA8 A;  2FYI A;  5B7D A;  3RYD A;  1RYX A;  3B6T A;  4NF5 A;  4O94 A;  2BJJ X;  3BKI B;  4P3L A;  2FA7 A;  4JB7 A;  5H8N B;  2DSF A;  3PMX A;  4OEU A;  3KBZ A;  4FEB A;  1OIB A;  1IMA A;  5TPA A;  3O6I A;  1INP A;  1YYZ A;  1H3D A;  1SW5 A;  1H45 A;  4NF8 A;  2OZZ A;  1JEU A;  1AMF A;  3N26 A;  3IOT A;  2DDK A;  1LBV A;  4FE8 A;  3KJ7 A;  3TQW A;  2OJT A;  5AA2 A;  4YKK A;  1MM7 A;  4FJP A;  4G68 A;  3UP9 A;  1B3E A;  4PGP A;  1ZKB A;  1MQH A;  1I6A A;  4YZZ A;  1GVC A;  1SBP A;  2ZNT A;  1K9Y A;  2V84 A;  4RNS A;  1B4Z A;  2Q88 A;  1IZ1 A;  1B1X A;  1GV8 A;  3SEX A;  2F7A A;  1WOD A;  4PTK A;  1M5C A;  4X1D A;  1MXX A;  2B3F A;  2I3V A;  3ISP A;  1DK4 A;  3G3K A;  1AWB A;  4GVO A;  5L9S A;  4R75 A;  1XI6 A;  3S9L C;  4OEV A;  1MXV A;  1PBP A;  4LQ2 A;  3MVW A;  5TP9 A;  3KFM A;  3M3F A;  4R9G A;  2UVH A;  3PUZ E;  4ELP A;  1BP5 A;  1VFD A;  1PEB A;  3MZ1 A;  5I57 B;  1B1H A;  3U1O A;  3C4M A;  3VVF A;  1KZ8 A;  4I1D A;  2Y7I A;  1QJM A;  1HSL A;  1QUI A;  1VSO A;  2FVZ A;  3H3G A;  3HN0 A;  3O28 A;  4F3S A;  4C1U A;  1MXW A;  4G4P A;  4ELQ A;  2DS9 A;  5LOM A;  2CZH A;  4Q30 B;  5CMM A;  3RT6 B;  3S2V A;  5CBS A;  1DTZ A;  1FBF A;  2HQ0 A;  1Q1K A;  1MY3 A;  4XKN A;  1TFA A;  4FAT A;  1D4N A;  4FEC A;  4QFN A;  3PPN A;  3IL1 B;  3KGC A;  4JDF A;  4H8I A;  1ZLQ A;  2CZK A;  5M2V A;  1FTA A;  2D21 A;  1O64 A;  4NWD A;  4PBH A;  4YB5 A;  1UTH B;  3A3C A;  1FQC A;  2XXV A;  4KFQ A;  1FPI A;  3RQT A;  2VPN A;  4YB7 A;  1MY2 A;  2RC9 A;  1FBD A;  2H9B A;  2R9J A;  4WXJ A;  1SW1 A;  3PUV E;  3I5O A;  3IX1 A;  2DWJ A;  3MZ9 A;  4OFO A;  4X8R A;  1IQ7 A;  3H03 A;  1UTB B;  3IO4 A;  1P1O A;  2ZMB A;  1SVX B;  3BFT A;  2UVJ A;  2XXH A;  4OAN A;  3MUQ A;  3THI A;  2CEY A;  5I58 B;  2YJP A;  2XD2 A; 
#chains in the Genus database with same CATH homology
 3E4R A;  1N84 A;  4NF4 B;  2ZXT A;  4OFL A;  4QFL A;  4FAJ A;  5KDT A;  4EXL A;  1RKM A;  1XS5 A;  2B65 A;  2H5Y A;  2QS2 A;  1Y4C A;  4F18 A;  3UIF A;  4OFJ A;  3MVY A;  3IR1 A;  1AIV A;  3EN3 A;  4MLV A;  2DQV A;  2ZYN A;  3VDF A;  2DVC A;  1A8F A;  4GXS B;  2HZK A;  3C31 A;  1B51 A;  2H99 A;  4C1T A;  2QS3 A;  1MXY A;  4EUO A;  2QPQ A;  1Z7M E;  5AE4 A;  4Q0C A;  3TEL A;  5JTY B;  4KHZ E;  3D4C A;  2VGQ A;  3G3I A;  1FTO A;  4GWO A;  1PBQ A;  3PMW A;  4POX A;  1N3X A;  5TU0 A;  4BDO A;  4HW8 A;  3RLF E;  4YIC A;  3RPW A;  3AXF A;  4E0X A;  1IXI A;  3KSX A;  1IIW A;  4F3G A;  3H7M A;  2XXT A;  3FJ7 A;  3KOT A;  4U22 A;  3HCQ A;  1IUD A;  3B7D A;  1LAX A;  2QJE A;  1ZMG A;  2V25 A;  5DVF A;  2NXO A;  4IGT A;  5H8Q A;  3LR1 A;  3RTW B;  4EXK A;  2DWA A;  4DZ1 A;  3IB2 A;  4X9T A;  3MW0 A;  1SW2 A;  4WED A;  2ONR A;  3JZJ A;  3MBP A;  4YKP A;  1HSE A;  1M5F A;  1QKA A;  1ANF A;  4TOZ A;  2NVU B;  3ONM A;  1DPE A;  2V3Q A;  3N6T A;  5CRY A;  3N6U A;  1M5B A;  1QUL A;  3PPQ A;  2H4I A;  4R72 A;  3KOS A;  2REG A;  4PQJ A;  1B7U A;  1DOT A;  3EHT A;  4RY1 A;  2AYS A;  4KYS A;  3OSQ A;  2ZNS A;  3CSB A;  1LFI A;  4EQ7 A;  3CG1 A;  5KZT A;  4FED A;  3K00 A;  1EZ9 A;  3MP6 A;  1ELJ A;  3C35 A;  4YKI A;  1O63 A;  3RY3 A;  2XXQ A;  2O68 A;  2NWJ A;  1S7Y A;  5CBR A;  1SYI A;  4JBZ A;  1MQI A;  4RK2 A;  1FW0 A;  2THI A;  3KN8 A;  4PP0 A;  3FAS A;  4MBP A;  5I2N B;  4YKJ A;  1NMU A;  5CC2 A;  4H5G A;  4PET A;  1O7T A;  4KD5 A;  1CB6 A;  4OER A;  2ANJ A;  3K4U A;  3IK6 B;  1TT1 A;  4R9F A;  3R7X A;  1WDN A;  1GGG A;  2F35 A;  3MPL A;  4ZED A;  3ZSF A;  3I3V A;  1II5 A;  3ZKK A;  1NL5 A;  5I2K B;  2XX8 A;  2DE3 A;  1US5 A;  3H6V A;  1DTG A;  4GXA A;  3RUM A;  3TZA A;  3FVK A;  4XXU A;  1IXG A;  1FQF A;  1DMB A;  4TQU Q;  4R2B A;  4I9D A;  1T0K A;  1N7X A;  3K6W A;  4F3P A;  3PPO A;  2O6A A;  3CSG A;  3KEI A;  4OZ9 A;  2HEU A;  4R2F A;  1NKX A;  3W9V A;  4HS7 A;  3TKD A;  5BWJ A;  4QF9 A;  4ESX A;  4F22 A;  1F9B A;  1B46 A;  3HO7 A;  4R73 A;  4LZ5 A;  1Y3N A;  1N7W A;  3M8U A;  2F6G A;  4P0I A;  3G3F A;  2ZYM A;  3IOU A;  4EQ9 A;  3IO6 A;  1PDA A;  1QW0 A;  1B5I A;  4KR5 A;  2YLN A;  5JEI A;  2ONK E;  1YTV A;  3BBR A;  3DEL B;  1USY E;  4Z7E A;  3GXA A;  4H65 A;  3QK6 A;  4RPN A;  3W15 C;  1A55 A;  1BTJ A;  1B5J A;  3M3L A;  3UGW A;  4PFU A;  4ZDM A;  3ILT B;  2QMX A;  3QYT A;  4YMA A;  4MFI A;  1POY 1;  4EF1 A;  2Y7W A;  4R6Y A;  2XXX A;  1NFT A;  2E1S A;  2UXA A;  1NNF A;  3FXQ A;  3SEW A;  1JW5 A;  2FNC A;  3FV1 A;  4RPO A;  4BDL A;  3TTL A;  3V89 B;  3ECR A;  1B0L A;  4H8J A;  2HCA A;  4GFR A;  3K6U A;  2GFE A;  3S9N C;  1B05 A;  1EZO A;  2I6E A;  2I48 A;  4JWO A;  1URG A;  3ZKL A;  1EU8 A;  3MZB A;  2I4B A;  4LVQ A;  4AQ4 A;  3TFL A;  3MJN A;  4U2R A;  4M4G A;  3SER A;  2AL4 A;  1UTH A;  3U8Q A;  4IY5 A;  4MF3 A;  1UIV A;  4U4X A;  2Z22 A;  3TTK A;  3G7W A;  2B3B A;  4OVJ A;  2DE2 A;  3RGY A;  3LUY A;  4KCD A;  3VLU A;  1N04 A;  2HAU A;  3CRB A;  3H4Z A;  3T9X B;  2Z8D A;  3TDJ A;  5I58 A;  4OQO A;  4JSD A;  4P11 A;  3FD3 A;  3SET A;  2PVU A;  3RTF B;  4NF4 A;  2OK2 A;  2P1S A;  1SQY A;  3QAX A;  3VE1 B;  5EYF A;  4DXU A;  3VV5 A;  5ELV A;  2F78 A;  3L6H A;  4LQ5 A;  3O6G A;  3A3U A;  1VE4 A;  3K6X A;  3SKP A;  1XVY A;  2HFB A;  5TPA B;  4DCY A;  1B3L A;  5FHM A;  2Q2C A;  4Z0I A;  3CFZ A;  1QVS A;  3WAE A;  1JVY A;  1JET A;  4NF6 B;  1MDQ A;  3QXM A;  3VXC A;  1PB8 A;  3KSJ A;  4GQO A;  5CMB A;  5ITO A;  2ALU A;  1USY H;  3GBA A;  1Y1Z A;  2QSX A;  4TLL B;  1B3F A;  4DDD A;  4XIG Q;  4GF8 A;  4R6K A;  5JTY A;  1XHY A;  2AL5 A;  3RT8 A;  4G68 C;  1JQF A;  1P1U A;  2D5W A;  3LSX A;  3DP8 A;  1OLC A;  4IO4 A;  2V3U A;  4IY6 A;  2XXW A;  2P2A A;  1PB9 A;  5ICT A;  5HM4 B;  2F7C A;  2PBW A;  5H8H B;  3KBR A;  2VD3 A;  4KPT A;  3DM0 A;  3IOR A;  4U1Z A;  4ESW A;  1ZIU A;  1D9V A;  5ITP A;  3QUJ A;  4HCY A;  2ESN A;  2KLF A;  2I49 A;  3EHU A;  1NH8 A;  2W7Y A;  3MP8 A;  2X7Q A;  3S9E A;  5DEX B;  4N13 A;  1YAE A;  1URD A;  4G2Z A;  2VHA A;  2HXW A;  2Z23 A;  2DOJ A;  1BIY A;  3VVE A;  4QRZ A;  3E9X A;  4JSO A;  4OET A;  3O9P A;  3E13 X;  2DYX A;  2ZYK A;  3SDF A;  2RKM A;  3H06 B;  2HZL A;  5H8S A;  3PGF A;  2UYE A;  3LSF B;  3RNN A;  2GHB A;  4N07 A;  1PC3 A;  1OVB A;  3OEN A;  3CI8 A;  4U1O A;  3TTR A;  1SI1 A;  4Q8R A;  4ONY A;  1P1Q A;  4OES A;  4U23 A;  2XXR A;  4QFP A;  5H8F B;  1LCF A;  4PFT A;  1A54 A;  1DPP A;  3Q28 A;  2GH9 A;  3E3K A;  3VLV A;  2OBG A;  3ZS6 A;  4M1V A;  1KWH A;  1ZBM A;  4DXC A;  3DP4 A;  2OWT A;  2HAV A;  4H0W A;  5CMK A;  4GOT A;  3UOR A;  5EHS A;  2ZNU A;  5L9O A;  3ILU B;  3TCG A;  1B5H A;  1ZTY A;  4BDR A;  4F3B A;  2RF1 A;  4RJZ A;  5I2N A;  1MM6 A;  1YCJ A;  3CG3 A;  5CMC A;  3PUX E;  4H67 A;  4ISU A;  2A5T B;  3Q29 A;  4PE5 B;  3TAJ A;  4AB5 A;  3QIM A;  1MH3 A;  3LBS A;  1MQD A;  3EQ1 A;  2GRV A;  3R26 A;  1FQB A;  4G8N A;  2XX9 A;  5I2K A;  1P99 A;  2RCB A;  2D3I A;  4QSD A;  2REJ A;  2I3W A;  2OWS A;  3CIJ A;  4XKR A;  1FQD A;  3V8X B;  4EF2 A;  2ZYO A;  2Z8E A;  3IJX B;  3MVZ A;  1B3H A;  3KN3 A;  1MXU A;  5I56 B;  2H98 A;  2PMS A;  4GL0 A;  3TTN A;  1MS7 A;  1XOC A;  1XT8 A;  1JVX A;  3K1N A;  1MPB A;  4X1B A;  1XC1 A;  2UYF A;  3O66 A;  2XD3 A;  4DCX A;  2O51 A;  5CI5 A;  3N5L A;  5A5X A;  2I58 A;  3Q27 A;  4I62 A;  3A09 A;  3IAZ A;  3SEY A;  1BLF A;  3FXU A;  3OEL A;  4ZEB A;  3U72 A;  1OQG A;  2R6G E;  4H1X A;  1R9Q A;  4K3F A;  4FOR A;  4YB6 A;  2XX7 A;  3MPK A;  1OQH A;  4LP2 B;  3UK4 A;  4Q5T A;  1QUJ A;  3OO6 A;  3S4U A;  1YPN A;  3GBB A;  1H44 A;  4G8H A;  5H8N A;  4ZE8 A;  5DYH A;  2Q2A A;  3OO8 A;  5FTH A;  3C32 A;  3G3J A;  4L17 A;  2O1M A;  1B7H A;  4GIZ A;  4ZE9 A;  3MQ9 A;  4U4S A;  1FCK A;  3UA8 A;  2Q89 A;  4EQB A;  4IO3 A;  3CFX A;  4MH5 A;  2Y84 A;  3LSW A;  3S9M C;  2R71 A;  3T66 A;  1JEV A;  2QRY A;  2G93 A;  2VD2 A;  3VXB A;  2O84 X;  2F97 A;  3T96 B;  3EPE A;  4ZEI A;  3CVG A;  3TUS A;  1ATG A;  2PX1 A;  4H6D A;  2QS4 A;  4ZEF A;  1I69 A;  1MH4 A;  1MY0 A;  3QUF A;  1Z7N E;  5DVI A;  4AB6 A;  1LLS A;  3KZG A;  1POT A;  4O3A A;  1LBC A;  4WEP A;  4ZZE A;  1B9J A;  4I8C A;  3K01 A;  5IKB A;  4ZEC A;  1I6Q A;  1OVT A;  3FV2 A;  1JW4 A;  5L9M A;  1Q35 A;  3G3G A;  5K2Y A;  4POW A;  3TOD A;  2UVG A;  3OD7 A;  3H6T A;  3UN6 A;  5AA1 A;  1IEJ A;  2QMW A;  4NE4 A;  1Y9U A;  1B6H A;  3CR9 A;  5BUU A;  3PV0 E;  1URS A;  2YPN A;  5HBC A;  2NUV A;  5I57 A;  5HPQ A;  4IB2 A;  5JK4 A;  3DP6 A;  4TLM B;  3L6G A;  2DVZ A;  3PPP A;  4F19 A;  4GL8 A;  1LCT A;  3I6V A;  2V93 A;  3C33 A;  5CM6 A;  2H25 A;  1AL3 A;  5DT6 A;  3V5A A;  2X26 A;  1H76 A;  2I0C A;  3TEP A;  2I0B A;  1MY1 A;  3RN8 A;  5I59 B;  1GR2 A;  3Q25 A;  5AA4 B;  3C34 A;  3OXN A;  2G29 A;  3LSL A;  4QHQ A;  4GRK A;  2LAO A;  4NTL A;  2RC8 A;  1NNK A;  4NF6 A;  3IJO B;  4F2Q A;  3FAT A;  5IAI A;  1LAH E;  1Y3P A;  2RC7 A;  5KCJ B;  1A40 A;  2XXU A;  3PD9 A;  3USD A;  1M5E A;  2VOZ A;  1LBB A;  4O3C A;  4JXI A;  4KQP A;  4YAH X;  1FTK A;  2ABH A;  3F11 A;  4PFY A;  4G77 A;  2NOO A;  1UIU A;  5AA2 D;  4F1V A;  3FVO A;  3Q26 A;  4RYA A;  1B3G A;  4DXB A;  3IB0 A;  1UTB A;  3FVG A;  4MLQ A;  1Y1M A;  1D3K A;  4YMB A;  4HCW A;  1JW1 A;  3TPA A;  3OO7 A;  4IO2 A;  1SI0 A;  3FGS A;  5H8H A;  5ICQ A;  4F31 B;  4FIM A;  2IEE A;  3HHF A;  4ZZA A;  3C9H A;  3SEV A;  3OEK A;  3K02 A;  3H6W A;  2DWH A;  1IIT A;  4NF5 B;  1R9L A;  4U21 A;  5DEX A;  3OMB A;  1QKB A;  3GZG A;  2O69 A;  1RYO A;  2F7B A;  1A99 A;  4F1U A;  1FTL A;  4JWY A;  4ZS9 A;  5L8D A;  4O3B A;  1FQE A;  1LAG E;  1P1W A;  4LAT A;  1A7L A;  1FQA A;  3C36 A;  2CMO A;  4NF8 B;  4LZ8 A;  4N6P A;  4IO5 A;  5K2X A;  3O97 A;  2DXY A;  3T9U A;  3DLN A;  4XTC Q;  3PUY E;  4PFW A;  1LGB C;  5AA2 B;  5FTI A;  1FTJ A;  1QUK A;  4LON B;  4G68 B;  1HSJ A;  3B6W A;  4OXV A;  3PD8 A;  2WKY A;  3HHG A;  1MPC A;  3TTM A;  1S9T A;  1SD3 A;  4OHN A;  2Z8F A;  1LST A;  3PU5 A;  3GLB A;  5H8F A;  1Y3Q A;  1Y20 A;  4XKQ A;  3SES A;  3B6Q A;  3OOA A;  1NNT A;  2GHA A;  1LAF E;  3FZV A;  1B4H A;  4THI A;  3KJT A;  1GTK A;  2Q9T A;  3HV1 A;  2DXR A;  3K2D A;  1OMP A;  3MP1 A;  3P7I A;  5F7V A;  3HPI A;  3K1P A;  1XVX A;  3MAM A;  2F36 A;  3O29 A;  3BFU A;  2A5T A;  5TP9 B;  2E0S A;  3MWB A;  1M5D A;  1N0T A;  3FVN A;  1JNF A;  4LA9 A;  2XXY A;  4BDQ A;  4ELO A;  1MQJ A;  4WKM A;  3SEU A;  1IXH A;  4GLI A;  2Y7P A;  4HTG A;  3JYR A;  4LUB A;  4NWC A;  3LC8 A;  3T9V A;  1WVJ A;  1SW4 A;  1N76 A;  4NED A;  3V83 A;  3ODB A;  2A5S A;  1B0H A;  4ELR A;  4ZEK A;  1N3W A;  1LFG A;  4NMY A;  5I56 A;  2OCU A;  4DE8 A;  4F29 A;  4IO6 A;  4F1Y A;  1B52 A;  2QL3 A;  4IGR A;  3FJG A;  2O7I A;  1MY4 A;  5DTB A;  3CFL A;  3O2A A;  3IOW A;  2PT1 A;  3PMV A;  1OLA A;  4KYD A;  4E0W A;  3TQL A;  4JWX A;  1SDX A;  1R1N A;  4OEN A;  4UAC A;  3U93 A;  3TCF A;  3U92 A;  1TWY A;  4G8M A;  1IXC A;  4YU0 A;  1ZU0 A;  2DP8 A;  1MRP A;  1CE2 A;  1B2H A;  4LZ7 A;  4RXL A;  3T22 A;  1LB9 A;  2P0S A;  1UQW A;  2XXI A;  1B58 A;  4KYE A;  3IB1 A;  4GD5 A;  2RCA A;  3KG2 A;  1US4 A;  3T9H B;  3H6U A;  1TXF A;  1D9Y A;  5KDT B;  1I6B A;  1TFD A;  2Y7R A;  1AH5 A;  1PB7 A;  3O6H A;  1MXZ A;  1NH7 A;  2XHD A;  1B40 A;  4OWD A;  5DVJ A;  1P1N A;  2Q8J A;  1EZP A;  5AA3 A;  3VLW A;  2XXP A;  4BDN A;  3FXR A;  1BKA A;  3WAF A;  3K1M A;  2F8D A;  2CZL A;  4OTE A;  3VFJ A;  2AIX A;  2OLB A;  3TYH A;  4BDM A;  3MC2 A;  4OYV A;  4QSE A;  4XKP A;  1B7Z A;  2VP1 A;  1FTM A;  3PPR A;  5FHO A;  3KN7 A;  3G3H A;  1MPD A;  5I84 A;  3T93 B;  4RK9 A;  3PUW E;  1LFH A;  2F34 A;  1SYH A;  2RIN A;  3EHS A;  4X48 A;  2DWI A;  2M8C A;  1Y4T A;  1DSN A;  2O7U A;  1L5T A;  4P0G A;  1EH3 A;  3QSL A;  3N94 A;  2PYY A;  1B32 A;  3W9W A;  1ZJL A;  4OMB A;  4EDP A;  3MVX A;  5ISU A;  1VFE A;  5FHN A;  4KCC A;  3K6V A;  4F39 A;  5H8Q B;  3D4G A;  5I59 A;  5J1D A;  1J1N A;  5AA4 A;  3OEM A;  3U94 A;  3FIR A;  4DLD A;  3VVD A;  4QFO A;  2I4C A;  3EF7 A;  4QSC A;  3JV9 A;  3TMG A;  3FUZ A;  3OO9 A;  4KI0 E;  2DE4 A;  2F6P A;  2IA4 A;  4DIG A;  5KCJ A;  1AOV A;  4QFK A;  1LB8 A;  1R6Z A;  3R6U A;  3TCH A;  4R74 A;  2PT2 A;  3OSR A;  1VR5 A;  3M3K A;  4R6H A;  1S50 A;  2Y7K A;  4RA1 A;  3FJM A;  2O1L A;  1MQG A;  5F1Q A;  4F2O A;  5EHM A;  1H43 A;  1MDP 1;  4IO7 A;  5B70 A;  3HST A;  5A5X B;  3K0V A;  2X7P A;  3IOV A;  2UVI A;  4ECF A;  1MG1 A;  4C0R A;  2V3T A;  1A8E A;  4BLA A;  4ND9 A;  2ONS A;  4H5F A;  2F5X A;  1NNP A;  2QS1 A;  4UA8 A;  2FYI A;  5B7D A;  1RYX A;  3B6T A;  4NF5 A;  2BJJ X;  3BKI B;  2FA7 A;  4JB7 A;  5H8N B;  2DSF A;  3PMX A;  4OEU A;  4FEB A;  1OIB A;  5TPA A;  3O6I A;  1H3D A;  1SW5 A;  1H45 A;  4NF8 A;  2OZZ A;  1JEU A;  1AMF A;  3N26 A;  3IOT A;  4FE8 A;  3KJ7 A;  3TQW A;  2OJT A;  5AA2 A;  4YKK A;  1MM7 A;  4FJP A;  4G68 A;  3UP9 A;  1B3E A;  1ZKB A;  1MQH A;  1I6A A;  4YZZ A;  1GVC A;  1SBP A;  2ZNT A;  2V84 A;  4RNS A;  1B4Z A;  1IZ1 A;  2Q88 A;  1B1X A;  1GV8 A;  3SEX A;  2F7A A;  1WOD A;  1M5C A;  4X1D A;  1MXX A;  2B3F A;  2I3V A;  3G3K A;  4GVO A;  5L9S A;  4R75 A;  3S9L C;  4OEV A;  1MXV A;  1PBP A;  4LQ2 A;  3MVW A;  5TP9 A;  3KFM A;  3M3F A;  4R9G A;  2UVH A;  3PUZ E;  4ELP A;  1BP5 A;  1VFD A;  1PEB A;  3MZ1 A;  5I57 B;  1B1H A;  3U1O A;  3C4M A;  3VVF A;  4I1D A;  2Y7I A;  1QJM A;  1HSL A;  1QUI A;  1VSO A;  3H3G A;  3HN0 A;  3O28 A;  4F3S A;  4C1U A;  1MXW A;  4G4P A;  4ELQ A;  2DS9 A;  5LOM A;  4Q30 B;  5CMM A;  3RT6 B;  3S2V A;  5CBS A;  1DTZ A;  2HQ0 A;  1Q1K A;  1MY3 A;  4XKN A;  1TFA A;  4FAT A;  1D4N A;  4FEC A;  4QFN A;  3PPN A;  3IL1 B;  3KGC A;  4JDF A;  5M2V A;  1ZLQ A;  4H8I A;  2D21 A;  1O64 A;  4NWD A;  4YB5 A;  1UTH B;  3A3C A;  1FQC A;  2XXV A;  4KFQ A;  3RQT A;  4YB7 A;  1MY2 A;  2RC9 A;  2H9B A;  2R9J A;  4WXJ A;  1SW1 A;  3PUV E;  3I5O A;  3IX1 A;  2DWJ A;  3MZ9 A;  4OFO A;  1IQ7 A;  3H03 A;  1UTB B;  3IO4 A;  1P1O A;  2ZMB A;  1SVX B;  3BFT A;  2UVJ A;  2XXH A;  3MUQ A;  3THI A;  5I58 B;  2YJP A;  2XD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...