3WAEA

X-ray structure of fe(iii)-bicarbonates-ttfbpa, a ferric ion-binding protein from thermus thermophilus hb8
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
b'PTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRON ABC TRANSPORTER, PERIPLASMIC IRON-BINDING PROTEIN
molecule tags Metal binding protein
source organism Thermus thermophilus
publication title A novel mode of ferric ion coordination by the periplasmic ferric ion-binding subunit FbpA of an ABC-type iron transporter from Thermus thermophilus HB8.
pubmed doi rcsb
total genus 112
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3waeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3waeA02
1LLSA 2O6AA 4UACA 4X1BA 2NWJA 1MPCA 4YZZA 3K6UA 3HO7A 3FVGA 2QMXA 4ESXA 3BKIB 4KPTA 2OBGA 3VXCA 3R26A 4I1DA 4Q30B 5BWJA 5IAIA 2OZZA 3OO7A 3JZJA 3HHFA 5L9MA 1H76A 3PD8A 1B1XA 1B7HA 1MXXA 2DYXA 2O7IA 1B3HA 1B32A 2B3BA 3CG1A 3GBBA 4GIZA 2P2AA 2HCAA 5AA4A 1B3GA 2I49A 1NL5A 1YAEA 3PMXA 4RPOA 3K6WA 5CMMA 3GBAA 2W7YA 3H06B 3PU5A 1FCKA 4LONB 5CI5A 4Z7EA 3TFLA 2ALUA 3IJOB 4LQ5A 1P1QA 5FHNA 1NNPA 1VR5A 2QS3A 2Z8FA 2ZMBA 3H4ZA 4I62A 1FQFA 1N3WA 4JDFA 4KHZE 4LZ7A 3S4UA 3EHTA 3CG3A 5CBSA 4EQ7A 4F31B 4XKPA 3TKDA 5KCJA 2DVZA 1XOCA 3KN8A 4RK9A 2ABHA 3G3KA 5L8DA 2REGA 1DTGA 3IB0A 3N26A 3MUQA 3H6WA 3KSJA 2P0SA 2Q88A 3OSRA 3PMWA 2NVUB 4IO2A 3V8XB 4E0WA 4OETA 1OLCA 2NXOA 4X9TA 3ECRA 4NF5B 2RKMA 5B7DA 4XKQA 4PETA 1BP5A 3W9WA 1DPEA 1IZ1A 2D21A 1NNKA 4LP2B 1R9LA 2AIXA 1GR2A 3PD9A 3RUMA 3EN3A 3FVKA 1PB8A 4I9DA 1L5TA 4R75A 4LQ2A 1TFDA 3FVOA 2V25A 5FTHA 4F2QA 3O6HA 3DP6A 2Q2CA 4U4SA 4P0IA 1IUDA 1O64A 3QAXA 1N0TA 2Q89A 1NMUA 1LCTA 5A5XB 3TTMA 1O63A 4F22A 1P1UA 2HAVA 3EF7A 4PFYA 5HBCA 2F6GA 4X1DA 5K2YA 5KCJB 3K1NA 4HS7A 3IJXB 4O3BA 1MY4A 4LZ8A 4NF4A 4XIGQ 4XXUA 4ZEBA 1RKMA 1LAFE 3ZS6A 3SEXA 3S9MC 4JWOA 3T9VA 1ZU0A 3IOWA 4DXCA 4QFOA 1ZJLA 1MM6A 4OFJA 4OERA 2V3TA 1M5FA 3MPKA 4NF6B 1PBPA 3TTLA 4EUOA 3DP8A 1SVXB 3CFLA 4G2ZA 4ESWA 4QSEA 5ITPA 1TXFA 1NH8A 3IB2A 1JQFA 5AA4B 2F7AA 3FZVA 2ZNUA 3KZGA 4EXKA 2VOZA 3LBSA 2REJA 4KD5A 2PVUA 5AA2B 4ECFA 4DLDA 3G3GA 4F3GA 3ILUB 4FORA 1LBCA 4RYAA 4R6KA 1Z7NE 3I3VA 4F3SA 2R6GE 2F7BA 4RJZA 2LAOA 2DP8A 4QFPA 1LGBC 3QK6A 2XD2A 3CVGA 3LSXA 1NFTA 2XD3A 3K1PA 4MBPA 1B1HA 3FXRA 5DEXB 5JTYA 1O7TA 3S9LC 1SI0A 1UTBB 5AA2A 1TT1A 3FJGA 5I56A 1US4A 4ZEIA 3U94A 1XVXA 3H3GA 2R71A 2HZLA 2I58A 3KJ7A 1OIBA 1PBQA 2OLBA 1MY1A 2F34A 1VFEA 3OSQA 4FEDA 4U1OA 1PC3A 3UORA 2QL3A 3K02A 5KDTB 2P1SA 4F1YA 4QHQA 3VVEA 1EH3A 2O7UA 3T9UA 1LSTA 2DVCA 2VD3A 2Y7RA 4ONYA 4YKPA 4ELPA 3Q28A 3MBPA 4YKKA 1CB6A 3CSBA 4IGRA 3OOAA 3PPNA 4M1VA 3O28A 1XC1A 2OWTA 3CFZA 3H6UA 3O97A 3JYRA 4N6PA 4ZE8A 5TPAA 1PB7A 1FQCA 3QSLA 4H5FA 4L17A 4O3CA 3VVFA 1IXCA 5FHMA 2I0CA 1NNTA 3S2VA 5I58B 3ILTB 2UVIA 5AE4A 1MPDA 3IO4A 3H03A 4R6YA 5CRYA 1MQIA 4N13A 4OYVA 3TYHA 1OVTA 2UVGA 3RT6B 1N7WA 3D4CA 1T0KA 1MDP1 4E0XA 1QW0A 2D3IA 3KEIA 1A8EA 2QS4A 1IITA 1Y1ZA 5H8HB 3VXBA 3RTFB 4IY6A 4EF2A 5F7VA 4JSOA 5HPQA 2QS2A 3IO6A 3V83A 1DMBA 4OMBA 3R6UA 2DWAA 2DE2A 5K2XA 3OEMA 4DXUA 3M3FA 1NKXA 2HAUA 5CC2A 4KR5A 4DE8A 5I84A 2Y7IA 3QXMA 2O1LA 3C36A 5H8HA 3HV1A 4NWCA 3BFTA 4GXSB 5DT6A 2A5TB 5H8NB 5ICTA 2ZNSA 1DTZA 3KOSA 4G4PA 3N6TA 4QF9A 5ELVA 5TU0A 1MRPA 3FIRA 4MFIA 2RINA 4R2BA 3GLBA 2XXTA 3FGSA 4MLVA 3Q29A 5I57A 1S9TA 2GHAA 2UVJA 3TUSA 1MXUA 3IL1B 3GXAA 1LBBA 4XKRA 3LSWA 3VE1B 4ELOA 2RC8A 4EQBA 1R9QA 3HN0A 2XXWA 4GL0A 1XHYA 2DOJA 4QFLA 2CZLA 2Y84A 3ZKLA 1JEVA 3FV1A 1MDQA 3OXNA 1JETA 3V89B 2ZYKA 2YLNA 3U72A 1QUKA 3VDFA 3Q26A 3FJ7A 4NMYA 4QRZA 3CR9A 3OEKA 4H0WA 2DWIA 1I6QA 3T93B 3UP9A 3G7WA 1M5BA 4U22A 1POTA 2DE3A 3B6QA 2B3FA 1AL3A 1SW1A 3RPWA 4NF6A 5F1QA 3IOUA 1QKBA 3C4MA 3K01A 1LAGE 3KN7A 4NWDA 4ZDMA 2DSFA 4KFQA 3W15C 1FQEA 4IY5A 1LFIA 4FE8A 1YPNA 5DEXA 4HW8A 1B3FA 1MH4A 4KCDA 4R9GA 4C0RA 3S9EA 4IB2A 3G3FA 5BUUA 3FASA 4G77A 1LAXA 3W9VA 5DVIA 3ONMA 1R6ZA 3LSFB 4LA9A 5EHMA 3MW0A 3G3IA 4ZS9A 4ZEKA 4GXAA 2PT1A 3THIA 1HSLA 4R2FA 2G29A 4DZ1A 2PYYA 2GFEA 3QIMA 4LUBA 2XXYA 1BIYA 4H8JA 3B6WA 3CFXA 4JBZA 2I3VA 4R73A 5CBRA 3CRBA 3RT8A 1M5CA 3VFJA 4F19A 3K00A 3DLNA 1Y3NA 5ICQA 1MXWA 4F39A 1IXIA 1TWYA 3PPQA 4TLMB 4YB6A 4JSDA 5FHOA 2ANJA 2V93A 3E9XA 2V3QA 2Z8DA 3PPRA 1N3XA 4XTCQ 1N76A 1H43A 3LSLA 1YCJA 1BKAA 4POXA 3T66A 1DOTA 4FATA 1Q35A 4KQPA 2F6PA 4LATA 1US5A 1WODA 2F7CA 1UQWA 3PPOA 4GD5A 2V3UA 4HTGA 4ZECA 3C35A 3L6HA 1ELJA 1B5JA 3PMVA 2DXRA 4KYEA 3TTKA 4QSDA 3B7DA 3Q27A 3B6TA 4YB5A 3RGYA 4OQOA 4LVQA 1P1OA 2H9BA 2ZYOA 4OXVA 5ISUA 1SYIA 2GH9A 4THIA 2NUVA 1QKAA 2OWSA 1QUIA 2XXXA 3FXUA 2Z22A 3KOTA 3OENA 4U4XA 1LFHA 1LCFA 4QFKA 2R9JA 4ND9A 2HEUA 3MC2A 3OELA 4RK2A 2OJTA 2XX7A 3D4GA 3HPIA 3OO8A 3E4RA 3KFMA 3IK6B 3K1MA 1B0HA 3IB1A 3KG2A 4EXLA 3RN8A 4P11A 3BFUA 3O66A 2H98A 4GL8A 4P0GA 5CMKA 4NTLA 4H8IA 4IGTA 1B5HA 4KCCA 5M2VA 1JW5A 1EZPA 3FVNA 5AA1A 1SYHA 4YB7A 3H6TA 1SW4A 5L9SA 1GVCA 1EZOA 4RNSA 2XHDA 1B2HA 1A8FA 1B4HA 1J1NA 1OLAA 1POY1 5ITOA 4Z0IA 3UK4A 1B6HA 1P1WA 4GQOA 2GHBA 4AQ4A 1OVBA 1Y4CA 1MXZA 2UXAA 1A99A 3FATA 2XXPA 3C31A 3FV2A 4IO3A 1TFAA 4BDLA 3AXFA 4ZEDA 4PFUA 3QUFA 1M5EA 5EHSA 1FTOA 2NOOA 4YMAA 5I59A 2XX8A 2I48A 2M8CA 4NF8A 3T96B 1AH5A 1NNFA 3EQ1A 2DWHA 1RYXA 2F5XA 2O68A 3IOVA 3K6XA 1FTMA 4BDOA 2E1SA 4KYDA 3MP6A 1B9JA 4PE5B 1VE4A 4FEBA 4ELRA 1B7UA 3CIJA 1R1NA 2XXRA 4G68A 3M8UA 4NE4A 4FJPA 4GVOA 3U93A 1B58A 2QS1A 1D3KA 3IX1A 4FIMA 2RC7A 4RXLA 4EDPA 1B52A 4F18A 1FTJA 1QJMA 1SBPA 2H4IA 1Y3QA 3M3LA 3UIFA 3WAFA 1QVSA 4YAHX 3U8QA 4WEPA 5I58A 2CMOA 2ZYMA 3TODA 2PMSA 1BTJA 4JB7A 4UA8A 1B46A 3KSXA 1IXGA 3OMBA 3TMGA 1OQHA 3TTNA 3UA8A 2THIA 2UYEA 3PUWE 5KZTA 2I6EA 2Z23A 4KYSA 3OD7A 2O69A 5JK4A 1ZTYA 2ZNTA 2F97A 5I2KB 2UYFA 4F1VA 1FTKA 1A55A 2F78A 4U21A 3TTRA 3TEPA 1UIUA 1USYH 2QPQA 4Q0CA 3C9HA 2PX1A 1MS7A 2WKYA 4G8NA 4C1UA 1AOVA 4QSCA 3QUJA 4NF4B 4OWDA 5J1DA 4ZEFA 1MQDA 4OFOA 4GF8A 2QMWA 3O6GA 3MAMA 3TQWA 1B5IA 3LR1A 2YJPA 1KWHA 1ZKBA 3C33A 3SETA 1ATGA 1MQHA 3L6GA 2XXIA 1S7YA 1UTBA 1ZMGA 2GRVA 4IO6A 1HSJA 1N7XA 5JTYB 3RLFE 3O9PA 5A5XA 5HM4B 2I4CA 1A54A 1ZIUA 3TQLA 5AA2D 3S9NC 3PV0E 2HFBA 3G3HA 3H6VA 4DXBA 3TPAA 3GZGA 1Y20A 1MQJA 4FECA 4F2OA 1H45A 1N84A 1EU8A 1IXHA 1NH7A 3MWBA 1XS5A 3O29A 2HXWA 2O51A 2AYSA 1D9YA 1MH3A 3A3UA 4OZ9A 4R9FA 4YICA 5EYFA 5DVJA 3SESA 2XXQA 3FJMA 2BJJX 4PQJA 2QRYA 2AL5A 1UTHA 1Y9UA 3MVYA 3T22A 4YMBA 1II5A 4QFNA 4EF1A 3U1OA 2VGQA 1PDAA 1CE2A 4MF3A 5I2NA 3MZ1A 4TQUQ 5AA3A 1ANFA 2HZKA 3DM0A 1HSEA 1QULA 3MQ9A 1Z7ME 4KI0E 1P1NA 1P99A 1PB9A 1A7LA 4IO4A 5DVFA 1GTKA 1N04A 4JWXA 1VFDA 4DDDA 5I59B 2I0BA 3MP1A 2DE4A 3KJTA 3QYTA 2I3WA 3VV5A 3M3KA 4PP0A 3VLUA 3FUZA 4BDNA 1B4ZA 2G93A 4RPNA 3ZKKA 3RY3A 3JV9A 4X48A 4I8CA 2XXUA 1RYOA 1URDA 1B40A 1BLFA 1MPBA 1H3DA 3KGCA 3O6IA 4F1UA 4OESA 3IORA 3K0VA 4LZ5A 1UIVA 2D5WA 3E3KA 4WXJA 3ZSFA 1QUJA 2Z8EA 2Q2AA 3N94A 1GGGA 2F8DA 5TPAB 1S50A 4ZE9A 1JVYA 2VD2A 3A09A 5CM6A 4F3BA 2RCAA 4H65A 1B3LA 2ONRA 3PPPA 3IAZA 3PUYE 3I5OA 1I6BA 4F29A 3MVWA 2VP1A 2A5SA 2I4BA 1JEUA 1URSA 2ZXTA 4JXIA 4TOZA 4C1TA 3TAJA 2FYIA 2RCBA 2O1MA 3MVZA 3F11A 2DQVA 3FXQA 3MZ9A 4RA1A 4RY1A 1WVJA 3HSTA 1USYE 4OFLA 3MP8A 3C32A 1URGA 4OEVA 4Q8RA 5I56B 2X7QA 2PBWA 4HCYA 4OVJA 1VSOA 1D9VA 4N07A 4PFTA 3DP4A 1WDNA 1FW0A 3CSGA 4H5GA 4U23A 4GRKA 3TELA 4PFWA 1GV8A 4POWA 1B3EA 1Y4TA 4OENA 3HCQA 5DTBA 4XKNA 4G68B 5H8QB 1ZLQA 3PUVE 3A3CA 4U2RA 4WEDA 1I6AA 4H6DA 4BDRA 5H8QA 3R7XA 5IKBA 1LB8A 4GWOA 4NF5A 3BBRA 3HHGA 2IEEA 4IO7A 1FQBA 3VLWA 2B65A 2H5YA 2ZYNA 4AB6A 1B51A 1B05A 2ESNA 3U92A 1YTVA 1Y3PA 4F3PA 2PT2A 1MXVA 2FNCA 4Q5TA 5DYHA 5TP9B 2QJEA 3MPLA 2Y7WA 3OO6A 1M5DA 1ZBMA 1JW1A 3SEUA 3LC8A 1A40A 1Y1MA 3SEWA 2A5TA 5H8NA 3H7MA 4BLAA 5I2NB 1IQ7A 3K4UA 1JNFA 3KBRA 3OO9A 4DCYA 1MY0A 1MM7A 4H67A 4HCWA 1JVXA 2XXHA 1MY3A 4ELQA 3N6UA 3IOTA 2DWJA 5I57B 4WKMA 1H44A 1IEJA 5I2KA 3ODBA 1DPPA 4G8MA 1EZ9A 2IA4A 2QSXA 2Y7PA 3SERA 1FQDA 5FTIA 3EHSA 1FQAA 2Y7KA 1XT8A 1FTLA 1I69A 3E13X 2RC9A 4GFRA 3WAEA 1D4NA 3C34A 2Q8JA 4ISUA 1IIWA 1MY2A 1OMPA 3PUZE 3PUXE 3TCGA 3Q25A 4DCXA 4FAJA 4ZZEA 3TCFA 3G3JA 3P7IA 4YKIA 5TP9A 3V5AA 4DIGA 1XVYA 3VVDA 3TZAA 1LB9A 2ONKE 4YKJA 4MLQA 2E0SA 5KDTA 2HQ0A 1LAHE 3CI8A 1UTHB 4R72A 3T9XB 2KLFA 2X26A 3N5LA 1OQGA 3UGWA 2DXYA 4NF8B 3T9HB 3TCHA 2H99A 4GLIA 1MG1A 4R74A 1JW4A 4OTEA 1SW5A 2VHAA 3DELB 3FD3A 3K2DA 3KN3A 4H1XA 4O3AA 3SEYA 5H8SA 1B0LA 2XX9A 4BDQA 3I6VA 4OHNA 2FA7A 3SKPA 1AMFA 1SW2A 2Q9TA 3K6VA 3O2AA 4OEUA 5L9OA 3MJNA 5CMCA 4YU0A 1SD3A 2AL4A 2O84X 4ZZAA 2H25A 3LUYA 4BDMA 3USDA 1PEBA 4NEDA 2OCUA 1MXYA 4G8HA 2F35A 1B7ZA 4AB5A 3RNNA 4G68C 1AIVA 2XXVA 3MZBA 1Q1KA 3VLVA 1SI1A 1SDXA 3EHUA 4JWYA 3PGFA 4IO5A 4EQ9A 3IR1A 2V84A 5CMBA 4TLLB 5LOMA 3SEVA 3TDJA 1F9BA 5H8FB 1DSNA 2DS9A 2F36A 3RQTA 3EPEA 2OK2A 3RTWB 1MQGA 2UVHA 3MVXA 3UN6A 4K3FA 5B70A 5H8FA 2RF1A 4GOTA 2X7PA 2YPNA 5JEIA 4M4GA 4U1ZA 4R6HA 1SQYA 4MH5A 1LFGA 2ONSA 3SDFA
chains in the Genus database with same CATH superfamily
4YZZA 3FVGA 2QMXA 4NGUA 4KPTA 4Q30B 2BJIA 3HHFA 4O8MA 1B1XA 1MXXA 1B3HA 1B32A 2P2AA 3PMXA 4G61A 5I57A 3PU5A 2W7YA 4Z7EA 3TFLA 4LQ5A 5FHNA 2QS3A 4I62A 3S4UA 1FQFA 4P9KA 4LZ7A 3BIHA 5CBSA 4EQ7A 5L8DA 4HE2A 3V8XB 4X9TA 3ECRA 5B7DA 1NNKA 1D9QA 1FBHA 2PFZA 3FVKA 1L5TA 4I9DA 3IFCA 4LQ2A 3FVOA 4U4SA 1IUDA 1NMUA 1FJ6A 1O63A 4PFYA 4X1DA 4HS7A 4XIGQ 1ZU0A 4DXCA 4EUOA 4NF6B 5DW8A 1LBZA 3IB2A 5AA4B 4EXKA 5AA2B 4ECFA 3G3GA 3SZPA 1LBCA 4HXVA 3QK6A 2XD2A 5JTYA 1O7TA 5T3JA 1UTBB 3S9LC 1US4A 3U94A 1OIBA 1FRPA 2F34A 4FEDA 2HPGA 2P1SA 4P56A 3Q28A 3CFZA 3H6UA 4N4UA 4ZE8A 3VVFA 2HHMA 2I0CA 5AE4A 5CRYA 1MQIA 4N13A 4OVPA 1QW0A 3BIGA 1FPLA 1DMBA 5K2XA 2QVVA 4DXUA 4NX1A 3M3FA 5LTCA 1NKXA 2HAUA 5I84A 5H8HA 3BFTA 2ZNSA 3N6TA 2XWOA 4MLVA 1S9TA 2GHAA 1MXUA 2XXWA 1XHYA 2Y84A 3FV1A 3V89B 3VDFA 2YLNA 3NOHA 3Q26A 3FJ7A 3OEKA 3T93B 3UP9A 2DE3A 3B6QA 4GBWA 3K01A 3KN7A 4KFQA 4HW8A 4FE8A 1YPNA 1MH4A 4KCDA 3MSTA 1LAXA 5DVIA 3ONMA 3MW0A 4ZS9A 2PT1A 2PYYA 5IGAA 2XXYA 4R73A 3CFXA 2I3VA 3CRBA 1Y3NA 1MXWA 1TWYA 3PPRA 4XTCQ 1H43A 3A29A 3LSLA 1BKAA 5EYHA 4FATA 3C35A 3ROJA 3B7DA 4XEQA 2ZYOA 1SYIA 1QKAA 2XXXA 1LCFA 3OELA 4GWSA 2XX7A 3D4GA 1B0HA 3IB1A 3BFUA 4GL8A 1FPBA 1B5HA 1SYHA 1B4HA 1OVBA 4MNCA 3C31A 1TFAA 3AXFA 4DI3D 2HXRA 3T96B 1NNFA 3EQ1A 2O68A 4KYDA 1IMDA 1B9JA 2OX3A 4FEBA 1B7UA 2XXRA 2KR0A 4FJPA 4EDPA 1D3KA 2H4IA 1K9ZA 3M3LA 3UIFA 3WAFA 3TODA 4UA8A 4JB7A 1B46A 4GWWA 1OQHA 3UA8A 1KA1A 2I6EA 4KYSA 5JK4A 3TEPA 3TTRA 1USYH 4GF8A 2QMWA 2YJPA 2MKZA 1ATGA 1FPKA 1DCUA 5HM4B 1NUZA 1MQJA 5IZZA 1H45A 3VXBA 1XS5A 2HXWA 1D9YA 4X04A 1G0IA 4YICA 3SESA 4PQJA 3U1OA 1PDAA 5AA3A 2HZKA 1QULA 1Z7ME 1P1NA 4IO4A 1GTKA 1KA0A 1N04A 1VFDA 2DDKA 5I3SA 4BDNA 1B4ZA 1IMAA 2XXUA 1FPJA 1RYOA 2P3VA 4PFRA 4OESA 2D5WA 1QUJA 1S50A 4MNPA 2RCAA 1B3LA 4F29A 4JXIA 2ZXTA 4TOZA 2FYIA 2O1MA 3F11A 4RY1A 1WVJA 4MHFA 4P1LA 4HCYA 1VSOA 3TELA 4PFWA 4POWA 4AS4A 4OENA 4XKNA 5H8QB 1ZLQA 3A3CA 4U2RA 4H6DA 5H8QA 3CHGA 1BK4A 4O7MA 4IO7A 2H5YA 1NUWA 3U92A 1Y3PA 5DYHA 3MPLA 2Y7WA 3LC8A 1Y1MA 3H7MA 5I2NB 3K4UA 1MM7A 1JVXA 1MY3A 3IOTA 2DWJA 4WKMA 2Q74A 1FQAA 2XWIA 3PUXE 3Q25A 4DCXA 4FAJA 4ZZEA 3TCFA 3G3JA 3P7IA 4OVQA 4YKIA 4DIGA 3TZAA 1NV0A 5KDTA 1LAHE 1UTHB 3T9XB 2X26A 3T9HB 4GLIA 4R74A 1SW5A 4BDQA 2FA7A 2Q9TA 4OEUA 5L9OA 3MJNA 4YU0A 5CMCA 2AL4A 2O84X 1PEBA 2OCUA 3B50A 1FBFA 3RNNA 4FBPA 1QGXA 3IR1A 4TLLB 5LOMA 3SEVA 1F9BA 1DSNA 3EPEA 1MQGA 1LBWA 3MVXA 2WEFA 4K3FA 3U65A 2RF1A 4GOTA 4M4GA 1LLSA 2O6AA 4UACA 4X1BA 1MPCA 4N17A 5IZ3A 3R26A 5BWJA 5L9MA 1B7HA 4MMPA 4GIZA 1B3GA 2I49A 1NL5A 4KXPA 5CMMA 4RPOA 4LONB 1FCKA 3IJOB 1NNPA 1VR5A 2Z8FA 3H4ZA 4JDFA 3CG3A 4XKPA 5KCJA 4ZE9A 2REGA 1DTGA 3IB0A 3N26A 3MUQA 4O7IA 1G0HA 5ESYA 2NVUB 4E0WA 4OETA 1OLCA 2NXOA 4XKQA 3W9WA 3PD9A 1PB8A 5ICTA 4R75A 5FTHA 1TFDA 3DP6A 4P0IA 3QAXA 1N0TA 4F22A 2F6GA 5J16A 5KCJB 4O3BA 1NV6A 4LZ8A 4NF4A 3S9MC 2Q8MA 3T9VA 3IOWA 4N81A 2V3TA 2FVZA 3MPKA 3TTLA 1IMBA 3DP8A 4G2ZA 4ESWA 4QSEA 1TXFA 1JQFA 3KZGA 3LBSA 4PDDA 4KD5A 1VDWA 2PVUA 4DLDA 1FSAA 4F3GA 4RYAA 4F3SA 1LBYA 4RJZA 4QFPA 4PFBA 3CVGA 2QVUA 2XD3A 3K1PA 1B1HA 3FXRA 1SI0A 4ZEIA 1XVXA 2I58A 1PBQA 2OLBA 1VFEA 3IFAA 4QHQA 3VVEA 1RDZA 3PPNA 4PE3A 3O28A 3JYRA 1PB7A 4O3CA 3ILTB 4OA4A 4R6YA 2L5VA 2UVGA 3RT6B 1N7WA 4IY6A 5F7VA 2QS2A 4OMBA 3R6UA 2DWAA 4N6DA 4KR5A 4MIJA 4NWCA 4GXSB 1DTZA 1NUYA 3KOSA 5TU0A 3FIRA 4MFIA 4R2BA 2XXTA 3FGSA 3Q29A 3TUSA 3IL1B 4XKRA 3LSWA 4EQBA 2DOJA 5ET5A 3OXNA 1NV2A 3CR9A 4PDHA 2DWIA 4XF5A 1I6QA 1M5BA 2B3FA 1SW1A 1QKBA 4NWDA 1B3FA 4R9GA 3S9EA 3W9VA 3LSFB 5EHMA 3G3IA 4GXAA 1HSLA 4R2FA 4DZ1A 5CBRA 4JBZA 1M5CA 3K00A 5ICQA 4F39A 3PPQA 4YB6A 4MNIA 4JSDA 2Z8DA 1N3XA 3PPOA 4ZECA 1UQWA 2DXRA 4KYEA 4QSDA 3B6TA 4PC9A 4OQOA 1FBCA 5ISUA 2NUVA 2OWSA 2XWKA 2R9JA 4GWYA 2OJTA 3HPIA 3OO8A 3E4RA 3KFMA 3IK6B 2WX9A 5ET6A 4P11A 2WYKA 3O66A 4P0GA 5CMKA 4IGTA 1JW5A 1EZPA 5AA1A 4GX6A 2XHDA 1A8FA 5ITOA 1B6HA 1P1WA 2GHBA 4AQ4A 2UXAA 3QUFA 5EHSA 1FTOA 5FBPA 2XX8A 2F5XA 3IOVA 3K6XA 1FTMA 4BDOA 2E1SA 1VE4A 3CIJA 1R1NA 3M8UA 4NE4A 2QS1A 2RC7A 4F18A 4N8YA 2ZYMA 5LDZA 3KSXA 2UYEA 3PUWE 2F97A 4F1VA 1FTKA 1A55A 4U21A 4C1UA 4Q0CA 1MS7A 3GYYA 4ZEFA 4OFOA 1KWHA 3C33A 3SETA 1IMCA 2XXIA 4IO6A 4EF1A 5A5XA 4N8GA 1HSJA 3O9PA 4PGNA 1ZIUA 4DXBA 1Y20A 4N91A 1IXHA 4F31B 4OZ9A 5DVJA 2BJJX 3MVYA 1EYJA 3T22A 5I2NA 3MZ1A 4TQUQ 5ET8A 1LBXA 1P99A 1PB9A 5I59B 1FPIA 3MP1A 2DE4A 3QYTA 4RPNA 3ZKKA 1BLFA 3KGCA 3IORA 4LZ5A 3E3KA 1GGGA 2VD2A 3A09A 5CM6A 1I6BA 3MYUA 2ZZWA 1URSA 1FTAA 2RCBA 3MZ9A 1FBPA 1USYE 4Q8RA 4OEVA 2PBWA 2F3DA 4N07A 3DP4A 4H5GA 4GRKA 1B3EA 3HCQA 1I6AA 1LB8A 2IEEA 1B05A 5I5PA 2PT2A 5TP9B 2QJEA 1JW1A 3SEUA 4AS5A 1A40A 4HCWA 2XXHA 4ELQA 3N6UA 1DPPA 2IA4A 2QSXA 3EHSA 2Q8JA 4ISUA 3KC0A 1MY2A 1OMPA 2VPNA 3V5AA 3VVDA 3KC1A 4NAPA 1LB9A 3EKIA 4MLQA 2E0SA 3CI8A 4O94A 2KLFA 3UGWA 3TCHA 2R8TA 2H99A 1JW4A 2VHAA 3DELB 4O3AA 1NV4A 3SEYA 1Q9DA 1DBZA 4LN5A 1MXYA 4AB5A 1FBDA 2XXVA 3MZBA 3VLVA 3EHUA 3PGFA 4HE0A 2F3BA 2DS9A 2F36A 5IZ3B 5JEIA 2X7PA 1AWBA 4U1ZA 4MH5A 4OTEA 2ONSA 3K6UA 4ESXA 3BKIB 2OBGA 4I1DA 5EQ8A 3JZJA 3PD8A 2O7IA 3CG1A 3GBBA 5AA4A 2HCAA 1YAEA 3TAJA 2ALUA 2ZMBA 4XFEA 1N3WA 3EHTA 4PCDA 5EQ9A 4IR8A 1XOCA 5TP9A 3KSJA 2P0SA 2Q88A 2RKMA 4PETA 1R9LA 4GBVA 3RUMA 4F2QA 2Q2CA 2Q89A 1LCTA 5A5XB 3TTMA 1P1UA 5HBCA 5K2YA 3K1NA 4XXUA 3SEXA 4QFOA 1MM6A 1M5FA 3CFLA 5ITPA 1NH8A 3FBPA 5A5LA 3FZVA 2ZNUA 4FORA 1Z7NE 2F7BA 2LAOA 1LGBC 1YXIA 1TT1A 5I56A 3H3GA 2HZLA 3KJ7A 4U1OA 1FPDA 4NQ8A 2P3NA 3K02A 4F1YA 1LSTA 2DVCA 4ONYA 2Y7RA 2KQZA 4YKPA 4ELPA 2WYPA 4YKKA 1CB6A 3OOAA 4M1VA 2OWTA 4N6PA 5TPAA 1FQCA 4H5FA 4L17A 1IXCA 3S2VA 5I58B 3IO4A 3TYHA 3KEIA 1Y1ZA 3RTFB 3V83A 2DE2A 4DE8A 3QXMA 3HV1A 4G4PA 4QF9A 2RINA 3GLBA 4DI4B 4UABA 3VE1B 4ELOA 2RC8A 1R9QA 3HN0A 4GL0A 4NF0A 1DK4A 2CZLA 4MAGA 1JETA 1QUKA 2CZIA 1POTA 1AL3A 4GX3A 3RPWA 1SPIA 3C4MA 5IZ1A 1FQEA 4IY5A 1IMFA 4IB2A 3FASA 4G77A 1R6ZA 4LA9A 3QIMA 4LUBA 1BIYA 4I3YA 2CEXA 3DLNA 1IXIA 5FHOA 2ANJA 2V93A 3E9XA 3T1BA 1N76A 1Q35A 5IAIA 1YYZA 4HTGA 4GD5A 2V3UA 1ELJA 2ZZVA 3Q27A 4YB5A 3RGYA 4LVQA 3E78A 2GH9A 3RPLB 3FXUA 2Z22A 4QFKA 4ND9A 4RK2A 4PAKA 5F24A 3K1MA 3KG2A 3RN8A 4NTLA 4KCCA 2FIXA 3FVNA 5L9SA 1GVCA 5IM2A 1B2HA 1OLAA 1POY1 3UK4A 1Y4CA 3FATA 1A99A 2PCRA 2XXPA 3FV2A 3KBZA 4MJOA 4PFUA 1M5EA 2WBBA 4YMAA 2I48A 4NF8A 1FPFA 1AH5A 1RYXA 4NN3A 4PE5B 4ELRA 4G68A 3U93A 4I40A 3IX1A 4FIMA 4RXLA 1B52A 1SBPA 4WEPA 4QXDA 3TMGA 5KZTA 2Z23A 2O69A 1ZTYA 2UYFA 2F78A 2QPQA 3C9HA 2WKYA 1AOVA 4MCOA 4QSCA 4OWDA 3TQWA 3MAMA 1B5IA 3LR1A 3U8QA 1MQHA 1UTBA 3RLFE 1N7XA 5JTYB 1YZ0A 2I4CA 1A54A 5AA2D 3PV0E 2HFBA 3H6VA 1NUXA 4FECA 1EU8A 3A3UA 1MH3A 2CEYA 4R9FA 5EYFA 2XXQA 2QRYA 1LEVA 1UTHA 1Y9UA 4QFNA 2VGQA 1CE2A 4MF3A 1ANFA 3MQ9A 3DM0A 4GWXA 4KI0E 2B4MA 1A7LA 4JWXA 4DDDA 4PP0A 3VLUA 3RY3A 3JV9A 4X48A 4I8CA 2XXKA 1H3DA 1RDYA 4F1UA 3K0VA 4WXJA 3ZSFA 1UIVA 1EYKA 2Z8EA 1EYIA 5TPAB 1LBVA 1JVYA 4H65A 2ONRA 3PPPA 3I5OA 2VP1A 2A5SA 2I4BA 4C1TA 3B8BA 5ET7A 2FIEA 3MVZA 3FXQA 4JVIA 3MP8A 1URGA 2XWVA 2X7QA 1D9VA 4PF8A 5EYGA 1GV8A 4G68B 4WEDA 3BBRA 4P47A 1FQBA 3VLWA 2ZYNA 2ESNA 1YTVA 4F3PA 4Q5TA 2FNCA 3SEWA 2B4LA 3KBRA 1MY0A 5I2KA 1H44A 1IEJA 4G8MA 2Y7PA 2Y7KA 1XT8A 1FTLA 3E13X 3C34A 1IIWA 1NV7A 3PUZE 3TCGA 4YKJA 4P3LA 1OQGA 2DXYA 4P8BA 3FD3A 4H1XA 4NG7A 5H8SA 1B0LA 3QMFA 2XX9A 3I6VA 4OHNA 1AMFA 3O2AA 1FBEA 4OVRA 1B7ZA 1AIVA 4G68C 2PFYA 4JWYA 4EQ9A 5EQAA 3TDJA 5H8FB 2OK2A 3RTWB 2UVHA 5H8FA 2YPNA 4R6HA 3E79A 3SDFA 2NWJA 3HO7A 3VXCA 2OZZA 3OO7A 1H76A 3O6HA 2DYXA 2B3BA 3K6WA 3GBAA 3H06B 5CI5A 1P1QA 4KHZE 4HE1A 2FHYA 3TKDA 2DVZA 3KN8A 3PTYA 4RK9A 2ABHA 3G3KA 4JVCA 3H6WA 3OSRA 3PMWA 4IO2A 4NF5B 1BP5A 1DPEA 1IZ1A 2D21A 4LP2B 2AIXA 1GR2A 1NV5A 3EN3A 1NI9A 2V25A 1IMEA 1O64A 4OVSA 4PAFA 1NV3A 3EF7A 2HAVA 3IJXB 1MY4A 4ZEBA 1RKMA 1LAFE 3ZS6A 4JWOA 2ZZXA 1ZJLA 4OERA 4OFJA 1PBPA 1SVXB 4N6KA 2F7AA 2FBPA 2VOZA 2REJA 3ILUB 4R6KA 3I3VA 2R6GE 2DP8A 3LSXA 1NFTA 4MBPA 5DEXB 5AA2A 3FJGA 4X8RA 2R71A 1MY1A 3OSQA 2V4CA 4JVDA 1PC3A 3UORA 2QL3A 5KDTB 4N15A 1EH3A 2O7UA 3T9UA 2VD3A 3MBPA 3CSBA 4IGRA 4ZEKA 3O97A 1XC1A 3QSLA 5FHMA 1NNTA 2UVIA 1MPDA 3H03A 4OYVA 1OVTA 1K9YA 3D4CA 1T0KA 1MDP1 4E0XA 4H45A 4I3EA 2D3IA 1A8EA 2QS4A 1IITA 5H8HB 1RDXA 4EF2A 4JSOA 5HPQA 3IO6A 3OEMA 2Y5LA 5CC2A 2Y7IA 2O1LA 3C36A 5DT6A 2A5TB 5H8NB 5ELVA 1MRPA 2UVJA 3GXAA 1LBBA 4QBAA 4QFLA 3ZKLA 1JEVA 1MDQA 2ZYKA 3U72A 4NMYA 4QRZA 4PAIA 4H0WA 3G7WA 4U22A 5I7IA 4NF6A 5F1QA 3IOUA 1LAGE 5EQ7A 4ZDMA 2DSFA 3W15C 1LFIA 5DEXA 4C0RA 1CNQA 3D1RA 3G3FA 5BUUA 3THIA 3LV0A 2G29A 2GFEA 4H8JA 3B6WA 1FJ9A 3RT8A 3VFJA 4F19A 4TLMB 2V3QA 4NHBA 3T66A 4POXA 1YCJA 1DOTA 4KQPA 2F6PA 4LATA 1WODA 1US5A 2F7CA 3L6HA 3TTKA 1B5JA 3PMVA 4OANA 4PF6A 1P1OA 2H9BA 4OXVA 4THIA 4U4XA 1QUIA 3KOTA 1LFHA 3OENA 3T0JA 4PFIA 2HEUA 3MC2A 4EXLA 4MX6A 2H98A 4H8IA 5M2VA 2CZHA 4YB7A 3H6TA 1SW4A 2QFLA 1EZOA 4RNSA 1J1NA 4Z0IA 4GQOA 1MXZA 2CZKA 4MEVA 4IO3A 4BDLA 4ZEDA 5I59A 2NOOA 2M8CA 2DWHA 1KZ8A 3MP6A 2QVRA 4GVOA 1B58A 1FTJA 1QJMA 1Y3QA 1QVSA 4YAHX 4OVTA 5I58A 2CMOA 4PGPA 2PMSA 1BTJA 1IXGA 3OMBA 3TTNA 2THIA 2OWZA 3OD7A 2ZNTA 5I2KB 2XA5A 4GWUA 1UIUA 2PX1A 4G8NA 3QUJA 4NF4B 5J1DA 1MQDA 3O6GA 1ZKBA 3HFUA 3L6GA 1S7YA 1ZMGA 2GRVA 1INPA 3TQLA 3S9NC 3G3HA 3TPAA 3GZGA 4PBQA 2Y5KA 4F2OA 1N84A 3SERA 3O29A 1NH7A 3MWBA 2O51A 2AYSA 3FJMA 4P1EA 1FPEA 2AL5A 4YMBA 1II5A 1HSEA 5DVFA 2I0BA 3KJTA 2I3WA 3VV5A 3M3KA 1XI6A 3FUZA 2G93A 4PBHA 1URDA 1B40A 1MPBA 3LUZA 3O6IA 2Q2AA 3N94A 2F8DA 3RPLA 4F3BA 3IAZA 3PUYE 2VPOA 3MVWA 1JEUA 2VT5A 2DQVA 4RA1A 3HSTA 4OFLA 3C32A 5I56B 4OVJA 4H46A 4PFTA 4U23A 1WDNA 1FW0A 3CSGA 1Y4TA 4GWZA 5DTBA 2WBDA 3PUVE 4BDRA 3RYDA 5IKBA 3R7XA 4GWOA 4NF5A 3HHGA 2B65A 4GX4A 4AB6A 1B51A 1MXVA 3OO6A 1M5DA 1ZBMA 2A5TA 5H8NA 4BLAA 1IQ7A 3OO9A 1JNFA 4DCYA 4H67A 5I57B 3ODBA 1EZ9A 1FQDA 5FTIA 1I69A 2RC9A 4GFRA 3WAEA 1D4NA 1NV1A 1XVYA 2ONKE 2HQ0A 4R72A 3N5LA 3FXBA 4NF8B 1MG1A 1JP4A 3K2DA 3KN3A 1FPGA 3SKPA 1SW2A 3K6VA 3ISPA 1SD3A 4ZZAA 4PTKA 2H25A 3LUYA 4BDMA 3USDA 4NEDA 4G8HA 2F35A 1Q1KA 1SI1A 1SDXA 4IO5A 1FBGA 2V84A 5CMBA 3RQTA 5B70A 3UN6A 2GQ1A 2JJKA 1SQYA 1LFGA
chains in the Genus database with same CATH topology
1LLSA 2O6AA 4UACA 4X1BA 2NWJA 1MPCA 4YZZA 3K6UA 3HO7A 3FVGA 2QMXA 4ESXA 3BKIB 4KPTA 2OBGA 3VXCA 3R26A 4I1DA 4Q30B 5BWJA 5IAIA 2OZZA 3OO7A 3JZJA 3HHFA 5L9MA 1H76A 3PD8A 1B1XA 1B7HA 1MXXA 2DYXA 2O7IA 1B3HA 1B32A 2B3BA 3CG1A 3GBBA 4GIZA 2P2AA 2HCAA 5AA4A 1B3GA 2I49A 1NL5A 1YAEA 3PMXA 4RPOA 3K6WA 5CMMA 3GBAA 2W7YA 3H06B 3PU5A 1FCKA 4LONB 5CI5A 4Z7EA 3TFLA 2ALUA 3IJOB 4LQ5A 1P1QA 5FHNA 1NNPA 1VR5A 2QS3A 2Z8FA 2ZMBA 3H4ZA 4I62A 1FQFA 1N3WA 4JDFA 4KHZE 4LZ7A 3S4UA 3EHTA 3CG3A 5CBSA 4EQ7A 4F31B 4XKPA 3TKDA 5KCJA 2DVZA 1XOCA 3KN8A 4RK9A 2ABHA 3G3KA 5L8DA 2REGA 1DTGA 3IB0A 3N26A 3MUQA 3H6WA 3KSJA 2P0SA 2Q88A 3OSRA 3PMWA 2NVUB 4IO2A 3V8XB 4E0WA 4OETA 1OLCA 2NXOA 4X9TA 3ECRA 4NF5B 2RKMA 5B7DA 4XKQA 4PETA 1BP5A 3W9WA 1DPEA 1IZ1A 2D21A 1NNKA 4LP2B 1R9LA 2AIXA 1GR2A 3PD9A 3RUMA 3EN3A 3FVKA 1PB8A 4I9DA 1L5TA 4R75A 4LQ2A 1TFDA 3FVOA 2V25A 5FTHA 4F2QA 3O6HA 3DP6A 2Q2CA 4U4SA 4P0IA 1IUDA 1O64A 3QAXA 1N0TA 2Q89A 1NMUA 1LCTA 5A5XB 3TTMA 1O63A 4F22A 1P1UA 2HAVA 3EF7A 4PFYA 5HBCA 2F6GA 4X1DA 5K2YA 5KCJB 3K1NA 4HS7A 3IJXB 4O3BA 1MY4A 4LZ8A 4NF4A 4XIGQ 4XXUA 4ZEBA 1RKMA 1LAFE 3ZS6A 3SEXA 3S9MC 4JWOA 3T9VA 1ZU0A 3IOWA 4DXCA 4QFOA 1ZJLA 1MM6A 4OFJA 4OERA 2V3TA 1M5FA 3MPKA 4NF6B 1PBPA 3TTLA 4EUOA 3DP8A 1SVXB 3CFLA 4G2ZA 4ESWA 4QSEA 5ITPA 1TXFA 1NH8A 3IB2A 1JQFA 5AA4B 2F7AA 3FZVA 2ZNUA 3KZGA 4EXKA 2VOZA 3LBSA 2REJA 4KD5A 2PVUA 5AA2B 4ECFA 4DLDA 3G3GA 4F3GA 3ILUB 4FORA 1LBCA 4RYAA 4R6KA 1Z7NE 3I3VA 4F3SA 2R6GE 2F7BA 4RJZA 2LAOA 2DP8A 4QFPA 1LGBC 3QK6A 2XD2A 3CVGA 3LSXA 1NFTA 2XD3A 3K1PA 4MBPA 1B1HA 3FXRA 5DEXB 5JTYA 1O7TA 3S9LC 1SI0A 1UTBB 5AA2A 1TT1A 3FJGA 5I56A 1US4A 4ZEIA 3U94A 1XVXA 3H3GA 2R71A 2HZLA 2I58A 3KJ7A 1OIBA 1PBQA 2OLBA 1MY1A 2F34A 1VFEA 3OSQA 4FEDA 4U1OA 1PC3A 3UORA 2QL3A 3K02A 5KDTB 2P1SA 4F1YA 4QHQA 3VVEA 1EH3A 2O7UA 3T9UA 1LSTA 2DVCA 2VD3A 2Y7RA 4ONYA 4YKPA 4ELPA 3Q28A 3MBPA 4YKKA 1CB6A 3CSBA 4IGRA 3OOAA 3PPNA 4M1VA 3O28A 1XC1A 2OWTA 3CFZA 3H6UA 3O97A 3JYRA 4N6PA 4ZE8A 5TPAA 1PB7A 1FQCA 3QSLA 4H5FA 4L17A 4O3CA 3VVFA 1IXCA 5FHMA 2I0CA 1NNTA 3S2VA 5I58B 3ILTB 2UVIA 5AE4A 1MPDA 3IO4A 3H03A 4R6YA 5CRYA 1MQIA 4N13A 4OYVA 3TYHA 1OVTA 2UVGA 3RT6B 1N7WA 3D4CA 1T0KA 1MDP1 4E0XA 1QW0A 2D3IA 3KEIA 1A8EA 2QS4A 1IITA 1Y1ZA 5H8HB 3VXBA 3RTFB 4IY6A 4EF2A 5F7VA 4JSOA 5HPQA 2QS2A 3IO6A 3V83A 1DMBA 4OMBA 3R6UA 2DWAA 2DE2A 5K2XA 3OEMA 4DXUA 3M3FA 1NKXA 2HAUA 5CC2A 4KR5A 4DE8A 5I84A 2Y7IA 3QXMA 2O1LA 3C36A 5H8HA 3HV1A 4NWCA 3BFTA 4GXSB 5DT6A 2A5TB 5H8NB 5ICTA 2ZNSA 1DTZA 3KOSA 4G4PA 3N6TA 4QF9A 5ELVA 5TU0A 1MRPA 3FIRA 4MFIA 2RINA 4R2BA 3GLBA 2XXTA 3FGSA 4MLVA 3Q29A 5I57A 1S9TA 2GHAA 2UVJA 3TUSA 1MXUA 3IL1B 3GXAA 1LBBA 4XKRA 3LSWA 3VE1B 4ELOA 2RC8A 4EQBA 1R9QA 3HN0A 2XXWA 4GL0A 1XHYA 2DOJA 4QFLA 2CZLA 2Y84A 3ZKLA 1JEVA 3FV1A 1MDQA 3OXNA 1JETA 3V89B 2ZYKA 2YLNA 3U72A 1QUKA 3VDFA 3Q26A 3FJ7A 4NMYA 4QRZA 3CR9A 3OEKA 4H0WA 2DWIA 1I6QA 3T93B 3UP9A 3G7WA 1M5BA 4U22A 1POTA 2DE3A 3B6QA 2B3FA 1AL3A 1SW1A 3RPWA 4NF6A 5F1QA 3IOUA 1QKBA 3C4MA 3K01A 1LAGE 3KN7A 4NWDA 4ZDMA 2DSFA 4KFQA 3W15C 1FQEA 4IY5A 1LFIA 4FE8A 1YPNA 5DEXA 4HW8A 1B3FA 1MH4A 4KCDA 4R9GA 4C0RA 3S9EA 4IB2A 3G3FA 5BUUA 3FASA 4G77A 1LAXA 3W9VA 5DVIA 3ONMA 1R6ZA 3LSFB 4LA9A 5EHMA 3MW0A 3G3IA 4ZS9A 4ZEKA 4GXAA 2PT1A 3THIA 1HSLA 4R2FA 2G29A 4DZ1A 2PYYA 2GFEA 3QIMA 4LUBA 2XXYA 1BIYA 4H8JA 3B6WA 3CFXA 4JBZA 2I3VA 4R73A 5CBRA 3CRBA 3RT8A 1M5CA 3VFJA 4F19A 3K00A 3DLNA 1Y3NA 5ICQA 1MXWA 4F39A 1IXIA 1TWYA 3PPQA 4TLMB 4YB6A 4JSDA 5FHOA 2ANJA 2V93A 3E9XA 2V3QA 2Z8DA 3PPRA 1N3XA 4XTCQ 1N76A 1H43A 3LSLA 1YCJA 1BKAA 4POXA 3T66A 1DOTA 4FATA 1Q35A 4KQPA 2F6PA 4LATA 1US5A 1WODA 2F7CA 1UQWA 3PPOA 4GD5A 2V3UA 4HTGA 4ZECA 3C35A 3L6HA 1ELJA 1B5JA 3PMVA 2DXRA 4KYEA 3TTKA 4QSDA 3B7DA 3Q27A 3B6TA 4YB5A 3RGYA 4OQOA 4LVQA 1P1OA 2H9BA 2ZYOA 4OXVA 5ISUA 1SYIA 2GH9A 4THIA 2NUVA 1QKAA 2OWSA 1QUIA 2XXXA 3FXUA 2Z22A 3KOTA 3OENA 4U4XA 1LFHA 1LCFA 4QFKA 2R9JA 4ND9A 2HEUA 3MC2A 3OELA 4RK2A 2OJTA 2XX7A 3D4GA 3HPIA 3OO8A 3E4RA 3KFMA 3IK6B 3K1MA 1B0HA 3IB1A 3KG2A 4EXLA 3RN8A 4P11A 3BFUA 3O66A 2H98A 4GL8A 4P0GA 5CMKA 4NTLA 4H8IA 4IGTA 1B5HA 4KCCA 5M2VA 1JW5A 1EZPA 3FVNA 5AA1A 1SYHA 4YB7A 3H6TA 1SW4A 5L9SA 1GVCA 1EZOA 4RNSA 2XHDA 1B2HA 1A8FA 1B4HA 1J1NA 1OLAA 1POY1 5ITOA 4Z0IA 3UK4A 1B6HA 1P1WA 4GQOA 2GHBA 4AQ4A 1OVBA 1Y4CA 1MXZA 2UXAA 1A99A 3FATA 2XXPA 3C31A 3FV2A 4IO3A 1TFAA 4BDLA 3AXFA 4ZEDA 4PFUA 3QUFA 1M5EA 5EHSA 1FTOA 2NOOA 4YMAA 5I59A 2XX8A 2I48A 2M8CA 4NF8A 3T96B 1AH5A 1NNFA 3EQ1A 2DWHA 1RYXA 2F5XA 2O68A 3IOVA 3K6XA 1FTMA 4BDOA 2E1SA 4KYDA 3MP6A 1B9JA 4PE5B 1VE4A 4FEBA 4ELRA 1B7UA 3CIJA 1R1NA 2XXRA 4G68A 3M8UA 4NE4A 4FJPA 4GVOA 3U93A 1B58A 2QS1A 1D3KA 3IX1A 4FIMA 2RC7A 4RXLA 4EDPA 1B52A 4F18A 1FTJA 1QJMA 1SBPA 2H4IA 1Y3QA 3M3LA 3UIFA 3WAFA 1QVSA 4YAHX 3U8QA 4WEPA 5I58A 2CMOA 2ZYMA 3TODA 2PMSA 1BTJA 4JB7A 4UA8A 1B46A 3KSXA 1IXGA 3OMBA 3TMGA 1OQHA 3TTNA 3UA8A 2THIA 2UYEA 3PUWE 5KZTA 2I6EA 2Z23A 4KYSA 3OD7A 2O69A 5JK4A 1ZTYA 2ZNTA 2F97A 5I2KB 2UYFA 4F1VA 1FTKA 1A55A 2F78A 4U21A 3TTRA 3TEPA 1UIUA 1USYH 2QPQA 4Q0CA 3C9HA 2PX1A 1MS7A 2WKYA 4G8NA 4C1UA 1AOVA 4QSCA 3QUJA 4NF4B 4OWDA 5J1DA 4ZEFA 1MQDA 4OFOA 4GF8A 2QMWA 3O6GA 3MAMA 3TQWA 1B5IA 3LR1A 2YJPA 1KWHA 1ZKBA 3C33A 3SETA 1ATGA 1MQHA 3L6GA 2XXIA 1S7YA 1UTBA 1ZMGA 2GRVA 4IO6A 1HSJA 1N7XA 5JTYB 3RLFE 3O9PA 5A5XA 5HM4B 2I4CA 1A54A 1ZIUA 3TQLA 5AA2D 3S9NC 3PV0E 2HFBA 3G3HA 3H6VA 4DXBA 3TPAA 3GZGA 1Y20A 1MQJA 4FECA 4F2OA 1H45A 1N84A 1EU8A 1IXHA 1NH7A 3MWBA 1XS5A 3O29A 2HXWA 2O51A 2AYSA 1D9YA 1MH3A 3A3UA 4OZ9A 4R9FA 4YICA 5EYFA 5DVJA 3SESA 2XXQA 3FJMA 2BJJX 4PQJA 2QRYA 2AL5A 1UTHA 1Y9UA 3MVYA 3T22A 4YMBA 1II5A 4QFNA 4EF1A 3U1OA 2VGQA 1PDAA 1CE2A 4MF3A 5I2NA 3MZ1A 4TQUQ 5AA3A 1ANFA 2HZKA 3DM0A 1HSEA 1QULA 3MQ9A 1Z7ME 4KI0E 1P1NA 1P99A 1PB9A 1A7LA 4IO4A 5DVFA 1GTKA 1N04A 4JWXA 1VFDA 4DDDA 5I59B 2I0BA 3MP1A 2DE4A 3KJTA 3QYTA 2I3WA 3VV5A 3M3KA 4PP0A 3VLUA 3FUZA 4BDNA 1B4ZA 2G93A 4RPNA 3ZKKA 3RY3A 3JV9A 4X48A 4I8CA 2XXUA 1RYOA 1URDA 1B40A 1BLFA 1MPBA 1H3DA 3KGCA 3O6IA 4F1UA 4OESA 3IORA 3K0VA 4LZ5A 1UIVA 2D5WA 3E3KA 4WXJA 3ZSFA 1QUJA 2Z8EA 2Q2AA 3N94A 1GGGA 2F8DA 5TPAB 1S50A 4ZE9A 1JVYA 2VD2A 3A09A 5CM6A 4F3BA 2RCAA 4H65A 1B3LA 2ONRA 3PPPA 3IAZA 3PUYE 3I5OA 1I6BA 4F29A 3MVWA 2VP1A 2A5SA 2I4BA 1JEUA 1URSA 2ZXTA 4JXIA 4TOZA 4C1TA 3TAJA 2FYIA 2RCBA 2O1MA 3MVZA 3F11A 2DQVA 3FXQA 3MZ9A 4RA1A 4RY1A 1WVJA 3HSTA 1USYE 4OFLA 3MP8A 3C32A 1URGA 4OEVA 4Q8RA 5I56B 2X7QA 2PBWA 4HCYA 4OVJA 1VSOA 1D9VA 4N07A 4PFTA 3DP4A 1WDNA 1FW0A 3CSGA 4H5GA 4U23A 4GRKA 3TELA 4PFWA 1GV8A 4POWA 1B3EA 1Y4TA 4OENA 3HCQA 5DTBA 4XKNA 4G68B 5H8QB 1ZLQA 3PUVE 3A3CA 4U2RA 4WEDA 1I6AA 4H6DA 4BDRA 5H8QA 3R7XA 5IKBA 1LB8A 4GWOA 4NF5A 3BBRA 3HHGA 2IEEA 4IO7A 1FQBA 3VLWA 2B65A 2H5YA 2ZYNA 4AB6A 1B51A 1B05A 2ESNA 3U92A 1YTVA 1Y3PA 4F3PA 2PT2A 1MXVA 2FNCA 4Q5TA 5DYHA 5TP9B 2QJEA 3MPLA 2Y7WA 3OO6A 1M5DA 1ZBMA 1JW1A 3SEUA 3LC8A 1A40A 1Y1MA 3SEWA 2A5TA 5H8NA 3H7MA 4BLAA 5I2NB 1IQ7A 3K4UA 1JNFA 3KBRA 3OO9A 4DCYA 1MY0A 1MM7A 4H67A 4HCWA 1JVXA 2XXHA 1MY3A 4ELQA 3N6UA 3IOTA 2DWJA 5I57B 4WKMA 1H44A 1IEJA 5I2KA 3ODBA 1DPPA 4G8MA 1EZ9A 2IA4A 2QSXA 2Y7PA 3SERA 1FQDA 5FTIA 3EHSA 1FQAA 2Y7KA 1XT8A 1FTLA 1I69A 3E13X 2RC9A 4GFRA 3WAEA 1D4NA 3C34A 2Q8JA 4ISUA 1IIWA 1MY2A 1OMPA 3PUZE 3PUXE 3TCGA 3Q25A 4DCXA 4FAJA 4ZZEA 3TCFA 3G3JA 3P7IA 4YKIA 5TP9A 3V5AA 4DIGA 1XVYA 3VVDA 3TZAA 1LB9A 2ONKE 4YKJA 4MLQA 2E0SA 5KDTA 2HQ0A 1LAHE 3CI8A 1UTHB 4R72A 3T9XB 2KLFA 2X26A 3N5LA 1OQGA 3UGWA 2DXYA 4NF8B 3T9HB 3TCHA 2H99A 4GLIA 1MG1A 4R74A 1JW4A 4OTEA 1SW5A 2VHAA 3DELB 3FD3A 3K2DA 3KN3A 4H1XA 4O3AA 3SEYA 5H8SA 1B0LA 2XX9A 4BDQA 3I6VA 4OHNA 2FA7A 3SKPA 1AMFA 1SW2A 2Q9TA 3K6VA 3O2AA 4OEUA 5L9OA 3MJNA 5CMCA 4YU0A 1SD3A 2AL4A 2O84X 4ZZAA 2H25A 3LUYA 4BDMA 3USDA 1PEBA 4NEDA 2OCUA 1MXYA 4G8HA 2F35A 1B7ZA 4AB5A 3RNNA 4G68C 1AIVA 2XXVA 3MZBA 1Q1KA 3VLVA 1SI1A 1SDXA 3EHUA 4JWYA 3PGFA 4IO5A 4EQ9A 3IR1A 2V84A 5CMBA 4TLLB 5LOMA 3SEVA 3TDJA 1F9BA 5H8FB 1DSNA 2DS9A 2F36A 3RQTA 3EPEA 2OK2A 3RTWB 1MQGA 2UVHA 3MVXA 3UN6A 4K3FA 5B70A 5H8FA 2RF1A 4GOTA 2X7PA 2YPNA 5JEIA 4M4GA 4U1ZA 4R6HA 1SQYA 4MH5A 1LFGA 2ONSA 3SDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LLS A;  2O6A A;  4UAC A;  4X1B A;  2NWJ A;  1MPC A;  4YZZ A;  3K6U A;  3HO7 A;  3FVG A;  2QMX A;  4ESX A;  3BKI B;  4KPT A;  2OBG A;  3VXC A;  3R26 A;  4I1D A;  4Q30 B;  5BWJ A;  5IAI A;  2OZZ A;  3OO7 A;  3JZJ A;  3HHF A;  5L9M A;  1H76 A;  3PD8 A;  1B1X A;  1B7H A;  1MXX A;  2DYX A;  2O7I A;  1B3H A;  1B32 A;  2B3B A;  3CG1 A;  3GBB A;  4GIZ A;  2P2A A;  2HCA A;  5AA4 A;  1B3G A;  2I49 A;  1NL5 A;  1YAE A;  3PMX A;  4RPO A;  3K6W A;  5CMM A;  3GBA A;  2W7Y A;  3H06 B;  3PU5 A;  1FCK A;  4LON B;  5CI5 A;  4Z7E A;  3TFL A;  2ALU A;  3IJO B;  4LQ5 A;  1P1Q A;  5FHN A;  1NNP A;  1VR5 A;  2QS3 A;  2Z8F A;  2ZMB A;  3H4Z A;  4I62 A;  1FQF A;  1N3W A;  4JDF A;  4KHZ E;  4LZ7 A;  3S4U A;  3EHT A;  3CG3 A;  5CBS A;  4EQ7 A;  4F31 B;  4XKP A;  3TKD A;  5KCJ A;  2DVZ A;  1XOC A;  3KN8 A;  4RK9 A;  2ABH A;  3G3K A;  5L8D A;  2REG A;  1DTG A;  3IB0 A;  3N26 A;  3MUQ A;  3H6W A;  3KSJ A;  2P0S A;  2Q88 A;  3OSR A;  3PMW A;  2NVU B;  4IO2 A;  3V8X B;  4E0W A;  4OET A;  1OLC A;  2NXO A;  4X9T A;  3ECR A;  4NF5 B;  2RKM A;  5B7D A;  4XKQ A;  4PET A;  1BP5 A;  3W9W A;  1DPE A;  1IZ1 A;  2D21 A;  1NNK A;  4LP2 B;  1R9L A;  2AIX A;  1GR2 A;  3PD9 A;  3RUM A;  3EN3 A;  3FVK A;  1PB8 A;  4I9D A;  1L5T A;  4R75 A;  4LQ2 A;  1TFD A;  3FVO A;  2V25 A;  5FTH A;  4F2Q A;  3O6H A;  3DP6 A;  2Q2C A;  4U4S A;  4P0I A;  1IUD A;  1O64 A;  3QAX A;  1N0T A;  2Q89 A;  1NMU A;  1LCT A;  5A5X B;  3TTM A;  1O63 A;  4F22 A;  1P1U A;  2HAV A;  3EF7 A;  4PFY A;  5HBC A;  2F6G A;  4X1D A;  5K2Y A;  5KCJ B;  3K1N A;  4HS7 A;  3IJX B;  4O3B A;  1MY4 A;  4LZ8 A;  4NF4 A;  4XIG Q;  4XXU A;  4ZEB A;  1RKM A;  1LAF E;  3ZS6 A;  3SEX A;  3S9M C;  4JWO A;  3T9V A;  1ZU0 A;  3IOW A;  4DXC A;  4QFO A;  1ZJL A;  1MM6 A;  4OFJ A;  4OER A;  2V3T A;  1M5F A;  3MPK A;  4NF6 B;  1PBP A;  3TTL A;  4EUO A;  3DP8 A;  1SVX B;  3CFL A;  4G2Z A;  4ESW A;  4QSE A;  5ITP A;  1TXF A;  1NH8 A;  3IB2 A;  1JQF A;  5AA4 B;  2F7A A;  3FZV A;  2ZNU A;  3KZG A;  4EXK A;  2VOZ A;  3LBS A;  2REJ A;  4KD5 A;  2PVU A;  5AA2 B;  4ECF A;  4DLD A;  3G3G A;  4F3G A;  3ILU B;  4FOR A;  1LBC A;  4RYA A;  4R6K A;  1Z7N E;  3I3V A;  4F3S A;  2R6G E;  2F7B A;  4RJZ A;  2LAO A;  2DP8 A;  4QFP A;  1LGB C;  3QK6 A;  2XD2 A;  3CVG A;  3LSX A;  1NFT A;  2XD3 A;  3K1P A;  4MBP A;  1B1H A;  3FXR A;  5DEX B;  5JTY A;  1O7T A;  3S9L C;  1SI0 A;  1UTB B;  5AA2 A;  1TT1 A;  3FJG A;  5I56 A;  1US4 A;  4ZEI A;  3U94 A;  1XVX A;  3H3G A;  2R71 A;  2HZL A;  2I58 A;  3KJ7 A;  1OIB A;  1PBQ A;  2OLB A;  1MY1 A;  2F34 A;  1VFE A;  3OSQ A;  4FED A;  4U1O A;  1PC3 A;  3UOR A;  2QL3 A;  3K02 A;  5KDT B;  2P1S A;  4F1Y A;  4QHQ A;  3VVE A;  1EH3 A;  2O7U A;  3T9U A;  1LST A;  2DVC A;  2VD3 A;  2Y7R A;  4ONY A;  4YKP A;  4ELP A;  3Q28 A;  3MBP A;  4YKK A;  1CB6 A;  3CSB A;  4IGR A;  3OOA A;  3PPN A;  4M1V A;  3O28 A;  1XC1 A;  2OWT A;  3CFZ A;  3H6U A;  3O97 A;  3JYR A;  4N6P A;  4ZE8 A;  5TPA A;  1PB7 A;  1FQC A;  3QSL A;  4H5F A;  4L17 A;  4O3C A;  3VVF A;  1IXC A;  5FHM A;  2I0C A;  1NNT A;  3S2V A;  5I58 B;  3ILT B;  2UVI A;  5AE4 A;  1MPD A;  3IO4 A;  3H03 A;  4R6Y A;  5CRY A;  1MQI A;  4N13 A;  4OYV A;  3TYH A;  1OVT A;  2UVG A;  3RT6 B;  1N7W A;  3D4C A;  1T0K A;  1MDP 1;  4E0X A;  1QW0 A;  2D3I A;  3KEI A;  1A8E A;  2QS4 A;  1IIT A;  1Y1Z A;  5H8H B;  3VXB A;  3RTF B;  4IY6 A;  4EF2 A;  5F7V A;  4JSO A;  5HPQ A;  2QS2 A;  3IO6 A;  3V83 A;  1DMB A;  4OMB A;  3R6U A;  2DWA A;  2DE2 A;  5K2X A;  3OEM A;  4DXU A;  3M3F A;  1NKX A;  2HAU A;  5CC2 A;  4KR5 A;  4DE8 A;  5I84 A;  2Y7I A;  3QXM A;  2O1L A;  3C36 A;  5H8H A;  3HV1 A;  4NWC A;  3BFT A;  4GXS B;  5DT6 A;  2A5T B;  5H8N B;  5ICT A;  2ZNS A;  1DTZ A;  3KOS A;  4G4P A;  3N6T A;  4QF9 A;  5ELV A;  5TU0 A;  1MRP A;  3FIR A;  4MFI A;  2RIN A;  4R2B A;  3GLB A;  2XXT A;  3FGS A;  4MLV A;  3Q29 A;  5I57 A;  1S9T A;  2GHA A;  2UVJ A;  3TUS A;  1MXU A;  3IL1 B;  3GXA A;  1LBB A;  4XKR A;  3LSW A;  3VE1 B;  4ELO A;  2RC8 A;  4EQB A;  1R9Q A;  3HN0 A;  2XXW A;  4GL0 A;  1XHY A;  2DOJ A;  4QFL A;  2CZL A;  2Y84 A;  3ZKL A;  1JEV A;  3FV1 A;  1MDQ A;  3OXN A;  1JET A;  3V89 B;  2ZYK A;  2YLN A;  3U72 A;  1QUK A;  3VDF A;  3Q26 A;  3FJ7 A;  4NMY A;  4QRZ A;  3CR9 A;  3OEK A;  4H0W A;  2DWI A;  1I6Q A;  3T93 B;  3UP9 A;  3G7W A;  1M5B A;  4U22 A;  1POT A;  2DE3 A;  3B6Q A;  2B3F A;  1AL3 A;  1SW1 A;  3RPW A;  4NF6 A;  5F1Q A;  3IOU A;  1QKB A;  3C4M A;  3K01 A;  1LAG E;  3KN7 A;  4NWD A;  4ZDM A;  2DSF A;  4KFQ A;  3W15 C;  1FQE A;  4IY5 A;  1LFI A;  4FE8 A;  1YPN A;  5DEX A;  4HW8 A;  1B3F A;  1MH4 A;  4KCD A;  4R9G A;  4C0R A;  3S9E A;  4IB2 A;  3G3F A;  5BUU A;  3FAS A;  4G77 A;  1LAX A;  3W9V A;  5DVI A;  3ONM A;  1R6Z A;  3LSF B;  4LA9 A;  5EHM A;  3MW0 A;  3G3I A;  4ZS9 A;  4ZEK A;  4GXA A;  2PT1 A;  3THI A;  1HSL A;  4R2F A;  2G29 A;  4DZ1 A;  2PYY A;  2GFE A;  3QIM A;  4LUB A;  2XXY A;  1BIY A;  4H8J A;  3B6W A;  3CFX A;  4JBZ A;  2I3V A;  4R73 A;  5CBR A;  3CRB A;  3RT8 A;  1M5C A;  3VFJ A;  4F19 A;  3K00 A;  3DLN A;  1Y3N A;  5ICQ A;  1MXW A;  4F39 A;  1IXI A;  1TWY A;  3PPQ A;  4TLM B;  4YB6 A;  4JSD A;  5FHO A;  2ANJ A;  2V93 A;  3E9X A;  2V3Q A;  2Z8D A;  3PPR A;  1N3X A;  4XTC Q;  1N76 A;  1H43 A;  3LSL A;  1YCJ A;  1BKA A;  4POX A;  3T66 A;  1DOT A;  4FAT A;  1Q35 A;  4KQP A;  2F6P A;  4LAT A;  1US5 A;  1WOD A;  2F7C A;  1UQW A;  3PPO A;  4GD5 A;  2V3U A;  4HTG A;  4ZEC A;  3C35 A;  3L6H A;  1ELJ A;  1B5J A;  3PMV A;  2DXR A;  4KYE A;  3TTK A;  4QSD A;  3B7D A;  3Q27 A;  3B6T A;  4YB5 A;  3RGY A;  4OQO A;  4LVQ A;  1P1O A;  2H9B A;  2ZYO A;  4OXV A;  5ISU A;  1SYI A;  2GH9 A;  4THI A;  2NUV A;  1QKA A;  2OWS A;  1QUI A;  2XXX A;  3FXU A;  2Z22 A;  3KOT A;  3OEN A;  4U4X A;  1LFH A;  1LCF A;  4QFK A;  2R9J A;  4ND9 A;  2HEU A;  3MC2 A;  3OEL A;  4RK2 A;  2OJT A;  2XX7 A;  3D4G A;  3HPI A;  3OO8 A;  3E4R A;  3KFM A;  3IK6 B;  3K1M A;  1B0H A;  3IB1 A;  3KG2 A;  4EXL A;  3RN8 A;  4P11 A;  3BFU A;  3O66 A;  2H98 A;  4GL8 A;  4P0G A;  5CMK A;  4NTL A;  4H8I A;  4IGT A;  1B5H A;  4KCC A;  5M2V A;  1JW5 A;  1EZP A;  3FVN A;  5AA1 A;  1SYH A;  4YB7 A;  3H6T A;  1SW4 A;  5L9S A;  1GVC A;  1EZO A;  4RNS A;  2XHD A;  1B2H A;  1A8F A;  1B4H A;  1J1N A;  1OLA A;  1POY 1;  5ITO A;  4Z0I A;  3UK4 A;  1B6H A;  1P1W A;  4GQO A;  2GHB A;  4AQ4 A;  1OVB A;  1Y4C A;  1MXZ A;  2UXA A;  1A99 A;  3FAT A;  2XXP A;  3C31 A;  3FV2 A;  4IO3 A;  1TFA A;  4BDL A;  3AXF A;  4ZED A;  4PFU A;  3QUF A;  1M5E A;  5EHS A;  1FTO A;  2NOO A;  4YMA A;  5I59 A;  2XX8 A;  2I48 A;  2M8C A;  4NF8 A;  3T96 B;  1AH5 A;  1NNF A;  3EQ1 A;  2DWH A;  1RYX A;  2F5X A;  2O68 A;  3IOV A;  3K6X A;  1FTM A;  4BDO A;  2E1S A;  4KYD A;  3MP6 A;  1B9J A;  4PE5 B;  1VE4 A;  4FEB A;  4ELR A;  1B7U A;  3CIJ A;  1R1N A;  2XXR A;  4G68 A;  3M8U A;  4NE4 A;  4FJP A;  4GVO A;  3U93 A;  1B58 A;  2QS1 A;  1D3K A;  3IX1 A;  4FIM A;  2RC7 A;  4RXL A;  4EDP A;  1B52 A;  4F18 A;  1FTJ A;  1QJM A;  1SBP A;  2H4I A;  1Y3Q A;  3M3L A;  3UIF A;  3WAF A;  1QVS A;  4YAH X;  3U8Q A;  4WEP A;  5I58 A;  2CMO A;  2ZYM A;  3TOD A;  2PMS A;  1BTJ A;  4JB7 A;  4UA8 A;  1B46 A;  3KSX A;  1IXG A;  3OMB A;  3TMG A;  1OQH A;  3TTN A;  3UA8 A;  2THI A;  2UYE A;  3PUW E;  5KZT A;  2I6E A;  2Z23 A;  4KYS A;  3OD7 A;  2O69 A;  5JK4 A;  1ZTY A;  2ZNT A;  2F97 A;  5I2K B;  2UYF A;  4F1V A;  1FTK A;  1A55 A;  2F78 A;  4U21 A;  3TTR A;  3TEP A;  1UIU A;  1USY H;  2QPQ A;  4Q0C A;  3C9H A;  2PX1 A;  1MS7 A;  2WKY A;  4G8N A;  4C1U A;  1AOV A;  4QSC A;  3QUJ A;  4NF4 B;  4OWD A;  5J1D A;  4ZEF A;  1MQD A;  4OFO A;  4GF8 A;  2QMW A;  3O6G A;  3MAM A;  3TQW A;  1B5I A;  3LR1 A;  2YJP A;  1KWH A;  1ZKB A;  3C33 A;  3SET A;  1ATG A;  1MQH A;  3L6G A;  2XXI A;  1S7Y A;  1UTB A;  1ZMG A;  2GRV A;  4IO6 A;  1HSJ A;  1N7X A;  5JTY B;  3RLF E;  3O9P A;  5A5X A;  5HM4 B;  2I4C A;  1A54 A;  1ZIU A;  3TQL A;  5AA2 D;  3S9N C;  3PV0 E;  2HFB A;  3G3H A;  3H6V A;  4DXB A;  3TPA A;  3GZG A;  1Y20 A;  1MQJ A;  4FEC A;  4F2O A;  1H45 A;  1N84 A;  1EU8 A;  1IXH A;  1NH7 A;  3MWB A;  1XS5 A;  3O29 A;  2HXW A;  2O51 A;  2AYS A;  1D9Y A;  1MH3 A;  3A3U A;  4OZ9 A;  4R9F A;  4YIC A;  5EYF A;  5DVJ A;  3SES A;  2XXQ A;  3FJM A;  2BJJ X;  4PQJ A;  2QRY A;  2AL5 A;  1UTH A;  1Y9U A;  3MVY A;  3T22 A;  4YMB A;  1II5 A;  4QFN A;  4EF1 A;  3U1O A;  2VGQ A;  1PDA A;  1CE2 A;  4MF3 A;  5I2N A;  3MZ1 A;  4TQU Q;  5AA3 A;  1ANF A;  2HZK A;  3DM0 A;  1HSE A;  1QUL A;  3MQ9 A;  1Z7M E;  4KI0 E;  1P1N A;  1P99 A;  1PB9 A;  1A7L A;  4IO4 A;  5DVF A;  1GTK A;  1N04 A;  4JWX A;  1VFD A;  4DDD A;  5I59 B;  2I0B A;  3MP1 A;  2DE4 A;  3KJT A;  3QYT A;  2I3W A;  3VV5 A;  3M3K A;  4PP0 A;  3VLU A;  3FUZ A;  4BDN A;  1B4Z A;  2G93 A;  4RPN A;  3ZKK A;  3RY3 A;  3JV9 A;  4X48 A;  4I8C A;  2XXU A;  1RYO A;  1URD A;  1B40 A;  1BLF A;  1MPB A;  1H3D A;  3KGC A;  3O6I A;  4F1U A;  4OES A;  3IOR A;  3K0V A;  4LZ5 A;  1UIV A;  2D5W A;  3E3K A;  4WXJ A;  3ZSF A;  1QUJ A;  2Z8E A;  2Q2A A;  3N94 A;  1GGG A;  2F8D A;  5TPA B;  1S50 A;  4ZE9 A;  1JVY A;  2VD2 A;  3A09 A;  5CM6 A;  4F3B A;  2RCA A;  4H65 A;  1B3L A;  2ONR A;  3PPP A;  3IAZ A;  3PUY E;  3I5O A;  1I6B A;  4F29 A;  3MVW A;  2VP1 A;  2A5S A;  2I4B A;  1JEU A;  1URS A;  2ZXT A;  4JXI A;  4TOZ A;  4C1T A;  3TAJ A;  2FYI A;  2RCB A;  2O1M A;  3MVZ A;  3F11 A;  2DQV A;  3FXQ A;  3MZ9 A;  4RA1 A;  4RY1 A;  1WVJ A;  3HST A;  1USY E;  4OFL A;  3MP8 A;  3C32 A;  1URG A;  4OEV A;  4Q8R A;  5I56 B;  2X7Q A;  2PBW A;  4HCY A;  4OVJ A;  1VSO A;  1D9V A;  4N07 A;  4PFT A;  3DP4 A;  1WDN A;  1FW0 A;  3CSG A;  4H5G A;  4U23 A;  4GRK A;  3TEL A;  4PFW A;  1GV8 A;  4POW A;  1B3E A;  1Y4T A;  4OEN A;  3HCQ A;  5DTB A;  4XKN A;  4G68 B;  5H8Q B;  1ZLQ A;  3PUV E;  3A3C A;  4U2R A;  4WED A;  1I6A A;  4H6D A;  4BDR A;  5H8Q A;  3R7X A;  5IKB A;  1LB8 A;  4GWO A;  4NF5 A;  3BBR A;  3HHG A;  2IEE A;  4IO7 A;  1FQB A;  3VLW A;  2B65 A;  2H5Y A;  2ZYN A;  4AB6 A;  1B51 A;  1B05 A;  2ESN A;  3U92 A;  1YTV A;  1Y3P A;  4F3P A;  2PT2 A;  1MXV A;  2FNC A;  4Q5T A;  5DYH A;  5TP9 B;  2QJE A;  3MPL A;  2Y7W A;  3OO6 A;  1M5D A;  1ZBM A;  1JW1 A;  3SEU A;  3LC8 A;  1A40 A;  1Y1M A;  3SEW A;  2A5T A;  5H8N A;  3H7M A;  4BLA A;  5I2N B;  1IQ7 A;  3K4U A;  1JNF A;  3KBR A;  3OO9 A;  4DCY A;  1MY0 A;  1MM7 A;  4H67 A;  4HCW A;  1JVX A;  2XXH A;  1MY3 A;  4ELQ A;  3N6U A;  3IOT A;  2DWJ A;  5I57 B;  4WKM A;  1H44 A;  1IEJ A;  5I2K A;  3ODB A;  1DPP A;  4G8M A;  1EZ9 A;  2IA4 A;  2QSX A;  2Y7P A;  3SER A;  1FQD A;  5FTI A;  3EHS A;  1FQA A;  2Y7K A;  1XT8 A;  1FTL A;  1I69 A;  3E13 X;  2RC9 A;  4GFR A;  3WAE A;  1D4N A;  3C34 A;  2Q8J A;  4ISU A;  1IIW A;  1MY2 A;  1OMP A;  3PUZ E;  3PUX E;  3TCG A;  3Q25 A;  4DCX A;  4FAJ A;  4ZZE A;  3TCF A;  3G3J A;  3P7I A;  4YKI A;  5TP9 A;  3V5A A;  4DIG A;  1XVY A;  3VVD A;  3TZA A;  1LB9 A;  2ONK E;  4YKJ A;  4MLQ A;  2E0S A;  5KDT A;  2HQ0 A;  1LAH E;  3CI8 A;  1UTH B;  4R72 A;  3T9X B;  2KLF A;  2X26 A;  3N5L A;  1OQG A;  3UGW A;  2DXY A;  4NF8 B;  3T9H B;  3TCH A;  2H99 A;  4GLI A;  1MG1 A;  4R74 A;  1JW4 A;  4OTE A;  1SW5 A;  2VHA A;  3DEL B;  3FD3 A;  3K2D A;  3KN3 A;  4H1X A;  4O3A A;  3SEY A;  5H8S A;  1B0L A;  2XX9 A;  4BDQ A;  3I6V A;  4OHN A;  2FA7 A;  3SKP A;  1AMF A;  1SW2 A;  2Q9T A;  3K6V A;  3O2A A;  4OEU A;  5L9O A;  3MJN A;  5CMC A;  4YU0 A;  1SD3 A;  2AL4 A;  2O84 X;  4ZZA A;  2H25 A;  3LUY A;  4BDM A;  3USD A;  1PEB A;  4NED A;  2OCU A;  1MXY A;  4G8H A;  2F35 A;  1B7Z A;  4AB5 A;  3RNN A;  4G68 C;  1AIV A;  2XXV A;  3MZB A;  1Q1K A;  3VLV A;  1SI1 A;  1SDX A;  3EHU A;  4JWY A;  3PGF A;  4IO5 A;  4EQ9 A;  3IR1 A;  2V84 A;  5CMB A;  4TLL B;  5LOM A;  3SEV A;  3TDJ A;  1F9B A;  5H8F B;  1DSN A;  2DS9 A;  2F36 A;  3RQT A;  3EPE A;  2OK2 A;  3RTW B;  1MQG A;  2UVH A;  3MVX A;  3UN6 A;  4K3F A;  5B70 A;  5H8F A;  2RF1 A;  4GOT A;  2X7P A;  2YPN A;  5JEI A;  4M4G A;  4U1Z A;  4R6H A;  1SQY A;  4MH5 A;  1LFG A;  2ONS A;  3SDF A; 
#chains in the Genus database with same CATH topology
 4YZZ A;  3FVG A;  2QMX A;  4NGU A;  4KPT A;  4Q30 B;  2BJI A;  3HHF A;  4O8M A;  1B1X A;  1MXX A;  1B3H A;  1B32 A;  2P2A A;  3PMX A;  4G61 A;  5I57 A;  3PU5 A;  2W7Y A;  4Z7E A;  3TFL A;  4LQ5 A;  5FHN A;  2QS3 A;  4I62 A;  3S4U A;  1FQF A;  4P9K A;  4LZ7 A;  3BIH A;  5CBS A;  4EQ7 A;  5L8D A;  4HE2 A;  3V8X B;  4X9T A;  3ECR A;  5B7D A;  1NNK A;  1D9Q A;  1FBH A;  2PFZ A;  3FVK A;  1L5T A;  4I9D A;  3IFC A;  4LQ2 A;  3FVO A;  4U4S A;  1IUD A;  1NMU A;  1FJ6 A;  1O63 A;  4PFY A;  4X1D A;  4HS7 A;  4XIG Q;  1ZU0 A;  4DXC A;  4EUO A;  4NF6 B;  5DW8 A;  1LBZ A;  3IB2 A;  5AA4 B;  4EXK A;  5AA2 B;  4ECF A;  3G3G A;  3SZP A;  1LBC A;  4HXV A;  3QK6 A;  2XD2 A;  5JTY A;  1O7T A;  5T3J A;  1UTB B;  3S9L C;  1US4 A;  3U94 A;  1OIB A;  1FRP A;  2F34 A;  4FED A;  2HPG A;  2P1S A;  4P56 A;  3Q28 A;  3CFZ A;  3H6U A;  4N4U A;  4ZE8 A;  3VVF A;  2HHM A;  2I0C A;  5AE4 A;  5CRY A;  1MQI A;  4N13 A;  4OVP A;  1QW0 A;  3BIG A;  1FPL A;  1DMB A;  5K2X A;  2QVV A;  4DXU A;  4NX1 A;  3M3F A;  5LTC A;  1NKX A;  2HAU A;  5I84 A;  5H8H A;  3BFT A;  2ZNS A;  3N6T A;  2XWO A;  4MLV A;  1S9T A;  2GHA A;  1MXU A;  2XXW A;  1XHY A;  2Y84 A;  3FV1 A;  3V89 B;  3VDF A;  2YLN A;  3NOH A;  3Q26 A;  3FJ7 A;  3OEK A;  3T93 B;  3UP9 A;  2DE3 A;  3B6Q A;  4GBW A;  3K01 A;  3KN7 A;  4KFQ A;  4HW8 A;  4FE8 A;  1YPN A;  1MH4 A;  4KCD A;  3MST A;  1LAX A;  5DVI A;  3ONM A;  3MW0 A;  4ZS9 A;  2PT1 A;  2PYY A;  5IGA A;  2XXY A;  4R73 A;  3CFX A;  2I3V A;  3CRB A;  1Y3N A;  1MXW A;  1TWY A;  3PPR A;  4XTC Q;  1H43 A;  3A29 A;  3LSL A;  1BKA A;  5EYH A;  4FAT A;  3C35 A;  3ROJ A;  3B7D A;  4XEQ A;  2ZYO A;  1SYI A;  1QKA A;  2XXX A;  1LCF A;  3OEL A;  4GWS A;  2XX7 A;  3D4G A;  1B0H A;  3IB1 A;  3BFU A;  4GL8 A;  1FPB A;  1B5H A;  1SYH A;  1B4H A;  1OVB A;  4MNC A;  3C31 A;  1TFA A;  3AXF A;  4DI3 D;  2HXR A;  3T96 B;  1NNF A;  3EQ1 A;  2O68 A;  4KYD A;  1IMD A;  1B9J A;  2OX3 A;  4FEB A;  1B7U A;  2XXR A;  2KR0 A;  4FJP A;  4EDP A;  1D3K A;  2H4I A;  1K9Z A;  3M3L A;  3UIF A;  3WAF A;  3TOD A;  4UA8 A;  4JB7 A;  1B46 A;  4GWW A;  1OQH A;  3UA8 A;  1KA1 A;  2I6E A;  4KYS A;  5JK4 A;  3TEP A;  3TTR A;  1USY H;  4GF8 A;  2QMW A;  2YJP A;  2MKZ A;  1ATG A;  1FPK A;  1DCU A;  5HM4 B;  1NUZ A;  1MQJ A;  5IZZ A;  1H45 A;  3VXB A;  1XS5 A;  2HXW A;  1D9Y A;  4X04 A;  1G0I A;  4YIC A;  3SES A;  4PQJ A;  3U1O A;  1PDA A;  5AA3 A;  2HZK A;  1QUL A;  1Z7M E;  1P1N A;  4IO4 A;  1GTK A;  1KA0 A;  1N04 A;  1VFD A;  2DDK A;  5I3S A;  4BDN A;  1B4Z A;  1IMA A;  2XXU A;  1FPJ A;  1RYO A;  2P3V A;  4PFR A;  4OES A;  2D5W A;  1QUJ A;  1S50 A;  4MNP A;  2RCA A;  1B3L A;  4F29 A;  4JXI A;  2ZXT A;  4TOZ A;  2FYI A;  2O1M A;  3F11 A;  4RY1 A;  1WVJ A;  4MHF A;  4P1L A;  4HCY A;  1VSO A;  3TEL A;  4PFW A;  4POW A;  4AS4 A;  4OEN A;  4XKN A;  5H8Q B;  1ZLQ A;  3A3C A;  4U2R A;  4H6D A;  5H8Q A;  3CHG A;  1BK4 A;  4O7M A;  4IO7 A;  2H5Y A;  1NUW A;  3U92 A;  1Y3P A;  5DYH A;  3MPL A;  2Y7W A;  3LC8 A;  1Y1M A;  3H7M A;  5I2N B;  3K4U A;  1MM7 A;  1JVX A;  1MY3 A;  3IOT A;  2DWJ A;  4WKM A;  2Q74 A;  1FQA A;  2XWI A;  3PUX E;  3Q25 A;  4DCX A;  4FAJ A;  4ZZE A;  3TCF A;  3G3J A;  3P7I A;  4OVQ A;  4YKI A;  4DIG A;  3TZA A;  1NV0 A;  5KDT A;  1LAH E;  1UTH B;  3T9X B;  2X26 A;  3T9H B;  4GLI A;  4R74 A;  1SW5 A;  4BDQ A;  2FA7 A;  2Q9T A;  4OEU A;  5L9O A;  3MJN A;  4YU0 A;  5CMC A;  2AL4 A;  2O84 X;  1PEB A;  2OCU A;  3B50 A;  1FBF A;  3RNN A;  4FBP A;  1QGX A;  3IR1 A;  4TLL B;  5LOM A;  3SEV A;  1F9B A;  1DSN A;  3EPE A;  1MQG A;  1LBW A;  3MVX A;  2WEF A;  4K3F A;  3U65 A;  2RF1 A;  4GOT A;  4M4G A;  1LLS A;  2O6A A;  4UAC A;  4X1B A;  1MPC A;  4N17 A;  5IZ3 A;  3R26 A;  5BWJ A;  5L9M A;  1B7H A;  4MMP A;  4GIZ A;  1B3G A;  2I49 A;  1NL5 A;  4KXP A;  5CMM A;  4RPO A;  4LON B;  1FCK A;  3IJO B;  1NNP A;  1VR5 A;  2Z8F A;  3H4Z A;  4JDF A;  3CG3 A;  4XKP A;  5KCJ A;  4ZE9 A;  2REG A;  1DTG A;  3IB0 A;  3N26 A;  3MUQ A;  4O7I A;  1G0H A;  5ESY A;  2NVU B;  4E0W A;  4OET A;  1OLC A;  2NXO A;  4XKQ A;  3W9W A;  3PD9 A;  1PB8 A;  5ICT A;  4R75 A;  5FTH A;  1TFD A;  3DP6 A;  4P0I A;  3QAX A;  1N0T A;  4F22 A;  2F6G A;  5J16 A;  5KCJ B;  4O3B A;  1NV6 A;  4LZ8 A;  4NF4 A;  3S9M C;  2Q8M A;  3T9V A;  3IOW A;  4N81 A;  2V3T A;  2FVZ A;  3MPK A;  3TTL A;  1IMB A;  3DP8 A;  4G2Z A;  4ESW A;  4QSE A;  1TXF A;  1JQF A;  3KZG A;  3LBS A;  4PDD A;  4KD5 A;  1VDW A;  2PVU A;  4DLD A;  1FSA A;  4F3G A;  4RYA A;  4F3S A;  1LBY A;  4RJZ A;  4QFP A;  4PFB A;  3CVG A;  2QVU A;  2XD3 A;  3K1P A;  1B1H A;  3FXR A;  1SI0 A;  4ZEI A;  1XVX A;  2I58 A;  1PBQ A;  2OLB A;  1VFE A;  3IFA A;  4QHQ A;  3VVE A;  1RDZ A;  3PPN A;  4PE3 A;  3O28 A;  3JYR A;  1PB7 A;  4O3C A;  3ILT B;  4OA4 A;  4R6Y A;  2L5V A;  2UVG A;  3RT6 B;  1N7W A;  4IY6 A;  5F7V A;  2QS2 A;  4OMB A;  3R6U A;  2DWA A;  4N6D A;  4KR5 A;  4MIJ A;  4NWC A;  4GXS B;  1DTZ A;  1NUY A;  3KOS A;  5TU0 A;  3FIR A;  4MFI A;  4R2B A;  2XXT A;  3FGS A;  3Q29 A;  3TUS A;  3IL1 B;  4XKR A;  3LSW A;  4EQB A;  2DOJ A;  5ET5 A;  3OXN A;  1NV2 A;  3CR9 A;  4PDH A;  2DWI A;  4XF5 A;  1I6Q A;  1M5B A;  2B3F A;  1SW1 A;  1QKB A;  4NWD A;  1B3F A;  4R9G A;  3S9E A;  3W9V A;  3LSF B;  5EHM A;  3G3I A;  4GXA A;  1HSL A;  4R2F A;  4DZ1 A;  5CBR A;  4JBZ A;  1M5C A;  3K00 A;  5ICQ A;  4F39 A;  3PPQ A;  4YB6 A;  4MNI A;  4JSD A;  2Z8D A;  1N3X A;  3PPO A;  4ZEC A;  1UQW A;  2DXR A;  4KYE A;  4QSD A;  3B6T A;  4PC9 A;  4OQO A;  1FBC A;  5ISU A;  2NUV A;  2OWS A;  2XWK A;  2R9J A;  4GWY A;  2OJT A;  3HPI A;  3OO8 A;  3E4R A;  3KFM A;  3IK6 B;  2WX9 A;  5ET6 A;  4P11 A;  2WYK A;  3O66 A;  4P0G A;  5CMK A;  4IGT A;  1JW5 A;  1EZP A;  5AA1 A;  4GX6 A;  2XHD A;  1A8F A;  5ITO A;  1B6H A;  1P1W A;  2GHB A;  4AQ4 A;  2UXA A;  3QUF A;  5EHS A;  1FTO A;  5FBP A;  2XX8 A;  2F5X A;  3IOV A;  3K6X A;  1FTM A;  4BDO A;  2E1S A;  1VE4 A;  3CIJ A;  1R1N A;  3M8U A;  4NE4 A;  2QS1 A;  2RC7 A;  4F18 A;  4N8Y A;  2ZYM A;  5LDZ A;  3KSX A;  2UYE A;  3PUW E;  2F97 A;  4F1V A;  1FTK A;  1A55 A;  4U21 A;  4C1U A;  4Q0C A;  1MS7 A;  3GYY A;  4ZEF A;  4OFO A;  1KWH A;  3C33 A;  3SET A;  1IMC A;  2XXI A;  4IO6 A;  4EF1 A;  5A5X A;  4N8G A;  1HSJ A;  3O9P A;  4PGN A;  1ZIU A;  4DXB A;  1Y20 A;  4N91 A;  1IXH A;  4F31 B;  4OZ9 A;  5DVJ A;  2BJJ X;  3MVY A;  1EYJ A;  3T22 A;  5I2N A;  3MZ1 A;  4TQU Q;  5ET8 A;  1LBX A;  1P99 A;  1PB9 A;  5I59 B;  1FPI A;  3MP1 A;  2DE4 A;  3QYT A;  4RPN A;  3ZKK A;  1BLF A;  3KGC A;  3IOR A;  4LZ5 A;  3E3K A;  1GGG A;  2VD2 A;  3A09 A;  5CM6 A;  1I6B A;  3MYU A;  2ZZW A;  1URS A;  1FTA A;  2RCB A;  3MZ9 A;  1FBP A;  1USY E;  4Q8R A;  4OEV A;  2PBW A;  2F3D A;  4N07 A;  3DP4 A;  4H5G A;  4GRK A;  1B3E A;  3HCQ A;  1I6A A;  1LB8 A;  2IEE A;  1B05 A;  5I5P A;  2PT2 A;  5TP9 B;  2QJE A;  1JW1 A;  3SEU A;  4AS5 A;  1A40 A;  4HCW A;  2XXH A;  4ELQ A;  3N6U A;  1DPP A;  2IA4 A;  2QSX A;  3EHS A;  2Q8J A;  4ISU A;  3KC0 A;  1MY2 A;  1OMP A;  2VPN A;  3V5A A;  3VVD A;  3KC1 A;  4NAP A;  1LB9 A;  3EKI A;  4MLQ A;  2E0S A;  3CI8 A;  4O94 A;  2KLF A;  3UGW A;  3TCH A;  2R8T A;  2H99 A;  1JW4 A;  2VHA A;  3DEL B;  4O3A A;  1NV4 A;  3SEY A;  1Q9D A;  1DBZ A;  4LN5 A;  1MXY A;  4AB5 A;  1FBD A;  2XXV A;  3MZB A;  3VLV A;  3EHU A;  3PGF A;  4HE0 A;  2F3B A;  2DS9 A;  2F36 A;  5IZ3 B;  5JEI A;  2X7P A;  1AWB A;  4U1Z A;  4MH5 A;  4OTE A;  2ONS A;  3K6U A;  4ESX A;  3BKI B;  2OBG A;  4I1D A;  5EQ8 A;  3JZJ A;  3PD8 A;  2O7I A;  3CG1 A;  3GBB A;  5AA4 A;  2HCA A;  1YAE A;  3TAJ A;  2ALU A;  2ZMB A;  4XFE A;  1N3W A;  3EHT A;  4PCD A;  5EQ9 A;  4IR8 A;  1XOC A;  5TP9 A;  3KSJ A;  2P0S A;  2Q88 A;  2RKM A;  4PET A;  1R9L A;  4GBV A;  3RUM A;  4F2Q A;  2Q2C A;  2Q89 A;  1LCT A;  5A5X B;  3TTM A;  1P1U A;  5HBC A;  5K2Y A;  3K1N A;  4XXU A;  3SEX A;  4QFO A;  1MM6 A;  1M5F A;  3CFL A;  5ITP A;  1NH8 A;  3FBP A;  5A5L A;  3FZV A;  2ZNU A;  4FOR A;  1Z7N E;  2F7B A;  2LAO A;  1LGB C;  1YXI A;  1TT1 A;  5I56 A;  3H3G A;  2HZL A;  3KJ7 A;  4U1O A;  1FPD A;  4NQ8 A;  2P3N A;  3K02 A;  4F1Y A;  1LST A;  2DVC A;  4ONY A;  2Y7R A;  2KQZ A;  4YKP A;  4ELP A;  2WYP A;  4YKK A;  1CB6 A;  3OOA A;  4M1V A;  2OWT A;  4N6P A;  5TPA A;  1FQC A;  4H5F A;  4L17 A;  1IXC A;  3S2V A;  5I58 B;  3IO4 A;  3TYH A;  3KEI A;  1Y1Z A;  3RTF B;  3V83 A;  2DE2 A;  4DE8 A;  3QXM A;  3HV1 A;  4G4P A;  4QF9 A;  2RIN A;  3GLB A;  4DI4 B;  4UAB A;  3VE1 B;  4ELO A;  2RC8 A;  1R9Q A;  3HN0 A;  4GL0 A;  4NF0 A;  1DK4 A;  2CZL A;  4MAG A;  1JET A;  1QUK A;  2CZI A;  1POT A;  1AL3 A;  4GX3 A;  3RPW A;  1SPI A;  3C4M A;  5IZ1 A;  1FQE A;  4IY5 A;  1IMF A;  4IB2 A;  3FAS A;  4G77 A;  1R6Z A;  4LA9 A;  3QIM A;  4LUB A;  1BIY A;  4I3Y A;  2CEX A;  3DLN A;  1IXI A;  5FHO A;  2ANJ A;  2V93 A;  3E9X A;  3T1B A;  1N76 A;  1Q35 A;  5IAI A;  1YYZ A;  4HTG A;  4GD5 A;  2V3U A;  1ELJ A;  2ZZV A;  3Q27 A;  4YB5 A;  3RGY A;  4LVQ A;  3E78 A;  2GH9 A;  3RPL B;  3FXU A;  2Z22 A;  4QFK A;  4ND9 A;  4RK2 A;  4PAK A;  5F24 A;  3K1M A;  3KG2 A;  3RN8 A;  4NTL A;  4KCC A;  2FIX A;  3FVN A;  5L9S A;  1GVC A;  5IM2 A;  1B2H A;  1OLA A;  1POY 1;  3UK4 A;  1Y4C A;  3FAT A;  1A99 A;  2PCR A;  2XXP A;  3FV2 A;  3KBZ A;  4MJO A;  4PFU A;  1M5E A;  2WBB A;  4YMA A;  2I48 A;  4NF8 A;  1FPF A;  1AH5 A;  1RYX A;  4NN3 A;  4PE5 B;  4ELR A;  4G68 A;  3U93 A;  4I40 A;  3IX1 A;  4FIM A;  4RXL A;  1B52 A;  1SBP A;  4WEP A;  4QXD A;  3TMG A;  5KZT A;  2Z23 A;  2O69 A;  1ZTY A;  2UYF A;  2F78 A;  2QPQ A;  3C9H A;  2WKY A;  1AOV A;  4MCO A;  4QSC A;  4OWD A;  3TQW A;  3MAM A;  1B5I A;  3LR1 A;  3U8Q A;  1MQH A;  1UTB A;  3RLF E;  1N7X A;  5JTY B;  1YZ0 A;  2I4C A;  1A54 A;  5AA2 D;  3PV0 E;  2HFB A;  3H6V A;  1NUX A;  4FEC A;  1EU8 A;  3A3U A;  1MH3 A;  2CEY A;  4R9F A;  5EYF A;  2XXQ A;  2QRY A;  1LEV A;  1UTH A;  1Y9U A;  4QFN A;  2VGQ A;  1CE2 A;  4MF3 A;  1ANF A;  3MQ9 A;  3DM0 A;  4GWX A;  4KI0 E;  2B4M A;  1A7L A;  4JWX A;  4DDD A;  4PP0 A;  3VLU A;  3RY3 A;  3JV9 A;  4X48 A;  4I8C A;  2XXK A;  1H3D A;  1RDY A;  4F1U A;  3K0V A;  4WXJ A;  3ZSF A;  1UIV A;  1EYK A;  2Z8E A;  1EYI A;  5TPA B;  1LBV A;  1JVY A;  4H65 A;  2ONR A;  3PPP A;  3I5O A;  2VP1 A;  2A5S A;  2I4B A;  4C1T A;  3B8B A;  5ET7 A;  2FIE A;  3MVZ A;  3FXQ A;  4JVI A;  3MP8 A;  1URG A;  2XWV A;  2X7Q A;  1D9V A;  4PF8 A;  5EYG A;  1GV8 A;  4G68 B;  4WED A;  3BBR A;  4P47 A;  1FQB A;  3VLW A;  2ZYN A;  2ESN A;  1YTV A;  4F3P A;  4Q5T A;  2FNC A;  3SEW A;  2B4L A;  3KBR A;  1MY0 A;  5I2K A;  1H44 A;  1IEJ A;  4G8M A;  2Y7P A;  2Y7K A;  1XT8 A;  1FTL A;  3E13 X;  3C34 A;  1IIW A;  1NV7 A;  3PUZ E;  3TCG A;  4YKJ A;  4P3L A;  1OQG A;  2DXY A;  4P8B A;  3FD3 A;  4H1X A;  4NG7 A;  5H8S A;  1B0L A;  3QMF A;  2XX9 A;  3I6V A;  4OHN A;  1AMF A;  3O2A A;  1FBE A;  4OVR A;  1B7Z A;  1AIV A;  4G68 C;  2PFY A;  4JWY A;  4EQ9 A;  5EQA A;  3TDJ A;  5H8F B;  2OK2 A;  3RTW B;  2UVH A;  5H8F A;  2YPN A;  4R6H A;  3E79 A;  3SDF A;  2NWJ A;  3HO7 A;  3VXC A;  2OZZ A;  3OO7 A;  1H76 A;  3O6H A;  2DYX A;  2B3B A;  3K6W A;  3GBA A;  3H06 B;  5CI5 A;  1P1Q A;  4KHZ E;  4HE1 A;  2FHY A;  3TKD A;  2DVZ A;  3KN8 A;  3PTY A;  4RK9 A;  2ABH A;  3G3K A;  4JVC A;  3H6W A;  3OSR A;  3PMW A;  4IO2 A;  4NF5 B;  1BP5 A;  1DPE A;  1IZ1 A;  2D21 A;  4LP2 B;  2AIX A;  1GR2 A;  1NV5 A;  3EN3 A;  1NI9 A;  2V25 A;  1IME A;  1O64 A;  4OVS A;  4PAF A;  1NV3 A;  3EF7 A;  2HAV A;  3IJX B;  1MY4 A;  4ZEB A;  1RKM A;  1LAF E;  3ZS6 A;  4JWO A;  2ZZX A;  1ZJL A;  4OER A;  4OFJ A;  1PBP A;  1SVX B;  4N6K A;  2F7A A;  2FBP A;  2VOZ A;  2REJ A;  3ILU B;  4R6K A;  3I3V A;  2R6G E;  2DP8 A;  3LSX A;  1NFT A;  4MBP A;  5DEX B;  5AA2 A;  3FJG A;  4X8R A;  2R71 A;  1MY1 A;  3OSQ A;  2V4C A;  4JVD A;  1PC3 A;  3UOR A;  2QL3 A;  5KDT B;  4N15 A;  1EH3 A;  2O7U A;  3T9U A;  2VD3 A;  3MBP A;  3CSB A;  4IGR A;  4ZEK A;  3O97 A;  1XC1 A;  3QSL A;  5FHM A;  1NNT A;  2UVI A;  1MPD A;  3H03 A;  4OYV A;  1OVT A;  1K9Y A;  3D4C A;  1T0K A;  1MDP 1;  4E0X A;  4H45 A;  4I3E A;  2D3I A;  1A8E A;  2QS4 A;  1IIT A;  5H8H B;  1RDX A;  4EF2 A;  4JSO A;  5HPQ A;  3IO6 A;  3OEM A;  2Y5L A;  5CC2 A;  2Y7I A;  2O1L A;  3C36 A;  5DT6 A;  2A5T B;  5H8N B;  5ELV A;  1MRP A;  2UVJ A;  3GXA A;  1LBB A;  4QBA A;  4QFL A;  3ZKL A;  1JEV A;  1MDQ A;  2ZYK A;  3U72 A;  4NMY A;  4QRZ A;  4PAI A;  4H0W A;  3G7W A;  4U22 A;  5I7I A;  4NF6 A;  5F1Q A;  3IOU A;  1LAG E;  5EQ7 A;  4ZDM A;  2DSF A;  3W15 C;  1LFI A;  5DEX A;  4C0R A;  1CNQ A;  3D1R A;  3G3F A;  5BUU A;  3THI A;  3LV0 A;  2G29 A;  2GFE A;  4H8J A;  3B6W A;  1FJ9 A;  3RT8 A;  3VFJ A;  4F19 A;  4TLM B;  2V3Q A;  4NHB A;  3T66 A;  4POX A;  1YCJ A;  1DOT A;  4KQP A;  2F6P A;  4LAT A;  1WOD A;  1US5 A;  2F7C A;  3L6H A;  3TTK A;  1B5J A;  3PMV A;  4OAN A;  4PF6 A;  1P1O A;  2H9B A;  4OXV A;  4THI A;  4U4X A;  1QUI A;  3KOT A;  1LFH A;  3OEN A;  3T0J A;  4PFI A;  2HEU A;  3MC2 A;  4EXL A;  4MX6 A;  2H98 A;  4H8I A;  5M2V A;  2CZH A;  4YB7 A;  3H6T A;  1SW4 A;  2QFL A;  1EZO A;  4RNS A;  1J1N A;  4Z0I A;  4GQO A;  1MXZ A;  2CZK A;  4MEV A;  4IO3 A;  4BDL A;  4ZED A;  5I59 A;  2NOO A;  2M8C A;  2DWH A;  1KZ8 A;  3MP6 A;  2QVR A;  4GVO A;  1B58 A;  1FTJ A;  1QJM A;  1Y3Q A;  1QVS A;  4YAH X;  4OVT A;  5I58 A;  2CMO A;  4PGP A;  2PMS A;  1BTJ A;  1IXG A;  3OMB A;  3TTN A;  2THI A;  2OWZ A;  3OD7 A;  2ZNT A;  5I2K B;  2XA5 A;  4GWU A;  1UIU A;  2PX1 A;  4G8N A;  3QUJ A;  4NF4 B;  5J1D A;  1MQD A;  3O6G A;  1ZKB A;  3HFU A;  3L6G A;  1S7Y A;  1ZMG A;  2GRV A;  1INP A;  3TQL A;  3S9N C;  3G3H A;  3TPA A;  3GZG A;  4PBQ A;  2Y5K A;  4F2O A;  1N84 A;  3SER A;  3O29 A;  1NH7 A;  3MWB A;  2O51 A;  2AYS A;  3FJM A;  4P1E A;  1FPE A;  2AL5 A;  4YMB A;  1II5 A;  1HSE A;  5DVF A;  2I0B A;  3KJT A;  2I3W A;  3VV5 A;  3M3K A;  1XI6 A;  3FUZ A;  2G93 A;  4PBH A;  1URD A;  1B40 A;  1MPB A;  3LUZ A;  3O6I A;  2Q2A A;  3N94 A;  2F8D A;  3RPL A;  4F3B A;  3IAZ A;  3PUY E;  2VPO A;  3MVW A;  1JEU A;  2VT5 A;  2DQV A;  4RA1 A;  3HST A;  4OFL A;  3C32 A;  5I56 B;  4OVJ A;  4H46 A;  4PFT A;  4U23 A;  1WDN A;  1FW0 A;  3CSG A;  1Y4T A;  4GWZ A;  5DTB A;  2WBD A;  3PUV E;  4BDR A;  3RYD A;  5IKB A;  3R7X A;  4GWO A;  4NF5 A;  3HHG A;  2B65 A;  4GX4 A;  4AB6 A;  1B51 A;  1MXV A;  3OO6 A;  1M5D A;  1ZBM A;  2A5T A;  5H8N A;  4BLA A;  1IQ7 A;  3OO9 A;  1JNF A;  4DCY A;  4H67 A;  5I57 B;  3ODB A;  1EZ9 A;  1FQD A;  5FTI A;  1I69 A;  2RC9 A;  4GFR A;  3WAE A;  1D4N A;  1NV1 A;  1XVY A;  2ONK E;  2HQ0 A;  4R72 A;  3N5L A;  3FXB A;  4NF8 B;  1MG1 A;  1JP4 A;  3K2D A;  3KN3 A;  1FPG A;  3SKP A;  1SW2 A;  3K6V A;  3ISP A;  1SD3 A;  4ZZA A;  4PTK A;  2H25 A;  3LUY A;  4BDM A;  3USD A;  4NED A;  4G8H A;  2F35 A;  1Q1K A;  1SI1 A;  1SDX A;  4IO5 A;  1FBG A;  2V84 A;  5CMB A;  3RQT A;  5B70 A;  3UN6 A;  2GQ1 A;  2JJK A;  1SQY A;  1LFG A; 
#chains in the Genus database with same CATH homology
 1LLS A;  2O6A A;  4UAC A;  4X1B A;  2NWJ A;  1MPC A;  4YZZ A;  3K6U A;  3HO7 A;  3FVG A;  2QMX A;  4ESX A;  3BKI B;  4KPT A;  2OBG A;  3VXC A;  3R26 A;  4I1D A;  4Q30 B;  5BWJ A;  5IAI A;  2OZZ A;  3OO7 A;  3JZJ A;  3HHF A;  5L9M A;  1H76 A;  3PD8 A;  1B1X A;  1B7H A;  1MXX A;  2DYX A;  2O7I A;  1B3H A;  1B32 A;  2B3B A;  3CG1 A;  3GBB A;  4GIZ A;  2P2A A;  2HCA A;  5AA4 A;  1B3G A;  2I49 A;  1NL5 A;  1YAE A;  3PMX A;  4RPO A;  3K6W A;  5CMM A;  3GBA A;  2W7Y A;  3H06 B;  3PU5 A;  1FCK A;  4LON B;  5CI5 A;  4Z7E A;  3TFL A;  2ALU A;  3IJO B;  4LQ5 A;  1P1Q A;  5FHN A;  1NNP A;  1VR5 A;  2QS3 A;  2Z8F A;  2ZMB A;  3H4Z A;  4I62 A;  1FQF A;  1N3W A;  4JDF A;  4KHZ E;  4LZ7 A;  3S4U A;  3EHT A;  3CG3 A;  5CBS A;  4EQ7 A;  4F31 B;  4XKP A;  3TKD A;  5KCJ A;  2DVZ A;  1XOC A;  3KN8 A;  4RK9 A;  2ABH A;  3G3K A;  5L8D A;  2REG A;  1DTG A;  3IB0 A;  3N26 A;  3MUQ A;  3H6W A;  3KSJ A;  2P0S A;  2Q88 A;  3OSR A;  3PMW A;  2NVU B;  4IO2 A;  3V8X B;  4E0W A;  4OET A;  1OLC A;  2NXO A;  4X9T A;  3ECR A;  4NF5 B;  2RKM A;  5B7D A;  4XKQ A;  4PET A;  1BP5 A;  3W9W A;  1DPE A;  1IZ1 A;  2D21 A;  1NNK A;  4LP2 B;  1R9L A;  2AIX A;  1GR2 A;  3PD9 A;  3RUM A;  3EN3 A;  3FVK A;  1PB8 A;  4I9D A;  1L5T A;  4R75 A;  4LQ2 A;  1TFD A;  3FVO A;  2V25 A;  5FTH A;  4F2Q A;  3O6H A;  3DP6 A;  2Q2C A;  4U4S A;  4P0I A;  1IUD A;  1O64 A;  3QAX A;  1N0T A;  2Q89 A;  1NMU A;  1LCT A;  5A5X B;  3TTM A;  1O63 A;  4F22 A;  1P1U A;  2HAV A;  3EF7 A;  4PFY A;  5HBC A;  2F6G A;  4X1D A;  5K2Y A;  5KCJ B;  3K1N A;  4HS7 A;  3IJX B;  4O3B A;  1MY4 A;  4LZ8 A;  4NF4 A;  4XIG Q;  4XXU A;  4ZEB A;  1RKM A;  1LAF E;  3ZS6 A;  3SEX A;  3S9M C;  4JWO A;  3T9V A;  1ZU0 A;  3IOW A;  4DXC A;  4QFO A;  1ZJL A;  1MM6 A;  4OFJ A;  4OER A;  2V3T A;  1M5F A;  3MPK A;  4NF6 B;  1PBP A;  3TTL A;  4EUO A;  3DP8 A;  1SVX B;  3CFL A;  4G2Z A;  4ESW A;  4QSE A;  5ITP A;  1TXF A;  1NH8 A;  3IB2 A;  1JQF A;  5AA4 B;  2F7A A;  3FZV A;  2ZNU A;  3KZG A;  4EXK A;  2VOZ A;  3LBS A;  2REJ A;  4KD5 A;  2PVU A;  5AA2 B;  4ECF A;  4DLD A;  3G3G A;  4F3G A;  3ILU B;  4FOR A;  1LBC A;  4RYA A;  4R6K A;  1Z7N E;  3I3V A;  4F3S A;  2R6G E;  2F7B A;  4RJZ A;  2LAO A;  2DP8 A;  4QFP A;  1LGB C;  3QK6 A;  2XD2 A;  3CVG A;  3LSX A;  1NFT A;  2XD3 A;  3K1P A;  4MBP A;  1B1H A;  3FXR A;  5DEX B;  5JTY A;  1O7T A;  3S9L C;  1SI0 A;  1UTB B;  5AA2 A;  1TT1 A;  3FJG A;  5I56 A;  1US4 A;  4ZEI A;  3U94 A;  1XVX A;  3H3G A;  2R71 A;  2HZL A;  2I58 A;  3KJ7 A;  1OIB A;  1PBQ A;  2OLB A;  1MY1 A;  2F34 A;  1VFE A;  3OSQ A;  4FED A;  4U1O A;  1PC3 A;  3UOR A;  2QL3 A;  3K02 A;  5KDT B;  2P1S A;  4F1Y A;  4QHQ A;  3VVE A;  1EH3 A;  2O7U A;  3T9U A;  1LST A;  2DVC A;  2VD3 A;  2Y7R A;  4ONY A;  4YKP A;  4ELP A;  3Q28 A;  3MBP A;  4YKK A;  1CB6 A;  3CSB A;  4IGR A;  3OOA A;  3PPN A;  4M1V A;  3O28 A;  1XC1 A;  2OWT A;  3CFZ A;  3H6U A;  3O97 A;  3JYR A;  4N6P A;  4ZE8 A;  5TPA A;  1PB7 A;  1FQC A;  3QSL A;  4H5F A;  4L17 A;  4O3C A;  3VVF A;  1IXC A;  5FHM A;  2I0C A;  1NNT A;  3S2V A;  5I58 B;  3ILT B;  2UVI A;  5AE4 A;  1MPD A;  3IO4 A;  3H03 A;  4R6Y A;  5CRY A;  1MQI A;  4N13 A;  4OYV A;  3TYH A;  1OVT A;  2UVG A;  3RT6 B;  1N7W A;  3D4C A;  1T0K A;  1MDP 1;  4E0X A;  1QW0 A;  2D3I A;  3KEI A;  1A8E A;  2QS4 A;  1IIT A;  1Y1Z A;  5H8H B;  3VXB A;  3RTF B;  4IY6 A;  4EF2 A;  5F7V A;  4JSO A;  5HPQ A;  2QS2 A;  3IO6 A;  3V83 A;  1DMB A;  4OMB A;  3R6U A;  2DWA A;  2DE2 A;  5K2X A;  3OEM A;  4DXU A;  3M3F A;  1NKX A;  2HAU A;  5CC2 A;  4KR5 A;  4DE8 A;  5I84 A;  2Y7I A;  3QXM A;  2O1L A;  3C36 A;  5H8H A;  3HV1 A;  4NWC A;  3BFT A;  4GXS B;  5DT6 A;  2A5T B;  5H8N B;  5ICT A;  2ZNS A;  1DTZ A;  3KOS A;  4G4P A;  3N6T A;  4QF9 A;  5ELV A;  5TU0 A;  1MRP A;  3FIR A;  4MFI A;  2RIN A;  4R2B A;  3GLB A;  2XXT A;  3FGS A;  4MLV A;  3Q29 A;  5I57 A;  1S9T A;  2GHA A;  2UVJ A;  3TUS A;  1MXU A;  3IL1 B;  3GXA A;  1LBB A;  4XKR A;  3LSW A;  3VE1 B;  4ELO A;  2RC8 A;  4EQB A;  1R9Q A;  3HN0 A;  2XXW A;  4GL0 A;  1XHY A;  2DOJ A;  4QFL A;  2CZL A;  2Y84 A;  3ZKL A;  1JEV A;  3FV1 A;  1MDQ A;  3OXN A;  1JET A;  3V89 B;  2ZYK A;  2YLN A;  3U72 A;  1QUK A;  3VDF A;  3Q26 A;  3FJ7 A;  4NMY A;  4QRZ A;  3CR9 A;  3OEK A;  4H0W A;  2DWI A;  1I6Q A;  3T93 B;  3UP9 A;  3G7W A;  1M5B A;  4U22 A;  1POT A;  2DE3 A;  3B6Q A;  2B3F A;  1AL3 A;  1SW1 A;  3RPW A;  4NF6 A;  5F1Q A;  3IOU A;  1QKB A;  3C4M A;  3K01 A;  1LAG E;  3KN7 A;  4NWD A;  4ZDM A;  2DSF A;  4KFQ A;  3W15 C;  1FQE A;  4IY5 A;  1LFI A;  4FE8 A;  1YPN A;  5DEX A;  4HW8 A;  1B3F A;  1MH4 A;  4KCD A;  4R9G A;  4C0R A;  3S9E A;  4IB2 A;  3G3F A;  5BUU A;  3FAS A;  4G77 A;  1LAX A;  3W9V A;  5DVI A;  3ONM A;  1R6Z A;  3LSF B;  4LA9 A;  5EHM A;  3MW0 A;  3G3I A;  4ZS9 A;  4ZEK A;  4GXA A;  2PT1 A;  3THI A;  1HSL A;  4R2F A;  2G29 A;  4DZ1 A;  2PYY A;  2GFE A;  3QIM A;  4LUB A;  2XXY A;  1BIY A;  4H8J A;  3B6W A;  3CFX A;  4JBZ A;  2I3V A;  4R73 A;  5CBR A;  3CRB A;  3RT8 A;  1M5C A;  3VFJ A;  4F19 A;  3K00 A;  3DLN A;  1Y3N A;  5ICQ A;  1MXW A;  4F39 A;  1IXI A;  1TWY A;  3PPQ A;  4TLM B;  4YB6 A;  4JSD A;  5FHO A;  2ANJ A;  2V93 A;  3E9X A;  2V3Q A;  2Z8D A;  3PPR A;  1N3X A;  4XTC Q;  1N76 A;  1H43 A;  3LSL A;  1YCJ A;  1BKA A;  4POX A;  3T66 A;  1DOT A;  4FAT A;  1Q35 A;  4KQP A;  2F6P A;  4LAT A;  1US5 A;  1WOD A;  2F7C A;  1UQW A;  3PPO A;  4GD5 A;  2V3U A;  4HTG A;  4ZEC A;  3C35 A;  3L6H A;  1ELJ A;  1B5J A;  3PMV A;  2DXR A;  4KYE A;  3TTK A;  4QSD A;  3B7D A;  3Q27 A;  3B6T A;  4YB5 A;  3RGY A;  4OQO A;  4LVQ A;  1P1O A;  2H9B A;  2ZYO A;  4OXV A;  5ISU A;  1SYI A;  2GH9 A;  4THI A;  2NUV A;  1QKA A;  2OWS A;  1QUI A;  2XXX A;  3FXU A;  2Z22 A;  3KOT A;  3OEN A;  4U4X A;  1LFH A;  1LCF A;  4QFK A;  2R9J A;  4ND9 A;  2HEU A;  3MC2 A;  3OEL A;  4RK2 A;  2OJT A;  2XX7 A;  3D4G A;  3HPI A;  3OO8 A;  3E4R A;  3KFM A;  3IK6 B;  3K1M A;  1B0H A;  3IB1 A;  3KG2 A;  4EXL A;  3RN8 A;  4P11 A;  3BFU A;  3O66 A;  2H98 A;  4GL8 A;  4P0G A;  5CMK A;  4NTL A;  4H8I A;  4IGT A;  1B5H A;  4KCC A;  5M2V A;  1JW5 A;  1EZP A;  3FVN A;  5AA1 A;  1SYH A;  4YB7 A;  3H6T A;  1SW4 A;  5L9S A;  1GVC A;  1EZO A;  4RNS A;  2XHD A;  1B2H A;  1A8F A;  1B4H A;  1J1N A;  1OLA A;  1POY 1;  5ITO A;  4Z0I A;  3UK4 A;  1B6H A;  1P1W A;  4GQO A;  2GHB A;  4AQ4 A;  1OVB A;  1Y4C A;  1MXZ A;  2UXA A;  1A99 A;  3FAT A;  2XXP A;  3C31 A;  3FV2 A;  4IO3 A;  1TFA A;  4BDL A;  3AXF A;  4ZED A;  4PFU A;  3QUF A;  1M5E A;  5EHS A;  1FTO A;  2NOO A;  4YMA A;  5I59 A;  2XX8 A;  2I48 A;  2M8C A;  4NF8 A;  3T96 B;  1AH5 A;  1NNF A;  3EQ1 A;  2DWH A;  1RYX A;  2F5X A;  2O68 A;  3IOV A;  3K6X A;  1FTM A;  4BDO A;  2E1S A;  4KYD A;  3MP6 A;  1B9J A;  4PE5 B;  1VE4 A;  4FEB A;  4ELR A;  1B7U A;  3CIJ A;  1R1N A;  2XXR A;  4G68 A;  3M8U A;  4NE4 A;  4FJP A;  4GVO A;  3U93 A;  1B58 A;  2QS1 A;  1D3K A;  3IX1 A;  4FIM A;  2RC7 A;  4RXL A;  4EDP A;  1B52 A;  4F18 A;  1FTJ A;  1QJM A;  1SBP A;  2H4I A;  1Y3Q A;  3M3L A;  3UIF A;  3WAF A;  1QVS A;  4YAH X;  3U8Q A;  4WEP A;  5I58 A;  2CMO A;  2ZYM A;  3TOD A;  2PMS A;  1BTJ A;  4JB7 A;  4UA8 A;  1B46 A;  3KSX A;  1IXG A;  3OMB A;  3TMG A;  1OQH A;  3TTN A;  3UA8 A;  2THI A;  2UYE A;  3PUW E;  5KZT A;  2I6E A;  2Z23 A;  4KYS A;  3OD7 A;  2O69 A;  5JK4 A;  1ZTY A;  2ZNT A;  2F97 A;  5I2K B;  2UYF A;  4F1V A;  1FTK A;  1A55 A;  2F78 A;  4U21 A;  3TTR A;  3TEP A;  1UIU A;  1USY H;  2QPQ A;  4Q0C A;  3C9H A;  2PX1 A;  1MS7 A;  2WKY A;  4G8N A;  4C1U A;  1AOV A;  4QSC A;  3QUJ A;  4NF4 B;  4OWD A;  5J1D A;  4ZEF A;  1MQD A;  4OFO A;  4GF8 A;  2QMW A;  3O6G A;  3MAM A;  3TQW A;  1B5I A;  3LR1 A;  2YJP A;  1KWH A;  1ZKB A;  3C33 A;  3SET A;  1ATG A;  1MQH A;  3L6G A;  2XXI A;  1S7Y A;  1UTB A;  1ZMG A;  2GRV A;  4IO6 A;  1HSJ A;  1N7X A;  5JTY B;  3RLF E;  3O9P A;  5A5X A;  5HM4 B;  2I4C A;  1A54 A;  1ZIU A;  3TQL A;  5AA2 D;  3S9N C;  3PV0 E;  2HFB A;  3G3H A;  3H6V A;  4DXB A;  3TPA A;  3GZG A;  1Y20 A;  1MQJ A;  4FEC A;  4F2O A;  1H45 A;  1N84 A;  1EU8 A;  1IXH A;  1NH7 A;  3MWB A;  1XS5 A;  3O29 A;  2HXW A;  2O51 A;  2AYS A;  1D9Y A;  1MH3 A;  3A3U A;  4OZ9 A;  4R9F A;  4YIC A;  5EYF A;  5DVJ A;  3SES A;  2XXQ A;  3FJM A;  2BJJ X;  4PQJ A;  2QRY A;  2AL5 A;  1UTH A;  1Y9U A;  3MVY A;  3T22 A;  4YMB A;  1II5 A;  4QFN A;  4EF1 A;  3U1O A;  2VGQ A;  1PDA A;  1CE2 A;  4MF3 A;  5I2N A;  3MZ1 A;  4TQU Q;  5AA3 A;  1ANF A;  2HZK A;  3DM0 A;  1HSE A;  1QUL A;  3MQ9 A;  1Z7M E;  4KI0 E;  1P1N A;  1P99 A;  1PB9 A;  1A7L A;  4IO4 A;  5DVF A;  1GTK A;  1N04 A;  4JWX A;  1VFD A;  4DDD A;  5I59 B;  2I0B A;  3MP1 A;  2DE4 A;  3KJT A;  3QYT A;  2I3W A;  3VV5 A;  3M3K A;  4PP0 A;  3VLU A;  3FUZ A;  4BDN A;  1B4Z A;  2G93 A;  4RPN A;  3ZKK A;  3RY3 A;  3JV9 A;  4X48 A;  4I8C A;  2XXU A;  1RYO A;  1URD A;  1B40 A;  1BLF A;  1MPB A;  1H3D A;  3KGC A;  3O6I A;  4F1U A;  4OES A;  3IOR A;  3K0V A;  4LZ5 A;  1UIV A;  2D5W A;  3E3K A;  4WXJ A;  3ZSF A;  1QUJ A;  2Z8E A;  2Q2A A;  3N94 A;  1GGG A;  2F8D A;  5TPA B;  1S50 A;  4ZE9 A;  1JVY A;  2VD2 A;  3A09 A;  5CM6 A;  4F3B A;  2RCA A;  4H65 A;  1B3L A;  2ONR A;  3PPP A;  3IAZ A;  3PUY E;  3I5O A;  1I6B A;  4F29 A;  3MVW A;  2VP1 A;  2A5S A;  2I4B A;  1JEU A;  1URS A;  2ZXT A;  4JXI A;  4TOZ A;  4C1T A;  3TAJ A;  2FYI A;  2RCB A;  2O1M A;  3MVZ A;  3F11 A;  2DQV A;  3FXQ A;  3MZ9 A;  4RA1 A;  4RY1 A;  1WVJ A;  3HST A;  1USY E;  4OFL A;  3MP8 A;  3C32 A;  1URG A;  4OEV A;  4Q8R A;  5I56 B;  2X7Q A;  2PBW A;  4HCY A;  4OVJ A;  1VSO A;  1D9V A;  4N07 A;  4PFT A;  3DP4 A;  1WDN A;  1FW0 A;  3CSG A;  4H5G A;  4U23 A;  4GRK A;  3TEL A;  4PFW A;  1GV8 A;  4POW A;  1B3E A;  1Y4T A;  4OEN A;  3HCQ A;  5DTB A;  4XKN A;  4G68 B;  5H8Q B;  1ZLQ A;  3PUV E;  3A3C A;  4U2R A;  4WED A;  1I6A A;  4H6D A;  4BDR A;  5H8Q A;  3R7X A;  5IKB A;  1LB8 A;  4GWO A;  4NF5 A;  3BBR A;  3HHG A;  2IEE A;  4IO7 A;  1FQB A;  3VLW A;  2B65 A;  2H5Y A;  2ZYN A;  4AB6 A;  1B51 A;  1B05 A;  2ESN A;  3U92 A;  1YTV A;  1Y3P A;  4F3P A;  2PT2 A;  1MXV A;  2FNC A;  4Q5T A;  5DYH A;  5TP9 B;  2QJE A;  3MPL A;  2Y7W A;  3OO6 A;  1M5D A;  1ZBM A;  1JW1 A;  3SEU A;  3LC8 A;  1A40 A;  1Y1M A;  3SEW A;  2A5T A;  5H8N A;  3H7M A;  4BLA A;  5I2N B;  1IQ7 A;  3K4U A;  1JNF A;  3KBR A;  3OO9 A;  4DCY A;  1MY0 A;  1MM7 A;  4H67 A;  4HCW A;  1JVX A;  2XXH A;  1MY3 A;  4ELQ A;  3N6U A;  3IOT A;  2DWJ A;  5I57 B;  4WKM A;  1H44 A;  1IEJ A;  5I2K A;  3ODB A;  1DPP A;  4G8M A;  1EZ9 A;  2IA4 A;  2QSX A;  2Y7P A;  3SER A;  1FQD A;  5FTI A;  3EHS A;  1FQA A;  2Y7K A;  1XT8 A;  1FTL A;  1I69 A;  3E13 X;  2RC9 A;  4GFR A;  3WAE A;  1D4N A;  3C34 A;  2Q8J A;  4ISU A;  1IIW A;  1MY2 A;  1OMP A;  3PUZ E;  3PUX E;  3TCG A;  3Q25 A;  4DCX A;  4FAJ A;  4ZZE A;  3TCF A;  3G3J A;  3P7I A;  4YKI A;  5TP9 A;  3V5A A;  4DIG A;  1XVY A;  3VVD A;  3TZA A;  1LB9 A;  2ONK E;  4YKJ A;  4MLQ A;  2E0S A;  5KDT A;  2HQ0 A;  1LAH E;  3CI8 A;  1UTH B;  4R72 A;  3T9X B;  2KLF A;  2X26 A;  3N5L A;  1OQG A;  3UGW A;  2DXY A;  4NF8 B;  3T9H B;  3TCH A;  2H99 A;  4GLI A;  1MG1 A;  4R74 A;  1JW4 A;  4OTE A;  1SW5 A;  2VHA A;  3DEL B;  3FD3 A;  3K2D A;  3KN3 A;  4H1X A;  4O3A A;  3SEY A;  5H8S A;  1B0L A;  2XX9 A;  4BDQ A;  3I6V A;  4OHN A;  2FA7 A;  3SKP A;  1AMF A;  1SW2 A;  2Q9T A;  3K6V A;  3O2A A;  4OEU A;  5L9O A;  3MJN A;  5CMC A;  4YU0 A;  1SD3 A;  2AL4 A;  2O84 X;  4ZZA A;  2H25 A;  3LUY A;  4BDM A;  3USD A;  1PEB A;  4NED A;  2OCU A;  1MXY A;  4G8H A;  2F35 A;  1B7Z A;  4AB5 A;  3RNN A;  4G68 C;  1AIV A;  2XXV A;  3MZB A;  1Q1K A;  3VLV A;  1SI1 A;  1SDX A;  3EHU A;  4JWY A;  3PGF A;  4IO5 A;  4EQ9 A;  3IR1 A;  2V84 A;  5CMB A;  4TLL B;  5LOM A;  3SEV A;  3TDJ A;  1F9B A;  5H8F B;  1DSN A;  2DS9 A;  2F36 A;  3RQT A;  3EPE A;  2OK2 A;  3RTW B;  1MQG A;  2UVH A;  3MVX A;  3UN6 A;  4K3F A;  5B70 A;  5H8F A;  2RF1 A;  4GOT A;  2X7P A;  2YPN A;  5JEI A;  4M4G A;  4U1Z A;  4R6H A;  1SQY A;  4MH5 A;  1LFG A;  2ONS A;  3SDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...