3WAEA

X-ray structure of fe(iii)-bicarbonates-ttfbpa, a ferric ion-binding protein from thermus thermophilus hb8
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
PTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords IRON ABC TRANSPORTER, PERIPLASMIC IRON-BINDING PROTEIN
publication title A novel mode of ferric ion coordination by the periplasmic ferric ion-binding subunit FbpA of an ABC-type iron transporter from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 112
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3waeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3waeA02
2Y7KA 4PP0A 3KZGA 1UIVA 3TQWA 4DDDA 4R9GA 2ZYNA 4MLVA 4Q5TA 4HS7A 3RQTA 1D9VA 5I2NA 1QKBA 5AA3A 3CFZA 3FJMA 2PVUA 2ZNTA 1F9BA 3MVZA 3LSFB 4L17A 1FQAA 4ZEKA 1DSNA 3CRBA 4PETA 1SW1A 1M5CA 4R75A 2R71A 1B5HA 2GHAA 1GTKA 1SW5A 4N6PA 5K2YA 3PGFA 3DP4A 3EHUA 1D9YA 1I69A 3ONMA 2H4IA 2G93A 1ZKBA 4YKKA 3Q25A 5FTIA 3SESA 5DVJA 1MRPA 1ZBMA 2F36A 4KPTA 3TUSA 2HXWA 2H9BA 4EXKA 4LVQA 1B5IA 3H6TA 3U1OA 4BDRA 1SW4A 4BDOA 2Q2AA 3Q29A 4WEDA 5AE4A 4NF4B 4LATA 3VVEA 2DE2A 3PD9A 3RT6B 5EHMA 2Q2CA 3IORA 3O6GA 4ECFA 3K0VA 4QSCA 3C9HA 3PV0E 2XXIA 5BWJA 2HAUA 2UVIA 4OFLA 4KHZE 2OZZA 1B5JA 4GD5A 2XXQA 3F11A 2O1LA 3K01A 3ILTB 1B52A 3M3KA 2HZLA 1LAXA 1VFEA 5FHOA 4HTGA 3VLUA 4RYAA 4U22A 3C32A 1WODA 3SEUA 4H5GA 1SI0A 5L9SA 3E3KA 3TTNA 1XS5A 2ZYOA 2V3UA 1UTHB 4FAJA 3FXRA 3HSTA 4G68A 2PT2A 4H67A 2QS1A 2Z8DA 2XXPA 4IO2A 5I57A 1MQHA 3SKPA 1BLFA 3GLBA 4IO4A 4ZZEA 1JQFA 4PFTA 1B40A 3OD7A 1VE4A 2RC7A 4THIA 1MPDA 5TPAB 4ZEIA 3PUWE 2VD3A 3GXAA 1IIWA 2I0CA 3TAJA 1P1WA 4U2RA 4XKQA 4QHQA 4ZE8A 4RJZA 3FXQA 3QIMA 4ZECA 2ZYKA 3IB1A 2BJJX 3OO6A 1B3HA 3O97A 1MDP1 1GR2A 2XX7A 1O63A 3RLFE 4TLLB 3G7WA 2XX9A 1ZJLA 4UACA 2DE3A 4H1XA 1Y1MA 2PBWA 4HCYA 4YMBA 4OHNA 3SETA 2GH9A 3VV5A 1EH3A 5KCJB 3A3CA 1MQIA 2AL5A 2W7YA 5AA1A 4EXLA 4FEDA 4KR5A 2RF1A 4IO3A 2ZYMA 3C31A 3H06B 1DTGA 2RCAA 5H8QA 4H6DA 4F2OA 4JBZA 1IZ1A 1NMUA 2Y84A 5DT6A 1MPBA 1A40A 3MZBA 1PC3A 4QRZA 4MH5A 1B1XA 4GFRA 3PD8A 3PPPA 4KCDA 3O6HA 3TDJA 3S9MC 5I59B 1AH5A 4F22A 3U94A 2H99A 3OO9A 3PUYE 2I0BA 1AL3A 5F1QA 1MQGA 4GQOA 1SDXA 2XXYA 1OLCA 1XOCA 1T0KA 1HSLA 2ALUA 3VDFA 3C4MA 4FORA 4KYSA 3QUFA 3UN6A 1URSA 4KQPA 1FCKA 3K1NA 4LONB 4HW8A 5FHNA 4X9TA 4AB6A 3KN8A 1RYOA 3KOTA 3WAEA 1POY1 2F7CA 4QFKA 4H5FA 2HAVA 3RTWB 1PB7A 4GOTA 5JTYB 3SERA 1OVTA 2D5WA 3PMVA 2QL3A 4OTEA 4OEUA 4N07A 3U92A 4FE8A 1MH4A 4NF8B 1VFDA 3A3UA 2O7UA 1Y3QA 1PBQA 4X1BA 3HN0A 2O69A 1LAGE 3TEPA 5A5XB 5CBRA 1R9QA 5IKBA 5H8HB 1LFIA 4TLMB 4N13A 1MXXA 3LC8A 1ELJA 2Z8FA 4I9DA 1UTBA 1EZOA 2P2AA 2QSXA 1QW0A 4R72A 3ECRA 2UVJA 3LSXA 3KSJA 5DEXB 2DWAA 2O7IA 4RPNA 3UA8A 5ICQA 4GXAA 4F3SA 1B58A 5I84A 3SEVA 2REGA 1TFAA 3IJXB 3W9WA 1SW2A 4NF5B 3T96B 1MXZA 3MW0A 3DLNA 4DXUA 4LZ7A 5I2KB 3T9VA 4FEBA 1M5DA 1FQDA 1YCJA 5AA4B 3L6GA 4R9FA 5I56A 4XKRA 4GF8A 1IXGA 1Y3PA 1Q1KA 2IEEA 4F19A 1Q35A 4R6HA 3S2VA 4F18A 4IO5A 5K2XA 3DP6A 3V83A 3JV9A 3SEYA 3KJ7A 5TP9A 3TCGA 4LA9A 4R73A 1MG1A 3JZJA 4YB7A 4F1YA 3K6VA 1LFGA 2OWTA 1IEJA 1POTA 1ZTYA 3PPOA 3PMWA 4QF9A 2KLFA 2I3VA 4I8CA 3AXFA 3GBAA 4GIZA 2NWJA 4U4SA 2F34A 1MS7A 3G3FA 5M2VA 2Z23A 5L9MA 1FQBA 2Y7PA 3O28A 3DP8A 1JVYA 3N6UA 3KEIA 3MZ9A 4FATA 4NF6A 1LCFA 1ZLQA 3UK4A 5DYHA 2XHDA 4E0WA 1MQJA 5H8NA 3GZGA 4UA8A 1H45A 1S7YA 3H6UA 1VR5A 2F6PA 2RINA 3VXCA 5I2NB 2F7BA 3TQLA 3VLWA 3MP6A 1NH7A 2ZNUA 3B6WA 3LSLA 1EU8A 3TCFA 2A5TA 4NWDA 4EQ9A 1OVBA 1USYH 3K2DA 2I48A 4R2BA 3S9LC 4HCWA 1IXIA 3T9HB 3FZVA 2H25A 1QUIA 1GGGA 1XC1A 3MPKA 2X7QA 1B9JA 1JNFA 2E0SA 1XHYA 2ONRA 4GL8A 2O68A 4GRKA 3H3GA 3FD3A 1HSJA 3CSGA 2QRYA 2HZKA 4IO6A 3IJOB 4RNSA 1PBPA 5DVIA 4G8NA 2V84A 3H4ZA 3HHGA 1AOVA 4DCXA 3PPQA 3PMXA 3U72A 3IOVA 3IOTA 1A8FA 1FQCA 1ZIUA 3U8QA 1AMFA 4YU0A 3S4UA 2XXUA 4PFUA 3TPAA 5AA2A 1EZ9A 3Q26A 3N26A 3HCQA 3VVDA 4P0IA 2XD2A 4JSDA 2AYSA 2B3BA 4JWYA 3FVNA 1BKAA 3E9XA 1M5FA 1NFTA 1MM7A 1ZU0A 4O3AA 1O64A 2V93A 3IK6B 5CRYA 5ICTA 3G3GA 3I3VA 3G3KA 4I1DA 2QS3A 3CFLA 2V3QA 1FQFA 1H43A 2X26A 1D4NA 4DE8A 4G68B 1AIVA 1FTLA 2R9JA 3O2AA 2IA4A 4EUOA 1S50A 1N7WA 1II5A 1Z7ME 2OCUA 3G3JA 1B0LA 5I57B 2AIXA 3TZAA 3EHTA 3C33A 3MQ9A 1FTKA 1LBCA 1MY4A 4GLIA 3DM0A 4NMYA 3K6XA 1XT8A 4RPOA 1O7TA 2DWIA 4XTCQ 3FV2A 4X48A 4BLAA 2UYFA 2B65A 3FASA 3RTFB 4IGRA 2Q8JA 3MP8A 3FXUA 3D4CA 1JETA 3I5OA 5ELVA 3IB0A 1RKMA 3K1PA 4EQ7A 2QJEA 2I49A 4M1VA 1Y20A 3LSWA 4C1TA 3BFUA 2PT1A 4C0RA 1GVCA 2HFBA 1QJMA 3QYTA 1OQGA 3OENA 2D3IA 3TODA 4QSDA 1A55A 1L5TA 4BDQA 4H8JA 1B05A 1URDA 4ELQA 2Q88A 4YAHX 2VP1A 4ND9A 1M5EA 4RXLA 1TWYA 3IL1B 2DP8A 3H6WA 5H8FB 2PMSA 2OJTA 1QKAA 4F31B 5KCJA 4YB5A 2DS9A 3K4UA 1IXHA 1H44A 1A99A 3W9VA 3CFXA 4OZ9A 4ELRA 3C36A 5I58A 2RCBA 3RY3A 1SD3A 1DTZA 5H8QB 4U4XA 3R26A 4RK2A 1LCTA 5CM6A 2I3WA 2XXTA 2NVUB 2XXRA 5HBCA 1R6ZA 3TELA 1SYHA 2XD3A 1OMPA 4OWDA 4ISUA 2LAOA 3MC2A 2CZLA 3BKIB 2DWHA 3PPRA 3R7XA 1DOTA 4XKNA 3VXBA 1TXFA 3IOWA 3QXMA 1N3WA 4QFOA 1PEBA 4OQOA 4QFNA 3THIA 1SBPA 1JEVA 3KSXA 3BFTA 2Y7WA 4ONYA 1WVJA 1LAHE 3BBRA 4OEVA 3C34A 2H5YA 5AA2D 5KDTA 4LQ2A 1NKXA 1UIUA 4U21A 1B0HA 3FVKA 3OMBA 4LZ5A 4H0WA 4OERA 3SEWA 3CSBA 3V89B 1DPEA 1B3FA 3FATA 5DTBA 4JB7A 1LB9A 3C35A 1US4A 3OELA 1IUDA 1MXYA 2XXXA 3MAMA 3TTRA 3TKDA 3ZS6A 5L8DA 4ELPA 3H03A 1R1NA 2M8CA 4YKIA 1Z7NE 1LSTA 2NXOA 4OMBA 4Z7EA 1B4HA 3FIRA 3GBBA 3R6UA 2VOZA 3HHFA 5EHSA 2DVCA 2O84X 4NE4A 4P0GA 2YPNA 2GHBA 3T22A 1QUJA 1R9LA 4KD5A 2ONSA 1B6HA 3N94A 2V25A 2DXYA 2ANJA 1NNTA 2CMOA 1Y9UA 3OO8A 4GWOA 4GVOA 4DXBA 2QPQA 4IY6A 5TU0A 4NF5A 1MXVA 1MH3A 1I6QA 3RUMA 3I6VA 1FTOA 3TTLA 3TMGA 1P1OA 2HEUA 2FYIA 4F1UA 1VSOA 3RN8A 4ZEDA 2HCAA 3OOAA 1LGBC 5I56B 1S9TA 2ESNA 2THIA 1FW0A 2REJA 1YPNA 1P99A 2F35A 3RT8A 4LUBA 1XVYA 1HSEA 1PB9A 4OFJA 1IQ7A 3RGYA 2B3FA 2D21A 2O1MA 4G68C 4PQJA 2Y7IA 4ZEBA 3ILUB 4OYVA 1Y1ZA 5TP9B 1LAFE 5EYFA 3LR1A 2F78A 5ITOA 3Q27A 4OENA 3KOSA 1B1HA 3TYHA 1OIBA 2FA7A 4G8HA 5IAIA 3B7DA 2VGQA 1FTMA 3QSLA 4K3FA 1LBBA 4WEPA 4DXCA 3UORA 4BDNA 4R2FA 2DQVA 3IAZA 4BDLA 4ZEFA 4TQUQ 3ZKKA 5HPQA 3JYRA 1B51A 3TTMA 1ZMGA 4NF6B 4Q8RA 1MPCA 3MJNA 3KBRA 5JK4A 5H8NB 1H76A 3PUVE 3QUJA 4FECA 1BIYA 2QS4A 1ANFA 4BDMA 1JW4A 4F3PA 4OFOA 1LB8A 1D3KA 5CI5A 3QK6A 4QFPA 3K6WA 1DPPA 1MDQA 4EF2A 4R6YA 2A5TB 2Q9TA 2PYYA 4Q30B 2DOJA 3HO7A 4PFWA 4E0XA 1LLSA 3UIFA 3K00A 3O66A 1IITA 1KWHA 3IO4A 2DVZA 5BUUA 3CG1A 4JXIA 5B70A 3MVXA 4ZE9A 1H3DA 2ZMBA 4KI0E 1FQEA 3S9NC 3KFMA 3Q28A 5KZTA 3LUYA 3V5AA 1Y4TA 3FVOA 3K02A 1XVXA 4NF4A 2XXVA 4LP2B 2UXAA 5JEIA 1MM6A 4G4PA 3CG3A 3E4RA 4DIGA 3KN3A 5AA2B 3ZKLA 1CE2A 4U23A 2F5XA 2ABHA 5ITPA 3RPWA 5DVFA 1YTVA 4IGTA 4WXJA 1SI1A 3G3IA 3FVGA 4NWCA 4X1DA 3B6TA 1JW5A 3EPEA 2FNCA 2VHAA 1BTJA 3L6HA 4ZDMA 3TTKA 1QULA 2GRVA 2YLNA 4DCYA 3T9XB 2DSFA 4DLDA 1B4ZA 4I62A 4OESA 2A5SA 2P0SA 1URGA 1P1NA 4Z0IA 1OLAA 1UTHA 4MF3A 3VFJA 3KN7A 3G3HA 4POXA 1A8EA 1SQYA 1LFHA 1N84A 2R6GE 2UVGA 1RYXA 4H8IA 4XIGQ 3M3FA 3WAFA 1CB6A 1UQWA 1B3LA 3PUZE 1BP5A 2QMXA 4OETA 2ZXTA 5TPAA 1N3XA 2DXRA 4AB5A 3MZ1A 4F39A 4C1UA 2RC8A 3FJ7A 1NNKA 3HV1A 4KFQA 1EZPA 1J1NA 3FJGA 2E1SA 4QFLA 1MQDA 3OEMA 3H6VA 3PPNA 1MY1A 4G2ZA 1N76A 4PFYA 3CI8A 4IB2A 1OQHA 1Y4CA 3OSQA 2P1SA 4AQ4A 3T66A 2QMWA 3IO6A 2ONKE 4ZS9A 4ELOA 2XXWA 5CMKA 2YJPA 2Z22A 3IX1A 3OXNA 2RKMA 3P7IA 4KYDA 1IXCA 2AL4A 3T9UA 2GFEA 2I4CA 5H8FA 4OXVA 4MBPA 1A7LA 5CMMA 4JWXA 4JWOA 4M4GA 3TFLA 3IR1A 4O3BA 2ZNSA 4XKPA 3OO7A 4YKPA 2OK2A 5I58B 2XXHA 3O6IA 1Y3NA 4YZZA 3MBPA 1PDAA 3E13X 4F1VA 2O6AA 3N5LA 2RC9A 1B7HA 4H65A 2NOOA 4YICA 3OSRA 2Y7RA 2OLBA 5FHMA 4FJPA 4GXSB 5I59A 4NEDA 4ZZAA 1QVSA 2V3TA 4U1ZA 3VE1B 4JSOA 4QSEA 1JEUA 4EF1A 5CBSA 1SVXB 3TCHA 5J1DA 1N7XA 3M3LA 3MUQA 3H7MA 2I58A 4KCCA 3O9PA 1QUKA 1B7UA 4R6KA 3MP1A 4NTLA 3MPLA 3MVYA 5HM4B 3S9EA 1JW1A 1M5BA 3KG2A 5KDTB 4G8MA 4Q0CA 3VVFA 1PB8A 4F29A 4IY5A 3B6QA 2PX1A 2WKYA 4YMAA 4RK9A 3FV1A 3LBSA 2F7AA 4F3BA 2VD2A 3V8XB 4MLQA 4YKJA 5CMBA 4ESWA 3USDA 1JVXA 5FTHA 2UVHA 3CVGA 2I4BA 3EQ1A 5JTYA 1MY2A 1MXUA 3ODBA 4ESXA 2F97A 3EHSA 1NNPA 5ISUA 1TT1A 3U93A 2OBGA 1MXWA 4YB6A 2DYXA 2NUVA 4XXUA 4NF8A 1B3EA 1B2HA 1N04A 2OWSA 1B32A 2G29A 5A5XA 2X7PA 3W15C 1I6BA 2QS2A 2I6EA 5H8HA 4GL0A 4R74A 1B46A 1MY3A 5LOMA 1DMBA 1B3GA 2F6GA 4POWA 1P1QA 3SEXA 1UTBB 3M8UA 3EN3A 1US5A 5DEXA 3ZSFA 3IOUA 5CC2A 2Z8EA 3EF7A 3IB2A 3SDFA 3FGSA 5CMCA 4F2QA 2XX8A 1YAEA 1P1UA 1NH8A 3MVWA 3UGWA 3A09A 5I2KA 3PU5A 3T93B 4F3GA 4O3CA 1ATGA 4PE5B 2H98A 3O29A 4LQ5A 5AA4A 4EDPA 1NL5A 5F7VA 3CR9A 3OEKA 3UP9A 4IO7A 3DELB 4EQBA 3CIJA 3KJTA 4FIMA 1FTJA 1MY0A 3FUZA 3MWBA 4JDFA 4DZ1A 4LZ8A 5B7DA 3HPIA 4RY1A 1TFDA 1NNFA 1A54A 4RA1A 4G77A 3N6TA 1GV8A 4U1OA 2UYEA 2F8DA 4MFIA 3D4GA 1B7ZA 2DWJA 5L9OA 3RNNA 2DE4A 4KYEA 3VLVA 4P11A 3K6UA 5H8SA 4OVJA 3K1MA 1USYE 1I6AA 1N0TA 3QAXA 2O51A 2Q89A 4TOZA 4WKMA 1SYIA 2HQ0A 3KGCA 1WDNA 3PUXE
chains in the Genus database with same CATH superfamily
2Y7KA 4PP0A 3KZGA 1UIVA 3TQWA 4DDDA 4R9GA 2ZYNA 5I7IA 4MLVA 4Q5TA 4HS7A 1FPGA 3RQTA 1D9VA 5I2NA 1QKBA 5AA3A 3CFZA 3FJMA 2PVUA 4GX6A 1SPIA 2ZNTA 4QBAA 1F9BA 3MVZA 4GX3A 3LSFB 4L17A 4DI3D 1FQAA 4ZEKA 1DSNA 3CRBA 4PETA 1RDXA 1M5CA 1SW1A 4R75A 2R71A 1B5HA 2GHAA 1GTKA 1SW5A 4N6PA 5K2YA 3RPLB 3PGFA 4PE3A 4N8GA 4N81A 3DP4A 4OANA 3EHUA 2GQ1A 3IFAA 1D9YA 1I69A 3ONMA 2H4IA 2G93A 4PFRA 1ZKBA 1DBZA 4YKKA 3Q25A 5FTIA 3SESA 5DVJA 1MRPA 1ZBMA 2F36A 4KPTA 2XA5A 3TUSA 2HXWA 4NHBA 2H9BA 4EXKA 5ET7A 4LVQA 1B5IA 2PFZA 3H6TA 3U1OA 4BDRA 1SW4A 1DCUA 4BDOA 2L5VA 2Y5LA 2Q2AA 3Q29A 4WEDA 5AE4A 4NF4B 4LATA 1NV2A 3VVEA 1LBVA 2DE2A 3PD9A 3RT6B 5EHMA 2Q2CA 3IORA 3O6GA 4ECFA 3K0VA 4QSCA 3C9HA 3PV0E 2XXIA 5BWJA 4OVRA 2HAUA 2UVIA 4P1EA 1INPA 5T3JA 4OFLA 4KHZE 2OZZA 1B5JA 4JVDA 4GD5A 2XXQA 3F11A 2O1LA 3K01A 3ILTB 4NGUA 1B52A 3M3KA 3B8BA 2DDKA 2HZLA 1LAXA 1VFEA 5FHOA 4HTGA 3VLUA 4RYAA 1QGXA 3MSTA 4U22A 3C32A 1WODA 3SEUA 4H5GA 1SI0A 5L9SA 3E3KA 3TTNA 1XS5A 2ZYOA 2V3UA 1UTHB 4FAJA 3FXRA 3HSTA 4G68A 2PT2A 4PCDA 4PBHA 4H67A 2QS1A 2Z8DA 2XXPA 4IO2A 5I57A 1MQHA 3SKPA 1BLFA 3GLBA 4IO4A 4ZZEA 1JQFA 4PFTA 1B40A 3OD7A 1VE4A 5I5PA 2RC7A 4THIA 1MPDA 5TPAB 2QVVA 4ZEIA 3PUWE 2VD3A 3GXAA 1IIWA 2I0CA 3TAJA 1P1WA 4U2RA 1JP4A 4XKQA 4QHQA 4ZE8A 4RJZA 3FXQA 3QIMA 3E78A 4ZECA 2ZYKA 3IB1A 4QXDA 2BJJX 3OO6A 1B3HA 3O97A 1MDP1 2KR0A 1GR2A 2XX7A 2OX3A 1O63A 5IZ1A 4TLLB 3RLFE 3G7WA 4N17A 2XX9A 1ZJLA 4UACA 2DE3A 4H1XA 1Y1MA 1FPLA 2PBWA 2WEFA 4HCYA 4I3YA 3IFCA 4YMBA 4OHNA 3SETA 3RYDA 2GH9A 3VV5A 1EH3A 5KCJB 3A3CA 1MQIA 2AL5A 2W7YA 5AA1A 4EXLA 4FEDA 4KR5A 4PBQA 2RF1A 4IO3A 2ZYMA 4HE2A 3C31A 3H06B 1DTGA 2RCAA 5H8QA 4H6DA 4F2OA 4JBZA 1IZ1A 1NMUA 2Y84A 5DT6A 1MPBA 1A40A 3MZBA 1PC3A 4QRZA 4MH5A 1B1XA 4N4UA 2Q8MA 4GFRA 3PD8A 3PPPA 4KCDA 3O6HA 3TDJA 3S9MC 5I59B 1AH5A 4F22A 3OO9A 2H99A 3U94A 3PUYE 2I0BA 1AL3A 5F1QA 1MQGA 4HE1A 4GQOA 2R8TA 1SDXA 2XXYA 1OLCA 2B4LA 2ZZXA 1XOCA 1T0KA 1HSLA 2ALUA 3VDFA 3C4MA 4FORA 4KYSA 5ET6A 3QUFA 3UN6A 1URSA 1FBFA 4KQPA 1FCKA 4P56A 1FPFA 3K1NA 4LONB 4HW8A 5FHNA 4X9TA 4AB6A 3KN8A 1RYOA 3KOTA 3WAEA 1POY1 4MJOA 2F7CA 4QFKA 4H5FA 2HAVA 3RTWB 1PB7A 2PCRA 4GOTA 5JTYB 3SERA 1OVTA 3FXBA 2D5WA 3PMVA 2QL3A 4OTEA 4OEUA 4N07A 3U92A 4FE8A 1MH4A 4O94A 4NF8B 1VFDA 3A3UA 2O7UA 1Y3QA 4NQ8A 1PBQA 4X1BA 3HN0A 2O69A 1LAGE 3TEPA 5A5XB 5CBRA 1R9QA 5IKBA 5H8HB 1LFIA 4TLMB 4N13A 1MXXA 3LC8A 1ELJA 2Z8FA 4I9DA 1UTBA 1EZOA 2P2AA 2QSXA 1QW0A 4KXPA 4R72A 3ECRA 1NUXA 2UVJA 3KSJA 3LSXA 2DWAA 4XF5A 2O7IA 4RPNA 4XEQA 5DEXB 3UA8A 5ICQA 4GXAA 4F3SA 1B58A 5I84A 3SEVA 2REGA 1TFAA 3IJXB 3W9WA 1SW2A 4NF5B 3T96B 1MXZA 3MW0A 3DLNA 4DXUA 4LZ7A 5I2KB 3LV0A 3T9VA 4FEBA 1M5DA 1NUYA 1FQDA 1YCJA 5AA4B 3T0JA 3L6GA 4R9FA 2F3DA 5I56A 4XKRA 4MNPA 4GF8A 1IXGA 1Y3PA 1EYJA 1Q1KA 2IEEA 4F19A 1Q35A 4R6HA 3S2VA 4F18A 4IO5A 5K2XA 3DP6A 3V83A 3JV9A 3SEYA 1K9ZA 3KJ7A 5TP9A 3TCGA 4LA9A 4R73A 1FBGA 1MG1A 3JZJA 4X8RA 4YB7A 1LBWA 4F1YA 3K6VA 1LFGA 2OWTA 1IEJA 1NV4A 1POTA 1ZTYA 4P3LA 3PPOA 3PMWA 4QF9A 2KLFA 2I3VA 4I8CA 2XWOA 3AXFA 3GBAA 4GIZA 2NWJA 4U4SA 2F34A 4UABA 1MS7A 3G3FA 5M2VA 2Z23A 5L9MA 1FQBA 3T1BA 2Y7PA 3O28A 3DP8A 3E79A 1JVYA 3N6UA 3KEIA 3MZ9A 4FATA 4HE0A 1AWBA 4NF6A 4GWXA 4AS4A 1LCFA 1ZLQA 3UK4A 5DYHA 2XHDA 1FSAA 4E0WA 1MQJA 5H8NA 3GZGA 4PAFA 5EYHA 4UA8A 1H45A 4NAPA 1S7YA 3H6UA 1VR5A 2F6PA 2RINA 3VXCA 3B50A 5I2NB 2F7BA 4PDHA 3TQLA 3VLWA 3MP6A 1NH7A 4JVCA 2ZNUA 3B6WA 1NV1A 1FJ9A 3LSLA 1EU8A 3TCFA 2A5TA 4NWDA 4EQ9A 4G61A 1KZ8A 4MIJA 1OVBA 1USYH 3K2DA 2I48A 4R2BA 3S9LC 4HCWA 1IXIA 4OVPA 3T9HB 3FZVA 2H25A 1QUIA 1GGGA 1XC1A 1G0IA 3MPKA 2X7QA 1B9JA 1JNFA 2E0SA 1XHYA 2ONRA 4GL8A 2O68A 4GRKA 3A29A 3H3GA 1NV7A 3FD3A 1HSJA 3CSGA 2QRYA 2HZKA 4IO6A 3IJOB 5J16A 4RNSA 1PBPA 5DVIA 4G8NA 4H46A 2V84A 4JVIA 3H4ZA 3HHGA 1AOVA 4DCXA 3PPQA 3PMXA 3U72A 3IOVA 3IOTA 2WYKA 1A8FA 1FQCA 1ZIUA 3U8QA 1AMFA 3MYUA 4YU0A 3S4UA 2XXUA 4PFUA 3TPAA 5AA2A 1EZ9A 3Q26A 4OA4A 3N26A 3HCQA 4MMPA 1IMDA 1XI6A 3VVDA 4P0IA 1FBPA 2XD2A 4JSDA 2AYSA 2B3BA 4JWYA 3FVNA 1BKAA 3E9XA 1M5FA 1NFTA 2WBDA 1MM7A 1ZU0A 4O3AA 1O64A 2V93A 3IK6B 5CRYA 4GBVA 5ICTA 3G3GA 3I3VA 3G3KA 4I1DA 2QS3A 3CFLA 2V3QA 2ZZVA 1YXIA 1FQFA 1H43A 3KC0A 2X26A 1D4NA 4DE8A 4G68B 1AIVA 1FTLA 2R9JA 3O2AA 4PDDA 2IA4A 2KQZA 4EUOA 1S50A 1N7WA 1II5A 1Z7ME 2OCUA 3G3JA 1B0LA 5I57B 2AIXA 3TZAA 3EHTA 1YYZA 3C33A 3MQ9A 1FTKA 1LBCA 1MY4A 4GLIA 5DW8A 3DM0A 4NN3A 4NMYA 3K6XA 1XT8A 4RPOA 1O7TA 2DWIA 4XTCQ 3FV2A 4X48A 4BLAA 2UYFA 2B65A 3FASA 3RTFB 4IGRA 1IMCA 2Q8JA 3MP8A 3FXUA 3D4CA 1FTAA 2CEXA 4NG7A 4PFIA 1JETA 4MNIA 3I5OA 5ELVA 3IB0A 1RKMA 3K1PA 4EQ7A 2QJEA 4LN5A 2I49A 4M1VA 1Y20A 3LSWA 4C1TA 3BFUA 2PT1A 2XWVA 4I3EA 4C0RA 1GVCA 1FBEA 2HFBA 1QJMA 2P3NA 3QYTA 1OQGA 3OENA 2D3IA 1CNQA 3TODA 4QSDA 1A55A 1L5TA 4BDQA 1D9QA 4H8JA 1B05A 1URDA 4ELQA 2Q88A 4YAHX 2VP1A 5ESYA 4ND9A 1M5EA 1EYKA 4RXLA 1TWYA 3IL1B 2DP8A 3H6WA 3CHGA 5H8FB 2PMSA 2OJTA 1QKAA 4F31B 4N6KA 5KCJA 4YB5A 1IMEA 2DS9A 3K4UA 1IXHA 1H44A 1A99A 3W9VA 3CFXA 4OZ9A 4ELRA 3C36A 4GWWA 4X04A 5I58A 2RCBA 2CZHA 1VDWA 3RY3A 1SD3A 4OVQA 1DTZA 5H8QB 4U4XA 2HHMA 3R26A 4RK2A 1LCTA 5CM6A 5IZ3A 1FRPA 2I3WA 2XXTA 2NVUB 2XXRA 2CZIA 5HBCA 1R6ZA 3TELA 1SYHA 2Q74A 5EQAA 2WBBA 2XD3A 3U65A 1OMPA 4OWDA 4ISUA 2LAOA 3MC2A 2CZLA 3BKIB 2DWHA 3PPRA 3R7XA 1DOTA 4GWSA 4XKNA 1BK4A 3HFUA 3VXBA 1TXFA 3IOWA 3QXMA 1N3WA 4QFOA 3ROJA 1PEBA 4OQOA 4QFNA 4XFEA 5IM2A 3THIA 1SBPA 1JEVA 3KSXA 1NUZA 2V4CA 3BFTA 5EQ8A 2Y7WA 4ONYA 1WVJA 1LAHE 3BBRA 4OEVA 3C34A 4MNCA 2H5YA 5AA2D 5KDTA 4LQ2A 5ET5A 5FBPA 1NKXA 1UIUA 4U21A 1B0HA 3FVKA 3OMBA 4LZ5A 3BIHA 4H0WA 3D1RA 4I40A 1FBDA 4OERA 3SEWA 3CSBA 3V89B 2CEYA 1DPEA 1B3FA 3FATA 5DTBA 4JB7A 1LB9A 3C35A 1US4A 3OELA 1IUDA 1MXYA 4P47A 4N8YA 2XXXA 3MAMA 3TTRA 3TKDA 3ZS6A 5L8DA 4ELPA 3H03A 1R1NA 2M8CA 4YKIA 3GYYA 1Z7NE 1LSTA 2NXOA 4OMBA 3FBPA 4Z7EA 1B4HA 3FIRA 3GBBA 3R6UA 2VOZA 1DK4A 3HHFA 4N6DA 2DVCA 5EHSA 4IR8A 2O84X 4NE4A 4P0GA 2YPNA 2GHBA 1YZ0A 5EQ7A 3T22A 1QUJA 1R9LA 4KD5A 2ONSA 1LBXA 1B6HA 3N94A 2V25A 2DXYA 1G0HA 2ANJA 1NNTA 2CMOA 1Y9UA 4O7IA 3OO8A 4GWOA 1NV5A 3EKIA 4GVOA 4DXBA 2QPQA 4IY6A 1NUWA 5TU0A 4NF5A 1MXVA 1MH3A 1I6QA 4P8BA 3I6VA 1FTOA 3RUMA 3TTLA 3TMGA 1P1OA 2HEUA 2FYIA 4F1UA 1VSOA 3RN8A 4ZEDA 2HCAA 3OOAA 1LGBC 5I56B 1S9TA 2ESNA 2THIA 2XXKA 1FW0A 2REJA 1YPNA 1P99A 2F35A 3RT8A 4LUBA 1XVYA 1HSEA 1PB9A 4OFJA 1IQ7A 3RGYA 2B3FA 2D21A 2O1MA 4G68C 4PQJA 2Y7IA 4ZEBA 3ILUB 4OYVA 1Y1ZA 5TP9B 1LAFE 5EYFA 3LR1A 2F78A 5ITOA 3Q27A 4MEVA 2QVUA 4OENA 3KOSA 1B1HA 3TYHA 2CZKA 1OIBA 1FPKA 2FA7A 4G8HA 5IAIA 3B7DA 4MCOA 2VGQA 1FTMA 3QSLA 4K3FA 1LBBA 4WEPA 4DXCA 3UORA 1KA0A 4BDNA 4R2FA 2DQVA 3IAZA 2Y5KA 4BDLA 4ZEFA 4TQUQ 3ZKKA 1FPDA 5HPQA 3JYRA 1B51A 3TTMA 1ZMGA 4NF6B 4Q8RA 4GWYA 1MPCA 4HXVA 3MJNA 3BIGA 3KBRA 5JK4A 2HXRA 5H8NB 1FBHA 1H76A 3PUVE 3QUJA 4FECA 1BIYA 2QS4A 1ANFA 4BDMA 1JW4A 4F3PA 4OFOA 1LB8A 1D3KA 5CI5A 5IZZA 3SZPA 1EYIA 3QK6A 4QFPA 3K6WA 3RPLA 1DPPA 1MDQA 4EF2A 4R6YA 2A5TB 2Q9TA 2PYYA 4Q30B 2DOJA 3HO7A 4PFWA 4E0XA 1LLSA 3UIFA 3K00A 3O66A 5F24A 4PAIA 1IITA 1KWHA 3IO4A 2DVZA 5BUUA 3CG1A 4JXIA 5B70A 3MVXA 4ZE9A 2QVRA 1H3DA 2ZMBA 4KI0E 2VT5A 2XWIA 1FQEA 2WX9A 3S9NC 4GX4A 3KFMA 1RDYA 2FHYA 3Q28A 1FBCA 5KZTA 1FJ6A 3LUYA 3V5AA 1Y4TA 3FVOA 3K02A 1XVXA 4NF4A 2XXVA 4LP2B 2UXAA 5JEIA 1MM6A 4G4PA 3CG3A 3E4RA 4DIGA 3PTYA 3KN3A 5AA2B 3ZKLA 1CE2A 5EYGA 1FPEA 2F5XA 4U23A 2ABHA 4OVSA 5ITPA 3RPWA 5DVFA 1YTVA 4IGTA 4WXJA 1SI1A 3G3IA 3FVGA 4NWCA 4X1DA 3B6TA 3NOHA 1JW5A 3EPEA 2FBPA 1NV3A 2FNCA 2VHAA 1BTJA 3L6HA 4ZDMA 3TTKA 1QULA 2GRVA 4PF8A 2YLNA 1NV6A 4DCYA 3T9XB 2VPOA 2DSFA 1IMAA 4DLDA 1B4ZA 5I3SA 4DI4B 4I62A 4OESA 2A5SA 2P0SA 1URGA 1P1NA 4Z0IA 1OLAA 1UTHA 4MF3A 2WYPA 3VFJA 3KN7A 3G3HA 4POXA 1A8EA 4PTKA 1SQYA 1LFHA 1N84A 1K9YA 2R6GE 2UVGA 1RYXA 4H8IA 4XIGQ 3M3FA 3WAFA 4H45A 1CB6A 1UQWA 1B3LA 3PUZE 1BP5A 3KC1A 2QMXA 4OETA 1NI9A 2ZXTA 4P9KA 5TPAA 1N3XA 3LUZA 2DXRA 4AB5A 3MZ1A 4F39A 4C1UA 2RC8A 3FJ7A 1NNKA 4NX1A 4PC9A 3HV1A 3QMFA 4KFQA 1EZPA 1J1NA 1NV0A 3FJGA 2E1SA 4QFLA 1MQDA 3OEMA 3H6VA 3PPNA 1MY1A 4G2ZA 1N76A 4PFYA 3CI8A 4IB2A 1OQHA 1Y4CA 3OSQA 2P1SA 4AQ4A 3T66A 4OVTA 2QMWA 2JJKA 3IO6A 2ONKE 1LBZA 4ZS9A 4ELOA 2XXWA 5CMKA 2MKZA 2YJPA 2Z22A 3IX1A 3OXNA 2RKMA 3P7IA 4KYDA 1FPJA 1IXCA 2AL4A 3T9UA 4N15A 4GBWA 2FIEA 2GFEA 2I4CA 2FIXA 4OXVA 5H8FA 1FPBA 4MBPA 1A7LA 5CMMA 4JWXA 4JWOA 5ET8A 4M4GA 3TFLA 3IR1A 4O3BA 2ZNSA 4XKPA 3OO7A 4P1LA 4YKPA 2OK2A 5I58B 2XXHA 3O6IA 1Y3NA 1Q9DA 4YZZA 3MBPA 1PDAA 4PGNA 3E13X 4F1VA 2O6AA 3N5LA 5IZ3B 2RC9A 1B7HA 4H65A 3ISPA 2NOOA 4YICA 3OSRA 4NF0A 2Y7RA 2OLBA 5FHMA 4FJPA 5IGAA 4GXSB 5I59A 4NEDA 4ZZAA 1QVSA 4O7MA 2V3TA 3KBZA 4U1ZA 2VPNA 3VE1B 4JSOA 4MHFA 4QSEA 1JEUA 2F3BA 4EF1A 5CBSA 1SVXB 3TCHA 5J1DA 1N7XA 3M3LA 3MUQA 3H7MA 2I58A 4KCCA 3O9PA 1QUKA 1B7UA 4R6KA 3MP1A 4NTLA 3MPLA 3MVYA 5HM4B 3S9EA 4PAKA 1JW1A 1M5BA 3KG2A 5KDTB 4G8MA 4Q0CA 3VVFA 1PB8A 4F29A 4IY5A 3B6QA 2PX1A 2WKYA 2P3VA 4YMAA 2XWKA 4RK9A 3FV1A 3LBSA 2F7AA 4F3BA 2VD2A 3V8XB 4MLQA 4YKJA 5CMBA 4ESWA 3USDA 1JVXA 5FTHA 2QFLA 1IMFA 2UVHA 3CVGA 2I4BA 3EQ1A 5JTYA 5LDZA 1MY2A 1MXUA 3ODBA 4ESXA 2F97A 1IMBA 3EHSA 5LTCA 1NNPA 1LBYA 5ISUA 1TT1A 3U93A 2OBGA 1LEVA 1MXWA 4YB6A 1RDZA 2DYXA 2NUVA 4XXUA 4NF8A 1B3EA 1B2HA 4O8MA 4MAGA 1N04A 2OWSA 1B32A 2G29A 5A5XA 2X7PA 3W15C 1I6BA 2QS2A 2I6EA 5H8HA 4GL0A 4R74A 1B46A 1MY3A 5LOMA 1DMBA 1B3GA 2F6GA 4N91A 4POWA 1P1QA 3SEXA 1UTBB 3M8UA 3EN3A 1US5A 5DEXA 1KA1A 3ZSFA 3IOUA 5CC2A 2Z8EA 3EF7A 3IB2A 3SDFA 3FGSA 5CMCA 4F2QA 2XX8A 1YAEA 1P1UA 1NH8A 3MVWA 2FVZA 3UGWA 1FPIA 3A09A 4FBPA 5I2KA 3PU5A 4PGPA 3T93B 4AS5A 4F3GA 4O3CA 1ATGA 4PE5B 2H98A 3O29A 4LQ5A 5AA4A 4EDPA 1NL5A 2ZZWA 5F7VA 3CR9A 3OEKA 3UP9A 4PFBA 4IO7A 3DELB 4EQBA 3CIJA 3KJTA 2B4MA 4GWUA 4FIMA 1FTJA 1MY0A 3FUZA 3MWBA 4JDFA 4MX6A 4LZ8A 4DZ1A 5B7DA 3HPIA 4RY1A 1TFDA 1NNFA 1A54A 4RA1A 4G77A 3N6TA 1GV8A 4U1OA 2UYEA 2F8DA 4MFIA 3D4GA 1B7ZA 2DWJA 2PFYA 5L9OA 3RNNA 2DE4A 4KYEA 3VLVA 4P11A 2OWZA 3K6UA 2HPGA 4GWZA 5H8SA 4OVJA 3K1MA 1USYE 1I6AA 1N0TA 5A5LA 3QAXA 2O51A 2Q89A 4TOZA 4WKMA 1SYIA 2HQ0A 4PF6A 3KGCA 5EQ9A 1WDNA 2BJIA 3PUXE
chains in the Genus database with same CATH topology
2Y7KA 4PP0A 3KZGA 1UIVA 3TQWA 4DDDA 4R9GA 2ZYNA 4MLVA 4Q5TA 4HS7A 3RQTA 1D9VA 5I2NA 1QKBA 5AA3A 3CFZA 3FJMA 2PVUA 2ZNTA 1F9BA 3MVZA 3LSFB 4L17A 1FQAA 4ZEKA 1DSNA 3CRBA 4PETA 1SW1A 1M5CA 4R75A 2R71A 1B5HA 2GHAA 1GTKA 1SW5A 4N6PA 5K2YA 3PGFA 3DP4A 3EHUA 1D9YA 1I69A 3ONMA 2H4IA 2G93A 1ZKBA 4YKKA 3Q25A 5FTIA 3SESA 5DVJA 1MRPA 1ZBMA 2F36A 4KPTA 3TUSA 2HXWA 2H9BA 4EXKA 4LVQA 1B5IA 3H6TA 3U1OA 4BDRA 1SW4A 4BDOA 2Q2AA 3Q29A 4WEDA 5AE4A 4NF4B 4LATA 3VVEA 2DE2A 3PD9A 3RT6B 5EHMA 2Q2CA 3IORA 3O6GA 4ECFA 3K0VA 4QSCA 3C9HA 3PV0E 2XXIA 5BWJA 2HAUA 2UVIA 4OFLA 4KHZE 2OZZA 1B5JA 4GD5A 2XXQA 3F11A 2O1LA 3K01A 3ILTB 1B52A 3M3KA 2HZLA 1LAXA 1VFEA 5FHOA 4HTGA 3VLUA 4RYAA 4U22A 3C32A 1WODA 3SEUA 4H5GA 1SI0A 5L9SA 3E3KA 3TTNA 1XS5A 2ZYOA 2V3UA 1UTHB 4FAJA 3FXRA 3HSTA 4G68A 2PT2A 4H67A 2QS1A 2Z8DA 2XXPA 4IO2A 5I57A 1MQHA 3SKPA 1BLFA 3GLBA 4IO4A 4ZZEA 1JQFA 4PFTA 1B40A 3OD7A 1VE4A 2RC7A 4THIA 1MPDA 5TPAB 4ZEIA 3PUWE 2VD3A 3GXAA 1IIWA 2I0CA 3TAJA 1P1WA 4U2RA 4XKQA 4QHQA 4ZE8A 4RJZA 3FXQA 3QIMA 4ZECA 2ZYKA 3IB1A 2BJJX 3OO6A 1B3HA 3O97A 1MDP1 1GR2A 2XX7A 1O63A 3RLFE 4TLLB 3G7WA 2XX9A 1ZJLA 4UACA 2DE3A 4H1XA 1Y1MA 2PBWA 4HCYA 4YMBA 4OHNA 3SETA 2GH9A 3VV5A 1EH3A 5KCJB 3A3CA 1MQIA 2AL5A 2W7YA 5AA1A 4EXLA 4FEDA 4KR5A 2RF1A 4IO3A 2ZYMA 3C31A 3H06B 1DTGA 2RCAA 5H8QA 4H6DA 4F2OA 4JBZA 1IZ1A 1NMUA 2Y84A 5DT6A 1MPBA 1A40A 3MZBA 1PC3A 4QRZA 4MH5A 1B1XA 4GFRA 3PD8A 3PPPA 4KCDA 3O6HA 3TDJA 3S9MC 5I59B 1AH5A 4F22A 3U94A 2H99A 3OO9A 3PUYE 2I0BA 1AL3A 5F1QA 1MQGA 4GQOA 1SDXA 2XXYA 1OLCA 1XOCA 1T0KA 1HSLA 2ALUA 3VDFA 3C4MA 4FORA 4KYSA 3QUFA 3UN6A 1URSA 4KQPA 1FCKA 3K1NA 4LONB 4HW8A 5FHNA 4X9TA 4AB6A 3KN8A 1RYOA 3KOTA 3WAEA 1POY1 2F7CA 4QFKA 4H5FA 2HAVA 3RTWB 1PB7A 4GOTA 5JTYB 3SERA 1OVTA 2D5WA 3PMVA 2QL3A 4OTEA 4OEUA 4N07A 3U92A 4FE8A 1MH4A 4NF8B 1VFDA 3A3UA 2O7UA 1Y3QA 1PBQA 4X1BA 3HN0A 2O69A 1LAGE 3TEPA 5A5XB 5CBRA 1R9QA 5IKBA 5H8HB 1LFIA 4TLMB 4N13A 1MXXA 3LC8A 1ELJA 2Z8FA 4I9DA 1UTBA 1EZOA 2P2AA 2QSXA 1QW0A 4R72A 3ECRA 2UVJA 3LSXA 3KSJA 5DEXB 2DWAA 2O7IA 4RPNA 3UA8A 5ICQA 4GXAA 4F3SA 1B58A 5I84A 3SEVA 2REGA 1TFAA 3IJXB 3W9WA 1SW2A 4NF5B 3T96B 1MXZA 3MW0A 3DLNA 4DXUA 4LZ7A 5I2KB 3T9VA 4FEBA 1M5DA 1FQDA 1YCJA 5AA4B 3L6GA 4R9FA 5I56A 4XKRA 4GF8A 1IXGA 1Y3PA 1Q1KA 2IEEA 4F19A 1Q35A 4R6HA 3S2VA 4F18A 4IO5A 5K2XA 3DP6A 3V83A 3JV9A 3SEYA 3KJ7A 5TP9A 3TCGA 4LA9A 4R73A 1MG1A 3JZJA 4YB7A 4F1YA 3K6VA 1LFGA 2OWTA 1IEJA 1POTA 1ZTYA 3PPOA 3PMWA 4QF9A 2KLFA 2I3VA 4I8CA 3AXFA 3GBAA 4GIZA 2NWJA 4U4SA 2F34A 1MS7A 3G3FA 5M2VA 2Z23A 5L9MA 1FQBA 2Y7PA 3O28A 3DP8A 1JVYA 3N6UA 3KEIA 3MZ9A 4FATA 4NF6A 1LCFA 1ZLQA 3UK4A 5DYHA 2XHDA 4E0WA 1MQJA 5H8NA 3GZGA 4UA8A 1H45A 1S7YA 3H6UA 1VR5A 2F6PA 2RINA 3VXCA 5I2NB 2F7BA 3TQLA 3VLWA 3MP6A 1NH7A 2ZNUA 3B6WA 3LSLA 1EU8A 3TCFA 2A5TA 4NWDA 4EQ9A 1OVBA 1USYH 3K2DA 2I48A 4R2BA 3S9LC 4HCWA 1IXIA 3T9HB 3FZVA 2H25A 1QUIA 1GGGA 1XC1A 3MPKA 2X7QA 1B9JA 1JNFA 2E0SA 1XHYA 2ONRA 4GL8A 2O68A 4GRKA 3H3GA 3FD3A 1HSJA 3CSGA 2QRYA 2HZKA 4IO6A 3IJOB 4RNSA 1PBPA 5DVIA 4G8NA 2V84A 3H4ZA 3HHGA 1AOVA 4DCXA 3PPQA 3PMXA 3U72A 3IOVA 3IOTA 1A8FA 1FQCA 1ZIUA 3U8QA 1AMFA 4YU0A 3S4UA 2XXUA 4PFUA 3TPAA 5AA2A 1EZ9A 3Q26A 3N26A 3HCQA 3VVDA 4P0IA 2XD2A 4JSDA 2AYSA 2B3BA 4JWYA 3FVNA 1BKAA 3E9XA 1M5FA 1NFTA 1MM7A 1ZU0A 4O3AA 1O64A 2V93A 3IK6B 5CRYA 5ICTA 3G3GA 3I3VA 3G3KA 4I1DA 2QS3A 3CFLA 2V3QA 1FQFA 1H43A 2X26A 1D4NA 4DE8A 4G68B 1AIVA 1FTLA 2R9JA 3O2AA 2IA4A 4EUOA 1S50A 1N7WA 1II5A 1Z7ME 2OCUA 3G3JA 1B0LA 5I57B 2AIXA 3TZAA 3EHTA 3C33A 3MQ9A 1FTKA 1LBCA 1MY4A 4GLIA 3DM0A 4NMYA 3K6XA 1XT8A 4RPOA 1O7TA 2DWIA 4XTCQ 3FV2A 4X48A 4BLAA 2UYFA 2B65A 3FASA 3RTFB 4IGRA 2Q8JA 3MP8A 3FXUA 3D4CA 1JETA 3I5OA 5ELVA 3IB0A 1RKMA 3K1PA 4EQ7A 2QJEA 2I49A 4M1VA 1Y20A 3LSWA 4C1TA 3BFUA 2PT1A 4C0RA 1GVCA 2HFBA 1QJMA 3QYTA 1OQGA 3OENA 2D3IA 3TODA 4QSDA 1A55A 1L5TA 4BDQA 4H8JA 1B05A 1URDA 4ELQA 2Q88A 4YAHX 2VP1A 4ND9A 1M5EA 4RXLA 1TWYA 3IL1B 2DP8A 3H6WA 5H8FB 2PMSA 2OJTA 1QKAA 4F31B 5KCJA 4YB5A 2DS9A 3K4UA 1IXHA 1H44A 1A99A 3W9VA 3CFXA 4OZ9A 4ELRA 3C36A 5I58A 2RCBA 3RY3A 1SD3A 1DTZA 5H8QB 4U4XA 3R26A 4RK2A 1LCTA 5CM6A 2I3WA 2XXTA 2NVUB 2XXRA 5HBCA 1R6ZA 3TELA 1SYHA 2XD3A 1OMPA 4OWDA 4ISUA 2LAOA 3MC2A 2CZLA 3BKIB 2DWHA 3PPRA 3R7XA 1DOTA 4XKNA 3VXBA 1TXFA 3IOWA 3QXMA 1N3WA 4QFOA 1PEBA 4OQOA 4QFNA 3THIA 1SBPA 1JEVA 3KSXA 3BFTA 2Y7WA 4ONYA 1WVJA 1LAHE 3BBRA 4OEVA 3C34A 2H5YA 5AA2D 5KDTA 4LQ2A 1NKXA 1UIUA 4U21A 1B0HA 3FVKA 3OMBA 4LZ5A 4H0WA 4OERA 3SEWA 3CSBA 3V89B 1DPEA 1B3FA 3FATA 5DTBA 4JB7A 1LB9A 3C35A 1US4A 3OELA 1IUDA 1MXYA 2XXXA 3MAMA 3TTRA 3TKDA 3ZS6A 5L8DA 4ELPA 3H03A 1R1NA 2M8CA 4YKIA 1Z7NE 1LSTA 2NXOA 4OMBA 4Z7EA 1B4HA 3FIRA 3GBBA 3R6UA 2VOZA 3HHFA 5EHSA 2DVCA 2O84X 4NE4A 4P0GA 2YPNA 2GHBA 3T22A 1QUJA 1R9LA 4KD5A 2ONSA 1B6HA 3N94A 2V25A 2DXYA 2ANJA 1NNTA 2CMOA 1Y9UA 3OO8A 4GWOA 4GVOA 4DXBA 2QPQA 4IY6A 5TU0A 4NF5A 1MXVA 1MH3A 1I6QA 3RUMA 3I6VA 1FTOA 3TTLA 3TMGA 1P1OA 2HEUA 2FYIA 4F1UA 1VSOA 3RN8A 4ZEDA 2HCAA 3OOAA 1LGBC 5I56B 1S9TA 2ESNA 2THIA 1FW0A 2REJA 1YPNA 1P99A 2F35A 3RT8A 4LUBA 1XVYA 1HSEA 1PB9A 4OFJA 1IQ7A 3RGYA 2B3FA 2D21A 2O1MA 4G68C 4PQJA 2Y7IA 4ZEBA 3ILUB 4OYVA 1Y1ZA 5TP9B 1LAFE 5EYFA 3LR1A 2F78A 5ITOA 3Q27A 4OENA 3KOSA 1B1HA 3TYHA 1OIBA 2FA7A 4G8HA 5IAIA 3B7DA 2VGQA 1FTMA 3QSLA 4K3FA 1LBBA 4WEPA 4DXCA 3UORA 4BDNA 4R2FA 2DQVA 3IAZA 4BDLA 4ZEFA 4TQUQ 3ZKKA 5HPQA 3JYRA 1B51A 3TTMA 1ZMGA 4NF6B 4Q8RA 1MPCA 3MJNA 3KBRA 5JK4A 5H8NB 1H76A 3PUVE 3QUJA 4FECA 1BIYA 2QS4A 1ANFA 4BDMA 1JW4A 4F3PA 4OFOA 1LB8A 1D3KA 5CI5A 3QK6A 4QFPA 3K6WA 1DPPA 1MDQA 4EF2A 4R6YA 2A5TB 2Q9TA 2PYYA 4Q30B 2DOJA 3HO7A 4PFWA 4E0XA 1LLSA 3UIFA 3K00A 3O66A 1IITA 1KWHA 3IO4A 2DVZA 5BUUA 3CG1A 4JXIA 5B70A 3MVXA 4ZE9A 1H3DA 2ZMBA 4KI0E 1FQEA 3S9NC 3KFMA 3Q28A 5KZTA 3LUYA 3V5AA 1Y4TA 3FVOA 3K02A 1XVXA 4NF4A 2XXVA 4LP2B 2UXAA 5JEIA 1MM6A 4G4PA 3CG3A 3E4RA 4DIGA 3KN3A 5AA2B 3ZKLA 1CE2A 4U23A 2F5XA 2ABHA 5ITPA 3RPWA 5DVFA 1YTVA 4IGTA 4WXJA 1SI1A 3G3IA 3FVGA 4NWCA 4X1DA 3B6TA 1JW5A 3EPEA 2FNCA 2VHAA 1BTJA 3L6HA 4ZDMA 3TTKA 1QULA 2GRVA 2YLNA 4DCYA 3T9XB 2DSFA 4DLDA 1B4ZA 4I62A 4OESA 2A5SA 2P0SA 1URGA 1P1NA 4Z0IA 1OLAA 1UTHA 4MF3A 3VFJA 3KN7A 3G3HA 4POXA 1A8EA 1SQYA 1LFHA 1N84A 2R6GE 2UVGA 1RYXA 4H8IA 4XIGQ 3M3FA 3WAFA 1CB6A 1UQWA 1B3LA 3PUZE 1BP5A 2QMXA 4OETA 2ZXTA 5TPAA 1N3XA 2DXRA 4AB5A 3MZ1A 4F39A 4C1UA 2RC8A 3FJ7A 1NNKA 3HV1A 4KFQA 1EZPA 1J1NA 3FJGA 2E1SA 4QFLA 1MQDA 3OEMA 3H6VA 3PPNA 1MY1A 4G2ZA 1N76A 4PFYA 3CI8A 4IB2A 1OQHA 1Y4CA 3OSQA 2P1SA 4AQ4A 3T66A 2QMWA 3IO6A 2ONKE 4ZS9A 4ELOA 2XXWA 5CMKA 2YJPA 2Z22A 3IX1A 3OXNA 2RKMA 3P7IA 4KYDA 1IXCA 2AL4A 3T9UA 2GFEA 2I4CA 5H8FA 4OXVA 4MBPA 1A7LA 5CMMA 4JWXA 4JWOA 4M4GA 3TFLA 3IR1A 4O3BA 2ZNSA 4XKPA 3OO7A 4YKPA 2OK2A 5I58B 2XXHA 3O6IA 1Y3NA 4YZZA 3MBPA 1PDAA 3E13X 4F1VA 2O6AA 3N5LA 2RC9A 1B7HA 4H65A 2NOOA 4YICA 3OSRA 2Y7RA 2OLBA 5FHMA 4FJPA 4GXSB 5I59A 4NEDA 4ZZAA 1QVSA 2V3TA 4U1ZA 3VE1B 4JSOA 4QSEA 1JEUA 4EF1A 5CBSA 1SVXB 3TCHA 5J1DA 1N7XA 3M3LA 3MUQA 3H7MA 2I58A 4KCCA 3O9PA 1QUKA 1B7UA 4R6KA 3MP1A 4NTLA 3MPLA 3MVYA 5HM4B 3S9EA 1JW1A 1M5BA 3KG2A 5KDTB 4G8MA 4Q0CA 3VVFA 1PB8A 4F29A 4IY5A 3B6QA 2PX1A 2WKYA 4YMAA 4RK9A 3FV1A 3LBSA 2F7AA 4F3BA 2VD2A 3V8XB 4MLQA 4YKJA 5CMBA 4ESWA 3USDA 1JVXA 5FTHA 2UVHA 3CVGA 2I4BA 3EQ1A 5JTYA 1MY2A 1MXUA 3ODBA 4ESXA 2F97A 3EHSA 1NNPA 5ISUA 1TT1A 3U93A 2OBGA 1MXWA 4YB6A 2DYXA 2NUVA 4XXUA 4NF8A 1B3EA 1B2HA 1N04A 2OWSA 1B32A 2G29A 5A5XA 2X7PA 3W15C 1I6BA 2QS2A 2I6EA 5H8HA 4GL0A 4R74A 1B46A 1MY3A 5LOMA 1DMBA 1B3GA 2F6GA 4POWA 1P1QA 3SEXA 1UTBB 3M8UA 3EN3A 1US5A 5DEXA 3ZSFA 3IOUA 5CC2A 2Z8EA 3EF7A 3IB2A 3SDFA 3FGSA 5CMCA 4F2QA 2XX8A 1YAEA 1P1UA 1NH8A 3MVWA 3UGWA 3A09A 5I2KA 3PU5A 3T93B 4F3GA 4O3CA 1ATGA 4PE5B 2H98A 3O29A 4LQ5A 5AA4A 4EDPA 1NL5A 5F7VA 3CR9A 3OEKA 3UP9A 4IO7A 3DELB 4EQBA 3CIJA 3KJTA 4FIMA 1FTJA 1MY0A 3FUZA 3MWBA 4JDFA 4DZ1A 4LZ8A 5B7DA 3HPIA 4RY1A 1TFDA 1NNFA 1A54A 4RA1A 4G77A 3N6TA 1GV8A 4U1OA 2UYEA 2F8DA 4MFIA 3D4GA 1B7ZA 2DWJA 5L9OA 3RNNA 2DE4A 4KYEA 3VLVA 4P11A 3K6UA 5H8SA 4OVJA 3K1MA 1USYE 1I6AA 1N0TA 3QAXA 2O51A 2Q89A 4TOZA 4WKMA 1SYIA 2HQ0A 3KGCA 1WDNA 3PUXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y7K A;  4PP0 A;  3KZG A;  1UIV A;  3TQW A;  4DDD A;  4R9G A;  2ZYN A;  4MLV A;  4Q5T A;  4HS7 A;  3RQT A;  1D9V A;  5I2N A;  1QKB A;  5AA3 A;  3CFZ A;  3FJM A;  2PVU A;  2ZNT A;  1F9B A;  3MVZ A;  3LSF B;  4L17 A;  1FQA A;  4ZEK A;  1DSN A;  3CRB A;  4PET A;  1SW1 A;  1M5C A;  4R75 A;  2R71 A;  1B5H A;  2GHA A;  1GTK A;  1SW5 A;  4N6P A;  5K2Y A;  3PGF A;  3DP4 A;  3EHU A;  1D9Y A;  1I69 A;  3ONM A;  2H4I A;  2G93 A;  1ZKB A;  4YKK A;  3Q25 A;  5FTI A;  3SES A;  5DVJ A;  1MRP A;  1ZBM A;  2F36 A;  4KPT A;  3TUS A;  2HXW A;  2H9B A;  4EXK A;  4LVQ A;  1B5I A;  3H6T A;  3U1O A;  4BDR A;  1SW4 A;  4BDO A;  2Q2A A;  3Q29 A;  4WED A;  5AE4 A;  4NF4 B;  4LAT A;  3VVE A;  2DE2 A;  3PD9 A;  3RT6 B;  5EHM A;  2Q2C A;  3IOR A;  3O6G A;  4ECF A;  3K0V A;  4QSC A;  3C9H A;  3PV0 E;  2XXI A;  5BWJ A;  2HAU A;  2UVI A;  4OFL A;  4KHZ E;  2OZZ A;  1B5J A;  4GD5 A;  2XXQ A;  3F11 A;  2O1L A;  3K01 A;  3ILT B;  1B52 A;  3M3K A;  2HZL A;  1LAX A;  1VFE A;  5FHO A;  4HTG A;  3VLU A;  4RYA A;  4U22 A;  3C32 A;  1WOD A;  3SEU A;  4H5G A;  1SI0 A;  5L9S A;  3E3K A;  3TTN A;  1XS5 A;  2ZYO A;  2V3U A;  1UTH B;  4FAJ A;  3FXR A;  3HST A;  4G68 A;  2PT2 A;  4H67 A;  2QS1 A;  2Z8D A;  2XXP A;  4IO2 A;  5I57 A;  1MQH A;  3SKP A;  1BLF A;  3GLB A;  4IO4 A;  4ZZE A;  1JQF A;  4PFT A;  1B40 A;  3OD7 A;  1VE4 A;  2RC7 A;  4THI A;  1MPD A;  5TPA B;  4ZEI A;  3PUW E;  2VD3 A;  3GXA A;  1IIW A;  2I0C A;  3TAJ A;  1P1W A;  4U2R A;  4XKQ A;  4QHQ A;  4ZE8 A;  4RJZ A;  3FXQ A;  3QIM A;  4ZEC A;  2ZYK A;  3IB1 A;  2BJJ X;  3OO6 A;  1B3H A;  3O97 A;  1MDP 1;  1GR2 A;  2XX7 A;  1O63 A;  3RLF E;  4TLL B;  3G7W A;  2XX9 A;  1ZJL A;  4UAC A;  2DE3 A;  4H1X A;  1Y1M A;  2PBW A;  4HCY A;  4YMB A;  4OHN A;  3SET A;  2GH9 A;  3VV5 A;  1EH3 A;  5KCJ B;  3A3C A;  1MQI A;  2AL5 A;  2W7Y A;  5AA1 A;  4EXL A;  4FED A;  4KR5 A;  2RF1 A;  4IO3 A;  2ZYM A;  3C31 A;  3H06 B;  1DTG A;  2RCA A;  5H8Q A;  4H6D A;  4F2O A;  4JBZ A;  1IZ1 A;  1NMU A;  2Y84 A;  5DT6 A;  1MPB A;  1A40 A;  3MZB A;  1PC3 A;  4QRZ A;  4MH5 A;  1B1X A;  4GFR A;  3PD8 A;  3PPP A;  4KCD A;  3O6H A;  3TDJ A;  3S9M C;  5I59 B;  1AH5 A;  4F22 A;  3U94 A;  2H99 A;  3OO9 A;  3PUY E;  2I0B A;  1AL3 A;  5F1Q A;  1MQG A;  4GQO A;  1SDX A;  2XXY A;  1OLC A;  1XOC A;  1T0K A;  1HSL A;  2ALU A;  3VDF A;  3C4M A;  4FOR A;  4KYS A;  3QUF A;  3UN6 A;  1URS A;  4KQP A;  1FCK A;  3K1N A;  4LON B;  4HW8 A;  5FHN A;  4X9T A;  4AB6 A;  3KN8 A;  1RYO A;  3KOT A;  3WAE A;  1POY 1;  2F7C A;  4QFK A;  4H5F A;  2HAV A;  3RTW B;  1PB7 A;  4GOT A;  5JTY B;  3SER A;  1OVT A;  2D5W A;  3PMV A;  2QL3 A;  4OTE A;  4OEU A;  4N07 A;  3U92 A;  4FE8 A;  1MH4 A;  4NF8 B;  1VFD A;  3A3U A;  2O7U A;  1Y3Q A;  1PBQ A;  4X1B A;  3HN0 A;  2O69 A;  1LAG E;  3TEP A;  5A5X B;  5CBR A;  1R9Q A;  5IKB A;  5H8H B;  1LFI A;  4TLM B;  4N13 A;  1MXX A;  3LC8 A;  1ELJ A;  2Z8F A;  4I9D A;  1UTB A;  1EZO A;  2P2A A;  2QSX A;  1QW0 A;  4R72 A;  3ECR A;  2UVJ A;  3LSX A;  3KSJ A;  5DEX B;  2DWA A;  2O7I A;  4RPN A;  3UA8 A;  5ICQ A;  4GXA A;  4F3S A;  1B58 A;  5I84 A;  3SEV A;  2REG A;  1TFA A;  3IJX B;  3W9W A;  1SW2 A;  4NF5 B;  3T96 B;  1MXZ A;  3MW0 A;  3DLN A;  4DXU A;  4LZ7 A;  5I2K B;  3T9V A;  4FEB A;  1M5D A;  1FQD A;  1YCJ A;  5AA4 B;  3L6G A;  4R9F A;  5I56 A;  4XKR A;  4GF8 A;  1IXG A;  1Y3P A;  1Q1K A;  2IEE A;  4F19 A;  1Q35 A;  4R6H A;  3S2V A;  4F18 A;  4IO5 A;  5K2X A;  3DP6 A;  3V83 A;  3JV9 A;  3SEY A;  3KJ7 A;  5TP9 A;  3TCG A;  4LA9 A;  4R73 A;  1MG1 A;  3JZJ A;  4YB7 A;  4F1Y A;  3K6V A;  1LFG A;  2OWT A;  1IEJ A;  1POT A;  1ZTY A;  3PPO A;  3PMW A;  4QF9 A;  2KLF A;  2I3V A;  4I8C A;  3AXF A;  3GBA A;  4GIZ A;  2NWJ A;  4U4S A;  2F34 A;  1MS7 A;  3G3F A;  5M2V A;  2Z23 A;  5L9M A;  1FQB A;  2Y7P A;  3O28 A;  3DP8 A;  1JVY A;  3N6U A;  3KEI A;  3MZ9 A;  4FAT A;  4NF6 A;  1LCF A;  1ZLQ A;  3UK4 A;  5DYH A;  2XHD A;  4E0W A;  1MQJ A;  5H8N A;  3GZG A;  4UA8 A;  1H45 A;  1S7Y A;  3H6U A;  1VR5 A;  2F6P A;  2RIN A;  3VXC A;  5I2N B;  2F7B A;  3TQL A;  3VLW A;  3MP6 A;  1NH7 A;  2ZNU A;  3B6W A;  3LSL A;  1EU8 A;  3TCF A;  2A5T A;  4NWD A;  4EQ9 A;  1OVB A;  1USY H;  3K2D A;  2I48 A;  4R2B A;  3S9L C;  4HCW A;  1IXI A;  3T9H B;  3FZV A;  2H25 A;  1QUI A;  1GGG A;  1XC1 A;  3MPK A;  2X7Q A;  1B9J A;  1JNF A;  2E0S A;  1XHY A;  2ONR A;  4GL8 A;  2O68 A;  4GRK A;  3H3G A;  3FD3 A;  1HSJ A;  3CSG A;  2QRY A;  2HZK A;  4IO6 A;  3IJO B;  4RNS A;  1PBP A;  5DVI A;  4G8N A;  2V84 A;  3H4Z A;  3HHG A;  1AOV A;  4DCX A;  3PPQ A;  3PMX A;  3U72 A;  3IOV A;  3IOT A;  1A8F A;  1FQC A;  1ZIU A;  3U8Q A;  1AMF A;  4YU0 A;  3S4U A;  2XXU A;  4PFU A;  3TPA A;  5AA2 A;  1EZ9 A;  3Q26 A;  3N26 A;  3HCQ A;  3VVD A;  4P0I A;  2XD2 A;  4JSD A;  2AYS A;  2B3B A;  4JWY A;  3FVN A;  1BKA A;  3E9X A;  1M5F A;  1NFT A;  1MM7 A;  1ZU0 A;  4O3A A;  1O64 A;  2V93 A;  3IK6 B;  5CRY A;  5ICT A;  3G3G A;  3I3V A;  3G3K A;  4I1D A;  2QS3 A;  3CFL A;  2V3Q A;  1FQF A;  1H43 A;  2X26 A;  1D4N A;  4DE8 A;  4G68 B;  1AIV A;  1FTL A;  2R9J A;  3O2A A;  2IA4 A;  4EUO A;  1S50 A;  1N7W A;  1II5 A;  1Z7M E;  2OCU A;  3G3J A;  1B0L A;  5I57 B;  2AIX A;  3TZA A;  3EHT A;  3C33 A;  3MQ9 A;  1FTK A;  1LBC A;  1MY4 A;  4GLI A;  3DM0 A;  4NMY A;  3K6X A;  1XT8 A;  4RPO A;  1O7T A;  2DWI A;  4XTC Q;  3FV2 A;  4X48 A;  4BLA A;  2UYF A;  2B65 A;  3FAS A;  3RTF B;  4IGR A;  2Q8J A;  3MP8 A;  3FXU A;  3D4C A;  1JET A;  3I5O A;  5ELV A;  3IB0 A;  1RKM A;  3K1P A;  4EQ7 A;  2QJE A;  2I49 A;  4M1V A;  1Y20 A;  3LSW A;  4C1T A;  3BFU A;  2PT1 A;  4C0R A;  1GVC A;  2HFB A;  1QJM A;  3QYT A;  1OQG A;  3OEN A;  2D3I A;  3TOD A;  4QSD A;  1A55 A;  1L5T A;  4BDQ A;  4H8J A;  1B05 A;  1URD A;  4ELQ A;  2Q88 A;  4YAH X;  2VP1 A;  4ND9 A;  1M5E A;  4RXL A;  1TWY A;  3IL1 B;  2DP8 A;  3H6W A;  5H8F B;  2PMS A;  2OJT A;  1QKA A;  4F31 B;  5KCJ A;  4YB5 A;  2DS9 A;  3K4U A;  1IXH A;  1H44 A;  1A99 A;  3W9V A;  3CFX A;  4OZ9 A;  4ELR A;  3C36 A;  5I58 A;  2RCB A;  3RY3 A;  1SD3 A;  1DTZ A;  5H8Q B;  4U4X A;  3R26 A;  4RK2 A;  1LCT A;  5CM6 A;  2I3W A;  2XXT A;  2NVU B;  2XXR A;  5HBC A;  1R6Z A;  3TEL A;  1SYH A;  2XD3 A;  1OMP A;  4OWD A;  4ISU A;  2LAO A;  3MC2 A;  2CZL A;  3BKI B;  2DWH A;  3PPR A;  3R7X A;  1DOT A;  4XKN A;  3VXB A;  1TXF A;  3IOW A;  3QXM A;  1N3W A;  4QFO A;  1PEB A;  4OQO A;  4QFN A;  3THI A;  1SBP A;  1JEV A;  3KSX A;  3BFT A;  2Y7W A;  4ONY A;  1WVJ A;  1LAH E;  3BBR A;  4OEV A;  3C34 A;  2H5Y A;  5AA2 D;  5KDT A;  4LQ2 A;  1NKX A;  1UIU A;  4U21 A;  1B0H A;  3FVK A;  3OMB A;  4LZ5 A;  4H0W A;  4OER A;  3SEW A;  3CSB A;  3V89 B;  1DPE A;  1B3F A;  3FAT A;  5DTB A;  4JB7 A;  1LB9 A;  3C35 A;  1US4 A;  3OEL A;  1IUD A;  1MXY A;  2XXX A;  3MAM A;  3TTR A;  3TKD A;  3ZS6 A;  5L8D A;  4ELP A;  3H03 A;  1R1N A;  2M8C A;  4YKI A;  1Z7N E;  1LST A;  2NXO A;  4OMB A;  4Z7E A;  1B4H A;  3FIR A;  3GBB A;  3R6U A;  2VOZ A;  3HHF A;  5EHS A;  2DVC A;  2O84 X;  4NE4 A;  4P0G A;  2YPN A;  2GHB A;  3T22 A;  1QUJ A;  1R9L A;  4KD5 A;  2ONS A;  1B6H A;  3N94 A;  2V25 A;  2DXY A;  2ANJ A;  1NNT A;  2CMO A;  1Y9U A;  3OO8 A;  4GWO A;  4GVO A;  4DXB A;  2QPQ A;  4IY6 A;  5TU0 A;  4NF5 A;  1MXV A;  1MH3 A;  1I6Q A;  3RUM A;  3I6V A;  1FTO A;  3TTL A;  3TMG A;  1P1O A;  2HEU A;  2FYI A;  4F1U A;  1VSO A;  3RN8 A;  4ZED A;  2HCA A;  3OOA A;  1LGB C;  5I56 B;  1S9T A;  2ESN A;  2THI A;  1FW0 A;  2REJ A;  1YPN A;  1P99 A;  2F35 A;  3RT8 A;  4LUB A;  1XVY A;  1HSE A;  1PB9 A;  4OFJ A;  1IQ7 A;  3RGY A;  2B3F A;  2D21 A;  2O1M A;  4G68 C;  4PQJ A;  2Y7I A;  4ZEB A;  3ILU B;  4OYV A;  1Y1Z A;  5TP9 B;  1LAF E;  5EYF A;  3LR1 A;  2F78 A;  5ITO A;  3Q27 A;  4OEN A;  3KOS A;  1B1H A;  3TYH A;  1OIB A;  2FA7 A;  4G8H A;  5IAI A;  3B7D A;  2VGQ A;  1FTM A;  3QSL A;  4K3F A;  1LBB A;  4WEP A;  4DXC A;  3UOR A;  4BDN A;  4R2F A;  2DQV A;  3IAZ A;  4BDL A;  4ZEF A;  4TQU Q;  3ZKK A;  5HPQ A;  3JYR A;  1B51 A;  3TTM A;  1ZMG A;  4NF6 B;  4Q8R A;  1MPC A;  3MJN A;  3KBR A;  5JK4 A;  5H8N B;  1H76 A;  3PUV E;  3QUJ A;  4FEC A;  1BIY A;  2QS4 A;  1ANF A;  4BDM A;  1JW4 A;  4F3P A;  4OFO A;  1LB8 A;  1D3K A;  5CI5 A;  3QK6 A;  4QFP A;  3K6W A;  1DPP A;  1MDQ A;  4EF2 A;  4R6Y A;  2A5T B;  2Q9T A;  2PYY A;  4Q30 B;  2DOJ A;  3HO7 A;  4PFW A;  4E0X A;  1LLS A;  3UIF A;  3K00 A;  3O66 A;  1IIT A;  1KWH A;  3IO4 A;  2DVZ A;  5BUU A;  3CG1 A;  4JXI A;  5B70 A;  3MVX A;  4ZE9 A;  1H3D A;  2ZMB A;  4KI0 E;  1FQE A;  3S9N C;  3KFM A;  3Q28 A;  5KZT A;  3LUY A;  3V5A A;  1Y4T A;  3FVO A;  3K02 A;  1XVX A;  4NF4 A;  2XXV A;  4LP2 B;  2UXA A;  5JEI A;  1MM6 A;  4G4P A;  3CG3 A;  3E4R A;  4DIG A;  3KN3 A;  5AA2 B;  3ZKL A;  1CE2 A;  4U23 A;  2F5X A;  2ABH A;  5ITP A;  3RPW A;  5DVF A;  1YTV A;  4IGT A;  4WXJ A;  1SI1 A;  3G3I A;  3FVG A;  4NWC A;  4X1D A;  3B6T A;  1JW5 A;  3EPE A;  2FNC A;  2VHA A;  1BTJ A;  3L6H A;  4ZDM A;  3TTK A;  1QUL A;  2GRV A;  2YLN A;  4DCY A;  3T9X B;  2DSF A;  4DLD A;  1B4Z A;  4I62 A;  4OES A;  2A5S A;  2P0S A;  1URG A;  1P1N A;  4Z0I A;  1OLA A;  1UTH A;  4MF3 A;  3VFJ A;  3KN7 A;  3G3H A;  4POX A;  1A8E A;  1SQY A;  1LFH A;  1N84 A;  2R6G E;  2UVG A;  1RYX A;  4H8I A;  4XIG Q;  3M3F A;  3WAF A;  1CB6 A;  1UQW A;  1B3L A;  3PUZ E;  1BP5 A;  2QMX A;  4OET A;  2ZXT A;  5TPA A;  1N3X A;  2DXR A;  4AB5 A;  3MZ1 A;  4F39 A;  4C1U A;  2RC8 A;  3FJ7 A;  1NNK A;  3HV1 A;  4KFQ A;  1EZP A;  1J1N A;  3FJG A;  2E1S A;  4QFL A;  1MQD A;  3OEM A;  3H6V A;  3PPN A;  1MY1 A;  4G2Z A;  1N76 A;  4PFY A;  3CI8 A;  4IB2 A;  1OQH A;  1Y4C A;  3OSQ A;  2P1S A;  4AQ4 A;  3T66 A;  2QMW A;  3IO6 A;  2ONK E;  4ZS9 A;  4ELO A;  2XXW A;  5CMK A;  2YJP A;  2Z22 A;  3IX1 A;  3OXN A;  2RKM A;  3P7I A;  4KYD A;  1IXC A;  2AL4 A;  3T9U A;  2GFE A;  2I4C A;  5H8F A;  4OXV A;  4MBP A;  1A7L A;  5CMM A;  4JWX A;  4JWO A;  4M4G A;  3TFL A;  3IR1 A;  4O3B A;  2ZNS A;  4XKP A;  3OO7 A;  4YKP A;  2OK2 A;  5I58 B;  2XXH A;  3O6I A;  1Y3N A;  4YZZ A;  3MBP A;  1PDA A;  3E13 X;  4F1V A;  2O6A A;  3N5L A;  2RC9 A;  1B7H A;  4H65 A;  2NOO A;  4YIC A;  3OSR A;  2Y7R A;  2OLB A;  5FHM A;  4FJP A;  4GXS B;  5I59 A;  4NED A;  4ZZA A;  1QVS A;  2V3T A;  4U1Z A;  3VE1 B;  4JSO A;  4QSE A;  1JEU A;  4EF1 A;  5CBS A;  1SVX B;  3TCH A;  5J1D A;  1N7X A;  3M3L A;  3MUQ A;  3H7M A;  2I58 A;  4KCC A;  3O9P A;  1QUK A;  1B7U A;  4R6K A;  3MP1 A;  4NTL A;  3MPL A;  3MVY A;  5HM4 B;  3S9E A;  1JW1 A;  1M5B A;  3KG2 A;  5KDT B;  4G8M A;  4Q0C A;  3VVF A;  1PB8 A;  4F29 A;  4IY5 A;  3B6Q A;  2PX1 A;  2WKY A;  4YMA A;  4RK9 A;  3FV1 A;  3LBS A;  2F7A A;  4F3B A;  2VD2 A;  3V8X B;  4MLQ A;  4YKJ A;  5CMB A;  4ESW A;  3USD A;  1JVX A;  5FTH A;  2UVH A;  3CVG A;  2I4B A;  3EQ1 A;  5JTY A;  1MY2 A;  1MXU A;  3ODB A;  4ESX A;  2F97 A;  3EHS A;  1NNP A;  5ISU A;  1TT1 A;  3U93 A;  2OBG A;  1MXW A;  4YB6 A;  2DYX A;  2NUV A;  4XXU A;  4NF8 A;  1B3E A;  1B2H A;  1N04 A;  2OWS A;  1B32 A;  2G29 A;  5A5X A;  2X7P A;  3W15 C;  1I6B A;  2QS2 A;  2I6E A;  5H8H A;  4GL0 A;  4R74 A;  1B46 A;  1MY3 A;  5LOM A;  1DMB A;  1B3G A;  2F6G A;  4POW A;  1P1Q A;  3SEX A;  1UTB B;  3M8U A;  3EN3 A;  1US5 A;  5DEX A;  3ZSF A;  3IOU A;  5CC2 A;  2Z8E A;  3EF7 A;  3IB2 A;  3SDF A;  3FGS A;  5CMC A;  4F2Q A;  2XX8 A;  1YAE A;  1P1U A;  1NH8 A;  3MVW A;  3UGW A;  3A09 A;  5I2K A;  3PU5 A;  3T93 B;  4F3G A;  4O3C A;  1ATG A;  4PE5 B;  2H98 A;  3O29 A;  4LQ5 A;  5AA4 A;  4EDP A;  1NL5 A;  5F7V A;  3CR9 A;  3OEK A;  3UP9 A;  4IO7 A;  3DEL B;  4EQB A;  3CIJ A;  3KJT A;  4FIM A;  1FTJ A;  1MY0 A;  3FUZ A;  3MWB A;  4JDF A;  4DZ1 A;  4LZ8 A;  5B7D A;  3HPI A;  4RY1 A;  1TFD A;  1NNF A;  1A54 A;  4RA1 A;  4G77 A;  3N6T A;  1GV8 A;  4U1O A;  2UYE A;  2F8D A;  4MFI A;  3D4G A;  1B7Z A;  2DWJ A;  5L9O A;  3RNN A;  2DE4 A;  4KYE A;  3VLV A;  4P11 A;  3K6U A;  5H8S A;  4OVJ A;  3K1M A;  1USY E;  1I6A A;  1N0T A;  3QAX A;  2O51 A;  2Q89 A;  4TOZ A;  4WKM A;  1SYI A;  2HQ0 A;  3KGC A;  1WDN A;  3PUX E; 
#chains in the Genus database with same CATH topology
 2Y7K A;  4PP0 A;  3KZG A;  1UIV A;  3TQW A;  4DDD A;  4R9G A;  2ZYN A;  5I7I A;  4MLV A;  4Q5T A;  4HS7 A;  1FPG A;  3RQT A;  1D9V A;  5I2N A;  1QKB A;  5AA3 A;  3CFZ A;  3FJM A;  2PVU A;  4GX6 A;  1SPI A;  2ZNT A;  4QBA A;  1F9B A;  3MVZ A;  4GX3 A;  3LSF B;  4L17 A;  4DI3 D;  1FQA A;  4ZEK A;  1DSN A;  3CRB A;  4PET A;  1RDX A;  1M5C A;  1SW1 A;  4R75 A;  2R71 A;  1B5H A;  2GHA A;  1GTK A;  1SW5 A;  4N6P A;  5K2Y A;  3RPL B;  3PGF A;  4PE3 A;  4N8G A;  4N81 A;  3DP4 A;  4OAN A;  3EHU A;  2GQ1 A;  3IFA A;  1D9Y A;  1I69 A;  3ONM A;  2H4I A;  2G93 A;  4PFR A;  1ZKB A;  1DBZ A;  4YKK A;  3Q25 A;  5FTI A;  3SES A;  5DVJ A;  1MRP A;  1ZBM A;  2F36 A;  4KPT A;  2XA5 A;  3TUS A;  2HXW A;  4NHB A;  2H9B A;  4EXK A;  5ET7 A;  4LVQ A;  1B5I A;  2PFZ A;  3H6T A;  3U1O A;  4BDR A;  1SW4 A;  1DCU A;  4BDO A;  2L5V A;  2Y5L A;  2Q2A A;  3Q29 A;  4WED A;  5AE4 A;  4NF4 B;  4LAT A;  1NV2 A;  3VVE A;  1LBV A;  2DE2 A;  3PD9 A;  3RT6 B;  5EHM A;  2Q2C A;  3IOR A;  3O6G A;  4ECF A;  3K0V A;  4QSC A;  3C9H A;  3PV0 E;  2XXI A;  5BWJ A;  4OVR A;  2HAU A;  2UVI A;  4P1E A;  1INP A;  5T3J A;  4OFL A;  4KHZ E;  2OZZ A;  1B5J A;  4JVD A;  4GD5 A;  2XXQ A;  3F11 A;  2O1L A;  3K01 A;  3ILT B;  4NGU A;  1B52 A;  3M3K A;  3B8B A;  2DDK A;  2HZL A;  1LAX A;  1VFE A;  5FHO A;  4HTG A;  3VLU A;  4RYA A;  1QGX A;  3MST A;  4U22 A;  3C32 A;  1WOD A;  3SEU A;  4H5G A;  1SI0 A;  5L9S A;  3E3K A;  3TTN A;  1XS5 A;  2ZYO A;  2V3U A;  1UTH B;  4FAJ A;  3FXR A;  3HST A;  4G68 A;  2PT2 A;  4PCD A;  4PBH A;  4H67 A;  2QS1 A;  2Z8D A;  2XXP A;  4IO2 A;  5I57 A;  1MQH A;  3SKP A;  1BLF A;  3GLB A;  4IO4 A;  4ZZE A;  1JQF A;  4PFT A;  1B40 A;  3OD7 A;  1VE4 A;  5I5P A;  2RC7 A;  4THI A;  1MPD A;  5TPA B;  2QVV A;  4ZEI A;  3PUW E;  2VD3 A;  3GXA A;  1IIW A;  2I0C A;  3TAJ A;  1P1W A;  4U2R A;  1JP4 A;  4XKQ A;  4QHQ A;  4ZE8 A;  4RJZ A;  3FXQ A;  3QIM A;  3E78 A;  4ZEC A;  2ZYK A;  3IB1 A;  4QXD A;  2BJJ X;  3OO6 A;  1B3H A;  3O97 A;  1MDP 1;  2KR0 A;  1GR2 A;  2XX7 A;  2OX3 A;  1O63 A;  5IZ1 A;  4TLL B;  3RLF E;  3G7W A;  4N17 A;  2XX9 A;  1ZJL A;  4UAC A;  2DE3 A;  4H1X A;  1Y1M A;  1FPL A;  2PBW A;  2WEF A;  4HCY A;  4I3Y A;  3IFC A;  4YMB A;  4OHN A;  3SET A;  3RYD A;  2GH9 A;  3VV5 A;  1EH3 A;  5KCJ B;  3A3C A;  1MQI A;  2AL5 A;  2W7Y A;  5AA1 A;  4EXL A;  4FED A;  4KR5 A;  4PBQ A;  2RF1 A;  4IO3 A;  2ZYM A;  4HE2 A;  3C31 A;  3H06 B;  1DTG A;  2RCA A;  5H8Q A;  4H6D A;  4F2O A;  4JBZ A;  1IZ1 A;  1NMU A;  2Y84 A;  5DT6 A;  1MPB A;  1A40 A;  3MZB A;  1PC3 A;  4QRZ A;  4MH5 A;  1B1X A;  4N4U A;  2Q8M A;  4GFR A;  3PD8 A;  3PPP A;  4KCD A;  3O6H A;  3TDJ A;  3S9M C;  5I59 B;  1AH5 A;  4F22 A;  3OO9 A;  2H99 A;  3U94 A;  3PUY E;  2I0B A;  1AL3 A;  5F1Q A;  1MQG A;  4HE1 A;  4GQO A;  2R8T A;  1SDX A;  2XXY A;  1OLC A;  2B4L A;  2ZZX A;  1XOC A;  1T0K A;  1HSL A;  2ALU A;  3VDF A;  3C4M A;  4FOR A;  4KYS A;  5ET6 A;  3QUF A;  3UN6 A;  1URS A;  1FBF A;  4KQP A;  1FCK A;  4P56 A;  1FPF A;  3K1N A;  4LON B;  4HW8 A;  5FHN A;  4X9T A;  4AB6 A;  3KN8 A;  1RYO A;  3KOT A;  3WAE A;  1POY 1;  4MJO A;  2F7C A;  4QFK A;  4H5F A;  2HAV A;  3RTW B;  1PB7 A;  2PCR A;  4GOT A;  5JTY B;  3SER A;  1OVT A;  3FXB A;  2D5W A;  3PMV A;  2QL3 A;  4OTE A;  4OEU A;  4N07 A;  3U92 A;  4FE8 A;  1MH4 A;  4O94 A;  4NF8 B;  1VFD A;  3A3U A;  2O7U A;  1Y3Q A;  4NQ8 A;  1PBQ A;  4X1B A;  3HN0 A;  2O69 A;  1LAG E;  3TEP A;  5A5X B;  5CBR A;  1R9Q A;  5IKB A;  5H8H B;  1LFI A;  4TLM B;  4N13 A;  1MXX A;  3LC8 A;  1ELJ A;  2Z8F A;  4I9D A;  1UTB A;  1EZO A;  2P2A A;  2QSX A;  1QW0 A;  4KXP A;  4R72 A;  3ECR A;  1NUX A;  2UVJ A;  3KSJ A;  3LSX A;  2DWA A;  4XF5 A;  2O7I A;  4RPN A;  4XEQ A;  5DEX B;  3UA8 A;  5ICQ A;  4GXA A;  4F3S A;  1B58 A;  5I84 A;  3SEV A;  2REG A;  1TFA A;  3IJX B;  3W9W A;  1SW2 A;  4NF5 B;  3T96 B;  1MXZ A;  3MW0 A;  3DLN A;  4DXU A;  4LZ7 A;  5I2K B;  3LV0 A;  3T9V A;  4FEB A;  1M5D A;  1NUY A;  1FQD A;  1YCJ A;  5AA4 B;  3T0J A;  3L6G A;  4R9F A;  2F3D A;  5I56 A;  4XKR A;  4MNP A;  4GF8 A;  1IXG A;  1Y3P A;  1EYJ A;  1Q1K A;  2IEE A;  4F19 A;  1Q35 A;  4R6H A;  3S2V A;  4F18 A;  4IO5 A;  5K2X A;  3DP6 A;  3V83 A;  3JV9 A;  3SEY A;  1K9Z A;  3KJ7 A;  5TP9 A;  3TCG A;  4LA9 A;  4R73 A;  1FBG A;  1MG1 A;  3JZJ A;  4X8R A;  4YB7 A;  1LBW A;  4F1Y A;  3K6V A;  1LFG A;  2OWT A;  1IEJ A;  1NV4 A;  1POT A;  1ZTY A;  4P3L A;  3PPO A;  3PMW A;  4QF9 A;  2KLF A;  2I3V A;  4I8C A;  2XWO A;  3AXF A;  3GBA A;  4GIZ A;  2NWJ A;  4U4S A;  2F34 A;  4UAB A;  1MS7 A;  3G3F A;  5M2V A;  2Z23 A;  5L9M A;  1FQB A;  3T1B A;  2Y7P A;  3O28 A;  3DP8 A;  3E79 A;  1JVY A;  3N6U A;  3KEI A;  3MZ9 A;  4FAT A;  4HE0 A;  1AWB A;  4NF6 A;  4GWX A;  4AS4 A;  1LCF A;  1ZLQ A;  3UK4 A;  5DYH A;  2XHD A;  1FSA A;  4E0W A;  1MQJ A;  5H8N A;  3GZG A;  4PAF A;  5EYH A;  4UA8 A;  1H45 A;  4NAP A;  1S7Y A;  3H6U A;  1VR5 A;  2F6P A;  2RIN A;  3VXC A;  3B50 A;  5I2N B;  2F7B A;  4PDH A;  3TQL A;  3VLW A;  3MP6 A;  1NH7 A;  4JVC A;  2ZNU A;  3B6W A;  1NV1 A;  1FJ9 A;  3LSL A;  1EU8 A;  3TCF A;  2A5T A;  4NWD A;  4EQ9 A;  4G61 A;  1KZ8 A;  4MIJ A;  1OVB A;  1USY H;  3K2D A;  2I48 A;  4R2B A;  3S9L C;  4HCW A;  1IXI A;  4OVP A;  3T9H B;  3FZV A;  2H25 A;  1QUI A;  1GGG A;  1XC1 A;  1G0I A;  3MPK A;  2X7Q A;  1B9J A;  1JNF A;  2E0S A;  1XHY A;  2ONR A;  4GL8 A;  2O68 A;  4GRK A;  3A29 A;  3H3G A;  1NV7 A;  3FD3 A;  1HSJ A;  3CSG A;  2QRY A;  2HZK A;  4IO6 A;  3IJO B;  5J16 A;  4RNS A;  1PBP A;  5DVI A;  4G8N A;  4H46 A;  2V84 A;  4JVI A;  3H4Z A;  3HHG A;  1AOV A;  4DCX A;  3PPQ A;  3PMX A;  3U72 A;  3IOV A;  3IOT A;  2WYK A;  1A8F A;  1FQC A;  1ZIU A;  3U8Q A;  1AMF A;  3MYU A;  4YU0 A;  3S4U A;  2XXU A;  4PFU A;  3TPA A;  5AA2 A;  1EZ9 A;  3Q26 A;  4OA4 A;  3N26 A;  3HCQ A;  4MMP A;  1IMD A;  1XI6 A;  3VVD A;  4P0I A;  1FBP A;  2XD2 A;  4JSD A;  2AYS A;  2B3B A;  4JWY A;  3FVN A;  1BKA A;  3E9X A;  1M5F A;  1NFT A;  2WBD A;  1MM7 A;  1ZU0 A;  4O3A A;  1O64 A;  2V93 A;  3IK6 B;  5CRY A;  4GBV A;  5ICT A;  3G3G A;  3I3V A;  3G3K A;  4I1D A;  2QS3 A;  3CFL A;  2V3Q A;  2ZZV A;  1YXI A;  1FQF A;  1H43 A;  3KC0 A;  2X26 A;  1D4N A;  4DE8 A;  4G68 B;  1AIV A;  1FTL A;  2R9J A;  3O2A A;  4PDD A;  2IA4 A;  2KQZ A;  4EUO A;  1S50 A;  1N7W A;  1II5 A;  1Z7M E;  2OCU A;  3G3J A;  1B0L A;  5I57 B;  2AIX A;  3TZA A;  3EHT A;  1YYZ A;  3C33 A;  3MQ9 A;  1FTK A;  1LBC A;  1MY4 A;  4GLI A;  5DW8 A;  3DM0 A;  4NN3 A;  4NMY A;  3K6X A;  1XT8 A;  4RPO A;  1O7T A;  2DWI A;  4XTC Q;  3FV2 A;  4X48 A;  4BLA A;  2UYF A;  2B65 A;  3FAS A;  3RTF B;  4IGR A;  1IMC A;  2Q8J A;  3MP8 A;  3FXU A;  3D4C A;  1FTA A;  2CEX A;  4NG7 A;  4PFI A;  1JET A;  4MNI A;  3I5O A;  5ELV A;  3IB0 A;  1RKM A;  3K1P A;  4EQ7 A;  2QJE A;  4LN5 A;  2I49 A;  4M1V A;  1Y20 A;  3LSW A;  4C1T A;  3BFU A;  2PT1 A;  2XWV A;  4I3E A;  4C0R A;  1GVC A;  1FBE A;  2HFB A;  1QJM A;  2P3N A;  3QYT A;  1OQG A;  3OEN A;  2D3I A;  1CNQ A;  3TOD A;  4QSD A;  1A55 A;  1L5T A;  4BDQ A;  1D9Q A;  4H8J A;  1B05 A;  1URD A;  4ELQ A;  2Q88 A;  4YAH X;  2VP1 A;  5ESY A;  4ND9 A;  1M5E A;  1EYK A;  4RXL A;  1TWY A;  3IL1 B;  2DP8 A;  3H6W A;  3CHG A;  5H8F B;  2PMS A;  2OJT A;  1QKA A;  4F31 B;  4N6K A;  5KCJ A;  4YB5 A;  1IME A;  2DS9 A;  3K4U A;  1IXH A;  1H44 A;  1A99 A;  3W9V A;  3CFX A;  4OZ9 A;  4ELR A;  3C36 A;  4GWW A;  4X04 A;  5I58 A;  2RCB A;  2CZH A;  1VDW A;  3RY3 A;  1SD3 A;  4OVQ A;  1DTZ A;  5H8Q B;  4U4X A;  2HHM A;  3R26 A;  4RK2 A;  1LCT A;  5CM6 A;  5IZ3 A;  1FRP A;  2I3W A;  2XXT A;  2NVU B;  2XXR A;  2CZI A;  5HBC A;  1R6Z A;  3TEL A;  1SYH A;  2Q74 A;  5EQA A;  2WBB A;  2XD3 A;  3U65 A;  1OMP A;  4OWD A;  4ISU A;  2LAO A;  3MC2 A;  2CZL A;  3BKI B;  2DWH A;  3PPR A;  3R7X A;  1DOT A;  4GWS A;  4XKN A;  1BK4 A;  3HFU A;  3VXB A;  1TXF A;  3IOW A;  3QXM A;  1N3W A;  4QFO A;  3ROJ A;  1PEB A;  4OQO A;  4QFN A;  4XFE A;  5IM2 A;  3THI A;  1SBP A;  1JEV A;  3KSX A;  1NUZ A;  2V4C A;  3BFT A;  5EQ8 A;  2Y7W A;  4ONY A;  1WVJ A;  1LAH E;  3BBR A;  4OEV A;  3C34 A;  4MNC A;  2H5Y A;  5AA2 D;  5KDT A;  4LQ2 A;  5ET5 A;  5FBP A;  1NKX A;  1UIU A;  4U21 A;  1B0H A;  3FVK A;  3OMB A;  4LZ5 A;  3BIH A;  4H0W A;  3D1R A;  4I40 A;  1FBD A;  4OER A;  3SEW A;  3CSB A;  3V89 B;  2CEY A;  1DPE A;  1B3F A;  3FAT A;  5DTB A;  4JB7 A;  1LB9 A;  3C35 A;  1US4 A;  3OEL A;  1IUD A;  1MXY A;  4P47 A;  4N8Y A;  2XXX A;  3MAM A;  3TTR A;  3TKD A;  3ZS6 A;  5L8D A;  4ELP A;  3H03 A;  1R1N A;  2M8C A;  4YKI A;  3GYY A;  1Z7N E;  1LST A;  2NXO A;  4OMB A;  3FBP A;  4Z7E A;  1B4H A;  3FIR A;  3GBB A;  3R6U A;  2VOZ A;  1DK4 A;  3HHF A;  4N6D A;  2DVC A;  5EHS A;  4IR8 A;  2O84 X;  4NE4 A;  4P0G A;  2YPN A;  2GHB A;  1YZ0 A;  5EQ7 A;  3T22 A;  1QUJ A;  1R9L A;  4KD5 A;  2ONS A;  1LBX A;  1B6H A;  3N94 A;  2V25 A;  2DXY A;  1G0H A;  2ANJ A;  1NNT A;  2CMO A;  1Y9U A;  4O7I A;  3OO8 A;  4GWO A;  1NV5 A;  3EKI A;  4GVO A;  4DXB A;  2QPQ A;  4IY6 A;  1NUW A;  5TU0 A;  4NF5 A;  1MXV A;  1MH3 A;  1I6Q A;  4P8B A;  3I6V A;  1FTO A;  3RUM A;  3TTL A;  3TMG A;  1P1O A;  2HEU A;  2FYI A;  4F1U A;  1VSO A;  3RN8 A;  4ZED A;  2HCA A;  3OOA A;  1LGB C;  5I56 B;  1S9T A;  2ESN A;  2THI A;  2XXK A;  1FW0 A;  2REJ A;  1YPN A;  1P99 A;  2F35 A;  3RT8 A;  4LUB A;  1XVY A;  1HSE A;  1PB9 A;  4OFJ A;  1IQ7 A;  3RGY A;  2B3F A;  2D21 A;  2O1M A;  4G68 C;  4PQJ A;  2Y7I A;  4ZEB A;  3ILU B;  4OYV A;  1Y1Z A;  5TP9 B;  1LAF E;  5EYF A;  3LR1 A;  2F78 A;  5ITO A;  3Q27 A;  4MEV A;  2QVU A;  4OEN A;  3KOS A;  1B1H A;  3TYH A;  2CZK A;  1OIB A;  1FPK A;  2FA7 A;  4G8H A;  5IAI A;  3B7D A;  4MCO A;  2VGQ A;  1FTM A;  3QSL A;  4K3F A;  1LBB A;  4WEP A;  4DXC A;  3UOR A;  1KA0 A;  4BDN A;  4R2F A;  2DQV A;  3IAZ A;  2Y5K A;  4BDL A;  4ZEF A;  4TQU Q;  3ZKK A;  1FPD A;  5HPQ A;  3JYR A;  1B51 A;  3TTM A;  1ZMG A;  4NF6 B;  4Q8R A;  4GWY A;  1MPC A;  4HXV A;  3MJN A;  3BIG A;  3KBR A;  5JK4 A;  2HXR A;  5H8N B;  1FBH A;  1H76 A;  3PUV E;  3QUJ A;  4FEC A;  1BIY A;  2QS4 A;  1ANF A;  4BDM A;  1JW4 A;  4F3P A;  4OFO A;  1LB8 A;  1D3K A;  5CI5 A;  5IZZ A;  3SZP A;  1EYI A;  3QK6 A;  4QFP A;  3K6W A;  3RPL A;  1DPP A;  1MDQ A;  4EF2 A;  4R6Y A;  2A5T B;  2Q9T A;  2PYY A;  4Q30 B;  2DOJ A;  3HO7 A;  4PFW A;  4E0X A;  1LLS A;  3UIF A;  3K00 A;  3O66 A;  5F24 A;  4PAI A;  1IIT A;  1KWH A;  3IO4 A;  2DVZ A;  5BUU A;  3CG1 A;  4JXI A;  5B70 A;  3MVX A;  4ZE9 A;  2QVR A;  1H3D A;  2ZMB A;  4KI0 E;  2VT5 A;  2XWI A;  1FQE A;  2WX9 A;  3S9N C;  4GX4 A;  3KFM A;  1RDY A;  2FHY A;  3Q28 A;  1FBC A;  5KZT A;  1FJ6 A;  3LUY A;  3V5A A;  1Y4T A;  3FVO A;  3K02 A;  1XVX A;  4NF4 A;  2XXV A;  4LP2 B;  2UXA A;  5JEI A;  1MM6 A;  4G4P A;  3CG3 A;  3E4R A;  4DIG A;  3PTY A;  3KN3 A;  5AA2 B;  3ZKL A;  1CE2 A;  5EYG A;  1FPE A;  2F5X A;  4U23 A;  2ABH A;  4OVS A;  5ITP A;  3RPW A;  5DVF A;  1YTV A;  4IGT A;  4WXJ A;  1SI1 A;  3G3I A;  3FVG A;  4NWC A;  4X1D A;  3B6T A;  3NOH A;  1JW5 A;  3EPE A;  2FBP A;  1NV3 A;  2FNC A;  2VHA A;  1BTJ A;  3L6H A;  4ZDM A;  3TTK A;  1QUL A;  2GRV A;  4PF8 A;  2YLN A;  1NV6 A;  4DCY A;  3T9X B;  2VPO A;  2DSF A;  1IMA A;  4DLD A;  1B4Z A;  5I3S A;  4DI4 B;  4I62 A;  4OES A;  2A5S A;  2P0S A;  1URG A;  1P1N A;  4Z0I A;  1OLA A;  1UTH A;  4MF3 A;  2WYP A;  3VFJ A;  3KN7 A;  3G3H A;  4POX A;  1A8E A;  4PTK A;  1SQY A;  1LFH A;  1N84 A;  1K9Y A;  2R6G E;  2UVG A;  1RYX A;  4H8I A;  4XIG Q;  3M3F A;  3WAF A;  4H45 A;  1CB6 A;  1UQW A;  1B3L A;  3PUZ E;  1BP5 A;  3KC1 A;  2QMX A;  4OET A;  1NI9 A;  2ZXT A;  4P9K A;  5TPA A;  1N3X A;  3LUZ A;  2DXR A;  4AB5 A;  3MZ1 A;  4F39 A;  4C1U A;  2RC8 A;  3FJ7 A;  1NNK A;  4NX1 A;  4PC9 A;  3HV1 A;  3QMF A;  4KFQ A;  1EZP A;  1J1N A;  1NV0 A;  3FJG A;  2E1S A;  4QFL A;  1MQD A;  3OEM A;  3H6V A;  3PPN A;  1MY1 A;  4G2Z A;  1N76 A;  4PFY A;  3CI8 A;  4IB2 A;  1OQH A;  1Y4C A;  3OSQ A;  2P1S A;  4AQ4 A;  3T66 A;  4OVT A;  2QMW A;  2JJK A;  3IO6 A;  2ONK E;  1LBZ A;  4ZS9 A;  4ELO A;  2XXW A;  5CMK A;  2MKZ A;  2YJP A;  2Z22 A;  3IX1 A;  3OXN A;  2RKM A;  3P7I A;  4KYD A;  1FPJ A;  1IXC A;  2AL4 A;  3T9U A;  4N15 A;  4GBW A;  2FIE A;  2GFE A;  2I4C A;  2FIX A;  4OXV A;  5H8F A;  1FPB A;  4MBP A;  1A7L A;  5CMM A;  4JWX A;  4JWO A;  5ET8 A;  4M4G A;  3TFL A;  3IR1 A;  4O3B A;  2ZNS A;  4XKP A;  3OO7 A;  4P1L A;  4YKP A;  2OK2 A;  5I58 B;  2XXH A;  3O6I A;  1Y3N A;  1Q9D A;  4YZZ A;  3MBP A;  1PDA A;  4PGN A;  3E13 X;  4F1V A;  2O6A A;  3N5L A;  5IZ3 B;  2RC9 A;  1B7H A;  4H65 A;  3ISP A;  2NOO A;  4YIC A;  3OSR A;  4NF0 A;  2Y7R A;  2OLB A;  5FHM A;  4FJP A;  5IGA A;  4GXS B;  5I59 A;  4NED A;  4ZZA A;  1QVS A;  4O7M A;  2V3T A;  3KBZ A;  4U1Z A;  2VPN A;  3VE1 B;  4JSO A;  4MHF A;  4QSE A;  1JEU A;  2F3B A;  4EF1 A;  5CBS A;  1SVX B;  3TCH A;  5J1D A;  1N7X A;  3M3L A;  3MUQ A;  3H7M A;  2I58 A;  4KCC A;  3O9P A;  1QUK A;  1B7U A;  4R6K A;  3MP1 A;  4NTL A;  3MPL A;  3MVY A;  5HM4 B;  3S9E A;  4PAK A;  1JW1 A;  1M5B A;  3KG2 A;  5KDT B;  4G8M A;  4Q0C A;  3VVF A;  1PB8 A;  4F29 A;  4IY5 A;  3B6Q A;  2PX1 A;  2WKY A;  2P3V A;  4YMA A;  2XWK A;  4RK9 A;  3FV1 A;  3LBS A;  2F7A A;  4F3B A;  2VD2 A;  3V8X B;  4MLQ A;  4YKJ A;  5CMB A;  4ESW A;  3USD A;  1JVX A;  5FTH A;  2QFL A;  1IMF A;  2UVH A;  3CVG A;  2I4B A;  3EQ1 A;  5JTY A;  5LDZ A;  1MY2 A;  1MXU A;  3ODB A;  4ESX A;  2F97 A;  1IMB A;  3EHS A;  5LTC A;  1NNP A;  1LBY A;  5ISU A;  1TT1 A;  3U93 A;  2OBG A;  1LEV A;  1MXW A;  4YB6 A;  1RDZ A;  2DYX A;  2NUV A;  4XXU A;  4NF8 A;  1B3E A;  1B2H A;  4O8M A;  4MAG A;  1N04 A;  2OWS A;  1B32 A;  2G29 A;  5A5X A;  2X7P A;  3W15 C;  1I6B A;  2QS2 A;  2I6E A;  5H8H A;  4GL0 A;  4R74 A;  1B46 A;  1MY3 A;  5LOM A;  1DMB A;  1B3G A;  2F6G A;  4N91 A;  4POW A;  1P1Q A;  3SEX A;  1UTB B;  3M8U A;  3EN3 A;  1US5 A;  5DEX A;  1KA1 A;  3ZSF A;  3IOU A;  5CC2 A;  2Z8E A;  3EF7 A;  3IB2 A;  3SDF A;  3FGS A;  5CMC A;  4F2Q A;  2XX8 A;  1YAE A;  1P1U A;  1NH8 A;  3MVW A;  2FVZ A;  3UGW A;  1FPI A;  3A09 A;  4FBP A;  5I2K A;  3PU5 A;  4PGP A;  3T93 B;  4AS5 A;  4F3G A;  4O3C A;  1ATG A;  4PE5 B;  2H98 A;  3O29 A;  4LQ5 A;  5AA4 A;  4EDP A;  1NL5 A;  2ZZW A;  5F7V A;  3CR9 A;  3OEK A;  3UP9 A;  4PFB A;  4IO7 A;  3DEL B;  4EQB A;  3CIJ A;  3KJT A;  2B4M A;  4GWU A;  4FIM A;  1FTJ A;  1MY0 A;  3FUZ A;  3MWB A;  4JDF A;  4MX6 A;  4LZ8 A;  4DZ1 A;  5B7D A;  3HPI A;  4RY1 A;  1TFD A;  1NNF A;  1A54 A;  4RA1 A;  4G77 A;  3N6T A;  1GV8 A;  4U1O A;  2UYE A;  2F8D A;  4MFI A;  3D4G A;  1B7Z A;  2DWJ A;  2PFY A;  5L9O A;  3RNN A;  2DE4 A;  4KYE A;  3VLV A;  4P11 A;  2OWZ A;  3K6U A;  2HPG A;  4GWZ A;  5H8S A;  4OVJ A;  3K1M A;  1USY E;  1I6A A;  1N0T A;  5A5L A;  3QAX A;  2O51 A;  2Q89 A;  4TOZ A;  4WKM A;  1SYI A;  2HQ0 A;  4PF6 A;  3KGC A;  5EQ9 A;  1WDN A;  2BJI A;  3PUX E; 
#chains in the Genus database with same CATH homology
 2Y7K A;  4PP0 A;  3KZG A;  1UIV A;  3TQW A;  4DDD A;  4R9G A;  2ZYN A;  4MLV A;  4Q5T A;  4HS7 A;  3RQT A;  1D9V A;  5I2N A;  1QKB A;  5AA3 A;  3CFZ A;  3FJM A;  2PVU A;  2ZNT A;  1F9B A;  3MVZ A;  3LSF B;  4L17 A;  1FQA A;  4ZEK A;  1DSN A;  3CRB A;  4PET A;  1SW1 A;  1M5C A;  4R75 A;  2R71 A;  1B5H A;  2GHA A;  1GTK A;  1SW5 A;  4N6P A;  5K2Y A;  3PGF A;  3DP4 A;  3EHU A;  1D9Y A;  1I69 A;  3ONM A;  2H4I A;  2G93 A;  1ZKB A;  4YKK A;  3Q25 A;  5FTI A;  3SES A;  5DVJ A;  1MRP A;  1ZBM A;  2F36 A;  4KPT A;  3TUS A;  2HXW A;  2H9B A;  4EXK A;  4LVQ A;  1B5I A;  3H6T A;  3U1O A;  4BDR A;  1SW4 A;  4BDO A;  2Q2A A;  3Q29 A;  4WED A;  5AE4 A;  4NF4 B;  4LAT A;  3VVE A;  2DE2 A;  3PD9 A;  3RT6 B;  5EHM A;  2Q2C A;  3IOR A;  3O6G A;  4ECF A;  3K0V A;  4QSC A;  3C9H A;  3PV0 E;  2XXI A;  5BWJ A;  2HAU A;  2UVI A;  4OFL A;  4KHZ E;  2OZZ A;  1B5J A;  4GD5 A;  2XXQ A;  3F11 A;  2O1L A;  3K01 A;  3ILT B;  1B52 A;  3M3K A;  2HZL A;  1LAX A;  1VFE A;  5FHO A;  4HTG A;  3VLU A;  4RYA A;  4U22 A;  3C32 A;  1WOD A;  3SEU A;  4H5G A;  1SI0 A;  5L9S A;  3E3K A;  3TTN A;  1XS5 A;  2ZYO A;  2V3U A;  1UTH B;  4FAJ A;  3FXR A;  3HST A;  4G68 A;  2PT2 A;  4H67 A;  2QS1 A;  2Z8D A;  2XXP A;  4IO2 A;  5I57 A;  1MQH A;  3SKP A;  1BLF A;  3GLB A;  4IO4 A;  4ZZE A;  1JQF A;  4PFT A;  1B40 A;  3OD7 A;  1VE4 A;  2RC7 A;  4THI A;  1MPD A;  5TPA B;  4ZEI A;  3PUW E;  2VD3 A;  3GXA A;  1IIW A;  2I0C A;  3TAJ A;  1P1W A;  4U2R A;  4XKQ A;  4QHQ A;  4ZE8 A;  4RJZ A;  3FXQ A;  3QIM A;  4ZEC A;  2ZYK A;  3IB1 A;  2BJJ X;  3OO6 A;  1B3H A;  3O97 A;  1MDP 1;  1GR2 A;  2XX7 A;  1O63 A;  3RLF E;  4TLL B;  3G7W A;  2XX9 A;  1ZJL A;  4UAC A;  2DE3 A;  4H1X A;  1Y1M A;  2PBW A;  4HCY A;  4YMB A;  4OHN A;  3SET A;  2GH9 A;  3VV5 A;  1EH3 A;  5KCJ B;  3A3C A;  1MQI A;  2AL5 A;  2W7Y A;  5AA1 A;  4EXL A;  4FED A;  4KR5 A;  2RF1 A;  4IO3 A;  2ZYM A;  3C31 A;  3H06 B;  1DTG A;  2RCA A;  5H8Q A;  4H6D A;  4F2O A;  4JBZ A;  1IZ1 A;  1NMU A;  2Y84 A;  5DT6 A;  1MPB A;  1A40 A;  3MZB A;  1PC3 A;  4QRZ A;  4MH5 A;  1B1X A;  4GFR A;  3PD8 A;  3PPP A;  4KCD A;  3O6H A;  3TDJ A;  3S9M C;  5I59 B;  1AH5 A;  4F22 A;  3U94 A;  2H99 A;  3OO9 A;  3PUY E;  2I0B A;  1AL3 A;  5F1Q A;  1MQG A;  4GQO A;  1SDX A;  2XXY A;  1OLC A;  1XOC A;  1T0K A;  1HSL A;  2ALU A;  3VDF A;  3C4M A;  4FOR A;  4KYS A;  3QUF A;  3UN6 A;  1URS A;  4KQP A;  1FCK A;  3K1N A;  4LON B;  4HW8 A;  5FHN A;  4X9T A;  4AB6 A;  3KN8 A;  1RYO A;  3KOT A;  3WAE A;  1POY 1;  2F7C A;  4QFK A;  4H5F A;  2HAV A;  3RTW B;  1PB7 A;  4GOT A;  5JTY B;  3SER A;  1OVT A;  2D5W A;  3PMV A;  2QL3 A;  4OTE A;  4OEU A;  4N07 A;  3U92 A;  4FE8 A;  1MH4 A;  4NF8 B;  1VFD A;  3A3U A;  2O7U A;  1Y3Q A;  1PBQ A;  4X1B A;  3HN0 A;  2O69 A;  1LAG E;  3TEP A;  5A5X B;  5CBR A;  1R9Q A;  5IKB A;  5H8H B;  1LFI A;  4TLM B;  4N13 A;  1MXX A;  3LC8 A;  1ELJ A;  2Z8F A;  4I9D A;  1UTB A;  1EZO A;  2P2A A;  2QSX A;  1QW0 A;  4R72 A;  3ECR A;  2UVJ A;  3LSX A;  3KSJ A;  5DEX B;  2DWA A;  2O7I A;  4RPN A;  3UA8 A;  5ICQ A;  4GXA A;  4F3S A;  1B58 A;  5I84 A;  3SEV A;  2REG A;  1TFA A;  3IJX B;  3W9W A;  1SW2 A;  4NF5 B;  3T96 B;  1MXZ A;  3MW0 A;  3DLN A;  4DXU A;  4LZ7 A;  5I2K B;  3T9V A;  4FEB A;  1M5D A;  1FQD A;  1YCJ A;  5AA4 B;  3L6G A;  4R9F A;  5I56 A;  4XKR A;  4GF8 A;  1IXG A;  1Y3P A;  1Q1K A;  2IEE A;  4F19 A;  1Q35 A;  4R6H A;  3S2V A;  4F18 A;  4IO5 A;  5K2X A;  3DP6 A;  3V83 A;  3JV9 A;  3SEY A;  3KJ7 A;  5TP9 A;  3TCG A;  4LA9 A;  4R73 A;  1MG1 A;  3JZJ A;  4YB7 A;  4F1Y A;  3K6V A;  1LFG A;  2OWT A;  1IEJ A;  1POT A;  1ZTY A;  3PPO A;  3PMW A;  4QF9 A;  2KLF A;  2I3V A;  4I8C A;  3AXF A;  3GBA A;  4GIZ A;  2NWJ A;  4U4S A;  2F34 A;  1MS7 A;  3G3F A;  5M2V A;  2Z23 A;  5L9M A;  1FQB A;  2Y7P A;  3O28 A;  3DP8 A;  1JVY A;  3N6U A;  3KEI A;  3MZ9 A;  4FAT A;  4NF6 A;  1LCF A;  1ZLQ A;  3UK4 A;  5DYH A;  2XHD A;  4E0W A;  1MQJ A;  5H8N A;  3GZG A;  4UA8 A;  1H45 A;  1S7Y A;  3H6U A;  1VR5 A;  2F6P A;  2RIN A;  3VXC A;  5I2N B;  2F7B A;  3TQL A;  3VLW A;  3MP6 A;  1NH7 A;  2ZNU A;  3B6W A;  3LSL A;  1EU8 A;  3TCF A;  2A5T A;  4NWD A;  4EQ9 A;  1OVB A;  1USY H;  3K2D A;  2I48 A;  4R2B A;  3S9L C;  4HCW A;  1IXI A;  3T9H B;  3FZV A;  2H25 A;  1QUI A;  1GGG A;  1XC1 A;  3MPK A;  2X7Q A;  1B9J A;  1JNF A;  2E0S A;  1XHY A;  2ONR A;  4GL8 A;  2O68 A;  4GRK A;  3H3G A;  3FD3 A;  1HSJ A;  3CSG A;  2QRY A;  2HZK A;  4IO6 A;  3IJO B;  4RNS A;  1PBP A;  5DVI A;  4G8N A;  2V84 A;  3H4Z A;  3HHG A;  1AOV A;  4DCX A;  3PPQ A;  3PMX A;  3U72 A;  3IOV A;  3IOT A;  1A8F A;  1FQC A;  1ZIU A;  3U8Q A;  1AMF A;  4YU0 A;  3S4U A;  2XXU A;  4PFU A;  3TPA A;  5AA2 A;  1EZ9 A;  3Q26 A;  3N26 A;  3HCQ A;  3VVD A;  4P0I A;  2XD2 A;  4JSD A;  2AYS A;  2B3B A;  4JWY A;  3FVN A;  1BKA A;  3E9X A;  1M5F A;  1NFT A;  1MM7 A;  1ZU0 A;  4O3A A;  1O64 A;  2V93 A;  3IK6 B;  5CRY A;  5ICT A;  3G3G A;  3I3V A;  3G3K A;  4I1D A;  2QS3 A;  3CFL A;  2V3Q A;  1FQF A;  1H43 A;  2X26 A;  1D4N A;  4DE8 A;  4G68 B;  1AIV A;  1FTL A;  2R9J A;  3O2A A;  2IA4 A;  4EUO A;  1S50 A;  1N7W A;  1II5 A;  1Z7M E;  2OCU A;  3G3J A;  1B0L A;  5I57 B;  2AIX A;  3TZA A;  3EHT A;  3C33 A;  3MQ9 A;  1FTK A;  1LBC A;  1MY4 A;  4GLI A;  3DM0 A;  4NMY A;  3K6X A;  1XT8 A;  4RPO A;  1O7T A;  2DWI A;  4XTC Q;  3FV2 A;  4X48 A;  4BLA A;  2UYF A;  2B65 A;  3FAS A;  3RTF B;  4IGR A;  2Q8J A;  3MP8 A;  3FXU A;  3D4C A;  1JET A;  3I5O A;  5ELV A;  3IB0 A;  1RKM A;  3K1P A;  4EQ7 A;  2QJE A;  2I49 A;  4M1V A;  1Y20 A;  3LSW A;  4C1T A;  3BFU A;  2PT1 A;  4C0R A;  1GVC A;  2HFB A;  1QJM A;  3QYT A;  1OQG A;  3OEN A;  2D3I A;  3TOD A;  4QSD A;  1A55 A;  1L5T A;  4BDQ A;  4H8J A;  1B05 A;  1URD A;  4ELQ A;  2Q88 A;  4YAH X;  2VP1 A;  4ND9 A;  1M5E A;  4RXL A;  1TWY A;  3IL1 B;  2DP8 A;  3H6W A;  5H8F B;  2PMS A;  2OJT A;  1QKA A;  4F31 B;  5KCJ A;  4YB5 A;  2DS9 A;  3K4U A;  1IXH A;  1H44 A;  1A99 A;  3W9V A;  3CFX A;  4OZ9 A;  4ELR A;  3C36 A;  5I58 A;  2RCB A;  3RY3 A;  1SD3 A;  1DTZ A;  5H8Q B;  4U4X A;  3R26 A;  4RK2 A;  1LCT A;  5CM6 A;  2I3W A;  2XXT A;  2NVU B;  2XXR A;  5HBC A;  1R6Z A;  3TEL A;  1SYH A;  2XD3 A;  1OMP A;  4OWD A;  4ISU A;  2LAO A;  3MC2 A;  2CZL A;  3BKI B;  2DWH A;  3PPR A;  3R7X A;  1DOT A;  4XKN A;  3VXB A;  1TXF A;  3IOW A;  3QXM A;  1N3W A;  4QFO A;  1PEB A;  4OQO A;  4QFN A;  3THI A;  1SBP A;  1JEV A;  3KSX A;  3BFT A;  2Y7W A;  4ONY A;  1WVJ A;  1LAH E;  3BBR A;  4OEV A;  3C34 A;  2H5Y A;  5AA2 D;  5KDT A;  4LQ2 A;  1NKX A;  1UIU A;  4U21 A;  1B0H A;  3FVK A;  3OMB A;  4LZ5 A;  4H0W A;  4OER A;  3SEW A;  3CSB A;  3V89 B;  1DPE A;  1B3F A;  3FAT A;  5DTB A;  4JB7 A;  1LB9 A;  3C35 A;  1US4 A;  3OEL A;  1IUD A;  1MXY A;  2XXX A;  3MAM A;  3TTR A;  3TKD A;  3ZS6 A;  5L8D A;  4ELP A;  3H03 A;  1R1N A;  2M8C A;  4YKI A;  1Z7N E;  1LST A;  2NXO A;  4OMB A;  4Z7E A;  1B4H A;  3FIR A;  3GBB A;  3R6U A;  2VOZ A;  3HHF A;  5EHS A;  2DVC A;  2O84 X;  4NE4 A;  4P0G A;  2YPN A;  2GHB A;  3T22 A;  1QUJ A;  1R9L A;  4KD5 A;  2ONS A;  1B6H A;  3N94 A;  2V25 A;  2DXY A;  2ANJ A;  1NNT A;  2CMO A;  1Y9U A;  3OO8 A;  4GWO A;  4GVO A;  4DXB A;  2QPQ A;  4IY6 A;  5TU0 A;  4NF5 A;  1MXV A;  1MH3 A;  1I6Q A;  3RUM A;  3I6V A;  1FTO A;  3TTL A;  3TMG A;  1P1O A;  2HEU A;  2FYI A;  4F1U A;  1VSO A;  3RN8 A;  4ZED A;  2HCA A;  3OOA A;  1LGB C;  5I56 B;  1S9T A;  2ESN A;  2THI A;  1FW0 A;  2REJ A;  1YPN A;  1P99 A;  2F35 A;  3RT8 A;  4LUB A;  1XVY A;  1HSE A;  1PB9 A;  4OFJ A;  1IQ7 A;  3RGY A;  2B3F A;  2D21 A;  2O1M A;  4G68 C;  4PQJ A;  2Y7I A;  4ZEB A;  3ILU B;  4OYV A;  1Y1Z A;  5TP9 B;  1LAF E;  5EYF A;  3LR1 A;  2F78 A;  5ITO A;  3Q27 A;  4OEN A;  3KOS A;  1B1H A;  3TYH A;  1OIB A;  2FA7 A;  4G8H A;  5IAI A;  3B7D A;  2VGQ A;  1FTM A;  3QSL A;  4K3F A;  1LBB A;  4WEP A;  4DXC A;  3UOR A;  4BDN A;  4R2F A;  2DQV A;  3IAZ A;  4BDL A;  4ZEF A;  4TQU Q;  3ZKK A;  5HPQ A;  3JYR A;  1B51 A;  3TTM A;  1ZMG A;  4NF6 B;  4Q8R A;  1MPC A;  3MJN A;  3KBR A;  5JK4 A;  5H8N B;  1H76 A;  3PUV E;  3QUJ A;  4FEC A;  1BIY A;  2QS4 A;  1ANF A;  4BDM A;  1JW4 A;  4F3P A;  4OFO A;  1LB8 A;  1D3K A;  5CI5 A;  3QK6 A;  4QFP A;  3K6W A;  1DPP A;  1MDQ A;  4EF2 A;  4R6Y A;  2A5T B;  2Q9T A;  2PYY A;  4Q30 B;  2DOJ A;  3HO7 A;  4PFW A;  4E0X A;  1LLS A;  3UIF A;  3K00 A;  3O66 A;  1IIT A;  1KWH A;  3IO4 A;  2DVZ A;  5BUU A;  3CG1 A;  4JXI A;  5B70 A;  3MVX A;  4ZE9 A;  1H3D A;  2ZMB A;  4KI0 E;  1FQE A;  3S9N C;  3KFM A;  3Q28 A;  5KZT A;  3LUY A;  3V5A A;  1Y4T A;  3FVO A;  3K02 A;  1XVX A;  4NF4 A;  2XXV A;  4LP2 B;  2UXA A;  5JEI A;  1MM6 A;  4G4P A;  3CG3 A;  3E4R A;  4DIG A;  3KN3 A;  5AA2 B;  3ZKL A;  1CE2 A;  4U23 A;  2F5X A;  2ABH A;  5ITP A;  3RPW A;  5DVF A;  1YTV A;  4IGT A;  4WXJ A;  1SI1 A;  3G3I A;  3FVG A;  4NWC A;  4X1D A;  3B6T A;  1JW5 A;  3EPE A;  2FNC A;  2VHA A;  1BTJ A;  3L6H A;  4ZDM A;  3TTK A;  1QUL A;  2GRV A;  2YLN A;  4DCY A;  3T9X B;  2DSF A;  4DLD A;  1B4Z A;  4I62 A;  4OES A;  2A5S A;  2P0S A;  1URG A;  1P1N A;  4Z0I A;  1OLA A;  1UTH A;  4MF3 A;  3VFJ A;  3KN7 A;  3G3H A;  4POX A;  1A8E A;  1SQY A;  1LFH A;  1N84 A;  2R6G E;  2UVG A;  1RYX A;  4H8I A;  4XIG Q;  3M3F A;  3WAF A;  1CB6 A;  1UQW A;  1B3L A;  3PUZ E;  1BP5 A;  2QMX A;  4OET A;  2ZXT A;  5TPA A;  1N3X A;  2DXR A;  4AB5 A;  3MZ1 A;  4F39 A;  4C1U A;  2RC8 A;  3FJ7 A;  1NNK A;  3HV1 A;  4KFQ A;  1EZP A;  1J1N A;  3FJG A;  2E1S A;  4QFL A;  1MQD A;  3OEM A;  3H6V A;  3PPN A;  1MY1 A;  4G2Z A;  1N76 A;  4PFY A;  3CI8 A;  4IB2 A;  1OQH A;  1Y4C A;  3OSQ A;  2P1S A;  4AQ4 A;  3T66 A;  2QMW A;  3IO6 A;  2ONK E;  4ZS9 A;  4ELO A;  2XXW A;  5CMK A;  2YJP A;  2Z22 A;  3IX1 A;  3OXN A;  2RKM A;  3P7I A;  4KYD A;  1IXC A;  2AL4 A;  3T9U A;  2GFE A;  2I4C A;  5H8F A;  4OXV A;  4MBP A;  1A7L A;  5CMM A;  4JWX A;  4JWO A;  4M4G A;  3TFL A;  3IR1 A;  4O3B A;  2ZNS A;  4XKP A;  3OO7 A;  4YKP A;  2OK2 A;  5I58 B;  2XXH A;  3O6I A;  1Y3N A;  4YZZ A;  3MBP A;  1PDA A;  3E13 X;  4F1V A;  2O6A A;  3N5L A;  2RC9 A;  1B7H A;  4H65 A;  2NOO A;  4YIC A;  3OSR A;  2Y7R A;  2OLB A;  5FHM A;  4FJP A;  4GXS B;  5I59 A;  4NED A;  4ZZA A;  1QVS A;  2V3T A;  4U1Z A;  3VE1 B;  4JSO A;  4QSE A;  1JEU A;  4EF1 A;  5CBS A;  1SVX B;  3TCH A;  5J1D A;  1N7X A;  3M3L A;  3MUQ A;  3H7M A;  2I58 A;  4KCC A;  3O9P A;  1QUK A;  1B7U A;  4R6K A;  3MP1 A;  4NTL A;  3MPL A;  3MVY A;  5HM4 B;  3S9E A;  1JW1 A;  1M5B A;  3KG2 A;  5KDT B;  4G8M A;  4Q0C A;  3VVF A;  1PB8 A;  4F29 A;  4IY5 A;  3B6Q A;  2PX1 A;  2WKY A;  4YMA A;  4RK9 A;  3FV1 A;  3LBS A;  2F7A A;  4F3B A;  2VD2 A;  3V8X B;  4MLQ A;  4YKJ A;  5CMB A;  4ESW A;  3USD A;  1JVX A;  5FTH A;  2UVH A;  3CVG A;  2I4B A;  3EQ1 A;  5JTY A;  1MY2 A;  1MXU A;  3ODB A;  4ESX A;  2F97 A;  3EHS A;  1NNP A;  5ISU A;  1TT1 A;  3U93 A;  2OBG A;  1MXW A;  4YB6 A;  2DYX A;  2NUV A;  4XXU A;  4NF8 A;  1B3E A;  1B2H A;  1N04 A;  2OWS A;  1B32 A;  2G29 A;  5A5X A;  2X7P A;  3W15 C;  1I6B A;  2QS2 A;  2I6E A;  5H8H A;  4GL0 A;  4R74 A;  1B46 A;  1MY3 A;  5LOM A;  1DMB A;  1B3G A;  2F6G A;  4POW A;  1P1Q A;  3SEX A;  1UTB B;  3M8U A;  3EN3 A;  1US5 A;  5DEX A;  3ZSF A;  3IOU A;  5CC2 A;  2Z8E A;  3EF7 A;  3IB2 A;  3SDF A;  3FGS A;  5CMC A;  4F2Q A;  2XX8 A;  1YAE A;  1P1U A;  1NH8 A;  3MVW A;  3UGW A;  3A09 A;  5I2K A;  3PU5 A;  3T93 B;  4F3G A;  4O3C A;  1ATG A;  4PE5 B;  2H98 A;  3O29 A;  4LQ5 A;  5AA4 A;  4EDP A;  1NL5 A;  5F7V A;  3CR9 A;  3OEK A;  3UP9 A;  4IO7 A;  3DEL B;  4EQB A;  3CIJ A;  3KJT A;  4FIM A;  1FTJ A;  1MY0 A;  3FUZ A;  3MWB A;  4JDF A;  4DZ1 A;  4LZ8 A;  5B7D A;  3HPI A;  4RY1 A;  1TFD A;  1NNF A;  1A54 A;  4RA1 A;  4G77 A;  3N6T A;  1GV8 A;  4U1O A;  2UYE A;  2F8D A;  4MFI A;  3D4G A;  1B7Z A;  2DWJ A;  5L9O A;  3RNN A;  2DE4 A;  4KYE A;  3VLV A;  4P11 A;  3K6U A;  5H8S A;  4OVJ A;  3K1M A;  1USY E;  1I6A A;  1N0T A;  3QAX A;  2O51 A;  2Q89 A;  4TOZ A;  4WKM A;  1SYI A;  2HQ0 A;  3KGC A;  1WDN A;  3PUX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...