3WAEA

X-ray structure of fe(iii)-bicarbonates-ttfbpa, a ferric ion-binding protein from thermus thermophilus hb8
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
PTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRON ABC TRANSPORTER, PERIPLASMIC IRON-BINDING PROTEIN
publication title A novel mode of ferric ion coordination by the periplasmic ferric ion-binding subunit FbpA of an ABC-type iron transporter from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Metal binding protein
total genus 112
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3waeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3waeA02
1B58A 2DQVA 1FQCA 2V3UA 1ZLQA 3TEPA 1FQBA 1MXYA 2IA4A 4ZEKA 1B40A 3DP6A 3CSGA 3TTLA 5H8NA 1GGGA 1JNFA 4F2OA 3C32A 2ONRA 1LSTA 1D4NA 1H76A 3Q28A 2OBGA 1LFHA 3D4GA 3RLFE 4XIGQ 1HSLA 4YICA 3FUZA 4WEPA 4EXKA 3N6UA 5KCJA 2P2AA 1R1NA 3IL1B 3KEIA 1ZMGA 4EF2A 3CSBA 1QVSA 5CBRA 2Q89A 4QFPA 3VVFA 4IO5A 1A54A 1SW4A 2B3BA 3IB0A 2GHBA 3VXBA 5CM6A 1JVXA 1XVYA 3VXCA 4U22A 4GLIA 1FQEA 4GXAA 1BLFA 4RXLA 3UORA 3CG3A 3RT6B 2A5TB 3KBRA 3U92A 2QJEA 4U4SA 3KJ7A 3A3UA 2DS9A 1DMBA 3RQTA 2Q2CA 1IXIA 1QKAA 2Z23A 2B3FA 4G8HA 1B3LA 3KSXA 2QSXA 3IJXB 2UYFA 1NKXA 2RC7A 4JBZA 1URGA 1MPCA 4OFJA 2Z22A 3MWBA 1SI0A 2XXUA 4YKIA 1N7XA 4OEUA 2Z8EA 4XKQA 1FW0A 1QUIA 4DCYA 1B3EA 3FGSA 4RJZA 2H4IA 4EQ7A 5H8FB 2HEUA 5CMKA 3T9XB 5I84A 2QMWA 3EF7A 1P1WA 2QS1A 4Q30B 2R71A 3B6WA 1YPNA 4FECA 3Q25A 2VD2A 3SERA 3A3CA 1SBPA 1S50A 2CMOA 4BLAA 3VLUA 4F1YA 1FTLA 3K2DA 3K6XA 1B4ZA 5I59A 4E0WA 3H6VA 1NNPA 2DP8A 3PMXA 3U94A 3IB1A 2DXRA 1TXFA 3MPKA 1NL5A 5KDTB 4RNSA 2Z8FA 3FJMA 1EZPA 3C9HA 3TTNA 1MXXA 1B3FA 2R6GE 4DIGA 4HTGA 4IB2A 5DVIA 2P1SA 5JK4A 1WVJA 4KQPA 3RPWA 2ABHA 3FJGA 1A55A 4QHQA 4OXVA 5IAIA 2QS3A 3KN3A 1UTBA 1AIVA 1LB9A 2Q8JA 5K2YA 5AA2B 1MS7A 2QS2A 4OQOA 2Y7PA 1NMUA 1ELJA 2O84X 1B7UA 2H25A 2G93A 2WKYA 1F9BA 2XXWA 4DXCA 2R9JA 3C36A 3MVXA 1Y4CA 4U21A 5FHNA 1CE2A 4EUOA 3MBPA 2ZNTA 4NF4A 1JW1A 1A40A 4O3CA 1JEVA 1LAGE 4DZ1A 1MXVA 1OQHA 5I56A 1P99A 4RYAA 1LLSA 4DLDA 1JW4A 3RN8A 2XXRA 1MM7A 3K00A 4C1TA 1FCKA 4JWOA 4P0GA 3FXQA 1UIUA 1B5HA 3ECRA 5DVJA 2AYSA 1RYXA 2ZNUA 3MC2A 3MZ1A 1AL3A 2Y7KA 1OLCA 1MXUA 4OEVA 3B6QA 4F2QA 3B7DA 3IR1A 2XXHA 5HBCA 1B05A 3U93A 4GVOA 1TWYA 3FXRA 5I2NA 4AB6A 1EZ9A 4DE8A 3I5OA 5FHOA 2X7PA 4MBPA 1M5DA 1DSNA 1MM6A 4QFOA 4GL0A 4EQ9A 1GR2A 2NOOA 1M5FA 1VR5A 1Y3NA 3SEXA 3RTFB 1EH3A 1XOCA 2OJTA 1FTOA 1SVXB 2O69A 5HM4B 3KN8A 4X48A 3TCGA 1B5IA 2F78A 3ZS6A 1MY0A 2KLFA 3IOWA 4GD5A 2NWJA 3I3VA 4G8MA 4ELRA 4ELOA 1Q35A 3QXMA 1B32A 4GFRA 1IXCA 2YLNA 3UA8A 3RY3A 2Q2AA 1MPBA 4GOTA 2RF1A 5L9MA 4F18A 3WAFA 3PUWE 3PPPA 4F1UA 4LP2B 3ILUB 1H43A 4G68B 4R6HA 3DP8A 3UGWA 1TFAA 1IEJA 4JXIA 1IXGA 3OO8A 1MH4A 4THIA 1VE4A 3FD3A 3O2AA 2VD3A 5DEXB 2OWSA 2F8DA 1GTKA 2I3WA 3IO6A 3LBSA 3SEYA 3OSQA 4JSOA 2XXVA 4YMBA 4GF8A 1USYE 4GL8A 3OSRA 2AL4A 4FJPA 4I62A 1SQYA 2I58A 4F3BA 1OLAA 4FATA 1DTZA 2Y7RA 5KZTA 1M5EA 1MXZA 3M3LA 1B0LA 2F36A 1LFGA 3M8UA 4NWCA 3VLWA 5CMCA 3CVGA 5CC2A 2THIA 3MZBA 3L6HA 4M1VA 3T9VA 5TPAB 3OD7A 2BJJX 4F1VA 4N07A 4MH5A 1WDNA 3I6VA 3EQ1A 1D9YA 1PEBA 4H65A 4KHZE 1EZOA 5ISUA 1N04A 4OERA 1UTHA 4EXLA 5I2KB 3H03A 1D3KA 2UVGA 1MY2A 2DE2A 1UQWA 5A5XB 3FVOA 4HCWA 1SI1A 2HAVA 3TODA 1MG1A 3KGCA 2XXIA 3IK6B 3LR1A 3IAZA 1LAXA 1LFIA 1DTGA 5H8HB 4H6DA 2X26A 4X9TA 2NVUB 3UP9A 3MZ9A 4KPTA 2DVCA 4U2RA 2O6AA 3IB2A 3MUQA 3R6UA 1LAFE 2A5SA 3VLVA 3UIFA 5IKBA 1B2HA 2XX7A 3SEUA 5I58B 1R9QA 3DLNA 1JW5A 3R26A 1NNFA 4ZECA 1FTKA 1B0HA 3G3JA 1HSEA 4GIZA 3GBAA 3T9HB 2XXYA 5DTBA 3S9LC 2AIXA 2REGA 3EHTA 2ZNSA 4F3SA 5CRYA 3H6WA 3HN0A 4IO4A 3BFTA 4C0RA 3THIA 1R6ZA 2W7YA 1FTMA 1BTJA 2ANJA 2FYIA 1Y3QA 4LONB 4OZ9A 2UVJA 1P1OA 4I9DA 3D4CA 2G29A 4IGTA 1PBQA 2H5YA 4H5FA 4NF8A 3OENA 4EDPA 2XXTA 2F7AA 5H8NB 2I4CA 4RY1A 5ITPA 1PB8A 2LAOA 4PQJA 4R2BA 4YB5A 1URSA 5FTHA 2DXYA 2V3QA 2DOJA 2H9BA 1PDAA 3K0VA 3S4UA 3W9VA 2REJA 4AB5A 4I8CA 4YMAA 3OO6A 1I6QA 1NNTA 2I6EA 1QUJA 1JQFA 1SYIA 5KCJB 4U1ZA 1WODA 2B65A 1IZ1A 4QSCA 3PPQA 1B7ZA 1N3WA 1KWHA 3KG2A 2I48A 2O1LA 3PD9A 4YAHX 3GBBA 1N3XA 3PMWA 2XHDA 3GXAA 2D5WA 5EHMA 1S9TA 2I3VA 3F11A 4NF6A 4PE5B 1AH5A 1ZJLA 3O29A 4OENA 2OLBA 2HZKA 2VGQA 3N94A 3O6HA 3W15C 2RCBA 4ONYA 3K4UA 3OEKA 4DDDA 4GXSB 2DE3A 5ICQA 4LUBA 3JV9A 2HQ0A 2RKMA 1HSJA 3GLBA 3PV0E 4F3PA 4OETA 2M8CA 4XKPA 1Y1ZA 4R6YA 4ECFA 4RPOA 2DSFA 1OVBA 3V89B 3HHGA 4G68C 4F39A 4PP0A 1IITA 1B6HA 3IJOB 2Y7IA 3TKDA 1YCJA 1SDXA 1OQGA 4NWDA 1MDQA 3WAEA 4Z0IA 2RC9A 2Y84A 3CFZA 1H45A 5F1QA 4MLVA 4KYSA 4KFQA 4ZEBA 4XKNA 3M3KA 3OMBA 1CB6A 3RTWB 1FQDA 1URDA 3TTRA 4F31B 5I59B 4GRKA 4POXA 3V8XB 4TLLB 1LBCA 4R73A 5FTIA 3IO4A 4DCXA 1VFEA 3HCQA 3C34A 3VDFA 3E9XA 3ZSFA 2PBWA 2UXAA 4LZ5A 2O7IA 2F97A 4F29A 4ESXA 4ZEDA 4N13A 4YB7A 2DWAA 3KOTA 4U23A 4ZS9A 1I6BA 2V3TA 3TELA 5AA4A 4K3FA 4IGRA 1MDP1 2PMSA 3EHSA 1MRPA 1T0KA 4NF4B 1I69A 4ISUA 3LSFB 5L8DA 1B1HA 1Y3PA 3T66A 3MQ9A 2ZYOA 5CI5A 2IEEA 1B1XA 1BKAA 3G3GA 3UN6A 1OIBA 4ZE9A 1H3DA 3KFMA 3MP1A 4YU0A 4KYEA 4R72A 3FXUA 1DOTA 3KSJA 3QUJA 2Q9TA 1B5JA 3M3FA 4Q0CA 5JTYA 2PVUA 3VVEA 2V84A 4YKPA 3PPRA 4FE8A 1Q1KA 3VE1B 3KOSA 5I2NB 2F35A 3TQWA 3TAJA 3CI8A 4NF5B 3LSLA 1MY3A 4R9FA 3A09A 3ZKKA 4UA8A 3TYHA 1MY4A 2DE4A 3TFLA 4L17A 4LQ5A 3O9PA 3CIJA 3LUYA 3OOAA 3G3FA 3MVYA 5I57A 5K2XA 2Q88A 3PMVA 5H8SA 2X7QA 4QFLA 3RUMA 1SYHA 4X1DA 1L5TA 1A7LA 4QFKA 3K6WA 1NH8A 3QAXA 3LC8A 4O3BA 3CR9A 4G77A 3ILTB 4FORA 1MH3A 5JEIA 4NE4A 3G3HA 1Y1MA 1ZTYA 3TTMA 2H99A 2I0CA 4JWXA 5H8QB 5L9OA 1USYH 1QJMA 4UACA 4AQ4A 3PUZE 4WEDA 3H6TA 5BWJA 3W9WA 5CMBA 1N0TA 5CBSA 3MVZA 4GWOA 1O64A 3H06B 5H8HA 1M5CA 4FEBA 1MQJA 4H8IA 3BBRA 2DVZA 2OK2A 4P0IA 3TZAA 4ELPA 2QMXA 4H67A 4ELQA 4QRZA 4ZZAA 1YAEA 3FZVA 2PX1A 1B46A 3K1PA 4IO6A 3L6GA 3EHUA 4ND9A 4BDNA 1LGBC 1UIVA 3GZGA 4GQOA 2HCAA 1MXWA 4IO2A 3QSLA 2XXPA 2RINA 1B3HA 4IY5A 3B6TA 3EN3A 3IORA 3H7MA 2RC8A 2FNCA 4PETA 3T96B 5EYFA 1ZIUA 2O51A 4WXJA 2VOZA 4KCCA 2I0BA 3FVGA 2OWTA 3FJ7A 1PC3A 3IOVA 3G3IA 2ZXTA 3TDJA 1OVTA 5EHSA 4NEDA 3TMGA 5TP9B 3C35A 4ESWA 2RCAA 3R7XA 2UVHA 4R2FA 4ZEIA 3MPLA 1DPPA 2DYXA 1QUKA 2A5TA 3MVWA 3Q26A 3FVNA 4RPNA 1LAHE 1J1NA 4BDMA 3HPIA 5ICTA 2QPQA 3H4ZA 1B4HA 5AA2D 2E0SA 4MLQA 1N76A 1DPEA 5F7VA 4YKKA 1P1NA 1IIWA 3PPNA 1OMPA 3KZGA 2F5XA 2XXXA 3O6GA 3N26A 1XT8A 2NXOA 3CFXA 2D3IA 1ZU0A 3JZJA 2GH9A 2XX9A 3BFUA 2ALUA 5H8FA 4IO7A 5J1DA 4OFOA 4BDQA 3FIRA 2VP1A 4NF8B 4OHNA 4OESA 1IQ7A 4PFUA 4OWDA 4U4XA 4LZ8A 5LOMA 4KD5A 3E4RA 4RK9A 4YKJA 3U72A 5DT6A 4X1BA 4YZZA 3HSTA 4ZZEA 1ATGA 3Q27A 3LSXA 5ELVA 1US4A 3C31A 3S9NC 4U1OA 3HHFA 5KDTA 1SW5A 3H6UA 4H8JA 4C1UA 2Z8DA 3QUFA 4JSDA 1FQFA 1Y20A 2D21A 3DP4A 3PPOA 2F6PA 2XX8A 3OEMA 3PUYE 2ESNA 1TFDA 3SESA 3RNNA 3S9EA 3PUVE 3V5AA 3PGFA 5AA2A 2V25A 1FTJA 2O1MA 1B51A 4R9GA 1S7YA 2AL5A 1A99A 3V83A 4NF6B 2P0SA 1A8FA 3SKPA 2ZYKA 2XD3A 2HFBA 2PT2A 2E1SA 4WKMA 1NH7A 1N84A 2ZYNA 5B7DA 3FVKA 2CZLA 2PYYA 4KCDA 1US5A 3QIMA 4FEDA 2H98A 3HV1A 1TT1A 3O97A 3DM0A 2NUVA 2DWJA 3CG1A 1FQAA 1MPDA 1LBBA 1MQHA 1NFTA 4KI0E 4TLMB 5AE4A 4R74A 4LVQA 4P11A 2F6GA 5DYHA 4DXUA 1Y9UA 1LB8A 4FAJA 3SETA 4OYVA 4QF9A 2HAUA 1P1QA 3FV1A 4JDFA 1YTVA 1POTA 4POWA 2HZLA 4HCYA 3Q29A 3UK4A 1EU8A 1UTBB 1QKBA 4XTCQ 3O6IA 3KN7A 4LATA 1PBPA 3QYTA 1SW2A 2I4BA 4LZ7A 2GFEA 1AOVA 3RGYA 4IO3A 3E13X 2XD2A 3K02A 4RA1A 1GV8A 2F7CA 1NNKA 1I6AA 3SEVA 3ZKLA 3N5LA 4Q5TA 2QRYA 3H3GA 1B7HA 3O66A 4KYDA 2ONKE 4EQBA 2ZYMA 3T9UA 2PT1A 5I56B 2GHAA 1VSOA 1QW0A 4PFTA 1PB9A 1XVXA 3E3KA 3TQLA 3VV5A 3CFLA 4XKRA 1QULA 4BDRA 1SW1A 3VFJA 1IXHA 2OCUA 3SDFA 3OO9A 3LSWA 3TTKA 3EPEA 2I49A 2ONSA 5L9SA 3FATA 3CRBA 5AA4B 3TCFA 1ZKBA 1JEUA 3TCHA 4NF5A 4TOZA 1Z7NE 4BDOA 4QSDA 4G68A 3TPAA 1POY1 1AMFA 4O3AA 3T22A 4PFWA 1ZBMA 1II5A 3USDA 4MF3A 1N7WA 3ONMA 3C4MA 3KJTA 2XXQA 5DEXA 1MQGA 5ITOA 1D9VA 1SD3A 1XHYA 3PD8A 1H44A 3K01A 4R75A 5M2VA 3C33A 1MQDA 4G4PA 4ZEFA 3U1OA 1JVYA 1PB7A 4H5GA 1M5BA 4OFLA 3PUXE 1BIYA 4DXBA 4MFIA 4H1XA 4F19A 2FA7A 5JTYB 2Y7WA 5AA1A 3FASA 3U8QA 3G3KA 4XXUA 3PU5A 4OVJA 3O28A 4QSEA 2DWIA 4OTEA 1MQIA 4Q8RA 3QK6A 5H8QA 1ANFA 4F3GA 2UVIA 5TPAA 3FV2A 1JETA 4RK2A 2UYEA 1A8EA 3TUSA 1B3GA 2VHAA 1O7TA 3MW0A 3N6TA 4R6KA 4FIMA 3S2VA 1R9LA 2HXWA 2F7BA 4KR5A 4G2ZA 1LCTA 5I2KA 1IUDA 4H0WA 5A5XA 4JWYA 1LCFA 5I57B 4I1DA 1Y4TA 4IY6A 4E0XA 3HO7A 3IOTA 2OZZA 4F22A 3MJNA 5TU0A 4PFYA 3K1NA 1B52A 4EF1A 2QL3A 4NMYA 2DWHA 3K1MA 1XS5A 2ZMBA 4HW8A 4JB7A 5FHMA 3SEWA 2GRVA 1VFDA 3VVDA 3G7WA 2QS4A 2F34A 1B9JA 4M4GA 4BDLA 3OXNA 1P1UA 5I58A 3OO7A 3K6VA 3RT8A 1O63A 4TQUQ 1BP5A 3S9MC 4Z7EA 3MAMA 1XC1A 4OMBA 4QFNA 4HS7A 2O68A 4G8NA 3AXFA 2YJPA 3DELB 3IX1A 1Z7ME 2YPNA 5TP9A 4ZE8A 3K6UA 3IOUA 1UTHB 4ZDMA 3BKIB 3MP8A 2V93A 1GVCA 4NTLA 3P7IA 3T93B 5HPQA 3MP6A 5BUUA 4YB6A 4N6PA 1RYOA 3OELA 1RKMA 2O7UA 5CMMA 3ODBA 3JYRA 5AA3A 1MY1A 5B70A 4LA9A 5DVFA 4LQ2A
chains in the Genus database with same CATH superfamily
1B58A 2DQVA 2CZHA 3KC1A 1FQCA 2V3UA 1ZLQA 3TEPA 1FQBA 1MXYA 3NOHA 2IA4A 4ZEKA 1B40A 3DP6A 3CSGA 3TTLA 5H8NA 1GGGA 3SZPA 1JNFA 4F2OA 3C32A 2ONRA 1LSTA 4GX3A 1D4NA 1H76A 3Q28A 2OBGA 1LFHA 3D4GA 3RLFE 4PFRA 4NG7A 4XIGQ 4IR8A 3IFCA 1HSLA 4YICA 3FUZA 4WEPA 4EXKA 3N6UA 5KCJA 2P2AA 1R1NA 3EKIA 3IL1B 3KEIA 1ZMGA 4EF2A 3CSBA 1QVSA 5CBRA 1LBVA 2Q89A 4P3LA 4QFPA 3VVFA 4IO5A 1A54A 1SW4A 2B3BA 3IB0A 2GHBA 4N17A 3VXBA 5CM6A 1JVXA 1XVYA 3VXCA 4U22A 4GLIA 1FQEA 4GXAA 1BLFA 4RXLA 3UORA 3CG3A 3RT6B 2A5TB 3KBRA 3U92A 2L5VA 2QJEA 4U4SA 3KJ7A 3A3UA 2DS9A 1DMBA 3RQTA 2Q2CA 1IXIA 4PAIA 1QKAA 2Z23A 2B3FA 4G8HA 1NV3A 1B3LA 3KSXA 2QSXA 3IJXB 2UYFA 1NKXA 2RC7A 4JBZA 2PCRA 1URGA 1MPCA 4OFJA 2Z22A 1KA1A 4GBVA 3MWBA 1SI0A 2XXUA 1N7XA 4OEUA 4YKIA 2Z8EA 4XKQA 1FW0A 1QUIA 4DCYA 1B3EA 3FGSA 4RJZA 2H4IA 4EQ7A 5H8FB 1LBWA 2HEUA 5CMKA 1G0IA 3T9XB 5I84A 2QMWA 3EF7A 1P1WA 2QS1A 4Q30B 2R71A 3B6WA 5EQ7A 1YPNA 4FECA 3Q25A 2VD2A 3SERA 3A3CA 1SBPA 1S50A 2CMOA 4BLAA 3VLUA 4F1YA 1FTLA 3K2DA 3K6XA 1B4ZA 5I59A 4N6DA 1FTAA 3H6VA 4E0WA 1NNPA 2DP8A 3PMXA 3U94A 3IB1A 2DXRA 1TXFA 3MPKA 1NL5A 5KDTB 4P47A 4RNSA 2Z8FA 3FJMA 1EZPA 3C9HA 3TTNA 1MXXA 2B4LA 1B3FA 2R6GE 4DIGA 4HTGA 4IB2A 5DVIA 2P1SA 5JK4A 1WVJA 4KQPA 3RPWA 2ABHA 3FJGA 1A55A 4QHQA 4OXVA 5IAIA 2QS3A 3KN3A 2VPOA 1UTBA 1AIVA 1LB9A 2Q8JA 5LTCA 5K2YA 5AA2B 1MS7A 2QS2A 4OVQA 4OQOA 2Y7PA 1NMUA 1ELJA 2O84X 1B7UA 2H25A 2G93A 2WKYA 1F9BA 2XXWA 4DXCA 2R9JA 3C36A 3MVXA 1Y4CA 4U21A 5FHNA 3GYYA 1CE2A 4EUOA 3MBPA 2ZNTA 4NF4A 1JW1A 1A40A 4O3CA 4OVTA 4PFBA 1JEVA 1LAGE 4DZ1A 1MXVA 1OQHA 5I56A 2XWKA 3IFAA 1P99A 5IZ3B 4RYAA 1LLSA 4DLDA 1JW4A 3RN8A 2XXRA 1MM7A 3K00A 4C1TA 1FCKA 4JWOA 2FHYA 4P0GA 3FXQA 1UIUA 1B5HA 3ECRA 5DVJA 2AYSA 1RYXA 2ZNUA 3MC2A 4PAKA 3MZ1A 1AL3A 4N91A 2Y7KA 1OLCA 1MXUA 4OEVA 3KC0A 3B6QA 5FBPA 4F2QA 3B7DA 3IR1A 2XXHA 2R8TA 1FJ9A 1XI6A 5HBCA 4OVRA 1B05A 3U93A 4GVOA 4OVSA 1TWYA 3FXRA 5I2NA 4AB6A 1EZ9A 4DE8A 4QXDA 3I5OA 5FHOA 2X7PA 1KZ8A 4MBPA 1M5DA 1DSNA 1MM6A 4P56A 4QFOA 4GL0A 4OVPA 4EQ9A 1GR2A 1FSAA 2NOOA 1M5FA 1VR5A 1Y3NA 3SEXA 2HXRA 3RTFB 4KXPA 4I3YA 1EH3A 1XOCA 3ISPA 2OJTA 1FTOA 1SVXB 2O69A 2DDKA 5HM4B 3KN8A 4X48A 3TCGA 1B5IA 4PDDA 5T3JA 2F78A 3ZS6A 1AWBA 1MY0A 2KLFA 3IOWA 4GD5A 2NWJA 3I3VA 4G8MA 4ELRA 4ELOA 1Q35A 3QXMA 1B32A 4GFRA 1IXCA 2YLNA 3UA8A 3RY3A 2Q2AA 4NF0A 1MPBA 4GOTA 4OA4A 2RF1A 5L9MA 4F18A 3WAFA 3PUWE 3PPPA 4F1UA 2PFZA 4LP2B 3ILUB 2VT5A 3ROJA 1H43A 4G68B 1NV0A 4R6HA 4MNPA 3DP8A 4X8RA 3UGWA 1TFAA 1IEJA 4JXIA 1IXGA 1G0HA 3OO8A 1MH4A 4THIA 1VE4A 3FD3A 3O2AA 2VD3A 5DEXB 2OWSA 3BIHA 2F8DA 1GTKA 4MX6A 2I3WA 3IO6A 3RPLB 1IMBA 3LBSA 3SEYA 3OSQA 4JSOA 2XXVA 4YMBA 4DI3D 4GF8A 1USYE 4GL8A 3OSRA 2AL4A 4FJPA 4I62A 1SQYA 2I58A 4F3BA 1OLAA 4FATA 1DTZA 2Y7RA 5KZTA 5DW8A 1M5EA 1MXZA 3M3LA 1B0LA 2F36A 1LFGA 3M8UA 4NWCA 3VLWA 4NAPA 5CMCA 3CVGA 3MSTA 5CC2A 5IZ1A 2THIA 3MZBA 3MYUA 1NI9A 3L6HA 4M1VA 3T9VA 5TPAB 3OD7A 2BJJX 4F1VA 4N07A 4MH5A 1WDNA 3I6VA 3EQ1A 1D9YA 1PEBA 4H65A 4AS5A 3T1BA 4KHZE 1EZOA 5ISUA 1N04A 4OERA 1UTHA 5I7IA 1LEVA 4EXLA 5I2KB 3H03A 1D3KA 1FPIA 2UVGA 1MY2A 2DE2A 1UQWA 5A5XB 3FVOA 4HCWA 1SI1A 2HAVA 3TODA 1MG1A 2ZZWA 3KGCA 2XXIA 3IK6B 3LR1A 3IAZA 1LAXA 1LFIA 1DTGA 1FPJA 1FBEA 5H8HB 4H6DA 2X26A 4X9TA 2NVUB 1KA0A 3UP9A 3MZ9A 4KPTA 2DVCA 4H46A 4U2RA 2FVZA 5ET7A 2O6AA 5IGAA 3IB2A 2Q8MA 3MUQA 3R6UA 1LAFE 2A5SA 3VLVA 4LN5A 3UIFA 5IKBA 1B2HA 2XX7A 3SEUA 5I58B 1R9QA 3DLNA 1JW5A 3R26A 1NNFA 4ZECA 1FTKA 1B0HA 3G3JA 1HSEA 4GIZA 3GBAA 1SPIA 1YXIA 3T9HB 2XXYA 5DTBA 3S9LC 2AIXA 2REGA 3EHTA 2ZNSA 4F3SA 5CRYA 3H6WA 4HE1A 3HN0A 4IO4A 1FBCA 3BFTA 4C0RA 3THIA 1R6ZA 2W7YA 1FTMA 1BTJA 2ANJA 2FYIA 1Y3QA 4LONB 4OZ9A 2UVJA 1P1OA 4I9DA 3D4CA 2G29A 4IGTA 4NGUA 1PBQA 2H5YA 4H5FA 4NF8A 3OENA 2QVRA 4EDPA 2XXTA 1NV7A 2F7AA 5H8NB 2I4CA 4RY1A 5ITPA 1PB8A 2LAOA 4PQJA 3FBPA 4R2BA 4YB5A 1URSA 5FTHA 2DXYA 2V3QA 2DOJA 2H9BA 1PDAA 3K0VA 3S4UA 3W9VA 2REJA 4NQ8A 4AB5A 4I8CA 4YMAA 1IMDA 3OO6A 1I6QA 1NNTA 2I6EA 4HE2A 1QUJA 4GWSA 1JQFA 1SYIA 5KCJB 4U1ZA 1WODA 2B65A 1IZ1A 4QSCA 3PPQA 1B7ZA 1N3WA 1NV2A 1FPBA 1KWHA 3KG2A 2I48A 4HE0A 2O1LA 5I5PA 5EQ8A 3PD9A 3GBBA 4YAHX 1N3XA 3PMWA 2XHDA 3GXAA 2D5WA 5EHMA 1S9TA 4MHFA 2I3VA 3F11A 4NF6A 4PE5B 1AH5A 1ZJLA 3O29A 4OENA 2OLBA 1IMCA 2HZKA 2VGQA 3N94A 3O6HA 3W15C 2RCBA 4ONYA 3K4UA 2OWZA 3OEKA 4DDDA 4GXSB 4PC9A 2DE3A 5ICQA 4LUBA 1NUXA 3JV9A 2HQ0A 2RKMA 4XF5A 3B8BA 1HSJA 3GLBA 3PV0E 4F3PA 4OETA 2M8CA 4XKPA 1Y1ZA 4R6YA 4ECFA 4RPOA 2DSFA 2BJIA 5ET6A 1NV6A 1OVBA 3V89B 3HHGA 2P3VA 4G68C 4OANA 4PP0A 4F39A 1IITA 1B6HA 3IJOB 2Y7IA 3TKDA 1YCJA 1SDXA 1OQGA 4NWDA 1MDQA 3WAEA 5I3SA 4Z0IA 4PDHA 2RC9A 2Y5LA 2Y84A 3CFZA 1H45A 5F1QA 4MLVA 4KYSA 4KFQA 4ZEBA 4XKNA 3M3KA 3OMBA 1CB6A 4O8MA 4P1EA 3RTWB 1FQDA 1URDA 3TTRA 2XWIA 4F31B 5I59B 4GRKA 4POXA 2GQ1A 3V8XB 4TLLB 1LBCA 4R73A 2KR0A 5FTIA 3IO4A 4DCXA 3B50A 1VFEA 3HCQA 3C34A 3VDFA 3E9XA 3ZSFA 2PBWA 2UXAA 4LZ5A 2O7IA 2F97A 4F29A 4ESXA 4ZEDA 1FJ6A 4N13A 4YB7A 2DWAA 4NN3A 3KOTA 4U23A 4ZS9A 1I6BA 2V3TA 2V4CA 3TELA 5AA4A 1FRPA 4K3FA 2QFLA 4IGRA 1MDP1 2PMSA 3EHSA 2F3BA 1MRPA 4QBAA 1T0KA 4NF4B 1I69A 4ISUA 3LSFB 5L8DA 1B1HA 1Y3PA 3T66A 5J16A 3MQ9A 2ZYOA 5CI5A 4PF8A 2IEEA 1B1XA 1BKAA 1LBXA 3G3GA 3UN6A 4PBQA 1OIBA 4ZE9A 1H3DA 3KFMA 3MP1A 4YU0A 4KYEA 4R72A 3FXUA 1DOTA 3KSJA 3QUJA 2Q9TA 1B5JA 3M3FA 4Q0CA 5JTYA 2PVUA 4MCOA 3VVEA 1DK4A 2V84A 4PCDA 4YKPA 3PPRA 4FE8A 1Q1KA 5ET8A 3VE1B 3KOSA 3E78A 5I2NB 3LV0A 2F35A 4MMPA 2PFYA 3TQWA 3TAJA 3CI8A 4NF5B 3LSLA 1MY3A 2F3DA 4R9FA 1IMEA 3A09A 3ZKKA 5F24A 4UA8A 3TYHA 1MY4A 2DE4A 4AS4A 3TFLA 4L17A 4LQ5A 3O9PA 3CIJA 3LUYA 3OOAA 3G3FA 3MVYA 1RDZA 4H45A 5I57A 5K2XA 2Q88A 3PMVA 5H8SA 2X7QA 4QFLA 2WBDA 4PAFA 5EQ9A 3RUMA 1SYHA 4X1DA 1L5TA 1FPDA 1A7LA 4QFKA 3K6WA 1NH8A 3QAXA 3LC8A 4O3BA 3U65A 3CR9A 4G77A 3ILTB 4NHBA 4FORA 1YYZA 1MH3A 5JEIA 4NE4A 3G3HA 1Y1MA 1Q9DA 1ZTYA 4N8YA 3TTMA 2H99A 2I0CA 4JWXA 5H8QB 5L9OA 1USYH 1QJMA 4UACA 4AQ4A 3PUZE 4WEDA 3H6TA 3LUZA 5BWJA 3W9WA 1EYJA 5ESYA 5CMBA 1N0TA 5CBSA 3MVZA 4GWOA 1O64A 3H06B 5H8HA 1M5CA 4FEBA 1MQJA 4H8IA 3BBRA 1LBZA 2DVZA 2OK2A 4P0IA 1NV5A 3TZAA 4ELPA 2QMXA 4H67A 4ELQA 4QRZA 4ZZAA 1YAEA 3FZVA 2PX1A 1B46A 1FPEA 4IO6A 3K1PA 3L6GA 3EHUA 4ND9A 4BDNA 2FBPA 1EYIA 1LGBC 1UIVA 3GZGA 4GQOA 2HCAA 1MXWA 4IO2A 3QSLA 2XXPA 2RINA 1B3HA 4MNIA 3HFUA 4IY5A 3B6TA 3RYDA 3EN3A 3IORA 3H7MA 2RC8A 2FNCA 4PETA 3T96B 5EYFA 1ZIUA 4GWUA 4NX1A 3E79A 1LBYA 2O51A 4WXJA 4PE3A 2VOZA 4KCCA 2I0BA 3FVGA 2OWTA 3FJ7A 4GWZA 1PC3A 3IOVA 3G3IA 5EYGA 1NV1A 4PBHA 2ZXTA 3TDJA 1OVTA 5EHSA 4NEDA 3TMGA 4JVDA 5TP9B 3C35A 2FIXA 2KQZA 4ESWA 2RCAA 3R7XA 1FPKA 2JJKA 2UVHA 4R2FA 4O94A 4ZEIA 3MPLA 1DPPA 2DYXA 1QUKA 2A5TA 3MVWA 3Q26A 3FVNA 4O7MA 4RPNA 1LAHE 4P8BA 1J1NA 1FPLA 1NUWA 4BDMA 3HPIA 5ICTA 2QPQA 3H4ZA 1B4HA 5AA2D 2E0SA 4MLQA 1N76A 1DPEA 5F7VA 4YKKA 1P1NA 1IIWA 4N8GA 3PPNA 1OMPA 3KZGA 2F5XA 2XXXA 3O6GA 3N26A 1XT8A 2NXOA 1DCUA 3CFXA 2D3IA 1ZU0A 3JZJA 2P3NA 2GH9A 2XX9A 3BFUA 2ALUA 5H8FA 4IO7A 5J1DA 4OFOA 4BDQA 2CZIA 1QGXA 3FIRA 4N15A 2HPGA 2VP1A 3CHGA 4NF8B 4OHNA 1FBFA 4OESA 1IQ7A 4PFUA 4OWDA 4U4XA 4GWWA 4LZ8A 5LOMA 4KD5A 3E4RA 4RK9A 4YKJA 3A29A 1K9ZA 3U72A 5DT6A 1EYKA 4N6KA 4X1BA 4YZZA 3HSTA 4ZZEA 1ATGA 3Q27A 3LSXA 4N4UA 5ELVA 4O7IA 1US4A 3C31A 3S9NC 4U1OA 3HHFA 4MAGA 1BK4A 5KDTA 1SW5A 3H6UA 4H8JA 4C1UA 1FBDA 2Z8DA 4JSDA 3QUFA 1FQFA 1Y20A 2D21A 3DP4A 3PPOA 2F6PA 2XX8A 3OEMA 3PUYE 2ESNA 1TFDA 3SESA 3RNNA 2WEFA 3S9EA 1IMAA 3PUVE 3V5AA 3PGFA 5AA2A 2V25A 1INPA 1FTJA 2O1MA 1B51A 4R9GA 1S7YA 2AL5A 1A99A 3V83A 4NF6B 2P0SA 1A8FA 3SKPA 2ZYKA 2XD3A 2HFBA 2PT2A 2E1SA 4WKMA 1NH7A 3FXBA 1N84A 2ZYNA 5B7DA 3FVKA 2CZLA 2PYYA 4KCDA 1US5A 3QIMA 4FEDA 2CEXA 2H98A 3HV1A 1TT1A 3O97A 3DM0A 2NUVA 2DWJA 3CG1A 1FBGA 1FQAA 2OX3A 1VDWA 1MPDA 5IZ3A 1LBBA 1MQHA 1NFTA 2QVVA 4KI0E 4TLMB 5AE4A 4R74A 4LVQA 4P11A 5EYHA 2F6GA 2B4MA 5DYHA 4DXUA 1Y9UA 1LB8A 4FAJA 3SETA 4OYVA 1RDYA 4QF9A 4GBWA 2HAUA 1P1QA 3FV1A 4JDFA 1YTVA 1POTA 4POWA 2HZLA 4HCYA 3Q29A 3UK4A 1EU8A 1UTBB 1QKBA 1NUYA 4XTCQ 3O6IA 3KN7A 4LATA 1PBPA 5EQAA 3QYTA 1SW2A 5IM2A 2I4BA 4MIJA 4MJOA 4LZ7A 2GFEA 1AOVA 3RGYA 4IO3A 3E13X 2XD2A 3K02A 4RA1A 1GV8A 2F7CA 1NNKA 1I6AA 3SEVA 3ZKLA 3N5LA 4Q5TA 1IMFA 2QRYA 3H3GA 1B7HA 3O66A 1D9QA 2XXKA 4KYDA 2CZKA 4JVCA 2ONKE 2VPNA 4EQBA 2ZYMA 3T9UA 2PT1A 4G61A 5I56B 2GHAA 1VSOA 1QW0A 4PFTA 1PB9A 1XVXA 3E3KA 3TQLA 3VV5A 3CFLA 4XKRA 1QULA 4BDRA 1SW1A 3VFJA 2HHMA 1IXHA 2OCUA 3SDFA 3OO9A 3LSWA 4DI4B 3TTKA 3EPEA 2FIEA 1FBHA 2I49A 2ONSA 5L9SA 3FATA 3CRBA 5AA4B 3TCFA 4GWYA 1YZ0A 1ZKBA 4N81A 1JEUA 3TCHA 4NF5A 4TOZA 2ZZVA 1Z7NE 2Q74A 4QSDA 4G68A 4MNCA 3TPAA 4BDOA 4MEVA 1POY1 1JP4A 1AMFA 4O3AA 3T22A 5A5LA 4PFWA 4PTKA 5IZZA 1ZBMA 1II5A 2WX9A 4MF3A 3USDA 3PTYA 3D1RA 1N7WA 3ONMA 3C4MA 1NV4A 4P1LA 4JVIA 1CNQA 3KJTA 2XXQA 5DEXA 2WYPA 1MQGA 1RDXA 5ITOA 1D9VA 1SD3A 3RPLA 4I3EA 1XHYA 2XWOA 3PD8A 1H44A 3K01A 4R75A 5M2VA 3C33A 1MQDA 2ZZXA 4G4PA 1FPFA 4ZEFA 3U1OA 1JVYA 1PB7A 4H5GA 4PFIA 4GX6A 1M5BA 4OFLA 3PUXE 1BIYA 4DXBA 4UABA 4MFIA 4H1XA 4F19A 2FA7A 5JTYB 4PGNA 2Y7WA 4FBPA 5AA1A 3FASA 3U8QA 1NUZA 3G3KA 4XXUA 3PU5A 4OVJA 3O28A 4GX4A 4QSEA 2DWIA 4OTEA 4HXVA 4XFEA 1MQIA 4Q8RA 3QK6A 5H8QA 1DBZA 1ANFA 4F3GA 2UVIA 4X04A 5TPAA 3FV2A 4GWXA 1JETA 4RK2A 2UYEA 1A8EA 3TUSA 1B3GA 2VHAA 1O7TA 3MW0A 3N6TA 4R6KA 4FIMA 3S2VA 1R9LA 2HXWA 2F7BA 1K9YA 3BIGA 3QMFA 4KR5A 5ET5A 2WBBA 4G2ZA 1LCTA 5I2KA 1IUDA 4H0WA 5A5XA 4JWYA 1LCFA 5I57B 4I40A 4PGPA 4I1DA 1Y4TA 4PF6A 4IY6A 4P9KA 4E0XA 3HO7A 3IOTA 2XWVA 2OZZA 4F22A 3MJNA 5TU0A 4PFYA 3K1NA 1B52A 3T0JA 4EF1A 2QL3A 4NMYA 2DWHA 3K1MA 1XS5A 2ZMBA 4HW8A 4JB7A 5FHMA 5LDZA 3SEWA 2GRVA 1VFDA 3VVDA 3G7WA 2QS4A 2Y5KA 2F34A 1B9JA 4M4GA 1FBPA 4BDLA 3OXNA 1P1UA 5I58A 3OO7A 3K6VA 3RT8A 1FPGA 1O63A 4TQUQ 1BP5A 3S9MC 4Z7EA 3MAMA 1XC1A 4OMBA 4QFNA 4HS7A 2O68A 4G8NA 2WYKA 3AXFA 2YJPA 3DELB 3IX1A 1Z7ME 2YPNA 2QVUA 5TP9A 4ZE8A 3K6UA 3IOUA 1UTHB 4ZDMA 3KBZA 3BKIB 3MP8A 2V93A 1GVCA 4NTLA 3P7IA 2CEYA 3T93B 5HPQA 3MP6A 4YB6A 2MKZA 4N6PA 1RYOA 5BUUA 3OELA 1RKMA 2O7UA 5CMMA 3ODBA 2XA5A 3JYRA 5AA3A 1MY1A 5B70A 4LA9A 5DVFA 4LQ2A 4XEQA
chains in the Genus database with same CATH topology
1B58A 2DQVA 1FQCA 2V3UA 1ZLQA 3TEPA 1FQBA 1MXYA 2IA4A 4ZEKA 1B40A 3DP6A 3CSGA 3TTLA 5H8NA 1GGGA 1JNFA 4F2OA 3C32A 2ONRA 1LSTA 1D4NA 1H76A 3Q28A 2OBGA 1LFHA 3D4GA 3RLFE 4XIGQ 1HSLA 4YICA 3FUZA 4WEPA 4EXKA 3N6UA 5KCJA 2P2AA 1R1NA 3IL1B 3KEIA 1ZMGA 4EF2A 3CSBA 1QVSA 5CBRA 2Q89A 4QFPA 3VVFA 4IO5A 1A54A 1SW4A 2B3BA 3IB0A 2GHBA 3VXBA 5CM6A 1JVXA 1XVYA 3VXCA 4U22A 4GLIA 1FQEA 4GXAA 1BLFA 4RXLA 3UORA 3CG3A 3RT6B 2A5TB 3KBRA 3U92A 2QJEA 4U4SA 3KJ7A 3A3UA 2DS9A 1DMBA 3RQTA 2Q2CA 1IXIA 1QKAA 2Z23A 2B3FA 4G8HA 1B3LA 3KSXA 2QSXA 3IJXB 2UYFA 1NKXA 2RC7A 4JBZA 1URGA 1MPCA 4OFJA 2Z22A 3MWBA 1SI0A 2XXUA 4YKIA 1N7XA 4OEUA 2Z8EA 4XKQA 1FW0A 1QUIA 4DCYA 1B3EA 3FGSA 4RJZA 2H4IA 4EQ7A 5H8FB 2HEUA 5CMKA 3T9XB 5I84A 2QMWA 3EF7A 1P1WA 2QS1A 4Q30B 2R71A 3B6WA 1YPNA 4FECA 3Q25A 2VD2A 3SERA 3A3CA 1SBPA 1S50A 2CMOA 4BLAA 3VLUA 4F1YA 1FTLA 3K2DA 3K6XA 1B4ZA 5I59A 4E0WA 3H6VA 1NNPA 2DP8A 3PMXA 3U94A 3IB1A 2DXRA 1TXFA 3MPKA 1NL5A 5KDTB 4RNSA 2Z8FA 3FJMA 1EZPA 3C9HA 3TTNA 1MXXA 1B3FA 2R6GE 4DIGA 4HTGA 4IB2A 5DVIA 2P1SA 5JK4A 1WVJA 4KQPA 3RPWA 2ABHA 3FJGA 1A55A 4QHQA 4OXVA 5IAIA 2QS3A 3KN3A 1UTBA 1AIVA 1LB9A 2Q8JA 5K2YA 5AA2B 1MS7A 2QS2A 4OQOA 2Y7PA 1NMUA 1ELJA 2O84X 1B7UA 2H25A 2G93A 2WKYA 1F9BA 2XXWA 4DXCA 2R9JA 3C36A 3MVXA 1Y4CA 4U21A 5FHNA 1CE2A 4EUOA 3MBPA 2ZNTA 4NF4A 1JW1A 1A40A 4O3CA 1JEVA 1LAGE 4DZ1A 1MXVA 1OQHA 5I56A 1P99A 4RYAA 1LLSA 4DLDA 1JW4A 3RN8A 2XXRA 1MM7A 3K00A 4C1TA 1FCKA 4JWOA 4P0GA 3FXQA 1UIUA 1B5HA 3ECRA 5DVJA 2AYSA 1RYXA 2ZNUA 3MC2A 3MZ1A 1AL3A 2Y7KA 1OLCA 1MXUA 4OEVA 3B6QA 4F2QA 3B7DA 3IR1A 2XXHA 5HBCA 1B05A 3U93A 4GVOA 1TWYA 3FXRA 5I2NA 4AB6A 1EZ9A 4DE8A 3I5OA 5FHOA 2X7PA 4MBPA 1M5DA 1DSNA 1MM6A 4QFOA 4GL0A 4EQ9A 1GR2A 2NOOA 1M5FA 1VR5A 1Y3NA 3SEXA 3RTFB 1EH3A 1XOCA 2OJTA 1FTOA 1SVXB 2O69A 5HM4B 3KN8A 4X48A 3TCGA 1B5IA 2F78A 3ZS6A 1MY0A 2KLFA 3IOWA 4GD5A 2NWJA 3I3VA 4G8MA 4ELRA 4ELOA 1Q35A 3QXMA 1B32A 4GFRA 1IXCA 2YLNA 3UA8A 3RY3A 2Q2AA 1MPBA 4GOTA 2RF1A 5L9MA 4F18A 3WAFA 3PUWE 3PPPA 4F1UA 4LP2B 3ILUB 1H43A 4G68B 4R6HA 3DP8A 3UGWA 1TFAA 1IEJA 4JXIA 1IXGA 3OO8A 1MH4A 4THIA 1VE4A 3FD3A 3O2AA 2VD3A 5DEXB 2OWSA 2F8DA 1GTKA 2I3WA 3IO6A 3LBSA 3SEYA 3OSQA 4JSOA 2XXVA 4YMBA 4GF8A 1USYE 4GL8A 3OSRA 2AL4A 4FJPA 4I62A 1SQYA 2I58A 4F3BA 1OLAA 4FATA 1DTZA 2Y7RA 5KZTA 1M5EA 1MXZA 3M3LA 1B0LA 2F36A 1LFGA 3M8UA 4NWCA 3VLWA 5CMCA 3CVGA 5CC2A 2THIA 3MZBA 3L6HA 4M1VA 3T9VA 5TPAB 3OD7A 2BJJX 4F1VA 4N07A 4MH5A 1WDNA 3I6VA 3EQ1A 1D9YA 1PEBA 4H65A 4KHZE 1EZOA 5ISUA 1N04A 4OERA 1UTHA 4EXLA 5I2KB 3H03A 1D3KA 2UVGA 1MY2A 2DE2A 1UQWA 5A5XB 3FVOA 4HCWA 1SI1A 2HAVA 3TODA 1MG1A 3KGCA 2XXIA 3IK6B 3LR1A 3IAZA 1LAXA 1LFIA 1DTGA 5H8HB 4H6DA 2X26A 4X9TA 2NVUB 3UP9A 3MZ9A 4KPTA 2DVCA 4U2RA 2O6AA 3IB2A 3MUQA 3R6UA 1LAFE 2A5SA 3VLVA 3UIFA 5IKBA 1B2HA 2XX7A 3SEUA 5I58B 1R9QA 3DLNA 1JW5A 3R26A 1NNFA 4ZECA 1FTKA 1B0HA 3G3JA 1HSEA 4GIZA 3GBAA 3T9HB 2XXYA 5DTBA 3S9LC 2AIXA 2REGA 3EHTA 2ZNSA 4F3SA 5CRYA 3H6WA 3HN0A 4IO4A 3BFTA 4C0RA 3THIA 1R6ZA 2W7YA 1FTMA 1BTJA 2ANJA 2FYIA 1Y3QA 4LONB 4OZ9A 2UVJA 1P1OA 4I9DA 3D4CA 2G29A 4IGTA 1PBQA 2H5YA 4H5FA 4NF8A 3OENA 4EDPA 2XXTA 2F7AA 5H8NB 2I4CA 4RY1A 5ITPA 1PB8A 2LAOA 4PQJA 4R2BA 4YB5A 1URSA 5FTHA 2DXYA 2V3QA 2DOJA 2H9BA 1PDAA 3K0VA 3S4UA 3W9VA 2REJA 4AB5A 4I8CA 4YMAA 3OO6A 1I6QA 1NNTA 2I6EA 1QUJA 1JQFA 1SYIA 5KCJB 4U1ZA 1WODA 2B65A 1IZ1A 4QSCA 3PPQA 1B7ZA 1N3WA 1KWHA 3KG2A 2I48A 2O1LA 3PD9A 4YAHX 3GBBA 1N3XA 3PMWA 2XHDA 3GXAA 2D5WA 5EHMA 1S9TA 2I3VA 3F11A 4NF6A 4PE5B 1AH5A 1ZJLA 3O29A 4OENA 2OLBA 2HZKA 2VGQA 3N94A 3O6HA 3W15C 2RCBA 4ONYA 3K4UA 3OEKA 4DDDA 4GXSB 2DE3A 5ICQA 4LUBA 3JV9A 2HQ0A 2RKMA 1HSJA 3GLBA 3PV0E 4F3PA 4OETA 2M8CA 4XKPA 1Y1ZA 4R6YA 4ECFA 4RPOA 2DSFA 1OVBA 3V89B 3HHGA 4G68C 4F39A 4PP0A 1IITA 1B6HA 3IJOB 2Y7IA 3TKDA 1YCJA 1SDXA 1OQGA 4NWDA 1MDQA 3WAEA 4Z0IA 2RC9A 2Y84A 3CFZA 1H45A 5F1QA 4MLVA 4KYSA 4KFQA 4ZEBA 4XKNA 3M3KA 3OMBA 1CB6A 3RTWB 1FQDA 1URDA 3TTRA 4F31B 5I59B 4GRKA 4POXA 3V8XB 4TLLB 1LBCA 4R73A 5FTIA 3IO4A 4DCXA 1VFEA 3HCQA 3C34A 3VDFA 3E9XA 3ZSFA 2PBWA 2UXAA 4LZ5A 2O7IA 2F97A 4F29A 4ESXA 4ZEDA 4N13A 4YB7A 2DWAA 3KOTA 4U23A 4ZS9A 1I6BA 2V3TA 3TELA 5AA4A 4K3FA 4IGRA 1MDP1 2PMSA 3EHSA 1MRPA 1T0KA 4NF4B 1I69A 4ISUA 3LSFB 5L8DA 1B1HA 1Y3PA 3T66A 3MQ9A 2ZYOA 5CI5A 2IEEA 1B1XA 1BKAA 3G3GA 3UN6A 1OIBA 4ZE9A 1H3DA 3KFMA 3MP1A 4YU0A 4KYEA 4R72A 3FXUA 1DOTA 3KSJA 3QUJA 2Q9TA 1B5JA 3M3FA 4Q0CA 5JTYA 2PVUA 3VVEA 2V84A 4YKPA 3PPRA 4FE8A 1Q1KA 3VE1B 3KOSA 5I2NB 2F35A 3TQWA 3TAJA 3CI8A 4NF5B 3LSLA 1MY3A 4R9FA 3A09A 3ZKKA 4UA8A 3TYHA 1MY4A 2DE4A 3TFLA 4L17A 4LQ5A 3O9PA 3CIJA 3LUYA 3OOAA 3G3FA 3MVYA 5I57A 5K2XA 2Q88A 3PMVA 5H8SA 2X7QA 4QFLA 3RUMA 1SYHA 4X1DA 1L5TA 1A7LA 4QFKA 3K6WA 1NH8A 3QAXA 3LC8A 4O3BA 3CR9A 4G77A 3ILTB 4FORA 1MH3A 5JEIA 4NE4A 3G3HA 1Y1MA 1ZTYA 3TTMA 2H99A 2I0CA 4JWXA 5H8QB 5L9OA 1USYH 1QJMA 4UACA 4AQ4A 3PUZE 4WEDA 3H6TA 5BWJA 3W9WA 5CMBA 1N0TA 5CBSA 3MVZA 4GWOA 1O64A 3H06B 5H8HA 1M5CA 4FEBA 1MQJA 4H8IA 3BBRA 2DVZA 2OK2A 4P0IA 3TZAA 4ELPA 2QMXA 4H67A 4ELQA 4QRZA 4ZZAA 1YAEA 3FZVA 2PX1A 1B46A 3K1PA 4IO6A 3L6GA 3EHUA 4ND9A 4BDNA 1LGBC 1UIVA 3GZGA 4GQOA 2HCAA 1MXWA 4IO2A 3QSLA 2XXPA 2RINA 1B3HA 4IY5A 3B6TA 3EN3A 3IORA 3H7MA 2RC8A 2FNCA 4PETA 3T96B 5EYFA 1ZIUA 2O51A 4WXJA 2VOZA 4KCCA 2I0BA 3FVGA 2OWTA 3FJ7A 1PC3A 3IOVA 3G3IA 2ZXTA 3TDJA 1OVTA 5EHSA 4NEDA 3TMGA 5TP9B 3C35A 4ESWA 2RCAA 3R7XA 2UVHA 4R2FA 4ZEIA 3MPLA 1DPPA 2DYXA 1QUKA 2A5TA 3MVWA 3Q26A 3FVNA 4RPNA 1LAHE 1J1NA 4BDMA 3HPIA 5ICTA 2QPQA 3H4ZA 1B4HA 5AA2D 2E0SA 4MLQA 1N76A 1DPEA 5F7VA 4YKKA 1P1NA 1IIWA 3PPNA 1OMPA 3KZGA 2F5XA 2XXXA 3O6GA 3N26A 1XT8A 2NXOA 3CFXA 2D3IA 1ZU0A 3JZJA 2GH9A 2XX9A 3BFUA 2ALUA 5H8FA 4IO7A 5J1DA 4OFOA 4BDQA 3FIRA 2VP1A 4NF8B 4OHNA 4OESA 1IQ7A 4PFUA 4OWDA 4U4XA 4LZ8A 5LOMA 4KD5A 3E4RA 4RK9A 4YKJA 3U72A 5DT6A 4X1BA 4YZZA 3HSTA 4ZZEA 1ATGA 3Q27A 3LSXA 5ELVA 1US4A 3C31A 3S9NC 4U1OA 3HHFA 5KDTA 1SW5A 3H6UA 4H8JA 4C1UA 2Z8DA 3QUFA 4JSDA 1FQFA 1Y20A 2D21A 3DP4A 3PPOA 2F6PA 2XX8A 3OEMA 3PUYE 2ESNA 1TFDA 3SESA 3RNNA 3S9EA 3PUVE 3V5AA 3PGFA 5AA2A 2V25A 1FTJA 2O1MA 1B51A 4R9GA 1S7YA 2AL5A 1A99A 3V83A 4NF6B 2P0SA 1A8FA 3SKPA 2ZYKA 2XD3A 2HFBA 2PT2A 2E1SA 4WKMA 1NH7A 1N84A 2ZYNA 5B7DA 3FVKA 2CZLA 2PYYA 4KCDA 1US5A 3QIMA 4FEDA 2H98A 3HV1A 1TT1A 3O97A 3DM0A 2NUVA 2DWJA 3CG1A 1FQAA 1MPDA 1LBBA 1MQHA 1NFTA 4KI0E 4TLMB 5AE4A 4R74A 4LVQA 4P11A 2F6GA 5DYHA 4DXUA 1Y9UA 1LB8A 4FAJA 3SETA 4OYVA 4QF9A 2HAUA 1P1QA 3FV1A 4JDFA 1YTVA 1POTA 4POWA 2HZLA 4HCYA 3Q29A 3UK4A 1EU8A 1UTBB 1QKBA 4XTCQ 3O6IA 3KN7A 4LATA 1PBPA 3QYTA 1SW2A 2I4BA 4LZ7A 2GFEA 1AOVA 3RGYA 4IO3A 3E13X 2XD2A 3K02A 4RA1A 1GV8A 2F7CA 1NNKA 1I6AA 3SEVA 3ZKLA 3N5LA 4Q5TA 2QRYA 3H3GA 1B7HA 3O66A 4KYDA 2ONKE 4EQBA 2ZYMA 3T9UA 2PT1A 5I56B 2GHAA 1VSOA 1QW0A 4PFTA 1PB9A 1XVXA 3E3KA 3TQLA 3VV5A 3CFLA 4XKRA 1QULA 4BDRA 1SW1A 3VFJA 1IXHA 2OCUA 3SDFA 3OO9A 3LSWA 3TTKA 3EPEA 2I49A 2ONSA 5L9SA 3FATA 3CRBA 5AA4B 3TCFA 1ZKBA 1JEUA 3TCHA 4NF5A 4TOZA 1Z7NE 4BDOA 4QSDA 4G68A 3TPAA 1POY1 1AMFA 4O3AA 3T22A 4PFWA 1ZBMA 1II5A 3USDA 4MF3A 1N7WA 3ONMA 3C4MA 3KJTA 2XXQA 5DEXA 1MQGA 5ITOA 1D9VA 1SD3A 1XHYA 3PD8A 1H44A 3K01A 4R75A 5M2VA 3C33A 1MQDA 4G4PA 4ZEFA 3U1OA 1JVYA 1PB7A 4H5GA 1M5BA 4OFLA 3PUXE 1BIYA 4DXBA 4MFIA 4H1XA 4F19A 2FA7A 5JTYB 2Y7WA 5AA1A 3FASA 3U8QA 3G3KA 4XXUA 3PU5A 4OVJA 3O28A 4QSEA 2DWIA 4OTEA 1MQIA 4Q8RA 3QK6A 5H8QA 1ANFA 4F3GA 2UVIA 5TPAA 3FV2A 1JETA 4RK2A 2UYEA 1A8EA 3TUSA 1B3GA 2VHAA 1O7TA 3MW0A 3N6TA 4R6KA 4FIMA 3S2VA 1R9LA 2HXWA 2F7BA 4KR5A 4G2ZA 1LCTA 5I2KA 1IUDA 4H0WA 5A5XA 4JWYA 1LCFA 5I57B 4I1DA 1Y4TA 4IY6A 4E0XA 3HO7A 3IOTA 2OZZA 4F22A 3MJNA 5TU0A 4PFYA 3K1NA 1B52A 4EF1A 2QL3A 4NMYA 2DWHA 3K1MA 1XS5A 2ZMBA 4HW8A 4JB7A 5FHMA 3SEWA 2GRVA 1VFDA 3VVDA 3G7WA 2QS4A 2F34A 1B9JA 4M4GA 4BDLA 3OXNA 1P1UA 5I58A 3OO7A 3K6VA 3RT8A 1O63A 4TQUQ 1BP5A 3S9MC 4Z7EA 3MAMA 1XC1A 4OMBA 4QFNA 4HS7A 2O68A 4G8NA 3AXFA 2YJPA 3DELB 3IX1A 1Z7ME 2YPNA 5TP9A 4ZE8A 3K6UA 3IOUA 1UTHB 4ZDMA 3BKIB 3MP8A 2V93A 1GVCA 4NTLA 3P7IA 3T93B 5HPQA 3MP6A 5BUUA 4YB6A 4N6PA 1RYOA 3OELA 1RKMA 2O7UA 5CMMA 3ODBA 3JYRA 5AA3A 1MY1A 5B70A 4LA9A 5DVFA 4LQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B58 A;  2DQV A;  1FQC A;  2V3U A;  1ZLQ A;  3TEP A;  1FQB A;  1MXY A;  2IA4 A;  4ZEK A;  1B40 A;  3DP6 A;  3CSG A;  3TTL A;  5H8N A;  1GGG A;  1JNF A;  4F2O A;  3C32 A;  2ONR A;  1LST A;  1D4N A;  1H76 A;  3Q28 A;  2OBG A;  1LFH A;  3D4G A;  3RLF E;  4XIG Q;  1HSL A;  4YIC A;  3FUZ A;  4WEP A;  4EXK A;  3N6U A;  5KCJ A;  2P2A A;  1R1N A;  3IL1 B;  3KEI A;  1ZMG A;  4EF2 A;  3CSB A;  1QVS A;  5CBR A;  2Q89 A;  4QFP A;  3VVF A;  4IO5 A;  1A54 A;  1SW4 A;  2B3B A;  3IB0 A;  2GHB A;  3VXB A;  5CM6 A;  1JVX A;  1XVY A;  3VXC A;  4U22 A;  4GLI A;  1FQE A;  4GXA A;  1BLF A;  4RXL A;  3UOR A;  3CG3 A;  3RT6 B;  2A5T B;  3KBR A;  3U92 A;  2QJE A;  4U4S A;  3KJ7 A;  3A3U A;  2DS9 A;  1DMB A;  3RQT A;  2Q2C A;  1IXI A;  1QKA A;  2Z23 A;  2B3F A;  4G8H A;  1B3L A;  3KSX A;  2QSX A;  3IJX B;  2UYF A;  1NKX A;  2RC7 A;  4JBZ A;  1URG A;  1MPC A;  4OFJ A;  2Z22 A;  3MWB A;  1SI0 A;  2XXU A;  4YKI A;  1N7X A;  4OEU A;  2Z8E A;  4XKQ A;  1FW0 A;  1QUI A;  4DCY A;  1B3E A;  3FGS A;  4RJZ A;  2H4I A;  4EQ7 A;  5H8F B;  2HEU A;  5CMK A;  3T9X B;  5I84 A;  2QMW A;  3EF7 A;  1P1W A;  2QS1 A;  4Q30 B;  2R71 A;  3B6W A;  1YPN A;  4FEC A;  3Q25 A;  2VD2 A;  3SER A;  3A3C A;  1SBP A;  1S50 A;  2CMO A;  4BLA A;  3VLU A;  4F1Y A;  1FTL A;  3K2D A;  3K6X A;  1B4Z A;  5I59 A;  4E0W A;  3H6V A;  1NNP A;  2DP8 A;  3PMX A;  3U94 A;  3IB1 A;  2DXR A;  1TXF A;  3MPK A;  1NL5 A;  5KDT B;  4RNS A;  2Z8F A;  3FJM A;  1EZP A;  3C9H A;  3TTN A;  1MXX A;  1B3F A;  2R6G E;  4DIG A;  4HTG A;  4IB2 A;  5DVI A;  2P1S A;  5JK4 A;  1WVJ A;  4KQP A;  3RPW A;  2ABH A;  3FJG A;  1A55 A;  4QHQ A;  4OXV A;  5IAI A;  2QS3 A;  3KN3 A;  1UTB A;  1AIV A;  1LB9 A;  2Q8J A;  5K2Y A;  5AA2 B;  1MS7 A;  2QS2 A;  4OQO A;  2Y7P A;  1NMU A;  1ELJ A;  2O84 X;  1B7U A;  2H25 A;  2G93 A;  2WKY A;  1F9B A;  2XXW A;  4DXC A;  2R9J A;  3C36 A;  3MVX A;  1Y4C A;  4U21 A;  5FHN A;  1CE2 A;  4EUO A;  3MBP A;  2ZNT A;  4NF4 A;  1JW1 A;  1A40 A;  4O3C A;  1JEV A;  1LAG E;  4DZ1 A;  1MXV A;  1OQH A;  5I56 A;  1P99 A;  4RYA A;  1LLS A;  4DLD A;  1JW4 A;  3RN8 A;  2XXR A;  1MM7 A;  3K00 A;  4C1T A;  1FCK A;  4JWO A;  4P0G A;  3FXQ A;  1UIU A;  1B5H A;  3ECR A;  5DVJ A;  2AYS A;  1RYX A;  2ZNU A;  3MC2 A;  3MZ1 A;  1AL3 A;  2Y7K A;  1OLC A;  1MXU A;  4OEV A;  3B6Q A;  4F2Q A;  3B7D A;  3IR1 A;  2XXH A;  5HBC A;  1B05 A;  3U93 A;  4GVO A;  1TWY A;  3FXR A;  5I2N A;  4AB6 A;  1EZ9 A;  4DE8 A;  3I5O A;  5FHO A;  2X7P A;  4MBP A;  1M5D A;  1DSN A;  1MM6 A;  4QFO A;  4GL0 A;  4EQ9 A;  1GR2 A;  2NOO A;  1M5F A;  1VR5 A;  1Y3N A;  3SEX A;  3RTF B;  1EH3 A;  1XOC A;  2OJT A;  1FTO A;  1SVX B;  2O69 A;  5HM4 B;  3KN8 A;  4X48 A;  3TCG A;  1B5I A;  2F78 A;  3ZS6 A;  1MY0 A;  2KLF A;  3IOW A;  4GD5 A;  2NWJ A;  3I3V A;  4G8M A;  4ELR A;  4ELO A;  1Q35 A;  3QXM A;  1B32 A;  4GFR A;  1IXC A;  2YLN A;  3UA8 A;  3RY3 A;  2Q2A A;  1MPB A;  4GOT A;  2RF1 A;  5L9M A;  4F18 A;  3WAF A;  3PUW E;  3PPP A;  4F1U A;  4LP2 B;  3ILU B;  1H43 A;  4G68 B;  4R6H A;  3DP8 A;  3UGW A;  1TFA A;  1IEJ A;  4JXI A;  1IXG A;  3OO8 A;  1MH4 A;  4THI A;  1VE4 A;  3FD3 A;  3O2A A;  2VD3 A;  5DEX B;  2OWS A;  2F8D A;  1GTK A;  2I3W A;  3IO6 A;  3LBS A;  3SEY A;  3OSQ A;  4JSO A;  2XXV A;  4YMB A;  4GF8 A;  1USY E;  4GL8 A;  3OSR A;  2AL4 A;  4FJP A;  4I62 A;  1SQY A;  2I58 A;  4F3B A;  1OLA A;  4FAT A;  1DTZ A;  2Y7R A;  5KZT A;  1M5E A;  1MXZ A;  3M3L A;  1B0L A;  2F36 A;  1LFG A;  3M8U A;  4NWC A;  3VLW A;  5CMC A;  3CVG A;  5CC2 A;  2THI A;  3MZB A;  3L6H A;  4M1V A;  3T9V A;  5TPA B;  3OD7 A;  2BJJ X;  4F1V A;  4N07 A;  4MH5 A;  1WDN A;  3I6V A;  3EQ1 A;  1D9Y A;  1PEB A;  4H65 A;  4KHZ E;  1EZO A;  5ISU A;  1N04 A;  4OER A;  1UTH A;  4EXL A;  5I2K B;  3H03 A;  1D3K A;  2UVG A;  1MY2 A;  2DE2 A;  1UQW A;  5A5X B;  3FVO A;  4HCW A;  1SI1 A;  2HAV A;  3TOD A;  1MG1 A;  3KGC A;  2XXI A;  3IK6 B;  3LR1 A;  3IAZ A;  1LAX A;  1LFI A;  1DTG A;  5H8H B;  4H6D A;  2X26 A;  4X9T A;  2NVU B;  3UP9 A;  3MZ9 A;  4KPT A;  2DVC A;  4U2R A;  2O6A A;  3IB2 A;  3MUQ A;  3R6U A;  1LAF E;  2A5S A;  3VLV A;  3UIF A;  5IKB A;  1B2H A;  2XX7 A;  3SEU A;  5I58 B;  1R9Q A;  3DLN A;  1JW5 A;  3R26 A;  1NNF A;  4ZEC A;  1FTK A;  1B0H A;  3G3J A;  1HSE A;  4GIZ A;  3GBA A;  3T9H B;  2XXY A;  5DTB A;  3S9L C;  2AIX A;  2REG A;  3EHT A;  2ZNS A;  4F3S A;  5CRY A;  3H6W A;  3HN0 A;  4IO4 A;  3BFT A;  4C0R A;  3THI A;  1R6Z A;  2W7Y A;  1FTM A;  1BTJ A;  2ANJ A;  2FYI A;  1Y3Q A;  4LON B;  4OZ9 A;  2UVJ A;  1P1O A;  4I9D A;  3D4C A;  2G29 A;  4IGT A;  1PBQ A;  2H5Y A;  4H5F A;  4NF8 A;  3OEN A;  4EDP A;  2XXT A;  2F7A A;  5H8N B;  2I4C A;  4RY1 A;  5ITP A;  1PB8 A;  2LAO A;  4PQJ A;  4R2B A;  4YB5 A;  1URS A;  5FTH A;  2DXY A;  2V3Q A;  2DOJ A;  2H9B A;  1PDA A;  3K0V A;  3S4U A;  3W9V A;  2REJ A;  4AB5 A;  4I8C A;  4YMA A;  3OO6 A;  1I6Q A;  1NNT A;  2I6E A;  1QUJ A;  1JQF A;  1SYI A;  5KCJ B;  4U1Z A;  1WOD A;  2B65 A;  1IZ1 A;  4QSC A;  3PPQ A;  1B7Z A;  1N3W A;  1KWH A;  3KG2 A;  2I48 A;  2O1L A;  3PD9 A;  4YAH X;  3GBB A;  1N3X A;  3PMW A;  2XHD A;  3GXA A;  2D5W A;  5EHM A;  1S9T A;  2I3V A;  3F11 A;  4NF6 A;  4PE5 B;  1AH5 A;  1ZJL A;  3O29 A;  4OEN A;  2OLB A;  2HZK A;  2VGQ A;  3N94 A;  3O6H A;  3W15 C;  2RCB A;  4ONY A;  3K4U A;  3OEK A;  4DDD A;  4GXS B;  2DE3 A;  5ICQ A;  4LUB A;  3JV9 A;  2HQ0 A;  2RKM A;  1HSJ A;  3GLB A;  3PV0 E;  4F3P A;  4OET A;  2M8C A;  4XKP A;  1Y1Z A;  4R6Y A;  4ECF A;  4RPO A;  2DSF A;  1OVB A;  3V89 B;  3HHG A;  4G68 C;  4F39 A;  4PP0 A;  1IIT A;  1B6H A;  3IJO B;  2Y7I A;  3TKD A;  1YCJ A;  1SDX A;  1OQG A;  4NWD A;  1MDQ A;  3WAE A;  4Z0I A;  2RC9 A;  2Y84 A;  3CFZ A;  1H45 A;  5F1Q A;  4MLV A;  4KYS A;  4KFQ A;  4ZEB A;  4XKN A;  3M3K A;  3OMB A;  1CB6 A;  3RTW B;  1FQD A;  1URD A;  3TTR A;  4F31 B;  5I59 B;  4GRK A;  4POX A;  3V8X B;  4TLL B;  1LBC A;  4R73 A;  5FTI A;  3IO4 A;  4DCX A;  1VFE A;  3HCQ A;  3C34 A;  3VDF A;  3E9X A;  3ZSF A;  2PBW A;  2UXA A;  4LZ5 A;  2O7I A;  2F97 A;  4F29 A;  4ESX A;  4ZED A;  4N13 A;  4YB7 A;  2DWA A;  3KOT A;  4U23 A;  4ZS9 A;  1I6B A;  2V3T A;  3TEL A;  5AA4 A;  4K3F A;  4IGR A;  1MDP 1;  2PMS A;  3EHS A;  1MRP A;  1T0K A;  4NF4 B;  1I69 A;  4ISU A;  3LSF B;  5L8D A;  1B1H A;  1Y3P A;  3T66 A;  3MQ9 A;  2ZYO A;  5CI5 A;  2IEE A;  1B1X A;  1BKA A;  3G3G A;  3UN6 A;  1OIB A;  4ZE9 A;  1H3D A;  3KFM A;  3MP1 A;  4YU0 A;  4KYE A;  4R72 A;  3FXU A;  1DOT A;  3KSJ A;  3QUJ A;  2Q9T A;  1B5J A;  3M3F A;  4Q0C A;  5JTY A;  2PVU A;  3VVE A;  2V84 A;  4YKP A;  3PPR A;  4FE8 A;  1Q1K A;  3VE1 B;  3KOS A;  5I2N B;  2F35 A;  3TQW A;  3TAJ A;  3CI8 A;  4NF5 B;  3LSL A;  1MY3 A;  4R9F A;  3A09 A;  3ZKK A;  4UA8 A;  3TYH A;  1MY4 A;  2DE4 A;  3TFL A;  4L17 A;  4LQ5 A;  3O9P A;  3CIJ A;  3LUY A;  3OOA A;  3G3F A;  3MVY A;  5I57 A;  5K2X A;  2Q88 A;  3PMV A;  5H8S A;  2X7Q A;  4QFL A;  3RUM A;  1SYH A;  4X1D A;  1L5T A;  1A7L A;  4QFK A;  3K6W A;  1NH8 A;  3QAX A;  3LC8 A;  4O3B A;  3CR9 A;  4G77 A;  3ILT B;  4FOR A;  1MH3 A;  5JEI A;  4NE4 A;  3G3H A;  1Y1M A;  1ZTY A;  3TTM A;  2H99 A;  2I0C A;  4JWX A;  5H8Q B;  5L9O A;  1USY H;  1QJM A;  4UAC A;  4AQ4 A;  3PUZ E;  4WED A;  3H6T A;  5BWJ A;  3W9W A;  5CMB A;  1N0T A;  5CBS A;  3MVZ A;  4GWO A;  1O64 A;  3H06 B;  5H8H A;  1M5C A;  4FEB A;  1MQJ A;  4H8I A;  3BBR A;  2DVZ A;  2OK2 A;  4P0I A;  3TZA A;  4ELP A;  2QMX A;  4H67 A;  4ELQ A;  4QRZ A;  4ZZA A;  1YAE A;  3FZV A;  2PX1 A;  1B46 A;  3K1P A;  4IO6 A;  3L6G A;  3EHU A;  4ND9 A;  4BDN A;  1LGB C;  1UIV A;  3GZG A;  4GQO A;  2HCA A;  1MXW A;  4IO2 A;  3QSL A;  2XXP A;  2RIN A;  1B3H A;  4IY5 A;  3B6T A;  3EN3 A;  3IOR A;  3H7M A;  2RC8 A;  2FNC A;  4PET A;  3T96 B;  5EYF A;  1ZIU A;  2O51 A;  4WXJ A;  2VOZ A;  4KCC A;  2I0B A;  3FVG A;  2OWT A;  3FJ7 A;  1PC3 A;  3IOV A;  3G3I A;  2ZXT A;  3TDJ A;  1OVT A;  5EHS A;  4NED A;  3TMG A;  5TP9 B;  3C35 A;  4ESW A;  2RCA A;  3R7X A;  2UVH A;  4R2F A;  4ZEI A;  3MPL A;  1DPP A;  2DYX A;  1QUK A;  2A5T A;  3MVW A;  3Q26 A;  3FVN A;  4RPN A;  1LAH E;  1J1N A;  4BDM A;  3HPI A;  5ICT A;  2QPQ A;  3H4Z A;  1B4H A;  5AA2 D;  2E0S A;  4MLQ A;  1N76 A;  1DPE A;  5F7V A;  4YKK A;  1P1N A;  1IIW A;  3PPN A;  1OMP A;  3KZG A;  2F5X A;  2XXX A;  3O6G A;  3N26 A;  1XT8 A;  2NXO A;  3CFX A;  2D3I A;  1ZU0 A;  3JZJ A;  2GH9 A;  2XX9 A;  3BFU A;  2ALU A;  5H8F A;  4IO7 A;  5J1D A;  4OFO A;  4BDQ A;  3FIR A;  2VP1 A;  4NF8 B;  4OHN A;  4OES A;  1IQ7 A;  4PFU A;  4OWD A;  4U4X A;  4LZ8 A;  5LOM A;  4KD5 A;  3E4R A;  4RK9 A;  4YKJ A;  3U72 A;  5DT6 A;  4X1B A;  4YZZ A;  3HST A;  4ZZE A;  1ATG A;  3Q27 A;  3LSX A;  5ELV A;  1US4 A;  3C31 A;  3S9N C;  4U1O A;  3HHF A;  5KDT A;  1SW5 A;  3H6U A;  4H8J A;  4C1U A;  2Z8D A;  3QUF A;  4JSD A;  1FQF A;  1Y20 A;  2D21 A;  3DP4 A;  3PPO A;  2F6P A;  2XX8 A;  3OEM A;  3PUY E;  2ESN A;  1TFD A;  3SES A;  3RNN A;  3S9E A;  3PUV E;  3V5A A;  3PGF A;  5AA2 A;  2V25 A;  1FTJ A;  2O1M A;  1B51 A;  4R9G A;  1S7Y A;  2AL5 A;  1A99 A;  3V83 A;  4NF6 B;  2P0S A;  1A8F A;  3SKP A;  2ZYK A;  2XD3 A;  2HFB A;  2PT2 A;  2E1S A;  4WKM A;  1NH7 A;  1N84 A;  2ZYN A;  5B7D A;  3FVK A;  2CZL A;  2PYY A;  4KCD A;  1US5 A;  3QIM A;  4FED A;  2H98 A;  3HV1 A;  1TT1 A;  3O97 A;  3DM0 A;  2NUV A;  2DWJ A;  3CG1 A;  1FQA A;  1MPD A;  1LBB A;  1MQH A;  1NFT A;  4KI0 E;  4TLM B;  5AE4 A;  4R74 A;  4LVQ A;  4P11 A;  2F6G A;  5DYH A;  4DXU A;  1Y9U A;  1LB8 A;  4FAJ A;  3SET A;  4OYV A;  4QF9 A;  2HAU A;  1P1Q A;  3FV1 A;  4JDF A;  1YTV A;  1POT A;  4POW A;  2HZL A;  4HCY A;  3Q29 A;  3UK4 A;  1EU8 A;  1UTB B;  1QKB A;  4XTC Q;  3O6I A;  3KN7 A;  4LAT A;  1PBP A;  3QYT A;  1SW2 A;  2I4B A;  4LZ7 A;  2GFE A;  1AOV A;  3RGY A;  4IO3 A;  3E13 X;  2XD2 A;  3K02 A;  4RA1 A;  1GV8 A;  2F7C A;  1NNK A;  1I6A A;  3SEV A;  3ZKL A;  3N5L A;  4Q5T A;  2QRY A;  3H3G A;  1B7H A;  3O66 A;  4KYD A;  2ONK E;  4EQB A;  2ZYM A;  3T9U A;  2PT1 A;  5I56 B;  2GHA A;  1VSO A;  1QW0 A;  4PFT A;  1PB9 A;  1XVX A;  3E3K A;  3TQL A;  3VV5 A;  3CFL A;  4XKR A;  1QUL A;  4BDR A;  1SW1 A;  3VFJ A;  1IXH A;  2OCU A;  3SDF A;  3OO9 A;  3LSW A;  3TTK A;  3EPE A;  2I49 A;  2ONS A;  5L9S A;  3FAT A;  3CRB A;  5AA4 B;  3TCF A;  1ZKB A;  1JEU A;  3TCH A;  4NF5 A;  4TOZ A;  1Z7N E;  4BDO A;  4QSD A;  4G68 A;  3TPA A;  1POY 1;  1AMF A;  4O3A A;  3T22 A;  4PFW A;  1ZBM A;  1II5 A;  3USD A;  4MF3 A;  1N7W A;  3ONM A;  3C4M A;  3KJT A;  2XXQ A;  5DEX A;  1MQG A;  5ITO A;  1D9V A;  1SD3 A;  1XHY A;  3PD8 A;  1H44 A;  3K01 A;  4R75 A;  5M2V A;  3C33 A;  1MQD A;  4G4P A;  4ZEF A;  3U1O A;  1JVY A;  1PB7 A;  4H5G A;  1M5B A;  4OFL A;  3PUX E;  1BIY A;  4DXB A;  4MFI A;  4H1X A;  4F19 A;  2FA7 A;  5JTY B;  2Y7W A;  5AA1 A;  3FAS A;  3U8Q A;  3G3K A;  4XXU A;  3PU5 A;  4OVJ A;  3O28 A;  4QSE A;  2DWI A;  4OTE A;  1MQI A;  4Q8R A;  3QK6 A;  5H8Q A;  1ANF A;  4F3G A;  2UVI A;  5TPA A;  3FV2 A;  1JET A;  4RK2 A;  2UYE A;  1A8E A;  3TUS A;  1B3G A;  2VHA A;  1O7T A;  3MW0 A;  3N6T A;  4R6K A;  4FIM A;  3S2V A;  1R9L A;  2HXW A;  2F7B A;  4KR5 A;  4G2Z A;  1LCT A;  5I2K A;  1IUD A;  4H0W A;  5A5X A;  4JWY A;  1LCF A;  5I57 B;  4I1D A;  1Y4T A;  4IY6 A;  4E0X A;  3HO7 A;  3IOT A;  2OZZ A;  4F22 A;  3MJN A;  5TU0 A;  4PFY A;  3K1N A;  1B52 A;  4EF1 A;  2QL3 A;  4NMY A;  2DWH A;  3K1M A;  1XS5 A;  2ZMB A;  4HW8 A;  4JB7 A;  5FHM A;  3SEW A;  2GRV A;  1VFD A;  3VVD A;  3G7W A;  2QS4 A;  2F34 A;  1B9J A;  4M4G A;  4BDL A;  3OXN A;  1P1U A;  5I58 A;  3OO7 A;  3K6V A;  3RT8 A;  1O63 A;  4TQU Q;  1BP5 A;  3S9M C;  4Z7E A;  3MAM A;  1XC1 A;  4OMB A;  4QFN A;  4HS7 A;  2O68 A;  4G8N A;  3AXF A;  2YJP A;  3DEL B;  3IX1 A;  1Z7M E;  2YPN A;  5TP9 A;  4ZE8 A;  3K6U A;  3IOU A;  1UTH B;  4ZDM A;  3BKI B;  3MP8 A;  2V93 A;  1GVC A;  4NTL A;  3P7I A;  3T93 B;  5HPQ A;  3MP6 A;  5BUU A;  4YB6 A;  4N6P A;  1RYO A;  3OEL A;  1RKM A;  2O7U A;  5CMM A;  3ODB A;  3JYR A;  5AA3 A;  1MY1 A;  5B70 A;  4LA9 A;  5DVF A;  4LQ2 A; 
#chains in the Genus database with same CATH topology
 1B58 A;  2DQV A;  2CZH A;  3KC1 A;  1FQC A;  2V3U A;  1ZLQ A;  3TEP A;  1FQB A;  1MXY A;  3NOH A;  2IA4 A;  4ZEK A;  1B40 A;  3DP6 A;  3CSG A;  3TTL A;  5H8N A;  1GGG A;  3SZP A;  1JNF A;  4F2O A;  3C32 A;  2ONR A;  1LST A;  4GX3 A;  1D4N A;  1H76 A;  3Q28 A;  2OBG A;  1LFH A;  3D4G A;  3RLF E;  4PFR A;  4NG7 A;  4XIG Q;  4IR8 A;  3IFC A;  1HSL A;  4YIC A;  3FUZ A;  4WEP A;  4EXK A;  3N6U A;  5KCJ A;  2P2A A;  1R1N A;  3EKI A;  3IL1 B;  3KEI A;  1ZMG A;  4EF2 A;  3CSB A;  1QVS A;  5CBR A;  1LBV A;  2Q89 A;  4P3L A;  4QFP A;  3VVF A;  4IO5 A;  1A54 A;  1SW4 A;  2B3B A;  3IB0 A;  2GHB A;  4N17 A;  3VXB A;  5CM6 A;  1JVX A;  1XVY A;  3VXC A;  4U22 A;  4GLI A;  1FQE A;  4GXA A;  1BLF A;  4RXL A;  3UOR A;  3CG3 A;  3RT6 B;  2A5T B;  3KBR A;  3U92 A;  2L5V A;  2QJE A;  4U4S A;  3KJ7 A;  3A3U A;  2DS9 A;  1DMB A;  3RQT A;  2Q2C A;  1IXI A;  4PAI A;  1QKA A;  2Z23 A;  2B3F A;  4G8H A;  1NV3 A;  1B3L A;  3KSX A;  2QSX A;  3IJX B;  2UYF A;  1NKX A;  2RC7 A;  4JBZ A;  2PCR A;  1URG A;  1MPC A;  4OFJ A;  2Z22 A;  1KA1 A;  4GBV A;  3MWB A;  1SI0 A;  2XXU A;  1N7X A;  4OEU A;  4YKI A;  2Z8E A;  4XKQ A;  1FW0 A;  1QUI A;  4DCY A;  1B3E A;  3FGS A;  4RJZ A;  2H4I A;  4EQ7 A;  5H8F B;  1LBW A;  2HEU A;  5CMK A;  1G0I A;  3T9X B;  5I84 A;  2QMW A;  3EF7 A;  1P1W A;  2QS1 A;  4Q30 B;  2R71 A;  3B6W A;  5EQ7 A;  1YPN A;  4FEC A;  3Q25 A;  2VD2 A;  3SER A;  3A3C A;  1SBP A;  1S50 A;  2CMO A;  4BLA A;  3VLU A;  4F1Y A;  1FTL A;  3K2D A;  3K6X A;  1B4Z A;  5I59 A;  4N6D A;  1FTA A;  3H6V A;  4E0W A;  1NNP A;  2DP8 A;  3PMX A;  3U94 A;  3IB1 A;  2DXR A;  1TXF A;  3MPK A;  1NL5 A;  5KDT B;  4P47 A;  4RNS A;  2Z8F A;  3FJM A;  1EZP A;  3C9H A;  3TTN A;  1MXX A;  2B4L A;  1B3F A;  2R6G E;  4DIG A;  4HTG A;  4IB2 A;  5DVI A;  2P1S A;  5JK4 A;  1WVJ A;  4KQP A;  3RPW A;  2ABH A;  3FJG A;  1A55 A;  4QHQ A;  4OXV A;  5IAI A;  2QS3 A;  3KN3 A;  2VPO A;  1UTB A;  1AIV A;  1LB9 A;  2Q8J A;  5LTC A;  5K2Y A;  5AA2 B;  1MS7 A;  2QS2 A;  4OVQ A;  4OQO A;  2Y7P A;  1NMU A;  1ELJ A;  2O84 X;  1B7U A;  2H25 A;  2G93 A;  2WKY A;  1F9B A;  2XXW A;  4DXC A;  2R9J A;  3C36 A;  3MVX A;  1Y4C A;  4U21 A;  5FHN A;  3GYY A;  1CE2 A;  4EUO A;  3MBP A;  2ZNT A;  4NF4 A;  1JW1 A;  1A40 A;  4O3C A;  4OVT A;  4PFB A;  1JEV A;  1LAG E;  4DZ1 A;  1MXV A;  1OQH A;  5I56 A;  2XWK A;  3IFA A;  1P99 A;  5IZ3 B;  4RYA A;  1LLS A;  4DLD A;  1JW4 A;  3RN8 A;  2XXR A;  1MM7 A;  3K00 A;  4C1T A;  1FCK A;  4JWO A;  2FHY A;  4P0G A;  3FXQ A;  1UIU A;  1B5H A;  3ECR A;  5DVJ A;  2AYS A;  1RYX A;  2ZNU A;  3MC2 A;  4PAK A;  3MZ1 A;  1AL3 A;  4N91 A;  2Y7K A;  1OLC A;  1MXU A;  4OEV A;  3KC0 A;  3B6Q A;  5FBP A;  4F2Q A;  3B7D A;  3IR1 A;  2XXH A;  2R8T A;  1FJ9 A;  1XI6 A;  5HBC A;  4OVR A;  1B05 A;  3U93 A;  4GVO A;  4OVS A;  1TWY A;  3FXR A;  5I2N A;  4AB6 A;  1EZ9 A;  4DE8 A;  4QXD A;  3I5O A;  5FHO A;  2X7P A;  1KZ8 A;  4MBP A;  1M5D A;  1DSN A;  1MM6 A;  4P56 A;  4QFO A;  4GL0 A;  4OVP A;  4EQ9 A;  1GR2 A;  1FSA A;  2NOO A;  1M5F A;  1VR5 A;  1Y3N A;  3SEX A;  2HXR A;  3RTF B;  4KXP A;  4I3Y A;  1EH3 A;  1XOC A;  3ISP A;  2OJT A;  1FTO A;  1SVX B;  2O69 A;  2DDK A;  5HM4 B;  3KN8 A;  4X48 A;  3TCG A;  1B5I A;  4PDD A;  5T3J A;  2F78 A;  3ZS6 A;  1AWB A;  1MY0 A;  2KLF A;  3IOW A;  4GD5 A;  2NWJ A;  3I3V A;  4G8M A;  4ELR A;  4ELO A;  1Q35 A;  3QXM A;  1B32 A;  4GFR A;  1IXC A;  2YLN A;  3UA8 A;  3RY3 A;  2Q2A A;  4NF0 A;  1MPB A;  4GOT A;  4OA4 A;  2RF1 A;  5L9M A;  4F18 A;  3WAF A;  3PUW E;  3PPP A;  4F1U A;  2PFZ A;  4LP2 B;  3ILU B;  2VT5 A;  3ROJ A;  1H43 A;  4G68 B;  1NV0 A;  4R6H A;  4MNP A;  3DP8 A;  4X8R A;  3UGW A;  1TFA A;  1IEJ A;  4JXI A;  1IXG A;  1G0H A;  3OO8 A;  1MH4 A;  4THI A;  1VE4 A;  3FD3 A;  3O2A A;  2VD3 A;  5DEX B;  2OWS A;  3BIH A;  2F8D A;  1GTK A;  4MX6 A;  2I3W A;  3IO6 A;  3RPL B;  1IMB A;  3LBS A;  3SEY A;  3OSQ A;  4JSO A;  2XXV A;  4YMB A;  4DI3 D;  4GF8 A;  1USY E;  4GL8 A;  3OSR A;  2AL4 A;  4FJP A;  4I62 A;  1SQY A;  2I58 A;  4F3B A;  1OLA A;  4FAT A;  1DTZ A;  2Y7R A;  5KZT A;  5DW8 A;  1M5E A;  1MXZ A;  3M3L A;  1B0L A;  2F36 A;  1LFG A;  3M8U A;  4NWC A;  3VLW A;  4NAP A;  5CMC A;  3CVG A;  3MST A;  5CC2 A;  5IZ1 A;  2THI A;  3MZB A;  3MYU A;  1NI9 A;  3L6H A;  4M1V A;  3T9V A;  5TPA B;  3OD7 A;  2BJJ X;  4F1V A;  4N07 A;  4MH5 A;  1WDN A;  3I6V A;  3EQ1 A;  1D9Y A;  1PEB A;  4H65 A;  4AS5 A;  3T1B A;  4KHZ E;  1EZO A;  5ISU A;  1N04 A;  4OER A;  1UTH A;  5I7I A;  1LEV A;  4EXL A;  5I2K B;  3H03 A;  1D3K A;  1FPI A;  2UVG A;  1MY2 A;  2DE2 A;  1UQW A;  5A5X B;  3FVO A;  4HCW A;  1SI1 A;  2HAV A;  3TOD A;  1MG1 A;  2ZZW A;  3KGC A;  2XXI A;  3IK6 B;  3LR1 A;  3IAZ A;  1LAX A;  1LFI A;  1DTG A;  1FPJ A;  1FBE A;  5H8H B;  4H6D A;  2X26 A;  4X9T A;  2NVU B;  1KA0 A;  3UP9 A;  3MZ9 A;  4KPT A;  2DVC A;  4H46 A;  4U2R A;  2FVZ A;  5ET7 A;  2O6A A;  5IGA A;  3IB2 A;  2Q8M A;  3MUQ A;  3R6U A;  1LAF E;  2A5S A;  3VLV A;  4LN5 A;  3UIF A;  5IKB A;  1B2H A;  2XX7 A;  3SEU A;  5I58 B;  1R9Q A;  3DLN A;  1JW5 A;  3R26 A;  1NNF A;  4ZEC A;  1FTK A;  1B0H A;  3G3J A;  1HSE A;  4GIZ A;  3GBA A;  1SPI A;  1YXI A;  3T9H B;  2XXY A;  5DTB A;  3S9L C;  2AIX A;  2REG A;  3EHT A;  2ZNS A;  4F3S A;  5CRY A;  3H6W A;  4HE1 A;  3HN0 A;  4IO4 A;  1FBC A;  3BFT A;  4C0R A;  3THI A;  1R6Z A;  2W7Y A;  1FTM A;  1BTJ A;  2ANJ A;  2FYI A;  1Y3Q A;  4LON B;  4OZ9 A;  2UVJ A;  1P1O A;  4I9D A;  3D4C A;  2G29 A;  4IGT A;  4NGU A;  1PBQ A;  2H5Y A;  4H5F A;  4NF8 A;  3OEN A;  2QVR A;  4EDP A;  2XXT A;  1NV7 A;  2F7A A;  5H8N B;  2I4C A;  4RY1 A;  5ITP A;  1PB8 A;  2LAO A;  4PQJ A;  3FBP A;  4R2B A;  4YB5 A;  1URS A;  5FTH A;  2DXY A;  2V3Q A;  2DOJ A;  2H9B A;  1PDA A;  3K0V A;  3S4U A;  3W9V A;  2REJ A;  4NQ8 A;  4AB5 A;  4I8C A;  4YMA A;  1IMD A;  3OO6 A;  1I6Q A;  1NNT A;  2I6E A;  4HE2 A;  1QUJ A;  4GWS A;  1JQF A;  1SYI A;  5KCJ B;  4U1Z A;  1WOD A;  2B65 A;  1IZ1 A;  4QSC A;  3PPQ A;  1B7Z A;  1N3W A;  1NV2 A;  1FPB A;  1KWH A;  3KG2 A;  2I48 A;  4HE0 A;  2O1L A;  5I5P A;  5EQ8 A;  3PD9 A;  3GBB A;  4YAH X;  1N3X A;  3PMW A;  2XHD A;  3GXA A;  2D5W A;  5EHM A;  1S9T A;  4MHF A;  2I3V A;  3F11 A;  4NF6 A;  4PE5 B;  1AH5 A;  1ZJL A;  3O29 A;  4OEN A;  2OLB A;  1IMC A;  2HZK A;  2VGQ A;  3N94 A;  3O6H A;  3W15 C;  2RCB A;  4ONY A;  3K4U A;  2OWZ A;  3OEK A;  4DDD A;  4GXS B;  4PC9 A;  2DE3 A;  5ICQ A;  4LUB A;  1NUX A;  3JV9 A;  2HQ0 A;  2RKM A;  4XF5 A;  3B8B A;  1HSJ A;  3GLB A;  3PV0 E;  4F3P A;  4OET A;  2M8C A;  4XKP A;  1Y1Z A;  4R6Y A;  4ECF A;  4RPO A;  2DSF A;  2BJI A;  5ET6 A;  1NV6 A;  1OVB A;  3V89 B;  3HHG A;  2P3V A;  4G68 C;  4OAN A;  4PP0 A;  4F39 A;  1IIT A;  1B6H A;  3IJO B;  2Y7I A;  3TKD A;  1YCJ A;  1SDX A;  1OQG A;  4NWD A;  1MDQ A;  3WAE A;  5I3S A;  4Z0I A;  4PDH A;  2RC9 A;  2Y5L A;  2Y84 A;  3CFZ A;  1H45 A;  5F1Q A;  4MLV A;  4KYS A;  4KFQ A;  4ZEB A;  4XKN A;  3M3K A;  3OMB A;  1CB6 A;  4O8M A;  4P1E A;  3RTW B;  1FQD A;  1URD A;  3TTR A;  2XWI A;  4F31 B;  5I59 B;  4GRK A;  4POX A;  2GQ1 A;  3V8X B;  4TLL B;  1LBC A;  4R73 A;  2KR0 A;  5FTI A;  3IO4 A;  4DCX A;  3B50 A;  1VFE A;  3HCQ A;  3C34 A;  3VDF A;  3E9X A;  3ZSF A;  2PBW A;  2UXA A;  4LZ5 A;  2O7I A;  2F97 A;  4F29 A;  4ESX A;  4ZED A;  1FJ6 A;  4N13 A;  4YB7 A;  2DWA A;  4NN3 A;  3KOT A;  4U23 A;  4ZS9 A;  1I6B A;  2V3T A;  2V4C A;  3TEL A;  5AA4 A;  1FRP A;  4K3F A;  2QFL A;  4IGR A;  1MDP 1;  2PMS A;  3EHS A;  2F3B A;  1MRP A;  4QBA A;  1T0K A;  4NF4 B;  1I69 A;  4ISU A;  3LSF B;  5L8D A;  1B1H A;  1Y3P A;  3T66 A;  5J16 A;  3MQ9 A;  2ZYO A;  5CI5 A;  4PF8 A;  2IEE A;  1B1X A;  1BKA A;  1LBX A;  3G3G A;  3UN6 A;  4PBQ A;  1OIB A;  4ZE9 A;  1H3D A;  3KFM A;  3MP1 A;  4YU0 A;  4KYE A;  4R72 A;  3FXU A;  1DOT A;  3KSJ A;  3QUJ A;  2Q9T A;  1B5J A;  3M3F A;  4Q0C A;  5JTY A;  2PVU A;  4MCO A;  3VVE A;  1DK4 A;  2V84 A;  4PCD A;  4YKP A;  3PPR A;  4FE8 A;  1Q1K A;  5ET8 A;  3VE1 B;  3KOS A;  3E78 A;  5I2N B;  3LV0 A;  2F35 A;  4MMP A;  2PFY A;  3TQW A;  3TAJ A;  3CI8 A;  4NF5 B;  3LSL A;  1MY3 A;  2F3D A;  4R9F A;  1IME A;  3A09 A;  3ZKK A;  5F24 A;  4UA8 A;  3TYH A;  1MY4 A;  2DE4 A;  4AS4 A;  3TFL A;  4L17 A;  4LQ5 A;  3O9P A;  3CIJ A;  3LUY A;  3OOA A;  3G3F A;  3MVY A;  1RDZ A;  4H45 A;  5I57 A;  5K2X A;  2Q88 A;  3PMV A;  5H8S A;  2X7Q A;  4QFL A;  2WBD A;  4PAF A;  5EQ9 A;  3RUM A;  1SYH A;  4X1D A;  1L5T A;  1FPD A;  1A7L A;  4QFK A;  3K6W A;  1NH8 A;  3QAX A;  3LC8 A;  4O3B A;  3U65 A;  3CR9 A;  4G77 A;  3ILT B;  4NHB A;  4FOR A;  1YYZ A;  1MH3 A;  5JEI A;  4NE4 A;  3G3H A;  1Y1M A;  1Q9D A;  1ZTY A;  4N8Y A;  3TTM A;  2H99 A;  2I0C A;  4JWX A;  5H8Q B;  5L9O A;  1USY H;  1QJM A;  4UAC A;  4AQ4 A;  3PUZ E;  4WED A;  3H6T A;  3LUZ A;  5BWJ A;  3W9W A;  1EYJ A;  5ESY A;  5CMB A;  1N0T A;  5CBS A;  3MVZ A;  4GWO A;  1O64 A;  3H06 B;  5H8H A;  1M5C A;  4FEB A;  1MQJ A;  4H8I A;  3BBR A;  1LBZ A;  2DVZ A;  2OK2 A;  4P0I A;  1NV5 A;  3TZA A;  4ELP A;  2QMX A;  4H67 A;  4ELQ A;  4QRZ A;  4ZZA A;  1YAE A;  3FZV A;  2PX1 A;  1B46 A;  1FPE A;  4IO6 A;  3K1P A;  3L6G A;  3EHU A;  4ND9 A;  4BDN A;  2FBP A;  1EYI A;  1LGB C;  1UIV A;  3GZG A;  4GQO A;  2HCA A;  1MXW A;  4IO2 A;  3QSL A;  2XXP A;  2RIN A;  1B3H A;  4MNI A;  3HFU A;  4IY5 A;  3B6T A;  3RYD A;  3EN3 A;  3IOR A;  3H7M A;  2RC8 A;  2FNC A;  4PET A;  3T96 B;  5EYF A;  1ZIU A;  4GWU A;  4NX1 A;  3E79 A;  1LBY A;  2O51 A;  4WXJ A;  4PE3 A;  2VOZ A;  4KCC A;  2I0B A;  3FVG A;  2OWT A;  3FJ7 A;  4GWZ A;  1PC3 A;  3IOV A;  3G3I A;  5EYG A;  1NV1 A;  4PBH A;  2ZXT A;  3TDJ A;  1OVT A;  5EHS A;  4NED A;  3TMG A;  4JVD A;  5TP9 B;  3C35 A;  2FIX A;  2KQZ A;  4ESW A;  2RCA A;  3R7X A;  1FPK A;  2JJK A;  2UVH A;  4R2F A;  4O94 A;  4ZEI A;  3MPL A;  1DPP A;  2DYX A;  1QUK A;  2A5T A;  3MVW A;  3Q26 A;  3FVN A;  4O7M A;  4RPN A;  1LAH E;  4P8B A;  1J1N A;  1FPL A;  1NUW A;  4BDM A;  3HPI A;  5ICT A;  2QPQ A;  3H4Z A;  1B4H A;  5AA2 D;  2E0S A;  4MLQ A;  1N76 A;  1DPE A;  5F7V A;  4YKK A;  1P1N A;  1IIW A;  4N8G A;  3PPN A;  1OMP A;  3KZG A;  2F5X A;  2XXX A;  3O6G A;  3N26 A;  1XT8 A;  2NXO A;  1DCU A;  3CFX A;  2D3I A;  1ZU0 A;  3JZJ A;  2P3N A;  2GH9 A;  2XX9 A;  3BFU A;  2ALU A;  5H8F A;  4IO7 A;  5J1D A;  4OFO A;  4BDQ A;  2CZI A;  1QGX A;  3FIR A;  4N15 A;  2HPG A;  2VP1 A;  3CHG A;  4NF8 B;  4OHN A;  1FBF A;  4OES A;  1IQ7 A;  4PFU A;  4OWD A;  4U4X A;  4GWW A;  4LZ8 A;  5LOM A;  4KD5 A;  3E4R A;  4RK9 A;  4YKJ A;  3A29 A;  1K9Z A;  3U72 A;  5DT6 A;  1EYK A;  4N6K A;  4X1B A;  4YZZ A;  3HST A;  4ZZE A;  1ATG A;  3Q27 A;  3LSX A;  4N4U A;  5ELV A;  4O7I A;  1US4 A;  3C31 A;  3S9N C;  4U1O A;  3HHF A;  4MAG A;  1BK4 A;  5KDT A;  1SW5 A;  3H6U A;  4H8J A;  4C1U A;  1FBD A;  2Z8D A;  4JSD A;  3QUF A;  1FQF A;  1Y20 A;  2D21 A;  3DP4 A;  3PPO A;  2F6P A;  2XX8 A;  3OEM A;  3PUY E;  2ESN A;  1TFD A;  3SES A;  3RNN A;  2WEF A;  3S9E A;  1IMA A;  3PUV E;  3V5A A;  3PGF A;  5AA2 A;  2V25 A;  1INP A;  1FTJ A;  2O1M A;  1B51 A;  4R9G A;  1S7Y A;  2AL5 A;  1A99 A;  3V83 A;  4NF6 B;  2P0S A;  1A8F A;  3SKP A;  2ZYK A;  2XD3 A;  2HFB A;  2PT2 A;  2E1S A;  4WKM A;  1NH7 A;  3FXB A;  1N84 A;  2ZYN A;  5B7D A;  3FVK A;  2CZL A;  2PYY A;  4KCD A;  1US5 A;  3QIM A;  4FED A;  2CEX A;  2H98 A;  3HV1 A;  1TT1 A;  3O97 A;  3DM0 A;  2NUV A;  2DWJ A;  3CG1 A;  1FBG A;  1FQA A;  2OX3 A;  1VDW A;  1MPD A;  5IZ3 A;  1LBB A;  1MQH A;  1NFT A;  2QVV A;  4KI0 E;  4TLM B;  5AE4 A;  4R74 A;  4LVQ A;  4P11 A;  5EYH A;  2F6G A;  2B4M A;  5DYH A;  4DXU A;  1Y9U A;  1LB8 A;  4FAJ A;  3SET A;  4OYV A;  1RDY A;  4QF9 A;  4GBW A;  2HAU A;  1P1Q A;  3FV1 A;  4JDF A;  1YTV A;  1POT A;  4POW A;  2HZL A;  4HCY A;  3Q29 A;  3UK4 A;  1EU8 A;  1UTB B;  1QKB A;  1NUY A;  4XTC Q;  3O6I A;  3KN7 A;  4LAT A;  1PBP A;  5EQA A;  3QYT A;  1SW2 A;  5IM2 A;  2I4B A;  4MIJ A;  4MJO A;  4LZ7 A;  2GFE A;  1AOV A;  3RGY A;  4IO3 A;  3E13 X;  2XD2 A;  3K02 A;  4RA1 A;  1GV8 A;  2F7C A;  1NNK A;  1I6A A;  3SEV A;  3ZKL A;  3N5L A;  4Q5T A;  1IMF A;  2QRY A;  3H3G A;  1B7H A;  3O66 A;  1D9Q A;  2XXK A;  4KYD A;  2CZK A;  4JVC A;  2ONK E;  2VPN A;  4EQB A;  2ZYM A;  3T9U A;  2PT1 A;  4G61 A;  5I56 B;  2GHA A;  1VSO A;  1QW0 A;  4PFT A;  1PB9 A;  1XVX A;  3E3K A;  3TQL A;  3VV5 A;  3CFL A;  4XKR A;  1QUL A;  4BDR A;  1SW1 A;  3VFJ A;  2HHM A;  1IXH A;  2OCU A;  3SDF A;  3OO9 A;  3LSW A;  4DI4 B;  3TTK A;  3EPE A;  2FIE A;  1FBH A;  2I49 A;  2ONS A;  5L9S A;  3FAT A;  3CRB A;  5AA4 B;  3TCF A;  4GWY A;  1YZ0 A;  1ZKB A;  4N81 A;  1JEU A;  3TCH A;  4NF5 A;  4TOZ A;  2ZZV A;  1Z7N E;  2Q74 A;  4QSD A;  4G68 A;  4MNC A;  3TPA A;  4BDO A;  4MEV A;  1POY 1;  1JP4 A;  1AMF A;  4O3A A;  3T22 A;  5A5L A;  4PFW A;  4PTK A;  5IZZ A;  1ZBM A;  1II5 A;  2WX9 A;  4MF3 A;  3USD A;  3PTY A;  3D1R A;  1N7W A;  3ONM A;  3C4M A;  1NV4 A;  4P1L A;  4JVI A;  1CNQ A;  3KJT A;  2XXQ A;  5DEX A;  2WYP A;  1MQG A;  1RDX A;  5ITO A;  1D9V A;  1SD3 A;  3RPL A;  4I3E A;  1XHY A;  2XWO A;  3PD8 A;  1H44 A;  3K01 A;  4R75 A;  5M2V A;  3C33 A;  1MQD A;  2ZZX A;  4G4P A;  1FPF A;  4ZEF A;  3U1O A;  1JVY A;  1PB7 A;  4H5G A;  4PFI A;  4GX6 A;  1M5B A;  4OFL A;  3PUX E;  1BIY A;  4DXB A;  4UAB A;  4MFI A;  4H1X A;  4F19 A;  2FA7 A;  5JTY B;  4PGN A;  2Y7W A;  4FBP A;  5AA1 A;  3FAS A;  3U8Q A;  1NUZ A;  3G3K A;  4XXU A;  3PU5 A;  4OVJ A;  3O28 A;  4GX4 A;  4QSE A;  2DWI A;  4OTE A;  4HXV A;  4XFE A;  1MQI A;  4Q8R A;  3QK6 A;  5H8Q A;  1DBZ A;  1ANF A;  4F3G A;  2UVI A;  4X04 A;  5TPA A;  3FV2 A;  4GWX A;  1JET A;  4RK2 A;  2UYE A;  1A8E A;  3TUS A;  1B3G A;  2VHA A;  1O7T A;  3MW0 A;  3N6T A;  4R6K A;  4FIM A;  3S2V A;  1R9L A;  2HXW A;  2F7B A;  1K9Y A;  3BIG A;  3QMF A;  4KR5 A;  5ET5 A;  2WBB A;  4G2Z A;  1LCT A;  5I2K A;  1IUD A;  4H0W A;  5A5X A;  4JWY A;  1LCF A;  5I57 B;  4I40 A;  4PGP A;  4I1D A;  1Y4T A;  4PF6 A;  4IY6 A;  4P9K A;  4E0X A;  3HO7 A;  3IOT A;  2XWV A;  2OZZ A;  4F22 A;  3MJN A;  5TU0 A;  4PFY A;  3K1N A;  1B52 A;  3T0J A;  4EF1 A;  2QL3 A;  4NMY A;  2DWH A;  3K1M A;  1XS5 A;  2ZMB A;  4HW8 A;  4JB7 A;  5FHM A;  5LDZ A;  3SEW A;  2GRV A;  1VFD A;  3VVD A;  3G7W A;  2QS4 A;  2Y5K A;  2F34 A;  1B9J A;  4M4G A;  1FBP A;  4BDL A;  3OXN A;  1P1U A;  5I58 A;  3OO7 A;  3K6V A;  3RT8 A;  1FPG A;  1O63 A;  4TQU Q;  1BP5 A;  3S9M C;  4Z7E A;  3MAM A;  1XC1 A;  4OMB A;  4QFN A;  4HS7 A;  2O68 A;  4G8N A;  2WYK A;  3AXF A;  2YJP A;  3DEL B;  3IX1 A;  1Z7M E;  2YPN A;  2QVU A;  5TP9 A;  4ZE8 A;  3K6U A;  3IOU A;  1UTH B;  4ZDM A;  3KBZ A;  3BKI B;  3MP8 A;  2V93 A;  1GVC A;  4NTL A;  3P7I A;  2CEY A;  3T93 B;  5HPQ A;  3MP6 A;  4YB6 A;  2MKZ A;  4N6P A;  1RYO A;  5BUU A;  3OEL A;  1RKM A;  2O7U A;  5CMM A;  3ODB A;  2XA5 A;  3JYR A;  5AA3 A;  1MY1 A;  5B70 A;  4LA9 A;  5DVF A;  4LQ2 A;  4XEQ A; 
#chains in the Genus database with same CATH homology
 1B58 A;  2DQV A;  1FQC A;  2V3U A;  1ZLQ A;  3TEP A;  1FQB A;  1MXY A;  2IA4 A;  4ZEK A;  1B40 A;  3DP6 A;  3CSG A;  3TTL A;  5H8N A;  1GGG A;  1JNF A;  4F2O A;  3C32 A;  2ONR A;  1LST A;  1D4N A;  1H76 A;  3Q28 A;  2OBG A;  1LFH A;  3D4G A;  3RLF E;  4XIG Q;  1HSL A;  4YIC A;  3FUZ A;  4WEP A;  4EXK A;  3N6U A;  5KCJ A;  2P2A A;  1R1N A;  3IL1 B;  3KEI A;  1ZMG A;  4EF2 A;  3CSB A;  1QVS A;  5CBR A;  2Q89 A;  4QFP A;  3VVF A;  4IO5 A;  1A54 A;  1SW4 A;  2B3B A;  3IB0 A;  2GHB A;  3VXB A;  5CM6 A;  1JVX A;  1XVY A;  3VXC A;  4U22 A;  4GLI A;  1FQE A;  4GXA A;  1BLF A;  4RXL A;  3UOR A;  3CG3 A;  3RT6 B;  2A5T B;  3KBR A;  3U92 A;  2QJE A;  4U4S A;  3KJ7 A;  3A3U A;  2DS9 A;  1DMB A;  3RQT A;  2Q2C A;  1IXI A;  1QKA A;  2Z23 A;  2B3F A;  4G8H A;  1B3L A;  3KSX A;  2QSX A;  3IJX B;  2UYF A;  1NKX A;  2RC7 A;  4JBZ A;  1URG A;  1MPC A;  4OFJ A;  2Z22 A;  3MWB A;  1SI0 A;  2XXU A;  4YKI A;  1N7X A;  4OEU A;  2Z8E A;  4XKQ A;  1FW0 A;  1QUI A;  4DCY A;  1B3E A;  3FGS A;  4RJZ A;  2H4I A;  4EQ7 A;  5H8F B;  2HEU A;  5CMK A;  3T9X B;  5I84 A;  2QMW A;  3EF7 A;  1P1W A;  2QS1 A;  4Q30 B;  2R71 A;  3B6W A;  1YPN A;  4FEC A;  3Q25 A;  2VD2 A;  3SER A;  3A3C A;  1SBP A;  1S50 A;  2CMO A;  4BLA A;  3VLU A;  4F1Y A;  1FTL A;  3K2D A;  3K6X A;  1B4Z A;  5I59 A;  4E0W A;  3H6V A;  1NNP A;  2DP8 A;  3PMX A;  3U94 A;  3IB1 A;  2DXR A;  1TXF A;  3MPK A;  1NL5 A;  5KDT B;  4RNS A;  2Z8F A;  3FJM A;  1EZP A;  3C9H A;  3TTN A;  1MXX A;  1B3F A;  2R6G E;  4DIG A;  4HTG A;  4IB2 A;  5DVI A;  2P1S A;  5JK4 A;  1WVJ A;  4KQP A;  3RPW A;  2ABH A;  3FJG A;  1A55 A;  4QHQ A;  4OXV A;  5IAI A;  2QS3 A;  3KN3 A;  1UTB A;  1AIV A;  1LB9 A;  2Q8J A;  5K2Y A;  5AA2 B;  1MS7 A;  2QS2 A;  4OQO A;  2Y7P A;  1NMU A;  1ELJ A;  2O84 X;  1B7U A;  2H25 A;  2G93 A;  2WKY A;  1F9B A;  2XXW A;  4DXC A;  2R9J A;  3C36 A;  3MVX A;  1Y4C A;  4U21 A;  5FHN A;  1CE2 A;  4EUO A;  3MBP A;  2ZNT A;  4NF4 A;  1JW1 A;  1A40 A;  4O3C A;  1JEV A;  1LAG E;  4DZ1 A;  1MXV A;  1OQH A;  5I56 A;  1P99 A;  4RYA A;  1LLS A;  4DLD A;  1JW4 A;  3RN8 A;  2XXR A;  1MM7 A;  3K00 A;  4C1T A;  1FCK A;  4JWO A;  4P0G A;  3FXQ A;  1UIU A;  1B5H A;  3ECR A;  5DVJ A;  2AYS A;  1RYX A;  2ZNU A;  3MC2 A;  3MZ1 A;  1AL3 A;  2Y7K A;  1OLC A;  1MXU A;  4OEV A;  3B6Q A;  4F2Q A;  3B7D A;  3IR1 A;  2XXH A;  5HBC A;  1B05 A;  3U93 A;  4GVO A;  1TWY A;  3FXR A;  5I2N A;  4AB6 A;  1EZ9 A;  4DE8 A;  3I5O A;  5FHO A;  2X7P A;  4MBP A;  1M5D A;  1DSN A;  1MM6 A;  4QFO A;  4GL0 A;  4EQ9 A;  1GR2 A;  2NOO A;  1M5F A;  1VR5 A;  1Y3N A;  3SEX A;  3RTF B;  1EH3 A;  1XOC A;  2OJT A;  1FTO A;  1SVX B;  2O69 A;  5HM4 B;  3KN8 A;  4X48 A;  3TCG A;  1B5I A;  2F78 A;  3ZS6 A;  1MY0 A;  2KLF A;  3IOW A;  4GD5 A;  2NWJ A;  3I3V A;  4G8M A;  4ELR A;  4ELO A;  1Q35 A;  3QXM A;  1B32 A;  4GFR A;  1IXC A;  2YLN A;  3UA8 A;  3RY3 A;  2Q2A A;  1MPB A;  4GOT A;  2RF1 A;  5L9M A;  4F18 A;  3WAF A;  3PUW E;  3PPP A;  4F1U A;  4LP2 B;  3ILU B;  1H43 A;  4G68 B;  4R6H A;  3DP8 A;  3UGW A;  1TFA A;  1IEJ A;  4JXI A;  1IXG A;  3OO8 A;  1MH4 A;  4THI A;  1VE4 A;  3FD3 A;  3O2A A;  2VD3 A;  5DEX B;  2OWS A;  2F8D A;  1GTK A;  2I3W A;  3IO6 A;  3LBS A;  3SEY A;  3OSQ A;  4JSO A;  2XXV A;  4YMB A;  4GF8 A;  1USY E;  4GL8 A;  3OSR A;  2AL4 A;  4FJP A;  4I62 A;  1SQY A;  2I58 A;  4F3B A;  1OLA A;  4FAT A;  1DTZ A;  2Y7R A;  5KZT A;  1M5E A;  1MXZ A;  3M3L A;  1B0L A;  2F36 A;  1LFG A;  3M8U A;  4NWC A;  3VLW A;  5CMC A;  3CVG A;  5CC2 A;  2THI A;  3MZB A;  3L6H A;  4M1V A;  3T9V A;  5TPA B;  3OD7 A;  2BJJ X;  4F1V A;  4N07 A;  4MH5 A;  1WDN A;  3I6V A;  3EQ1 A;  1D9Y A;  1PEB A;  4H65 A;  4KHZ E;  1EZO A;  5ISU A;  1N04 A;  4OER A;  1UTH A;  4EXL A;  5I2K B;  3H03 A;  1D3K A;  2UVG A;  1MY2 A;  2DE2 A;  1UQW A;  5A5X B;  3FVO A;  4HCW A;  1SI1 A;  2HAV A;  3TOD A;  1MG1 A;  3KGC A;  2XXI A;  3IK6 B;  3LR1 A;  3IAZ A;  1LAX A;  1LFI A;  1DTG A;  5H8H B;  4H6D A;  2X26 A;  4X9T A;  2NVU B;  3UP9 A;  3MZ9 A;  4KPT A;  2DVC A;  4U2R A;  2O6A A;  3IB2 A;  3MUQ A;  3R6U A;  1LAF E;  2A5S A;  3VLV A;  3UIF A;  5IKB A;  1B2H A;  2XX7 A;  3SEU A;  5I58 B;  1R9Q A;  3DLN A;  1JW5 A;  3R26 A;  1NNF A;  4ZEC A;  1FTK A;  1B0H A;  3G3J A;  1HSE A;  4GIZ A;  3GBA A;  3T9H B;  2XXY A;  5DTB A;  3S9L C;  2AIX A;  2REG A;  3EHT A;  2ZNS A;  4F3S A;  5CRY A;  3H6W A;  3HN0 A;  4IO4 A;  3BFT A;  4C0R A;  3THI A;  1R6Z A;  2W7Y A;  1FTM A;  1BTJ A;  2ANJ A;  2FYI A;  1Y3Q A;  4LON B;  4OZ9 A;  2UVJ A;  1P1O A;  4I9D A;  3D4C A;  2G29 A;  4IGT A;  1PBQ A;  2H5Y A;  4H5F A;  4NF8 A;  3OEN A;  4EDP A;  2XXT A;  2F7A A;  5H8N B;  2I4C A;  4RY1 A;  5ITP A;  1PB8 A;  2LAO A;  4PQJ A;  4R2B A;  4YB5 A;  1URS A;  5FTH A;  2DXY A;  2V3Q A;  2DOJ A;  2H9B A;  1PDA A;  3K0V A;  3S4U A;  3W9V A;  2REJ A;  4AB5 A;  4I8C A;  4YMA A;  3OO6 A;  1I6Q A;  1NNT A;  2I6E A;  1QUJ A;  1JQF A;  1SYI A;  5KCJ B;  4U1Z A;  1WOD A;  2B65 A;  1IZ1 A;  4QSC A;  3PPQ A;  1B7Z A;  1N3W A;  1KWH A;  3KG2 A;  2I48 A;  2O1L A;  3PD9 A;  4YAH X;  3GBB A;  1N3X A;  3PMW A;  2XHD A;  3GXA A;  2D5W A;  5EHM A;  1S9T A;  2I3V A;  3F11 A;  4NF6 A;  4PE5 B;  1AH5 A;  1ZJL A;  3O29 A;  4OEN A;  2OLB A;  2HZK A;  2VGQ A;  3N94 A;  3O6H A;  3W15 C;  2RCB A;  4ONY A;  3K4U A;  3OEK A;  4DDD A;  4GXS B;  2DE3 A;  5ICQ A;  4LUB A;  3JV9 A;  2HQ0 A;  2RKM A;  1HSJ A;  3GLB A;  3PV0 E;  4F3P A;  4OET A;  2M8C A;  4XKP A;  1Y1Z A;  4R6Y A;  4ECF A;  4RPO A;  2DSF A;  1OVB A;  3V89 B;  3HHG A;  4G68 C;  4F39 A;  4PP0 A;  1IIT A;  1B6H A;  3IJO B;  2Y7I A;  3TKD A;  1YCJ A;  1SDX A;  1OQG A;  4NWD A;  1MDQ A;  3WAE A;  4Z0I A;  2RC9 A;  2Y84 A;  3CFZ A;  1H45 A;  5F1Q A;  4MLV A;  4KYS A;  4KFQ A;  4ZEB A;  4XKN A;  3M3K A;  3OMB A;  1CB6 A;  3RTW B;  1FQD A;  1URD A;  3TTR A;  4F31 B;  5I59 B;  4GRK A;  4POX A;  3V8X B;  4TLL B;  1LBC A;  4R73 A;  5FTI A;  3IO4 A;  4DCX A;  1VFE A;  3HCQ A;  3C34 A;  3VDF A;  3E9X A;  3ZSF A;  2PBW A;  2UXA A;  4LZ5 A;  2O7I A;  2F97 A;  4F29 A;  4ESX A;  4ZED A;  4N13 A;  4YB7 A;  2DWA A;  3KOT A;  4U23 A;  4ZS9 A;  1I6B A;  2V3T A;  3TEL A;  5AA4 A;  4K3F A;  4IGR A;  1MDP 1;  2PMS A;  3EHS A;  1MRP A;  1T0K A;  4NF4 B;  1I69 A;  4ISU A;  3LSF B;  5L8D A;  1B1H A;  1Y3P A;  3T66 A;  3MQ9 A;  2ZYO A;  5CI5 A;  2IEE A;  1B1X A;  1BKA A;  3G3G A;  3UN6 A;  1OIB A;  4ZE9 A;  1H3D A;  3KFM A;  3MP1 A;  4YU0 A;  4KYE A;  4R72 A;  3FXU A;  1DOT A;  3KSJ A;  3QUJ A;  2Q9T A;  1B5J A;  3M3F A;  4Q0C A;  5JTY A;  2PVU A;  3VVE A;  2V84 A;  4YKP A;  3PPR A;  4FE8 A;  1Q1K A;  3VE1 B;  3KOS A;  5I2N B;  2F35 A;  3TQW A;  3TAJ A;  3CI8 A;  4NF5 B;  3LSL A;  1MY3 A;  4R9F A;  3A09 A;  3ZKK A;  4UA8 A;  3TYH A;  1MY4 A;  2DE4 A;  3TFL A;  4L17 A;  4LQ5 A;  3O9P A;  3CIJ A;  3LUY A;  3OOA A;  3G3F A;  3MVY A;  5I57 A;  5K2X A;  2Q88 A;  3PMV A;  5H8S A;  2X7Q A;  4QFL A;  3RUM A;  1SYH A;  4X1D A;  1L5T A;  1A7L A;  4QFK A;  3K6W A;  1NH8 A;  3QAX A;  3LC8 A;  4O3B A;  3CR9 A;  4G77 A;  3ILT B;  4FOR A;  1MH3 A;  5JEI A;  4NE4 A;  3G3H A;  1Y1M A;  1ZTY A;  3TTM A;  2H99 A;  2I0C A;  4JWX A;  5H8Q B;  5L9O A;  1USY H;  1QJM A;  4UAC A;  4AQ4 A;  3PUZ E;  4WED A;  3H6T A;  5BWJ A;  3W9W A;  5CMB A;  1N0T A;  5CBS A;  3MVZ A;  4GWO A;  1O64 A;  3H06 B;  5H8H A;  1M5C A;  4FEB A;  1MQJ A;  4H8I A;  3BBR A;  2DVZ A;  2OK2 A;  4P0I A;  3TZA A;  4ELP A;  2QMX A;  4H67 A;  4ELQ A;  4QRZ A;  4ZZA A;  1YAE A;  3FZV A;  2PX1 A;  1B46 A;  3K1P A;  4IO6 A;  3L6G A;  3EHU A;  4ND9 A;  4BDN A;  1LGB C;  1UIV A;  3GZG A;  4GQO A;  2HCA A;  1MXW A;  4IO2 A;  3QSL A;  2XXP A;  2RIN A;  1B3H A;  4IY5 A;  3B6T A;  3EN3 A;  3IOR A;  3H7M A;  2RC8 A;  2FNC A;  4PET A;  3T96 B;  5EYF A;  1ZIU A;  2O51 A;  4WXJ A;  2VOZ A;  4KCC A;  2I0B A;  3FVG A;  2OWT A;  3FJ7 A;  1PC3 A;  3IOV A;  3G3I A;  2ZXT A;  3TDJ A;  1OVT A;  5EHS A;  4NED A;  3TMG A;  5TP9 B;  3C35 A;  4ESW A;  2RCA A;  3R7X A;  2UVH A;  4R2F A;  4ZEI A;  3MPL A;  1DPP A;  2DYX A;  1QUK A;  2A5T A;  3MVW A;  3Q26 A;  3FVN A;  4RPN A;  1LAH E;  1J1N A;  4BDM A;  3HPI A;  5ICT A;  2QPQ A;  3H4Z A;  1B4H A;  5AA2 D;  2E0S A;  4MLQ A;  1N76 A;  1DPE A;  5F7V A;  4YKK A;  1P1N A;  1IIW A;  3PPN A;  1OMP A;  3KZG A;  2F5X A;  2XXX A;  3O6G A;  3N26 A;  1XT8 A;  2NXO A;  3CFX A;  2D3I A;  1ZU0 A;  3JZJ A;  2GH9 A;  2XX9 A;  3BFU A;  2ALU A;  5H8F A;  4IO7 A;  5J1D A;  4OFO A;  4BDQ A;  3FIR A;  2VP1 A;  4NF8 B;  4OHN A;  4OES A;  1IQ7 A;  4PFU A;  4OWD A;  4U4X A;  4LZ8 A;  5LOM A;  4KD5 A;  3E4R A;  4RK9 A;  4YKJ A;  3U72 A;  5DT6 A;  4X1B A;  4YZZ A;  3HST A;  4ZZE A;  1ATG A;  3Q27 A;  3LSX A;  5ELV A;  1US4 A;  3C31 A;  3S9N C;  4U1O A;  3HHF A;  5KDT A;  1SW5 A;  3H6U A;  4H8J A;  4C1U A;  2Z8D A;  3QUF A;  4JSD A;  1FQF A;  1Y20 A;  2D21 A;  3DP4 A;  3PPO A;  2F6P A;  2XX8 A;  3OEM A;  3PUY E;  2ESN A;  1TFD A;  3SES A;  3RNN A;  3S9E A;  3PUV E;  3V5A A;  3PGF A;  5AA2 A;  2V25 A;  1FTJ A;  2O1M A;  1B51 A;  4R9G A;  1S7Y A;  2AL5 A;  1A99 A;  3V83 A;  4NF6 B;  2P0S A;  1A8F A;  3SKP A;  2ZYK A;  2XD3 A;  2HFB A;  2PT2 A;  2E1S A;  4WKM A;  1NH7 A;  1N84 A;  2ZYN A;  5B7D A;  3FVK A;  2CZL A;  2PYY A;  4KCD A;  1US5 A;  3QIM A;  4FED A;  2H98 A;  3HV1 A;  1TT1 A;  3O97 A;  3DM0 A;  2NUV A;  2DWJ A;  3CG1 A;  1FQA A;  1MPD A;  1LBB A;  1MQH A;  1NFT A;  4KI0 E;  4TLM B;  5AE4 A;  4R74 A;  4LVQ A;  4P11 A;  2F6G A;  5DYH A;  4DXU A;  1Y9U A;  1LB8 A;  4FAJ A;  3SET A;  4OYV A;  4QF9 A;  2HAU A;  1P1Q A;  3FV1 A;  4JDF A;  1YTV A;  1POT A;  4POW A;  2HZL A;  4HCY A;  3Q29 A;  3UK4 A;  1EU8 A;  1UTB B;  1QKB A;  4XTC Q;  3O6I A;  3KN7 A;  4LAT A;  1PBP A;  3QYT A;  1SW2 A;  2I4B A;  4LZ7 A;  2GFE A;  1AOV A;  3RGY A;  4IO3 A;  3E13 X;  2XD2 A;  3K02 A;  4RA1 A;  1GV8 A;  2F7C A;  1NNK A;  1I6A A;  3SEV A;  3ZKL A;  3N5L A;  4Q5T A;  2QRY A;  3H3G A;  1B7H A;  3O66 A;  4KYD A;  2ONK E;  4EQB A;  2ZYM A;  3T9U A;  2PT1 A;  5I56 B;  2GHA A;  1VSO A;  1QW0 A;  4PFT A;  1PB9 A;  1XVX A;  3E3K A;  3TQL A;  3VV5 A;  3CFL A;  4XKR A;  1QUL A;  4BDR A;  1SW1 A;  3VFJ A;  1IXH A;  2OCU A;  3SDF A;  3OO9 A;  3LSW A;  3TTK A;  3EPE A;  2I49 A;  2ONS A;  5L9S A;  3FAT A;  3CRB A;  5AA4 B;  3TCF A;  1ZKB A;  1JEU A;  3TCH A;  4NF5 A;  4TOZ A;  1Z7N E;  4BDO A;  4QSD A;  4G68 A;  3TPA A;  1POY 1;  1AMF A;  4O3A A;  3T22 A;  4PFW A;  1ZBM A;  1II5 A;  3USD A;  4MF3 A;  1N7W A;  3ONM A;  3C4M A;  3KJT A;  2XXQ A;  5DEX A;  1MQG A;  5ITO A;  1D9V A;  1SD3 A;  1XHY A;  3PD8 A;  1H44 A;  3K01 A;  4R75 A;  5M2V A;  3C33 A;  1MQD A;  4G4P A;  4ZEF A;  3U1O A;  1JVY A;  1PB7 A;  4H5G A;  1M5B A;  4OFL A;  3PUX E;  1BIY A;  4DXB A;  4MFI A;  4H1X A;  4F19 A;  2FA7 A;  5JTY B;  2Y7W A;  5AA1 A;  3FAS A;  3U8Q A;  3G3K A;  4XXU A;  3PU5 A;  4OVJ A;  3O28 A;  4QSE A;  2DWI A;  4OTE A;  1MQI A;  4Q8R A;  3QK6 A;  5H8Q A;  1ANF A;  4F3G A;  2UVI A;  5TPA A;  3FV2 A;  1JET A;  4RK2 A;  2UYE A;  1A8E A;  3TUS A;  1B3G A;  2VHA A;  1O7T A;  3MW0 A;  3N6T A;  4R6K A;  4FIM A;  3S2V A;  1R9L A;  2HXW A;  2F7B A;  4KR5 A;  4G2Z A;  1LCT A;  5I2K A;  1IUD A;  4H0W A;  5A5X A;  4JWY A;  1LCF A;  5I57 B;  4I1D A;  1Y4T A;  4IY6 A;  4E0X A;  3HO7 A;  3IOT A;  2OZZ A;  4F22 A;  3MJN A;  5TU0 A;  4PFY A;  3K1N A;  1B52 A;  4EF1 A;  2QL3 A;  4NMY A;  2DWH A;  3K1M A;  1XS5 A;  2ZMB A;  4HW8 A;  4JB7 A;  5FHM A;  3SEW A;  2GRV A;  1VFD A;  3VVD A;  3G7W A;  2QS4 A;  2F34 A;  1B9J A;  4M4G A;  4BDL A;  3OXN A;  1P1U A;  5I58 A;  3OO7 A;  3K6V A;  3RT8 A;  1O63 A;  4TQU Q;  1BP5 A;  3S9M C;  4Z7E A;  3MAM A;  1XC1 A;  4OMB A;  4QFN A;  4HS7 A;  2O68 A;  4G8N A;  3AXF A;  2YJP A;  3DEL B;  3IX1 A;  1Z7M E;  2YPN A;  5TP9 A;  4ZE8 A;  3K6U A;  3IOU A;  1UTH B;  4ZDM A;  3BKI B;  3MP8 A;  2V93 A;  1GVC A;  4NTL A;  3P7I A;  3T93 B;  5HPQ A;  3MP6 A;  5BUU A;  4YB6 A;  4N6P A;  1RYO A;  3OEL A;  1RKM A;  2O7U A;  5CMM A;  3ODB A;  3JYR A;  5AA3 A;  1MY1 A;  5B70 A;  4LA9 A;  5DVF A;  4LQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...