3G3HA

Crystal structure of the glur6 ligand binding domain dimer k665r i749l q753k mutant with glutamate and nacl at 1.5 angstrom resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
252
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKRSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITLAILKLQEEGKLHMMKEKWWCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 85
structure length 252
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3hA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3hA02
2O6AA 1ZLQA 5A5XB 3L6HA 2XXRA 1AIVA 3D4CA 3TTRA 2XX7A 3TAJA 3PPPA 3IB1A 1VFDA 3VDFA 1D9VA 4G8NA 5DVIA 4EUOA 1ZTYA 2F7CA 3U1OA 1B40A 4GXAA 3U93A 4KR5A 3MZ9A 3RNNA 3IOWA 5EHSA 5M2VA 5H8NA 3V8XB 2R71A 3O2AA 1JETA 1H3DA 2D3IA 2A5TA 2PBWA 1NNFA 3PPQA 2DQVA 5ITPA 1MQDA 1SBPA 5DYHA 5I2KA 3L6GA 4GVOA 5DT6A 2DWHA 1B32A 2OLBA 4EDPA 4R6YA 4ECFA 3PGFA 2VGQA 4ELQA 5FHNA 4O3CA 4POXA 4H5GA 4YKJA 1I6AA 1M5FA 1LAGE 3G3JA 1LAXA 3W9VA 4ZEFA 4ELPA 1B7HA 3HN0A 1B9JA 1B0LA 1FQBA 2F5XA 4H5FA 4O3AA 4KYDA 3T9XB 2Q89A 1Y3PA 1QULA 1UTHB 2B65A 3DELB 5I57B 1GV8A 3SETA 4WEDA 4G68C 1MY1A 2E0SA 1SYIA 4TLLB 4BDNA 4F2OA 2XXYA 4XKNA 3LSLA 3MVXA 1GVCA 3ILTB 1ZU0A 3FVKA 4G68B 3FGSA 4Z0IA 1N7XA 2PX1A 2HAUA 1LFHA 2I0CA 4R9FA 4GXSB 2ESNA 4X9TA 5L9SA 3Q29A 3KZGA 4AB6A 1NNKA 5ELVA 2V25A 5CBRA 1YTVA 3MPLA 3N26A 3TQLA 1MY0A 3FVOA 1MDQA 3EPEA 1NL5A 1B1XA 2HZKA 4DXCA 3K4UA 3TQWA 2ONKE 3MVZA 5H8NB 3HV1A 5I84A 4RK2A 2A5TB 3KN7A 4EF2A 4F18A 3T9HB 5I2KB 1NMUA 3UORA 4G8HA 3E9XA 3MWBA 2HXWA 3FD3A 1MM6A 4U22A 2AL5A 1LBBA 1ZJLA 3PPOA 3ECRA 4RYAA 2HEUA 3K0VA 3PMVA 2H5YA 4HCYA 4I1DA 1MY2A 3TODA 4C1TA 1B3FA 1OVTA 2QPQA 3S9LC 1DTGA 4GQOA 1VSOA 4RNSA 3B6TA 1YPNA 3IAZA 3H4ZA 5CMCA 4PFYA 2ZNUA 3G7WA 4F3SA 3KN8A 2I6EA 3FJMA 2Y7IA 3O9PA 2PT2A 2XXIA 4GRKA 3LSFB 3RTFB 2UYFA 4RJZA 5EYFA 3LUYA 4F3BA 1MXWA 1R9QA 5AA4B 1URSA 1OMPA 3MC2A 3PUYE 2RC7A 1JVXA 1LFIA 1RKMA 1VR5A 3SEWA 4I9DA 3T96B 3CSBA 1P1UA 4YKPA 1WODA 3OEKA 5AA2D 3RN8A 1MY4A 1SD3A 2D21A 5F7VA 3UP9A 1PBPA 5H8HB 4PE5B 4FEBA 4XTCQ 5FTHA 4LQ2A 4H8IA 3S9EA 4F39A 3M8UA 2G93A 4NF5B 3IB2A 3W15C 1N7WA 1QKBA 2FYIA 3T93B 3FXRA 4WEPA 4PFTA 2OWSA 2R6GE 1FQCA 3KSJA 5KZTA 1GTKA 4OERA 3ILUB 4FECA 5DVJA 4FATA 1US4A 3N6UA 3BBRA 4R9GA 3IOUA 4QFPA 1LB8A 4DIGA 4DDDA 1PEBA 4LATA 3Q25A 4YAHX 4ELRA 2YPNA 3I6VA 2A5SA 1MXZA 4IGRA 2RCBA 3IX1A 2AL4A 5KCJA 4OHNA 1P99A 1EZ9A 2VOZA 3G3GA 4QFNA 1JW4A 4HS7A 3DLNA 4OMBA 3FXQA 4GIZA 3SEXA 1B7ZA 1B7UA 1R6ZA 2XX9A 5H8QB 3F11A 3O28A 4KI0E 1N76A 4U1ZA 4LQ5A 1P1NA 3G3HA 1BTJA 2X7PA 1FTKA 2CZLA 3O66A 3PUZE 4FJPA 3BFTA 2YJPA 1B05A 1MPBA 2PYYA 1Y1MA 4H6DA 3LBSA 2Y7RA 3SKPA 1R1NA 3TPAA 2F35A 1MXYA 4NF8A 4E0XA 1MPCA 1O7TA 3FZVA 3TKDA 1UTBA 3IORA 4GLIA 1J1NA 3GBAA 3IJXB 4HCWA 1IXIA 5CI5A 4JXIA 3T66A 2I3WA 1MH3A 3IL1B 4XKQA 1IXHA 1GR2A 3UK4A 3OO6A 2AYSA 4BDOA 2DXRA 2WKYA 3M3KA 4U4XA 1LCFA 3N6TA 4UA8A 2R9JA 4R6HA 4ZE8A 3EF7A 3C36A 1IXCA 4NTLA 4NF6A 2OJTA 2ZNTA 4L17A 4DCXA 1TFAA 1DMBA 1A8EA 1PC3A 4JDFA 4BLAA 3HHGA 4R72A 1N3XA 3ZSFA 3RY3A 4IO6A 4MLQA 5H8FA 3TCFA 4BDLA 4P0GA 3QXMA 3QIMA 2DWIA 3JYRA 4XKRA 2DE4A 3MW0A 4IY5A 2Q88A 2P1SA 1Z7ME 3RUMA 3FUZA 4OWDA 1MXUA 1I6QA 3V5AA 4AB5A 1M5EA 3IOVA 5KCJB 5I59A 3PMXA 4TQUQ 4EXLA 1MRPA 1JEVA 2P0SA 1SW4A 2BJJX 3O6GA 3A3CA 1IEJA 4F2QA 4YKIA 2ZXTA 2RC9A 1ZMGA 3VVEA 1URDA 3MVYA 4K3FA 2PT1A 1P1WA 3PUVE 2QMWA 2FNCA 1H76A 3H6VA 4NF8B 1SI1A 4Q8RA 3RGYA 3OXNA 5DTBA 2O7IA 4JSDA 5FHOA 2XXXA 3VV5A 5ISUA 3FVGA 4YMAA 3IR1A 2QSXA 1KWHA 4PFUA 4ZEKA 3T22A 3H6TA 4RK9A 3V83A 2REJA 1AMFA 4MFIA 1SW5A 3K6XA 1FTMA 1ANFA 1A8FA 4YB5A 4DXUA 3MQ9A 3C4MA 3C32A 3OOAA 3B6WA 1SDXA 1LFGA 3OD7A 3KFMA 1OLCA 5I58A 2HZLA 2O68A 3MP6A 4X1BA 3TDJA 2O84X 2Y7WA 4F3GA 4RY1A 4IO7A 4P11A 1VFEA 4EXKA 1CB6A 1DPPA 2ZYNA 3TUSA 1I69A 1XHYA 5CRYA 2HFBA 5TP9A 4RA1A 2XXQA 3SERA 1N84A 5H8FB 1MXXA 4WKMA 1LBCA 5K2XA 1NFTA 3CR9A 1LSTA 4IO3A 3CVGA 3K01A 4R74A 2I4CA 3CFLA 4FAJA 2Y7KA 4C0RA 3SESA 2XHDA 1H43A 1MS7A 4I8CA 4QSDA 5CMKA 1PDAA 3JV9A 4O3BA 5I59B 1S9TA 4YZZA 4OETA 2W7YA 1B3HA 5AA2A 1L5TA 2VP1A 4LA9A 2VD2A 5CBSA 1M5DA 2XXHA 3KJTA 5K2YA 1DOTA 1OQGA 3VXBA 3R7XA 1XVXA 3RQTA 1EU8A 3BKIB 3U72A 1JQFA 2HCAA 3KBRA 1B5HA 4IO4A 3USDA 3EQ1A 1A99A 2D5WA 2F36A 1B5JA 3D4GA 3FV2A 1SW2A 2UVHA 1B1HA 3FJGA 3O6HA 2THIA 4KHZE 4GD5A 4YMBA 2Y84A 3I5OA 3CFXA 1B4ZA 3VVDA 1BLFA 3MJNA 3VE1B 1Y4TA 3HCQA 2Q9TA 1RYXA 3CG3A 5DEXA 3AXFA 4F22A 4QF9A 4OFLA 4KCCA 2DOJA 1MG1A 3ODBA 1R9LA 2XXPA 1POTA 2LAOA 3GLBA 3VLWA 3C31A 5J1DA 3V89B 3GXAA 3ZS6A 3OO9A 4DXBA 3LC8A 2NVUB 2ALUA 1QJMA 5TP9B 1ZIUA 1OIBA 2HAVA 3P7IA 1ZBMA 2ZMBA 2Y7PA 1FQAA 1N04A 3H06B 1BP5A 3B7DA 3U94A 5I2NA 3KOSA 5TPAA 2VD3A 4F29A 3S4UA 2Z8DA 1OLAA 1TXFA 5LOMA 3O6IA 4I62A 1A55A 2ZYMA 4X1DA 1MQIA 2QRYA 2QS3A 4F1UA 2XXTA 4IGTA 3Q27A 4H8JA 4OVJA 4R75A 2NWJA 1FW0A 1N0TA 1B3EA 5AA2B 4EQBA 1FQEA 4GOTA 3S9MC 5H8SA 1UQWA 1LLSA 3PD9A 4XKPA 4QRZA 3FV1A 4NF4A 4KFQA 3K02A 1LCTA 1MH4A 1S7YA 3O29A 4MLVA 5EHMA 2XXWA 3SEYA 5DVFA 2DP8A 4YB6A 4ZEDA 3LSWA 1MXVA 1MQJA 2REGA 2O1LA 2IA4A 4U23A 2F6PA 1M5BA 4OFJA 2GHAA 2DVCA 4TOZA 4MH5A 4KQPA 1Y3NA 3C9HA 2RF1A 3M3LA 3EN3A 4ZZEA 5B70A 4PETA 4M4GA 5HBCA 2VHAA 5CC2A 3K6UA 2O69A 3IK6B 4OFOA 1XC1A 5JTYA 3MAMA 3H6WA 2ANJA 2DE2A 3RTWB 4LUBA 3RPWA 5JEIA 4NWDA 1OVBA 1H44A 4DLDA 3Q26A 4Z7EA 4JWXA 3HO7A 5A5XA 2ABHA 2NUVA 3DP6A 1FTJA 3LSXA 1B3GA 4GWOA 3OMBA 3S9NC 1FTOA 1B0HA 3U92A 3LR1A 1YCJA 4QHQA 4WXJA 1TFDA 4ISUA 2KLFA 3FVNA 1FTLA 1H45A 2DVZA 1EZOA 2QJEA 2NOOA 3OSRA 2Q2CA 2DE3A 4ESWA 4AQ4A 2X26A 1JNFA 1YAEA 2PVUA 2Z22A 4X48A 3RT8A 2V84A 1IQ7A 1D4NA 4YU0A 3I3VA 4RPOA 3VVFA 1Y4CA 3UN6A 4NF4B 5HM4B 4FIMA 3QUJA 4R73A 2F6GA 2ONRA 4KYSA 2DSFA 4IO5A 3KEIA 1ELJA 5KDTA 1F9BA 2QMXA 2GH9A 5TU0A 4MBPA 2F97A 4ZZAA 5I56A 3TCHA 3OEMA 5CMMA 5HPQA 1QUKA 4OXVA 4JWOA 3DP4A 4F1VA 5AE4A 3OSQA 4ZECA 3ZKLA 3C35A 3G3KA 3VFJA 4ELOA 5I57A 4XIGQ 4BDMA 3MUQA 4Q5TA 3T9UA 3UA8A 1IXGA 3HHFA 4F1YA 1LGBC 3FIRA 4P0IA 5JTYB 2F8DA 3GZGA 4LZ5A 2HQ0A 1Y20A 2XX8A 3IOTA 1AOVA 1RYOA 1LAFE 4ZEIA 5IKBA 3PUWE 3IO6A 4DZ1A 1USYH 1LAHE 4ZE9A 4F19A 4JB7A 4QFOA 2Z23A 3E3KA 1MDP1 3R26A 1Y3QA 1P1QA 3C34A 4F31B 1JW1A 3K1PA 1T0KA 3PPRA 2B3FA 4G4PA 2Z8EA 4DE8A 1UIVA 4U2RA 5IAIA 4IY6A 3TTLA 2H9BA 4NE4A 3G3FA 5F1QA 3H03A 1I6BA 1UTBB 1OQHA 4U21A 1SVXB 3CI8A 3ZKKA 3E13X 4KYEA 3MZ1A 3SEUA 4R6KA 5JK4A 1BIYA 4G77A 1SI0A 3H6UA 1B2HA 3SEVA 3WAEA 1HSJA 4N07A 3E4RA 4N6PA 2DWAA 3H7MA 3QAXA 1QVSA 1IUDA 3EHSA 3M3FA 3UGWA 2XXUA 2RC8A 1EZPA 1AL3A 1ZKBA 2ONSA 3A09A 3TFLA 1IITA 2O1MA 3FJ7A 3IO4A 2PMSA 3KN3A 4NF6B 4RPNA 5KDTB 1D3KA 4QFKA 3HPIA 3KG2A 4G2ZA 2V93A 5I56B 1WVJA 3VLUA 2QL3A 3OO8A 4M1VA 1P1OA 4U4SA 3C33A 4OYVA 3IJOB 2O51A 3SDFA 4BDRA 3TCGA 3MBPA 1AH5A 3TTNA 3IB0A 1B4HA 5AA4A 3RT6B 1O63A 3K1NA 4JSOA 4OQOA 4GF8A 1B46A 2XD2A 4JWYA 2ZYOA 1M5CA 1DTZA 1QW0A 1GGGA 4Q30B 3MP1A 4OZ9A 3OELA 3K2DA 2F7BA 4EQ7A 4ZDMA 3O97A 4ND9A 3FXUA 5H8HA 4LVQA 3TELA 4EQ9A 3PUXE 1JVYA 4JBZA 4GL0A 2O7UA 4NF5A 3TTKA 4OEUA 4TLMB 5B7DA 4DCYA 5CM6A 1BKAA 3PV0E 4FEDA 1NH8A 4LP2B 1B6HA 2B3BA 2P2AA 2QS2A 1USYE 4THIA 3QK6A 4GFRA 2H25A 2I49A 3QUFA 3CG1A 3BFUA 5FHMA 1N3WA 3KOTA 2OWTA 1XVYA 5AA1A 4H67A 3DP8A 2UVIA 2I4BA 5ICTA 3TTMA 2CMOA 4PFWA 2V3TA 4H1XA 2RCAA 3TMGA 2OBGA 3WAFA 5I58B 1NNTA 3CIJA 4U1OA 2OZZA 4ZS9A 2IEEA 2Q2AA 2F7AA 3U8QA 3VLVA 1II5A 3JZJA 4NWCA 2DXYA 4NMYA 1QUIA 3S2VA 4H65A 1Q35A 3B6QA 1JEUA 2AIXA 3THIA 5H8QA 2E1SA 3A3UA 1B52A 4NEDA 3VXCA 2F34A 3KSXA 3N5LA 3N94A 4PP0A 1Z7NE 4QFLA 2GFEA 4FORA 4Q0CA 5L9MA 2V3QA 2RINA 4OESA 1XOCA 2I58A 4R2BA 4G8MA 1TWYA 5ITOA 3MZBA 2RKMA 3K1MA 1NNPA 4IB2A 4OENA 3EHTA 4QSEA 1Y1ZA 4ZEBA 3GBBA 3MVWA 1QUJA 2V3UA 4XXUA 2UVJA 1MQGA 1QKAA 4MF3A 1US5A 1MM7A 2OCUA 1PBQA 3PMWA 2YLNA 4YKKA 3HSTA 3RLFE 3TYHA 2GHBA 4QSCA 1B58A 2Z8FA 5CMBA 1WDNA 2FA7A 1NKXA 3CFZA 3W9WA 2QS1A 1ATGA 3OO7A 3Q28A 2H4IA 3ONMA 1O64A 3K6WA 5ICQA 3T9VA 3DM0A 1VE4A 2XXVA 1D9YA 2UYEA 2DWJA 1SYHA 1FQFA 4UACA 1FQDA 1POY1 4KD5A 3PD8A 2I0BA 5DEXB 3PU5A 5FTIA 4E0WA 1NH7A 3CSGA 3MPKA 3R6UA 1HSLA 2X7QA 5BWJA 2XD3A 3TZAA 3OENA 3EHUA 1B3LA 4OTEA 3QYTA 4HW8A 1CE2A 2I3VA 1HSEA 3K00A 5BUUA 4KCDA 1JW5A 3QSLA 1B5IA 5I2NB 5TPAB 2F78A 3CRBA 1MPDA 3G3IA 1LB9A 1TT1A 4KPTA 2UXAA 1IIWA 4LZ8A 3KJ7A 5L8DA 1B51A 2H98A 2ZNSA 1EH3A 3KGCA 1XT8A 3FASA 5L9OA 2OK2A 4OEVA 1MQHA 2M8CA 3FATA 4IO2A 2UVGA 1A40A 4LONB 4BDQA 1Y9UA 2DYXA 2GRVA 2ZYKA 3MP8A 3K6VA 1A54A 1SQYA 2QS4A 4ESXA 1PB8A 2Q8JA 1S50A 2H99A 4N13A 4C1UA 4LZ7A 1A7LA 1MY3A 1DPEA 3H3GA 1XS5A 1UIUA 1DSNA 2I48A 1UTHA 4FE8A 4F3PA 4H0WA 3UIFA 4RXLA 5AA3A 2DS9A 1SW1A 4R2FA 1IZ1A 4GL8A 1Q1KA 2G29A 2NXOA 4YICA 3TEPA 4HTGA 4PQJA 4G68A 1FCKA 4ONYA 4EF1A 1PB9A 3PPNA 1URGA 4POWA 1PB7A 4YB7A
chains in the Genus database with same CATH superfamily
2O6AA 1ZLQA 5A5XB 3L6HA 2XXRA 1AIVA 5I5PA 3D4CA 3TTRA 2XX7A 3TAJA 3PPPA 3IB1A 1VFDA 3VDFA 1IMAA 1D9VA 4G8NA 5DVIA 4EUOA 1ZTYA 2F7CA 3U1OA 1B40A 4GXAA 3U93A 4KR5A 3U65A 3MZ9A 3RNNA 3IOWA 5EHSA 5M2VA 5H8NA 1IMBA 3V8XB 2R71A 3O2AA 1JETA 1H3DA 2D3IA 2A5TA 2PBWA 1NNFA 4PFIA 3PPQA 5IGAA 2DQVA 5ITPA 1MQDA 1SBPA 5DYHA 5I2KA 3L6GA 4GVOA 2VPOA 5DT6A 2DWHA 4XF5A 1B32A 2OLBA 3QMFA 4FBPA 4EDPA 4R6YA 4ECFA 3PGFA 2VGQA 4ELQA 5FHNA 4O3CA 4POXA 4H5GA 2VPNA 3NOHA 4YKJA 5EQ7A 2B4MA 1I6AA 1M5FA 1LAGE 3G3JA 1LAXA 3W9VA 2FVZA 4PE3A 4ZEFA 4ELPA 1B7HA 3HN0A 3PTYA 1B9JA 1B0LA 1FQBA 2F5XA 4H5FA 4O3AA 4KYDA 2XWVA 3T9XB 4GWXA 2Q89A 1Y3PA 1QULA 1UTHB 2B65A 3DELB 1NV0A 5I57B 1GV8A 3SETA 4WEDA 4G68C 1MY1A 2E0SA 2MKZA 1SYIA 4TLLB 4BDNA 4F2OA 2XXYA 4XKNA 3LSLA 3MVXA 1GVCA 3ILTB 1ZU0A 3FVKA 4G68B 3FGSA 4MNCA 4Z0IA 1N7XA 2PX1A 4PTKA 2HAUA 4AS4A 4PGPA 1LFHA 2I0CA 4GX6A 4R9FA 4GXSB 2ESNA 1FBPA 4PBHA 3E78A 4X9TA 5L9SA 3Q29A 3KZGA 4AB6A 1NNKA 5ELVA 2V25A 5CBRA 1YTVA 3MPLA 3N26A 3TQLA 1MY0A 3FVOA 1MDQA 4PAFA 2P3VA 3EPEA 3MSTA 2XWKA 1NL5A 1B1XA 2HZKA 4DXCA 3K4UA 3TQWA 4PBQA 2ONKE 3MVZA 5H8NB 3HV1A 5I84A 4HXVA 4RK2A 2A5TB 3KN7A 4EF2A 4F18A 3BIHA 3T9HB 5I2KB 1NMUA 3UORA 4G8HA 3E9XA 3MWBA 2HXWA 3FD3A 4G61A 4GWZA 1MM6A 5IZ1A 4U22A 2AL5A 1LBBA 2JJKA 1ZJLA 3PPOA 3ECRA 4RYAA 2HEUA 3K0VA 3PMVA 2H5YA 4PCDA 4HCYA 4I1DA 1MY2A 3TODA 4C1TA 1B3FA 1OVTA 2QPQA 1NUYA 3S9LC 2FIEA 1DTGA 4GQOA 1VSOA 5I7IA 4RNSA 3B6TA 1YPNA 3IAZA 3H4ZA 5CMCA 4PFYA 2ZNUA 3G7WA 4F3SA 3KN8A 2I6EA 3FJMA 2Y7IA 3O9PA 2PT2A 2XXIA 2WEFA 4GRKA 3LSFB 4P56A 3RTFB 2UYFA 4RJZA 5EYFA 2Y5LA 3LUYA 4F3BA 2HPGA 1MXWA 1R9QA 5AA4B 1URSA 1OMPA 1KZ8A 3MC2A 3PUYE 2RC7A 4O7MA 1JVXA 2WBDA 1LFIA 1RKMA 1VR5A 3SEWA 4XFEA 4I9DA 3T96B 3CSBA 1P1UA 4YKPA 4NF0A 1WODA 3OEKA 4X04A 5AA2D 3RN8A 2HHMA 1MY4A 1SD3A 2D21A 5F7VA 3UP9A 1PBPA 4OA4A 5H8HB 4PE5B 4FEBA 4XTCQ 5FTHA 4LQ2A 4H8IA 3S9EA 4F39A 3M8UA 2G93A 4NF5B 3IB2A 3W15C 4GWYA 4MIJA 1N7WA 1QKBA 2FYIA 3T93B 3FXRA 4WEPA 4PFTA 2OWSA 2R6GE 1FQCA 3KSJA 5KZTA 1DCUA 1GTKA 4OERA 3ILUB 4FECA 5DVJA 4FATA 3LV0A 1US4A 4PAKA 3N6UA 3KC1A 3BBRA 2WX9A 4R9GA 3IOUA 4QFPA 1LB8A 4DIGA 2QVUA 4DDDA 1LBVA 1PEBA 1NUWA 4OANA 2QFLA 2PFYA 4LATA 3Q25A 4YAHX 2CZIA 4ELRA 1YYZA 1RDZA 2YPNA 3I6VA 2A5SA 1MXZA 4IGRA 4NX1A 2RCBA 3IX1A 5ET8A 2AL4A 5KCJA 4OHNA 1P99A 1EZ9A 4N17A 4MMPA 2VOZA 3G3GA 4QFNA 1JW4A 4HS7A 3DLNA 4H46A 4OMBA 3FXQA 2ZZVA 1Q9DA 4GIZA 3SEXA 1B7ZA 1B7UA 1R6ZA 2XX9A 5H8QB 3F11A 3O28A 4KI0E 1N76A 4U1ZA 4LQ5A 1FBFA 1NUXA 1P1NA 3G3HA 1BTJA 4JVCA 2X7PA 1FTKA 2CZLA 3O66A 3PUZE 4FJPA 3BFTA 2YJPA 1B05A 1MPBA 2PYYA 1Y1MA 4H6DA 3LBSA 2Y7RA 3SKPA 1R1NA 3TPAA 2F35A 1MXYA 4NAPA 4NF8A 4E0XA 1MPCA 1O7TA 2WYKA 3FZVA 3TKDA 1UTBA 4MEVA 3IORA 4GLIA 1J1NA 3GBAA 3IJXB 4HCWA 5IZ3A 1IXIA 4N4UA 5ET5A 2R8TA 5CI5A 2F3BA 4JXIA 3T66A 2I3WA 1MH3A 3IL1B 4XKQA 1IXHA 1GR2A 3UK4A 4OVTA 2QVRA 1FJ6A 4I3YA 3OO6A 2AYSA 4BDOA 2DXRA 2WKYA 3M3KA 4U4XA 4O7IA 1LCFA 3N6TA 1CNQA 4UA8A 2R9JA 4R6HA 4ZE8A 5IZZA 2OWZA 4N91A 3EF7A 3C36A 1IXCA 4NTLA 4NF6A 2OJTA 2ZNTA 1K9ZA 1FRPA 4L17A 4DCXA 3D1RA 1TFAA 1AWBA 1DMBA 2CEXA 1A8EA 1PC3A 4JDFA 4PAIA 4BLAA 3HHGA 1NV5A 4X8RA 4R72A 1N3XA 3ZSFA 3RY3A 4IO6A 4MLQA 5H8FA 3TCFA 4BDLA 5A5LA 1FBEA 4P0GA 3QXMA 3QIMA 2DWIA 3JYRA 4XKRA 2DE4A 3MW0A 1IMCA 4IY5A 2Q88A 2P1SA 2BJIA 1Z7ME 3RUMA 2Q8MA 3FUZA 4OWDA 1MXUA 1I6QA 3V5AA 1FPBA 4AB5A 1M5EA 3IOVA 5KCJB 5I59A 3PMXA 4TQUQ 2GQ1A 4EXLA 1MRPA 1JEVA 4MJOA 2P0SA 1SW4A 4AS5A 2BJJX 2V4CA 3O6GA 4O94A 3A3CA 1IEJA 4F2QA 4YKIA 2ZXTA 2RC9A 1ZMGA 4GX3A 3VVEA 1URDA 4PF8A 3MVYA 4K3FA 4MHFA 2PT1A 3RYDA 1YXIA 4MCOA 1P1WA 2XXKA 3PUVE 2QMWA 2FNCA 1H76A 3H6VA 4NF8B 1SI1A 4Q8RA 3RGYA 3OXNA 4GWWA 5DTBA 1JP4A 2O7IA 4JSDA 5FHOA 2XXXA 3VV5A 4IR8A 5ISUA 5LTCA 3FVGA 4YMAA 3IR1A 2QSXA 1KWHA 4HE1A 4PFUA 4ZEKA 3T22A 3H6TA 4RK9A 3V83A 2REJA 1AMFA 1FBHA 4MFIA 1SW5A 3K6XA 1FTMA 3RPLA 1ANFA 1A8FA 4YB5A 4DXUA 4N6KA 3MQ9A 3C4MA 2XA5A 3C32A 3OOAA 3B6WA 1SDXA 1LFGA 3OD7A 3KFMA 1OLCA 5I58A 2HZLA 2O68A 2FIXA 3MP6A 4X1BA 3TDJA 2O84X 2Y7WA 4F3GA 4RY1A 4IO7A 4P11A 1VFEA 1CB6A 4EXKA 1DPPA 2ZYNA 3TUSA 1I69A 3HFUA 1XHYA 5CRYA 2HFBA 5TP9A 4RA1A 2XXQA 1FPKA 3SERA 1N84A 5H8FB 1MXXA 4WKMA 1LBCA 5K2XA 4N8GA 1IMFA 2P3NA 1NFTA 3CR9A 4OVPA 1LSTA 4IO3A 3CVGA 4HE0A 3K01A 4R74A 4QBAA 2I4CA 3CFLA 4FAJA 2Y7KA 4C0RA 3SESA 2XHDA 1H43A 1MS7A 2L5VA 4I8CA 4QSDA 5CMKA 1PDAA 3JV9A 4O3BA 5I59B 1S9TA 4YZZA 4OETA 2W7YA 1B3HA 5AA2A 1L5TA 1NV7A 2VP1A 4LA9A 1D9QA 2VD2A 5CBSA 2ZZXA 1M5DA 4OVRA 2XXHA 3KJTA 5K2YA 1DOTA 1OQGA 3VXBA 3R7XA 1XVXA 3RQTA 1EU8A 4UABA 3BKIB 3U72A 1JQFA 2HCAA 4PF6A 2CEYA 3KBRA 1B5HA 4IO4A 3USDA 3EQ1A 4P47A 1FPEA 1A99A 2D5WA 2F36A 1B5JA 3D4GA 1FSAA 3FV2A 1SW2A 2UVHA 1B1HA 1FPIA 3FJGA 3O6HA 2THIA 4KHZE 4GD5A 4YMBA 2Y84A 3I5OA 3CFXA 5FBPA 1B4ZA 3VVDA 1BLFA 3MJNA 3VE1B 1Y4TA 3HCQA 2Q9TA 5T3JA 1NV3A 1RYXA 3CG3A 5DEXA 3AXFA 4F22A 2OX3A 4QF9A 4OFLA 4KCCA 4QXDA 2DOJA 1MG1A 3ODBA 1R9LA 2XXPA 3FBPA 3IFAA 1POTA 2LAOA 3GLBA 5J16A 1XI6A 3VLWA 3C31A 5J1DA 3V89B 3GXAA 3ZS6A 3OO9A 4DXBA 3LC8A 2NVUB 2ALUA 1QJMA 5TP9B 1ZIUA 1OIBA 2HAVA 3P7IA 1ZBMA 3LUZA 1K9YA 2ZMBA 2Y7PA 1FQAA 1N04A 3H06B 1BP5A 3B7DA 3U94A 5I2NA 3KOSA 5TPAA 1EYKA 2VD3A 4F29A 3S4UA 2Z8DA 1OLAA 1TXFA 5LOMA 3O6IA 4I62A 1A55A 3E79A 2ZYMA 4X1DA 1MQIA 2QRYA 2QS3A 4F1UA 2XXTA 4IGTA 3Q27A 4H8JA 4OVJA 4R75A 2NWJA 1FW0A 1N0TA 1B3EA 4NQ8A 5AA2B 4EQBA 1FQEA 4GOTA 1FBGA 1LBZA 3S9MC 5H8SA 1UQWA 1LLSA 3PD9A 4XKPA 4GBVA 4QRZA 3FV1A 5EYGA 4NF4A 4KFQA 3K02A 1LCTA 1MH4A 1G0HA 1S7YA 3O29A 4MLVA 5EHMA 2XXWA 3SEYA 5DVFA 4NN3A 2DP8A 4YB6A 3B8BA 4ZEDA 3LSWA 1LBWA 1MXVA 1MQJA 2REGA 2O1LA 2IA4A 4U23A 4JVIA 2F6PA 1M5BA 4OFJA 5ET6A 2GHAA 2DVCA 4TOZA 4MH5A 5LDZA 4KQPA 1Y3NA 3C9HA 2RF1A 3M3LA 1G0IA 3EN3A 4ZZEA 5B70A 4PETA 4M4GA 5HBCA 2VHAA 4N15A 5CC2A 3K6UA 2O69A 3IK6B 4OFOA 1XC1A 5JTYA 3MAMA 3H6WA 2ANJA 2DE2A 3RTWB 4LUBA 3RPWA 5JEIA 4NWDA 1OVBA 1H44A 4DLDA 3Q26A 4Z7EA 4JWXA 3T1BA 3HO7A 5A5XA 3KC0A 1FPLA 2ABHA 2NUVA 3DP6A 1FTJA 4DI3D 2FBPA 3LSXA 1B3GA 4GWOA 2Q74A 3OMBA 3S9NC 1FTOA 1B0HA 3U92A 2CZKA 3LR1A 1YCJA 4HE2A 3EKIA 4QHQA 4WXJA 1FPDA 1TFDA 4ISUA 2KLFA 1FJ9A 3FVNA 5EYHA 1FTLA 1H45A 2DVZA 1EZOA 2QJEA 2NOOA 3OSRA 2Q2CA 2DE3A 4ESWA 4AQ4A 2X26A 1JNFA 1YAEA 2PVUA 2Z22A 4X48A 3RT8A 2V84A 1IQ7A 1D4NA 4YU0A 3I3VA 4RPOA 1RDXA 3VVFA 1Y4CA 3UN6A 4NF4B 5HM4B 4FIMA 3QUJA 4R73A 2F6GA 2ONRA 4KYSA 1LBYA 2DSFA 4IO5A 3KEIA 1DBZA 1ELJA 5KDTA 1F9BA 1VDWA 2QMXA 2GH9A 5TU0A 4MBPA 2F97A 4ZZAA 5I56A 3TCHA 2WBBA 4P8BA 3OEMA 5CMMA 5HPQA 1QUKA 4OXVA 4JWOA 3DP4A 4F1VA 5AE4A 4GBWA 3OSQA 4ZECA 3ZKLA 3C35A 3G3KA 3VFJA 4XEQA 4ELOA 5I57A 4XIGQ 4BDMA 3MUQA 4Q5TA 3T9UA 4MNIA 4I3EA 3UA8A 1IXGA 3HHFA 4F1YA 1LGBC 4OVQA 3FIRA 4P0IA 1FBCA 4PDDA 5JTYB 2F8DA 3GZGA 4LZ5A 2HQ0A 1Y20A 2XX8A 3IOTA 1AOVA 1RYOA 4N6DA 1LAFE 4ZEIA 5IKBA 3PUWE 3IO6A 4DZ1A 1USYH 1LAHE 4ZE9A 4F19A 4JB7A 4QFOA 2Z23A 3E3KA 1MDP1 3R26A 1Y3QA 1P1QA 3C34A 4F31B 1JW1A 3K1PA 1T0KA 3PPRA 4NHBA 2B3FA 4G4PA 2Z8EA 4P1LA 4DE8A 1UIVA 4U2RA 5IAIA 4IY6A 4GWSA 3TTLA 2H9BA 4NE4A 3G3FA 5F1QA 3H03A 3T0JA 2XWOA 1I6BA 1UTBB 1OQHA 4U21A 1SVXB 3CI8A 3ZKKA 5IM2A 3E13X 4KYEA 5IZ3B 3MZ1A 3SEUA 4R6KA 5JK4A 2XWIA 1BIYA 4OVSA 4G77A 1SI0A 3H6UA 1B2HA 3SEVA 3WAEA 1HSJA 4N07A 4N81A 3E4RA 4N6PA 4N8YA 5EQ9A 2DWAA 3H7MA 3QAXA 4PFRA 1QVSA 1IUDA 3EHSA 3M3FA 3UGWA 2XXUA 2RC8A 1EZPA 1AL3A 1ZKBA 2ONSA 3A09A 3TFLA 4O8MA 1IITA 2O1MA 3FJ7A 3IO4A 2PMSA 3KN3A 4NF6B 4RPNA 4PDHA 5KDTB 1D3KA 4QFKA 3HPIA 3KG2A 4G2ZA 1KA1A 3SZPA 2V93A 5I56B 1WVJA 5ET7A 2FHYA 3VLUA 2QL3A 3OO8A 4M1VA 1FPJA 1P1OA 3ISPA 4U4SA 3C33A 4P1EA 2PCRA 4OYVA 3IJOB 2O51A 3SDFA 4BDRA 3TCGA 3MBPA 1NI9A 1AH5A 3TTNA 3IB0A 1BK4A 1B4HA 5AA4A 3RT6B 1O63A 3K1NA 4JSOA 4OQOA 4DI4B 4GF8A 1B46A 2XD2A 4JWYA 1IMEA 2ZYOA 1M5CA 1DTZA 1QW0A 1GGGA 4Q30B 4PGNA 4NG7A 3MP1A 4OZ9A 3OELA 3K2DA 2F7BA 2VT5A 4EQ7A 4ZDMA 1FTAA 1SPIA 3O97A 4ND9A 4KXPA 3FXUA 5H8HA 4LVQA 3TELA 4EQ9A 3PUXE 1JVYA 4JBZA 4GL0A 2O7UA 3KBZA 4NF5A 3TTKA 4OEUA 4TLMB 5B7DA 4MX6A 3A29A 4DCYA 5CM6A 1BKAA 3PV0E 4FEDA 1NH8A 4LP2B 1B6HA 2B3BA 2P2AA 2QS2A 3ROJA 1USYE 4THIA 3QK6A 3CHGA 1NV2A 5I3SA 4GFRA 4H45A 2H25A 2I49A 3QUFA 3IFCA 3CG1A 3B50A 3BFUA 5FHMA 1N3WA 3KOTA 2OWTA 1XVYA 5AA1A 4H67A 3DP8A 2UVIA 2I4BA 3RPLB 5ICTA 3TTMA 2CMOA 4PFWA 2V3TA 1INPA 4H1XA 2RCAA 3TMGA 2OBGA 1YZ0A 3GYYA 3WAFA 5I58B 2KR0A 1NNTA 3CIJA 4U1OA 1RDYA 2OZZA 4ZS9A 2IEEA 2Q2AA 2F7AA 3U8QA 3VLVA 1II5A 3JZJA 4NWCA 2DXYA 4NMYA 1QUIA 3S2VA 4H65A 1Q35A 3B6QA 1JEUA 2AIXA 3THIA 5H8QA 2E1SA 3A3UA 1B52A 1LEVA 4NEDA 3VXCA 2CZHA 2F34A 3KSXA 3N5LA 3N94A 4PP0A 1Z7NE 4QFLA 2GFEA 4FORA 4Q0CA 5L9MA 2V3QA 5EQ8A 2RINA 4OESA 1XOCA 2I58A 2HXRA 4R2BA 1LBXA 4G8MA 4JVDA 1TWYA 5ITOA 3MZBA 5DW8A 1FPFA 2RKMA 3K1MA 1NNPA 5ESYA 4IB2A 4OENA 4I40A 3EHTA 4QSEA 2B4LA 1Y1ZA 4ZEBA 3GBBA 3MVWA 1QUJA 2V3UA 4XXUA 2UVJA 1MQGA 1EYIA 1QKAA 4MF3A 1US5A 1MM7A 2OCUA 1PBQA 3PMWA 2YLNA 4YKKA 3HSTA 3RLFE 3TYHA 2GHBA 4QSCA 1B58A 2Z8FA 5CMBA 1WDNA 2FA7A 1NKXA 1NV4A 3CFZA 3W9WA 2QS1A 1NV6A 1ATGA 3OO7A 3Q28A 4LN5A 2H4IA 3ONMA 1O64A 3K6WA 5ICQA 3T9VA 3DM0A 1VE4A 2XXVA 1D9YA 2UYEA 4GX4A 2DWJA 1SYHA 1FQFA 4UACA 1FPGA 1FQDA 1NUZA 1POY1 4KD5A 3PD8A 1DK4A 2I0BA 5DEXB 3PU5A 5FTIA 4E0WA 4NGUA 1NH7A 3CSGA 2DDKA 3MPKA 3R6UA 3MYUA 1HSLA 3BIGA 2X7QA 1EYJA 5BWJA 2XD3A 3TZAA 3OENA 5EQAA 3EHUA 1B3LA 4OTEA 3QYTA 4HW8A 1CE2A 2I3VA 1HSEA 2PFZA 3K00A 5BUUA 4KCDA 1JW5A 3QSLA 1B5IA 5I2NB 5TPAB 2F78A 4P3LA 3CRBA 1MPDA 3G3IA 1LB9A 1TT1A 4KPTA 2WYPA 2UXAA 1IIWA 4LZ8A 3KJ7A 5L8DA 1B51A 2H98A 2ZNSA 1EH3A 3KGCA 1NV1A 1XT8A 3FASA 5L9OA 2OK2A 3FXBA 4OEVA 1MQHA 2M8CA 3FATA 4IO2A 2F3DA 2UVGA 1A40A 4LONB 4BDQA 1Y9UA 2DYXA 2GRVA 2ZYKA 3MP8A 3K6VA 1A54A 1SQYA 2QS4A 4ESXA 1PB8A 2Q8JA 1S50A 4PC9A 1KA0A 2H99A 4N13A 1IMDA 4C1UA 4LZ7A 1A7LA 1MY3A 1DPEA 3H3GA 4MAGA 4PFBA 2QVVA 1XS5A 1UIUA 1DSNA 2I48A 1UTHA 4FE8A 4F3PA 1QGXA 4H0WA 3UIFA 2KQZA 4RXLA 5AA3A 2DS9A 1SW1A 4R2FA 2Y5KA 2ZZWA 1IZ1A 4GL8A 1Q1KA 1FBDA 2G29A 2NXOA 4YICA 4P9KA 3TEPA 4HTGA 5F24A 4GWUA 4PQJA 4G68A 1FCKA 4ONYA 4EF1A 1PB9A 3PPNA 1URGA 4MNPA 4POWA 1PB7A 4YB7A
chains in the Genus database with same CATH topology
2O6AA 1ZLQA 5A5XB 3L6HA 2XXRA 1AIVA 3D4CA 3TTRA 2XX7A 3TAJA 3PPPA 3IB1A 1VFDA 3VDFA 1D9VA 4G8NA 5DVIA 4EUOA 1ZTYA 2F7CA 3U1OA 1B40A 4GXAA 3U93A 4KR5A 3MZ9A 3RNNA 3IOWA 5EHSA 5M2VA 5H8NA 3V8XB 2R71A 3O2AA 1JETA 1H3DA 2D3IA 2A5TA 2PBWA 1NNFA 3PPQA 2DQVA 5ITPA 1MQDA 1SBPA 5DYHA 5I2KA 3L6GA 4GVOA 5DT6A 2DWHA 1B32A 2OLBA 4EDPA 4R6YA 4ECFA 3PGFA 2VGQA 4ELQA 5FHNA 4O3CA 4POXA 4H5GA 4YKJA 1I6AA 1M5FA 1LAGE 3G3JA 1LAXA 3W9VA 4ZEFA 4ELPA 1B7HA 3HN0A 1B9JA 1B0LA 1FQBA 2F5XA 4H5FA 4O3AA 4KYDA 3T9XB 2Q89A 1Y3PA 1QULA 1UTHB 2B65A 3DELB 5I57B 1GV8A 3SETA 4WEDA 4G68C 1MY1A 2E0SA 1SYIA 4TLLB 4BDNA 4F2OA 2XXYA 4XKNA 3LSLA 3MVXA 1GVCA 3ILTB 1ZU0A 3FVKA 4G68B 3FGSA 4Z0IA 1N7XA 2PX1A 2HAUA 1LFHA 2I0CA 4R9FA 4GXSB 2ESNA 4X9TA 5L9SA 3Q29A 3KZGA 4AB6A 1NNKA 5ELVA 2V25A 5CBRA 1YTVA 3MPLA 3N26A 3TQLA 1MY0A 3FVOA 1MDQA 3EPEA 1NL5A 1B1XA 2HZKA 4DXCA 3K4UA 3TQWA 2ONKE 3MVZA 5H8NB 3HV1A 5I84A 4RK2A 2A5TB 3KN7A 4EF2A 4F18A 3T9HB 5I2KB 1NMUA 3UORA 4G8HA 3E9XA 3MWBA 2HXWA 3FD3A 1MM6A 4U22A 2AL5A 1LBBA 1ZJLA 3PPOA 3ECRA 4RYAA 2HEUA 3K0VA 3PMVA 2H5YA 4HCYA 4I1DA 1MY2A 3TODA 4C1TA 1B3FA 1OVTA 2QPQA 3S9LC 1DTGA 4GQOA 1VSOA 4RNSA 3B6TA 1YPNA 3IAZA 3H4ZA 5CMCA 4PFYA 2ZNUA 3G7WA 4F3SA 3KN8A 2I6EA 3FJMA 2Y7IA 3O9PA 2PT2A 2XXIA 4GRKA 3LSFB 3RTFB 2UYFA 4RJZA 5EYFA 3LUYA 4F3BA 1MXWA 1R9QA 5AA4B 1URSA 1OMPA 3MC2A 3PUYE 2RC7A 1JVXA 1LFIA 1RKMA 1VR5A 3SEWA 4I9DA 3T96B 3CSBA 1P1UA 4YKPA 1WODA 3OEKA 5AA2D 3RN8A 1MY4A 1SD3A 2D21A 5F7VA 3UP9A 1PBPA 5H8HB 4PE5B 4FEBA 4XTCQ 5FTHA 4LQ2A 4H8IA 3S9EA 4F39A 3M8UA 2G93A 4NF5B 3IB2A 3W15C 1N7WA 1QKBA 2FYIA 3T93B 3FXRA 4WEPA 4PFTA 2OWSA 2R6GE 1FQCA 3KSJA 5KZTA 1GTKA 4OERA 3ILUB 4FECA 5DVJA 4FATA 1US4A 3N6UA 3BBRA 4R9GA 3IOUA 4QFPA 1LB8A 4DIGA 4DDDA 1PEBA 4LATA 3Q25A 4YAHX 4ELRA 2YPNA 3I6VA 2A5SA 1MXZA 4IGRA 2RCBA 3IX1A 2AL4A 5KCJA 4OHNA 1P99A 1EZ9A 2VOZA 3G3GA 4QFNA 1JW4A 4HS7A 3DLNA 4OMBA 3FXQA 4GIZA 3SEXA 1B7ZA 1B7UA 1R6ZA 2XX9A 5H8QB 3F11A 3O28A 4KI0E 1N76A 4U1ZA 4LQ5A 1P1NA 3G3HA 1BTJA 2X7PA 1FTKA 2CZLA 3O66A 3PUZE 4FJPA 3BFTA 2YJPA 1B05A 1MPBA 2PYYA 1Y1MA 4H6DA 3LBSA 2Y7RA 3SKPA 1R1NA 3TPAA 2F35A 1MXYA 4NF8A 4E0XA 1MPCA 1O7TA 3FZVA 3TKDA 1UTBA 3IORA 4GLIA 1J1NA 3GBAA 3IJXB 4HCWA 1IXIA 5CI5A 4JXIA 3T66A 2I3WA 1MH3A 3IL1B 4XKQA 1IXHA 1GR2A 3UK4A 3OO6A 2AYSA 4BDOA 2DXRA 2WKYA 3M3KA 4U4XA 1LCFA 3N6TA 4UA8A 2R9JA 4R6HA 4ZE8A 3EF7A 3C36A 1IXCA 4NTLA 4NF6A 2OJTA 2ZNTA 4L17A 4DCXA 1TFAA 1DMBA 1A8EA 1PC3A 4JDFA 4BLAA 3HHGA 4R72A 1N3XA 3ZSFA 3RY3A 4IO6A 4MLQA 5H8FA 3TCFA 4BDLA 4P0GA 3QXMA 3QIMA 2DWIA 3JYRA 4XKRA 2DE4A 3MW0A 4IY5A 2Q88A 2P1SA 1Z7ME 3RUMA 3FUZA 4OWDA 1MXUA 1I6QA 3V5AA 4AB5A 1M5EA 3IOVA 5KCJB 5I59A 3PMXA 4TQUQ 4EXLA 1MRPA 1JEVA 2P0SA 1SW4A 2BJJX 3O6GA 3A3CA 1IEJA 4F2QA 4YKIA 2ZXTA 2RC9A 1ZMGA 3VVEA 1URDA 3MVYA 4K3FA 2PT1A 1P1WA 3PUVE 2QMWA 2FNCA 1H76A 3H6VA 4NF8B 1SI1A 4Q8RA 3RGYA 3OXNA 5DTBA 2O7IA 4JSDA 5FHOA 2XXXA 3VV5A 5ISUA 3FVGA 4YMAA 3IR1A 2QSXA 1KWHA 4PFUA 4ZEKA 3T22A 3H6TA 4RK9A 3V83A 2REJA 1AMFA 4MFIA 1SW5A 3K6XA 1FTMA 1ANFA 1A8FA 4YB5A 4DXUA 3MQ9A 3C4MA 3C32A 3OOAA 3B6WA 1SDXA 1LFGA 3OD7A 3KFMA 1OLCA 5I58A 2HZLA 2O68A 3MP6A 4X1BA 3TDJA 2O84X 2Y7WA 4F3GA 4RY1A 4IO7A 4P11A 1VFEA 4EXKA 1CB6A 1DPPA 2ZYNA 3TUSA 1I69A 1XHYA 5CRYA 2HFBA 5TP9A 4RA1A 2XXQA 3SERA 1N84A 5H8FB 1MXXA 4WKMA 1LBCA 5K2XA 1NFTA 3CR9A 1LSTA 4IO3A 3CVGA 3K01A 4R74A 2I4CA 3CFLA 4FAJA 2Y7KA 4C0RA 3SESA 2XHDA 1H43A 1MS7A 4I8CA 4QSDA 5CMKA 1PDAA 3JV9A 4O3BA 5I59B 1S9TA 4YZZA 4OETA 2W7YA 1B3HA 5AA2A 1L5TA 2VP1A 4LA9A 2VD2A 5CBSA 1M5DA 2XXHA 3KJTA 5K2YA 1DOTA 1OQGA 3VXBA 3R7XA 1XVXA 3RQTA 1EU8A 3BKIB 3U72A 1JQFA 2HCAA 3KBRA 1B5HA 4IO4A 3USDA 3EQ1A 1A99A 2D5WA 2F36A 1B5JA 3D4GA 3FV2A 1SW2A 2UVHA 1B1HA 3FJGA 3O6HA 2THIA 4KHZE 4GD5A 4YMBA 2Y84A 3I5OA 3CFXA 1B4ZA 3VVDA 1BLFA 3MJNA 3VE1B 1Y4TA 3HCQA 2Q9TA 1RYXA 3CG3A 5DEXA 3AXFA 4F22A 4QF9A 4OFLA 4KCCA 2DOJA 1MG1A 3ODBA 1R9LA 2XXPA 1POTA 2LAOA 3GLBA 3VLWA 3C31A 5J1DA 3V89B 3GXAA 3ZS6A 3OO9A 4DXBA 3LC8A 2NVUB 2ALUA 1QJMA 5TP9B 1ZIUA 1OIBA 2HAVA 3P7IA 1ZBMA 2ZMBA 2Y7PA 1FQAA 1N04A 3H06B 1BP5A 3B7DA 3U94A 5I2NA 3KOSA 5TPAA 2VD3A 4F29A 3S4UA 2Z8DA 1OLAA 1TXFA 5LOMA 3O6IA 4I62A 1A55A 2ZYMA 4X1DA 1MQIA 2QRYA 2QS3A 4F1UA 2XXTA 4IGTA 3Q27A 4H8JA 4OVJA 4R75A 2NWJA 1FW0A 1N0TA 1B3EA 5AA2B 4EQBA 1FQEA 4GOTA 3S9MC 5H8SA 1UQWA 1LLSA 3PD9A 4XKPA 4QRZA 3FV1A 4NF4A 4KFQA 3K02A 1LCTA 1MH4A 1S7YA 3O29A 4MLVA 5EHMA 2XXWA 3SEYA 5DVFA 2DP8A 4YB6A 4ZEDA 3LSWA 1MXVA 1MQJA 2REGA 2O1LA 2IA4A 4U23A 2F6PA 1M5BA 4OFJA 2GHAA 2DVCA 4TOZA 4MH5A 4KQPA 1Y3NA 3C9HA 2RF1A 3M3LA 3EN3A 4ZZEA 5B70A 4PETA 4M4GA 5HBCA 2VHAA 5CC2A 3K6UA 2O69A 3IK6B 4OFOA 1XC1A 5JTYA 3MAMA 3H6WA 2ANJA 2DE2A 3RTWB 4LUBA 3RPWA 5JEIA 4NWDA 1OVBA 1H44A 4DLDA 3Q26A 4Z7EA 4JWXA 3HO7A 5A5XA 2ABHA 2NUVA 3DP6A 1FTJA 3LSXA 1B3GA 4GWOA 3OMBA 3S9NC 1FTOA 1B0HA 3U92A 3LR1A 1YCJA 4QHQA 4WXJA 1TFDA 4ISUA 2KLFA 3FVNA 1FTLA 1H45A 2DVZA 1EZOA 2QJEA 2NOOA 3OSRA 2Q2CA 2DE3A 4ESWA 4AQ4A 2X26A 1JNFA 1YAEA 2PVUA 2Z22A 4X48A 3RT8A 2V84A 1IQ7A 1D4NA 4YU0A 3I3VA 4RPOA 3VVFA 1Y4CA 3UN6A 4NF4B 5HM4B 4FIMA 3QUJA 4R73A 2F6GA 2ONRA 4KYSA 2DSFA 4IO5A 3KEIA 1ELJA 5KDTA 1F9BA 2QMXA 2GH9A 5TU0A 4MBPA 2F97A 4ZZAA 5I56A 3TCHA 3OEMA 5CMMA 5HPQA 1QUKA 4OXVA 4JWOA 3DP4A 4F1VA 5AE4A 3OSQA 4ZECA 3ZKLA 3C35A 3G3KA 3VFJA 4ELOA 5I57A 4XIGQ 4BDMA 3MUQA 4Q5TA 3T9UA 3UA8A 1IXGA 3HHFA 4F1YA 1LGBC 3FIRA 4P0IA 5JTYB 2F8DA 3GZGA 4LZ5A 2HQ0A 1Y20A 2XX8A 3IOTA 1AOVA 1RYOA 1LAFE 4ZEIA 5IKBA 3PUWE 3IO6A 4DZ1A 1USYH 1LAHE 4ZE9A 4F19A 4JB7A 4QFOA 2Z23A 3E3KA 1MDP1 3R26A 1Y3QA 1P1QA 3C34A 4F31B 1JW1A 3K1PA 1T0KA 3PPRA 2B3FA 4G4PA 2Z8EA 4DE8A 1UIVA 4U2RA 5IAIA 4IY6A 3TTLA 2H9BA 4NE4A 3G3FA 5F1QA 3H03A 1I6BA 1UTBB 1OQHA 4U21A 1SVXB 3CI8A 3ZKKA 3E13X 4KYEA 3MZ1A 3SEUA 4R6KA 5JK4A 1BIYA 4G77A 1SI0A 3H6UA 1B2HA 3SEVA 3WAEA 1HSJA 4N07A 3E4RA 4N6PA 2DWAA 3H7MA 3QAXA 1QVSA 1IUDA 3EHSA 3M3FA 3UGWA 2XXUA 2RC8A 1EZPA 1AL3A 1ZKBA 2ONSA 3A09A 3TFLA 1IITA 2O1MA 3FJ7A 3IO4A 2PMSA 3KN3A 4NF6B 4RPNA 5KDTB 1D3KA 4QFKA 3HPIA 3KG2A 4G2ZA 2V93A 5I56B 1WVJA 3VLUA 2QL3A 3OO8A 4M1VA 1P1OA 4U4SA 3C33A 4OYVA 3IJOB 2O51A 3SDFA 4BDRA 3TCGA 3MBPA 1AH5A 3TTNA 3IB0A 1B4HA 5AA4A 3RT6B 1O63A 3K1NA 4JSOA 4OQOA 4GF8A 1B46A 2XD2A 4JWYA 2ZYOA 1M5CA 1DTZA 1QW0A 1GGGA 4Q30B 3MP1A 4OZ9A 3OELA 3K2DA 2F7BA 4EQ7A 4ZDMA 3O97A 4ND9A 3FXUA 5H8HA 4LVQA 3TELA 4EQ9A 3PUXE 1JVYA 4JBZA 4GL0A 2O7UA 4NF5A 3TTKA 4OEUA 4TLMB 5B7DA 4DCYA 5CM6A 1BKAA 3PV0E 4FEDA 1NH8A 4LP2B 1B6HA 2B3BA 2P2AA 2QS2A 1USYE 4THIA 3QK6A 4GFRA 2H25A 2I49A 3QUFA 3CG1A 3BFUA 5FHMA 1N3WA 3KOTA 2OWTA 1XVYA 5AA1A 4H67A 3DP8A 2UVIA 2I4BA 5ICTA 3TTMA 2CMOA 4PFWA 2V3TA 4H1XA 2RCAA 3TMGA 2OBGA 3WAFA 5I58B 1NNTA 3CIJA 4U1OA 2OZZA 4ZS9A 2IEEA 2Q2AA 2F7AA 3U8QA 3VLVA 1II5A 3JZJA 4NWCA 2DXYA 4NMYA 1QUIA 3S2VA 4H65A 1Q35A 3B6QA 1JEUA 2AIXA 3THIA 5H8QA 2E1SA 3A3UA 1B52A 4NEDA 3VXCA 2F34A 3KSXA 3N5LA 3N94A 4PP0A 1Z7NE 4QFLA 2GFEA 4FORA 4Q0CA 5L9MA 2V3QA 2RINA 4OESA 1XOCA 2I58A 4R2BA 4G8MA 1TWYA 5ITOA 3MZBA 2RKMA 3K1MA 1NNPA 4IB2A 4OENA 3EHTA 4QSEA 1Y1ZA 4ZEBA 3GBBA 3MVWA 1QUJA 2V3UA 4XXUA 2UVJA 1MQGA 1QKAA 4MF3A 1US5A 1MM7A 2OCUA 1PBQA 3PMWA 2YLNA 4YKKA 3HSTA 3RLFE 3TYHA 2GHBA 4QSCA 1B58A 2Z8FA 5CMBA 1WDNA 2FA7A 1NKXA 3CFZA 3W9WA 2QS1A 1ATGA 3OO7A 3Q28A 2H4IA 3ONMA 1O64A 3K6WA 5ICQA 3T9VA 3DM0A 1VE4A 2XXVA 1D9YA 2UYEA 2DWJA 1SYHA 1FQFA 4UACA 1FQDA 1POY1 4KD5A 3PD8A 2I0BA 5DEXB 3PU5A 5FTIA 4E0WA 1NH7A 3CSGA 3MPKA 3R6UA 1HSLA 2X7QA 5BWJA 2XD3A 3TZAA 3OENA 3EHUA 1B3LA 4OTEA 3QYTA 4HW8A 1CE2A 2I3VA 1HSEA 3K00A 5BUUA 4KCDA 1JW5A 3QSLA 1B5IA 5I2NB 5TPAB 2F78A 3CRBA 1MPDA 3G3IA 1LB9A 1TT1A 4KPTA 2UXAA 1IIWA 4LZ8A 3KJ7A 5L8DA 1B51A 2H98A 2ZNSA 1EH3A 3KGCA 1XT8A 3FASA 5L9OA 2OK2A 4OEVA 1MQHA 2M8CA 3FATA 4IO2A 2UVGA 1A40A 4LONB 4BDQA 1Y9UA 2DYXA 2GRVA 2ZYKA 3MP8A 3K6VA 1A54A 1SQYA 2QS4A 4ESXA 1PB8A 2Q8JA 1S50A 2H99A 4N13A 4C1UA 4LZ7A 1A7LA 1MY3A 1DPEA 3H3GA 1XS5A 1UIUA 1DSNA 2I48A 1UTHA 4FE8A 4F3PA 4H0WA 3UIFA 4RXLA 5AA3A 2DS9A 1SW1A 4R2FA 1IZ1A 4GL8A 1Q1KA 2G29A 2NXOA 4YICA 3TEPA 4HTGA 4PQJA 4G68A 1FCKA 4ONYA 4EF1A 1PB9A 3PPNA 1URGA 4POWA 1PB7A 4YB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6A A;  1ZLQ A;  5A5X B;  3L6H A;  2XXR A;  1AIV A;  3D4C A;  3TTR A;  2XX7 A;  3TAJ A;  3PPP A;  3IB1 A;  1VFD A;  3VDF A;  1D9V A;  4G8N A;  5DVI A;  4EUO A;  1ZTY A;  2F7C A;  3U1O A;  1B40 A;  4GXA A;  3U93 A;  4KR5 A;  3MZ9 A;  3RNN A;  3IOW A;  5EHS A;  5M2V A;  5H8N A;  3V8X B;  2R71 A;  3O2A A;  1JET A;  1H3D A;  2D3I A;  2A5T A;  2PBW A;  1NNF A;  3PPQ A;  2DQV A;  5ITP A;  1MQD A;  1SBP A;  5DYH A;  5I2K A;  3L6G A;  4GVO A;  5DT6 A;  2DWH A;  1B32 A;  2OLB A;  4EDP A;  4R6Y A;  4ECF A;  3PGF A;  2VGQ A;  4ELQ A;  5FHN A;  4O3C A;  4POX A;  4H5G A;  4YKJ A;  1I6A A;  1M5F A;  1LAG E;  3G3J A;  1LAX A;  3W9V A;  4ZEF A;  4ELP A;  1B7H A;  3HN0 A;  1B9J A;  1B0L A;  1FQB A;  2F5X A;  4H5F A;  4O3A A;  4KYD A;  3T9X B;  2Q89 A;  1Y3P A;  1QUL A;  1UTH B;  2B65 A;  3DEL B;  5I57 B;  1GV8 A;  3SET A;  4WED A;  4G68 C;  1MY1 A;  2E0S A;  1SYI A;  4TLL B;  4BDN A;  4F2O A;  2XXY A;  4XKN A;  3LSL A;  3MVX A;  1GVC A;  3ILT B;  1ZU0 A;  3FVK A;  4G68 B;  3FGS A;  4Z0I A;  1N7X A;  2PX1 A;  2HAU A;  1LFH A;  2I0C A;  4R9F A;  4GXS B;  2ESN A;  4X9T A;  5L9S A;  3Q29 A;  3KZG A;  4AB6 A;  1NNK A;  5ELV A;  2V25 A;  5CBR A;  1YTV A;  3MPL A;  3N26 A;  3TQL A;  1MY0 A;  3FVO A;  1MDQ A;  3EPE A;  1NL5 A;  1B1X A;  2HZK A;  4DXC A;  3K4U A;  3TQW A;  2ONK E;  3MVZ A;  5H8N B;  3HV1 A;  5I84 A;  4RK2 A;  2A5T B;  3KN7 A;  4EF2 A;  4F18 A;  3T9H B;  5I2K B;  1NMU A;  3UOR A;  4G8H A;  3E9X A;  3MWB A;  2HXW A;  3FD3 A;  1MM6 A;  4U22 A;  2AL5 A;  1LBB A;  1ZJL A;  3PPO A;  3ECR A;  4RYA A;  2HEU A;  3K0V A;  3PMV A;  2H5Y A;  4HCY A;  4I1D A;  1MY2 A;  3TOD A;  4C1T A;  1B3F A;  1OVT A;  2QPQ A;  3S9L C;  1DTG A;  4GQO A;  1VSO A;  4RNS A;  3B6T A;  1YPN A;  3IAZ A;  3H4Z A;  5CMC A;  4PFY A;  2ZNU A;  3G7W A;  4F3S A;  3KN8 A;  2I6E A;  3FJM A;  2Y7I A;  3O9P A;  2PT2 A;  2XXI A;  4GRK A;  3LSF B;  3RTF B;  2UYF A;  4RJZ A;  5EYF A;  3LUY A;  4F3B A;  1MXW A;  1R9Q A;  5AA4 B;  1URS A;  1OMP A;  3MC2 A;  3PUY E;  2RC7 A;  1JVX A;  1LFI A;  1RKM A;  1VR5 A;  3SEW A;  4I9D A;  3T96 B;  3CSB A;  1P1U A;  4YKP A;  1WOD A;  3OEK A;  5AA2 D;  3RN8 A;  1MY4 A;  1SD3 A;  2D21 A;  5F7V A;  3UP9 A;  1PBP A;  5H8H B;  4PE5 B;  4FEB A;  4XTC Q;  5FTH A;  4LQ2 A;  4H8I A;  3S9E A;  4F39 A;  3M8U A;  2G93 A;  4NF5 B;  3IB2 A;  3W15 C;  1N7W A;  1QKB A;  2FYI A;  3T93 B;  3FXR A;  4WEP A;  4PFT A;  2OWS A;  2R6G E;  1FQC A;  3KSJ A;  5KZT A;  1GTK A;  4OER A;  3ILU B;  4FEC A;  5DVJ A;  4FAT A;  1US4 A;  3N6U A;  3BBR A;  4R9G A;  3IOU A;  4QFP A;  1LB8 A;  4DIG A;  4DDD A;  1PEB A;  4LAT A;  3Q25 A;  4YAH X;  4ELR A;  2YPN A;  3I6V A;  2A5S A;  1MXZ A;  4IGR A;  2RCB A;  3IX1 A;  2AL4 A;  5KCJ A;  4OHN A;  1P99 A;  1EZ9 A;  2VOZ A;  3G3G A;  4QFN A;  1JW4 A;  4HS7 A;  3DLN A;  4OMB A;  3FXQ A;  4GIZ A;  3SEX A;  1B7Z A;  1B7U A;  1R6Z A;  2XX9 A;  5H8Q B;  3F11 A;  3O28 A;  4KI0 E;  1N76 A;  4U1Z A;  4LQ5 A;  1P1N A;  3G3H A;  1BTJ A;  2X7P A;  1FTK A;  2CZL A;  3O66 A;  3PUZ E;  4FJP A;  3BFT A;  2YJP A;  1B05 A;  1MPB A;  2PYY A;  1Y1M A;  4H6D A;  3LBS A;  2Y7R A;  3SKP A;  1R1N A;  3TPA A;  2F35 A;  1MXY A;  4NF8 A;  4E0X A;  1MPC A;  1O7T A;  3FZV A;  3TKD A;  1UTB A;  3IOR A;  4GLI A;  1J1N A;  3GBA A;  3IJX B;  4HCW A;  1IXI A;  5CI5 A;  4JXI A;  3T66 A;  2I3W A;  1MH3 A;  3IL1 B;  4XKQ A;  1IXH A;  1GR2 A;  3UK4 A;  3OO6 A;  2AYS A;  4BDO A;  2DXR A;  2WKY A;  3M3K A;  4U4X A;  1LCF A;  3N6T A;  4UA8 A;  2R9J A;  4R6H A;  4ZE8 A;  3EF7 A;  3C36 A;  1IXC A;  4NTL A;  4NF6 A;  2OJT A;  2ZNT A;  4L17 A;  4DCX A;  1TFA A;  1DMB A;  1A8E A;  1PC3 A;  4JDF A;  4BLA A;  3HHG A;  4R72 A;  1N3X A;  3ZSF A;  3RY3 A;  4IO6 A;  4MLQ A;  5H8F A;  3TCF A;  4BDL A;  4P0G A;  3QXM A;  3QIM A;  2DWI A;  3JYR A;  4XKR A;  2DE4 A;  3MW0 A;  4IY5 A;  2Q88 A;  2P1S A;  1Z7M E;  3RUM A;  3FUZ A;  4OWD A;  1MXU A;  1I6Q A;  3V5A A;  4AB5 A;  1M5E A;  3IOV A;  5KCJ B;  5I59 A;  3PMX A;  4TQU Q;  4EXL A;  1MRP A;  1JEV A;  2P0S A;  1SW4 A;  2BJJ X;  3O6G A;  3A3C A;  1IEJ A;  4F2Q A;  4YKI A;  2ZXT A;  2RC9 A;  1ZMG A;  3VVE A;  1URD A;  3MVY A;  4K3F A;  2PT1 A;  1P1W A;  3PUV E;  2QMW A;  2FNC A;  1H76 A;  3H6V A;  4NF8 B;  1SI1 A;  4Q8R A;  3RGY A;  3OXN A;  5DTB A;  2O7I A;  4JSD A;  5FHO A;  2XXX A;  3VV5 A;  5ISU A;  3FVG A;  4YMA A;  3IR1 A;  2QSX A;  1KWH A;  4PFU A;  4ZEK A;  3T22 A;  3H6T A;  4RK9 A;  3V83 A;  2REJ A;  1AMF A;  4MFI A;  1SW5 A;  3K6X A;  1FTM A;  1ANF A;  1A8F A;  4YB5 A;  4DXU A;  3MQ9 A;  3C4M A;  3C32 A;  3OOA A;  3B6W A;  1SDX A;  1LFG A;  3OD7 A;  3KFM A;  1OLC A;  5I58 A;  2HZL A;  2O68 A;  3MP6 A;  4X1B A;  3TDJ A;  2O84 X;  2Y7W A;  4F3G A;  4RY1 A;  4IO7 A;  4P11 A;  1VFE A;  4EXK A;  1CB6 A;  1DPP A;  2ZYN A;  3TUS A;  1I69 A;  1XHY A;  5CRY A;  2HFB A;  5TP9 A;  4RA1 A;  2XXQ A;  3SER A;  1N84 A;  5H8F B;  1MXX A;  4WKM A;  1LBC A;  5K2X A;  1NFT A;  3CR9 A;  1LST A;  4IO3 A;  3CVG A;  3K01 A;  4R74 A;  2I4C A;  3CFL A;  4FAJ A;  2Y7K A;  4C0R A;  3SES A;  2XHD A;  1H43 A;  1MS7 A;  4I8C A;  4QSD A;  5CMK A;  1PDA A;  3JV9 A;  4O3B A;  5I59 B;  1S9T A;  4YZZ A;  4OET A;  2W7Y A;  1B3H A;  5AA2 A;  1L5T A;  2VP1 A;  4LA9 A;  2VD2 A;  5CBS A;  1M5D A;  2XXH A;  3KJT A;  5K2Y A;  1DOT A;  1OQG A;  3VXB A;  3R7X A;  1XVX A;  3RQT A;  1EU8 A;  3BKI B;  3U72 A;  1JQF A;  2HCA A;  3KBR A;  1B5H A;  4IO4 A;  3USD A;  3EQ1 A;  1A99 A;  2D5W A;  2F36 A;  1B5J A;  3D4G A;  3FV2 A;  1SW2 A;  2UVH A;  1B1H A;  3FJG A;  3O6H A;  2THI A;  4KHZ E;  4GD5 A;  4YMB A;  2Y84 A;  3I5O A;  3CFX A;  1B4Z A;  3VVD A;  1BLF A;  3MJN A;  3VE1 B;  1Y4T A;  3HCQ A;  2Q9T A;  1RYX A;  3CG3 A;  5DEX A;  3AXF A;  4F22 A;  4QF9 A;  4OFL A;  4KCC A;  2DOJ A;  1MG1 A;  3ODB A;  1R9L A;  2XXP A;  1POT A;  2LAO A;  3GLB A;  3VLW A;  3C31 A;  5J1D A;  3V89 B;  3GXA A;  3ZS6 A;  3OO9 A;  4DXB A;  3LC8 A;  2NVU B;  2ALU A;  1QJM A;  5TP9 B;  1ZIU A;  1OIB A;  2HAV A;  3P7I A;  1ZBM A;  2ZMB A;  2Y7P A;  1FQA A;  1N04 A;  3H06 B;  1BP5 A;  3B7D A;  3U94 A;  5I2N A;  3KOS A;  5TPA A;  2VD3 A;  4F29 A;  3S4U A;  2Z8D A;  1OLA A;  1TXF A;  5LOM A;  3O6I A;  4I62 A;  1A55 A;  2ZYM A;  4X1D A;  1MQI A;  2QRY A;  2QS3 A;  4F1U A;  2XXT A;  4IGT A;  3Q27 A;  4H8J A;  4OVJ A;  4R75 A;  2NWJ A;  1FW0 A;  1N0T A;  1B3E A;  5AA2 B;  4EQB A;  1FQE A;  4GOT A;  3S9M C;  5H8S A;  1UQW A;  1LLS A;  3PD9 A;  4XKP A;  4QRZ A;  3FV1 A;  4NF4 A;  4KFQ A;  3K02 A;  1LCT A;  1MH4 A;  1S7Y A;  3O29 A;  4MLV A;  5EHM A;  2XXW A;  3SEY A;  5DVF A;  2DP8 A;  4YB6 A;  4ZED A;  3LSW A;  1MXV A;  1MQJ A;  2REG A;  2O1L A;  2IA4 A;  4U23 A;  2F6P A;  1M5B A;  4OFJ A;  2GHA A;  2DVC A;  4TOZ A;  4MH5 A;  4KQP A;  1Y3N A;  3C9H A;  2RF1 A;  3M3L A;  3EN3 A;  4ZZE A;  5B70 A;  4PET A;  4M4G A;  5HBC A;  2VHA A;  5CC2 A;  3K6U A;  2O69 A;  3IK6 B;  4OFO A;  1XC1 A;  5JTY A;  3MAM A;  3H6W A;  2ANJ A;  2DE2 A;  3RTW B;  4LUB A;  3RPW A;  5JEI A;  4NWD A;  1OVB A;  1H44 A;  4DLD A;  3Q26 A;  4Z7E A;  4JWX A;  3HO7 A;  5A5X A;  2ABH A;  2NUV A;  3DP6 A;  1FTJ A;  3LSX A;  1B3G A;  4GWO A;  3OMB A;  3S9N C;  1FTO A;  1B0H A;  3U92 A;  3LR1 A;  1YCJ A;  4QHQ A;  4WXJ A;  1TFD A;  4ISU A;  2KLF A;  3FVN A;  1FTL A;  1H45 A;  2DVZ A;  1EZO A;  2QJE A;  2NOO A;  3OSR A;  2Q2C A;  2DE3 A;  4ESW A;  4AQ4 A;  2X26 A;  1JNF A;  1YAE A;  2PVU A;  2Z22 A;  4X48 A;  3RT8 A;  2V84 A;  1IQ7 A;  1D4N A;  4YU0 A;  3I3V A;  4RPO A;  3VVF A;  1Y4C A;  3UN6 A;  4NF4 B;  5HM4 B;  4FIM A;  3QUJ A;  4R73 A;  2F6G A;  2ONR A;  4KYS A;  2DSF A;  4IO5 A;  3KEI A;  1ELJ A;  5KDT A;  1F9B A;  2QMX A;  2GH9 A;  5TU0 A;  4MBP A;  2F97 A;  4ZZA A;  5I56 A;  3TCH A;  3OEM A;  5CMM A;  5HPQ A;  1QUK A;  4OXV A;  4JWO A;  3DP4 A;  4F1V A;  5AE4 A;  3OSQ A;  4ZEC A;  3ZKL A;  3C35 A;  3G3K A;  3VFJ A;  4ELO A;  5I57 A;  4XIG Q;  4BDM A;  3MUQ A;  4Q5T A;  3T9U A;  3UA8 A;  1IXG A;  3HHF A;  4F1Y A;  1LGB C;  3FIR A;  4P0I A;  5JTY B;  2F8D A;  3GZG A;  4LZ5 A;  2HQ0 A;  1Y20 A;  2XX8 A;  3IOT A;  1AOV A;  1RYO A;  1LAF E;  4ZEI A;  5IKB A;  3PUW E;  3IO6 A;  4DZ1 A;  1USY H;  1LAH E;  4ZE9 A;  4F19 A;  4JB7 A;  4QFO A;  2Z23 A;  3E3K A;  1MDP 1;  3R26 A;  1Y3Q A;  1P1Q A;  3C34 A;  4F31 B;  1JW1 A;  3K1P A;  1T0K A;  3PPR A;  2B3F A;  4G4P A;  2Z8E A;  4DE8 A;  1UIV A;  4U2R A;  5IAI A;  4IY6 A;  3TTL A;  2H9B A;  4NE4 A;  3G3F A;  5F1Q A;  3H03 A;  1I6B A;  1UTB B;  1OQH A;  4U21 A;  1SVX B;  3CI8 A;  3ZKK A;  3E13 X;  4KYE A;  3MZ1 A;  3SEU A;  4R6K A;  5JK4 A;  1BIY A;  4G77 A;  1SI0 A;  3H6U A;  1B2H A;  3SEV A;  3WAE A;  1HSJ A;  4N07 A;  3E4R A;  4N6P A;  2DWA A;  3H7M A;  3QAX A;  1QVS A;  1IUD A;  3EHS A;  3M3F A;  3UGW A;  2XXU A;  2RC8 A;  1EZP A;  1AL3 A;  1ZKB A;  2ONS A;  3A09 A;  3TFL A;  1IIT A;  2O1M A;  3FJ7 A;  3IO4 A;  2PMS A;  3KN3 A;  4NF6 B;  4RPN A;  5KDT B;  1D3K A;  4QFK A;  3HPI A;  3KG2 A;  4G2Z A;  2V93 A;  5I56 B;  1WVJ A;  3VLU A;  2QL3 A;  3OO8 A;  4M1V A;  1P1O A;  4U4S A;  3C33 A;  4OYV A;  3IJO B;  2O51 A;  3SDF A;  4BDR A;  3TCG A;  3MBP A;  1AH5 A;  3TTN A;  3IB0 A;  1B4H A;  5AA4 A;  3RT6 B;  1O63 A;  3K1N A;  4JSO A;  4OQO A;  4GF8 A;  1B46 A;  2XD2 A;  4JWY A;  2ZYO A;  1M5C A;  1DTZ A;  1QW0 A;  1GGG A;  4Q30 B;  3MP1 A;  4OZ9 A;  3OEL A;  3K2D A;  2F7B A;  4EQ7 A;  4ZDM A;  3O97 A;  4ND9 A;  3FXU A;  5H8H A;  4LVQ A;  3TEL A;  4EQ9 A;  3PUX E;  1JVY A;  4JBZ A;  4GL0 A;  2O7U A;  4NF5 A;  3TTK A;  4OEU A;  4TLM B;  5B7D A;  4DCY A;  5CM6 A;  1BKA A;  3PV0 E;  4FED A;  1NH8 A;  4LP2 B;  1B6H A;  2B3B A;  2P2A A;  2QS2 A;  1USY E;  4THI A;  3QK6 A;  4GFR A;  2H25 A;  2I49 A;  3QUF A;  3CG1 A;  3BFU A;  5FHM A;  1N3W A;  3KOT A;  2OWT A;  1XVY A;  5AA1 A;  4H67 A;  3DP8 A;  2UVI A;  2I4B A;  5ICT A;  3TTM A;  2CMO A;  4PFW A;  2V3T A;  4H1X A;  2RCA A;  3TMG A;  2OBG A;  3WAF A;  5I58 B;  1NNT A;  3CIJ A;  4U1O A;  2OZZ A;  4ZS9 A;  2IEE A;  2Q2A A;  2F7A A;  3U8Q A;  3VLV A;  1II5 A;  3JZJ A;  4NWC A;  2DXY A;  4NMY A;  1QUI A;  3S2V A;  4H65 A;  1Q35 A;  3B6Q A;  1JEU A;  2AIX A;  3THI A;  5H8Q A;  2E1S A;  3A3U A;  1B52 A;  4NED A;  3VXC A;  2F34 A;  3KSX A;  3N5L A;  3N94 A;  4PP0 A;  1Z7N E;  4QFL A;  2GFE A;  4FOR A;  4Q0C A;  5L9M A;  2V3Q A;  2RIN A;  4OES A;  1XOC A;  2I58 A;  4R2B A;  4G8M A;  1TWY A;  5ITO A;  3MZB A;  2RKM A;  3K1M A;  1NNP A;  4IB2 A;  4OEN A;  3EHT A;  4QSE A;  1Y1Z A;  4ZEB A;  3GBB A;  3MVW A;  1QUJ A;  2V3U A;  4XXU A;  2UVJ A;  1MQG A;  1QKA A;  4MF3 A;  1US5 A;  1MM7 A;  2OCU A;  1PBQ A;  3PMW A;  2YLN A;  4YKK A;  3HST A;  3RLF E;  3TYH A;  2GHB A;  4QSC A;  1B58 A;  2Z8F A;  5CMB A;  1WDN A;  2FA7 A;  1NKX A;  3CFZ A;  3W9W A;  2QS1 A;  1ATG A;  3OO7 A;  3Q28 A;  2H4I A;  3ONM A;  1O64 A;  3K6W A;  5ICQ A;  3T9V A;  3DM0 A;  1VE4 A;  2XXV A;  1D9Y A;  2UYE A;  2DWJ A;  1SYH A;  1FQF A;  4UAC A;  1FQD A;  1POY 1;  4KD5 A;  3PD8 A;  2I0B A;  5DEX B;  3PU5 A;  5FTI A;  4E0W A;  1NH7 A;  3CSG A;  3MPK A;  3R6U A;  1HSL A;  2X7Q A;  5BWJ A;  2XD3 A;  3TZA A;  3OEN A;  3EHU A;  1B3L A;  4OTE A;  3QYT A;  4HW8 A;  1CE2 A;  2I3V A;  1HSE A;  3K00 A;  5BUU A;  4KCD A;  1JW5 A;  3QSL A;  1B5I A;  5I2N B;  5TPA B;  2F78 A;  3CRB A;  1MPD A;  3G3I A;  1LB9 A;  1TT1 A;  4KPT A;  2UXA A;  1IIW A;  4LZ8 A;  3KJ7 A;  5L8D A;  1B51 A;  2H98 A;  2ZNS A;  1EH3 A;  3KGC A;  1XT8 A;  3FAS A;  5L9O A;  2OK2 A;  4OEV A;  1MQH A;  2M8C A;  3FAT A;  4IO2 A;  2UVG A;  1A40 A;  4LON B;  4BDQ A;  1Y9U A;  2DYX A;  2GRV A;  2ZYK A;  3MP8 A;  3K6V A;  1A54 A;  1SQY A;  2QS4 A;  4ESX A;  1PB8 A;  2Q8J A;  1S50 A;  2H99 A;  4N13 A;  4C1U A;  4LZ7 A;  1A7L A;  1MY3 A;  1DPE A;  3H3G A;  1XS5 A;  1UIU A;  1DSN A;  2I48 A;  1UTH A;  4FE8 A;  4F3P A;  4H0W A;  3UIF A;  4RXL A;  5AA3 A;  2DS9 A;  1SW1 A;  4R2F A;  1IZ1 A;  4GL8 A;  1Q1K A;  2G29 A;  2NXO A;  4YIC A;  3TEP A;  4HTG A;  4PQJ A;  4G68 A;  1FCK A;  4ONY A;  4EF1 A;  1PB9 A;  3PPN A;  1URG A;  4POW A;  1PB7 A;  4YB7 A; 
#chains in the Genus database with same CATH topology
 2O6A A;  1ZLQ A;  5A5X B;  3L6H A;  2XXR A;  1AIV A;  5I5P A;  3D4C A;  3TTR A;  2XX7 A;  3TAJ A;  3PPP A;  3IB1 A;  1VFD A;  3VDF A;  1IMA A;  1D9V A;  4G8N A;  5DVI A;  4EUO A;  1ZTY A;  2F7C A;  3U1O A;  1B40 A;  4GXA A;  3U93 A;  4KR5 A;  3U65 A;  3MZ9 A;  3RNN A;  3IOW A;  5EHS A;  5M2V A;  5H8N A;  1IMB A;  3V8X B;  2R71 A;  3O2A A;  1JET A;  1H3D A;  2D3I A;  2A5T A;  2PBW A;  1NNF A;  4PFI A;  3PPQ A;  5IGA A;  2DQV A;  5ITP A;  1MQD A;  1SBP A;  5DYH A;  5I2K A;  3L6G A;  4GVO A;  2VPO A;  5DT6 A;  2DWH A;  4XF5 A;  1B32 A;  2OLB A;  3QMF A;  4FBP A;  4EDP A;  4R6Y A;  4ECF A;  3PGF A;  2VGQ A;  4ELQ A;  5FHN A;  4O3C A;  4POX A;  4H5G A;  2VPN A;  3NOH A;  4YKJ A;  5EQ7 A;  2B4M A;  1I6A A;  1M5F A;  1LAG E;  3G3J A;  1LAX A;  3W9V A;  2FVZ A;  4PE3 A;  4ZEF A;  4ELP A;  1B7H A;  3HN0 A;  3PTY A;  1B9J A;  1B0L A;  1FQB A;  2F5X A;  4H5F A;  4O3A A;  4KYD A;  2XWV A;  3T9X B;  4GWX A;  2Q89 A;  1Y3P A;  1QUL A;  1UTH B;  2B65 A;  3DEL B;  1NV0 A;  5I57 B;  1GV8 A;  3SET A;  4WED A;  4G68 C;  1MY1 A;  2E0S A;  2MKZ A;  1SYI A;  4TLL B;  4BDN A;  4F2O A;  2XXY A;  4XKN A;  3LSL A;  3MVX A;  1GVC A;  3ILT B;  1ZU0 A;  3FVK A;  4G68 B;  3FGS A;  4MNC A;  4Z0I A;  1N7X A;  2PX1 A;  4PTK A;  2HAU A;  4AS4 A;  4PGP A;  1LFH A;  2I0C A;  4GX6 A;  4R9F A;  4GXS B;  2ESN A;  1FBP A;  4PBH A;  3E78 A;  4X9T A;  5L9S A;  3Q29 A;  3KZG A;  4AB6 A;  1NNK A;  5ELV A;  2V25 A;  5CBR A;  1YTV A;  3MPL A;  3N26 A;  3TQL A;  1MY0 A;  3FVO A;  1MDQ A;  4PAF A;  2P3V A;  3EPE A;  3MST A;  2XWK A;  1NL5 A;  1B1X A;  2HZK A;  4DXC A;  3K4U A;  3TQW A;  4PBQ A;  2ONK E;  3MVZ A;  5H8N B;  3HV1 A;  5I84 A;  4HXV A;  4RK2 A;  2A5T B;  3KN7 A;  4EF2 A;  4F18 A;  3BIH A;  3T9H B;  5I2K B;  1NMU A;  3UOR A;  4G8H A;  3E9X A;  3MWB A;  2HXW A;  3FD3 A;  4G61 A;  4GWZ A;  1MM6 A;  5IZ1 A;  4U22 A;  2AL5 A;  1LBB A;  2JJK A;  1ZJL A;  3PPO A;  3ECR A;  4RYA A;  2HEU A;  3K0V A;  3PMV A;  2H5Y A;  4PCD A;  4HCY A;  4I1D A;  1MY2 A;  3TOD A;  4C1T A;  1B3F A;  1OVT A;  2QPQ A;  1NUY A;  3S9L C;  2FIE A;  1DTG A;  4GQO A;  1VSO A;  5I7I A;  4RNS A;  3B6T A;  1YPN A;  3IAZ A;  3H4Z A;  5CMC A;  4PFY A;  2ZNU A;  3G7W A;  4F3S A;  3KN8 A;  2I6E A;  3FJM A;  2Y7I A;  3O9P A;  2PT2 A;  2XXI A;  2WEF A;  4GRK A;  3LSF B;  4P56 A;  3RTF B;  2UYF A;  4RJZ A;  5EYF A;  2Y5L A;  3LUY A;  4F3B A;  2HPG A;  1MXW A;  1R9Q A;  5AA4 B;  1URS A;  1OMP A;  1KZ8 A;  3MC2 A;  3PUY E;  2RC7 A;  4O7M A;  1JVX A;  2WBD A;  1LFI A;  1RKM A;  1VR5 A;  3SEW A;  4XFE A;  4I9D A;  3T96 B;  3CSB A;  1P1U A;  4YKP A;  4NF0 A;  1WOD A;  3OEK A;  4X04 A;  5AA2 D;  3RN8 A;  2HHM A;  1MY4 A;  1SD3 A;  2D21 A;  5F7V A;  3UP9 A;  1PBP A;  4OA4 A;  5H8H B;  4PE5 B;  4FEB A;  4XTC Q;  5FTH A;  4LQ2 A;  4H8I A;  3S9E A;  4F39 A;  3M8U A;  2G93 A;  4NF5 B;  3IB2 A;  3W15 C;  4GWY A;  4MIJ A;  1N7W A;  1QKB A;  2FYI A;  3T93 B;  3FXR A;  4WEP A;  4PFT A;  2OWS A;  2R6G E;  1FQC A;  3KSJ A;  5KZT A;  1DCU A;  1GTK A;  4OER A;  3ILU B;  4FEC A;  5DVJ A;  4FAT A;  3LV0 A;  1US4 A;  4PAK A;  3N6U A;  3KC1 A;  3BBR A;  2WX9 A;  4R9G A;  3IOU A;  4QFP A;  1LB8 A;  4DIG A;  2QVU A;  4DDD A;  1LBV A;  1PEB A;  1NUW A;  4OAN A;  2QFL A;  2PFY A;  4LAT A;  3Q25 A;  4YAH X;  2CZI A;  4ELR A;  1YYZ A;  1RDZ A;  2YPN A;  3I6V A;  2A5S A;  1MXZ A;  4IGR A;  4NX1 A;  2RCB A;  3IX1 A;  5ET8 A;  2AL4 A;  5KCJ A;  4OHN A;  1P99 A;  1EZ9 A;  4N17 A;  4MMP A;  2VOZ A;  3G3G A;  4QFN A;  1JW4 A;  4HS7 A;  3DLN A;  4H46 A;  4OMB A;  3FXQ A;  2ZZV A;  1Q9D A;  4GIZ A;  3SEX A;  1B7Z A;  1B7U A;  1R6Z A;  2XX9 A;  5H8Q B;  3F11 A;  3O28 A;  4KI0 E;  1N76 A;  4U1Z A;  4LQ5 A;  1FBF A;  1NUX A;  1P1N A;  3G3H A;  1BTJ A;  4JVC A;  2X7P A;  1FTK A;  2CZL A;  3O66 A;  3PUZ E;  4FJP A;  3BFT A;  2YJP A;  1B05 A;  1MPB A;  2PYY A;  1Y1M A;  4H6D A;  3LBS A;  2Y7R A;  3SKP A;  1R1N A;  3TPA A;  2F35 A;  1MXY A;  4NAP A;  4NF8 A;  4E0X A;  1MPC A;  1O7T A;  2WYK A;  3FZV A;  3TKD A;  1UTB A;  4MEV A;  3IOR A;  4GLI A;  1J1N A;  3GBA A;  3IJX B;  4HCW A;  5IZ3 A;  1IXI A;  4N4U A;  5ET5 A;  2R8T A;  5CI5 A;  2F3B A;  4JXI A;  3T66 A;  2I3W A;  1MH3 A;  3IL1 B;  4XKQ A;  1IXH A;  1GR2 A;  3UK4 A;  4OVT A;  2QVR A;  1FJ6 A;  4I3Y A;  3OO6 A;  2AYS A;  4BDO A;  2DXR A;  2WKY A;  3M3K A;  4U4X A;  4O7I A;  1LCF A;  3N6T A;  1CNQ A;  4UA8 A;  2R9J A;  4R6H A;  4ZE8 A;  5IZZ A;  2OWZ A;  4N91 A;  3EF7 A;  3C36 A;  1IXC A;  4NTL A;  4NF6 A;  2OJT A;  2ZNT A;  1K9Z A;  1FRP A;  4L17 A;  4DCX A;  3D1R A;  1TFA A;  1AWB A;  1DMB A;  2CEX A;  1A8E A;  1PC3 A;  4JDF A;  4PAI A;  4BLA A;  3HHG A;  1NV5 A;  4X8R A;  4R72 A;  1N3X A;  3ZSF A;  3RY3 A;  4IO6 A;  4MLQ A;  5H8F A;  3TCF A;  4BDL A;  5A5L A;  1FBE A;  4P0G A;  3QXM A;  3QIM A;  2DWI A;  3JYR A;  4XKR A;  2DE4 A;  3MW0 A;  1IMC A;  4IY5 A;  2Q88 A;  2P1S A;  2BJI A;  1Z7M E;  3RUM A;  2Q8M A;  3FUZ A;  4OWD A;  1MXU A;  1I6Q A;  3V5A A;  1FPB A;  4AB5 A;  1M5E A;  3IOV A;  5KCJ B;  5I59 A;  3PMX A;  4TQU Q;  2GQ1 A;  4EXL A;  1MRP A;  1JEV A;  4MJO A;  2P0S A;  1SW4 A;  4AS5 A;  2BJJ X;  2V4C A;  3O6G A;  4O94 A;  3A3C A;  1IEJ A;  4F2Q A;  4YKI A;  2ZXT A;  2RC9 A;  1ZMG A;  4GX3 A;  3VVE A;  1URD A;  4PF8 A;  3MVY A;  4K3F A;  4MHF A;  2PT1 A;  3RYD A;  1YXI A;  4MCO A;  1P1W A;  2XXK A;  3PUV E;  2QMW A;  2FNC A;  1H76 A;  3H6V A;  4NF8 B;  1SI1 A;  4Q8R A;  3RGY A;  3OXN A;  4GWW A;  5DTB A;  1JP4 A;  2O7I A;  4JSD A;  5FHO A;  2XXX A;  3VV5 A;  4IR8 A;  5ISU A;  5LTC A;  3FVG A;  4YMA A;  3IR1 A;  2QSX A;  1KWH A;  4HE1 A;  4PFU A;  4ZEK A;  3T22 A;  3H6T A;  4RK9 A;  3V83 A;  2REJ A;  1AMF A;  1FBH A;  4MFI A;  1SW5 A;  3K6X A;  1FTM A;  3RPL A;  1ANF A;  1A8F A;  4YB5 A;  4DXU A;  4N6K A;  3MQ9 A;  3C4M A;  2XA5 A;  3C32 A;  3OOA A;  3B6W A;  1SDX A;  1LFG A;  3OD7 A;  3KFM A;  1OLC A;  5I58 A;  2HZL A;  2O68 A;  2FIX A;  3MP6 A;  4X1B A;  3TDJ A;  2O84 X;  2Y7W A;  4F3G A;  4RY1 A;  4IO7 A;  4P11 A;  1VFE A;  1CB6 A;  4EXK A;  1DPP A;  2ZYN A;  3TUS A;  1I69 A;  3HFU A;  1XHY A;  5CRY A;  2HFB A;  5TP9 A;  4RA1 A;  2XXQ A;  1FPK A;  3SER A;  1N84 A;  5H8F B;  1MXX A;  4WKM A;  1LBC A;  5K2X A;  4N8G A;  1IMF A;  2P3N A;  1NFT A;  3CR9 A;  4OVP A;  1LST A;  4IO3 A;  3CVG A;  4HE0 A;  3K01 A;  4R74 A;  4QBA A;  2I4C A;  3CFL A;  4FAJ A;  2Y7K A;  4C0R A;  3SES A;  2XHD A;  1H43 A;  1MS7 A;  2L5V A;  4I8C A;  4QSD A;  5CMK A;  1PDA A;  3JV9 A;  4O3B A;  5I59 B;  1S9T A;  4YZZ A;  4OET A;  2W7Y A;  1B3H A;  5AA2 A;  1L5T A;  1NV7 A;  2VP1 A;  4LA9 A;  1D9Q A;  2VD2 A;  5CBS A;  2ZZX A;  1M5D A;  4OVR A;  2XXH A;  3KJT A;  5K2Y A;  1DOT A;  1OQG A;  3VXB A;  3R7X A;  1XVX A;  3RQT A;  1EU8 A;  4UAB A;  3BKI B;  3U72 A;  1JQF A;  2HCA A;  4PF6 A;  2CEY A;  3KBR A;  1B5H A;  4IO4 A;  3USD A;  3EQ1 A;  4P47 A;  1FPE A;  1A99 A;  2D5W A;  2F36 A;  1B5J A;  3D4G A;  1FSA A;  3FV2 A;  1SW2 A;  2UVH A;  1B1H A;  1FPI A;  3FJG A;  3O6H A;  2THI A;  4KHZ E;  4GD5 A;  4YMB A;  2Y84 A;  3I5O A;  3CFX A;  5FBP A;  1B4Z A;  3VVD A;  1BLF A;  3MJN A;  3VE1 B;  1Y4T A;  3HCQ A;  2Q9T A;  5T3J A;  1NV3 A;  1RYX A;  3CG3 A;  5DEX A;  3AXF A;  4F22 A;  2OX3 A;  4QF9 A;  4OFL A;  4KCC A;  4QXD A;  2DOJ A;  1MG1 A;  3ODB A;  1R9L A;  2XXP A;  3FBP A;  3IFA A;  1POT A;  2LAO A;  3GLB A;  5J16 A;  1XI6 A;  3VLW A;  3C31 A;  5J1D A;  3V89 B;  3GXA A;  3ZS6 A;  3OO9 A;  4DXB A;  3LC8 A;  2NVU B;  2ALU A;  1QJM A;  5TP9 B;  1ZIU A;  1OIB A;  2HAV A;  3P7I A;  1ZBM A;  3LUZ A;  1K9Y A;  2ZMB A;  2Y7P A;  1FQA A;  1N04 A;  3H06 B;  1BP5 A;  3B7D A;  3U94 A;  5I2N A;  3KOS A;  5TPA A;  1EYK A;  2VD3 A;  4F29 A;  3S4U A;  2Z8D A;  1OLA A;  1TXF A;  5LOM A;  3O6I A;  4I62 A;  1A55 A;  3E79 A;  2ZYM A;  4X1D A;  1MQI A;  2QRY A;  2QS3 A;  4F1U A;  2XXT A;  4IGT A;  3Q27 A;  4H8J A;  4OVJ A;  4R75 A;  2NWJ A;  1FW0 A;  1N0T A;  1B3E A;  4NQ8 A;  5AA2 B;  4EQB A;  1FQE A;  4GOT A;  1FBG A;  1LBZ A;  3S9M C;  5H8S A;  1UQW A;  1LLS A;  3PD9 A;  4XKP A;  4GBV A;  4QRZ A;  3FV1 A;  5EYG A;  4NF4 A;  4KFQ A;  3K02 A;  1LCT A;  1MH4 A;  1G0H A;  1S7Y A;  3O29 A;  4MLV A;  5EHM A;  2XXW A;  3SEY A;  5DVF A;  4NN3 A;  2DP8 A;  4YB6 A;  3B8B A;  4ZED A;  3LSW A;  1LBW A;  1MXV A;  1MQJ A;  2REG A;  2O1L A;  2IA4 A;  4U23 A;  4JVI A;  2F6P A;  1M5B A;  4OFJ A;  5ET6 A;  2GHA A;  2DVC A;  4TOZ A;  4MH5 A;  5LDZ A;  4KQP A;  1Y3N A;  3C9H A;  2RF1 A;  3M3L A;  1G0I A;  3EN3 A;  4ZZE A;  5B70 A;  4PET A;  4M4G A;  5HBC A;  2VHA A;  4N15 A;  5CC2 A;  3K6U A;  2O69 A;  3IK6 B;  4OFO A;  1XC1 A;  5JTY A;  3MAM A;  3H6W A;  2ANJ A;  2DE2 A;  3RTW B;  4LUB A;  3RPW A;  5JEI A;  4NWD A;  1OVB A;  1H44 A;  4DLD A;  3Q26 A;  4Z7E A;  4JWX A;  3T1B A;  3HO7 A;  5A5X A;  3KC0 A;  1FPL A;  2ABH A;  2NUV A;  3DP6 A;  1FTJ A;  4DI3 D;  2FBP A;  3LSX A;  1B3G A;  4GWO A;  2Q74 A;  3OMB A;  3S9N C;  1FTO A;  1B0H A;  3U92 A;  2CZK A;  3LR1 A;  1YCJ A;  4HE2 A;  3EKI A;  4QHQ A;  4WXJ A;  1FPD A;  1TFD A;  4ISU A;  2KLF A;  1FJ9 A;  3FVN A;  5EYH A;  1FTL A;  1H45 A;  2DVZ A;  1EZO A;  2QJE A;  2NOO A;  3OSR A;  2Q2C A;  2DE3 A;  4ESW A;  4AQ4 A;  2X26 A;  1JNF A;  1YAE A;  2PVU A;  2Z22 A;  4X48 A;  3RT8 A;  2V84 A;  1IQ7 A;  1D4N A;  4YU0 A;  3I3V A;  4RPO A;  1RDX A;  3VVF A;  1Y4C A;  3UN6 A;  4NF4 B;  5HM4 B;  4FIM A;  3QUJ A;  4R73 A;  2F6G A;  2ONR A;  4KYS A;  1LBY A;  2DSF A;  4IO5 A;  3KEI A;  1DBZ A;  1ELJ A;  5KDT A;  1F9B A;  1VDW A;  2QMX A;  2GH9 A;  5TU0 A;  4MBP A;  2F97 A;  4ZZA A;  5I56 A;  3TCH A;  2WBB A;  4P8B A;  3OEM A;  5CMM A;  5HPQ A;  1QUK A;  4OXV A;  4JWO A;  3DP4 A;  4F1V A;  5AE4 A;  4GBW A;  3OSQ A;  4ZEC A;  3ZKL A;  3C35 A;  3G3K A;  3VFJ A;  4XEQ A;  4ELO A;  5I57 A;  4XIG Q;  4BDM A;  3MUQ A;  4Q5T A;  3T9U A;  4MNI A;  4I3E A;  3UA8 A;  1IXG A;  3HHF A;  4F1Y A;  1LGB C;  4OVQ A;  3FIR A;  4P0I A;  1FBC A;  4PDD A;  5JTY B;  2F8D A;  3GZG A;  4LZ5 A;  2HQ0 A;  1Y20 A;  2XX8 A;  3IOT A;  1AOV A;  1RYO A;  4N6D A;  1LAF E;  4ZEI A;  5IKB A;  3PUW E;  3IO6 A;  4DZ1 A;  1USY H;  1LAH E;  4ZE9 A;  4F19 A;  4JB7 A;  4QFO A;  2Z23 A;  3E3K A;  1MDP 1;  3R26 A;  1Y3Q A;  1P1Q A;  3C34 A;  4F31 B;  1JW1 A;  3K1P A;  1T0K A;  3PPR A;  4NHB A;  2B3F A;  4G4P A;  2Z8E A;  4P1L A;  4DE8 A;  1UIV A;  4U2R A;  5IAI A;  4IY6 A;  4GWS A;  3TTL A;  2H9B A;  4NE4 A;  3G3F A;  5F1Q A;  3H03 A;  3T0J A;  2XWO A;  1I6B A;  1UTB B;  1OQH A;  4U21 A;  1SVX B;  3CI8 A;  3ZKK A;  5IM2 A;  3E13 X;  4KYE A;  5IZ3 B;  3MZ1 A;  3SEU A;  4R6K A;  5JK4 A;  2XWI A;  1BIY A;  4OVS A;  4G77 A;  1SI0 A;  3H6U A;  1B2H A;  3SEV A;  3WAE A;  1HSJ A;  4N07 A;  4N81 A;  3E4R A;  4N6P A;  4N8Y A;  5EQ9 A;  2DWA A;  3H7M A;  3QAX A;  4PFR A;  1QVS A;  1IUD A;  3EHS A;  3M3F A;  3UGW A;  2XXU A;  2RC8 A;  1EZP A;  1AL3 A;  1ZKB A;  2ONS A;  3A09 A;  3TFL A;  4O8M A;  1IIT A;  2O1M A;  3FJ7 A;  3IO4 A;  2PMS A;  3KN3 A;  4NF6 B;  4RPN A;  4PDH A;  5KDT B;  1D3K A;  4QFK A;  3HPI A;  3KG2 A;  4G2Z A;  1KA1 A;  3SZP A;  2V93 A;  5I56 B;  1WVJ A;  5ET7 A;  2FHY A;  3VLU A;  2QL3 A;  3OO8 A;  4M1V A;  1FPJ A;  1P1O A;  3ISP A;  4U4S A;  3C33 A;  4P1E A;  2PCR A;  4OYV A;  3IJO B;  2O51 A;  3SDF A;  4BDR A;  3TCG A;  3MBP A;  1NI9 A;  1AH5 A;  3TTN A;  3IB0 A;  1BK4 A;  1B4H A;  5AA4 A;  3RT6 B;  1O63 A;  3K1N A;  4JSO A;  4OQO A;  4DI4 B;  4GF8 A;  1B46 A;  2XD2 A;  4JWY A;  1IME A;  2ZYO A;  1M5C A;  1DTZ A;  1QW0 A;  1GGG A;  4Q30 B;  4PGN A;  4NG7 A;  3MP1 A;  4OZ9 A;  3OEL A;  3K2D A;  2F7B A;  2VT5 A;  4EQ7 A;  4ZDM A;  1FTA A;  1SPI A;  3O97 A;  4ND9 A;  4KXP A;  3FXU A;  5H8H A;  4LVQ A;  3TEL A;  4EQ9 A;  3PUX E;  1JVY A;  4JBZ A;  4GL0 A;  2O7U A;  3KBZ A;  4NF5 A;  3TTK A;  4OEU A;  4TLM B;  5B7D A;  4MX6 A;  3A29 A;  4DCY A;  5CM6 A;  1BKA A;  3PV0 E;  4FED A;  1NH8 A;  4LP2 B;  1B6H A;  2B3B A;  2P2A A;  2QS2 A;  3ROJ A;  1USY E;  4THI A;  3QK6 A;  3CHG A;  1NV2 A;  5I3S A;  4GFR A;  4H45 A;  2H25 A;  2I49 A;  3QUF A;  3IFC A;  3CG1 A;  3B50 A;  3BFU A;  5FHM A;  1N3W A;  3KOT A;  2OWT A;  1XVY A;  5AA1 A;  4H67 A;  3DP8 A;  2UVI A;  2I4B A;  3RPL B;  5ICT A;  3TTM A;  2CMO A;  4PFW A;  2V3T A;  1INP A;  4H1X A;  2RCA A;  3TMG A;  2OBG A;  1YZ0 A;  3GYY A;  3WAF A;  5I58 B;  2KR0 A;  1NNT A;  3CIJ A;  4U1O A;  1RDY A;  2OZZ A;  4ZS9 A;  2IEE A;  2Q2A A;  2F7A A;  3U8Q A;  3VLV A;  1II5 A;  3JZJ A;  4NWC A;  2DXY A;  4NMY A;  1QUI A;  3S2V A;  4H65 A;  1Q35 A;  3B6Q A;  1JEU A;  2AIX A;  3THI A;  5H8Q A;  2E1S A;  3A3U A;  1B52 A;  1LEV A;  4NED A;  3VXC A;  2CZH A;  2F34 A;  3KSX A;  3N5L A;  3N94 A;  4PP0 A;  1Z7N E;  4QFL A;  2GFE A;  4FOR A;  4Q0C A;  5L9M A;  2V3Q A;  5EQ8 A;  2RIN A;  4OES A;  1XOC A;  2I58 A;  2HXR A;  4R2B A;  1LBX A;  4G8M A;  4JVD A;  1TWY A;  5ITO A;  3MZB A;  5DW8 A;  1FPF A;  2RKM A;  3K1M A;  1NNP A;  5ESY A;  4IB2 A;  4OEN A;  4I40 A;  3EHT A;  4QSE A;  2B4L A;  1Y1Z A;  4ZEB A;  3GBB A;  3MVW A;  1QUJ A;  2V3U A;  4XXU A;  2UVJ A;  1MQG A;  1EYI A;  1QKA A;  4MF3 A;  1US5 A;  1MM7 A;  2OCU A;  1PBQ A;  3PMW A;  2YLN A;  4YKK A;  3HST A;  3RLF E;  3TYH A;  2GHB A;  4QSC A;  1B58 A;  2Z8F A;  5CMB A;  1WDN A;  2FA7 A;  1NKX A;  1NV4 A;  3CFZ A;  3W9W A;  2QS1 A;  1NV6 A;  1ATG A;  3OO7 A;  3Q28 A;  4LN5 A;  2H4I A;  3ONM A;  1O64 A;  3K6W A;  5ICQ A;  3T9V A;  3DM0 A;  1VE4 A;  2XXV A;  1D9Y A;  2UYE A;  4GX4 A;  2DWJ A;  1SYH A;  1FQF A;  4UAC A;  1FPG A;  1FQD A;  1NUZ A;  1POY 1;  4KD5 A;  3PD8 A;  1DK4 A;  2I0B A;  5DEX B;  3PU5 A;  5FTI A;  4E0W A;  4NGU A;  1NH7 A;  3CSG A;  2DDK A;  3MPK A;  3R6U A;  3MYU A;  1HSL A;  3BIG A;  2X7Q A;  1EYJ A;  5BWJ A;  2XD3 A;  3TZA A;  3OEN A;  5EQA A;  3EHU A;  1B3L A;  4OTE A;  3QYT A;  4HW8 A;  1CE2 A;  2I3V A;  1HSE A;  2PFZ A;  3K00 A;  5BUU A;  4KCD A;  1JW5 A;  3QSL A;  1B5I A;  5I2N B;  5TPA B;  2F78 A;  4P3L A;  3CRB A;  1MPD A;  3G3I A;  1LB9 A;  1TT1 A;  4KPT A;  2WYP A;  2UXA A;  1IIW A;  4LZ8 A;  3KJ7 A;  5L8D A;  1B51 A;  2H98 A;  2ZNS A;  1EH3 A;  3KGC A;  1NV1 A;  1XT8 A;  3FAS A;  5L9O A;  2OK2 A;  3FXB A;  4OEV A;  1MQH A;  2M8C A;  3FAT A;  4IO2 A;  2F3D A;  2UVG A;  1A40 A;  4LON B;  4BDQ A;  1Y9U A;  2DYX A;  2GRV A;  2ZYK A;  3MP8 A;  3K6V A;  1A54 A;  1SQY A;  2QS4 A;  4ESX A;  1PB8 A;  2Q8J A;  1S50 A;  4PC9 A;  1KA0 A;  2H99 A;  4N13 A;  1IMD A;  4C1U A;  4LZ7 A;  1A7L A;  1MY3 A;  1DPE A;  3H3G A;  4MAG A;  4PFB A;  2QVV A;  1XS5 A;  1UIU A;  1DSN A;  2I48 A;  1UTH A;  4FE8 A;  4F3P A;  1QGX A;  4H0W A;  3UIF A;  2KQZ A;  4RXL A;  5AA3 A;  2DS9 A;  1SW1 A;  4R2F A;  2Y5K A;  2ZZW A;  1IZ1 A;  4GL8 A;  1Q1K A;  1FBD A;  2G29 A;  2NXO A;  4YIC A;  4P9K A;  3TEP A;  4HTG A;  5F24 A;  4GWU A;  4PQJ A;  4G68 A;  1FCK A;  4ONY A;  4EF1 A;  1PB9 A;  3PPN A;  1URG A;  4MNP A;  4POW A;  1PB7 A;  4YB7 A; 
#chains in the Genus database with same CATH homology
 2O6A A;  1ZLQ A;  5A5X B;  3L6H A;  2XXR A;  1AIV A;  3D4C A;  3TTR A;  2XX7 A;  3TAJ A;  3PPP A;  3IB1 A;  1VFD A;  3VDF A;  1D9V A;  4G8N A;  5DVI A;  4EUO A;  1ZTY A;  2F7C A;  3U1O A;  1B40 A;  4GXA A;  3U93 A;  4KR5 A;  3MZ9 A;  3RNN A;  3IOW A;  5EHS A;  5M2V A;  5H8N A;  3V8X B;  2R71 A;  3O2A A;  1JET A;  1H3D A;  2D3I A;  2A5T A;  2PBW A;  1NNF A;  3PPQ A;  2DQV A;  5ITP A;  1MQD A;  1SBP A;  5DYH A;  5I2K A;  3L6G A;  4GVO A;  5DT6 A;  2DWH A;  1B32 A;  2OLB A;  4EDP A;  4R6Y A;  4ECF A;  3PGF A;  2VGQ A;  4ELQ A;  5FHN A;  4O3C A;  4POX A;  4H5G A;  4YKJ A;  1I6A A;  1M5F A;  1LAG E;  3G3J A;  1LAX A;  3W9V A;  4ZEF A;  4ELP A;  1B7H A;  3HN0 A;  1B9J A;  1B0L A;  1FQB A;  2F5X A;  4H5F A;  4O3A A;  4KYD A;  3T9X B;  2Q89 A;  1Y3P A;  1QUL A;  1UTH B;  2B65 A;  3DEL B;  5I57 B;  1GV8 A;  3SET A;  4WED A;  4G68 C;  1MY1 A;  2E0S A;  1SYI A;  4TLL B;  4BDN A;  4F2O A;  2XXY A;  4XKN A;  3LSL A;  3MVX A;  1GVC A;  3ILT B;  1ZU0 A;  3FVK A;  4G68 B;  3FGS A;  4Z0I A;  1N7X A;  2PX1 A;  2HAU A;  1LFH A;  2I0C A;  4R9F A;  4GXS B;  2ESN A;  4X9T A;  5L9S A;  3Q29 A;  3KZG A;  4AB6 A;  1NNK A;  5ELV A;  2V25 A;  5CBR A;  1YTV A;  3MPL A;  3N26 A;  3TQL A;  1MY0 A;  3FVO A;  1MDQ A;  3EPE A;  1NL5 A;  1B1X A;  2HZK A;  4DXC A;  3K4U A;  3TQW A;  2ONK E;  3MVZ A;  5H8N B;  3HV1 A;  5I84 A;  4RK2 A;  2A5T B;  3KN7 A;  4EF2 A;  4F18 A;  3T9H B;  5I2K B;  1NMU A;  3UOR A;  4G8H A;  3E9X A;  3MWB A;  2HXW A;  3FD3 A;  1MM6 A;  4U22 A;  2AL5 A;  1LBB A;  1ZJL A;  3PPO A;  3ECR A;  4RYA A;  2HEU A;  3K0V A;  3PMV A;  2H5Y A;  4HCY A;  4I1D A;  1MY2 A;  3TOD A;  4C1T A;  1B3F A;  1OVT A;  2QPQ A;  3S9L C;  1DTG A;  4GQO A;  1VSO A;  4RNS A;  3B6T A;  1YPN A;  3IAZ A;  3H4Z A;  5CMC A;  4PFY A;  2ZNU A;  3G7W A;  4F3S A;  3KN8 A;  2I6E A;  3FJM A;  2Y7I A;  3O9P A;  2PT2 A;  2XXI A;  4GRK A;  3LSF B;  3RTF B;  2UYF A;  4RJZ A;  5EYF A;  3LUY A;  4F3B A;  1MXW A;  1R9Q A;  5AA4 B;  1URS A;  1OMP A;  3MC2 A;  3PUY E;  2RC7 A;  1JVX A;  1LFI A;  1RKM A;  1VR5 A;  3SEW A;  4I9D A;  3T96 B;  3CSB A;  1P1U A;  4YKP A;  1WOD A;  3OEK A;  5AA2 D;  3RN8 A;  1MY4 A;  1SD3 A;  2D21 A;  5F7V A;  3UP9 A;  1PBP A;  5H8H B;  4PE5 B;  4FEB A;  4XTC Q;  5FTH A;  4LQ2 A;  4H8I A;  3S9E A;  4F39 A;  3M8U A;  2G93 A;  4NF5 B;  3IB2 A;  3W15 C;  1N7W A;  1QKB A;  2FYI A;  3T93 B;  3FXR A;  4WEP A;  4PFT A;  2OWS A;  2R6G E;  1FQC A;  3KSJ A;  5KZT A;  1GTK A;  4OER A;  3ILU B;  4FEC A;  5DVJ A;  4FAT A;  1US4 A;  3N6U A;  3BBR A;  4R9G A;  3IOU A;  4QFP A;  1LB8 A;  4DIG A;  4DDD A;  1PEB A;  4LAT A;  3Q25 A;  4YAH X;  4ELR A;  2YPN A;  3I6V A;  2A5S A;  1MXZ A;  4IGR A;  2RCB A;  3IX1 A;  2AL4 A;  5KCJ A;  4OHN A;  1P99 A;  1EZ9 A;  2VOZ A;  3G3G A;  4QFN A;  1JW4 A;  4HS7 A;  3DLN A;  4OMB A;  3FXQ A;  4GIZ A;  3SEX A;  1B7Z A;  1B7U A;  1R6Z A;  2XX9 A;  5H8Q B;  3F11 A;  3O28 A;  4KI0 E;  1N76 A;  4U1Z A;  4LQ5 A;  1P1N A;  3G3H A;  1BTJ A;  2X7P A;  1FTK A;  2CZL A;  3O66 A;  3PUZ E;  4FJP A;  3BFT A;  2YJP A;  1B05 A;  1MPB A;  2PYY A;  1Y1M A;  4H6D A;  3LBS A;  2Y7R A;  3SKP A;  1R1N A;  3TPA A;  2F35 A;  1MXY A;  4NF8 A;  4E0X A;  1MPC A;  1O7T A;  3FZV A;  3TKD A;  1UTB A;  3IOR A;  4GLI A;  1J1N A;  3GBA A;  3IJX B;  4HCW A;  1IXI A;  5CI5 A;  4JXI A;  3T66 A;  2I3W A;  1MH3 A;  3IL1 B;  4XKQ A;  1IXH A;  1GR2 A;  3UK4 A;  3OO6 A;  2AYS A;  4BDO A;  2DXR A;  2WKY A;  3M3K A;  4U4X A;  1LCF A;  3N6T A;  4UA8 A;  2R9J A;  4R6H A;  4ZE8 A;  3EF7 A;  3C36 A;  1IXC A;  4NTL A;  4NF6 A;  2OJT A;  2ZNT A;  4L17 A;  4DCX A;  1TFA A;  1DMB A;  1A8E A;  1PC3 A;  4JDF A;  4BLA A;  3HHG A;  4R72 A;  1N3X A;  3ZSF A;  3RY3 A;  4IO6 A;  4MLQ A;  5H8F A;  3TCF A;  4BDL A;  4P0G A;  3QXM A;  3QIM A;  2DWI A;  3JYR A;  4XKR A;  2DE4 A;  3MW0 A;  4IY5 A;  2Q88 A;  2P1S A;  1Z7M E;  3RUM A;  3FUZ A;  4OWD A;  1MXU A;  1I6Q A;  3V5A A;  4AB5 A;  1M5E A;  3IOV A;  5KCJ B;  5I59 A;  3PMX A;  4TQU Q;  4EXL A;  1MRP A;  1JEV A;  2P0S A;  1SW4 A;  2BJJ X;  3O6G A;  3A3C A;  1IEJ A;  4F2Q A;  4YKI A;  2ZXT A;  2RC9 A;  1ZMG A;  3VVE A;  1URD A;  3MVY A;  4K3F A;  2PT1 A;  1P1W A;  3PUV E;  2QMW A;  2FNC A;  1H76 A;  3H6V A;  4NF8 B;  1SI1 A;  4Q8R A;  3RGY A;  3OXN A;  5DTB A;  2O7I A;  4JSD A;  5FHO A;  2XXX A;  3VV5 A;  5ISU A;  3FVG A;  4YMA A;  3IR1 A;  2QSX A;  1KWH A;  4PFU A;  4ZEK A;  3T22 A;  3H6T A;  4RK9 A;  3V83 A;  2REJ A;  1AMF A;  4MFI A;  1SW5 A;  3K6X A;  1FTM A;  1ANF A;  1A8F A;  4YB5 A;  4DXU A;  3MQ9 A;  3C4M A;  3C32 A;  3OOA A;  3B6W A;  1SDX A;  1LFG A;  3OD7 A;  3KFM A;  1OLC A;  5I58 A;  2HZL A;  2O68 A;  3MP6 A;  4X1B A;  3TDJ A;  2O84 X;  2Y7W A;  4F3G A;  4RY1 A;  4IO7 A;  4P11 A;  1VFE A;  4EXK A;  1CB6 A;  1DPP A;  2ZYN A;  3TUS A;  1I69 A;  1XHY A;  5CRY A;  2HFB A;  5TP9 A;  4RA1 A;  2XXQ A;  3SER A;  1N84 A;  5H8F B;  1MXX A;  4WKM A;  1LBC A;  5K2X A;  1NFT A;  3CR9 A;  1LST A;  4IO3 A;  3CVG A;  3K01 A;  4R74 A;  2I4C A;  3CFL A;  4FAJ A;  2Y7K A;  4C0R A;  3SES A;  2XHD A;  1H43 A;  1MS7 A;  4I8C A;  4QSD A;  5CMK A;  1PDA A;  3JV9 A;  4O3B A;  5I59 B;  1S9T A;  4YZZ A;  4OET A;  2W7Y A;  1B3H A;  5AA2 A;  1L5T A;  2VP1 A;  4LA9 A;  2VD2 A;  5CBS A;  1M5D A;  2XXH A;  3KJT A;  5K2Y A;  1DOT A;  1OQG A;  3VXB A;  3R7X A;  1XVX A;  3RQT A;  1EU8 A;  3BKI B;  3U72 A;  1JQF A;  2HCA A;  3KBR A;  1B5H A;  4IO4 A;  3USD A;  3EQ1 A;  1A99 A;  2D5W A;  2F36 A;  1B5J A;  3D4G A;  3FV2 A;  1SW2 A;  2UVH A;  1B1H A;  3FJG A;  3O6H A;  2THI A;  4KHZ E;  4GD5 A;  4YMB A;  2Y84 A;  3I5O A;  3CFX A;  1B4Z A;  3VVD A;  1BLF A;  3MJN A;  3VE1 B;  1Y4T A;  3HCQ A;  2Q9T A;  1RYX A;  3CG3 A;  5DEX A;  3AXF A;  4F22 A;  4QF9 A;  4OFL A;  4KCC A;  2DOJ A;  1MG1 A;  3ODB A;  1R9L A;  2XXP A;  1POT A;  2LAO A;  3GLB A;  3VLW A;  3C31 A;  5J1D A;  3V89 B;  3GXA A;  3ZS6 A;  3OO9 A;  4DXB A;  3LC8 A;  2NVU B;  2ALU A;  1QJM A;  5TP9 B;  1ZIU A;  1OIB A;  2HAV A;  3P7I A;  1ZBM A;  2ZMB A;  2Y7P A;  1FQA A;  1N04 A;  3H06 B;  1BP5 A;  3B7D A;  3U94 A;  5I2N A;  3KOS A;  5TPA A;  2VD3 A;  4F29 A;  3S4U A;  2Z8D A;  1OLA A;  1TXF A;  5LOM A;  3O6I A;  4I62 A;  1A55 A;  2ZYM A;  4X1D A;  1MQI A;  2QRY A;  2QS3 A;  4F1U A;  2XXT A;  4IGT A;  3Q27 A;  4H8J A;  4OVJ A;  4R75 A;  2NWJ A;  1FW0 A;  1N0T A;  1B3E A;  5AA2 B;  4EQB A;  1FQE A;  4GOT A;  3S9M C;  5H8S A;  1UQW A;  1LLS A;  3PD9 A;  4XKP A;  4QRZ A;  3FV1 A;  4NF4 A;  4KFQ A;  3K02 A;  1LCT A;  1MH4 A;  1S7Y A;  3O29 A;  4MLV A;  5EHM A;  2XXW A;  3SEY A;  5DVF A;  2DP8 A;  4YB6 A;  4ZED A;  3LSW A;  1MXV A;  1MQJ A;  2REG A;  2O1L A;  2IA4 A;  4U23 A;  2F6P A;  1M5B A;  4OFJ A;  2GHA A;  2DVC A;  4TOZ A;  4MH5 A;  4KQP A;  1Y3N A;  3C9H A;  2RF1 A;  3M3L A;  3EN3 A;  4ZZE A;  5B70 A;  4PET A;  4M4G A;  5HBC A;  2VHA A;  5CC2 A;  3K6U A;  2O69 A;  3IK6 B;  4OFO A;  1XC1 A;  5JTY A;  3MAM A;  3H6W A;  2ANJ A;  2DE2 A;  3RTW B;  4LUB A;  3RPW A;  5JEI A;  4NWD A;  1OVB A;  1H44 A;  4DLD A;  3Q26 A;  4Z7E A;  4JWX A;  3HO7 A;  5A5X A;  2ABH A;  2NUV A;  3DP6 A;  1FTJ A;  3LSX A;  1B3G A;  4GWO A;  3OMB A;  3S9N C;  1FTO A;  1B0H A;  3U92 A;  3LR1 A;  1YCJ A;  4QHQ A;  4WXJ A;  1TFD A;  4ISU A;  2KLF A;  3FVN A;  1FTL A;  1H45 A;  2DVZ A;  1EZO A;  2QJE A;  2NOO A;  3OSR A;  2Q2C A;  2DE3 A;  4ESW A;  4AQ4 A;  2X26 A;  1JNF A;  1YAE A;  2PVU A;  2Z22 A;  4X48 A;  3RT8 A;  2V84 A;  1IQ7 A;  1D4N A;  4YU0 A;  3I3V A;  4RPO A;  3VVF A;  1Y4C A;  3UN6 A;  4NF4 B;  5HM4 B;  4FIM A;  3QUJ A;  4R73 A;  2F6G A;  2ONR A;  4KYS A;  2DSF A;  4IO5 A;  3KEI A;  1ELJ A;  5KDT A;  1F9B A;  2QMX A;  2GH9 A;  5TU0 A;  4MBP A;  2F97 A;  4ZZA A;  5I56 A;  3TCH A;  3OEM A;  5CMM A;  5HPQ A;  1QUK A;  4OXV A;  4JWO A;  3DP4 A;  4F1V A;  5AE4 A;  3OSQ A;  4ZEC A;  3ZKL A;  3C35 A;  3G3K A;  3VFJ A;  4ELO A;  5I57 A;  4XIG Q;  4BDM A;  3MUQ A;  4Q5T A;  3T9U A;  3UA8 A;  1IXG A;  3HHF A;  4F1Y A;  1LGB C;  3FIR A;  4P0I A;  5JTY B;  2F8D A;  3GZG A;  4LZ5 A;  2HQ0 A;  1Y20 A;  2XX8 A;  3IOT A;  1AOV A;  1RYO A;  1LAF E;  4ZEI A;  5IKB A;  3PUW E;  3IO6 A;  4DZ1 A;  1USY H;  1LAH E;  4ZE9 A;  4F19 A;  4JB7 A;  4QFO A;  2Z23 A;  3E3K A;  1MDP 1;  3R26 A;  1Y3Q A;  1P1Q A;  3C34 A;  4F31 B;  1JW1 A;  3K1P A;  1T0K A;  3PPR A;  2B3F A;  4G4P A;  2Z8E A;  4DE8 A;  1UIV A;  4U2R A;  5IAI A;  4IY6 A;  3TTL A;  2H9B A;  4NE4 A;  3G3F A;  5F1Q A;  3H03 A;  1I6B A;  1UTB B;  1OQH A;  4U21 A;  1SVX B;  3CI8 A;  3ZKK A;  3E13 X;  4KYE A;  3MZ1 A;  3SEU A;  4R6K A;  5JK4 A;  1BIY A;  4G77 A;  1SI0 A;  3H6U A;  1B2H A;  3SEV A;  3WAE A;  1HSJ A;  4N07 A;  3E4R A;  4N6P A;  2DWA A;  3H7M A;  3QAX A;  1QVS A;  1IUD A;  3EHS A;  3M3F A;  3UGW A;  2XXU A;  2RC8 A;  1EZP A;  1AL3 A;  1ZKB A;  2ONS A;  3A09 A;  3TFL A;  1IIT A;  2O1M A;  3FJ7 A;  3IO4 A;  2PMS A;  3KN3 A;  4NF6 B;  4RPN A;  5KDT B;  1D3K A;  4QFK A;  3HPI A;  3KG2 A;  4G2Z A;  2V93 A;  5I56 B;  1WVJ A;  3VLU A;  2QL3 A;  3OO8 A;  4M1V A;  1P1O A;  4U4S A;  3C33 A;  4OYV A;  3IJO B;  2O51 A;  3SDF A;  4BDR A;  3TCG A;  3MBP A;  1AH5 A;  3TTN A;  3IB0 A;  1B4H A;  5AA4 A;  3RT6 B;  1O63 A;  3K1N A;  4JSO A;  4OQO A;  4GF8 A;  1B46 A;  2XD2 A;  4JWY A;  2ZYO A;  1M5C A;  1DTZ A;  1QW0 A;  1GGG A;  4Q30 B;  3MP1 A;  4OZ9 A;  3OEL A;  3K2D A;  2F7B A;  4EQ7 A;  4ZDM A;  3O97 A;  4ND9 A;  3FXU A;  5H8H A;  4LVQ A;  3TEL A;  4EQ9 A;  3PUX E;  1JVY A;  4JBZ A;  4GL0 A;  2O7U A;  4NF5 A;  3TTK A;  4OEU A;  4TLM B;  5B7D A;  4DCY A;  5CM6 A;  1BKA A;  3PV0 E;  4FED A;  1NH8 A;  4LP2 B;  1B6H A;  2B3B A;  2P2A A;  2QS2 A;  1USY E;  4THI A;  3QK6 A;  4GFR A;  2H25 A;  2I49 A;  3QUF A;  3CG1 A;  3BFU A;  5FHM A;  1N3W A;  3KOT A;  2OWT A;  1XVY A;  5AA1 A;  4H67 A;  3DP8 A;  2UVI A;  2I4B A;  5ICT A;  3TTM A;  2CMO A;  4PFW A;  2V3T A;  4H1X A;  2RCA A;  3TMG A;  2OBG A;  3WAF A;  5I58 B;  1NNT A;  3CIJ A;  4U1O A;  2OZZ A;  4ZS9 A;  2IEE A;  2Q2A A;  2F7A A;  3U8Q A;  3VLV A;  1II5 A;  3JZJ A;  4NWC A;  2DXY A;  4NMY A;  1QUI A;  3S2V A;  4H65 A;  1Q35 A;  3B6Q A;  1JEU A;  2AIX A;  3THI A;  5H8Q A;  2E1S A;  3A3U A;  1B52 A;  4NED A;  3VXC A;  2F34 A;  3KSX A;  3N5L A;  3N94 A;  4PP0 A;  1Z7N E;  4QFL A;  2GFE A;  4FOR A;  4Q0C A;  5L9M A;  2V3Q A;  2RIN A;  4OES A;  1XOC A;  2I58 A;  4R2B A;  4G8M A;  1TWY A;  5ITO A;  3MZB A;  2RKM A;  3K1M A;  1NNP A;  4IB2 A;  4OEN A;  3EHT A;  4QSE A;  1Y1Z A;  4ZEB A;  3GBB A;  3MVW A;  1QUJ A;  2V3U A;  4XXU A;  2UVJ A;  1MQG A;  1QKA A;  4MF3 A;  1US5 A;  1MM7 A;  2OCU A;  1PBQ A;  3PMW A;  2YLN A;  4YKK A;  3HST A;  3RLF E;  3TYH A;  2GHB A;  4QSC A;  1B58 A;  2Z8F A;  5CMB A;  1WDN A;  2FA7 A;  1NKX A;  3CFZ A;  3W9W A;  2QS1 A;  1ATG A;  3OO7 A;  3Q28 A;  2H4I A;  3ONM A;  1O64 A;  3K6W A;  5ICQ A;  3T9V A;  3DM0 A;  1VE4 A;  2XXV A;  1D9Y A;  2UYE A;  2DWJ A;  1SYH A;  1FQF A;  4UAC A;  1FQD A;  1POY 1;  4KD5 A;  3PD8 A;  2I0B A;  5DEX B;  3PU5 A;  5FTI A;  4E0W A;  1NH7 A;  3CSG A;  3MPK A;  3R6U A;  1HSL A;  2X7Q A;  5BWJ A;  2XD3 A;  3TZA A;  3OEN A;  3EHU A;  1B3L A;  4OTE A;  3QYT A;  4HW8 A;  1CE2 A;  2I3V A;  1HSE A;  3K00 A;  5BUU A;  4KCD A;  1JW5 A;  3QSL A;  1B5I A;  5I2N B;  5TPA B;  2F78 A;  3CRB A;  1MPD A;  3G3I A;  1LB9 A;  1TT1 A;  4KPT A;  2UXA A;  1IIW A;  4LZ8 A;  3KJ7 A;  5L8D A;  1B51 A;  2H98 A;  2ZNS A;  1EH3 A;  3KGC A;  1XT8 A;  3FAS A;  5L9O A;  2OK2 A;  4OEV A;  1MQH A;  2M8C A;  3FAT A;  4IO2 A;  2UVG A;  1A40 A;  4LON B;  4BDQ A;  1Y9U A;  2DYX A;  2GRV A;  2ZYK A;  3MP8 A;  3K6V A;  1A54 A;  1SQY A;  2QS4 A;  4ESX A;  1PB8 A;  2Q8J A;  1S50 A;  2H99 A;  4N13 A;  4C1U A;  4LZ7 A;  1A7L A;  1MY3 A;  1DPE A;  3H3G A;  1XS5 A;  1UIU A;  1DSN A;  2I48 A;  1UTH A;  4FE8 A;  4F3P A;  4H0W A;  3UIF A;  4RXL A;  5AA3 A;  2DS9 A;  1SW1 A;  4R2F A;  1IZ1 A;  4GL8 A;  1Q1K A;  2G29 A;  2NXO A;  4YIC A;  3TEP A;  4HTG A;  4PQJ A;  4G68 A;  1FCK A;  4ONY A;  4EF1 A;  1PB9 A;  3PPN A;  1URG A;  4POW A;  1PB7 A;  4YB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...