3PPPA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
272
structure length
272
Chain Sequence
DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 105
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3pppA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3pppA02
4R2BA 1Y9UA 4DDDA 4UACA 2Z22A 3KBRA 5I2KB 3OO9A 4RYAA 3IORA 3OENA 3N5LA 3M3FA 4YMAA 3KGCA 2FYIA 5TP9B 3SEXA 3K1NA 4RPOA 1EZOA 2GH9A 3UGWA 1NNKA 4U2RA 2F8DA 3JYRA 2NOOA 3CFLA 1A55A 4R9FA 2ZYMA 3C36A 2PBWA 4OZ9A 2V93A 2YLNA 2ZMBA 3WAEA 4H0WA 1B4HA 3LSXA 3GBAA 3H6TA 4ZDMA 4EXLA 3C4MA 1VFEA 3TUSA 1H3DA 3I5OA 3RY3A 3BFUA 3M8UA 5TU0A 1EZPA 4HCWA 1OQHA 3TODA 2F97A 2DWJA 4Z0IA 4F19A 2ALUA 1FTJA 2F6PA 3MWBA 4WKMA 3RQTA 3TTKA 1D9VA 2PT2A 3TTLA 4DLDA 1OVBA 1Y3QA 4KCDA 5AA2B 2XXQA 3QSLA 3M3LA 1N7WA 4H5GA 3PUXE 2PMSA 1LFHA 2XX7A 4JSOA 1EZ9A 1LSTA 4YB7A 5JTYB 1F9BA 3PV0E 2OZZA 4HCYA 3CI8A 1S7YA 5H8HB 1NFTA 4GL8A 4R9GA 4F1YA 2GRVA 4ZEBA 1B5JA 1Z7NE 1SI0A 3O97A 3QUJA 3F11A 3FIRA 1P99A 2Q2CA 3QYTA 2DYXA 1GGGA 4NWDA 3C35A 1B52A 3TCFA 1MXXA 5HBCA 4YICA 4WEPA 1MQIA 1QKBA 5A5XA 1GVCA 3WAFA 4FATA 2XXHA 5DT6A 2GHAA 1LAHE 2QMXA 4ONYA 4I62A 3K6XA 4LVQA 3S9LC 1UTBB 1MQDA 3FUZA 4OEUA 4POXA 3K2DA 5CBSA 4RK9A 4I1DA 1Z7ME 1FCKA 3PPOA 2F7BA 1UTHB 1JEUA 1R1NA 1PB7A 3PMVA 1P1NA 2H5YA 4BDRA 1VSOA 1LBCA 3RN8A 4G68C 2ONRA 2ZYOA 1ELJA 2XD3A 5KDTB 1IXGA 2REJA 3TYHA 1P1UA 4FEDA 5H8QB 1KWHA 3KEIA 1LAXA 1AH5A 3U93A 1MXYA 2DWIA 1TT1A 1NNFA 4BDLA 4ELQA 3L6GA 4OEVA 1RYOA 2UVGA 3G3FA 4NF4B 4IY5A 2RF1A 3QK6A 4QSEA 4QFNA 1H44A 4NWCA 2X7PA 3MBPA 4IO2A 1MPDA 4HW8A 2NWJA 4M1VA 2Q8JA 3T96B 3LSLA 3TTMA 1ZLQA 2O1MA 3S9MC 5AA4A 4GFRA 3T9UA 1IZ1A 5DVIA 4Q30B 3V83A 4IGRA 1HSEA 5I56A 1MXZA 3VXCA 4OETA 4ESXA 5CRYA 1AL3A 4N07A 4KYDA 5M2VA 4QFLA 4QRZA 2F36A 3O29A 2HAUA 4HTGA 4ND9A 2DXRA 3EPEA 5FHOA 3PUVE 3KJTA 4FJPA 2V84A 1NNTA 1B7UA 1BKAA 1LFGA 3LBSA 3UN6A 2Y7KA 1IUDA 3O6GA 1XVXA 2ZNTA 1IXCA 3UIFA 2CMOA 1YAEA 2DWHA 3PPRA 4XIGQ 4JDFA 5TPAB 4DXCA 2F78A 3TZAA 1XC1A 3KN8A 4GD5A 1YTVA 4WEDA 3PGFA 4OXVA 4F1VA 3E3KA 1LBBA 4GOTA 2UYFA 1MQJA 1ZKBA 2DVCA 3EHUA 3V89B 5F7VA 2UYEA 1B4ZA 3KOTA 3RNNA 4MF3A 4F3PA 2O51A 3TELA 2O84X 1PEBA 4H8JA 3IOWA 2XXTA 1MXUA 3Q28A 3VFJA 3C9HA 3IOUA 2Z8EA 1FTOA 2GHBA 3MVWA 4JWXA 4GVOA 1EH3A 5I2KA 4OFJA 4IY6A 3THIA 4R6KA 4X1DA 4EUOA 4EQBA 2RCAA 1QULA 1B3HA 3TCGA 4YB6A 3EHTA 3D4CA 4F29A 5I58B 2Z23A 5FTIA 4RK2A 1B40A 3U94A 4KFQA 3MP8A 3CG1A 3MPLA 3LR1A 2QS4A 1A54A 1CE2A 4DCXA 1DPPA 3IO6A 3OMBA 3USDA 4U23A 4LONB 5ITOA 3MP6A 4H1XA 1R6ZA 2HXWA 4JWYA 4LQ5A 2HEUA 1O63A 1QUKA 4ZS9A 1I6AA 4GQOA 2OJTA 1UIUA 4EQ7A 2ZXTA 2XHDA 4R74A 4ZEKA 2X26A 1D3KA 3RTWB 1SW5A 1AOVA 3SDFA 2ZNUA 1S50A 3B6TA 3VE1B 4BLAA 3LUYA 3OO6A 3S9EA 4F22A 3PPNA 3EQ1A 1ANFA 1PC3A 5HPQA 3G3HA 1Y20A 2Y84A 1LB9A 5K2YA 2I58A 3OXNA 2NXOA 3B6WA 5I2NA 5AE4A 3DP6A 1SYIA 4HS7A 2VGQA 1A99A 3UORA 5I59B 2QPQA 3Q27A 2I48A 2F7CA 2XXPA 5JTYA 3PMXA 2I6EA 3HO7A 4H6DA 3G7WA 4RY1A 3RT6B 3HV1A 4YB5A 1LCFA 5H8HA 1R9LA 5I57B 2DE3A 2RKMA 5ITPA 4ZEFA 3T9HB 2OBGA 5H8FB 1NH7A 4ISUA 1WDNA 1B51A 1PBPA 3RLFE 4UA8A 1DSNA 1B3FA 1HSLA 2VP1A 4FE8A 3FXQA 4IO7A 1FQAA 1YCJA 1I6QA 4MH5A 2QRYA 4XXUA 4TQUQ 3RTFB 3SEVA 1M5BA 2V3UA 3Q25A 4PFTA 2FNCA 4QHQA 3QAXA 3TTRA 3B7DA 1WVJA 1OLCA 3HN0A 1IXHA 4BDOA 3CIJA 5L9SA 1UTBA 3FD3A 3S4UA 4OFLA 1IEJA 1LB8A 3PD9A 4M4GA 4OESA 1VFDA 5JEIA 3FVKA 1Y1ZA 2DP8A 4YKPA 2RC8A 4NF8B 5KDTA 1DOTA 5CMBA 1B1HA 4EQ9A 2Q89A 2F7AA 3TQLA 4JBZA 4AB6A 1RKMA 3G3JA 3CRBA 4GIZA 4G68B 4BDMA 2D21A 1QVSA 3JZJA 3MZ9A 4Q8RA 4OMBA 1L5TA 3MPKA 5L9OA 2Y7IA 4DXBA 5DVFA 2A5TB 2Z8FA 4OHNA 2Y7WA 4LZ7A 4OERA 2NUVA 1QUIA 3HCQA 4E0XA 3C31A 1HSJA 1QUJA 2BJJX 2UVHA 4JXIA 4ELOA 2Q9TA 1PBQA 4PFWA 4YAHX 3G3KA 3R6UA 1USYE 3SKPA 5CI5A 4G2ZA 1SQYA 4F3BA 4ZZAA 4DCYA 3K6VA 1MM7A 2P0SA 3T9XB 3GBBA 3EN3A 2XXUA 5DEXB 3CR9A 2ANJA 4BDQA 3LSFB 1B0LA 2LAOA 1SVXB 3ZSFA 3MZ1A 4O3CA 2Y7RA 2UVJA 1EU8A 3FV1A 3PUWE 3E13X 4YKIA 4KCCA 5ISUA 1P1OA 3ZS6A 5I84A 3P7IA 3ILUB 2OLBA 3GZGA 3DP8A 1MY4A 4R75A 2DVZA 3MZBA 2GFEA 4RJZA 4YKKA 1N7XA 3M3KA 3VLWA 4R72A 1B7HA 4QSCA 4PFYA 1PB9A 3OEKA 2XXYA 3K6UA 5B70A 3LC8A 2XXVA 3ZKKA 2THIA 2HQ0A 2OWTA 3MVXA 1POY1 3SEUA 4OVJA 4LUBA 1LLSA 3OELA 2Z8DA 1P1QA 4R73A 3IAZA 3SERA 1B58A 5EHMA 3CFZA 2WKYA 1M5CA 3H6WA 3U72A 1TFDA 5EHSA 3RT8A 4KYEA 2VD2A 4FEBA 3T66A 1MPBA 2DWAA 4U4XA 3C34A 2XXIA 1ZU0A 1XVYA 3FJGA 2DOJA 3K1MA 1GR2A 3B6QA 1Q1KA 5IKBA 1JETA 2I0CA 4Q5TA 1JVYA 3FZVA 4I8CA 3IB1A 3SETA 1PDAA 3BFTA 3H6UA 2M8CA 4MLVA 3ECRA 1B3LA 3BBRA 2XD2A 4O3BA 5JK4A 1US5A 2XXWA 3IL1B 4OFOA 4XTCQ 4Z7EA 2R9JA 2V3TA 4F3SA 4H8IA 2DXYA 4GL0A 3JV9A 4F39A 3K02A 3G3IA 4ELPA 3MP1A 3H4ZA 1B05A 1OVTA 1MPCA 3Q26A 3N26A 2DS9A 2QMWA 2DE2A 4GLIA 3H03A 4G77A 3UP9A 3HHGA 1MY0A 1M5DA 3O28A 1FQEA 1Y4CA 1OLAA 3PPQA 4OWDA 5I59A 1MH3A 2IEEA 2REGA 2F5XA 4R6YA 1DTGA 4AB5A 4IO3A 3TKDA 4NF5A 5A5XB 1H76A 2DE4A 4P0GA 3VLVA 3KN3A 1NMUA 4MLQA 2O1LA 4GF8A 1T0KA 1ZTYA 1JQFA 5I57A 3IB0A 3W9WA 3MVYA 3GLBA 1XHYA 2HFBA 5CMMA 2I49A 5H8FA 2QSXA 3K6WA 3MVZA 1USYH 4H5FA 4AQ4A 4JB7A 2ABHA 1QKAA 4X9TA 3PPPA 3FVOA 3HHFA 3DLNA 2I4BA 1D4NA 2HZLA 4FORA 3OD7A 4OENA 1SDXA 1GTKA 4XKNA 2UVIA 1BTJA 1JEVA 3KSJA 1B5IA 3BKIB 5TP9A 4N13A 2V3QA 4QFKA 3CG3A 1JNFA 3RUMA 5H8NB 1B46A 3FV2A 1II5A 3I6VA 4IO6A 4RXLA 4FIMA 3PU5A 1GV8A 2F34A 3U1OA 4RNSA 1D9YA 5FTHA 2AL4A 2E0SA 3FVGA 4X48A 1IITA 1DMBA 3W9VA 4R6HA 2O7IA 1A7LA 4NF8A 4O3AA 3RPWA 5AA4B 1QW0A 3FATA 5CMKA 3VLUA 1JW4A 3CVGA 5I56B 1MQHA 2ESNA 4K3FA 3TAJA 3KFMA 3U8QA 2QL3A 2Q2AA 4G68A 4KHZE 3HPIA 1H43A 5AA2A 4KI0E 4QSDA 1UQWA 2AL5A 1FQBA 4POWA 3K00A 2A5TA 5CBRA 1SW2A 1B9JA 2OK2A 2Y7PA 4OTEA 2RCBA 4EXKA 1ZJLA 2OCUA 4DXUA 3E9XA 3SEYA 3MJNA 3V5AA 3G3GA 1FQDA 3SESA 1IXIA 5L9MA 4PE5B 1MY1A 2DQVA 3T9VA 4Q0CA 4NE4A 1DTZA 4N6PA 5KCJB 3N94A 3H7MA 2B3BA 3OO7A 2V25A 3FASA 4EF2A 5CM6A 3TPAA 3FVNA 5EYFA 4U22A 4TLLB 1B6HA 3PUYE 4ESWA 5DYHA 5FHMA 4XKQA 1WODA 1N04A 1OMPA 5AA2D 2QS1A 4P11A 1O7TA 4FAJA 3KG2A 5IAIA 2H9BA 4THIA 4WXJA 1FQFA 5DEXA 3PUZE 2XXXA 2D3IA 4F2OA 4PFUA 3IR1A 1URGA 4X1BA 1ZMGA 4NMYA 3T93B 4P0IA 4OYVA 5HM4B 3H06B 1VR5A 1IIWA 3QUFA 3VXBA 1MXVA 3H3GA 3RGYA 3L6HA 1FTMA 1LAGE 2IA4A 1N84A 5FHNA 3R7XA 4LP2B 4MBPA 3MC2A 3TQWA 3MAMA 1MDQA 1UTHA 2G93A 4ECFA 4QFOA 4EF1A 3IB2A 4I9DA 2YJPA 1CB6A 3DP4A 2QJEA 5H8QA 4ELRA 4KPTA 1PB8A 4F18A 3VVFA 4DE8A 2HAVA 1MM6A 2VOZA 1MXWA 3O6HA 4RA1A 4QF9A 4NF4A 1A8EA 1B1XA 3S2VA 2HCAA 3AXFA 3FGSA 1MY3A 4C1TA 4H65A 4NF6B 1BP5A 2O68A 3OSQA 1MG1A 4PQJA 3SEWA 4LATA 4R2FA 5I2NB 3A3UA 4U1ZA 2H25A 1FQCA 1IQ7A 5CC2A 1OIBA 2AYSA 3R26A 1ZBMA 3TTNA 3TEPA 3UK4A 1LGBC 4OQOA 1B3GA 3C32A 4YMBA 4PETA 1FTKA 1B0HA 2NVUB 2XX9A 5B7DA 2I3VA 2ZNSA 3PMWA 4E0WA 2I0BA 2XX8A 1NH8A 4ZEDA 5BWJA 1SYHA 1B5HA 3FJMA 4NEDA 3O6IA 4XKPA 1NKXA 5TPAA 1UIVA 3DM0A 1FW0A 4YKJA 1POTA 3H6VA 3QXMA 3ILTB 4NTLA 3A3CA 5KZTA 1MY2A 1R9QA 3O2AA 2W7YA 2R71A 4LZ5A 3KJ7A 3N6UA 5K2XA 2RC9A 1SW4A 3N6TA 1A8FA 4G4PA 4GXAA 1P1WA 1SW1A 4U4SA 3IOTA 3CSGA 3LSWA 3DELB 3Q29A 1NNPA 1MDP1 2OWSA 3KZGA 1JVXA 4IB2A 3W15C 5AA3A 4U21A 4C1UA 2B3FA 2KLFA 2ZYKA 1LAFE 5DVJA 5I58A 3IOVA 1DPEA 3U92A 5H8NA 2HZKA 2A5SA 1AMFA 1BIYA 2D5WA 3OSRA 1O64A 1TXFA 5CMCA 3VV5A 3VVDA 1B7ZA 1MRPA 1B2HA 3TFLA 4TOZA 1AIVA 1Y3NA 2YPNA 3OOAA 4H67A 4DZ1A 3OO8A 2H98A 3ZKLA 1ZIUA 1XOCA 3KOSA 2ONSA 2QS3A 1B32A 2Q88A 1ATGA 4KYSA 4LQ2A 1OQGA 3KN7A 5H8SA 3TDJA 1SBPA 4GRKA 4IGTA 2PVUA 5LOMA 1Y1MA 1M5EA 2VD3A 2QS2A 3C33A 1N76A 4ZE9A 1N3WA 5ICTA 1SD3A 1TFAA 1J1NA 2I3WA 1TWYA 3IJOB 1H45A 3K1PA 4KD5A 1N0TA 2H99A 4F3GA 3VVEA 3FJ7A 3T22A 4F1UA 4FECA 1XS5A 2G29A 1I69A 5ICQA 4LA9A 5J1DA 5KCJA 4RPNA 4ZZEA 2P1SA 3CSBA 4GWOA 5ELVA 3V8XB 3HSTA 2F6GA 3FXRA 4G8HA 3MW0A 1MH4A 1S9TA 5AA1A 3K0VA 3EF7A 1SI1A 1NL5A 3E4RA 1US4A 4TLMB 1I6BA 1LFIA 1N3XA 3D4GA 4IO4A 4IO5A 3KSXA 2AIXA 3MUQA 1URDA 3TCHA 2X7QA 1QJMA 3K01A 1Q35A 2DSFA 4ZEIA 2RINA 2H4IA 2UXAA 2FA7A 1B3EA 2ONKE 2E1SA 3VDFA 1XT8A 4PP0A 1MQGA 3IO4A 1JW5A 2PX1A 4DIGA 2O6AA 1LCTA 4ZE8A 2O69A 5F1QA 3IK6B 3I3VA 2XXRA 3QIMA 1RYXA 4YZZA 1MS7A 4F2QA 3GXAA 1Y4TA 4G8MA 4XKRA 4KR5A 3A09A 3ODBA 3PD8A 2R6GE 4GXSB 4LZ8A 2P2AA 4JSDA 1FTLA 2F35A 3IJXB 4BDNA 4NF6A 1Y3PA 3K4UA 4L17A 3TMGA 2CZLA 2I4CA 4QFPA 1YPNA 1A40A 4ZECA 1URSA 4MFIA 3FXUA 3IX1A 1M5FA 3CFXA 3MQ9A 3S9NC 5L8DA 4U1OA 4EDPA 3ONMA 4KQPA 1BLFA 4NF5B 2VHAA 1JW1A 4C0RA 3OEMA 2O7UA 3UA8A 4JWOA 3O9PA 4G8NA 5BUUA 1VE4A 3O66A 4YU0A 2B65A 2ZYNA 3EHSA 2PYYA 5DTBA 2PT1A 4F31B 2RC7A
chains in the Genus database with same CATH superfamily
4R2BA 4O7IA 2BJIA 1Y9UA 4DDDA 4PF8A 4UACA 2Z22A 3KBRA 5I2KB 3OO9A 3RYDA 4RYAA 1INPA 3IORA 3OENA 3N5LA 3M3FA 4YMAA 3KGCA 2FYIA 5TP9B 3T0JA 3SEXA 3K1NA 4RPOA 1EZOA 2GH9A 3UGWA 1NNKA 4U2RA 1FPKA 2F8DA 3JYRA 2NOOA 3CFLA 1A55A 4R9FA 2ZYMA 3C36A 2PBWA 4MCOA 4OZ9A 2V93A 2YLNA 2ZMBA 3WAEA 4H0WA 1B4HA 3LSXA 3GBAA 3H6TA 4ZDMA 1NI9A 4EXLA 3C4MA 2XXKA 1VFEA 3TUSA 1H3DA 3I5OA 1NUXA 3RY3A 3BFUA 3M8UA 5TU0A 1EZPA 4HCWA 1OQHA 3TODA 2F97A 2DWJA 4Z0IA 4F19A 2ALUA 1FTJA 2F6PA 3MWBA 2XWOA 1FSAA 4WKMA 3GYYA 3RQTA 3TTKA 1D9VA 2PT2A 3TTLA 4DLDA 1OVBA 2GQ1A 1Y3QA 4KCDA 5AA2B 1DCUA 2XXQA 3QSLA 3M3LA 1BK4A 1N7WA 4H5GA 3PUXE 2PMSA 1LFHA 2XX7A 4GWZA 4JSOA 4G61A 1EZ9A 1LSTA 4YB7A 5JTYB 1LBVA 5I7IA 1F9BA 3PV0E 2OZZA 4HCYA 4OVQA 3CI8A 4IR8A 1S7YA 5H8HB 1NFTA 4GL8A 4R9GA 4F1YA 2GRVA 4ZEBA 1FJ9A 1B5JA 1Z7NE 5ESYA 1SI0A 3O97A 3QUJA 3F11A 3FIRA 1P99A 2Q2CA 3BIHA 3QYTA 2DYXA 1GGGA 4NWDA 3C35A 3E78A 3ROJA 1B52A 3TCFA 1FJ6A 4GX6A 1MXXA 4PF6A 5HBCA 4YICA 4O7MA 4WEPA 1MQIA 1QKBA 5A5XA 1GVCA 3WAFA 4FATA 2XXHA 5DT6A 2GHAA 1LAHE 2QMXA 4H46A 4ONYA 4I62A 3K6XA 4LVQA 3S9LC 2WYKA 4H45A 1UTBB 1MQDA 1FPEA 3FUZA 4OEUA 4POXA 3K2DA 5CBSA 4RK9A 1IMCA 4I1DA 1Z7ME 1FCKA 3PPOA 2F7BA 1UTHB 1JEUA 4HE2A 1R1NA 1PB7A 3PMVA 1P1NA 2H5YA 4BDRA 1VSOA 1LBCA 3RN8A 4G68C 4OVTA 4OVSA 2ONRA 2ZYOA 1ELJA 2XD3A 5KDTB 4MMPA 4PGNA 1IXGA 2REJA 3TYHA 1P1UA 4FEDA 5H8QB 1KWHA 3KEIA 1LAXA 1AH5A 3U93A 1MXYA 2DWIA 1TT1A 4MNPA 1NV0A 1NNFA 4BDLA 4ELQA 3L6GA 4OEVA 1RYOA 2UVGA 3G3FA 4NF4B 4IY5A 2RF1A 3QK6A 4QSEA 4QFNA 1H44A 5IM2A 1D9QA 4NWCA 2X7PA 3MBPA 4UABA 4IO2A 4GWSA 1MPDA 4HW8A 2NWJA 3QMFA 4M1VA 2Q8JA 3T96B 3LSLA 1IMFA 4P3LA 3TTMA 1ZLQA 2O1MA 3S9MC 5AA4A 4GFRA 3T9UA 1IZ1A 5DVIA 4N8YA 4Q30B 3V83A 4IGRA 1HSEA 5I56A 1MXZA 3VXCA 4OETA 4ESXA 1FBDA 1EYKA 5CRYA 1AL3A 4N07A 4KYDA 5M2VA 4QFLA 4QRZA 2F36A 4ND9A 4PAKA 3O29A 2HAUA 4HTGA 2CZHA 2DXRA 4AS5A 2KR0A 2PFYA 3EPEA 5FHOA 2FHYA 3PUVE 3KJTA 3KC0A 4FJPA 2V84A 1NNTA 1B7UA 1BKAA 1LFGA 3LBSA 3UN6A 2Y7KA 2HHMA 1IUDA 4AS4A 3O6GA 1XVXA 2QVUA 2ZNTA 1IXCA 1FPJA 3UIFA 2CMOA 1YAEA 2DWHA 3PPRA 4XIGQ 1LBXA 4JDFA 5TPAB 4DXCA 2QFLA 2F78A 3MSTA 3TZAA 1XC1A 3KN8A 4XFEA 4GD5A 1YTVA 4WEDA 3PGFA 1SPIA 4OXVA 4F1VA 3E3KA 1LBBA 2WX9A 4GOTA 2UYFA 1MQJA 1ZKBA 4HE1A 2DVCA 3EHUA 2B4MA 3V89B 5F7VA 2UYEA 1B4ZA 3KOTA 3RNNA 4MF3A 5EYHA 4F3PA 2O51A 3TELA 4N91A 2O84X 1PEBA 4H8JA 3IOWA 2XXTA 1MXUA 3Q28A 3VFJA 3C9HA 4GWYA 2L5VA 3IOUA 4DI4B 2Z8EA 1FTOA 2GHBA 3MVWA 4JWXA 4GVOA 1EH3A 5I2KA 4OFJA 4IY6A 3THIA 4R6KA 3IFAA 4X1DA 1FPLA 4EUOA 4PBQA 3FBPA 1NV1A 4EQBA 2RCAA 1QULA 1B3HA 4YB6A 3TCGA 3EHTA 3D4CA 4F29A 5I58B 2Z23A 5FTIA 4RK2A 1B40A 3U94A 2XWKA 4KFQA 4MIJA 3MP8A 4OVPA 3CG1A 3MPLA 1NV2A 3LR1A 4FBPA 2QS4A 4DI3D 4O8MA 1A54A 1CE2A 4DCXA 1DPPA 3IO6A 4P8BA 3OMBA 1NV4A 3USDA 3E79A 1EYJA 4U23A 4LONB 4QXDA 5ET8A 5ITOA 3MP6A 4H1XA 1R6ZA 2HXWA 4JWYA 4LQ5A 2HEUA 1O63A 1G0HA 1QUKA 4ZS9A 1I6AA 4GQOA 2OJTA 5J16A 1UIUA 4EQ7A 2ZXTA 2XHDA 4MEVA 4R74A 4ZEKA 2X26A 1D3KA 1K9YA 1G0IA 3RTWB 1SW5A 1AOVA 3SDFA 2ZNUA 1IMAA 1S50A 4I3YA 3B6TA 3VE1B 4BLAA 3LUYA 4HE0A 2OX3A 5IZ1A 3OO6A 3NOHA 3S9EA 4F22A 3PPNA 3EQ1A 1ANFA 1PC3A 2XWIA 5HPQA 3G3HA 1Y20A 2Y84A 1LB9A 5K2YA 2I58A 3OXNA 2NXOA 4PFIA 3B6WA 5I2NA 5AE4A 3DP6A 1SYIA 4HS7A 1FPBA 2VGQA 1A99A 3UORA 5I59B 2QPQA 3Q27A 3HFUA 2I48A 4QBAA 2F7CA 2XXPA 5JTYA 3PMXA 2I6EA 3HO7A 4H6DA 3G7WA 4RY1A 3RT6B 3HV1A 4PAFA 4YB5A 1LCFA 3PTYA 5H8HA 1R9LA 5I57B 2DE3A 2RKMA 4PBHA 2CZIA 5ITPA 4ZEFA 3T9HB 2OBGA 5H8FB 1NH7A 4ISUA 4NAPA 1WDNA 1B51A 1PBPA 3RLFE 4UA8A 1DSNA 1B3FA 1HSLA 2VP1A 4FE8A 3FXQA 2QVRA 4IO7A 1FQAA 1I6QA 1YCJA 4MH5A 2QRYA 4XXUA 4TQUQ 3RTFB 3SEVA 1M5BA 2V3UA 3Q25A 4PFTA 2FNCA 4QHQA 3QAXA 3TTRA 3B7DA 1WVJA 1OLCA 3HN0A 1IXHA 4BDOA 3CIJA 5L9SA 1UTBA 3FD3A 3S4UA 4GX3A 4OFLA 1IEJA 1JP4A 2B4LA 1LB8A 3PD9A 4NN3A 4M4GA 4OESA 1VFDA 3EKIA 5JEIA 3FVKA 1Y1ZA 2DP8A 3LUZA 4YKPA 2RC8A 4NF8B 5KDTA 1DOTA 5CMBA 1B1HA 3RPLB 4EQ9A 2Q89A 2F7AA 3TQLA 1FPFA 4JBZA 4AB6A 1RKMA 4P47A 1EYIA 2HPGA 3G3JA 3CRBA 4GIZA 4G68B 4BDMA 2D21A 1FPDA 1QVSA 3JZJA 3MZ9A 4Q8RA 4OMBA 1L5TA 3MPKA 5L9OA 2Y7IA 4DXBA 5DVFA 1YYZA 2A5TB 2Z8FA 4OHNA 2Y7WA 4LZ7A 4OERA 2NUVA 1QUIA 3HCQA 4O94A 4E0XA 3C31A 1HSJA 1QUJA 4JVIA 2BJJX 2UVHA 4JXIA 5F24A 4ELOA 2Q9TA 1PBQA 4PFWA 4YAHX 3G3KA 3R6UA 1USYE 3SKPA 5CI5A 1LBWA 4G2ZA 1SQYA 4F3BA 1FBHA 4ZZAA 4DCYA 3K6VA 1MM7A 2P0SA 3T9XB 3GBBA 3EN3A 2XXUA 1FBEA 5DEXB 2XWVA 3CR9A 2ANJA 4BDQA 3LSFB 1B0LA 2LAOA 1SVXB 4GX4A 3ZSFA 3MZ1A 4O3CA 2Y7RA 2UVJA 1EU8A 3FV1A 3PUWE 4MX6A 3E13X 4YKIA 4KCCA 5ISUA 1IMDA 1P1OA 3ZS6A 5I84A 3P7IA 3ILUB 2OLBA 5I5PA 3GZGA 3DP8A 1MY4A 4R75A 2DVZA 3MZBA 2GFEA 4LN5A 4RJZA 4YKKA 1N7XA 3M3KA 3VLWA 4R72A 5ET5A 1FPGA 1B7HA 4NF0A 2PCRA 4QSCA 2CEXA 4PFYA 3T1BA 1PB9A 2VPNA 3OEKA 2XXYA 3K6UA 5EQ7A 5B70A 3LC8A 2XXVA 3ZKKA 3U65A 2FVZA 2THIA 5T3JA 2HQ0A 2OWTA 3MVXA 1POY1 3SEUA 4OVJA 4LUBA 3B8BA 1LLSA 3OELA 1K9ZA 2Z8DA 1P1QA 4R73A 3IAZA 3SERA 1B58A 4I3EA 5EHMA 3CFZA 2WKYA 1M5CA 3H6WA 1DBZA 3U72A 1TFDA 5EHSA 3RT8A 4NGUA 4KYEA 1FBPA 1NV6A 2VD2A 4FEBA 1FBCA 3T66A 1MPBA 2DWAA 4U4XA 3C34A 3KBZA 2XXIA 1ZU0A 1XVYA 3FJGA 2DOJA 3K1MA 1GR2A 4HXVA 3B6QA 1Q1KA 5IKBA 1JETA 2I0CA 4Q5TA 1JVYA 3B50A 3FZVA 4I8CA 3IB1A 3SETA 1PDAA 3BFTA 3H6UA 2M8CA 4MLVA 3ECRA 4MAGA 1B3LA 3BBRA 2XD2A 4O3BA 5A5LA 5JK4A 1US5A 2XXWA 3IL1B 4OFOA 4XTCQ 4Z7EA 2R9JA 2XA5A 2V3TA 4F3SA 4H8IA 2DXYA 4GL0A 3JV9A 4F39A 3K02A 3G3IA 4ELPA 4P56A 3MP1A 4N17A 3H4ZA 1B05A 1OVTA 1MPCA 3Q26A 3N26A 2DS9A 1LBZA 2QMWA 2DE2A 4GLIA 3H03A 4G77A 3UP9A 1QGXA 1NV3A 3HHGA 1MY0A 1M5DA 3O28A 2PFZA 1FQEA 1DK4A 1Y4CA 1OLAA 3PPQA 4OWDA 5I59A 1MH3A 2IEEA 2REGA 2F5XA 4R6YA 1DTGA 5IZ3A 4AB5A 4X04A 4IO3A 3TKDA 4NF5A 5A5XB 1H76A 2DE4A 4P0GA 3VLVA 3KN3A 1NMUA 4MLQA 2O1LA 4GF8A 4N15A 1T0KA 1ZTYA 1JQFA 5FBPA 5I3SA 5I57A 3IB0A 3W9WA 3MVYA 3GLBA 1XHYA 2HFBA 5CMMA 2I49A 5H8FA 1RDZA 2QSXA 3K6WA 3MVZA 4MHFA 4N8GA 1USYH 4H5FA 4AQ4A 4P9KA 4JB7A 2ABHA 1QKAA 4X9TA 3PPPA 3FVOA 3HHFA 3DLNA 2I4BA 1D4NA 2HZLA 4FORA 3OD7A 4OENA 1SDXA 1GTKA 4XKNA 4PC9A 2UVIA 1BTJA 1JEVA 3KSJA 2DDKA 1B5IA 3BKIB 5TP9A 3ISPA 4N13A 2V3QA 4QFKA 3CG3A 1JNFA 1Q9DA 3RUMA 5H8NB 1B46A 3FV2A 1II5A 3I6VA 2ZZWA 4IO6A 4RXLA 4FIMA 3PU5A 1GV8A 2F34A 3U1OA 4RNSA 1D9YA 5FTHA 2AL4A 2E0SA 3FVGA 4X48A 1IITA 1DMBA 3SZPA 3W9VA 4R6HA 2O7IA 1A7LA 4NF8A 4O3AA 2V4CA 3RPWA 5AA4B 3RPLA 1QW0A 3FATA 5CMKA 5ET6A 3VLUA 1JW4A 2WBDA 3CVGA 5I56B 1MQHA 2ESNA 4K3FA 3TAJA 3KFMA 3U8QA 2QL3A 2Q2AA 4G68A 4KHZE 4GBVA 3HPIA 1H43A 5AA2A 2P3VA 4KI0E 4QSDA 1UQWA 2AL5A 1FQBA 4POWA 3K00A 2A5TA 5CBRA 1SW2A 4N6DA 1B9JA 2OK2A 2Y7PA 5DW8A 4OTEA 2OWZA 2RCBA 4EXKA 1ZJLA 2OCUA 4DXUA 3E9XA 3SEYA 3MJNA 3V5AA 3G3GA 1FQDA 3SESA 1IXIA 1FRPA 5L9MA 4PE5B 1MY1A 1NV5A 2DQVA 3T9VA 4Q0CA 4NE4A 4GBWA 1DTZA 2Y5KA 4N6PA 4PFRA 5KCJB 3N94A 3H7MA 4XF5A 2B3BA 3OO7A 2V25A 3FASA 4EF2A 5CM6A 3TPAA 3FVNA 5EYFA 4U22A 4TLLB 1B6HA 3PUYE 4ESWA 5DYHA 5FHMA 4XKQA 1WODA 1N04A 1OMPA 5AA2D 2QS1A 4P11A 1O7TA 4FAJA 3KG2A 5IAIA 2H9BA 4THIA 5ET7A 4WXJA 1FQFA 5DEXA 3PUZE 4X8RA 2XXXA 2D3IA 4F2OA 4OANA 4PFUA 3IR1A 1URGA 4X1BA 1ZMGA 2WEFA 4NMYA 3T93B 4P0IA 4OYVA 5HM4B 3H06B 1VR5A 1IIWA 3QUFA 4JVCA 3VXBA 1MXVA 3H3GA 3RGYA 3L6HA 1FTMA 4MJOA 2Y5LA 1LAGE 2IA4A 1N84A 5FHNA 3R7XA 4LP2B 2FIXA 4MBPA 3MC2A 3TQWA 3MAMA 1MDQA 2QVVA 1UTHA 2G93A 4ECFA 2VT5A 3BIGA 4QFOA 4EF1A 1NV7A 3IB2A 4I9DA 2YJPA 1CB6A 3DP4A 4XEQA 2QJEA 5H8QA 4ELRA 4KPTA 1PB8A 4F18A 3VVFA 4DE8A 2HAVA 1MM6A 2VOZA 1MXWA 3O6HA 4RA1A 4QF9A 4NF4A 1A8EA 1B1XA 3S2VA 1RDYA 4KXPA 4PDDA 2HCAA 3AXFA 3FGSA 1MY3A 4C1TA 4GWUA 4H65A 1NUWA 4NF6B 1BP5A 2P3NA 2O68A 3OSQA 1MG1A 4PQJA 3SEWA 4N81A 4LATA 4R2FA 5I2NB 3A3UA 4U1ZA 2H25A 1FQCA 1IQ7A 5CC2A 5LTCA 1OIBA 4NQ8A 2AYSA 3R26A 1ZBMA 3TTNA 3TEPA 3UK4A 1LGBC 4OQOA 1B3GA 3C32A 1CNQA 4YMBA 2Q8MA 4PETA 1FTKA 1B0HA 2NVUB 2XX9A 5B7DA 2I3VA 2ZNSA 3PMWA 4E0WA 2I0BA 2XX8A 1NH8A 4ZEDA 5BWJA 1SYHA 1B5HA 3FJMA 4NEDA 3O6IA 4PTKA 4XKPA 3LV0A 1NKXA 5TPAA 1UIVA 3DM0A 1FW0A 4YKJA 1POTA 4PDHA 3H6VA 5IZZA 3QXMA 4P1EA 1XI6A 3ILTB 4NTLA 1FPIA 3A3CA 5KZTA 1MY2A 1R9QA 3O2AA 2W7YA 2R71A 4GWWA 4P1LA 4LZ5A 3KJ7A 3N6UA 4NX1A 5K2XA 2RC9A 1IMBA 1SW4A 3N6TA 1A8FA 4G4PA 4GXAA 1P1WA 1SW1A 4U4SA 3IOTA 3CSGA 2Q74A 3LSWA 3DELB 5EQAA 3Q29A 1NNPA 1MDP1 1NUYA 2OWSA 3KZGA 1JVXA 4IB2A 3W15C 4NG7A 4PCDA 5AA3A 4U21A 4C1UA 2B3FA 2KLFA 2ZYKA 1LAFE 5DVJA 5I58A 3IOVA 1DPEA 3U92A 5H8NA 2HZKA 2A5SA 1AMFA 1BIYA 2D5WA 3OSRA 1O64A 1TXFA 3CHGA 4OVRA 5CMCA 1KA0A 3VV5A 3VVDA 1B7ZA 1MRPA 1B2HA 1VDWA 3TFLA 4TOZA 3MYUA 5EYGA 1AIVA 1Y3NA 2YPNA 3OOAA 4N4UA 4MNIA 3IFCA 2ZZVA 4H67A 4DZ1A 3OO8A 2H98A 3ZKLA 1ZIUA 1XOCA 3KOSA 4GWXA 2ONSA 2QS3A 1B32A 3D1RA 2Q88A 1ATGA 4KYSA 1KA1A 1FTAA 4LQ2A 1OQGA 3KN7A 5H8SA 3TDJA 1SBPA 4GRKA 4IGTA 2PVUA 4PE3A 5LOMA 1Y1MA 1M5EA 2CEYA 2VD3A 2QS2A 3C33A 1N76A 4ZE9A 1N3WA 5ICTA 1SD3A 1TFAA 1J1NA 2I3WA 5EQ8A 1TWYA 4JVDA 3IJOB 1H45A 3K1PA 4KD5A 1N0TA 2H99A 2KQZA 4F3GA 3VVEA 4NHBA 3FJ7A 3T22A 4F1UA 4FECA 1XS5A 2G29A 1I69A 5ICQA 2JJKA 4LA9A 5J1DA 2FIEA 5KCJA 1FBFA 4RPNA 4ZZEA 2P1SA 3CSBA 1AWBA 2F3DA 4GWOA 5ELVA 3V8XB 3HSTA 5LDZA 2ZZXA 4OA4A 2HXRA 2F6GA 3FXRA 4G8HA 3MW0A 1MH4A 2VPOA 2WBBA 1S9TA 5AA1A 3K0VA 3EF7A 1SI1A 1NL5A 3E4RA 1US4A 5IGAA 4TLMB 1I6BA 1LFIA 1N3XA 3D4GA 4IO4A 4IO5A 3KSXA 2AIXA 3MUQA 1URDA 4PGPA 3TCHA 2X7QA 1QJMA 3K01A 1Q35A 2DSFA 4ZEIA 1KZ8A 1NUZA 2RINA 1LBYA 2H4IA 2UXAA 2FA7A 1B3EA 2ONKE 2E1SA 1IMEA 3VDFA 1XT8A 4PP0A 1MQGA 1YZ0A 3IO4A 1JW5A 2PX1A 4DIGA 2O6AA 1LCTA 2CZKA 4PFBA 4ZE8A 2O69A 5F1QA 4MNCA 3IK6B 3I3VA 2XXRA 3QIMA 1RYXA 4YZZA 1MS7A 4F2QA 2R8TA 3GXAA 1Y4TA 4G8MA 4XKRA 4KR5A 3A09A 3ODBA 3PD8A 4PAIA 2R6GE 4GXSB 4LZ8A 2WYPA 2F3BA 2P2AA 3FXBA 4JSDA 1FTLA 4N6KA 2F35A 3IJXB 4BDNA 2MKZA 4NF6A 1Y3PA 3A29A 3K4UA 4L17A 3TMGA 2CZLA 2I4CA 4QFPA 1YPNA 1A40A 1RDXA 4ZECA 1URSA 4MFIA 3FXUA 3IX1A 1M5FA 3CFXA 3MQ9A 2FBPA 3S9NC 5L8DA 4U1OA 4EDPA 3ONMA 4KQPA 1LEVA 5EQ9A 1BLFA 5IZ3B 4NF5B 2VHAA 1JW1A 4C0RA 3OEMA 2O7UA 3UA8A 4JWOA 3O9PA 4G8NA 5BUUA 1VE4A 4I40A 3KC1A 3O66A 4YU0A 1YXIA 2B65A 2ZYNA 3EHSA 2PYYA 1FBGA 5DTBA 2PT1A 2RC7A 4F31B
chains in the Genus database with same CATH topology
4R2BA 1Y9UA 4DDDA 4UACA 2Z22A 3KBRA 5I2KB 3OO9A 4RYAA 3IORA 3OENA 3N5LA 3M3FA 4YMAA 3KGCA 2FYIA 5TP9B 3SEXA 3K1NA 4RPOA 1EZOA 2GH9A 3UGWA 1NNKA 4U2RA 2F8DA 3JYRA 2NOOA 3CFLA 1A55A 4R9FA 2ZYMA 3C36A 2PBWA 4OZ9A 2V93A 2YLNA 2ZMBA 3WAEA 4H0WA 1B4HA 3LSXA 3GBAA 3H6TA 4ZDMA 4EXLA 3C4MA 1VFEA 3TUSA 1H3DA 3I5OA 3RY3A 3BFUA 3M8UA 5TU0A 1EZPA 4HCWA 1OQHA 3TODA 2F97A 2DWJA 4Z0IA 4F19A 2ALUA 1FTJA 2F6PA 3MWBA 4WKMA 3RQTA 3TTKA 1D9VA 2PT2A 3TTLA 4DLDA 1OVBA 1Y3QA 4KCDA 5AA2B 2XXQA 3QSLA 3M3LA 1N7WA 4H5GA 3PUXE 2PMSA 1LFHA 2XX7A 4JSOA 1EZ9A 1LSTA 4YB7A 5JTYB 1F9BA 3PV0E 2OZZA 4HCYA 3CI8A 1S7YA 5H8HB 1NFTA 4GL8A 4R9GA 4F1YA 2GRVA 4ZEBA 1B5JA 1Z7NE 1SI0A 3O97A 3QUJA 3F11A 3FIRA 1P99A 2Q2CA 3QYTA 2DYXA 1GGGA 4NWDA 3C35A 1B52A 3TCFA 1MXXA 5HBCA 4YICA 4WEPA 1MQIA 1QKBA 5A5XA 1GVCA 3WAFA 4FATA 2XXHA 5DT6A 2GHAA 1LAHE 2QMXA 4ONYA 4I62A 3K6XA 4LVQA 3S9LC 1UTBB 1MQDA 3FUZA 4OEUA 4POXA 3K2DA 5CBSA 4RK9A 4I1DA 1Z7ME 1FCKA 3PPOA 2F7BA 1UTHB 1JEUA 1R1NA 1PB7A 3PMVA 1P1NA 2H5YA 4BDRA 1VSOA 1LBCA 3RN8A 4G68C 2ONRA 2ZYOA 1ELJA 2XD3A 5KDTB 1IXGA 2REJA 3TYHA 1P1UA 4FEDA 5H8QB 1KWHA 3KEIA 1LAXA 1AH5A 3U93A 1MXYA 2DWIA 1TT1A 1NNFA 4BDLA 4ELQA 3L6GA 4OEVA 1RYOA 2UVGA 3G3FA 4NF4B 4IY5A 2RF1A 3QK6A 4QSEA 4QFNA 1H44A 4NWCA 2X7PA 3MBPA 4IO2A 1MPDA 4HW8A 2NWJA 4M1VA 2Q8JA 3T96B 3LSLA 3TTMA 1ZLQA 2O1MA 3S9MC 5AA4A 4GFRA 3T9UA 1IZ1A 5DVIA 4Q30B 3V83A 4IGRA 1HSEA 5I56A 1MXZA 3VXCA 4OETA 4ESXA 5CRYA 1AL3A 4N07A 4KYDA 5M2VA 4QFLA 4QRZA 2F36A 3O29A 2HAUA 4HTGA 4ND9A 2DXRA 3EPEA 5FHOA 3PUVE 3KJTA 4FJPA 2V84A 1NNTA 1B7UA 1BKAA 1LFGA 3LBSA 3UN6A 2Y7KA 1IUDA 3O6GA 1XVXA 2ZNTA 1IXCA 3UIFA 2CMOA 1YAEA 2DWHA 3PPRA 4XIGQ 4JDFA 5TPAB 4DXCA 2F78A 3TZAA 1XC1A 3KN8A 4GD5A 1YTVA 4WEDA 3PGFA 4OXVA 4F1VA 3E3KA 1LBBA 4GOTA 2UYFA 1MQJA 1ZKBA 2DVCA 3EHUA 3V89B 5F7VA 2UYEA 1B4ZA 3KOTA 3RNNA 4MF3A 4F3PA 2O51A 3TELA 2O84X 1PEBA 4H8JA 3IOWA 2XXTA 1MXUA 3Q28A 3VFJA 3C9HA 3IOUA 2Z8EA 1FTOA 2GHBA 3MVWA 4JWXA 4GVOA 1EH3A 5I2KA 4OFJA 4IY6A 3THIA 4R6KA 4X1DA 4EUOA 4EQBA 2RCAA 1QULA 1B3HA 3TCGA 4YB6A 3EHTA 3D4CA 4F29A 5I58B 2Z23A 5FTIA 4RK2A 1B40A 3U94A 4KFQA 3MP8A 3CG1A 3MPLA 3LR1A 2QS4A 1A54A 1CE2A 4DCXA 1DPPA 3IO6A 3OMBA 3USDA 4U23A 4LONB 5ITOA 3MP6A 4H1XA 1R6ZA 2HXWA 4JWYA 4LQ5A 2HEUA 1O63A 1QUKA 4ZS9A 1I6AA 4GQOA 2OJTA 1UIUA 4EQ7A 2ZXTA 2XHDA 4R74A 4ZEKA 2X26A 1D3KA 3RTWB 1SW5A 1AOVA 3SDFA 2ZNUA 1S50A 3B6TA 3VE1B 4BLAA 3LUYA 3OO6A 3S9EA 4F22A 3PPNA 3EQ1A 1ANFA 1PC3A 5HPQA 3G3HA 1Y20A 2Y84A 1LB9A 5K2YA 2I58A 3OXNA 2NXOA 3B6WA 5I2NA 5AE4A 3DP6A 1SYIA 4HS7A 2VGQA 1A99A 3UORA 5I59B 2QPQA 3Q27A 2I48A 2F7CA 2XXPA 5JTYA 3PMXA 2I6EA 3HO7A 4H6DA 3G7WA 4RY1A 3RT6B 3HV1A 4YB5A 1LCFA 5H8HA 1R9LA 5I57B 2DE3A 2RKMA 5ITPA 4ZEFA 3T9HB 2OBGA 5H8FB 1NH7A 4ISUA 1WDNA 1B51A 1PBPA 3RLFE 4UA8A 1DSNA 1B3FA 1HSLA 2VP1A 4FE8A 3FXQA 4IO7A 1FQAA 1YCJA 1I6QA 4MH5A 2QRYA 4XXUA 4TQUQ 3RTFB 3SEVA 1M5BA 2V3UA 3Q25A 4PFTA 2FNCA 4QHQA 3QAXA 3TTRA 3B7DA 1WVJA 1OLCA 3HN0A 1IXHA 4BDOA 3CIJA 5L9SA 1UTBA 3FD3A 3S4UA 4OFLA 1IEJA 1LB8A 3PD9A 4M4GA 4OESA 1VFDA 5JEIA 3FVKA 1Y1ZA 2DP8A 4YKPA 2RC8A 4NF8B 5KDTA 1DOTA 5CMBA 1B1HA 4EQ9A 2Q89A 2F7AA 3TQLA 4JBZA 4AB6A 1RKMA 3G3JA 3CRBA 4GIZA 4G68B 4BDMA 2D21A 1QVSA 3JZJA 3MZ9A 4Q8RA 4OMBA 1L5TA 3MPKA 5L9OA 2Y7IA 4DXBA 5DVFA 2A5TB 2Z8FA 4OHNA 2Y7WA 4LZ7A 4OERA 2NUVA 1QUIA 3HCQA 4E0XA 3C31A 1HSJA 1QUJA 2BJJX 2UVHA 4JXIA 4ELOA 2Q9TA 1PBQA 4PFWA 4YAHX 3G3KA 3R6UA 1USYE 3SKPA 5CI5A 4G2ZA 1SQYA 4F3BA 4ZZAA 4DCYA 3K6VA 1MM7A 2P0SA 3T9XB 3GBBA 3EN3A 2XXUA 5DEXB 3CR9A 2ANJA 4BDQA 3LSFB 1B0LA 2LAOA 1SVXB 3ZSFA 3MZ1A 4O3CA 2Y7RA 2UVJA 1EU8A 3FV1A 3PUWE 3E13X 4YKIA 4KCCA 5ISUA 1P1OA 3ZS6A 5I84A 3P7IA 3ILUB 2OLBA 3GZGA 3DP8A 1MY4A 4R75A 2DVZA 3MZBA 2GFEA 4RJZA 4YKKA 1N7XA 3M3KA 3VLWA 4R72A 1B7HA 4QSCA 4PFYA 1PB9A 3OEKA 2XXYA 3K6UA 5B70A 3LC8A 2XXVA 3ZKKA 2THIA 2HQ0A 2OWTA 3MVXA 1POY1 3SEUA 4OVJA 4LUBA 1LLSA 3OELA 2Z8DA 1P1QA 4R73A 3IAZA 3SERA 1B58A 5EHMA 3CFZA 2WKYA 1M5CA 3H6WA 3U72A 1TFDA 5EHSA 3RT8A 4KYEA 2VD2A 4FEBA 3T66A 1MPBA 2DWAA 4U4XA 3C34A 2XXIA 1ZU0A 1XVYA 3FJGA 2DOJA 3K1MA 1GR2A 3B6QA 1Q1KA 5IKBA 1JETA 2I0CA 4Q5TA 1JVYA 3FZVA 4I8CA 3IB1A 3SETA 1PDAA 3BFTA 3H6UA 2M8CA 4MLVA 3ECRA 1B3LA 3BBRA 2XD2A 4O3BA 5JK4A 1US5A 2XXWA 3IL1B 4OFOA 4XTCQ 4Z7EA 2R9JA 2V3TA 4F3SA 4H8IA 2DXYA 4GL0A 3JV9A 4F39A 3K02A 3G3IA 4ELPA 3MP1A 3H4ZA 1B05A 1OVTA 1MPCA 3Q26A 3N26A 2DS9A 2QMWA 2DE2A 4GLIA 3H03A 4G77A 3UP9A 3HHGA 1MY0A 1M5DA 3O28A 1FQEA 1Y4CA 1OLAA 3PPQA 4OWDA 5I59A 1MH3A 2IEEA 2REGA 2F5XA 4R6YA 1DTGA 4AB5A 4IO3A 3TKDA 4NF5A 5A5XB 1H76A 2DE4A 4P0GA 3VLVA 3KN3A 1NMUA 4MLQA 2O1LA 4GF8A 1T0KA 1ZTYA 1JQFA 5I57A 3IB0A 3W9WA 3MVYA 3GLBA 1XHYA 2HFBA 5CMMA 2I49A 5H8FA 2QSXA 3K6WA 3MVZA 1USYH 4H5FA 4AQ4A 4JB7A 2ABHA 1QKAA 4X9TA 3PPPA 3FVOA 3HHFA 3DLNA 2I4BA 1D4NA 2HZLA 4FORA 3OD7A 4OENA 1SDXA 1GTKA 4XKNA 2UVIA 1BTJA 1JEVA 3KSJA 1B5IA 3BKIB 5TP9A 4N13A 2V3QA 4QFKA 3CG3A 1JNFA 3RUMA 5H8NB 1B46A 3FV2A 1II5A 3I6VA 4IO6A 4RXLA 4FIMA 3PU5A 1GV8A 2F34A 3U1OA 4RNSA 1D9YA 5FTHA 2AL4A 2E0SA 3FVGA 4X48A 1IITA 1DMBA 3W9VA 4R6HA 2O7IA 1A7LA 4NF8A 4O3AA 3RPWA 5AA4B 1QW0A 3FATA 5CMKA 3VLUA 1JW4A 3CVGA 5I56B 1MQHA 2ESNA 4K3FA 3TAJA 3KFMA 3U8QA 2QL3A 2Q2AA 4G68A 4KHZE 3HPIA 1H43A 5AA2A 4KI0E 4QSDA 1UQWA 2AL5A 1FQBA 4POWA 3K00A 2A5TA 5CBRA 1SW2A 1B9JA 2OK2A 2Y7PA 4OTEA 2RCBA 4EXKA 1ZJLA 2OCUA 4DXUA 3E9XA 3SEYA 3MJNA 3V5AA 3G3GA 1FQDA 3SESA 1IXIA 5L9MA 4PE5B 1MY1A 2DQVA 3T9VA 4Q0CA 4NE4A 1DTZA 4N6PA 5KCJB 3N94A 3H7MA 2B3BA 3OO7A 2V25A 3FASA 4EF2A 5CM6A 3TPAA 3FVNA 5EYFA 4U22A 4TLLB 1B6HA 3PUYE 4ESWA 5DYHA 5FHMA 4XKQA 1WODA 1N04A 1OMPA 5AA2D 2QS1A 4P11A 1O7TA 4FAJA 3KG2A 5IAIA 2H9BA 4THIA 4WXJA 1FQFA 5DEXA 3PUZE 2XXXA 2D3IA 4F2OA 4PFUA 3IR1A 1URGA 4X1BA 1ZMGA 4NMYA 3T93B 4P0IA 4OYVA 5HM4B 3H06B 1VR5A 1IIWA 3QUFA 3VXBA 1MXVA 3H3GA 3RGYA 3L6HA 1FTMA 1LAGE 2IA4A 1N84A 5FHNA 3R7XA 4LP2B 4MBPA 3MC2A 3TQWA 3MAMA 1MDQA 1UTHA 2G93A 4ECFA 4QFOA 4EF1A 3IB2A 4I9DA 2YJPA 1CB6A 3DP4A 2QJEA 5H8QA 4ELRA 4KPTA 1PB8A 4F18A 3VVFA 4DE8A 2HAVA 1MM6A 2VOZA 1MXWA 3O6HA 4RA1A 4QF9A 4NF4A 1A8EA 1B1XA 3S2VA 2HCAA 3AXFA 3FGSA 1MY3A 4C1TA 4H65A 4NF6B 1BP5A 2O68A 3OSQA 1MG1A 4PQJA 3SEWA 4LATA 4R2FA 5I2NB 3A3UA 4U1ZA 2H25A 1FQCA 1IQ7A 5CC2A 1OIBA 2AYSA 3R26A 1ZBMA 3TTNA 3TEPA 3UK4A 1LGBC 4OQOA 1B3GA 3C32A 4YMBA 4PETA 1FTKA 1B0HA 2NVUB 2XX9A 5B7DA 2I3VA 2ZNSA 3PMWA 4E0WA 2I0BA 2XX8A 1NH8A 4ZEDA 5BWJA 1SYHA 1B5HA 3FJMA 4NEDA 3O6IA 4XKPA 1NKXA 5TPAA 1UIVA 3DM0A 1FW0A 4YKJA 1POTA 3H6VA 3QXMA 3ILTB 4NTLA 3A3CA 5KZTA 1MY2A 1R9QA 3O2AA 2W7YA 2R71A 4LZ5A 3KJ7A 3N6UA 5K2XA 2RC9A 1SW4A 3N6TA 1A8FA 4G4PA 4GXAA 1P1WA 1SW1A 4U4SA 3IOTA 3CSGA 3LSWA 3DELB 3Q29A 1NNPA 1MDP1 2OWSA 3KZGA 1JVXA 4IB2A 3W15C 5AA3A 4U21A 4C1UA 2B3FA 2KLFA 2ZYKA 1LAFE 5DVJA 5I58A 3IOVA 1DPEA 3U92A 5H8NA 2HZKA 2A5SA 1AMFA 1BIYA 2D5WA 3OSRA 1O64A 1TXFA 5CMCA 3VV5A 3VVDA 1B7ZA 1MRPA 1B2HA 3TFLA 4TOZA 1AIVA 1Y3NA 2YPNA 3OOAA 4H67A 4DZ1A 3OO8A 2H98A 3ZKLA 1ZIUA 1XOCA 3KOSA 2ONSA 2QS3A 1B32A 2Q88A 1ATGA 4KYSA 4LQ2A 1OQGA 3KN7A 5H8SA 3TDJA 1SBPA 4GRKA 4IGTA 2PVUA 5LOMA 1Y1MA 1M5EA 2VD3A 2QS2A 3C33A 1N76A 4ZE9A 1N3WA 5ICTA 1SD3A 1TFAA 1J1NA 2I3WA 1TWYA 3IJOB 1H45A 3K1PA 4KD5A 1N0TA 2H99A 4F3GA 3VVEA 3FJ7A 3T22A 4F1UA 4FECA 1XS5A 2G29A 1I69A 5ICQA 4LA9A 5J1DA 5KCJA 4RPNA 4ZZEA 2P1SA 3CSBA 4GWOA 5ELVA 3V8XB 3HSTA 2F6GA 3FXRA 4G8HA 3MW0A 1MH4A 1S9TA 5AA1A 3K0VA 3EF7A 1SI1A 1NL5A 3E4RA 1US4A 4TLMB 1I6BA 1LFIA 1N3XA 3D4GA 4IO4A 4IO5A 3KSXA 2AIXA 3MUQA 1URDA 3TCHA 2X7QA 1QJMA 3K01A 1Q35A 2DSFA 4ZEIA 2RINA 2H4IA 2UXAA 2FA7A 1B3EA 2ONKE 2E1SA 3VDFA 1XT8A 4PP0A 1MQGA 3IO4A 1JW5A 2PX1A 4DIGA 2O6AA 1LCTA 4ZE8A 2O69A 5F1QA 3IK6B 3I3VA 2XXRA 3QIMA 1RYXA 4YZZA 1MS7A 4F2QA 3GXAA 1Y4TA 4G8MA 4XKRA 4KR5A 3A09A 3ODBA 3PD8A 2R6GE 4GXSB 4LZ8A 2P2AA 4JSDA 1FTLA 2F35A 3IJXB 4BDNA 4NF6A 1Y3PA 3K4UA 4L17A 3TMGA 2CZLA 2I4CA 4QFPA 1YPNA 1A40A 4ZECA 1URSA 4MFIA 3FXUA 3IX1A 1M5FA 3CFXA 3MQ9A 3S9NC 5L8DA 4U1OA 4EDPA 3ONMA 4KQPA 1BLFA 4NF5B 2VHAA 1JW1A 4C0RA 3OEMA 2O7UA 3UA8A 4JWOA 3O9PA 4G8NA 5BUUA 1VE4A 3O66A 4YU0A 2B65A 2ZYNA 3EHSA 2PYYA 5DTBA 2PT1A 4F31B 2RC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2B A;  1Y9U A;  4DDD A;  4UAC A;  2Z22 A;  3KBR A;  5I2K B;  3OO9 A;  4RYA A;  3IOR A;  3OEN A;  3N5L A;  3M3F A;  4YMA A;  3KGC A;  2FYI A;  5TP9 B;  3SEX A;  3K1N A;  4RPO A;  1EZO A;  2GH9 A;  3UGW A;  1NNK A;  4U2R A;  2F8D A;  3JYR A;  2NOO A;  3CFL A;  1A55 A;  4R9F A;  2ZYM A;  3C36 A;  2PBW A;  4OZ9 A;  2V93 A;  2YLN A;  2ZMB A;  3WAE A;  4H0W A;  1B4H A;  3LSX A;  3GBA A;  3H6T A;  4ZDM A;  4EXL A;  3C4M A;  1VFE A;  3TUS A;  1H3D A;  3I5O A;  3RY3 A;  3BFU A;  3M8U A;  5TU0 A;  1EZP A;  4HCW A;  1OQH A;  3TOD A;  2F97 A;  2DWJ A;  4Z0I A;  4F19 A;  2ALU A;  1FTJ A;  2F6P A;  3MWB A;  4WKM A;  3RQT A;  3TTK A;  1D9V A;  2PT2 A;  3TTL A;  4DLD A;  1OVB A;  1Y3Q A;  4KCD A;  5AA2 B;  2XXQ A;  3QSL A;  3M3L A;  1N7W A;  4H5G A;  3PUX E;  2PMS A;  1LFH A;  2XX7 A;  4JSO A;  1EZ9 A;  1LST A;  4YB7 A;  5JTY B;  1F9B A;  3PV0 E;  2OZZ A;  4HCY A;  3CI8 A;  1S7Y A;  5H8H B;  1NFT A;  4GL8 A;  4R9G A;  4F1Y A;  2GRV A;  4ZEB A;  1B5J A;  1Z7N E;  1SI0 A;  3O97 A;  3QUJ A;  3F11 A;  3FIR A;  1P99 A;  2Q2C A;  3QYT A;  2DYX A;  1GGG A;  4NWD A;  3C35 A;  1B52 A;  3TCF A;  1MXX A;  5HBC A;  4YIC A;  4WEP A;  1MQI A;  1QKB A;  5A5X A;  1GVC A;  3WAF A;  4FAT A;  2XXH A;  5DT6 A;  2GHA A;  1LAH E;  2QMX A;  4ONY A;  4I62 A;  3K6X A;  4LVQ A;  3S9L C;  1UTB B;  1MQD A;  3FUZ A;  4OEU A;  4POX A;  3K2D A;  5CBS A;  4RK9 A;  4I1D A;  1Z7M E;  1FCK A;  3PPO A;  2F7B A;  1UTH B;  1JEU A;  1R1N A;  1PB7 A;  3PMV A;  1P1N A;  2H5Y A;  4BDR A;  1VSO A;  1LBC A;  3RN8 A;  4G68 C;  2ONR A;  2ZYO A;  1ELJ A;  2XD3 A;  5KDT B;  1IXG A;  2REJ A;  3TYH A;  1P1U A;  4FED A;  5H8Q B;  1KWH A;  3KEI A;  1LAX A;  1AH5 A;  3U93 A;  1MXY A;  2DWI A;  1TT1 A;  1NNF A;  4BDL A;  4ELQ A;  3L6G A;  4OEV A;  1RYO A;  2UVG A;  3G3F A;  4NF4 B;  4IY5 A;  2RF1 A;  3QK6 A;  4QSE A;  4QFN A;  1H44 A;  4NWC A;  2X7P A;  3MBP A;  4IO2 A;  1MPD A;  4HW8 A;  2NWJ A;  4M1V A;  2Q8J A;  3T96 B;  3LSL A;  3TTM A;  1ZLQ A;  2O1M A;  3S9M C;  5AA4 A;  4GFR A;  3T9U A;  1IZ1 A;  5DVI A;  4Q30 B;  3V83 A;  4IGR A;  1HSE A;  5I56 A;  1MXZ A;  3VXC A;  4OET A;  4ESX A;  5CRY A;  1AL3 A;  4N07 A;  4KYD A;  5M2V A;  4QFL A;  4QRZ A;  2F36 A;  3O29 A;  2HAU A;  4HTG A;  4ND9 A;  2DXR A;  3EPE A;  5FHO A;  3PUV E;  3KJT A;  4FJP A;  2V84 A;  1NNT A;  1B7U A;  1BKA A;  1LFG A;  3LBS A;  3UN6 A;  2Y7K A;  1IUD A;  3O6G A;  1XVX A;  2ZNT A;  1IXC A;  3UIF A;  2CMO A;  1YAE A;  2DWH A;  3PPR A;  4XIG Q;  4JDF A;  5TPA B;  4DXC A;  2F78 A;  3TZA A;  1XC1 A;  3KN8 A;  4GD5 A;  1YTV A;  4WED A;  3PGF A;  4OXV A;  4F1V A;  3E3K A;  1LBB A;  4GOT A;  2UYF A;  1MQJ A;  1ZKB A;  2DVC A;  3EHU A;  3V89 B;  5F7V A;  2UYE A;  1B4Z A;  3KOT A;  3RNN A;  4MF3 A;  4F3P A;  2O51 A;  3TEL A;  2O84 X;  1PEB A;  4H8J A;  3IOW A;  2XXT A;  1MXU A;  3Q28 A;  3VFJ A;  3C9H A;  3IOU A;  2Z8E A;  1FTO A;  2GHB A;  3MVW A;  4JWX A;  4GVO A;  1EH3 A;  5I2K A;  4OFJ A;  4IY6 A;  3THI A;  4R6K A;  4X1D A;  4EUO A;  4EQB A;  2RCA A;  1QUL A;  1B3H A;  3TCG A;  4YB6 A;  3EHT A;  3D4C A;  4F29 A;  5I58 B;  2Z23 A;  5FTI A;  4RK2 A;  1B40 A;  3U94 A;  4KFQ A;  3MP8 A;  3CG1 A;  3MPL A;  3LR1 A;  2QS4 A;  1A54 A;  1CE2 A;  4DCX A;  1DPP A;  3IO6 A;  3OMB A;  3USD A;  4U23 A;  4LON B;  5ITO A;  3MP6 A;  4H1X A;  1R6Z A;  2HXW A;  4JWY A;  4LQ5 A;  2HEU A;  1O63 A;  1QUK A;  4ZS9 A;  1I6A A;  4GQO A;  2OJT A;  1UIU A;  4EQ7 A;  2ZXT A;  2XHD A;  4R74 A;  4ZEK A;  2X26 A;  1D3K A;  3RTW B;  1SW5 A;  1AOV A;  3SDF A;  2ZNU A;  1S50 A;  3B6T A;  3VE1 B;  4BLA A;  3LUY A;  3OO6 A;  3S9E A;  4F22 A;  3PPN A;  3EQ1 A;  1ANF A;  1PC3 A;  5HPQ A;  3G3H A;  1Y20 A;  2Y84 A;  1LB9 A;  5K2Y A;  2I58 A;  3OXN A;  2NXO A;  3B6W A;  5I2N A;  5AE4 A;  3DP6 A;  1SYI A;  4HS7 A;  2VGQ A;  1A99 A;  3UOR A;  5I59 B;  2QPQ A;  3Q27 A;  2I48 A;  2F7C A;  2XXP A;  5JTY A;  3PMX A;  2I6E A;  3HO7 A;  4H6D A;  3G7W A;  4RY1 A;  3RT6 B;  3HV1 A;  4YB5 A;  1LCF A;  5H8H A;  1R9L A;  5I57 B;  2DE3 A;  2RKM A;  5ITP A;  4ZEF A;  3T9H B;  2OBG A;  5H8F B;  1NH7 A;  4ISU A;  1WDN A;  1B51 A;  1PBP A;  3RLF E;  4UA8 A;  1DSN A;  1B3F A;  1HSL A;  2VP1 A;  4FE8 A;  3FXQ A;  4IO7 A;  1FQA A;  1YCJ A;  1I6Q A;  4MH5 A;  2QRY A;  4XXU A;  4TQU Q;  3RTF B;  3SEV A;  1M5B A;  2V3U A;  3Q25 A;  4PFT A;  2FNC A;  4QHQ A;  3QAX A;  3TTR A;  3B7D A;  1WVJ A;  1OLC A;  3HN0 A;  1IXH A;  4BDO A;  3CIJ A;  5L9S A;  1UTB A;  3FD3 A;  3S4U A;  4OFL A;  1IEJ A;  1LB8 A;  3PD9 A;  4M4G A;  4OES A;  1VFD A;  5JEI A;  3FVK A;  1Y1Z A;  2DP8 A;  4YKP A;  2RC8 A;  4NF8 B;  5KDT A;  1DOT A;  5CMB A;  1B1H A;  4EQ9 A;  2Q89 A;  2F7A A;  3TQL A;  4JBZ A;  4AB6 A;  1RKM A;  3G3J A;  3CRB A;  4GIZ A;  4G68 B;  4BDM A;  2D21 A;  1QVS A;  3JZJ A;  3MZ9 A;  4Q8R A;  4OMB A;  1L5T A;  3MPK A;  5L9O A;  2Y7I A;  4DXB A;  5DVF A;  2A5T B;  2Z8F A;  4OHN A;  2Y7W A;  4LZ7 A;  4OER A;  2NUV A;  1QUI A;  3HCQ A;  4E0X A;  3C31 A;  1HSJ A;  1QUJ A;  2BJJ X;  2UVH A;  4JXI A;  4ELO A;  2Q9T A;  1PBQ A;  4PFW A;  4YAH X;  3G3K A;  3R6U A;  1USY E;  3SKP A;  5CI5 A;  4G2Z A;  1SQY A;  4F3B A;  4ZZA A;  4DCY A;  3K6V A;  1MM7 A;  2P0S A;  3T9X B;  3GBB A;  3EN3 A;  2XXU A;  5DEX B;  3CR9 A;  2ANJ A;  4BDQ A;  3LSF B;  1B0L A;  2LAO A;  1SVX B;  3ZSF A;  3MZ1 A;  4O3C A;  2Y7R A;  2UVJ A;  1EU8 A;  3FV1 A;  3PUW E;  3E13 X;  4YKI A;  4KCC A;  5ISU A;  1P1O A;  3ZS6 A;  5I84 A;  3P7I A;  3ILU B;  2OLB A;  3GZG A;  3DP8 A;  1MY4 A;  4R75 A;  2DVZ A;  3MZB A;  2GFE A;  4RJZ A;  4YKK A;  1N7X A;  3M3K A;  3VLW A;  4R72 A;  1B7H A;  4QSC A;  4PFY A;  1PB9 A;  3OEK A;  2XXY A;  3K6U A;  5B70 A;  3LC8 A;  2XXV A;  3ZKK A;  2THI A;  2HQ0 A;  2OWT A;  3MVX A;  1POY 1;  3SEU A;  4OVJ A;  4LUB A;  1LLS A;  3OEL A;  2Z8D A;  1P1Q A;  4R73 A;  3IAZ A;  3SER A;  1B58 A;  5EHM A;  3CFZ A;  2WKY A;  1M5C A;  3H6W A;  3U72 A;  1TFD A;  5EHS A;  3RT8 A;  4KYE A;  2VD2 A;  4FEB A;  3T66 A;  1MPB A;  2DWA A;  4U4X A;  3C34 A;  2XXI A;  1ZU0 A;  1XVY A;  3FJG A;  2DOJ A;  3K1M A;  1GR2 A;  3B6Q A;  1Q1K A;  5IKB A;  1JET A;  2I0C A;  4Q5T A;  1JVY A;  3FZV A;  4I8C A;  3IB1 A;  3SET A;  1PDA A;  3BFT A;  3H6U A;  2M8C A;  4MLV A;  3ECR A;  1B3L A;  3BBR A;  2XD2 A;  4O3B A;  5JK4 A;  1US5 A;  2XXW A;  3IL1 B;  4OFO A;  4XTC Q;  4Z7E A;  2R9J A;  2V3T A;  4F3S A;  4H8I A;  2DXY A;  4GL0 A;  3JV9 A;  4F39 A;  3K02 A;  3G3I A;  4ELP A;  3MP1 A;  3H4Z A;  1B05 A;  1OVT A;  1MPC A;  3Q26 A;  3N26 A;  2DS9 A;  2QMW A;  2DE2 A;  4GLI A;  3H03 A;  4G77 A;  3UP9 A;  3HHG A;  1MY0 A;  1M5D A;  3O28 A;  1FQE A;  1Y4C A;  1OLA A;  3PPQ A;  4OWD A;  5I59 A;  1MH3 A;  2IEE A;  2REG A;  2F5X A;  4R6Y A;  1DTG A;  4AB5 A;  4IO3 A;  3TKD A;  4NF5 A;  5A5X B;  1H76 A;  2DE4 A;  4P0G A;  3VLV A;  3KN3 A;  1NMU A;  4MLQ A;  2O1L A;  4GF8 A;  1T0K A;  1ZTY A;  1JQF A;  5I57 A;  3IB0 A;  3W9W A;  3MVY A;  3GLB A;  1XHY A;  2HFB A;  5CMM A;  2I49 A;  5H8F A;  2QSX A;  3K6W A;  3MVZ A;  1USY H;  4H5F A;  4AQ4 A;  4JB7 A;  2ABH A;  1QKA A;  4X9T A;  3PPP A;  3FVO A;  3HHF A;  3DLN A;  2I4B A;  1D4N A;  2HZL A;  4FOR A;  3OD7 A;  4OEN A;  1SDX A;  1GTK A;  4XKN A;  2UVI A;  1BTJ A;  1JEV A;  3KSJ A;  1B5I A;  3BKI B;  5TP9 A;  4N13 A;  2V3Q A;  4QFK A;  3CG3 A;  1JNF A;  3RUM A;  5H8N B;  1B46 A;  3FV2 A;  1II5 A;  3I6V A;  4IO6 A;  4RXL A;  4FIM A;  3PU5 A;  1GV8 A;  2F34 A;  3U1O A;  4RNS A;  1D9Y A;  5FTH A;  2AL4 A;  2E0S A;  3FVG A;  4X48 A;  1IIT A;  1DMB A;  3W9V A;  4R6H A;  2O7I A;  1A7L A;  4NF8 A;  4O3A A;  3RPW A;  5AA4 B;  1QW0 A;  3FAT A;  5CMK A;  3VLU A;  1JW4 A;  3CVG A;  5I56 B;  1MQH A;  2ESN A;  4K3F A;  3TAJ A;  3KFM A;  3U8Q A;  2QL3 A;  2Q2A A;  4G68 A;  4KHZ E;  3HPI A;  1H43 A;  5AA2 A;  4KI0 E;  4QSD A;  1UQW A;  2AL5 A;  1FQB A;  4POW A;  3K00 A;  2A5T A;  5CBR A;  1SW2 A;  1B9J A;  2OK2 A;  2Y7P A;  4OTE A;  2RCB A;  4EXK A;  1ZJL A;  2OCU A;  4DXU A;  3E9X A;  3SEY A;  3MJN A;  3V5A A;  3G3G A;  1FQD A;  3SES A;  1IXI A;  5L9M A;  4PE5 B;  1MY1 A;  2DQV A;  3T9V A;  4Q0C A;  4NE4 A;  1DTZ A;  4N6P A;  5KCJ B;  3N94 A;  3H7M A;  2B3B A;  3OO7 A;  2V25 A;  3FAS A;  4EF2 A;  5CM6 A;  3TPA A;  3FVN A;  5EYF A;  4U22 A;  4TLL B;  1B6H A;  3PUY E;  4ESW A;  5DYH A;  5FHM A;  4XKQ A;  1WOD A;  1N04 A;  1OMP A;  5AA2 D;  2QS1 A;  4P11 A;  1O7T A;  4FAJ A;  3KG2 A;  5IAI A;  2H9B A;  4THI A;  4WXJ A;  1FQF A;  5DEX A;  3PUZ E;  2XXX A;  2D3I A;  4F2O A;  4PFU A;  3IR1 A;  1URG A;  4X1B A;  1ZMG A;  4NMY A;  3T93 B;  4P0I A;  4OYV A;  5HM4 B;  3H06 B;  1VR5 A;  1IIW A;  3QUF A;  3VXB A;  1MXV A;  3H3G A;  3RGY A;  3L6H A;  1FTM A;  1LAG E;  2IA4 A;  1N84 A;  5FHN A;  3R7X A;  4LP2 B;  4MBP A;  3MC2 A;  3TQW A;  3MAM A;  1MDQ A;  1UTH A;  2G93 A;  4ECF A;  4QFO A;  4EF1 A;  3IB2 A;  4I9D A;  2YJP A;  1CB6 A;  3DP4 A;  2QJE A;  5H8Q A;  4ELR A;  4KPT A;  1PB8 A;  4F18 A;  3VVF A;  4DE8 A;  2HAV A;  1MM6 A;  2VOZ A;  1MXW A;  3O6H A;  4RA1 A;  4QF9 A;  4NF4 A;  1A8E A;  1B1X A;  3S2V A;  2HCA A;  3AXF A;  3FGS A;  1MY3 A;  4C1T A;  4H65 A;  4NF6 B;  1BP5 A;  2O68 A;  3OSQ A;  1MG1 A;  4PQJ A;  3SEW A;  4LAT A;  4R2F A;  5I2N B;  3A3U A;  4U1Z A;  2H25 A;  1FQC A;  1IQ7 A;  5CC2 A;  1OIB A;  2AYS A;  3R26 A;  1ZBM A;  3TTN A;  3TEP A;  3UK4 A;  1LGB C;  4OQO A;  1B3G A;  3C32 A;  4YMB A;  4PET A;  1FTK A;  1B0H A;  2NVU B;  2XX9 A;  5B7D A;  2I3V A;  2ZNS A;  3PMW A;  4E0W A;  2I0B A;  2XX8 A;  1NH8 A;  4ZED A;  5BWJ A;  1SYH A;  1B5H A;  3FJM A;  4NED A;  3O6I A;  4XKP A;  1NKX A;  5TPA A;  1UIV A;  3DM0 A;  1FW0 A;  4YKJ A;  1POT A;  3H6V A;  3QXM A;  3ILT B;  4NTL A;  3A3C A;  5KZT A;  1MY2 A;  1R9Q A;  3O2A A;  2W7Y A;  2R71 A;  4LZ5 A;  3KJ7 A;  3N6U A;  5K2X A;  2RC9 A;  1SW4 A;  3N6T A;  1A8F A;  4G4P A;  4GXA A;  1P1W A;  1SW1 A;  4U4S A;  3IOT A;  3CSG A;  3LSW A;  3DEL B;  3Q29 A;  1NNP A;  1MDP 1;  2OWS A;  3KZG A;  1JVX A;  4IB2 A;  3W15 C;  5AA3 A;  4U21 A;  4C1U A;  2B3F A;  2KLF A;  2ZYK A;  1LAF E;  5DVJ A;  5I58 A;  3IOV A;  1DPE A;  3U92 A;  5H8N A;  2HZK A;  2A5S A;  1AMF A;  1BIY A;  2D5W A;  3OSR A;  1O64 A;  1TXF A;  5CMC A;  3VV5 A;  3VVD A;  1B7Z A;  1MRP A;  1B2H A;  3TFL A;  4TOZ A;  1AIV A;  1Y3N A;  2YPN A;  3OOA A;  4H67 A;  4DZ1 A;  3OO8 A;  2H98 A;  3ZKL A;  1ZIU A;  1XOC A;  3KOS A;  2ONS A;  2QS3 A;  1B32 A;  2Q88 A;  1ATG A;  4KYS A;  4LQ2 A;  1OQG A;  3KN7 A;  5H8S A;  3TDJ A;  1SBP A;  4GRK A;  4IGT A;  2PVU A;  5LOM A;  1Y1M A;  1M5E A;  2VD3 A;  2QS2 A;  3C33 A;  1N76 A;  4ZE9 A;  1N3W A;  5ICT A;  1SD3 A;  1TFA A;  1J1N A;  2I3W A;  1TWY A;  3IJO B;  1H45 A;  3K1P A;  4KD5 A;  1N0T A;  2H99 A;  4F3G A;  3VVE A;  3FJ7 A;  3T22 A;  4F1U A;  4FEC A;  1XS5 A;  2G29 A;  1I69 A;  5ICQ A;  4LA9 A;  5J1D A;  5KCJ A;  4RPN A;  4ZZE A;  2P1S A;  3CSB A;  4GWO A;  5ELV A;  3V8X B;  3HST A;  2F6G A;  3FXR A;  4G8H A;  3MW0 A;  1MH4 A;  1S9T A;  5AA1 A;  3K0V A;  3EF7 A;  1SI1 A;  1NL5 A;  3E4R A;  1US4 A;  4TLM B;  1I6B A;  1LFI A;  1N3X A;  3D4G A;  4IO4 A;  4IO5 A;  3KSX A;  2AIX A;  3MUQ A;  1URD A;  3TCH A;  2X7Q A;  1QJM A;  3K01 A;  1Q35 A;  2DSF A;  4ZEI A;  2RIN A;  2H4I A;  2UXA A;  2FA7 A;  1B3E A;  2ONK E;  2E1S A;  3VDF A;  1XT8 A;  4PP0 A;  1MQG A;  3IO4 A;  1JW5 A;  2PX1 A;  4DIG A;  2O6A A;  1LCT A;  4ZE8 A;  2O69 A;  5F1Q A;  3IK6 B;  3I3V A;  2XXR A;  3QIM A;  1RYX A;  4YZZ A;  1MS7 A;  4F2Q A;  3GXA A;  1Y4T A;  4G8M A;  4XKR A;  4KR5 A;  3A09 A;  3ODB A;  3PD8 A;  2R6G E;  4GXS B;  4LZ8 A;  2P2A A;  4JSD A;  1FTL A;  2F35 A;  3IJX B;  4BDN A;  4NF6 A;  1Y3P A;  3K4U A;  4L17 A;  3TMG A;  2CZL A;  2I4C A;  4QFP A;  1YPN A;  1A40 A;  4ZEC A;  1URS A;  4MFI A;  3FXU A;  3IX1 A;  1M5F A;  3CFX A;  3MQ9 A;  3S9N C;  5L8D A;  4U1O A;  4EDP A;  3ONM A;  4KQP A;  1BLF A;  4NF5 B;  2VHA A;  1JW1 A;  4C0R A;  3OEM A;  2O7U A;  3UA8 A;  4JWO A;  3O9P A;  4G8N A;  5BUU A;  1VE4 A;  3O66 A;  4YU0 A;  2B65 A;  2ZYN A;  3EHS A;  2PYY A;  5DTB A;  2PT1 A;  4F31 B;  2RC7 A; 
#chains in the Genus database with same CATH topology
 4R2B A;  4O7I A;  2BJI A;  1Y9U A;  4DDD A;  4PF8 A;  4UAC A;  2Z22 A;  3KBR A;  5I2K B;  3OO9 A;  3RYD A;  4RYA A;  1INP A;  3IOR A;  3OEN A;  3N5L A;  3M3F A;  4YMA A;  3KGC A;  2FYI A;  5TP9 B;  3T0J A;  3SEX A;  3K1N A;  4RPO A;  1EZO A;  2GH9 A;  3UGW A;  1NNK A;  4U2R A;  1FPK A;  2F8D A;  3JYR A;  2NOO A;  3CFL A;  1A55 A;  4R9F A;  2ZYM A;  3C36 A;  2PBW A;  4MCO A;  4OZ9 A;  2V93 A;  2YLN A;  2ZMB A;  3WAE A;  4H0W A;  1B4H A;  3LSX A;  3GBA A;  3H6T A;  4ZDM A;  1NI9 A;  4EXL A;  3C4M A;  2XXK A;  1VFE A;  3TUS A;  1H3D A;  3I5O A;  1NUX A;  3RY3 A;  3BFU A;  3M8U A;  5TU0 A;  1EZP A;  4HCW A;  1OQH A;  3TOD A;  2F97 A;  2DWJ A;  4Z0I A;  4F19 A;  2ALU A;  1FTJ A;  2F6P A;  3MWB A;  2XWO A;  1FSA A;  4WKM A;  3GYY A;  3RQT A;  3TTK A;  1D9V A;  2PT2 A;  3TTL A;  4DLD A;  1OVB A;  2GQ1 A;  1Y3Q A;  4KCD A;  5AA2 B;  1DCU A;  2XXQ A;  3QSL A;  3M3L A;  1BK4 A;  1N7W A;  4H5G A;  3PUX E;  2PMS A;  1LFH A;  2XX7 A;  4GWZ A;  4JSO A;  4G61 A;  1EZ9 A;  1LST A;  4YB7 A;  5JTY B;  1LBV A;  5I7I A;  1F9B A;  3PV0 E;  2OZZ A;  4HCY A;  4OVQ A;  3CI8 A;  4IR8 A;  1S7Y A;  5H8H B;  1NFT A;  4GL8 A;  4R9G A;  4F1Y A;  2GRV A;  4ZEB A;  1FJ9 A;  1B5J A;  1Z7N E;  5ESY A;  1SI0 A;  3O97 A;  3QUJ A;  3F11 A;  3FIR A;  1P99 A;  2Q2C A;  3BIH A;  3QYT A;  2DYX A;  1GGG A;  4NWD A;  3C35 A;  3E78 A;  3ROJ A;  1B52 A;  3TCF A;  1FJ6 A;  4GX6 A;  1MXX A;  4PF6 A;  5HBC A;  4YIC A;  4O7M A;  4WEP A;  1MQI A;  1QKB A;  5A5X A;  1GVC A;  3WAF A;  4FAT A;  2XXH A;  5DT6 A;  2GHA A;  1LAH E;  2QMX A;  4H46 A;  4ONY A;  4I62 A;  3K6X A;  4LVQ A;  3S9L C;  2WYK A;  4H45 A;  1UTB B;  1MQD A;  1FPE A;  3FUZ A;  4OEU A;  4POX A;  3K2D A;  5CBS A;  4RK9 A;  1IMC A;  4I1D A;  1Z7M E;  1FCK A;  3PPO A;  2F7B A;  1UTH B;  1JEU A;  4HE2 A;  1R1N A;  1PB7 A;  3PMV A;  1P1N A;  2H5Y A;  4BDR A;  1VSO A;  1LBC A;  3RN8 A;  4G68 C;  4OVT A;  4OVS A;  2ONR A;  2ZYO A;  1ELJ A;  2XD3 A;  5KDT B;  4MMP A;  4PGN A;  1IXG A;  2REJ A;  3TYH A;  1P1U A;  4FED A;  5H8Q B;  1KWH A;  3KEI A;  1LAX A;  1AH5 A;  3U93 A;  1MXY A;  2DWI A;  1TT1 A;  4MNP A;  1NV0 A;  1NNF A;  4BDL A;  4ELQ A;  3L6G A;  4OEV A;  1RYO A;  2UVG A;  3G3F A;  4NF4 B;  4IY5 A;  2RF1 A;  3QK6 A;  4QSE A;  4QFN A;  1H44 A;  5IM2 A;  1D9Q A;  4NWC A;  2X7P A;  3MBP A;  4UAB A;  4IO2 A;  4GWS A;  1MPD A;  4HW8 A;  2NWJ A;  3QMF A;  4M1V A;  2Q8J A;  3T96 B;  3LSL A;  1IMF A;  4P3L A;  3TTM A;  1ZLQ A;  2O1M A;  3S9M C;  5AA4 A;  4GFR A;  3T9U A;  1IZ1 A;  5DVI A;  4N8Y A;  4Q30 B;  3V83 A;  4IGR A;  1HSE A;  5I56 A;  1MXZ A;  3VXC A;  4OET A;  4ESX A;  1FBD A;  1EYK A;  5CRY A;  1AL3 A;  4N07 A;  4KYD A;  5M2V A;  4QFL A;  4QRZ A;  2F36 A;  4ND9 A;  4PAK A;  3O29 A;  2HAU A;  4HTG A;  2CZH A;  2DXR A;  4AS5 A;  2KR0 A;  2PFY A;  3EPE A;  5FHO A;  2FHY A;  3PUV E;  3KJT A;  3KC0 A;  4FJP A;  2V84 A;  1NNT A;  1B7U A;  1BKA A;  1LFG A;  3LBS A;  3UN6 A;  2Y7K A;  2HHM A;  1IUD A;  4AS4 A;  3O6G A;  1XVX A;  2QVU A;  2ZNT A;  1IXC A;  1FPJ A;  3UIF A;  2CMO A;  1YAE A;  2DWH A;  3PPR A;  4XIG Q;  1LBX A;  4JDF A;  5TPA B;  4DXC A;  2QFL A;  2F78 A;  3MST A;  3TZA A;  1XC1 A;  3KN8 A;  4XFE A;  4GD5 A;  1YTV A;  4WED A;  3PGF A;  1SPI A;  4OXV A;  4F1V A;  3E3K A;  1LBB A;  2WX9 A;  4GOT A;  2UYF A;  1MQJ A;  1ZKB A;  4HE1 A;  2DVC A;  3EHU A;  2B4M A;  3V89 B;  5F7V A;  2UYE A;  1B4Z A;  3KOT A;  3RNN A;  4MF3 A;  5EYH A;  4F3P A;  2O51 A;  3TEL A;  4N91 A;  2O84 X;  1PEB A;  4H8J A;  3IOW A;  2XXT A;  1MXU A;  3Q28 A;  3VFJ A;  3C9H A;  4GWY A;  2L5V A;  3IOU A;  4DI4 B;  2Z8E A;  1FTO A;  2GHB A;  3MVW A;  4JWX A;  4GVO A;  1EH3 A;  5I2K A;  4OFJ A;  4IY6 A;  3THI A;  4R6K A;  3IFA A;  4X1D A;  1FPL A;  4EUO A;  4PBQ A;  3FBP A;  1NV1 A;  4EQB A;  2RCA A;  1QUL A;  1B3H A;  4YB6 A;  3TCG A;  3EHT A;  3D4C A;  4F29 A;  5I58 B;  2Z23 A;  5FTI A;  4RK2 A;  1B40 A;  3U94 A;  2XWK A;  4KFQ A;  4MIJ A;  3MP8 A;  4OVP A;  3CG1 A;  3MPL A;  1NV2 A;  3LR1 A;  4FBP A;  2QS4 A;  4DI3 D;  4O8M A;  1A54 A;  1CE2 A;  4DCX A;  1DPP A;  3IO6 A;  4P8B A;  3OMB A;  1NV4 A;  3USD A;  3E79 A;  1EYJ A;  4U23 A;  4LON B;  4QXD A;  5ET8 A;  5ITO A;  3MP6 A;  4H1X A;  1R6Z A;  2HXW A;  4JWY A;  4LQ5 A;  2HEU A;  1O63 A;  1G0H A;  1QUK A;  4ZS9 A;  1I6A A;  4GQO A;  2OJT A;  5J16 A;  1UIU A;  4EQ7 A;  2ZXT A;  2XHD A;  4MEV A;  4R74 A;  4ZEK A;  2X26 A;  1D3K A;  1K9Y A;  1G0I A;  3RTW B;  1SW5 A;  1AOV A;  3SDF A;  2ZNU A;  1IMA A;  1S50 A;  4I3Y A;  3B6T A;  3VE1 B;  4BLA A;  3LUY A;  4HE0 A;  2OX3 A;  5IZ1 A;  3OO6 A;  3NOH A;  3S9E A;  4F22 A;  3PPN A;  3EQ1 A;  1ANF A;  1PC3 A;  2XWI A;  5HPQ A;  3G3H A;  1Y20 A;  2Y84 A;  1LB9 A;  5K2Y A;  2I58 A;  3OXN A;  2NXO A;  4PFI A;  3B6W A;  5I2N A;  5AE4 A;  3DP6 A;  1SYI A;  4HS7 A;  1FPB A;  2VGQ A;  1A99 A;  3UOR A;  5I59 B;  2QPQ A;  3Q27 A;  3HFU A;  2I48 A;  4QBA A;  2F7C A;  2XXP A;  5JTY A;  3PMX A;  2I6E A;  3HO7 A;  4H6D A;  3G7W A;  4RY1 A;  3RT6 B;  3HV1 A;  4PAF A;  4YB5 A;  1LCF A;  3PTY A;  5H8H A;  1R9L A;  5I57 B;  2DE3 A;  2RKM A;  4PBH A;  2CZI A;  5ITP A;  4ZEF A;  3T9H B;  2OBG A;  5H8F B;  1NH7 A;  4ISU A;  4NAP A;  1WDN A;  1B51 A;  1PBP A;  3RLF E;  4UA8 A;  1DSN A;  1B3F A;  1HSL A;  2VP1 A;  4FE8 A;  3FXQ A;  2QVR A;  4IO7 A;  1FQA A;  1I6Q A;  1YCJ A;  4MH5 A;  2QRY A;  4XXU A;  4TQU Q;  3RTF B;  3SEV A;  1M5B A;  2V3U A;  3Q25 A;  4PFT A;  2FNC A;  4QHQ A;  3QAX A;  3TTR A;  3B7D A;  1WVJ A;  1OLC A;  3HN0 A;  1IXH A;  4BDO A;  3CIJ A;  5L9S A;  1UTB A;  3FD3 A;  3S4U A;  4GX3 A;  4OFL A;  1IEJ A;  1JP4 A;  2B4L A;  1LB8 A;  3PD9 A;  4NN3 A;  4M4G A;  4OES A;  1VFD A;  3EKI A;  5JEI A;  3FVK A;  1Y1Z A;  2DP8 A;  3LUZ A;  4YKP A;  2RC8 A;  4NF8 B;  5KDT A;  1DOT A;  5CMB A;  1B1H A;  3RPL B;  4EQ9 A;  2Q89 A;  2F7A A;  3TQL A;  1FPF A;  4JBZ A;  4AB6 A;  1RKM A;  4P47 A;  1EYI A;  2HPG A;  3G3J A;  3CRB A;  4GIZ A;  4G68 B;  4BDM A;  2D21 A;  1FPD A;  1QVS A;  3JZJ A;  3MZ9 A;  4Q8R A;  4OMB A;  1L5T A;  3MPK A;  5L9O A;  2Y7I A;  4DXB A;  5DVF A;  1YYZ A;  2A5T B;  2Z8F A;  4OHN A;  2Y7W A;  4LZ7 A;  4OER A;  2NUV A;  1QUI A;  3HCQ A;  4O94 A;  4E0X A;  3C31 A;  1HSJ A;  1QUJ A;  4JVI A;  2BJJ X;  2UVH A;  4JXI A;  5F24 A;  4ELO A;  2Q9T A;  1PBQ A;  4PFW A;  4YAH X;  3G3K A;  3R6U A;  1USY E;  3SKP A;  5CI5 A;  1LBW A;  4G2Z A;  1SQY A;  4F3B A;  1FBH A;  4ZZA A;  4DCY A;  3K6V A;  1MM7 A;  2P0S A;  3T9X B;  3GBB A;  3EN3 A;  2XXU A;  1FBE A;  5DEX B;  2XWV A;  3CR9 A;  2ANJ A;  4BDQ A;  3LSF B;  1B0L A;  2LAO A;  1SVX B;  4GX4 A;  3ZSF A;  3MZ1 A;  4O3C A;  2Y7R A;  2UVJ A;  1EU8 A;  3FV1 A;  3PUW E;  4MX6 A;  3E13 X;  4YKI A;  4KCC A;  5ISU A;  1IMD A;  1P1O A;  3ZS6 A;  5I84 A;  3P7I A;  3ILU B;  2OLB A;  5I5P A;  3GZG A;  3DP8 A;  1MY4 A;  4R75 A;  2DVZ A;  3MZB A;  2GFE A;  4LN5 A;  4RJZ A;  4YKK A;  1N7X A;  3M3K A;  3VLW A;  4R72 A;  5ET5 A;  1FPG A;  1B7H A;  4NF0 A;  2PCR A;  4QSC A;  2CEX A;  4PFY A;  3T1B A;  1PB9 A;  2VPN A;  3OEK A;  2XXY A;  3K6U A;  5EQ7 A;  5B70 A;  3LC8 A;  2XXV A;  3ZKK A;  3U65 A;  2FVZ A;  2THI A;  5T3J A;  2HQ0 A;  2OWT A;  3MVX A;  1POY 1;  3SEU A;  4OVJ A;  4LUB A;  3B8B A;  1LLS A;  3OEL A;  1K9Z A;  2Z8D A;  1P1Q A;  4R73 A;  3IAZ A;  3SER A;  1B58 A;  4I3E A;  5EHM A;  3CFZ A;  2WKY A;  1M5C A;  3H6W A;  1DBZ A;  3U72 A;  1TFD A;  5EHS A;  3RT8 A;  4NGU A;  4KYE A;  1FBP A;  1NV6 A;  2VD2 A;  4FEB A;  1FBC A;  3T66 A;  1MPB A;  2DWA A;  4U4X A;  3C34 A;  3KBZ A;  2XXI A;  1ZU0 A;  1XVY A;  3FJG A;  2DOJ A;  3K1M A;  1GR2 A;  4HXV A;  3B6Q A;  1Q1K A;  5IKB A;  1JET A;  2I0C A;  4Q5T A;  1JVY A;  3B50 A;  3FZV A;  4I8C A;  3IB1 A;  3SET A;  1PDA A;  3BFT A;  3H6U A;  2M8C A;  4MLV A;  3ECR A;  4MAG A;  1B3L A;  3BBR A;  2XD2 A;  4O3B A;  5A5L A;  5JK4 A;  1US5 A;  2XXW A;  3IL1 B;  4OFO A;  4XTC Q;  4Z7E A;  2R9J A;  2XA5 A;  2V3T A;  4F3S A;  4H8I A;  2DXY A;  4GL0 A;  3JV9 A;  4F39 A;  3K02 A;  3G3I A;  4ELP A;  4P56 A;  3MP1 A;  4N17 A;  3H4Z A;  1B05 A;  1OVT A;  1MPC A;  3Q26 A;  3N26 A;  2DS9 A;  1LBZ A;  2QMW A;  2DE2 A;  4GLI A;  3H03 A;  4G77 A;  3UP9 A;  1QGX A;  1NV3 A;  3HHG A;  1MY0 A;  1M5D A;  3O28 A;  2PFZ A;  1FQE A;  1DK4 A;  1Y4C A;  1OLA A;  3PPQ A;  4OWD A;  5I59 A;  1MH3 A;  2IEE A;  2REG A;  2F5X A;  4R6Y A;  1DTG A;  5IZ3 A;  4AB5 A;  4X04 A;  4IO3 A;  3TKD A;  4NF5 A;  5A5X B;  1H76 A;  2DE4 A;  4P0G A;  3VLV A;  3KN3 A;  1NMU A;  4MLQ A;  2O1L A;  4GF8 A;  4N15 A;  1T0K A;  1ZTY A;  1JQF A;  5FBP A;  5I3S A;  5I57 A;  3IB0 A;  3W9W A;  3MVY A;  3GLB A;  1XHY A;  2HFB A;  5CMM A;  2I49 A;  5H8F A;  1RDZ A;  2QSX A;  3K6W A;  3MVZ A;  4MHF A;  4N8G A;  1USY H;  4H5F A;  4AQ4 A;  4P9K A;  4JB7 A;  2ABH A;  1QKA A;  4X9T A;  3PPP A;  3FVO A;  3HHF A;  3DLN A;  2I4B A;  1D4N A;  2HZL A;  4FOR A;  3OD7 A;  4OEN A;  1SDX A;  1GTK A;  4XKN A;  4PC9 A;  2UVI A;  1BTJ A;  1JEV A;  3KSJ A;  2DDK A;  1B5I A;  3BKI B;  5TP9 A;  3ISP A;  4N13 A;  2V3Q A;  4QFK A;  3CG3 A;  1JNF A;  1Q9D A;  3RUM A;  5H8N B;  1B46 A;  3FV2 A;  1II5 A;  3I6V A;  2ZZW A;  4IO6 A;  4RXL A;  4FIM A;  3PU5 A;  1GV8 A;  2F34 A;  3U1O A;  4RNS A;  1D9Y A;  5FTH A;  2AL4 A;  2E0S A;  3FVG A;  4X48 A;  1IIT A;  1DMB A;  3SZP A;  3W9V A;  4R6H A;  2O7I A;  1A7L A;  4NF8 A;  4O3A A;  2V4C A;  3RPW A;  5AA4 B;  3RPL A;  1QW0 A;  3FAT A;  5CMK A;  5ET6 A;  3VLU A;  1JW4 A;  2WBD A;  3CVG A;  5I56 B;  1MQH A;  2ESN A;  4K3F A;  3TAJ A;  3KFM A;  3U8Q A;  2QL3 A;  2Q2A A;  4G68 A;  4KHZ E;  4GBV A;  3HPI A;  1H43 A;  5AA2 A;  2P3V A;  4KI0 E;  4QSD A;  1UQW A;  2AL5 A;  1FQB A;  4POW A;  3K00 A;  2A5T A;  5CBR A;  1SW2 A;  4N6D A;  1B9J A;  2OK2 A;  2Y7P A;  5DW8 A;  4OTE A;  2OWZ A;  2RCB A;  4EXK A;  1ZJL A;  2OCU A;  4DXU A;  3E9X A;  3SEY A;  3MJN A;  3V5A A;  3G3G A;  1FQD A;  3SES A;  1IXI A;  1FRP A;  5L9M A;  4PE5 B;  1MY1 A;  1NV5 A;  2DQV A;  3T9V A;  4Q0C A;  4NE4 A;  4GBW A;  1DTZ A;  2Y5K A;  4N6P A;  4PFR A;  5KCJ B;  3N94 A;  3H7M A;  4XF5 A;  2B3B A;  3OO7 A;  2V25 A;  3FAS A;  4EF2 A;  5CM6 A;  3TPA A;  3FVN A;  5EYF A;  4U22 A;  4TLL B;  1B6H A;  3PUY E;  4ESW A;  5DYH A;  5FHM A;  4XKQ A;  1WOD A;  1N04 A;  1OMP A;  5AA2 D;  2QS1 A;  4P11 A;  1O7T A;  4FAJ A;  3KG2 A;  5IAI A;  2H9B A;  4THI A;  5ET7 A;  4WXJ A;  1FQF A;  5DEX A;  3PUZ E;  4X8R A;  2XXX A;  2D3I A;  4F2O A;  4OAN A;  4PFU A;  3IR1 A;  1URG A;  4X1B A;  1ZMG A;  2WEF A;  4NMY A;  3T93 B;  4P0I A;  4OYV A;  5HM4 B;  3H06 B;  1VR5 A;  1IIW A;  3QUF A;  4JVC A;  3VXB A;  1MXV A;  3H3G A;  3RGY A;  3L6H A;  1FTM A;  4MJO A;  2Y5L A;  1LAG E;  2IA4 A;  1N84 A;  5FHN A;  3R7X A;  4LP2 B;  2FIX A;  4MBP A;  3MC2 A;  3TQW A;  3MAM A;  1MDQ A;  2QVV A;  1UTH A;  2G93 A;  4ECF A;  2VT5 A;  3BIG A;  4QFO A;  4EF1 A;  1NV7 A;  3IB2 A;  4I9D A;  2YJP A;  1CB6 A;  3DP4 A;  4XEQ A;  2QJE A;  5H8Q A;  4ELR A;  4KPT A;  1PB8 A;  4F18 A;  3VVF A;  4DE8 A;  2HAV A;  1MM6 A;  2VOZ A;  1MXW A;  3O6H A;  4RA1 A;  4QF9 A;  4NF4 A;  1A8E A;  1B1X A;  3S2V A;  1RDY A;  4KXP A;  4PDD A;  2HCA A;  3AXF A;  3FGS A;  1MY3 A;  4C1T A;  4GWU A;  4H65 A;  1NUW A;  4NF6 B;  1BP5 A;  2P3N A;  2O68 A;  3OSQ A;  1MG1 A;  4PQJ A;  3SEW A;  4N81 A;  4LAT A;  4R2F A;  5I2N B;  3A3U A;  4U1Z A;  2H25 A;  1FQC A;  1IQ7 A;  5CC2 A;  5LTC A;  1OIB A;  4NQ8 A;  2AYS A;  3R26 A;  1ZBM A;  3TTN A;  3TEP A;  3UK4 A;  1LGB C;  4OQO A;  1B3G A;  3C32 A;  1CNQ A;  4YMB A;  2Q8M A;  4PET A;  1FTK A;  1B0H A;  2NVU B;  2XX9 A;  5B7D A;  2I3V A;  2ZNS A;  3PMW A;  4E0W A;  2I0B A;  2XX8 A;  1NH8 A;  4ZED A;  5BWJ A;  1SYH A;  1B5H A;  3FJM A;  4NED A;  3O6I A;  4PTK A;  4XKP A;  3LV0 A;  1NKX A;  5TPA A;  1UIV A;  3DM0 A;  1FW0 A;  4YKJ A;  1POT A;  4PDH A;  3H6V A;  5IZZ A;  3QXM A;  4P1E A;  1XI6 A;  3ILT B;  4NTL A;  1FPI A;  3A3C A;  5KZT A;  1MY2 A;  1R9Q A;  3O2A A;  2W7Y A;  2R71 A;  4GWW A;  4P1L A;  4LZ5 A;  3KJ7 A;  3N6U A;  4NX1 A;  5K2X A;  2RC9 A;  1IMB A;  1SW4 A;  3N6T A;  1A8F A;  4G4P A;  4GXA A;  1P1W A;  1SW1 A;  4U4S A;  3IOT A;  3CSG A;  2Q74 A;  3LSW A;  3DEL B;  5EQA A;  3Q29 A;  1NNP A;  1MDP 1;  1NUY A;  2OWS A;  3KZG A;  1JVX A;  4IB2 A;  3W15 C;  4NG7 A;  4PCD A;  5AA3 A;  4U21 A;  4C1U A;  2B3F A;  2KLF A;  2ZYK A;  1LAF E;  5DVJ A;  5I58 A;  3IOV A;  1DPE A;  3U92 A;  5H8N A;  2HZK A;  2A5S A;  1AMF A;  1BIY A;  2D5W A;  3OSR A;  1O64 A;  1TXF A;  3CHG A;  4OVR A;  5CMC A;  1KA0 A;  3VV5 A;  3VVD A;  1B7Z A;  1MRP A;  1B2H A;  1VDW A;  3TFL A;  4TOZ A;  3MYU A;  5EYG A;  1AIV A;  1Y3N A;  2YPN A;  3OOA A;  4N4U A;  4MNI A;  3IFC A;  2ZZV A;  4H67 A;  4DZ1 A;  3OO8 A;  2H98 A;  3ZKL A;  1ZIU A;  1XOC A;  3KOS A;  4GWX A;  2ONS A;  2QS3 A;  1B32 A;  3D1R A;  2Q88 A;  1ATG A;  4KYS A;  1KA1 A;  1FTA A;  4LQ2 A;  1OQG A;  3KN7 A;  5H8S A;  3TDJ A;  1SBP A;  4GRK A;  4IGT A;  2PVU A;  4PE3 A;  5LOM A;  1Y1M A;  1M5E A;  2CEY A;  2VD3 A;  2QS2 A;  3C33 A;  1N76 A;  4ZE9 A;  1N3W A;  5ICT A;  1SD3 A;  1TFA A;  1J1N A;  2I3W A;  5EQ8 A;  1TWY A;  4JVD A;  3IJO B;  1H45 A;  3K1P A;  4KD5 A;  1N0T A;  2H99 A;  2KQZ A;  4F3G A;  3VVE A;  4NHB A;  3FJ7 A;  3T22 A;  4F1U A;  4FEC A;  1XS5 A;  2G29 A;  1I69 A;  5ICQ A;  2JJK A;  4LA9 A;  5J1D A;  2FIE A;  5KCJ A;  1FBF A;  4RPN A;  4ZZE A;  2P1S A;  3CSB A;  1AWB A;  2F3D A;  4GWO A;  5ELV A;  3V8X B;  3HST A;  5LDZ A;  2ZZX A;  4OA4 A;  2HXR A;  2F6G A;  3FXR A;  4G8H A;  3MW0 A;  1MH4 A;  2VPO A;  2WBB A;  1S9T A;  5AA1 A;  3K0V A;  3EF7 A;  1SI1 A;  1NL5 A;  3E4R A;  1US4 A;  5IGA A;  4TLM B;  1I6B A;  1LFI A;  1N3X A;  3D4G A;  4IO4 A;  4IO5 A;  3KSX A;  2AIX A;  3MUQ A;  1URD A;  4PGP A;  3TCH A;  2X7Q A;  1QJM A;  3K01 A;  1Q35 A;  2DSF A;  4ZEI A;  1KZ8 A;  1NUZ A;  2RIN A;  1LBY A;  2H4I A;  2UXA A;  2FA7 A;  1B3E A;  2ONK E;  2E1S A;  1IME A;  3VDF A;  1XT8 A;  4PP0 A;  1MQG A;  1YZ0 A;  3IO4 A;  1JW5 A;  2PX1 A;  4DIG A;  2O6A A;  1LCT A;  2CZK A;  4PFB A;  4ZE8 A;  2O69 A;  5F1Q A;  4MNC A;  3IK6 B;  3I3V A;  2XXR A;  3QIM A;  1RYX A;  4YZZ A;  1MS7 A;  4F2Q A;  2R8T A;  3GXA A;  1Y4T A;  4G8M A;  4XKR A;  4KR5 A;  3A09 A;  3ODB A;  3PD8 A;  4PAI A;  2R6G E;  4GXS B;  4LZ8 A;  2WYP A;  2F3B A;  2P2A A;  3FXB A;  4JSD A;  1FTL A;  4N6K A;  2F35 A;  3IJX B;  4BDN A;  2MKZ A;  4NF6 A;  1Y3P A;  3A29 A;  3K4U A;  4L17 A;  3TMG A;  2CZL A;  2I4C A;  4QFP A;  1YPN A;  1A40 A;  1RDX A;  4ZEC A;  1URS A;  4MFI A;  3FXU A;  3IX1 A;  1M5F A;  3CFX A;  3MQ9 A;  2FBP A;  3S9N C;  5L8D A;  4U1O A;  4EDP A;  3ONM A;  4KQP A;  1LEV A;  5EQ9 A;  1BLF A;  5IZ3 B;  4NF5 B;  2VHA A;  1JW1 A;  4C0R A;  3OEM A;  2O7U A;  3UA8 A;  4JWO A;  3O9P A;  4G8N A;  5BUU A;  1VE4 A;  4I40 A;  3KC1 A;  3O66 A;  4YU0 A;  1YXI A;  2B65 A;  2ZYN A;  3EHS A;  2PYY A;  1FBG A;  5DTB A;  2PT1 A;  2RC7 A;  4F31 B; 
#chains in the Genus database with same CATH homology
 4R2B A;  1Y9U A;  4DDD A;  4UAC A;  2Z22 A;  3KBR A;  5I2K B;  3OO9 A;  4RYA A;  3IOR A;  3OEN A;  3N5L A;  3M3F A;  4YMA A;  3KGC A;  2FYI A;  5TP9 B;  3SEX A;  3K1N A;  4RPO A;  1EZO A;  2GH9 A;  3UGW A;  1NNK A;  4U2R A;  2F8D A;  3JYR A;  2NOO A;  3CFL A;  1A55 A;  4R9F A;  2ZYM A;  3C36 A;  2PBW A;  4OZ9 A;  2V93 A;  2YLN A;  2ZMB A;  3WAE A;  4H0W A;  1B4H A;  3LSX A;  3GBA A;  3H6T A;  4ZDM A;  4EXL A;  3C4M A;  1VFE A;  3TUS A;  1H3D A;  3I5O A;  3RY3 A;  3BFU A;  3M8U A;  5TU0 A;  1EZP A;  4HCW A;  1OQH A;  3TOD A;  2F97 A;  2DWJ A;  4Z0I A;  4F19 A;  2ALU A;  1FTJ A;  2F6P A;  3MWB A;  4WKM A;  3RQT A;  3TTK A;  1D9V A;  2PT2 A;  3TTL A;  4DLD A;  1OVB A;  1Y3Q A;  4KCD A;  5AA2 B;  2XXQ A;  3QSL A;  3M3L A;  1N7W A;  4H5G A;  3PUX E;  2PMS A;  1LFH A;  2XX7 A;  4JSO A;  1EZ9 A;  1LST A;  4YB7 A;  5JTY B;  1F9B A;  3PV0 E;  2OZZ A;  4HCY A;  3CI8 A;  1S7Y A;  5H8H B;  1NFT A;  4GL8 A;  4R9G A;  4F1Y A;  2GRV A;  4ZEB A;  1B5J A;  1Z7N E;  1SI0 A;  3O97 A;  3QUJ A;  3F11 A;  3FIR A;  1P99 A;  2Q2C A;  3QYT A;  2DYX A;  1GGG A;  4NWD A;  3C35 A;  1B52 A;  3TCF A;  1MXX A;  5HBC A;  4YIC A;  4WEP A;  1MQI A;  1QKB A;  5A5X A;  1GVC A;  3WAF A;  4FAT A;  2XXH A;  5DT6 A;  2GHA A;  1LAH E;  2QMX A;  4ONY A;  4I62 A;  3K6X A;  4LVQ A;  3S9L C;  1UTB B;  1MQD A;  3FUZ A;  4OEU A;  4POX A;  3K2D A;  5CBS A;  4RK9 A;  4I1D A;  1Z7M E;  1FCK A;  3PPO A;  2F7B A;  1UTH B;  1JEU A;  1R1N A;  1PB7 A;  3PMV A;  1P1N A;  2H5Y A;  4BDR A;  1VSO A;  1LBC A;  3RN8 A;  4G68 C;  2ONR A;  2ZYO A;  1ELJ A;  2XD3 A;  5KDT B;  1IXG A;  2REJ A;  3TYH A;  1P1U A;  4FED A;  5H8Q B;  1KWH A;  3KEI A;  1LAX A;  1AH5 A;  3U93 A;  1MXY A;  2DWI A;  1TT1 A;  1NNF A;  4BDL A;  4ELQ A;  3L6G A;  4OEV A;  1RYO A;  2UVG A;  3G3F A;  4NF4 B;  4IY5 A;  2RF1 A;  3QK6 A;  4QSE A;  4QFN A;  1H44 A;  4NWC A;  2X7P A;  3MBP A;  4IO2 A;  1MPD A;  4HW8 A;  2NWJ A;  4M1V A;  2Q8J A;  3T96 B;  3LSL A;  3TTM A;  1ZLQ A;  2O1M A;  3S9M C;  5AA4 A;  4GFR A;  3T9U A;  1IZ1 A;  5DVI A;  4Q30 B;  3V83 A;  4IGR A;  1HSE A;  5I56 A;  1MXZ A;  3VXC A;  4OET A;  4ESX A;  5CRY A;  1AL3 A;  4N07 A;  4KYD A;  5M2V A;  4QFL A;  4QRZ A;  2F36 A;  3O29 A;  2HAU A;  4HTG A;  4ND9 A;  2DXR A;  3EPE A;  5FHO A;  3PUV E;  3KJT A;  4FJP A;  2V84 A;  1NNT A;  1B7U A;  1BKA A;  1LFG A;  3LBS A;  3UN6 A;  2Y7K A;  1IUD A;  3O6G A;  1XVX A;  2ZNT A;  1IXC A;  3UIF A;  2CMO A;  1YAE A;  2DWH A;  3PPR A;  4XIG Q;  4JDF A;  5TPA B;  4DXC A;  2F78 A;  3TZA A;  1XC1 A;  3KN8 A;  4GD5 A;  1YTV A;  4WED A;  3PGF A;  4OXV A;  4F1V A;  3E3K A;  1LBB A;  4GOT A;  2UYF A;  1MQJ A;  1ZKB A;  2DVC A;  3EHU A;  3V89 B;  5F7V A;  2UYE A;  1B4Z A;  3KOT A;  3RNN A;  4MF3 A;  4F3P A;  2O51 A;  3TEL A;  2O84 X;  1PEB A;  4H8J A;  3IOW A;  2XXT A;  1MXU A;  3Q28 A;  3VFJ A;  3C9H A;  3IOU A;  2Z8E A;  1FTO A;  2GHB A;  3MVW A;  4JWX A;  4GVO A;  1EH3 A;  5I2K A;  4OFJ A;  4IY6 A;  3THI A;  4R6K A;  4X1D A;  4EUO A;  4EQB A;  2RCA A;  1QUL A;  1B3H A;  3TCG A;  4YB6 A;  3EHT A;  3D4C A;  4F29 A;  5I58 B;  2Z23 A;  5FTI A;  4RK2 A;  1B40 A;  3U94 A;  4KFQ A;  3MP8 A;  3CG1 A;  3MPL A;  3LR1 A;  2QS4 A;  1A54 A;  1CE2 A;  4DCX A;  1DPP A;  3IO6 A;  3OMB A;  3USD A;  4U23 A;  4LON B;  5ITO A;  3MP6 A;  4H1X A;  1R6Z A;  2HXW A;  4JWY A;  4LQ5 A;  2HEU A;  1O63 A;  1QUK A;  4ZS9 A;  1I6A A;  4GQO A;  2OJT A;  1UIU A;  4EQ7 A;  2ZXT A;  2XHD A;  4R74 A;  4ZEK A;  2X26 A;  1D3K A;  3RTW B;  1SW5 A;  1AOV A;  3SDF A;  2ZNU A;  1S50 A;  3B6T A;  3VE1 B;  4BLA A;  3LUY A;  3OO6 A;  3S9E A;  4F22 A;  3PPN A;  3EQ1 A;  1ANF A;  1PC3 A;  5HPQ A;  3G3H A;  1Y20 A;  2Y84 A;  1LB9 A;  5K2Y A;  2I58 A;  3OXN A;  2NXO A;  3B6W A;  5I2N A;  5AE4 A;  3DP6 A;  1SYI A;  4HS7 A;  2VGQ A;  1A99 A;  3UOR A;  5I59 B;  2QPQ A;  3Q27 A;  2I48 A;  2F7C A;  2XXP A;  5JTY A;  3PMX A;  2I6E A;  3HO7 A;  4H6D A;  3G7W A;  4RY1 A;  3RT6 B;  3HV1 A;  4YB5 A;  1LCF A;  5H8H A;  1R9L A;  5I57 B;  2DE3 A;  2RKM A;  5ITP A;  4ZEF A;  3T9H B;  2OBG A;  5H8F B;  1NH7 A;  4ISU A;  1WDN A;  1B51 A;  1PBP A;  3RLF E;  4UA8 A;  1DSN A;  1B3F A;  1HSL A;  2VP1 A;  4FE8 A;  3FXQ A;  4IO7 A;  1FQA A;  1YCJ A;  1I6Q A;  4MH5 A;  2QRY A;  4XXU A;  4TQU Q;  3RTF B;  3SEV A;  1M5B A;  2V3U A;  3Q25 A;  4PFT A;  2FNC A;  4QHQ A;  3QAX A;  3TTR A;  3B7D A;  1WVJ A;  1OLC A;  3HN0 A;  1IXH A;  4BDO A;  3CIJ A;  5L9S A;  1UTB A;  3FD3 A;  3S4U A;  4OFL A;  1IEJ A;  1LB8 A;  3PD9 A;  4M4G A;  4OES A;  1VFD A;  5JEI A;  3FVK A;  1Y1Z A;  2DP8 A;  4YKP A;  2RC8 A;  4NF8 B;  5KDT A;  1DOT A;  5CMB A;  1B1H A;  4EQ9 A;  2Q89 A;  2F7A A;  3TQL A;  4JBZ A;  4AB6 A;  1RKM A;  3G3J A;  3CRB A;  4GIZ A;  4G68 B;  4BDM A;  2D21 A;  1QVS A;  3JZJ A;  3MZ9 A;  4Q8R A;  4OMB A;  1L5T A;  3MPK A;  5L9O A;  2Y7I A;  4DXB A;  5DVF A;  2A5T B;  2Z8F A;  4OHN A;  2Y7W A;  4LZ7 A;  4OER A;  2NUV A;  1QUI A;  3HCQ A;  4E0X A;  3C31 A;  1HSJ A;  1QUJ A;  2BJJ X;  2UVH A;  4JXI A;  4ELO A;  2Q9T A;  1PBQ A;  4PFW A;  4YAH X;  3G3K A;  3R6U A;  1USY E;  3SKP A;  5CI5 A;  4G2Z A;  1SQY A;  4F3B A;  4ZZA A;  4DCY A;  3K6V A;  1MM7 A;  2P0S A;  3T9X B;  3GBB A;  3EN3 A;  2XXU A;  5DEX B;  3CR9 A;  2ANJ A;  4BDQ A;  3LSF B;  1B0L A;  2LAO A;  1SVX B;  3ZSF A;  3MZ1 A;  4O3C A;  2Y7R A;  2UVJ A;  1EU8 A;  3FV1 A;  3PUW E;  3E13 X;  4YKI A;  4KCC A;  5ISU A;  1P1O A;  3ZS6 A;  5I84 A;  3P7I A;  3ILU B;  2OLB A;  3GZG A;  3DP8 A;  1MY4 A;  4R75 A;  2DVZ A;  3MZB A;  2GFE A;  4RJZ A;  4YKK A;  1N7X A;  3M3K A;  3VLW A;  4R72 A;  1B7H A;  4QSC A;  4PFY A;  1PB9 A;  3OEK A;  2XXY A;  3K6U A;  5B70 A;  3LC8 A;  2XXV A;  3ZKK A;  2THI A;  2HQ0 A;  2OWT A;  3MVX A;  1POY 1;  3SEU A;  4OVJ A;  4LUB A;  1LLS A;  3OEL A;  2Z8D A;  1P1Q A;  4R73 A;  3IAZ A;  3SER A;  1B58 A;  5EHM A;  3CFZ A;  2WKY A;  1M5C A;  3H6W A;  3U72 A;  1TFD A;  5EHS A;  3RT8 A;  4KYE A;  2VD2 A;  4FEB A;  3T66 A;  1MPB A;  2DWA A;  4U4X A;  3C34 A;  2XXI A;  1ZU0 A;  1XVY A;  3FJG A;  2DOJ A;  3K1M A;  1GR2 A;  3B6Q A;  1Q1K A;  5IKB A;  1JET A;  2I0C A;  4Q5T A;  1JVY A;  3FZV A;  4I8C A;  3IB1 A;  3SET A;  1PDA A;  3BFT A;  3H6U A;  2M8C A;  4MLV A;  3ECR A;  1B3L A;  3BBR A;  2XD2 A;  4O3B A;  5JK4 A;  1US5 A;  2XXW A;  3IL1 B;  4OFO A;  4XTC Q;  4Z7E A;  2R9J A;  2V3T A;  4F3S A;  4H8I A;  2DXY A;  4GL0 A;  3JV9 A;  4F39 A;  3K02 A;  3G3I A;  4ELP A;  3MP1 A;  3H4Z A;  1B05 A;  1OVT A;  1MPC A;  3Q26 A;  3N26 A;  2DS9 A;  2QMW A;  2DE2 A;  4GLI A;  3H03 A;  4G77 A;  3UP9 A;  3HHG A;  1MY0 A;  1M5D A;  3O28 A;  1FQE A;  1Y4C A;  1OLA A;  3PPQ A;  4OWD A;  5I59 A;  1MH3 A;  2IEE A;  2REG A;  2F5X A;  4R6Y A;  1DTG A;  4AB5 A;  4IO3 A;  3TKD A;  4NF5 A;  5A5X B;  1H76 A;  2DE4 A;  4P0G A;  3VLV A;  3KN3 A;  1NMU A;  4MLQ A;  2O1L A;  4GF8 A;  1T0K A;  1ZTY A;  1JQF A;  5I57 A;  3IB0 A;  3W9W A;  3MVY A;  3GLB A;  1XHY A;  2HFB A;  5CMM A;  2I49 A;  5H8F A;  2QSX A;  3K6W A;  3MVZ A;  1USY H;  4H5F A;  4AQ4 A;  4JB7 A;  2ABH A;  1QKA A;  4X9T A;  3PPP A;  3FVO A;  3HHF A;  3DLN A;  2I4B A;  1D4N A;  2HZL A;  4FOR A;  3OD7 A;  4OEN A;  1SDX A;  1GTK A;  4XKN A;  2UVI A;  1BTJ A;  1JEV A;  3KSJ A;  1B5I A;  3BKI B;  5TP9 A;  4N13 A;  2V3Q A;  4QFK A;  3CG3 A;  1JNF A;  3RUM A;  5H8N B;  1B46 A;  3FV2 A;  1II5 A;  3I6V A;  4IO6 A;  4RXL A;  4FIM A;  3PU5 A;  1GV8 A;  2F34 A;  3U1O A;  4RNS A;  1D9Y A;  5FTH A;  2AL4 A;  2E0S A;  3FVG A;  4X48 A;  1IIT A;  1DMB A;  3W9V A;  4R6H A;  2O7I A;  1A7L A;  4NF8 A;  4O3A A;  3RPW A;  5AA4 B;  1QW0 A;  3FAT A;  5CMK A;  3VLU A;  1JW4 A;  3CVG A;  5I56 B;  1MQH A;  2ESN A;  4K3F A;  3TAJ A;  3KFM A;  3U8Q A;  2QL3 A;  2Q2A A;  4G68 A;  4KHZ E;  3HPI A;  1H43 A;  5AA2 A;  4KI0 E;  4QSD A;  1UQW A;  2AL5 A;  1FQB A;  4POW A;  3K00 A;  2A5T A;  5CBR A;  1SW2 A;  1B9J A;  2OK2 A;  2Y7P A;  4OTE A;  2RCB A;  4EXK A;  1ZJL A;  2OCU A;  4DXU A;  3E9X A;  3SEY A;  3MJN A;  3V5A A;  3G3G A;  1FQD A;  3SES A;  1IXI A;  5L9M A;  4PE5 B;  1MY1 A;  2DQV A;  3T9V A;  4Q0C A;  4NE4 A;  1DTZ A;  4N6P A;  5KCJ B;  3N94 A;  3H7M A;  2B3B A;  3OO7 A;  2V25 A;  3FAS A;  4EF2 A;  5CM6 A;  3TPA A;  3FVN A;  5EYF A;  4U22 A;  4TLL B;  1B6H A;  3PUY E;  4ESW A;  5DYH A;  5FHM A;  4XKQ A;  1WOD A;  1N04 A;  1OMP A;  5AA2 D;  2QS1 A;  4P11 A;  1O7T A;  4FAJ A;  3KG2 A;  5IAI A;  2H9B A;  4THI A;  4WXJ A;  1FQF A;  5DEX A;  3PUZ E;  2XXX A;  2D3I A;  4F2O A;  4PFU A;  3IR1 A;  1URG A;  4X1B A;  1ZMG A;  4NMY A;  3T93 B;  4P0I A;  4OYV A;  5HM4 B;  3H06 B;  1VR5 A;  1IIW A;  3QUF A;  3VXB A;  1MXV A;  3H3G A;  3RGY A;  3L6H A;  1FTM A;  1LAG E;  2IA4 A;  1N84 A;  5FHN A;  3R7X A;  4LP2 B;  4MBP A;  3MC2 A;  3TQW A;  3MAM A;  1MDQ A;  1UTH A;  2G93 A;  4ECF A;  4QFO A;  4EF1 A;  3IB2 A;  4I9D A;  2YJP A;  1CB6 A;  3DP4 A;  2QJE A;  5H8Q A;  4ELR A;  4KPT A;  1PB8 A;  4F18 A;  3VVF A;  4DE8 A;  2HAV A;  1MM6 A;  2VOZ A;  1MXW A;  3O6H A;  4RA1 A;  4QF9 A;  4NF4 A;  1A8E A;  1B1X A;  3S2V A;  2HCA A;  3AXF A;  3FGS A;  1MY3 A;  4C1T A;  4H65 A;  4NF6 B;  1BP5 A;  2O68 A;  3OSQ A;  1MG1 A;  4PQJ A;  3SEW A;  4LAT A;  4R2F A;  5I2N B;  3A3U A;  4U1Z A;  2H25 A;  1FQC A;  1IQ7 A;  5CC2 A;  1OIB A;  2AYS A;  3R26 A;  1ZBM A;  3TTN A;  3TEP A;  3UK4 A;  1LGB C;  4OQO A;  1B3G A;  3C32 A;  4YMB A;  4PET A;  1FTK A;  1B0H A;  2NVU B;  2XX9 A;  5B7D A;  2I3V A;  2ZNS A;  3PMW A;  4E0W A;  2I0B A;  2XX8 A;  1NH8 A;  4ZED A;  5BWJ A;  1SYH A;  1B5H A;  3FJM A;  4NED A;  3O6I A;  4XKP A;  1NKX A;  5TPA A;  1UIV A;  3DM0 A;  1FW0 A;  4YKJ A;  1POT A;  3H6V A;  3QXM A;  3ILT B;  4NTL A;  3A3C A;  5KZT A;  1MY2 A;  1R9Q A;  3O2A A;  2W7Y A;  2R71 A;  4LZ5 A;  3KJ7 A;  3N6U A;  5K2X A;  2RC9 A;  1SW4 A;  3N6T A;  1A8F A;  4G4P A;  4GXA A;  1P1W A;  1SW1 A;  4U4S A;  3IOT A;  3CSG A;  3LSW A;  3DEL B;  3Q29 A;  1NNP A;  1MDP 1;  2OWS A;  3KZG A;  1JVX A;  4IB2 A;  3W15 C;  5AA3 A;  4U21 A;  4C1U A;  2B3F A;  2KLF A;  2ZYK A;  1LAF E;  5DVJ A;  5I58 A;  3IOV A;  1DPE A;  3U92 A;  5H8N A;  2HZK A;  2A5S A;  1AMF A;  1BIY A;  2D5W A;  3OSR A;  1O64 A;  1TXF A;  5CMC A;  3VV5 A;  3VVD A;  1B7Z A;  1MRP A;  1B2H A;  3TFL A;  4TOZ A;  1AIV A;  1Y3N A;  2YPN A;  3OOA A;  4H67 A;  4DZ1 A;  3OO8 A;  2H98 A;  3ZKL A;  1ZIU A;  1XOC A;  3KOS A;  2ONS A;  2QS3 A;  1B32 A;  2Q88 A;  1ATG A;  4KYS A;  4LQ2 A;  1OQG A;  3KN7 A;  5H8S A;  3TDJ A;  1SBP A;  4GRK A;  4IGT A;  2PVU A;  5LOM A;  1Y1M A;  1M5E A;  2VD3 A;  2QS2 A;  3C33 A;  1N76 A;  4ZE9 A;  1N3W A;  5ICT A;  1SD3 A;  1TFA A;  1J1N A;  2I3W A;  1TWY A;  3IJO B;  1H45 A;  3K1P A;  4KD5 A;  1N0T A;  2H99 A;  4F3G A;  3VVE A;  3FJ7 A;  3T22 A;  4F1U A;  4FEC A;  1XS5 A;  2G29 A;  1I69 A;  5ICQ A;  4LA9 A;  5J1D A;  5KCJ A;  4RPN A;  4ZZE A;  2P1S A;  3CSB A;  4GWO A;  5ELV A;  3V8X B;  3HST A;  2F6G A;  3FXR A;  4G8H A;  3MW0 A;  1MH4 A;  1S9T A;  5AA1 A;  3K0V A;  3EF7 A;  1SI1 A;  1NL5 A;  3E4R A;  1US4 A;  4TLM B;  1I6B A;  1LFI A;  1N3X A;  3D4G A;  4IO4 A;  4IO5 A;  3KSX A;  2AIX A;  3MUQ A;  1URD A;  3TCH A;  2X7Q A;  1QJM A;  3K01 A;  1Q35 A;  2DSF A;  4ZEI A;  2RIN A;  2H4I A;  2UXA A;  2FA7 A;  1B3E A;  2ONK E;  2E1S A;  3VDF A;  1XT8 A;  4PP0 A;  1MQG A;  3IO4 A;  1JW5 A;  2PX1 A;  4DIG A;  2O6A A;  1LCT A;  4ZE8 A;  2O69 A;  5F1Q A;  3IK6 B;  3I3V A;  2XXR A;  3QIM A;  1RYX A;  4YZZ A;  1MS7 A;  4F2Q A;  3GXA A;  1Y4T A;  4G8M A;  4XKR A;  4KR5 A;  3A09 A;  3ODB A;  3PD8 A;  2R6G E;  4GXS B;  4LZ8 A;  2P2A A;  4JSD A;  1FTL A;  2F35 A;  3IJX B;  4BDN A;  4NF6 A;  1Y3P A;  3K4U A;  4L17 A;  3TMG A;  2CZL A;  2I4C A;  4QFP A;  1YPN A;  1A40 A;  4ZEC A;  1URS A;  4MFI A;  3FXU A;  3IX1 A;  1M5F A;  3CFX A;  3MQ9 A;  3S9N C;  5L8D A;  4U1O A;  4EDP A;  3ONM A;  4KQP A;  1BLF A;  4NF5 B;  2VHA A;  1JW1 A;  4C0R A;  3OEM A;  2O7U A;  3UA8 A;  4JWO A;  3O9P A;  4G8N A;  5BUU A;  1VE4 A;  3O66 A;  4YU0 A;  2B65 A;  2ZYN A;  3EHS A;  2PYY A;  5DTB A;  2PT1 A;  4F31 B;  2RC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...