3PPPA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
272
structure length
272
Chain Sequence
DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
total genus 105
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3pppA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3pppA02
4OXVA 3FVNA 4ONYA 2RF1A 4RJZA 2DWHA 4HTGA 4R9GA 3C31A 2XX8A 5B7DA 4F19A 4YKKA 2ZNUA 1AL3A 1BTJA 2UXAA 3Q29A 3I5OA 2O6AA 4KYDA 3TCFA 4YU0A 1ZIUA 3FGSA 3VLWA 2I48A 4C1TA 1DSNA 3WAEA 1JEVA 1EZPA 2UVJA 1DPPA 1SYIA 3B6TA 1NFTA 3T9XB 4OEVA 2XXHA 4GVOA 4BDRA 1LAHE 3FASA 3O6IA 3BKIB 5KCJA 4DCXA 4OFJA 1NNTA 1B1XA 3N6UA 3FVKA 1L5TA 4R2FA 1OVTA 4PQJA 3UORA 1MRPA 1LFHA 1ZBMA 4WEDA 1VFEA 4MF3A 3FXRA 1TXFA 4U4SA 2DXRA 3A3UA 1JEUA 1GR2A 1OQGA 3MVWA 1D3KA 3TDJA 1A7LA 4QSEA 3RNNA 2Y7RA 4Z0IA 4WKMA 3MWBA 3VDFA 4EXKA 1OMPA 1IXIA 2HEUA 1Z7NE 4Z7EA 2D21A 5I56A 3OXNA 3PPOA 1R9LA 5HM4B 5I58B 4DXBA 2NWJA 4OVJA 1XS5A 4MBPA 5EHMA 5FTHA 4PFYA 3H6VA 3TQLA 3K1NA 3C36A 4JWOA 1JNFA 2I4BA 1B7HA 3DLNA 4NTLA 1S9TA 4YKPA 4MH5A 3P7IA 4WEPA 3MVZA 3U93A 4KI0E 4M1VA 4ELOA 5CM6A 2XXTA 2Q2AA 1TT1A 4RPNA 3TAJA 5CRYA 3SEUA 4HCYA 3O29A 2QRYA 2V84A 3MPLA 2O84X 2XXXA 3TKDA 5L9SA 3TELA 2P0SA 2F34A 5CMMA 1MQIA 2DOJA 4KCDA 4EDPA 3M3LA 2PVUA 2Z8DA 4N6PA 4ZZEA 1B3GA 1Y4CA 3SEXA 5I2KA 2V3QA 3K01A 5ITPA 2DP8A 2V93A 3PMXA 5LOMA 1MY2A 3FIRA 2O69A 4IO4A 3M3KA 2PYYA 2DXYA 1MM7A 1N0TA 4RK9A 4KPTA 5AA2A 2RCAA 2ANJA 1MY0A 2R71A 4U1ZA 3THIA 1H76A 3OMBA 5ICTA 3K1PA 3V8XB 4PFUA 1Y3QA 2AL4A 1D9YA 2DE2A 3CR9A 1B4HA 3PPRA 3HN0A 1SW5A 3FVGA 2XXRA 4LONB 1VFDA 3KFMA 2KLFA 3CG1A 1M5EA 2F6PA 4U4XA 5AA4B 3JV9A 3QYTA 3VVEA 5H8HA 1I6AA 2XXPA 4H67A 3H4ZA 4GQOA 1DMBA 1DPEA 1M5BA 1N76A 2UVHA 3ODBA 3MC2A 3OOAA 1O64A 2P2AA 4IY5A 5H8FB 4PFWA 4NWDA 4GF8A 4DXUA 5JK4A 2ZYOA 2F36A 2XXUA 1Y3NA 4THIA 2CZLA 2OWSA 5DVJA 4EQBA 1ANFA 3A09A 2O7UA 2H25A 5AA3A 2O7IA 3CI8A 1MQJA 4H5FA 3K6WA 4YKIA 1P1WA 1SQYA 4ZE9A 5I84A 1UTHB 3N6TA 3KN3A 4LA9A 4MLQA 3ONMA 4DXCA 3IB0A 4PP0A 4U1OA 4GRKA 1XVYA 1Y1ZA 4OQOA 3IO4A 3CG3A 2UYFA 4EF2A 4NF6A 1FTLA 4FAJA 5DYHA 3MP8A 3DP6A 1IIWA 5DVFA 2ZXTA 1EZ9A 1MY3A 1B4ZA 1PB7A 1R9QA 3RY3A 4EF1A 1FQFA 3EN3A 4I1DA 2RCBA 4ZZAA 4ND9A 4X1BA 2GH9A 3KOTA 4QSDA 3Q26A 4N07A 4YKJA 1TFAA 5TU0A 4BDNA 2F78A 2HFBA 3HO7A 1B32A 3L6HA 5KCJB 3C34A 1WVJA 3OEMA 2QMWA 4P0GA 4DE8A 3Q27A 2YLNA 5TP9A 2I0CA 1JQFA 5K2XA 4POXA 3V5AA 4OTEA 1IXCA 1O7TA 1M5FA 2PT1A 2I49A 2B65A 1URGA 3L6GA 1QULA 3IJOB 1PB9A 3PUWE 5TPAB 4G68A 2DE3A 1Q35A 1MDP1 3QIMA 5I56B 3KG2A 4EQ9A 3HSTA 2H98A 1USYE 5AA1A 2ZYKA 1VR5A 3KN8A 1OLAA 2Y7PA 4Q0CA 5DTBA 1M5DA 3SEVA 2HCAA 4H1XA 1ZKBA 5ELVA 3T9VA 1ZMGA 2OCUA 1SDXA 1SBPA 4FEDA 4IO7A 1IXHA 1SI0A 4JDFA 3UN6A 3CVGA 3MVXA 2R9JA 4AB5A 3K02A 3RN8A 1N3XA 2GRVA 1UQWA 2HXWA 1POY1 3W9VA 4ZDMA 4ZEFA 2ZNTA 3DM0A 4IO2A 2Y7WA 1H45A 5I2KB 4OHNA 3EF7A 3SERA 4POWA 3MJNA 3FXQA 3PD8A 2PBWA 1UIVA 1I6BA 1LBCA 2HZKA 3QUJA 4GOTA 3FV2A 5AA2B 2Z8EA 3IOTA 1LLSA 4UACA 3W9WA 3SEWA 1DOTA 3N5LA 1MG1A 1AMFA 4ECFA 3K6XA 2RC9A 3S2VA 4FATA 3OELA 3KJ7A 2RC7A 1MM6A 1VSOA 4G2ZA 1FQCA 1MDQA 3H6UA 3UK4A 1BIYA 2I4CA 1PC3A 5AE4A 2RC8A 1IXGA 2DWJA 2OZZA 5A5XA 1RYOA 2G93A 4RXLA 3O28A 5CMBA 2UVIA 1MH3A 1AH5A 5CI5A 1B7UA 3U92A 1S7YA 4U2RA 3QXMA 1US5A 3OO8A 3GBAA 5CMKA 4QFLA 4AQ4A 5H8HB 1B5HA 3ZKLA 5JTYA 3MVYA 1PB8A 4XKNA 4O3BA 4XIGQ 1A40A 3PMVA 4ZE8A 3C32A 3FV1A 4OYVA 1ELJA 1DTGA 3KSJA 1QUKA 3RT6B 3OO6A 3G3FA 3VV5A 4ESXA 4QF9A 3PGFA 3TTLA 1Z7ME 1Y4TA 2ONSA 5ICQA 4WXJA 2HAVA 5H8NA 3TODA 3IOVA 2QJEA 2NVUB 4NF4A 2VD3A 1SVXB 1NNFA 2QSXA 3TTNA 1Q1KA 3SETA 3M3FA 1R6ZA 2WKYA 4KYSA 3UP9A 4N13A 3EQ1A 1FW0A 4GWOA 3QUFA 4IB2A 4QRZA 1NL5A 3PPNA 4Q8RA 2UYEA 1FTMA 3LSWA 3O6GA 1MQDA 1MPDA 2DVCA 2RKMA 4NWCA 1US4A 3G3GA 3FUZA 5B70A 4YB5A 4KD5A 4F18A 4BLAA 1SYHA 3BFUA 2XX9A 3KBRA 2ZNSA 4HS7A 3CSGA 1JVYA 2X7QA 1LAGE 4ZECA 2XX7A 2F8DA 5FHOA 3FXUA 3CIJA 3W15C 3IOUA 2GHAA 3U8QA 3DELB 3ILTB 2A5SA 4HW8A 3K00A 1T0KA 5CMCA 1B51A 4YMAA 2QS3A 1MXVA 3SKPA 1PDAA 3O6HA 4GFRA 1Y3PA 3TTKA 5TP9B 3IL1B 4BDMA 4OETA 4TQUQ 4NF5A 1ATGA 4XKRA 4PE5B 5I57A 1IUDA 1EH3A 4NE4A 4X48A 2XXWA 4DCYA 4RY1A 2LAOA 4G68B 4DIGA 4KQPA 4E0XA 4RK2A 4R9FA 2DWIA 1FQEA 4F2QA 3V83A 4R72A 3IOWA 1FTOA 3IAZA 1B46A 3G7WA 4Q5TA 1SW1A 1S50A 1B1HA 4HCWA 4F3SA 1NNPA 4OENA 4ZEKA 1NH8A 4RNSA 4ELPA 1MS7A 1UTBA 2IA4A 4U21A 2OLBA 5FHNA 1GV8A 1I69A 1OLCA 3FJGA 5CBRA 5DEXA 3IORA 4DDDA 3VE1B 1LAXA 3KN7A 2THIA 3WAFA 1MY4A 4QFOA 4XKQA 2Q88A 3PUYE 5I2NA 2E0SA 1GTKA 4OFOA 1B52A 1FQAA 3IK6B 2V3TA 2Y84A 2DVZA 2UVGA 2CMOA 3TQWA 1TFDA 3TYHA 4OFLA 1II5A 1P1QA 4LATA 5H8QA 3QSLA 5IAIA 2A5TA 3HCQA 2GFEA 1M5CA 1SI1A 3RT8A 2REJA 3BFTA 4YZZA 5ISUA 3VLVA 1D9VA 3IB2A 4JSDA 4LQ2A 3D4GA 4NEDA 2VGQA 3VLUA 5HPQA 1FQBA 3KOSA 2Q2CA 1P1NA 3HPIA 1LGBC 2NOOA 3FVOA 2H9BA 3O66A 2ESNA 3EPEA 3RPWA 3RTWB 3VXCA 4GL0A 3GBBA 3S9LC 1URSA 4FECA 3DP4A 1B05A 3K2DA 5A5XB 4QFKA 3JZJA 1SW4A 4PFTA 2B3FA 3LSFB 2F7AA 1B0LA 1RKMA 4MFIA 2I3WA 3GZGA 4QHQA 1FTKA 5JTYB 4JSOA 1B0HA 5M2VA 2D3IA 4IGRA 3EHUA 3TTRA 1LB9A 3M8UA 4LZ8A 3Q28A 1N84A 2F7BA 3MAMA 1MXXA 3MZ9A 5FTIA 2NXOA 2QS2A 4YAHX 1QKAA 2ONRA 4F29A 1MPBA 1A8FA 4R75A 3C9HA 2I0BA 3KEIA 4ELRA 4TLMB 2I58A 2BJJX 5H8NB 4GD5A 1B5IA 3H7MA 1PEBA 1GGGA 2ALUA 4IO6A 3RUMA 5J1DA 3B6WA 2OBGA 4FE8A 3TZAA 4JWXA 4F39A 2V25A 3HHGA 1XOCA 1POTA 3PPPA 1ZLQA 2HAUA 3LBSA 2O1LA 3VFJA 4KFQA 1YCJA 4R73A 2NUVA 3FJ7A 4EUOA 3LC8A 1EZOA 1LAFE 4E0WA 4H65A 3PUZE 2F5XA 3PPQA 2F97A 4GL8A 1OIBA 4DZ1A 1MH4A 2IEEA 4JWYA 3S9NC 3MBPA 3C35A 1H44A 3E9XA 2QL3A 3T9HB 2D5WA 1QUJA 1JW4A 4GLIA 5KDTA 3F11A 5I59A 2XXVA 3PU5A 3G3JA 3BBRA 1QJMA 3PV0E 4X1DA 3T96B 1XVXA 4C1UA 1F9BA 2XXYA 2Z8FA 4H0WA 4I8CA 4FJPA 4ESWA 5L9MA 3T93B 3T22A 3Q25A 4RYAA 2Z23A 5ITOA 3H03A 2AL5A 3OD7A 2OWTA 2VHAA 1USYH 4K3FA 4KCCA 4OESA 1URDA 4EXLA 2Y7IA 2OK2A 4F3BA 4LP2B 3OSQA 1O63A 4G8NA 4NF5B 4XKPA 1NMUA 3CFZA 2XXIA 1OQHA 5I57B 3AXFA 4LQ5A 2X26A 1P1UA 2B3BA 4U22A 3RLFE 4XXUA 1LBBA 3B7DA 1B7ZA 2PX1A 3ECRA 3B6QA 3FZVA 1CE2A 4NF8A 4JXIA 3H6TA 2FNCA 4F1YA 3G3HA 3R7XA 3OENA 2RINA 3PD9A 3UGWA 3ILUB 5TPAA 1QW0A 4ZEBA 3K4UA 2O68A 2E1SA 3OSRA 2F35A 3A3CA 4MLVA 1Y20A 5BUUA 4YMBA 4OZ9A 1AOVA 3C33A 2W7YA 4H5GA 2F6GA 3MP1A 2Q8JA 3USDA 2ZYMA 1UTBB 4GXSB 2VP1A 3R26A 4IGTA 4IY6A 4QSCA 5F1QA 3K0VA 4I62A 4QFNA 4GIZA 5DEXB 1XHYA 3SESA 5L9OA 2YJPA 1LSTA 4IO5A 1P1OA 2QS1A 3LSXA 3IB1A 2Y7KA 5I2NB 3E3KA 2AIXA 1PBPA 1B3FA 1MXZA 4UA8A 3OO9A 3CFXA 3H6WA 4NF6B 5CBSA 2QMXA 2PMSA 1FCKA 3HHFA 3PMWA 3FD3A 5H8QB 2H5YA 3I6VA 2A5TB 5F7VA 1QKBA 2Q89A 1I6QA 1IITA 3IX1A 4F2OA 1JVXA 4U23A 1MY1A 2ZYNA 4YB7A 2H99A 3MPKA 1KWHA 2ZMBA 1B2HA 1B6HA 5DVIA 4O3AA 2DQVA 5L8DA 3O2AA 3VVDA 2I6EA 2XD3A 1FQDA 3T9UA 4G8MA 3ZS6A 3SDFA 4JB7A 4R6KA 5EHSA 5CC2A 4LZ5A 4TLLB 1MQGA 4EQ7A 2V3UA 1IQ7A 3E13X 4R6HA 2GHBA 3ZSFA 2M8CA 1QUIA 3H3GA 1ZJLA 2VOZA 5IKBA 4JBZA 3MUQA 4G77A 2X7PA 3T66A 4QFPA 4F1VA 5H8SA 1A8EA 2F7CA 5KZTA 3S9EA 3U94A 4GXAA 4G4PA 3K1MA 1DTZA 3DP8A 3HV1A 1JW5A 1LFGA 1FTJA 4YICA 1B40A 1NNKA 3OEKA 2P1SA 3KSXA 3S4UA 3N26A 2HZLA 3MZ1A 2Z22A 4ZEIA 3IO6A 2AYSA 2ONKE 3MQ9A 2DS9A 4F3GA 3OO7A 3MP6A 2FYIA 4XTCQ 5I58A 3E4RA 3MZBA 1ZTYA 3K6VA 4FORA 1MPCA 3TFLA 2O51A 3S9MC 1JETA 2QPQA 3MW0A 4NMYA 1LCFA 3CSBA 3LR1A 1EU8A 3UIFA 2ABHA 3TPAA 1TWYA 1MXUA 2DSFA 3RQTA 2QS4A 2XHDA 3PUXE 4G68C 4P11A 3RTFB 4G8HA 2R6GE 1JW1A 3GLBA 3GXAA 4AB6A 4PETA 3EHSA 4F1UA 3KGCA 4FIMA 1LCTA 2I3VA 1A54A 4LUBA 3EHTA 4OEUA 3N94A 4BDOA 3VXBA 1IZ1A 5KDTB 4BDQA 5I59B 4C0RA 1R1NA 2VD2A 4M4GA 4IO3A 1B9JA 4I9DA 1YTVA 3H06B 2PT2A 3U1OA 2DWAA 1ZU0A 3IJXB 2G29A 3G3KA 5FHMA 2XD2A 1B5JA 5EYFA 1H3DA 1B3EA 4R6YA 4L17A 3G3IA 3UA8A 3ZKKA 4H8JA 4OMBA 4YB6A 4F31B 3VVFA 1H43A 4OERA 3O97A 1A99A 4TOZA 5K2YA 3R6UA 1J1NA 3KJTA 3TCHA 1MXYA 1WODA 1LFIA 3I3VA 3IR1A 2REGA 4R74A 4H6DA 3QK6A 1A55A 4RA1A 4Q30B 1AIVA 4ZEDA 1VE4A 1BKAA 2O1MA 1B58A 1P99A 4LVQA 1WDNA 3QAXA 1YAEA 3FATA 5AA4A 4KYEA 3U72A 3FJMA 4LZ7A 4NF8B 1B3HA 1N04A 3D4CA 3TMGA 1Y1MA 1BLFA 1BP5A 1N3WA 2XXQA 2H4IA 1NH7A 3C4MA 4KR5A 3RGYA 1OVBA 1N7XA 1RYXA 4X9TA 4ISUA 1LB8A 2OJTA 1GVCA 1PBQA 3CRBA 4F22A 4H8IA 1Y9UA 4ZS9A 4O3CA 1XC1A 2FA7A 2DE4A 3K6UA 3O9PA 1YPNA 5DT6A 1MXWA 5H8FA 5BWJA 3TTMA 3TCGA 3PUVE 3SEYA 1QVSA 1MQHA 4NF4B 5AA2D 4F3PA 3TUSA 2YPNA 4R2BA 1UIUA 4ELQA 2HQ0A 1HSJA 2Q9TA 4BDLA 3KZGA 3LUYA 1B3LA 4FEBA 5JEIA 1HSLA 4KHZE 1N7WA 1CB6A 1HSEA 1D4NA 3CFLA 1SW2A 1NKXA 3V89B 1UTHA 1IEJA 1SD3A 2DYXA 4RPOA 3LSLA 5HBCA 3TEPA 4DLDA 4P0IA 3JYRA 4OWDA 1XT8A
chains in the Genus database with same CATH superfamily
4OXVA 3FVNA 4ONYA 5EQAA 2RF1A 4RJZA 2DWHA 2QVRA 4HTGA 4R9GA 3C31A 2XX8A 5B7DA 4F19A 4YKKA 2ZNUA 1AL3A 4H45A 3HFUA 1BTJA 4PDHA 2UXAA 3Q29A 3I5OA 1D9QA 2O6AA 4KYDA 3TCFA 4YU0A 1ZIUA 3FGSA 3VLWA 2I48A 4C1TA 1DSNA 4MEVA 3B50A 4P3LA 3WAEA 1JEVA 2Q74A 1EZPA 2UVJA 1DPPA 1SYIA 3B6TA 1NFTA 3T9XB 4OEVA 2XXHA 3T1BA 4GVOA 4BDRA 1LAHE 3FASA 3O6IA 3BKIB 5KCJA 4DCXA 1NI9A 4OFJA 1NNTA 1B1XA 3N6UA 3FVKA 1L5TA 1IMAA 4R2FA 1OVTA 3CHGA 4PQJA 3UORA 1MRPA 1LFHA 1ZBMA 1FBEA 4WEDA 1VFEA 4MF3A 3FXRA 5IZ3A 1TXFA 4U4SA 2DXRA 3A3UA 1JEUA 1GR2A 1OQGA 1YZ0A 3MVWA 1D3KA 3TDJA 5I5PA 1A7LA 4QSEA 2V4CA 3RNNA 1YYZA 2Y7RA 4Z0IA 4WKMA 3MWBA 3VDFA 4EXKA 1OMPA 1IXIA 2HEUA 1Z7NE 1NUZA 2D21A 4Z7EA 5I56A 3OXNA 2FVZA 3PPOA 1R9LA 5HM4B 5I58B 4DXBA 2NWJA 4OVJA 1XS5A 4MBPA 5EHMA 4X04A 5FTHA 4PFYA 3ROJA 3H6VA 3TQLA 3K1NA 3C36A 4O7IA 4JWOA 1JNFA 2I4BA 4NF0A 4OVSA 1B7HA 3DLNA 4GWZA 4NTLA 1S9TA 4YKPA 4MH5A 4N4UA 3P7IA 4WEPA 3MVZA 3B8BA 3U93A 4KI0E 4M1VA 4ELOA 5CM6A 2XXTA 2Q2AA 4I40A 1TT1A 4RPNA 3TAJA 5CRYA 3SEUA 4HCYA 2FIXA 3O29A 2QRYA 2V84A 3MPLA 4N91A 2O84X 2XXXA 3TKDA 5L9SA 3TELA 2P0SA 2F34A 2HXRA 5CMMA 1MQIA 2DOJA 3LV0A 4KCDA 4EDPA 2FHYA 3M3LA 2PVUA 2Z8DA 4N6PA 4ZZEA 1B3GA 1Y4CA 3SEXA 5I2KA 5I7IA 2V3QA 3K01A 5ITPA 1FBFA 2DP8A 2ZZVA 2V93A 3PMXA 5LOMA 1MY2A 3FIRA 2O69A 4IO4A 3M3KA 2PYYA 2DXYA 2VT5A 1MM7A 1FRPA 1N0TA 4RK9A 4KPTA 2Y5LA 2RCAA 5AA2A 2HHMA 2ANJA 1MY0A 2R71A 4U1ZA 3THIA 1H76A 3OMBA 5ICTA 2KQZA 2B4MA 3K1PA 3V8XB 4PFUA 1Y3QA 2AL4A 1D9YA 2DE2A 1NV1A 3CR9A 1B4HA 3PPRA 3HN0A 1SW5A 1FPDA 3FVGA 2DDKA 2XXRA 4LONB 1VFDA 3KFMA 2MKZA 2KLFA 4GWXA 2QVVA 4KXPA 3CG1A 1M5EA 2F6PA 4U4XA 4P56A 5AA4B 3JV9A 3QYTA 3VVEA 4OVTA 5H8HA 1I6AA 2XXPA 4H67A 3H4ZA 4GQOA 1DMBA 4PFIA 1DPEA 1M5BA 1N76A 2UVHA 3ODBA 3MC2A 3OOAA 1O64A 2P2AA 4IY5A 4P1EA 5H8FB 4PFWA 4NWDA 4GF8A 4GWYA 4DXUA 5JK4A 2ZYOA 2F36A 1BK4A 2XXUA 1Y3NA 4THIA 2CZLA 2OWSA 5DVJA 4EQBA 1ANFA 3A09A 2O7UA 2H25A 5AA3A 2O7IA 3CI8A 1MQJA 1G0HA 5EQ8A 4H5FA 3K6WA 4YKIA 1P1WA 1SQYA 4ZE9A 5I84A 3BIHA 4MHFA 1UTHB 2F3BA 3N6TA 2WYKA 3KN3A 1XI6A 4LA9A 3KBZA 4MLQA 3ONMA 4DXCA 1FJ9A 3IB0A 4PP0A 4U1OA 3U65A 4GRKA 1XVYA 1Y1ZA 2B4LA 4OQOA 3IO4A 3CG3A 2UYFA 1FPGA 4EF2A 4NF6A 1FTLA 1NV6A 2F3DA 4FAJA 2BJIA 5DYHA 3MP8A 3DP6A 1IIWA 5DVFA 2ZXTA 1EZ9A 1MY3A 3E79A 1B4ZA 1PB7A 1FJ6A 1R9QA 3RY3A 4EF1A 1FQFA 3EN3A 4I1DA 2RCBA 4ZZAA 4ND9A 1FBPA 4X1BA 2GH9A 3KOTA 4QSDA 4N17A 3Q26A 4N07A 4YKJA 1TFAA 1FPEA 1QGXA 5TU0A 4BDNA 2F78A 2HFBA 3HO7A 1B32A 3L6HA 5KCJB 3C34A 2VPNA 1WVJA 3OEMA 2QMWA 4P0GA 4DE8A 2XWVA 3Q27A 2YLNA 3MSTA 5TP9A 2I0CA 1JQFA 4GX3A 5K2XA 4POXA 3V5AA 4OTEA 1IXCA 1O7TA 1M5FA 2PT1A 2I49A 2B65A 1URGA 3L6GA 1QULA 3IJOB 2WEFA 1PB9A 3D1RA 3PUWE 5TPAB 5ET5A 4G68A 2DE3A 2PFZA 4O94A 1Q35A 1FBHA 1MDP1 3QIMA 4IR8A 5I56B 3KG2A 1G0IA 4EQ9A 3HSTA 2H98A 1USYE 5AA1A 2ZYKA 1VR5A 3KN8A 1OLAA 2Y7PA 4Q0CA 5DTBA 1M5DA 3SEVA 2HCAA 4H1XA 1ZKBA 2CZHA 4P8BA 5ELVA 3FXBA 1EYIA 3T9VA 1ZMGA 4PC9A 2OCUA 1SDXA 1LEVA 1SBPA 4FEDA 1KA0A 4IO7A 1IXHA 1SI0A 4P1LA 4NG7A 4AS4A 4JDFA 3UN6A 4QBAA 3CVGA 3MVXA 1RDXA 2R9JA 4AB5A 4DI4B 3K02A 3RN8A 1N3XA 2GRVA 1UQWA 2HXWA 1POY1 3W9VA 4ZDMA 4ZEFA 2ZNTA 3DM0A 4IO2A 2Y7WA 5IM2A 1H45A 5I2KB 4H46A 4OHNA 4QXDA 1NV4A 3EF7A 3SERA 4POWA 3MJNA 3FXQA 3PD8A 2PBWA 1UIVA 1I6BA 1LBCA 1NUYA 2HZKA 3QUJA 4GOTA 3FV2A 5AA2B 1EYJA 2Z8EA 3IOTA 1LLSA 4UACA 3W9WA 4GWWA 3SEWA 1DOTA 2XWKA 3N5LA 1MG1A 1AMFA 4ECFA 3K6XA 2RC9A 3S2VA 4FATA 3OELA 3KJ7A 4GBVA 2RC7A 1MM6A 1VSOA 4G2ZA 1CNQA 1FQCA 1MDQA 3H6UA 3UK4A 1LBWA 1BIYA 2I4CA 1PC3A 5AE4A 2RC8A 1IXGA 2DWJA 2OZZA 5A5XA 1RYOA 2G93A 4RXLA 3O28A 5CMBA 2UVIA 1IMDA 1MH3A 1AH5A 5CI5A 1B7UA 3U92A 1S7YA 4U2RA 2CEYA 3RPLA 2FBPA 1FPLA 3QXMA 5IZZA 1US5A 4PAKA 3OO8A 5T3JA 3GBAA 5CMKA 4QFLA 4AQ4A 5H8HB 1B5HA 4OA4A 3ZKLA 5JTYA 3MVYA 1PB8A 4XKNA 1IMFA 1NV0A 4O3BA 4XIGQ 1A40A 3PMVA 4ZE8A 3C32A 3FV1A 4OYVA 1DTGA 1ELJA 3KSJA 1QUKA 3RT6B 3OO6A 3G3FA 3VV5A 4ESXA 4QF9A 3PGFA 3TTLA 1Z7ME 1Y4TA 2ONSA 3IFAA 5ICQA 4OVRA 4WXJA 2HAVA 5H8NA 3TODA 3IOVA 2QJEA 2NVUB 4NF4A 2VD3A 1SVXB 1NNFA 2QSXA 3TTNA 1Q1KA 3SETA 3M3FA 1R6ZA 4MMPA 2WKYA 4KYSA 3UP9A 4N13A 3EQ1A 1Q9DA 1FW0A 5A5LA 4GWOA 4PFBA 3QUFA 4IB2A 4QRZA 2R8TA 1NL5A 3PPNA 4Q8RA 2UYEA 1FTMA 3LSWA 4N8YA 3O6GA 1MQDA 1MPDA 2DVCA 2RKMA 1RDZA 5ET7A 4NWCA 2L5VA 1US4A 3G3GA 3FUZA 3LUZA 5B70A 4N15A 4YB5A 4KD5A 4F18A 4BLAA 1SYHA 3KC0A 3BFUA 2XX9A 3KBRA 2ZNSA 4HS7A 3CSGA 1JVYA 1FBDA 2X7QA 1LAGE 4ZECA 2XX7A 4NHBA 2F8DA 5EQ7A 5FHOA 3FXUA 3CIJA 3W15C 3IOUA 4MNIA 2GHAA 3U8QA 3DELB 3ILTB 5EYHA 2A5SA 4HW8A 3K00A 1T0KA 5CMCA 1B51A 4YMAA 2QS3A 4PAIA 1MXVA 3SKPA 1PDAA 3O6HA 4GFRA 1Y3PA 2GQ1A 3TTKA 5TP9B 3IL1B 4BDMA 4OETA 4TQUQ 4LN5A 4NF5A 1ATGA 4XKRA 4PE3A 4PE5B 5I57A 1IUDA 1EH3A 4NE4A 4X48A 4P47A 3RYDA 2XXWA 2XWIA 4DCYA 2KR0A 3ISPA 2LAOA 4RY1A 4G68B 4DIGA 4HXVA 4KQPA 4E0XA 4RK2A 4R9FA 2DWIA 1FQEA 4F2QA 3GYYA 3V83A 4R72A 4XF5A 3IOWA 1FTOA 5IZ1A 1SPIA 3IAZA 1B46A 3G7WA 2XWOA 4Q5TA 1SW1A 1S50A 4GX4A 1B1HA 4HCWA 1NV3A 4F3SA 4PBQA 1NNPA 4OENA 4ZEKA 1NH8A 2XA5A 4RNSA 4ELPA 1MS7A 1UTBA 2IA4A 2WBDA 2OLBA 4U21A 5FHNA 1GV8A 2QVUA 1FBGA 1I69A 1OLCA 3FJGA 5CBRA 5DEXA 3IORA 4DDDA 3VE1B 1LAXA 3KN7A 4PF8A 2THIA 4P9KA 3WAFA 1MY4A 4QFOA 4XKQA 2Q88A 2OX3A 3PUYE 5I2NA 2E0SA 1GTKA 1DBZA 4OFOA 2WX9A 1B52A 1FQAA 3IK6B 2V3TA 2Y84A 2DVZA 2UVGA 2CMOA 4O7MA 3TQWA 1TFDA 3TYHA 2ZZWA 4I3YA 4OFLA 1II5A 1P1QA 4LATA 5H8QA 1YXIA 3QSLA 5IAIA 2A5TA 3HCQA 2GFEA 1M5CA 1SI1A 3RT8A 4FBPA 2REJA 3BFTA 4YZZA 5ISUA 3VLVA 1D9VA 3IB2A 4JSDA 4LQ2A 3D4GA 4NEDA 2VGQA 3VLUA 5HPQA 1FQBA 4HE2A 3KOSA 2Q2CA 1P1NA 3HPIA 1EYKA 1LGBC 2NOOA 3FVOA 2H9BA 3O66A 4MX6A 2ESNA 3EPEA 3RPWA 3RTWB 3VXCA 4GBWA 4GL0A 1FBCA 3GBBA 3S9LC 4PTKA 1URSA 2Q8MA 4FECA 3DP4A 1B05A 3K2DA 5A5XB 4QFKA 3JZJA 1SW4A 5LDZA 4PFTA 2B3FA 3LSFB 2F7AA 1B0LA 1RKMA 5IZ3B 4MFIA 3RPLB 2I3WA 1AWBA 3GZGA 4PGPA 4QHQA 1FTKA 5IGAA 5JTYB 4JSOA 1B0HA 2WYPA 5M2VA 2HPGA 2D3IA 4IGRA 3EHUA 3TTRA 4OVPA 1LB9A 3M8UA 4GX6A 4LZ8A 3Q28A 1N84A 3BIGA 2F7BA 3MAMA 1MXXA 3MZ9A 5FTIA 2NXOA 2QS2A 1VDWA 4YAHX 1QKAA 2ONRA 4F29A 1MPBA 1A8FA 4R75A 4PBHA 3C9HA 4PF6A 2I0BA 3KEIA 4ELRA 1IMBA 4TLMB 2I58A 2BJJX 5H8NB 4GD5A 1B5IA 5FBPA 5DW8A 3H7MA 1PEBA 1GGGA 2ALUA 4IO6A 3RUMA 5J1DA 3B6WA 2OBGA 4FE8A 3TZAA 4JWXA 4F39A 2V25A 3HHGA 1XOCA 1POTA 4JVIA 3PPPA 4NAPA 1ZLQA 2HAUA 3LBSA 2O1LA 3VFJA 4KFQA 1YCJA 4HE1A 4R73A 2NUVA 3FJ7A 4EUOA 3LC8A 1EZOA 1LAFE 2CEXA 4E0WA 4H65A 3PUZE 4N81A 2F5XA 3PPQA 1INPA 2F97A 4GL8A 2CZKA 1OIBA 4DZ1A 1MH4A 2IEEA 5EQ9A 4JWYA 3S9NC 3MBPA 3C35A 1H44A 3E9XA 4GWSA 2QL3A 2CZIA 2PCRA 3T9HB 2D5WA 1QUJA 4XFEA 1JW4A 4NGUA 4GLIA 2VPOA 5KDTA 1LBXA 3F11A 5I59A 4X8RA 4GWUA 2XXVA 3PU5A 3G3JA 3BBRA 1QJMA 3PV0E 4DI3D 4X1DA 2ZZXA 3T96B 1XVXA 4C1UA 1FPBA 1F9BA 2XXYA 2Z8FA 4H0WA 4I8CA 4FJPA 4ESWA 5L9MA 3T93B 3T22A 1NUXA 3Q25A 4RYAA 2Z23A 5ITOA 3H03A 2AL5A 3OD7A 2OWTA 2VHAA 1USYH 1IMCA 4K3FA 4KCCA 4OESA 1URDA 4EXLA 2Y7IA 2OK2A 4MJOA 4F3BA 4LP2B 1LBYA 3OSQA 1O63A 4G8NA 4NF5B 4XKPA 1NMUA 3CFZA 2XXIA 1OQHA 5I57B 3AXFA 4LQ5A 3T0JA 2X26A 1P1UA 2B3BA 1FPIA 4U22A 3RLFE 4XXUA 1LBBA 3B7DA 1B7ZA 2PX1A 3ECRA 3KC1A 3B6QA 3FZVA 1CE2A 4NF8A 4JXIA 3H6TA 2FNCA 4F1YA 3G3HA 1JP4A 3R7XA 3OENA 3E78A 2RINA 4N6DA 3PD9A 3UGWA 3ILUB 5TPAA 1QW0A 4ZEBA 3K4UA 2O68A 2E1SA 3OSRA 2F35A 3A3CA 4MAGA 4MLVA 1Y20A 5BUUA 4YMBA 4OZ9A 1AOVA 3C33A 2W7YA 4H5GA 1DCUA 2F6GA 3MP1A 2Q8JA 3USDA 2ZYMA 1K9ZA 1UTBB 4GXSB 2VP1A 3R26A 4IGTA 4IY6A 4O8MA 4QSCA 5F1QA 3K0VA 4I62A 4QFNA 3NOHA 4GIZA 5DEXB 1XHYA 3SESA 5L9OA 2P3NA 2YJPA 1LSTA 5LTCA 4IO5A 1NV5A 1P1OA 2QS1A 3LSXA 3IB1A 2Y7KA 5I2NB 3E3KA 2AIXA 1PBPA 1B3FA 3EKIA 1MXZA 4UA8A 4XEQA 3OO9A 3CFXA 3H6WA 4NF6B 1KZ8A 5CBSA 2QMXA 2PMSA 1FCKA 3HHFA 3PMWA 3FD3A 5H8QB 2H5YA 3I6VA 2A5TB 5F7VA 4I3EA 1QKBA 2Q89A 1I6QA 1IITA 3IX1A 4F2OA 1JVXA 4U23A 1MY1A 2ZYNA 1RDYA 4JVDA 4YB7A 4PAFA 2JJKA 2H99A 2QFLA 3MPKA 1KWHA 2ZMBA 3FBPA 1B2HA 1B6HA 5DVIA 3IFCA 4O3AA 2DQVA 5L8DA 3O2AA 3VVDA 2I6EA 2XD3A 1FQDA 3T9UA 4G8MA 3ZS6A 3SDFA 1FPKA 4JB7A 1FTAA 3QMFA 5J16A 4R6KA 5EHSA 5CC2A 4LZ5A 4TLLB 1MQGA 4EQ7A 2V3UA 1IQ7A 3E13X 1FPJA 2GHBA 4R6HA 3ZSFA 2M8CA 1QUIA 3H3GA 1ZJLA 2VOZA 5IKBA 4JBZA 3MUQA 4G77A 2X7PA 3T66A 4QFPA 4F1VA 2OWZA 5H8SA 1A8EA 2F7CA 5KZTA 4G61A 4N8GA 4NN3A 1LBVA 3S9EA 3U94A 4GXAA 2XXKA 4G4PA 3K1MA 1DTZA 3DP8A 3HV1A 1JW5A 1LFGA 1FTJA 4YICA 1B40A 1NNKA 1NV7A 3OEKA 2P1SA 3KSXA 3S4UA 3N26A 2HZLA 3MZ1A 4OVQA 2Z22A 1K9YA 4ZEIA 3IO6A 2AYSA 2WBBA 2ONKE 3MQ9A 2DS9A 4F3GA 3OO7A 3MP6A 2FYIA 4XTCQ 5I58A 3E4RA 3MZBA 1ZTYA 3K6VA 4FORA 1MPCA 4PDDA 3TFLA 2O51A 3S9MC 1JETA 2QPQA 3MW0A 2PFYA 4NMYA 1LCFA 3CSBA 3LR1A 1EU8A 3UIFA 2ABHA 3TPAA 1TWYA 1MXUA 2DSFA 3RQTA 4PFRA 2QS4A 2XHDA 3PUXE 4G68C 4P11A 4UABA 3RTFB 4HE0A 4G8HA 2R6GE 1JW1A 3GLBA 2FIEA 4NX1A 3GXAA 4AB6A 4PETA 3EHSA 4F1UA 3KGCA 4FIMA 1FSAA 1LCTA 2I3VA 1A54A 4LUBA 3EHTA 4OEUA 3N94A 4BDOA 3VXBA 1IZ1A 5KDTB 4BDQA 5I59B 4C0RA 1R1NA 2VD2A 4M4GA 4IO3A 5F24A 1B9JA 4I9DA 1YTVA 5ESYA 3H06B 2PT2A 3U1OA 2DWAA 1ZU0A 3IJXB 3MYUA 2G29A 3G3KA 5FHMA 2XD2A 1B5JA 5EYFA 1H3DA 1B3EA 4R6YA 4L17A 3G3IA 3UA8A 3ZKKA 4H8JA 4OMBA 4YB6A 4F31B 3VVFA 1H43A 4MNPA 3PTYA 4OERA 2Y5KA 4MIJA 3O97A 1A99A 4TOZA 5K2YA 3R6UA 1J1NA 3KJTA 3TCHA 1MXYA 1LFIA 1WODA 3I3VA 3IR1A 2REGA 4R74A 4H6DA 3QK6A 1A55A 4PGNA 4RA1A 4Q30B 1AIVA 4ZEDA 4NQ8A 4MNCA 1VE4A 1BKAA 2O1MA 1B58A 1P99A 4LVQA 1WDNA 3QAXA 1YAEA 2P3VA 3FATA 4N6KA 5AA4A 4KYEA 3U72A 3FJMA 4LZ7A 4NF8B 1B3HA 1N04A 3D4CA 3TMGA 1Y1MA 1BLFA 1BP5A 1NUWA 1N3WA 2XXQA 2H4IA 3SZPA 1NH7A 3C4MA 3A29A 4KR5A 1NV2A 5I3SA 3RGYA 1OVBA 1N7XA 1RYXA 4X9TA 4ISUA 1LB8A 2OJTA 1GVCA 1PBQA 3CRBA 4F22A 4H8IA 1Y9UA 4ZS9A 1FPFA 4O3CA 1XC1A 1IMEA 2FA7A 2DE4A 3K6UA 3O9PA 1YPNA 5DT6A 1MXWA 5H8FA 5BWJA 3TCGA 3TTMA 3PUVE 3SEYA 1QVSA 4PCDA 1MQHA 4NF4B 4OANA 5AA2D 4F3PA 4JVCA 3TUSA 2YPNA 4R2BA 4MCOA 1UIUA 4ELQA 2HQ0A 5ET6A 1HSJA 2Q9TA 4BDLA 3KZGA 1KA1A 3LUYA 1B3LA 4FEBA 5JEIA 1HSLA 4KHZE 1N7WA 4AS5A 1CB6A 1HSEA 1D4NA 3CFLA 1SW2A 5EYGA 1NKXA 3V89B 1UTHA 1LBZA 1IEJA 1DK4A 1SD3A 5ET8A 2DYXA 4RPOA 3LSLA 5HBCA 3TEPA 4DLDA 4P0IA 3JYRA 4OWDA 1XT8A
chains in the Genus database with same CATH topology
4OXVA 3FVNA 4ONYA 2RF1A 4RJZA 2DWHA 4HTGA 4R9GA 3C31A 2XX8A 5B7DA 4F19A 4YKKA 2ZNUA 1AL3A 1BTJA 2UXAA 3Q29A 3I5OA 2O6AA 4KYDA 3TCFA 4YU0A 1ZIUA 3FGSA 3VLWA 2I48A 4C1TA 1DSNA 3WAEA 1JEVA 1EZPA 2UVJA 1DPPA 1SYIA 3B6TA 1NFTA 3T9XB 4OEVA 2XXHA 4GVOA 4BDRA 1LAHE 3FASA 3O6IA 3BKIB 5KCJA 4DCXA 4OFJA 1NNTA 1B1XA 3N6UA 3FVKA 1L5TA 4R2FA 1OVTA 4PQJA 3UORA 1MRPA 1LFHA 1ZBMA 4WEDA 1VFEA 4MF3A 3FXRA 1TXFA 4U4SA 2DXRA 3A3UA 1JEUA 1GR2A 1OQGA 3MVWA 1D3KA 3TDJA 1A7LA 4QSEA 3RNNA 2Y7RA 4Z0IA 4WKMA 3MWBA 3VDFA 4EXKA 1OMPA 1IXIA 2HEUA 1Z7NE 4Z7EA 2D21A 5I56A 3OXNA 3PPOA 1R9LA 5HM4B 5I58B 4DXBA 2NWJA 4OVJA 1XS5A 4MBPA 5EHMA 5FTHA 4PFYA 3H6VA 3TQLA 3K1NA 3C36A 4JWOA 1JNFA 2I4BA 1B7HA 3DLNA 4NTLA 1S9TA 4YKPA 4MH5A 3P7IA 4WEPA 3MVZA 3U93A 4KI0E 4M1VA 4ELOA 5CM6A 2XXTA 2Q2AA 1TT1A 4RPNA 3TAJA 5CRYA 3SEUA 4HCYA 3O29A 2QRYA 2V84A 3MPLA 2O84X 2XXXA 3TKDA 5L9SA 3TELA 2P0SA 2F34A 5CMMA 1MQIA 2DOJA 4KCDA 4EDPA 3M3LA 2PVUA 2Z8DA 4N6PA 4ZZEA 1B3GA 1Y4CA 3SEXA 5I2KA 2V3QA 3K01A 5ITPA 2DP8A 2V93A 3PMXA 5LOMA 1MY2A 3FIRA 2O69A 4IO4A 3M3KA 2PYYA 2DXYA 1MM7A 1N0TA 4RK9A 4KPTA 5AA2A 2RCAA 2ANJA 1MY0A 2R71A 4U1ZA 3THIA 1H76A 3OMBA 5ICTA 3K1PA 3V8XB 4PFUA 1Y3QA 2AL4A 1D9YA 2DE2A 3CR9A 1B4HA 3PPRA 3HN0A 1SW5A 3FVGA 2XXRA 4LONB 1VFDA 3KFMA 2KLFA 3CG1A 1M5EA 2F6PA 4U4XA 5AA4B 3JV9A 3QYTA 3VVEA 5H8HA 1I6AA 2XXPA 4H67A 3H4ZA 4GQOA 1DMBA 1DPEA 1M5BA 1N76A 2UVHA 3ODBA 3MC2A 3OOAA 1O64A 2P2AA 4IY5A 5H8FB 4PFWA 4NWDA 4GF8A 4DXUA 5JK4A 2ZYOA 2F36A 2XXUA 1Y3NA 4THIA 2CZLA 2OWSA 5DVJA 4EQBA 1ANFA 3A09A 2O7UA 2H25A 5AA3A 2O7IA 3CI8A 1MQJA 4H5FA 3K6WA 4YKIA 1P1WA 1SQYA 4ZE9A 5I84A 1UTHB 3N6TA 3KN3A 4LA9A 4MLQA 3ONMA 4DXCA 3IB0A 4PP0A 4U1OA 4GRKA 1XVYA 1Y1ZA 4OQOA 3IO4A 3CG3A 2UYFA 4EF2A 4NF6A 1FTLA 4FAJA 5DYHA 3MP8A 3DP6A 1IIWA 5DVFA 2ZXTA 1EZ9A 1MY3A 1B4ZA 1PB7A 1R9QA 3RY3A 4EF1A 1FQFA 3EN3A 4I1DA 2RCBA 4ZZAA 4ND9A 4X1BA 2GH9A 3KOTA 4QSDA 3Q26A 4N07A 4YKJA 1TFAA 5TU0A 4BDNA 2F78A 2HFBA 3HO7A 1B32A 3L6HA 5KCJB 3C34A 1WVJA 3OEMA 2QMWA 4P0GA 4DE8A 3Q27A 2YLNA 5TP9A 2I0CA 1JQFA 5K2XA 4POXA 3V5AA 4OTEA 1IXCA 1O7TA 1M5FA 2PT1A 2I49A 2B65A 1URGA 3L6GA 1QULA 3IJOB 1PB9A 3PUWE 5TPAB 4G68A 2DE3A 1Q35A 1MDP1 3QIMA 5I56B 3KG2A 4EQ9A 3HSTA 2H98A 1USYE 5AA1A 2ZYKA 1VR5A 3KN8A 1OLAA 2Y7PA 4Q0CA 5DTBA 1M5DA 3SEVA 2HCAA 4H1XA 1ZKBA 5ELVA 3T9VA 1ZMGA 2OCUA 1SDXA 1SBPA 4FEDA 4IO7A 1IXHA 1SI0A 4JDFA 3UN6A 3CVGA 3MVXA 2R9JA 4AB5A 3K02A 3RN8A 1N3XA 2GRVA 1UQWA 2HXWA 1POY1 3W9VA 4ZDMA 4ZEFA 2ZNTA 3DM0A 4IO2A 2Y7WA 1H45A 5I2KB 4OHNA 3EF7A 3SERA 4POWA 3MJNA 3FXQA 3PD8A 2PBWA 1UIVA 1I6BA 1LBCA 2HZKA 3QUJA 4GOTA 3FV2A 5AA2B 2Z8EA 3IOTA 1LLSA 4UACA 3W9WA 3SEWA 1DOTA 3N5LA 1MG1A 1AMFA 4ECFA 3K6XA 2RC9A 3S2VA 4FATA 3OELA 3KJ7A 2RC7A 1MM6A 1VSOA 4G2ZA 1FQCA 1MDQA 3H6UA 3UK4A 1BIYA 2I4CA 1PC3A 5AE4A 2RC8A 1IXGA 2DWJA 2OZZA 5A5XA 1RYOA 2G93A 4RXLA 3O28A 5CMBA 2UVIA 1MH3A 1AH5A 5CI5A 1B7UA 3U92A 1S7YA 4U2RA 3QXMA 1US5A 3OO8A 3GBAA 5CMKA 4QFLA 4AQ4A 5H8HB 1B5HA 3ZKLA 5JTYA 3MVYA 1PB8A 4XKNA 4O3BA 4XIGQ 1A40A 3PMVA 4ZE8A 3C32A 3FV1A 4OYVA 1ELJA 1DTGA 3KSJA 1QUKA 3RT6B 3OO6A 3G3FA 3VV5A 4ESXA 4QF9A 3PGFA 3TTLA 1Z7ME 1Y4TA 2ONSA 5ICQA 4WXJA 2HAVA 5H8NA 3TODA 3IOVA 2QJEA 2NVUB 4NF4A 2VD3A 1SVXB 1NNFA 2QSXA 3TTNA 1Q1KA 3SETA 3M3FA 1R6ZA 2WKYA 4KYSA 3UP9A 4N13A 3EQ1A 1FW0A 4GWOA 3QUFA 4IB2A 4QRZA 1NL5A 3PPNA 4Q8RA 2UYEA 1FTMA 3LSWA 3O6GA 1MQDA 1MPDA 2DVCA 2RKMA 4NWCA 1US4A 3G3GA 3FUZA 5B70A 4YB5A 4KD5A 4F18A 4BLAA 1SYHA 3BFUA 2XX9A 3KBRA 2ZNSA 4HS7A 3CSGA 1JVYA 2X7QA 1LAGE 4ZECA 2XX7A 2F8DA 5FHOA 3FXUA 3CIJA 3W15C 3IOUA 2GHAA 3U8QA 3DELB 3ILTB 2A5SA 4HW8A 3K00A 1T0KA 5CMCA 1B51A 4YMAA 2QS3A 1MXVA 3SKPA 1PDAA 3O6HA 4GFRA 1Y3PA 3TTKA 5TP9B 3IL1B 4BDMA 4OETA 4TQUQ 4NF5A 1ATGA 4XKRA 4PE5B 5I57A 1IUDA 1EH3A 4NE4A 4X48A 2XXWA 4DCYA 4RY1A 2LAOA 4G68B 4DIGA 4KQPA 4E0XA 4RK2A 4R9FA 2DWIA 1FQEA 4F2QA 3V83A 4R72A 3IOWA 1FTOA 3IAZA 1B46A 3G7WA 4Q5TA 1SW1A 1S50A 1B1HA 4HCWA 4F3SA 1NNPA 4OENA 4ZEKA 1NH8A 4RNSA 4ELPA 1MS7A 1UTBA 2IA4A 4U21A 2OLBA 5FHNA 1GV8A 1I69A 1OLCA 3FJGA 5CBRA 5DEXA 3IORA 4DDDA 3VE1B 1LAXA 3KN7A 2THIA 3WAFA 1MY4A 4QFOA 4XKQA 2Q88A 3PUYE 5I2NA 2E0SA 1GTKA 4OFOA 1B52A 1FQAA 3IK6B 2V3TA 2Y84A 2DVZA 2UVGA 2CMOA 3TQWA 1TFDA 3TYHA 4OFLA 1II5A 1P1QA 4LATA 5H8QA 3QSLA 5IAIA 2A5TA 3HCQA 2GFEA 1M5CA 1SI1A 3RT8A 2REJA 3BFTA 4YZZA 5ISUA 3VLVA 1D9VA 3IB2A 4JSDA 4LQ2A 3D4GA 4NEDA 2VGQA 3VLUA 5HPQA 1FQBA 3KOSA 2Q2CA 1P1NA 3HPIA 1LGBC 2NOOA 3FVOA 2H9BA 3O66A 2ESNA 3EPEA 3RPWA 3RTWB 3VXCA 4GL0A 3GBBA 3S9LC 1URSA 4FECA 3DP4A 1B05A 3K2DA 5A5XB 4QFKA 3JZJA 1SW4A 4PFTA 2B3FA 3LSFB 2F7AA 1B0LA 1RKMA 4MFIA 2I3WA 3GZGA 4QHQA 1FTKA 5JTYB 4JSOA 1B0HA 5M2VA 2D3IA 4IGRA 3EHUA 3TTRA 1LB9A 3M8UA 4LZ8A 3Q28A 1N84A 2F7BA 3MAMA 1MXXA 3MZ9A 5FTIA 2NXOA 2QS2A 4YAHX 1QKAA 2ONRA 4F29A 1MPBA 1A8FA 4R75A 3C9HA 2I0BA 3KEIA 4ELRA 4TLMB 2I58A 2BJJX 5H8NB 4GD5A 1B5IA 3H7MA 1PEBA 1GGGA 2ALUA 4IO6A 3RUMA 5J1DA 3B6WA 2OBGA 4FE8A 3TZAA 4JWXA 4F39A 2V25A 3HHGA 1XOCA 1POTA 3PPPA 1ZLQA 2HAUA 3LBSA 2O1LA 3VFJA 4KFQA 1YCJA 4R73A 2NUVA 3FJ7A 4EUOA 3LC8A 1EZOA 1LAFE 4E0WA 4H65A 3PUZE 2F5XA 3PPQA 2F97A 4GL8A 1OIBA 4DZ1A 1MH4A 2IEEA 4JWYA 3S9NC 3MBPA 3C35A 1H44A 3E9XA 2QL3A 3T9HB 2D5WA 1QUJA 1JW4A 4GLIA 5KDTA 3F11A 5I59A 2XXVA 3PU5A 3G3JA 3BBRA 1QJMA 3PV0E 4X1DA 3T96B 1XVXA 4C1UA 1F9BA 2XXYA 2Z8FA 4H0WA 4I8CA 4FJPA 4ESWA 5L9MA 3T93B 3T22A 3Q25A 4RYAA 2Z23A 5ITOA 3H03A 2AL5A 3OD7A 2OWTA 2VHAA 1USYH 4K3FA 4KCCA 4OESA 1URDA 4EXLA 2Y7IA 2OK2A 4F3BA 4LP2B 3OSQA 1O63A 4G8NA 4NF5B 4XKPA 1NMUA 3CFZA 2XXIA 1OQHA 5I57B 3AXFA 4LQ5A 2X26A 1P1UA 2B3BA 4U22A 3RLFE 4XXUA 1LBBA 3B7DA 1B7ZA 2PX1A 3ECRA 3B6QA 3FZVA 1CE2A 4NF8A 4JXIA 3H6TA 2FNCA 4F1YA 3G3HA 3R7XA 3OENA 2RINA 3PD9A 3UGWA 3ILUB 5TPAA 1QW0A 4ZEBA 3K4UA 2O68A 2E1SA 3OSRA 2F35A 3A3CA 4MLVA 1Y20A 5BUUA 4YMBA 4OZ9A 1AOVA 3C33A 2W7YA 4H5GA 2F6GA 3MP1A 2Q8JA 3USDA 2ZYMA 1UTBB 4GXSB 2VP1A 3R26A 4IGTA 4IY6A 4QSCA 5F1QA 3K0VA 4I62A 4QFNA 4GIZA 5DEXB 1XHYA 3SESA 5L9OA 2YJPA 1LSTA 4IO5A 1P1OA 2QS1A 3LSXA 3IB1A 2Y7KA 5I2NB 3E3KA 2AIXA 1PBPA 1B3FA 1MXZA 4UA8A 3OO9A 3CFXA 3H6WA 4NF6B 5CBSA 2QMXA 2PMSA 1FCKA 3HHFA 3PMWA 3FD3A 5H8QB 2H5YA 3I6VA 2A5TB 5F7VA 1QKBA 2Q89A 1I6QA 1IITA 3IX1A 4F2OA 1JVXA 4U23A 1MY1A 2ZYNA 4YB7A 2H99A 3MPKA 1KWHA 2ZMBA 1B2HA 1B6HA 5DVIA 4O3AA 2DQVA 5L8DA 3O2AA 3VVDA 2I6EA 2XD3A 1FQDA 3T9UA 4G8MA 3ZS6A 3SDFA 4JB7A 4R6KA 5EHSA 5CC2A 4LZ5A 4TLLB 1MQGA 4EQ7A 2V3UA 1IQ7A 3E13X 4R6HA 2GHBA 3ZSFA 2M8CA 1QUIA 3H3GA 1ZJLA 2VOZA 5IKBA 4JBZA 3MUQA 4G77A 2X7PA 3T66A 4QFPA 4F1VA 5H8SA 1A8EA 2F7CA 5KZTA 3S9EA 3U94A 4GXAA 4G4PA 3K1MA 1DTZA 3DP8A 3HV1A 1JW5A 1LFGA 1FTJA 4YICA 1B40A 1NNKA 3OEKA 2P1SA 3KSXA 3S4UA 3N26A 2HZLA 3MZ1A 2Z22A 4ZEIA 3IO6A 2AYSA 2ONKE 3MQ9A 2DS9A 4F3GA 3OO7A 3MP6A 2FYIA 4XTCQ 5I58A 3E4RA 3MZBA 1ZTYA 3K6VA 4FORA 1MPCA 3TFLA 2O51A 3S9MC 1JETA 2QPQA 3MW0A 4NMYA 1LCFA 3CSBA 3LR1A 1EU8A 3UIFA 2ABHA 3TPAA 1TWYA 1MXUA 2DSFA 3RQTA 2QS4A 2XHDA 3PUXE 4G68C 4P11A 3RTFB 4G8HA 2R6GE 1JW1A 3GLBA 3GXAA 4AB6A 4PETA 3EHSA 4F1UA 3KGCA 4FIMA 1LCTA 2I3VA 1A54A 4LUBA 3EHTA 4OEUA 3N94A 4BDOA 3VXBA 1IZ1A 5KDTB 4BDQA 5I59B 4C0RA 1R1NA 2VD2A 4M4GA 4IO3A 1B9JA 4I9DA 1YTVA 3H06B 2PT2A 3U1OA 2DWAA 1ZU0A 3IJXB 2G29A 3G3KA 5FHMA 2XD2A 1B5JA 5EYFA 1H3DA 1B3EA 4R6YA 4L17A 3G3IA 3UA8A 3ZKKA 4H8JA 4OMBA 4YB6A 4F31B 3VVFA 1H43A 4OERA 3O97A 1A99A 4TOZA 5K2YA 3R6UA 1J1NA 3KJTA 3TCHA 1MXYA 1WODA 1LFIA 3I3VA 3IR1A 2REGA 4R74A 4H6DA 3QK6A 1A55A 4RA1A 4Q30B 1AIVA 4ZEDA 1VE4A 1BKAA 2O1MA 1B58A 1P99A 4LVQA 1WDNA 3QAXA 1YAEA 3FATA 5AA4A 4KYEA 3U72A 3FJMA 4LZ7A 4NF8B 1B3HA 1N04A 3D4CA 3TMGA 1Y1MA 1BLFA 1BP5A 1N3WA 2XXQA 2H4IA 1NH7A 3C4MA 4KR5A 3RGYA 1OVBA 1N7XA 1RYXA 4X9TA 4ISUA 1LB8A 2OJTA 1GVCA 1PBQA 3CRBA 4F22A 4H8IA 1Y9UA 4ZS9A 4O3CA 1XC1A 2FA7A 2DE4A 3K6UA 3O9PA 1YPNA 5DT6A 1MXWA 5H8FA 5BWJA 3TTMA 3TCGA 3PUVE 3SEYA 1QVSA 1MQHA 4NF4B 5AA2D 4F3PA 3TUSA 2YPNA 4R2BA 1UIUA 4ELQA 2HQ0A 1HSJA 2Q9TA 4BDLA 3KZGA 3LUYA 1B3LA 4FEBA 5JEIA 1HSLA 4KHZE 1N7WA 1CB6A 1HSEA 1D4NA 3CFLA 1SW2A 1NKXA 3V89B 1UTHA 1IEJA 1SD3A 2DYXA 4RPOA 3LSLA 5HBCA 3TEPA 4DLDA 4P0IA 3JYRA 4OWDA 1XT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OXV A;  3FVN A;  4ONY A;  2RF1 A;  4RJZ A;  2DWH A;  4HTG A;  4R9G A;  3C31 A;  2XX8 A;  5B7D A;  4F19 A;  4YKK A;  2ZNU A;  1AL3 A;  1BTJ A;  2UXA A;  3Q29 A;  3I5O A;  2O6A A;  4KYD A;  3TCF A;  4YU0 A;  1ZIU A;  3FGS A;  3VLW A;  2I48 A;  4C1T A;  1DSN A;  3WAE A;  1JEV A;  1EZP A;  2UVJ A;  1DPP A;  1SYI A;  3B6T A;  1NFT A;  3T9X B;  4OEV A;  2XXH A;  4GVO A;  4BDR A;  1LAH E;  3FAS A;  3O6I A;  3BKI B;  5KCJ A;  4DCX A;  4OFJ A;  1NNT A;  1B1X A;  3N6U A;  3FVK A;  1L5T A;  4R2F A;  1OVT A;  4PQJ A;  3UOR A;  1MRP A;  1LFH A;  1ZBM A;  4WED A;  1VFE A;  4MF3 A;  3FXR A;  1TXF A;  4U4S A;  2DXR A;  3A3U A;  1JEU A;  1GR2 A;  1OQG A;  3MVW A;  1D3K A;  3TDJ A;  1A7L A;  4QSE A;  3RNN A;  2Y7R A;  4Z0I A;  4WKM A;  3MWB A;  3VDF A;  4EXK A;  1OMP A;  1IXI A;  2HEU A;  1Z7N E;  4Z7E A;  2D21 A;  5I56 A;  3OXN A;  3PPO A;  1R9L A;  5HM4 B;  5I58 B;  4DXB A;  2NWJ A;  4OVJ A;  1XS5 A;  4MBP A;  5EHM A;  5FTH A;  4PFY A;  3H6V A;  3TQL A;  3K1N A;  3C36 A;  4JWO A;  1JNF A;  2I4B A;  1B7H A;  3DLN A;  4NTL A;  1S9T A;  4YKP A;  4MH5 A;  3P7I A;  4WEP A;  3MVZ A;  3U93 A;  4KI0 E;  4M1V A;  4ELO A;  5CM6 A;  2XXT A;  2Q2A A;  1TT1 A;  4RPN A;  3TAJ A;  5CRY A;  3SEU A;  4HCY A;  3O29 A;  2QRY A;  2V84 A;  3MPL A;  2O84 X;  2XXX A;  3TKD A;  5L9S A;  3TEL A;  2P0S A;  2F34 A;  5CMM A;  1MQI A;  2DOJ A;  4KCD A;  4EDP A;  3M3L A;  2PVU A;  2Z8D A;  4N6P A;  4ZZE A;  1B3G A;  1Y4C A;  3SEX A;  5I2K A;  2V3Q A;  3K01 A;  5ITP A;  2DP8 A;  2V93 A;  3PMX A;  5LOM A;  1MY2 A;  3FIR A;  2O69 A;  4IO4 A;  3M3K A;  2PYY A;  2DXY A;  1MM7 A;  1N0T A;  4RK9 A;  4KPT A;  5AA2 A;  2RCA A;  2ANJ A;  1MY0 A;  2R71 A;  4U1Z A;  3THI A;  1H76 A;  3OMB A;  5ICT A;  3K1P A;  3V8X B;  4PFU A;  1Y3Q A;  2AL4 A;  1D9Y A;  2DE2 A;  3CR9 A;  1B4H A;  3PPR A;  3HN0 A;  1SW5 A;  3FVG A;  2XXR A;  4LON B;  1VFD A;  3KFM A;  2KLF A;  3CG1 A;  1M5E A;  2F6P A;  4U4X A;  5AA4 B;  3JV9 A;  3QYT A;  3VVE A;  5H8H A;  1I6A A;  2XXP A;  4H67 A;  3H4Z A;  4GQO A;  1DMB A;  1DPE A;  1M5B A;  1N76 A;  2UVH A;  3ODB A;  3MC2 A;  3OOA A;  1O64 A;  2P2A A;  4IY5 A;  5H8F B;  4PFW A;  4NWD A;  4GF8 A;  4DXU A;  5JK4 A;  2ZYO A;  2F36 A;  2XXU A;  1Y3N A;  4THI A;  2CZL A;  2OWS A;  5DVJ A;  4EQB A;  1ANF A;  3A09 A;  2O7U A;  2H25 A;  5AA3 A;  2O7I A;  3CI8 A;  1MQJ A;  4H5F A;  3K6W A;  4YKI A;  1P1W A;  1SQY A;  4ZE9 A;  5I84 A;  1UTH B;  3N6T A;  3KN3 A;  4LA9 A;  4MLQ A;  3ONM A;  4DXC A;  3IB0 A;  4PP0 A;  4U1O A;  4GRK A;  1XVY A;  1Y1Z A;  4OQO A;  3IO4 A;  3CG3 A;  2UYF A;  4EF2 A;  4NF6 A;  1FTL A;  4FAJ A;  5DYH A;  3MP8 A;  3DP6 A;  1IIW A;  5DVF A;  2ZXT A;  1EZ9 A;  1MY3 A;  1B4Z A;  1PB7 A;  1R9Q A;  3RY3 A;  4EF1 A;  1FQF A;  3EN3 A;  4I1D A;  2RCB A;  4ZZA A;  4ND9 A;  4X1B A;  2GH9 A;  3KOT A;  4QSD A;  3Q26 A;  4N07 A;  4YKJ A;  1TFA A;  5TU0 A;  4BDN A;  2F78 A;  2HFB A;  3HO7 A;  1B32 A;  3L6H A;  5KCJ B;  3C34 A;  1WVJ A;  3OEM A;  2QMW A;  4P0G A;  4DE8 A;  3Q27 A;  2YLN A;  5TP9 A;  2I0C A;  1JQF A;  5K2X A;  4POX A;  3V5A A;  4OTE A;  1IXC A;  1O7T A;  1M5F A;  2PT1 A;  2I49 A;  2B65 A;  1URG A;  3L6G A;  1QUL A;  3IJO B;  1PB9 A;  3PUW E;  5TPA B;  4G68 A;  2DE3 A;  1Q35 A;  1MDP 1;  3QIM A;  5I56 B;  3KG2 A;  4EQ9 A;  3HST A;  2H98 A;  1USY E;  5AA1 A;  2ZYK A;  1VR5 A;  3KN8 A;  1OLA A;  2Y7P A;  4Q0C A;  5DTB A;  1M5D A;  3SEV A;  2HCA A;  4H1X A;  1ZKB A;  5ELV A;  3T9V A;  1ZMG A;  2OCU A;  1SDX A;  1SBP A;  4FED A;  4IO7 A;  1IXH A;  1SI0 A;  4JDF A;  3UN6 A;  3CVG A;  3MVX A;  2R9J A;  4AB5 A;  3K02 A;  3RN8 A;  1N3X A;  2GRV A;  1UQW A;  2HXW A;  1POY 1;  3W9V A;  4ZDM A;  4ZEF A;  2ZNT A;  3DM0 A;  4IO2 A;  2Y7W A;  1H45 A;  5I2K B;  4OHN A;  3EF7 A;  3SER A;  4POW A;  3MJN A;  3FXQ A;  3PD8 A;  2PBW A;  1UIV A;  1I6B A;  1LBC A;  2HZK A;  3QUJ A;  4GOT A;  3FV2 A;  5AA2 B;  2Z8E A;  3IOT A;  1LLS A;  4UAC A;  3W9W A;  3SEW A;  1DOT A;  3N5L A;  1MG1 A;  1AMF A;  4ECF A;  3K6X A;  2RC9 A;  3S2V A;  4FAT A;  3OEL A;  3KJ7 A;  2RC7 A;  1MM6 A;  1VSO A;  4G2Z A;  1FQC A;  1MDQ A;  3H6U A;  3UK4 A;  1BIY A;  2I4C A;  1PC3 A;  5AE4 A;  2RC8 A;  1IXG A;  2DWJ A;  2OZZ A;  5A5X A;  1RYO A;  2G93 A;  4RXL A;  3O28 A;  5CMB A;  2UVI A;  1MH3 A;  1AH5 A;  5CI5 A;  1B7U A;  3U92 A;  1S7Y A;  4U2R A;  3QXM A;  1US5 A;  3OO8 A;  3GBA A;  5CMK A;  4QFL A;  4AQ4 A;  5H8H B;  1B5H A;  3ZKL A;  5JTY A;  3MVY A;  1PB8 A;  4XKN A;  4O3B A;  4XIG Q;  1A40 A;  3PMV A;  4ZE8 A;  3C32 A;  3FV1 A;  4OYV A;  1ELJ A;  1DTG A;  3KSJ A;  1QUK A;  3RT6 B;  3OO6 A;  3G3F A;  3VV5 A;  4ESX A;  4QF9 A;  3PGF A;  3TTL A;  1Z7M E;  1Y4T A;  2ONS A;  5ICQ A;  4WXJ A;  2HAV A;  5H8N A;  3TOD A;  3IOV A;  2QJE A;  2NVU B;  4NF4 A;  2VD3 A;  1SVX B;  1NNF A;  2QSX A;  3TTN A;  1Q1K A;  3SET A;  3M3F A;  1R6Z A;  2WKY A;  4KYS A;  3UP9 A;  4N13 A;  3EQ1 A;  1FW0 A;  4GWO A;  3QUF A;  4IB2 A;  4QRZ A;  1NL5 A;  3PPN A;  4Q8R A;  2UYE A;  1FTM A;  3LSW A;  3O6G A;  1MQD A;  1MPD A;  2DVC A;  2RKM A;  4NWC A;  1US4 A;  3G3G A;  3FUZ A;  5B70 A;  4YB5 A;  4KD5 A;  4F18 A;  4BLA A;  1SYH A;  3BFU A;  2XX9 A;  3KBR A;  2ZNS A;  4HS7 A;  3CSG A;  1JVY A;  2X7Q A;  1LAG E;  4ZEC A;  2XX7 A;  2F8D A;  5FHO A;  3FXU A;  3CIJ A;  3W15 C;  3IOU A;  2GHA A;  3U8Q A;  3DEL B;  3ILT B;  2A5S A;  4HW8 A;  3K00 A;  1T0K A;  5CMC A;  1B51 A;  4YMA A;  2QS3 A;  1MXV A;  3SKP A;  1PDA A;  3O6H A;  4GFR A;  1Y3P A;  3TTK A;  5TP9 B;  3IL1 B;  4BDM A;  4OET A;  4TQU Q;  4NF5 A;  1ATG A;  4XKR A;  4PE5 B;  5I57 A;  1IUD A;  1EH3 A;  4NE4 A;  4X48 A;  2XXW A;  4DCY A;  4RY1 A;  2LAO A;  4G68 B;  4DIG A;  4KQP A;  4E0X A;  4RK2 A;  4R9F A;  2DWI A;  1FQE A;  4F2Q A;  3V83 A;  4R72 A;  3IOW A;  1FTO A;  3IAZ A;  1B46 A;  3G7W A;  4Q5T A;  1SW1 A;  1S50 A;  1B1H A;  4HCW A;  4F3S A;  1NNP A;  4OEN A;  4ZEK A;  1NH8 A;  4RNS A;  4ELP A;  1MS7 A;  1UTB A;  2IA4 A;  4U21 A;  2OLB A;  5FHN A;  1GV8 A;  1I69 A;  1OLC A;  3FJG A;  5CBR A;  5DEX A;  3IOR A;  4DDD A;  3VE1 B;  1LAX A;  3KN7 A;  2THI A;  3WAF A;  1MY4 A;  4QFO A;  4XKQ A;  2Q88 A;  3PUY E;  5I2N A;  2E0S A;  1GTK A;  4OFO A;  1B52 A;  1FQA A;  3IK6 B;  2V3T A;  2Y84 A;  2DVZ A;  2UVG A;  2CMO A;  3TQW A;  1TFD A;  3TYH A;  4OFL A;  1II5 A;  1P1Q A;  4LAT A;  5H8Q A;  3QSL A;  5IAI A;  2A5T A;  3HCQ A;  2GFE A;  1M5C A;  1SI1 A;  3RT8 A;  2REJ A;  3BFT A;  4YZZ A;  5ISU A;  3VLV A;  1D9V A;  3IB2 A;  4JSD A;  4LQ2 A;  3D4G A;  4NED A;  2VGQ A;  3VLU A;  5HPQ A;  1FQB A;  3KOS A;  2Q2C A;  1P1N A;  3HPI A;  1LGB C;  2NOO A;  3FVO A;  2H9B A;  3O66 A;  2ESN A;  3EPE A;  3RPW A;  3RTW B;  3VXC A;  4GL0 A;  3GBB A;  3S9L C;  1URS A;  4FEC A;  3DP4 A;  1B05 A;  3K2D A;  5A5X B;  4QFK A;  3JZJ A;  1SW4 A;  4PFT A;  2B3F A;  3LSF B;  2F7A A;  1B0L A;  1RKM A;  4MFI A;  2I3W A;  3GZG A;  4QHQ A;  1FTK A;  5JTY B;  4JSO A;  1B0H A;  5M2V A;  2D3I A;  4IGR A;  3EHU A;  3TTR A;  1LB9 A;  3M8U A;  4LZ8 A;  3Q28 A;  1N84 A;  2F7B A;  3MAM A;  1MXX A;  3MZ9 A;  5FTI A;  2NXO A;  2QS2 A;  4YAH X;  1QKA A;  2ONR A;  4F29 A;  1MPB A;  1A8F A;  4R75 A;  3C9H A;  2I0B A;  3KEI A;  4ELR A;  4TLM B;  2I58 A;  2BJJ X;  5H8N B;  4GD5 A;  1B5I A;  3H7M A;  1PEB A;  1GGG A;  2ALU A;  4IO6 A;  3RUM A;  5J1D A;  3B6W A;  2OBG A;  4FE8 A;  3TZA A;  4JWX A;  4F39 A;  2V25 A;  3HHG A;  1XOC A;  1POT A;  3PPP A;  1ZLQ A;  2HAU A;  3LBS A;  2O1L A;  3VFJ A;  4KFQ A;  1YCJ A;  4R73 A;  2NUV A;  3FJ7 A;  4EUO A;  3LC8 A;  1EZO A;  1LAF E;  4E0W A;  4H65 A;  3PUZ E;  2F5X A;  3PPQ A;  2F97 A;  4GL8 A;  1OIB A;  4DZ1 A;  1MH4 A;  2IEE A;  4JWY A;  3S9N C;  3MBP A;  3C35 A;  1H44 A;  3E9X A;  2QL3 A;  3T9H B;  2D5W A;  1QUJ A;  1JW4 A;  4GLI A;  5KDT A;  3F11 A;  5I59 A;  2XXV A;  3PU5 A;  3G3J A;  3BBR A;  1QJM A;  3PV0 E;  4X1D A;  3T96 B;  1XVX A;  4C1U A;  1F9B A;  2XXY A;  2Z8F A;  4H0W A;  4I8C A;  4FJP A;  4ESW A;  5L9M A;  3T93 B;  3T22 A;  3Q25 A;  4RYA A;  2Z23 A;  5ITO A;  3H03 A;  2AL5 A;  3OD7 A;  2OWT A;  2VHA A;  1USY H;  4K3F A;  4KCC A;  4OES A;  1URD A;  4EXL A;  2Y7I A;  2OK2 A;  4F3B A;  4LP2 B;  3OSQ A;  1O63 A;  4G8N A;  4NF5 B;  4XKP A;  1NMU A;  3CFZ A;  2XXI A;  1OQH A;  5I57 B;  3AXF A;  4LQ5 A;  2X26 A;  1P1U A;  2B3B A;  4U22 A;  3RLF E;  4XXU A;  1LBB A;  3B7D A;  1B7Z A;  2PX1 A;  3ECR A;  3B6Q A;  3FZV A;  1CE2 A;  4NF8 A;  4JXI A;  3H6T A;  2FNC A;  4F1Y A;  3G3H A;  3R7X A;  3OEN A;  2RIN A;  3PD9 A;  3UGW A;  3ILU B;  5TPA A;  1QW0 A;  4ZEB A;  3K4U A;  2O68 A;  2E1S A;  3OSR A;  2F35 A;  3A3C A;  4MLV A;  1Y20 A;  5BUU A;  4YMB A;  4OZ9 A;  1AOV A;  3C33 A;  2W7Y A;  4H5G A;  2F6G A;  3MP1 A;  2Q8J A;  3USD A;  2ZYM A;  1UTB B;  4GXS B;  2VP1 A;  3R26 A;  4IGT A;  4IY6 A;  4QSC A;  5F1Q A;  3K0V A;  4I62 A;  4QFN A;  4GIZ A;  5DEX B;  1XHY A;  3SES A;  5L9O A;  2YJP A;  1LST A;  4IO5 A;  1P1O A;  2QS1 A;  3LSX A;  3IB1 A;  2Y7K A;  5I2N B;  3E3K A;  2AIX A;  1PBP A;  1B3F A;  1MXZ A;  4UA8 A;  3OO9 A;  3CFX A;  3H6W A;  4NF6 B;  5CBS A;  2QMX A;  2PMS A;  1FCK A;  3HHF A;  3PMW A;  3FD3 A;  5H8Q B;  2H5Y A;  3I6V A;  2A5T B;  5F7V A;  1QKB A;  2Q89 A;  1I6Q A;  1IIT A;  3IX1 A;  4F2O A;  1JVX A;  4U23 A;  1MY1 A;  2ZYN A;  4YB7 A;  2H99 A;  3MPK A;  1KWH A;  2ZMB A;  1B2H A;  1B6H A;  5DVI A;  4O3A A;  2DQV A;  5L8D A;  3O2A A;  3VVD A;  2I6E A;  2XD3 A;  1FQD A;  3T9U A;  4G8M A;  3ZS6 A;  3SDF A;  4JB7 A;  4R6K A;  5EHS A;  5CC2 A;  4LZ5 A;  4TLL B;  1MQG A;  4EQ7 A;  2V3U A;  1IQ7 A;  3E13 X;  4R6H A;  2GHB A;  3ZSF A;  2M8C A;  1QUI A;  3H3G A;  1ZJL A;  2VOZ A;  5IKB A;  4JBZ A;  3MUQ A;  4G77 A;  2X7P A;  3T66 A;  4QFP A;  4F1V A;  5H8S A;  1A8E A;  2F7C A;  5KZT A;  3S9E A;  3U94 A;  4GXA A;  4G4P A;  3K1M A;  1DTZ A;  3DP8 A;  3HV1 A;  1JW5 A;  1LFG A;  1FTJ A;  4YIC A;  1B40 A;  1NNK A;  3OEK A;  2P1S A;  3KSX A;  3S4U A;  3N26 A;  2HZL A;  3MZ1 A;  2Z22 A;  4ZEI A;  3IO6 A;  2AYS A;  2ONK E;  3MQ9 A;  2DS9 A;  4F3G A;  3OO7 A;  3MP6 A;  2FYI A;  4XTC Q;  5I58 A;  3E4R A;  3MZB A;  1ZTY A;  3K6V A;  4FOR A;  1MPC A;  3TFL A;  2O51 A;  3S9M C;  1JET A;  2QPQ A;  3MW0 A;  4NMY A;  1LCF A;  3CSB A;  3LR1 A;  1EU8 A;  3UIF A;  2ABH A;  3TPA A;  1TWY A;  1MXU A;  2DSF A;  3RQT A;  2QS4 A;  2XHD A;  3PUX E;  4G68 C;  4P11 A;  3RTF B;  4G8H A;  2R6G E;  1JW1 A;  3GLB A;  3GXA A;  4AB6 A;  4PET A;  3EHS A;  4F1U A;  3KGC A;  4FIM A;  1LCT A;  2I3V A;  1A54 A;  4LUB A;  3EHT A;  4OEU A;  3N94 A;  4BDO A;  3VXB A;  1IZ1 A;  5KDT B;  4BDQ A;  5I59 B;  4C0R A;  1R1N A;  2VD2 A;  4M4G A;  4IO3 A;  1B9J A;  4I9D A;  1YTV A;  3H06 B;  2PT2 A;  3U1O A;  2DWA A;  1ZU0 A;  3IJX B;  2G29 A;  3G3K A;  5FHM A;  2XD2 A;  1B5J A;  5EYF A;  1H3D A;  1B3E A;  4R6Y A;  4L17 A;  3G3I A;  3UA8 A;  3ZKK A;  4H8J A;  4OMB A;  4YB6 A;  4F31 B;  3VVF A;  1H43 A;  4OER A;  3O97 A;  1A99 A;  4TOZ A;  5K2Y A;  3R6U A;  1J1N A;  3KJT A;  3TCH A;  1MXY A;  1WOD A;  1LFI A;  3I3V A;  3IR1 A;  2REG A;  4R74 A;  4H6D A;  3QK6 A;  1A55 A;  4RA1 A;  4Q30 B;  1AIV A;  4ZED A;  1VE4 A;  1BKA A;  2O1M A;  1B58 A;  1P99 A;  4LVQ A;  1WDN A;  3QAX A;  1YAE A;  3FAT A;  5AA4 A;  4KYE A;  3U72 A;  3FJM A;  4LZ7 A;  4NF8 B;  1B3H A;  1N04 A;  3D4C A;  3TMG A;  1Y1M A;  1BLF A;  1BP5 A;  1N3W A;  2XXQ A;  2H4I A;  1NH7 A;  3C4M A;  4KR5 A;  3RGY A;  1OVB A;  1N7X A;  1RYX A;  4X9T A;  4ISU A;  1LB8 A;  2OJT A;  1GVC A;  1PBQ A;  3CRB A;  4F22 A;  4H8I A;  1Y9U A;  4ZS9 A;  4O3C A;  1XC1 A;  2FA7 A;  2DE4 A;  3K6U A;  3O9P A;  1YPN A;  5DT6 A;  1MXW A;  5H8F A;  5BWJ A;  3TTM A;  3TCG A;  3PUV E;  3SEY A;  1QVS A;  1MQH A;  4NF4 B;  5AA2 D;  4F3P A;  3TUS A;  2YPN A;  4R2B A;  1UIU A;  4ELQ A;  2HQ0 A;  1HSJ A;  2Q9T A;  4BDL A;  3KZG A;  3LUY A;  1B3L A;  4FEB A;  5JEI A;  1HSL A;  4KHZ E;  1N7W A;  1CB6 A;  1HSE A;  1D4N A;  3CFL A;  1SW2 A;  1NKX A;  3V89 B;  1UTH A;  1IEJ A;  1SD3 A;  2DYX A;  4RPO A;  3LSL A;  5HBC A;  3TEP A;  4DLD A;  4P0I A;  3JYR A;  4OWD A;  1XT8 A; 
#chains in the Genus database with same CATH topology
 4OXV A;  3FVN A;  4ONY A;  5EQA A;  2RF1 A;  4RJZ A;  2DWH A;  2QVR A;  4HTG A;  4R9G A;  3C31 A;  2XX8 A;  5B7D A;  4F19 A;  4YKK A;  2ZNU A;  1AL3 A;  4H45 A;  3HFU A;  1BTJ A;  4PDH A;  2UXA A;  3Q29 A;  3I5O A;  1D9Q A;  2O6A A;  4KYD A;  3TCF A;  4YU0 A;  1ZIU A;  3FGS A;  3VLW A;  2I48 A;  4C1T A;  1DSN A;  4MEV A;  3B50 A;  4P3L A;  3WAE A;  1JEV A;  2Q74 A;  1EZP A;  2UVJ A;  1DPP A;  1SYI A;  3B6T A;  1NFT A;  3T9X B;  4OEV A;  2XXH A;  3T1B A;  4GVO A;  4BDR A;  1LAH E;  3FAS A;  3O6I A;  3BKI B;  5KCJ A;  4DCX A;  1NI9 A;  4OFJ A;  1NNT A;  1B1X A;  3N6U A;  3FVK A;  1L5T A;  1IMA A;  4R2F A;  1OVT A;  3CHG A;  4PQJ A;  3UOR A;  1MRP A;  1LFH A;  1ZBM A;  1FBE A;  4WED A;  1VFE A;  4MF3 A;  3FXR A;  5IZ3 A;  1TXF A;  4U4S A;  2DXR A;  3A3U A;  1JEU A;  1GR2 A;  1OQG A;  1YZ0 A;  3MVW A;  1D3K A;  3TDJ A;  5I5P A;  1A7L A;  4QSE A;  2V4C A;  3RNN A;  1YYZ A;  2Y7R A;  4Z0I A;  4WKM A;  3MWB A;  3VDF A;  4EXK A;  1OMP A;  1IXI A;  2HEU A;  1Z7N E;  1NUZ A;  2D21 A;  4Z7E A;  5I56 A;  3OXN A;  2FVZ A;  3PPO A;  1R9L A;  5HM4 B;  5I58 B;  4DXB A;  2NWJ A;  4OVJ A;  1XS5 A;  4MBP A;  5EHM A;  4X04 A;  5FTH A;  4PFY A;  3ROJ A;  3H6V A;  3TQL A;  3K1N A;  3C36 A;  4O7I A;  4JWO A;  1JNF A;  2I4B A;  4NF0 A;  4OVS A;  1B7H A;  3DLN A;  4GWZ A;  4NTL A;  1S9T A;  4YKP A;  4MH5 A;  4N4U A;  3P7I A;  4WEP A;  3MVZ A;  3B8B A;  3U93 A;  4KI0 E;  4M1V A;  4ELO A;  5CM6 A;  2XXT A;  2Q2A A;  4I40 A;  1TT1 A;  4RPN A;  3TAJ A;  5CRY A;  3SEU A;  4HCY A;  2FIX A;  3O29 A;  2QRY A;  2V84 A;  3MPL A;  4N91 A;  2O84 X;  2XXX A;  3TKD A;  5L9S A;  3TEL A;  2P0S A;  2F34 A;  2HXR A;  5CMM A;  1MQI A;  2DOJ A;  3LV0 A;  4KCD A;  4EDP A;  2FHY A;  3M3L A;  2PVU A;  2Z8D A;  4N6P A;  4ZZE A;  1B3G A;  1Y4C A;  3SEX A;  5I2K A;  5I7I A;  2V3Q A;  3K01 A;  5ITP A;  1FBF A;  2DP8 A;  2ZZV A;  2V93 A;  3PMX A;  5LOM A;  1MY2 A;  3FIR A;  2O69 A;  4IO4 A;  3M3K A;  2PYY A;  2DXY A;  2VT5 A;  1MM7 A;  1FRP A;  1N0T A;  4RK9 A;  4KPT A;  2Y5L A;  2RCA A;  5AA2 A;  2HHM A;  2ANJ A;  1MY0 A;  2R71 A;  4U1Z A;  3THI A;  1H76 A;  3OMB A;  5ICT A;  2KQZ A;  2B4M A;  3K1P A;  3V8X B;  4PFU A;  1Y3Q A;  2AL4 A;  1D9Y A;  2DE2 A;  1NV1 A;  3CR9 A;  1B4H A;  3PPR A;  3HN0 A;  1SW5 A;  1FPD A;  3FVG A;  2DDK A;  2XXR A;  4LON B;  1VFD A;  3KFM A;  2MKZ A;  2KLF A;  4GWX A;  2QVV A;  4KXP A;  3CG1 A;  1M5E A;  2F6P A;  4U4X A;  4P56 A;  5AA4 B;  3JV9 A;  3QYT A;  3VVE A;  4OVT A;  5H8H A;  1I6A A;  2XXP A;  4H67 A;  3H4Z A;  4GQO A;  1DMB A;  4PFI A;  1DPE A;  1M5B A;  1N76 A;  2UVH A;  3ODB A;  3MC2 A;  3OOA A;  1O64 A;  2P2A A;  4IY5 A;  4P1E A;  5H8F B;  4PFW A;  4NWD A;  4GF8 A;  4GWY A;  4DXU A;  5JK4 A;  2ZYO A;  2F36 A;  1BK4 A;  2XXU A;  1Y3N A;  4THI A;  2CZL A;  2OWS A;  5DVJ A;  4EQB A;  1ANF A;  3A09 A;  2O7U A;  2H25 A;  5AA3 A;  2O7I A;  3CI8 A;  1MQJ A;  1G0H A;  5EQ8 A;  4H5F A;  3K6W A;  4YKI A;  1P1W A;  1SQY A;  4ZE9 A;  5I84 A;  3BIH A;  4MHF A;  1UTH B;  2F3B A;  3N6T A;  2WYK A;  3KN3 A;  1XI6 A;  4LA9 A;  3KBZ A;  4MLQ A;  3ONM A;  4DXC A;  1FJ9 A;  3IB0 A;  4PP0 A;  4U1O A;  3U65 A;  4GRK A;  1XVY A;  1Y1Z A;  2B4L A;  4OQO A;  3IO4 A;  3CG3 A;  2UYF A;  1FPG A;  4EF2 A;  4NF6 A;  1FTL A;  1NV6 A;  2F3D A;  4FAJ A;  2BJI A;  5DYH A;  3MP8 A;  3DP6 A;  1IIW A;  5DVF A;  2ZXT A;  1EZ9 A;  1MY3 A;  3E79 A;  1B4Z A;  1PB7 A;  1FJ6 A;  1R9Q A;  3RY3 A;  4EF1 A;  1FQF A;  3EN3 A;  4I1D A;  2RCB A;  4ZZA A;  4ND9 A;  1FBP A;  4X1B A;  2GH9 A;  3KOT A;  4QSD A;  4N17 A;  3Q26 A;  4N07 A;  4YKJ A;  1TFA A;  1FPE A;  1QGX A;  5TU0 A;  4BDN A;  2F78 A;  2HFB A;  3HO7 A;  1B32 A;  3L6H A;  5KCJ B;  3C34 A;  2VPN A;  1WVJ A;  3OEM A;  2QMW A;  4P0G A;  4DE8 A;  2XWV A;  3Q27 A;  2YLN A;  3MST A;  5TP9 A;  2I0C A;  1JQF A;  4GX3 A;  5K2X A;  4POX A;  3V5A A;  4OTE A;  1IXC A;  1O7T A;  1M5F A;  2PT1 A;  2I49 A;  2B65 A;  1URG A;  3L6G A;  1QUL A;  3IJO B;  2WEF A;  1PB9 A;  3D1R A;  3PUW E;  5TPA B;  5ET5 A;  4G68 A;  2DE3 A;  2PFZ A;  4O94 A;  1Q35 A;  1FBH A;  1MDP 1;  3QIM A;  4IR8 A;  5I56 B;  3KG2 A;  1G0I A;  4EQ9 A;  3HST A;  2H98 A;  1USY E;  5AA1 A;  2ZYK A;  1VR5 A;  3KN8 A;  1OLA A;  2Y7P A;  4Q0C A;  5DTB A;  1M5D A;  3SEV A;  2HCA A;  4H1X A;  1ZKB A;  2CZH A;  4P8B A;  5ELV A;  3FXB A;  1EYI A;  3T9V A;  1ZMG A;  4PC9 A;  2OCU A;  1SDX A;  1LEV A;  1SBP A;  4FED A;  1KA0 A;  4IO7 A;  1IXH A;  1SI0 A;  4P1L A;  4NG7 A;  4AS4 A;  4JDF A;  3UN6 A;  4QBA A;  3CVG A;  3MVX A;  1RDX A;  2R9J A;  4AB5 A;  4DI4 B;  3K02 A;  3RN8 A;  1N3X A;  2GRV A;  1UQW A;  2HXW A;  1POY 1;  3W9V A;  4ZDM A;  4ZEF A;  2ZNT A;  3DM0 A;  4IO2 A;  2Y7W A;  5IM2 A;  1H45 A;  5I2K B;  4H46 A;  4OHN A;  4QXD A;  1NV4 A;  3EF7 A;  3SER A;  4POW A;  3MJN A;  3FXQ A;  3PD8 A;  2PBW A;  1UIV A;  1I6B A;  1LBC A;  1NUY A;  2HZK A;  3QUJ A;  4GOT A;  3FV2 A;  5AA2 B;  1EYJ A;  2Z8E A;  3IOT A;  1LLS A;  4UAC A;  3W9W A;  4GWW A;  3SEW A;  1DOT A;  2XWK A;  3N5L A;  1MG1 A;  1AMF A;  4ECF A;  3K6X A;  2RC9 A;  3S2V A;  4FAT A;  3OEL A;  3KJ7 A;  4GBV A;  2RC7 A;  1MM6 A;  1VSO A;  4G2Z A;  1CNQ A;  1FQC A;  1MDQ A;  3H6U A;  3UK4 A;  1LBW A;  1BIY A;  2I4C A;  1PC3 A;  5AE4 A;  2RC8 A;  1IXG A;  2DWJ A;  2OZZ A;  5A5X A;  1RYO A;  2G93 A;  4RXL A;  3O28 A;  5CMB A;  2UVI A;  1IMD A;  1MH3 A;  1AH5 A;  5CI5 A;  1B7U A;  3U92 A;  1S7Y A;  4U2R A;  2CEY A;  3RPL A;  2FBP A;  1FPL A;  3QXM A;  5IZZ A;  1US5 A;  4PAK A;  3OO8 A;  5T3J A;  3GBA A;  5CMK A;  4QFL A;  4AQ4 A;  5H8H B;  1B5H A;  4OA4 A;  3ZKL A;  5JTY A;  3MVY A;  1PB8 A;  4XKN A;  1IMF A;  1NV0 A;  4O3B A;  4XIG Q;  1A40 A;  3PMV A;  4ZE8 A;  3C32 A;  3FV1 A;  4OYV A;  1DTG A;  1ELJ A;  3KSJ A;  1QUK A;  3RT6 B;  3OO6 A;  3G3F A;  3VV5 A;  4ESX A;  4QF9 A;  3PGF A;  3TTL A;  1Z7M E;  1Y4T A;  2ONS A;  3IFA A;  5ICQ A;  4OVR A;  4WXJ A;  2HAV A;  5H8N A;  3TOD A;  3IOV A;  2QJE A;  2NVU B;  4NF4 A;  2VD3 A;  1SVX B;  1NNF A;  2QSX A;  3TTN A;  1Q1K A;  3SET A;  3M3F A;  1R6Z A;  4MMP A;  2WKY A;  4KYS A;  3UP9 A;  4N13 A;  3EQ1 A;  1Q9D A;  1FW0 A;  5A5L A;  4GWO A;  4PFB A;  3QUF A;  4IB2 A;  4QRZ A;  2R8T A;  1NL5 A;  3PPN A;  4Q8R A;  2UYE A;  1FTM A;  3LSW A;  4N8Y A;  3O6G A;  1MQD A;  1MPD A;  2DVC A;  2RKM A;  1RDZ A;  5ET7 A;  4NWC A;  2L5V A;  1US4 A;  3G3G A;  3FUZ A;  3LUZ A;  5B70 A;  4N15 A;  4YB5 A;  4KD5 A;  4F18 A;  4BLA A;  1SYH A;  3KC0 A;  3BFU A;  2XX9 A;  3KBR A;  2ZNS A;  4HS7 A;  3CSG A;  1JVY A;  1FBD A;  2X7Q A;  1LAG E;  4ZEC A;  2XX7 A;  4NHB A;  2F8D A;  5EQ7 A;  5FHO A;  3FXU A;  3CIJ A;  3W15 C;  3IOU A;  4MNI A;  2GHA A;  3U8Q A;  3DEL B;  3ILT B;  5EYH A;  2A5S A;  4HW8 A;  3K00 A;  1T0K A;  5CMC A;  1B51 A;  4YMA A;  2QS3 A;  4PAI A;  1MXV A;  3SKP A;  1PDA A;  3O6H A;  4GFR A;  1Y3P A;  2GQ1 A;  3TTK A;  5TP9 B;  3IL1 B;  4BDM A;  4OET A;  4TQU Q;  4LN5 A;  4NF5 A;  1ATG A;  4XKR A;  4PE3 A;  4PE5 B;  5I57 A;  1IUD A;  1EH3 A;  4NE4 A;  4X48 A;  4P47 A;  3RYD A;  2XXW A;  2XWI A;  4DCY A;  2KR0 A;  3ISP A;  2LAO A;  4RY1 A;  4G68 B;  4DIG A;  4HXV A;  4KQP A;  4E0X A;  4RK2 A;  4R9F A;  2DWI A;  1FQE A;  4F2Q A;  3GYY A;  3V83 A;  4R72 A;  4XF5 A;  3IOW A;  1FTO A;  5IZ1 A;  1SPI A;  3IAZ A;  1B46 A;  3G7W A;  2XWO A;  4Q5T A;  1SW1 A;  1S50 A;  4GX4 A;  1B1H A;  4HCW A;  1NV3 A;  4F3S A;  4PBQ A;  1NNP A;  4OEN A;  4ZEK A;  1NH8 A;  2XA5 A;  4RNS A;  4ELP A;  1MS7 A;  1UTB A;  2IA4 A;  2WBD A;  2OLB A;  4U21 A;  5FHN A;  1GV8 A;  2QVU A;  1FBG A;  1I69 A;  1OLC A;  3FJG A;  5CBR A;  5DEX A;  3IOR A;  4DDD A;  3VE1 B;  1LAX A;  3KN7 A;  4PF8 A;  2THI A;  4P9K A;  3WAF A;  1MY4 A;  4QFO A;  4XKQ A;  2Q88 A;  2OX3 A;  3PUY E;  5I2N A;  2E0S A;  1GTK A;  1DBZ A;  4OFO A;  2WX9 A;  1B52 A;  1FQA A;  3IK6 B;  2V3T A;  2Y84 A;  2DVZ A;  2UVG A;  2CMO A;  4O7M A;  3TQW A;  1TFD A;  3TYH A;  2ZZW A;  4I3Y A;  4OFL A;  1II5 A;  1P1Q A;  4LAT A;  5H8Q A;  1YXI A;  3QSL A;  5IAI A;  2A5T A;  3HCQ A;  2GFE A;  1M5C A;  1SI1 A;  3RT8 A;  4FBP A;  2REJ A;  3BFT A;  4YZZ A;  5ISU A;  3VLV A;  1D9V A;  3IB2 A;  4JSD A;  4LQ2 A;  3D4G A;  4NED A;  2VGQ A;  3VLU A;  5HPQ A;  1FQB A;  4HE2 A;  3KOS A;  2Q2C A;  1P1N A;  3HPI A;  1EYK A;  1LGB C;  2NOO A;  3FVO A;  2H9B A;  3O66 A;  4MX6 A;  2ESN A;  3EPE A;  3RPW A;  3RTW B;  3VXC A;  4GBW A;  4GL0 A;  1FBC A;  3GBB A;  3S9L C;  4PTK A;  1URS A;  2Q8M A;  4FEC A;  3DP4 A;  1B05 A;  3K2D A;  5A5X B;  4QFK A;  3JZJ A;  1SW4 A;  5LDZ A;  4PFT A;  2B3F A;  3LSF B;  2F7A A;  1B0L A;  1RKM A;  5IZ3 B;  4MFI A;  3RPL B;  2I3W A;  1AWB A;  3GZG A;  4PGP A;  4QHQ A;  1FTK A;  5IGA A;  5JTY B;  4JSO A;  1B0H A;  2WYP A;  5M2V A;  2HPG A;  2D3I A;  4IGR A;  3EHU A;  3TTR A;  4OVP A;  1LB9 A;  3M8U A;  4GX6 A;  4LZ8 A;  3Q28 A;  1N84 A;  3BIG A;  2F7B A;  3MAM A;  1MXX A;  3MZ9 A;  5FTI A;  2NXO A;  2QS2 A;  1VDW A;  4YAH X;  1QKA A;  2ONR A;  4F29 A;  1MPB A;  1A8F A;  4R75 A;  4PBH A;  3C9H A;  4PF6 A;  2I0B A;  3KEI A;  4ELR A;  1IMB A;  4TLM B;  2I58 A;  2BJJ X;  5H8N B;  4GD5 A;  1B5I A;  5FBP A;  5DW8 A;  3H7M A;  1PEB A;  1GGG A;  2ALU A;  4IO6 A;  3RUM A;  5J1D A;  3B6W A;  2OBG A;  4FE8 A;  3TZA A;  4JWX A;  4F39 A;  2V25 A;  3HHG A;  1XOC A;  1POT A;  4JVI A;  3PPP A;  4NAP A;  1ZLQ A;  2HAU A;  3LBS A;  2O1L A;  3VFJ A;  4KFQ A;  1YCJ A;  4HE1 A;  4R73 A;  2NUV A;  3FJ7 A;  4EUO A;  3LC8 A;  1EZO A;  1LAF E;  2CEX A;  4E0W A;  4H65 A;  3PUZ E;  4N81 A;  2F5X A;  3PPQ A;  1INP A;  2F97 A;  4GL8 A;  2CZK A;  1OIB A;  4DZ1 A;  1MH4 A;  2IEE A;  5EQ9 A;  4JWY A;  3S9N C;  3MBP A;  3C35 A;  1H44 A;  3E9X A;  4GWS A;  2QL3 A;  2CZI A;  2PCR A;  3T9H B;  2D5W A;  1QUJ A;  4XFE A;  1JW4 A;  4NGU A;  4GLI A;  2VPO A;  5KDT A;  1LBX A;  3F11 A;  5I59 A;  4X8R A;  4GWU A;  2XXV A;  3PU5 A;  3G3J A;  3BBR A;  1QJM A;  3PV0 E;  4DI3 D;  4X1D A;  2ZZX A;  3T96 B;  1XVX A;  4C1U A;  1FPB A;  1F9B A;  2XXY A;  2Z8F A;  4H0W A;  4I8C A;  4FJP A;  4ESW A;  5L9M A;  3T93 B;  3T22 A;  1NUX A;  3Q25 A;  4RYA A;  2Z23 A;  5ITO A;  3H03 A;  2AL5 A;  3OD7 A;  2OWT A;  2VHA A;  1USY H;  1IMC A;  4K3F A;  4KCC A;  4OES A;  1URD A;  4EXL A;  2Y7I A;  2OK2 A;  4MJO A;  4F3B A;  4LP2 B;  1LBY A;  3OSQ A;  1O63 A;  4G8N A;  4NF5 B;  4XKP A;  1NMU A;  3CFZ A;  2XXI A;  1OQH A;  5I57 B;  3AXF A;  4LQ5 A;  3T0J A;  2X26 A;  1P1U A;  2B3B A;  1FPI A;  4U22 A;  3RLF E;  4XXU A;  1LBB A;  3B7D A;  1B7Z A;  2PX1 A;  3ECR A;  3KC1 A;  3B6Q A;  3FZV A;  1CE2 A;  4NF8 A;  4JXI A;  3H6T A;  2FNC A;  4F1Y A;  3G3H A;  1JP4 A;  3R7X A;  3OEN A;  3E78 A;  2RIN A;  4N6D A;  3PD9 A;  3UGW A;  3ILU B;  5TPA A;  1QW0 A;  4ZEB A;  3K4U A;  2O68 A;  2E1S A;  3OSR A;  2F35 A;  3A3C A;  4MAG A;  4MLV A;  1Y20 A;  5BUU A;  4YMB A;  4OZ9 A;  1AOV A;  3C33 A;  2W7Y A;  4H5G A;  1DCU A;  2F6G A;  3MP1 A;  2Q8J A;  3USD A;  2ZYM A;  1K9Z A;  1UTB B;  4GXS B;  2VP1 A;  3R26 A;  4IGT A;  4IY6 A;  4O8M A;  4QSC A;  5F1Q A;  3K0V A;  4I62 A;  4QFN A;  3NOH A;  4GIZ A;  5DEX B;  1XHY A;  3SES A;  5L9O A;  2P3N A;  2YJP A;  1LST A;  5LTC A;  4IO5 A;  1NV5 A;  1P1O A;  2QS1 A;  3LSX A;  3IB1 A;  2Y7K A;  5I2N B;  3E3K A;  2AIX A;  1PBP A;  1B3F A;  3EKI A;  1MXZ A;  4UA8 A;  4XEQ A;  3OO9 A;  3CFX A;  3H6W A;  4NF6 B;  1KZ8 A;  5CBS A;  2QMX A;  2PMS A;  1FCK A;  3HHF A;  3PMW A;  3FD3 A;  5H8Q B;  2H5Y A;  3I6V A;  2A5T B;  5F7V A;  4I3E A;  1QKB A;  2Q89 A;  1I6Q A;  1IIT A;  3IX1 A;  4F2O A;  1JVX A;  4U23 A;  1MY1 A;  2ZYN A;  1RDY A;  4JVD A;  4YB7 A;  4PAF A;  2JJK A;  2H99 A;  2QFL A;  3MPK A;  1KWH A;  2ZMB A;  3FBP A;  1B2H A;  1B6H A;  5DVI A;  3IFC A;  4O3A A;  2DQV A;  5L8D A;  3O2A A;  3VVD A;  2I6E A;  2XD3 A;  1FQD A;  3T9U A;  4G8M A;  3ZS6 A;  3SDF A;  1FPK A;  4JB7 A;  1FTA A;  3QMF A;  5J16 A;  4R6K A;  5EHS A;  5CC2 A;  4LZ5 A;  4TLL B;  1MQG A;  4EQ7 A;  2V3U A;  1IQ7 A;  3E13 X;  1FPJ A;  2GHB A;  4R6H A;  3ZSF A;  2M8C A;  1QUI A;  3H3G A;  1ZJL A;  2VOZ A;  5IKB A;  4JBZ A;  3MUQ A;  4G77 A;  2X7P A;  3T66 A;  4QFP A;  4F1V A;  2OWZ A;  5H8S A;  1A8E A;  2F7C A;  5KZT A;  4G61 A;  4N8G A;  4NN3 A;  1LBV A;  3S9E A;  3U94 A;  4GXA A;  2XXK A;  4G4P A;  3K1M A;  1DTZ A;  3DP8 A;  3HV1 A;  1JW5 A;  1LFG A;  1FTJ A;  4YIC A;  1B40 A;  1NNK A;  1NV7 A;  3OEK A;  2P1S A;  3KSX A;  3S4U A;  3N26 A;  2HZL A;  3MZ1 A;  4OVQ A;  2Z22 A;  1K9Y A;  4ZEI A;  3IO6 A;  2AYS A;  2WBB A;  2ONK E;  3MQ9 A;  2DS9 A;  4F3G A;  3OO7 A;  3MP6 A;  2FYI A;  4XTC Q;  5I58 A;  3E4R A;  3MZB A;  1ZTY A;  3K6V A;  4FOR A;  1MPC A;  4PDD A;  3TFL A;  2O51 A;  3S9M C;  1JET A;  2QPQ A;  3MW0 A;  2PFY A;  4NMY A;  1LCF A;  3CSB A;  3LR1 A;  1EU8 A;  3UIF A;  2ABH A;  3TPA A;  1TWY A;  1MXU A;  2DSF A;  3RQT A;  4PFR A;  2QS4 A;  2XHD A;  3PUX E;  4G68 C;  4P11 A;  4UAB A;  3RTF B;  4HE0 A;  4G8H A;  2R6G E;  1JW1 A;  3GLB A;  2FIE A;  4NX1 A;  3GXA A;  4AB6 A;  4PET A;  3EHS A;  4F1U A;  3KGC A;  4FIM A;  1FSA A;  1LCT A;  2I3V A;  1A54 A;  4LUB A;  3EHT A;  4OEU A;  3N94 A;  4BDO A;  3VXB A;  1IZ1 A;  5KDT B;  4BDQ A;  5I59 B;  4C0R A;  1R1N A;  2VD2 A;  4M4G A;  4IO3 A;  5F24 A;  1B9J A;  4I9D A;  1YTV A;  5ESY A;  3H06 B;  2PT2 A;  3U1O A;  2DWA A;  1ZU0 A;  3IJX B;  3MYU A;  2G29 A;  3G3K A;  5FHM A;  2XD2 A;  1B5J A;  5EYF A;  1H3D A;  1B3E A;  4R6Y A;  4L17 A;  3G3I A;  3UA8 A;  3ZKK A;  4H8J A;  4OMB A;  4YB6 A;  4F31 B;  3VVF A;  1H43 A;  4MNP A;  3PTY A;  4OER A;  2Y5K A;  4MIJ A;  3O97 A;  1A99 A;  4TOZ A;  5K2Y A;  3R6U A;  1J1N A;  3KJT A;  3TCH A;  1MXY A;  1LFI A;  1WOD A;  3I3V A;  3IR1 A;  2REG A;  4R74 A;  4H6D A;  3QK6 A;  1A55 A;  4PGN A;  4RA1 A;  4Q30 B;  1AIV A;  4ZED A;  4NQ8 A;  4MNC A;  1VE4 A;  1BKA A;  2O1M A;  1B58 A;  1P99 A;  4LVQ A;  1WDN A;  3QAX A;  1YAE A;  2P3V A;  3FAT A;  4N6K A;  5AA4 A;  4KYE A;  3U72 A;  3FJM A;  4LZ7 A;  4NF8 B;  1B3H A;  1N04 A;  3D4C A;  3TMG A;  1Y1M A;  1BLF A;  1BP5 A;  1NUW A;  1N3W A;  2XXQ A;  2H4I A;  3SZP A;  1NH7 A;  3C4M A;  3A29 A;  4KR5 A;  1NV2 A;  5I3S A;  3RGY A;  1OVB A;  1N7X A;  1RYX A;  4X9T A;  4ISU A;  1LB8 A;  2OJT A;  1GVC A;  1PBQ A;  3CRB A;  4F22 A;  4H8I A;  1Y9U A;  4ZS9 A;  1FPF A;  4O3C A;  1XC1 A;  1IME A;  2FA7 A;  2DE4 A;  3K6U A;  3O9P A;  1YPN A;  5DT6 A;  1MXW A;  5H8F A;  5BWJ A;  3TCG A;  3TTM A;  3PUV E;  3SEY A;  1QVS A;  4PCD A;  1MQH A;  4NF4 B;  4OAN A;  5AA2 D;  4F3P A;  4JVC A;  3TUS A;  2YPN A;  4R2B A;  4MCO A;  1UIU A;  4ELQ A;  2HQ0 A;  5ET6 A;  1HSJ A;  2Q9T A;  4BDL A;  3KZG A;  1KA1 A;  3LUY A;  1B3L A;  4FEB A;  5JEI A;  1HSL A;  4KHZ E;  1N7W A;  4AS5 A;  1CB6 A;  1HSE A;  1D4N A;  3CFL A;  1SW2 A;  5EYG A;  1NKX A;  3V89 B;  1UTH A;  1LBZ A;  1IEJ A;  1DK4 A;  1SD3 A;  5ET8 A;  2DYX A;  4RPO A;  3LSL A;  5HBC A;  3TEP A;  4DLD A;  4P0I A;  3JYR A;  4OWD A;  1XT8 A; 
#chains in the Genus database with same CATH homology
 4OXV A;  3FVN A;  4ONY A;  2RF1 A;  4RJZ A;  2DWH A;  4HTG A;  4R9G A;  3C31 A;  2XX8 A;  5B7D A;  4F19 A;  4YKK A;  2ZNU A;  1AL3 A;  1BTJ A;  2UXA A;  3Q29 A;  3I5O A;  2O6A A;  4KYD A;  3TCF A;  4YU0 A;  1ZIU A;  3FGS A;  3VLW A;  2I48 A;  4C1T A;  1DSN A;  3WAE A;  1JEV A;  1EZP A;  2UVJ A;  1DPP A;  1SYI A;  3B6T A;  1NFT A;  3T9X B;  4OEV A;  2XXH A;  4GVO A;  4BDR A;  1LAH E;  3FAS A;  3O6I A;  3BKI B;  5KCJ A;  4DCX A;  4OFJ A;  1NNT A;  1B1X A;  3N6U A;  3FVK A;  1L5T A;  4R2F A;  1OVT A;  4PQJ A;  3UOR A;  1MRP A;  1LFH A;  1ZBM A;  4WED A;  1VFE A;  4MF3 A;  3FXR A;  1TXF A;  4U4S A;  2DXR A;  3A3U A;  1JEU A;  1GR2 A;  1OQG A;  3MVW A;  1D3K A;  3TDJ A;  1A7L A;  4QSE A;  3RNN A;  2Y7R A;  4Z0I A;  4WKM A;  3MWB A;  3VDF A;  4EXK A;  1OMP A;  1IXI A;  2HEU A;  1Z7N E;  4Z7E A;  2D21 A;  5I56 A;  3OXN A;  3PPO A;  1R9L A;  5HM4 B;  5I58 B;  4DXB A;  2NWJ A;  4OVJ A;  1XS5 A;  4MBP A;  5EHM A;  5FTH A;  4PFY A;  3H6V A;  3TQL A;  3K1N A;  3C36 A;  4JWO A;  1JNF A;  2I4B A;  1B7H A;  3DLN A;  4NTL A;  1S9T A;  4YKP A;  4MH5 A;  3P7I A;  4WEP A;  3MVZ A;  3U93 A;  4KI0 E;  4M1V A;  4ELO A;  5CM6 A;  2XXT A;  2Q2A A;  1TT1 A;  4RPN A;  3TAJ A;  5CRY A;  3SEU A;  4HCY A;  3O29 A;  2QRY A;  2V84 A;  3MPL A;  2O84 X;  2XXX A;  3TKD A;  5L9S A;  3TEL A;  2P0S A;  2F34 A;  5CMM A;  1MQI A;  2DOJ A;  4KCD A;  4EDP A;  3M3L A;  2PVU A;  2Z8D A;  4N6P A;  4ZZE A;  1B3G A;  1Y4C A;  3SEX A;  5I2K A;  2V3Q A;  3K01 A;  5ITP A;  2DP8 A;  2V93 A;  3PMX A;  5LOM A;  1MY2 A;  3FIR A;  2O69 A;  4IO4 A;  3M3K A;  2PYY A;  2DXY A;  1MM7 A;  1N0T A;  4RK9 A;  4KPT A;  5AA2 A;  2RCA A;  2ANJ A;  1MY0 A;  2R71 A;  4U1Z A;  3THI A;  1H76 A;  3OMB A;  5ICT A;  3K1P A;  3V8X B;  4PFU A;  1Y3Q A;  2AL4 A;  1D9Y A;  2DE2 A;  3CR9 A;  1B4H A;  3PPR A;  3HN0 A;  1SW5 A;  3FVG A;  2XXR A;  4LON B;  1VFD A;  3KFM A;  2KLF A;  3CG1 A;  1M5E A;  2F6P A;  4U4X A;  5AA4 B;  3JV9 A;  3QYT A;  3VVE A;  5H8H A;  1I6A A;  2XXP A;  4H67 A;  3H4Z A;  4GQO A;  1DMB A;  1DPE A;  1M5B A;  1N76 A;  2UVH A;  3ODB A;  3MC2 A;  3OOA A;  1O64 A;  2P2A A;  4IY5 A;  5H8F B;  4PFW A;  4NWD A;  4GF8 A;  4DXU A;  5JK4 A;  2ZYO A;  2F36 A;  2XXU A;  1Y3N A;  4THI A;  2CZL A;  2OWS A;  5DVJ A;  4EQB A;  1ANF A;  3A09 A;  2O7U A;  2H25 A;  5AA3 A;  2O7I A;  3CI8 A;  1MQJ A;  4H5F A;  3K6W A;  4YKI A;  1P1W A;  1SQY A;  4ZE9 A;  5I84 A;  1UTH B;  3N6T A;  3KN3 A;  4LA9 A;  4MLQ A;  3ONM A;  4DXC A;  3IB0 A;  4PP0 A;  4U1O A;  4GRK A;  1XVY A;  1Y1Z A;  4OQO A;  3IO4 A;  3CG3 A;  2UYF A;  4EF2 A;  4NF6 A;  1FTL A;  4FAJ A;  5DYH A;  3MP8 A;  3DP6 A;  1IIW A;  5DVF A;  2ZXT A;  1EZ9 A;  1MY3 A;  1B4Z A;  1PB7 A;  1R9Q A;  3RY3 A;  4EF1 A;  1FQF A;  3EN3 A;  4I1D A;  2RCB A;  4ZZA A;  4ND9 A;  4X1B A;  2GH9 A;  3KOT A;  4QSD A;  3Q26 A;  4N07 A;  4YKJ A;  1TFA A;  5TU0 A;  4BDN A;  2F78 A;  2HFB A;  3HO7 A;  1B32 A;  3L6H A;  5KCJ B;  3C34 A;  1WVJ A;  3OEM A;  2QMW A;  4P0G A;  4DE8 A;  3Q27 A;  2YLN A;  5TP9 A;  2I0C A;  1JQF A;  5K2X A;  4POX A;  3V5A A;  4OTE A;  1IXC A;  1O7T A;  1M5F A;  2PT1 A;  2I49 A;  2B65 A;  1URG A;  3L6G A;  1QUL A;  3IJO B;  1PB9 A;  3PUW E;  5TPA B;  4G68 A;  2DE3 A;  1Q35 A;  1MDP 1;  3QIM A;  5I56 B;  3KG2 A;  4EQ9 A;  3HST A;  2H98 A;  1USY E;  5AA1 A;  2ZYK A;  1VR5 A;  3KN8 A;  1OLA A;  2Y7P A;  4Q0C A;  5DTB A;  1M5D A;  3SEV A;  2HCA A;  4H1X A;  1ZKB A;  5ELV A;  3T9V A;  1ZMG A;  2OCU A;  1SDX A;  1SBP A;  4FED A;  4IO7 A;  1IXH A;  1SI0 A;  4JDF A;  3UN6 A;  3CVG A;  3MVX A;  2R9J A;  4AB5 A;  3K02 A;  3RN8 A;  1N3X A;  2GRV A;  1UQW A;  2HXW A;  1POY 1;  3W9V A;  4ZDM A;  4ZEF A;  2ZNT A;  3DM0 A;  4IO2 A;  2Y7W A;  1H45 A;  5I2K B;  4OHN A;  3EF7 A;  3SER A;  4POW A;  3MJN A;  3FXQ A;  3PD8 A;  2PBW A;  1UIV A;  1I6B A;  1LBC A;  2HZK A;  3QUJ A;  4GOT A;  3FV2 A;  5AA2 B;  2Z8E A;  3IOT A;  1LLS A;  4UAC A;  3W9W A;  3SEW A;  1DOT A;  3N5L A;  1MG1 A;  1AMF A;  4ECF A;  3K6X A;  2RC9 A;  3S2V A;  4FAT A;  3OEL A;  3KJ7 A;  2RC7 A;  1MM6 A;  1VSO A;  4G2Z A;  1FQC A;  1MDQ A;  3H6U A;  3UK4 A;  1BIY A;  2I4C A;  1PC3 A;  5AE4 A;  2RC8 A;  1IXG A;  2DWJ A;  2OZZ A;  5A5X A;  1RYO A;  2G93 A;  4RXL A;  3O28 A;  5CMB A;  2UVI A;  1MH3 A;  1AH5 A;  5CI5 A;  1B7U A;  3U92 A;  1S7Y A;  4U2R A;  3QXM A;  1US5 A;  3OO8 A;  3GBA A;  5CMK A;  4QFL A;  4AQ4 A;  5H8H B;  1B5H A;  3ZKL A;  5JTY A;  3MVY A;  1PB8 A;  4XKN A;  4O3B A;  4XIG Q;  1A40 A;  3PMV A;  4ZE8 A;  3C32 A;  3FV1 A;  4OYV A;  1ELJ A;  1DTG A;  3KSJ A;  1QUK A;  3RT6 B;  3OO6 A;  3G3F A;  3VV5 A;  4ESX A;  4QF9 A;  3PGF A;  3TTL A;  1Z7M E;  1Y4T A;  2ONS A;  5ICQ A;  4WXJ A;  2HAV A;  5H8N A;  3TOD A;  3IOV A;  2QJE A;  2NVU B;  4NF4 A;  2VD3 A;  1SVX B;  1NNF A;  2QSX A;  3TTN A;  1Q1K A;  3SET A;  3M3F A;  1R6Z A;  2WKY A;  4KYS A;  3UP9 A;  4N13 A;  3EQ1 A;  1FW0 A;  4GWO A;  3QUF A;  4IB2 A;  4QRZ A;  1NL5 A;  3PPN A;  4Q8R A;  2UYE A;  1FTM A;  3LSW A;  3O6G A;  1MQD A;  1MPD A;  2DVC A;  2RKM A;  4NWC A;  1US4 A;  3G3G A;  3FUZ A;  5B70 A;  4YB5 A;  4KD5 A;  4F18 A;  4BLA A;  1SYH A;  3BFU A;  2XX9 A;  3KBR A;  2ZNS A;  4HS7 A;  3CSG A;  1JVY A;  2X7Q A;  1LAG E;  4ZEC A;  2XX7 A;  2F8D A;  5FHO A;  3FXU A;  3CIJ A;  3W15 C;  3IOU A;  2GHA A;  3U8Q A;  3DEL B;  3ILT B;  2A5S A;  4HW8 A;  3K00 A;  1T0K A;  5CMC A;  1B51 A;  4YMA A;  2QS3 A;  1MXV A;  3SKP A;  1PDA A;  3O6H A;  4GFR A;  1Y3P A;  3TTK A;  5TP9 B;  3IL1 B;  4BDM A;  4OET A;  4TQU Q;  4NF5 A;  1ATG A;  4XKR A;  4PE5 B;  5I57 A;  1IUD A;  1EH3 A;  4NE4 A;  4X48 A;  2XXW A;  4DCY A;  4RY1 A;  2LAO A;  4G68 B;  4DIG A;  4KQP A;  4E0X A;  4RK2 A;  4R9F A;  2DWI A;  1FQE A;  4F2Q A;  3V83 A;  4R72 A;  3IOW A;  1FTO A;  3IAZ A;  1B46 A;  3G7W A;  4Q5T A;  1SW1 A;  1S50 A;  1B1H A;  4HCW A;  4F3S A;  1NNP A;  4OEN A;  4ZEK A;  1NH8 A;  4RNS A;  4ELP A;  1MS7 A;  1UTB A;  2IA4 A;  4U21 A;  2OLB A;  5FHN A;  1GV8 A;  1I69 A;  1OLC A;  3FJG A;  5CBR A;  5DEX A;  3IOR A;  4DDD A;  3VE1 B;  1LAX A;  3KN7 A;  2THI A;  3WAF A;  1MY4 A;  4QFO A;  4XKQ A;  2Q88 A;  3PUY E;  5I2N A;  2E0S A;  1GTK A;  4OFO A;  1B52 A;  1FQA A;  3IK6 B;  2V3T A;  2Y84 A;  2DVZ A;  2UVG A;  2CMO A;  3TQW A;  1TFD A;  3TYH A;  4OFL A;  1II5 A;  1P1Q A;  4LAT A;  5H8Q A;  3QSL A;  5IAI A;  2A5T A;  3HCQ A;  2GFE A;  1M5C A;  1SI1 A;  3RT8 A;  2REJ A;  3BFT A;  4YZZ A;  5ISU A;  3VLV A;  1D9V A;  3IB2 A;  4JSD A;  4LQ2 A;  3D4G A;  4NED A;  2VGQ A;  3VLU A;  5HPQ A;  1FQB A;  3KOS A;  2Q2C A;  1P1N A;  3HPI A;  1LGB C;  2NOO A;  3FVO A;  2H9B A;  3O66 A;  2ESN A;  3EPE A;  3RPW A;  3RTW B;  3VXC A;  4GL0 A;  3GBB A;  3S9L C;  1URS A;  4FEC A;  3DP4 A;  1B05 A;  3K2D A;  5A5X B;  4QFK A;  3JZJ A;  1SW4 A;  4PFT A;  2B3F A;  3LSF B;  2F7A A;  1B0L A;  1RKM A;  4MFI A;  2I3W A;  3GZG A;  4QHQ A;  1FTK A;  5JTY B;  4JSO A;  1B0H A;  5M2V A;  2D3I A;  4IGR A;  3EHU A;  3TTR A;  1LB9 A;  3M8U A;  4LZ8 A;  3Q28 A;  1N84 A;  2F7B A;  3MAM A;  1MXX A;  3MZ9 A;  5FTI A;  2NXO A;  2QS2 A;  4YAH X;  1QKA A;  2ONR A;  4F29 A;  1MPB A;  1A8F A;  4R75 A;  3C9H A;  2I0B A;  3KEI A;  4ELR A;  4TLM B;  2I58 A;  2BJJ X;  5H8N B;  4GD5 A;  1B5I A;  3H7M A;  1PEB A;  1GGG A;  2ALU A;  4IO6 A;  3RUM A;  5J1D A;  3B6W A;  2OBG A;  4FE8 A;  3TZA A;  4JWX A;  4F39 A;  2V25 A;  3HHG A;  1XOC A;  1POT A;  3PPP A;  1ZLQ A;  2HAU A;  3LBS A;  2O1L A;  3VFJ A;  4KFQ A;  1YCJ A;  4R73 A;  2NUV A;  3FJ7 A;  4EUO A;  3LC8 A;  1EZO A;  1LAF E;  4E0W A;  4H65 A;  3PUZ E;  2F5X A;  3PPQ A;  2F97 A;  4GL8 A;  1OIB A;  4DZ1 A;  1MH4 A;  2IEE A;  4JWY A;  3S9N C;  3MBP A;  3C35 A;  1H44 A;  3E9X A;  2QL3 A;  3T9H B;  2D5W A;  1QUJ A;  1JW4 A;  4GLI A;  5KDT A;  3F11 A;  5I59 A;  2XXV A;  3PU5 A;  3G3J A;  3BBR A;  1QJM A;  3PV0 E;  4X1D A;  3T96 B;  1XVX A;  4C1U A;  1F9B A;  2XXY A;  2Z8F A;  4H0W A;  4I8C A;  4FJP A;  4ESW A;  5L9M A;  3T93 B;  3T22 A;  3Q25 A;  4RYA A;  2Z23 A;  5ITO A;  3H03 A;  2AL5 A;  3OD7 A;  2OWT A;  2VHA A;  1USY H;  4K3F A;  4KCC A;  4OES A;  1URD A;  4EXL A;  2Y7I A;  2OK2 A;  4F3B A;  4LP2 B;  3OSQ A;  1O63 A;  4G8N A;  4NF5 B;  4XKP A;  1NMU A;  3CFZ A;  2XXI A;  1OQH A;  5I57 B;  3AXF A;  4LQ5 A;  2X26 A;  1P1U A;  2B3B A;  4U22 A;  3RLF E;  4XXU A;  1LBB A;  3B7D A;  1B7Z A;  2PX1 A;  3ECR A;  3B6Q A;  3FZV A;  1CE2 A;  4NF8 A;  4JXI A;  3H6T A;  2FNC A;  4F1Y A;  3G3H A;  3R7X A;  3OEN A;  2RIN A;  3PD9 A;  3UGW A;  3ILU B;  5TPA A;  1QW0 A;  4ZEB A;  3K4U A;  2O68 A;  2E1S A;  3OSR A;  2F35 A;  3A3C A;  4MLV A;  1Y20 A;  5BUU A;  4YMB A;  4OZ9 A;  1AOV A;  3C33 A;  2W7Y A;  4H5G A;  2F6G A;  3MP1 A;  2Q8J A;  3USD A;  2ZYM A;  1UTB B;  4GXS B;  2VP1 A;  3R26 A;  4IGT A;  4IY6 A;  4QSC A;  5F1Q A;  3K0V A;  4I62 A;  4QFN A;  4GIZ A;  5DEX B;  1XHY A;  3SES A;  5L9O A;  2YJP A;  1LST A;  4IO5 A;  1P1O A;  2QS1 A;  3LSX A;  3IB1 A;  2Y7K A;  5I2N B;  3E3K A;  2AIX A;  1PBP A;  1B3F A;  1MXZ A;  4UA8 A;  3OO9 A;  3CFX A;  3H6W A;  4NF6 B;  5CBS A;  2QMX A;  2PMS A;  1FCK A;  3HHF A;  3PMW A;  3FD3 A;  5H8Q B;  2H5Y A;  3I6V A;  2A5T B;  5F7V A;  1QKB A;  2Q89 A;  1I6Q A;  1IIT A;  3IX1 A;  4F2O A;  1JVX A;  4U23 A;  1MY1 A;  2ZYN A;  4YB7 A;  2H99 A;  3MPK A;  1KWH A;  2ZMB A;  1B2H A;  1B6H A;  5DVI A;  4O3A A;  2DQV A;  5L8D A;  3O2A A;  3VVD A;  2I6E A;  2XD3 A;  1FQD A;  3T9U A;  4G8M A;  3ZS6 A;  3SDF A;  4JB7 A;  4R6K A;  5EHS A;  5CC2 A;  4LZ5 A;  4TLL B;  1MQG A;  4EQ7 A;  2V3U A;  1IQ7 A;  3E13 X;  4R6H A;  2GHB A;  3ZSF A;  2M8C A;  1QUI A;  3H3G A;  1ZJL A;  2VOZ A;  5IKB A;  4JBZ A;  3MUQ A;  4G77 A;  2X7P A;  3T66 A;  4QFP A;  4F1V A;  5H8S A;  1A8E A;  2F7C A;  5KZT A;  3S9E A;  3U94 A;  4GXA A;  4G4P A;  3K1M A;  1DTZ A;  3DP8 A;  3HV1 A;  1JW5 A;  1LFG A;  1FTJ A;  4YIC A;  1B40 A;  1NNK A;  3OEK A;  2P1S A;  3KSX A;  3S4U A;  3N26 A;  2HZL A;  3MZ1 A;  2Z22 A;  4ZEI A;  3IO6 A;  2AYS A;  2ONK E;  3MQ9 A;  2DS9 A;  4F3G A;  3OO7 A;  3MP6 A;  2FYI A;  4XTC Q;  5I58 A;  3E4R A;  3MZB A;  1ZTY A;  3K6V A;  4FOR A;  1MPC A;  3TFL A;  2O51 A;  3S9M C;  1JET A;  2QPQ A;  3MW0 A;  4NMY A;  1LCF A;  3CSB A;  3LR1 A;  1EU8 A;  3UIF A;  2ABH A;  3TPA A;  1TWY A;  1MXU A;  2DSF A;  3RQT A;  2QS4 A;  2XHD A;  3PUX E;  4G68 C;  4P11 A;  3RTF B;  4G8H A;  2R6G E;  1JW1 A;  3GLB A;  3GXA A;  4AB6 A;  4PET A;  3EHS A;  4F1U A;  3KGC A;  4FIM A;  1LCT A;  2I3V A;  1A54 A;  4LUB A;  3EHT A;  4OEU A;  3N94 A;  4BDO A;  3VXB A;  1IZ1 A;  5KDT B;  4BDQ A;  5I59 B;  4C0R A;  1R1N A;  2VD2 A;  4M4G A;  4IO3 A;  1B9J A;  4I9D A;  1YTV A;  3H06 B;  2PT2 A;  3U1O A;  2DWA A;  1ZU0 A;  3IJX B;  2G29 A;  3G3K A;  5FHM A;  2XD2 A;  1B5J A;  5EYF A;  1H3D A;  1B3E A;  4R6Y A;  4L17 A;  3G3I A;  3UA8 A;  3ZKK A;  4H8J A;  4OMB A;  4YB6 A;  4F31 B;  3VVF A;  1H43 A;  4OER A;  3O97 A;  1A99 A;  4TOZ A;  5K2Y A;  3R6U A;  1J1N A;  3KJT A;  3TCH A;  1MXY A;  1WOD A;  1LFI A;  3I3V A;  3IR1 A;  2REG A;  4R74 A;  4H6D A;  3QK6 A;  1A55 A;  4RA1 A;  4Q30 B;  1AIV A;  4ZED A;  1VE4 A;  1BKA A;  2O1M A;  1B58 A;  1P99 A;  4LVQ A;  1WDN A;  3QAX A;  1YAE A;  3FAT A;  5AA4 A;  4KYE A;  3U72 A;  3FJM A;  4LZ7 A;  4NF8 B;  1B3H A;  1N04 A;  3D4C A;  3TMG A;  1Y1M A;  1BLF A;  1BP5 A;  1N3W A;  2XXQ A;  2H4I A;  1NH7 A;  3C4M A;  4KR5 A;  3RGY A;  1OVB A;  1N7X A;  1RYX A;  4X9T A;  4ISU A;  1LB8 A;  2OJT A;  1GVC A;  1PBQ A;  3CRB A;  4F22 A;  4H8I A;  1Y9U A;  4ZS9 A;  4O3C A;  1XC1 A;  2FA7 A;  2DE4 A;  3K6U A;  3O9P A;  1YPN A;  5DT6 A;  1MXW A;  5H8F A;  5BWJ A;  3TTM A;  3TCG A;  3PUV E;  3SEY A;  1QVS A;  1MQH A;  4NF4 B;  5AA2 D;  4F3P A;  3TUS A;  2YPN A;  4R2B A;  1UIU A;  4ELQ A;  2HQ0 A;  1HSJ A;  2Q9T A;  4BDL A;  3KZG A;  3LUY A;  1B3L A;  4FEB A;  5JEI A;  1HSL A;  4KHZ E;  1N7W A;  1CB6 A;  1HSE A;  1D4N A;  3CFL A;  1SW2 A;  1NKX A;  3V89 B;  1UTH A;  1IEJ A;  1SD3 A;  2DYX A;  4RPO A;  3LSL A;  5HBC A;  3TEP A;  4DLD A;  4P0I A;  3JYR A;  4OWD A;  1XT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...