4YICA

Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) with bound picolinic acid
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
344
structure length
344
Chain Sequence
ANPTVRWRMSTSWPKSLDTIYGSADELCKRVGQLTDGKFEIRAFPGGELVPSAQNMDAVSNGTVECNHVLSTMYIGKNTALTFDTGLSFGLNARQHNAWIHYGGGLQQLRELYKKYNIVNHVCGNVGVQMGGWYRKEIKSTADLNGLNMRIGGIGGMVLSKLGVVPQQIPPGDIYPALEKGTIDAAEWIGPYDDEKLGFNKVAPYYYSPGWFEGSASITSMVNDKAWEALPPAYQAAFEAACGEQSMRMLANYDARNPLALRKLIAGGAKVSFFPKEVMDAVYKASQQLWTELSEKNPDFKAIYPGWKKFQEDEAGWFRVAENALDNYTFAAVARAQAKAENLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
publication title CRYSTAL STRUCTURE OF A TRAP TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM BORDETELLA BRONCHISEPTICA RB50 (BB0280, TARGET EFI-500035) WITH BOUND PICOLINIC ACID
rcsb
source organism Bordetella bronchiseptica
molecule tags Transport protein
total genus 135
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4yicA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4yicA01
4NQ8A 4IO2A 1D4NA 3T66A 1SD3A 3SETA 4MH5A 2Y7KA 4ISUA 3L6HA 2PT1A 2XXPA 3T9UA 3T93B 3A3UA 4DIGA 5EHMA 4O3BA 3W9WA 5IM2A 5KDTA 3IX1A 1N7XA 2ZYNA 3KEIA 4KR5A 2P1SA 1S50A 5TPAA 2OK2A 3TEPA 2ANJA 4HS7A 1MXVA 4YKIA 4U1ZA 1FQDA 2F36A 3OMBA 3TUSA 1QUJA 3T9HB 4WKMA 2I0BA 4DI4B 1LB8A 1ELJA 3LBSA 2RKMA 1XHYA 1XT8A 3OD7A 1Y4TA 4RJZA 3O9PA 1MQDA 3LR1A 3PUXE 3G3KA 3SESA 2UVGA 3PMVA 4MBPA 3OOAA 4NAPA 3JZJA 3A3CA 3B50A 1SYIA 2RC8A 3B6TA 4F22A 2HEUA 3LSFB 2DXYA 3K6VA 3BFTA 4QSEA 1SW5A 3T9XB 1AIVA 5CC2A 4OXVA 1D9YA 1BP5A 3VLVA 2WX9A 2XXRA 2A5TA 4KYSA 3M3KA 1FQAA 3QK6A 3RTWB 2XX9A 4MIJA 3VVEA 1URDA 3CVGA 2H9BA 3TQLA 1OLCA 3G3IA 3IO4A 2RCBA 3GXAA 4NN3A 3TELA 1I6BA 5I57A 2V3QA 3M3LA 5JK4A 3MVZA 4PETA 1URSA 4O3AA 4ZEIA 1WODA 1RYXA 2O84X 4LP2B 4PAFA 4G2ZA 1ZU0A 3QYTA 1IXIA 4EQ7A 1H76A 4PFTA 1LFIA 3T9VA 1OLAA 1B7ZA 4ZE9A 5DYHA 2I49A 3FIRA 5CBSA 1JVXA 3PPPA 5K2XA 2YLNA 4F18A 4X9TA 2ZYMA 3K4UA 2ZNSA 1MQGA 4U4XA 4N6KA 4XKPA 4MNIA 4N91A 3MVYA 1B4ZA 1VFDA 2Z8FA 5H8FA 3B7DA 4PFWA 1B58A 2PBWA 1P1QA 4EQ9A 1HSJA 3GYYA 2I58A 4Z0IA 4THIA 2ZNUA 1B1XA 4OERA 5A5XB 1H45A 5BWJA 3UA8A 4LATA 3ZSFA 3H6VA 1IQ7A 4KFQA 2Z23A 3H6WA 3EF7A 4GD5A 2F6PA 4RXLA 3FVNA 1A54A 4PGPA 1NFTA 2PMSA 4XIGQ 1OMPA 1DPPA 3IB0A 4XF5A 2OCUA 1GVCA 1US4A 5HM4B 2UXAA 1B05A 3IL1B 2THIA 3K6XA 3DP6A 3IOUA 4NEDA 3IOVA 4NF6A 3Q26A 4YB7A 2NUVA 1ZJLA 2YPNA 3FJGA 4H65A 4MLVA 3FZVA 2H5YA 4FECA 4M1VA 1MG1A 1N84A 4TQUQ 1ZBMA 3E3KA 3LSXA 1ATGA 4ECFA 3CSGA 5DTBA 4IGTA 4XKRA 3KSXA 4QSCA 1N76A 2QS1A 4KHZE 2CZLA 4PFBA 3O6IA 2Q2AA 2F78A 4KD5A 3TFLA 3ECRA 4P0IA 2FA7A 1P1OA 4YKKA 4NMYA 2PX1A 4F3PA 4ESWA 2O1MA 2UYEA 4MAGA 4UABA 2VPNA 1YTVA 1O7TA 1QW0A 1MPDA 1SW1A 4QRZA 2OWTA 1FCKA 4PC9A 4XKQA 3TODA 3HPIA 3DELB 2OBGA 1M5CA 2XA5A 4QFPA 3RQTA 1IXCA 4DXBA 2GHBA 2WYPA 1SBPA 3EN3A 1JQFA 5IAIA 1XOCA 3TTRA 4NF8B 4YAHX 3BFUA 4E0XA 1XS5A 1MXWA 4JBZA 1IEJA 4OYVA 2VHAA 5AA4A 3KSJA 3WAEA 3DLNA 4MFIA 4I62A 5I58A 3U1OA 2F5XA 5LTCA 3R6UA 4LQ2A 4GF8A 2AIXA 1DSNA 4N8GA 3V5AA 1MXUA 1MQIA 2Q8JA 3RTFB 2Y7IA 3DP8A 1HSEA 3PV0E 1PB8A 4NG7A 3B6WA 4K3FA 4N6PA 3V89B 4QFNA 1XVYA 3EPEA 3CFZA 1A7LA 2DVCA 4ZZEA 2VP1A 3R7XA 1XC1A 3TMGA 2DVZA 2HXWA 5KCJB 2XXVA 4R9GA 3H06B 1YCJA 1LSTA 2O6AA 1LCFA 3OSQA 3LSWA 4NE4A 4U21A 2QL3A 1JVYA 5I2KB 1BLFA 3FXRA 1DOTA 4OANA 4AB5A 1EU8A 1POTA 1NH8A 1T0KA 3Q29A 3TTNA 1M5EA 3ZKLA 3VDFA 5ELVA 3QUFA 1OVTA 3CR9A 4KPTA 1FTLA 2DWHA 5H8QA 3SERA 4GRKA 2RINA 4FAJA 3K01A 4KCDA 5J1DA 4GQOA 4QHQA 4R9FA 4F3BA 4FEBA 4G68C 3K1PA 1PBQA 4RA1A 2Z22A 2XX8A 4NF6B 5L9OA 4BLAA 4MNPA 4FJPA 2D5WA 3CG3A 3N94A 3QUJA 2O69A 4GXAA 5BUUA 4GVOA 2XWOA 5LOMA 1LLSA 2P2AA 4IB2A 1UIVA 5ICQA 1KWHA 4NF4A 2XXQA 3C4MA 4PFIA 4ELPA 4ELRA 2AYSA 4OVRA 1M5BA 4XXUA 5FHNA 2F7AA 5EHSA 4OVQA 4P47A 4RK9A 4HTGA 1I69A 3TZAA 4YB5A 5I59A 5IKBA 5DVIA 3FV2A 5FTHA 3FVOA 4R6YA 4ZS9A 4PF6A 4G8MA 4X04A 1VSOA 5DVFA 1S9TA 2I3WA 1TWYA 3K00A 4H5GA 1JEUA 3SEYA 3PMWA 1OQGA 2W7YA 4PAIA 1SW2A 1ZKBA 4NF5A 2O7UA 2VD3A 3S4UA 3TTLA 4PAKA 3PPNA 3HN0A 2ESNA 3N5LA 4P1EA 4H8IA 3SEVA 4N6DA 3TCGA 4R72A 3RPWA 1B0LA 1Z7NE 1P1UA 4DE8A 1TXFA 2AL4A 5CMKA 4LVQA 2A5SA 3P7IA 1URGA 4MNCA 3V8XB 4G77A 1MXYA 4F2QA 2XXTA 5ITOA 3H4ZA 4FORA 4JWXA 3IR1A 3TTMA 1MM7A 2PFYA 2F7CA 4U4SA 3FJMA 3FD3A 4OA4A 3ILUB 2DWAA 3Q25A 2DE4A 4GOTA 3GLBA 4H0WA 3M3FA 4POWA 2RC7A 1Y3NA 5ICTA 1XVXA 3G3GA 2V3UA 1GTKA 4Q5TA 1O64A 2HZKA 4M4GA 1OIBA 4FATA 1A99A 4BDOA 3THIA 1SW4A 1BIYA 2I3VA 2QRYA 1MH4A 4NX1A 1LBBA 5IZZA 4PP0A 3KOSA 2QMXA 1R6ZA 3QSLA 2REJA 2B65A 4NWCA 3MP8A 4PQJA 4DXCA 2O51A 4KI0E 4OEVA 4BDNA 3EHUA 2D3IA 4BDRA 2E0SA 1B1HA 3RY3A 4ZDMA 4O8MA 4LZ5A 3LC8A 4H8JA 2Q9TA 1QUKA 1MQJA 4LA9A 4I8CA 3U93A 3E13X 5H8HA 1MDQA 3L6GA 2OWSA 3FXQA 1GGGA 3H03A 2Q88A 4X1DA 3ILTB 1IZ1A 3O6HA 2ALUA 1SVXB 1LFHA 4QFLA 1H43A 2LAOA 3UIFA 2M8CA 5DEXB 3V83A 4AB6A 4TOZA 1P1WA 2R6GE 4KYEA 4PBQA 4U2RA 3UORA 2XXKA 3KFMA 2ZZVA 4N17A 3O28A 3RLFE 4P11A 5JTYA 4EXKA 3QXMA 2Q89A 1JETA 2H25A 1B5JA 4IO5A 3FV1A 3GBBA 3EHSA 3FXBA 3N26A 5F7VA 4LUBA 2R9JA 1DTGA 3MQ9A 1USYH 2I6EA 2F7BA 3PD9A 3G3JA 5TP9A 3KG2A 4F3GA 4ZEDA 2DOJA 5L9SA 1CB6A 4RNSA 4C1UA 4OVPA 2HAUA 3OEMA 4XTCQ 1LFGA 3N6TA 4G68B 1N0TA 5AA1A 1PB9A 3CG1A 5CRYA 2YJPA 4DI3D 1AMFA 2XWKA 5AA2A 1B3HA 1B3EA 1J1NA 3VVFA 1UTBA 3IK6B 1VE4A 3IOTA 4X48A 2XD2A 5I56B 4F29A 2XXYA 4P1LA 4R6HA 3E9XA 2I48A 1MQHA 3RNNA 1JEVA 5L9MA 1N3XA 1B4HA 1NL5A 4RY1A 3M8UA 4EDPA 5KDTB 2FNCA 3FASA 4RYAA 3K2DA 1B40A 3ZKKA 4JWYA 2V93A 3UGWA 4WEPA 4GLIA 4IO6A 4O3CA 3USDA 3I5OA 2BJJX 3JYRA 4U1OA 3SEXA 4F39A 4BDQA 2IA4A 1IIWA 4WXJA 2NWJA 5TPAB 3VFJA 1A8FA 1LAFE 4I9DA 2DE2A 1EZOA 4JXIA 1QUIA 1SI1A 4O94A 3QIMA 3TDJA 3MZBA 3TKDA 5AA2D 1Q1KA 1LCTA 3H7MA 1YPNA 1PEBA 4GL8A 4RK2A 1AH5A 1A55A 3SKPA 4ND9A 5AE4A 5CMCA 5B70A 1M5DA 5H8NA 3KZGA 3U65A 4OHNA 3CIJA 3W9VA 3TYHA 4UA8A 4F1YA 1UTHA 1NH7A 3GBAA 2RCAA 4PE3A 2PVUA 3OEKA 3U92A 5FHMA 2XXIA 2A5TB 1DPEA 4F1VA 3VE1B 3UP9A 5DT6A 3IB1A 2PT2A 1FQCA 2HPGA 2VGQA 5I2NA 3HCQA 1A8EA 2DWIA 3Q27A 1Y3PA 2HQ0A 4N13A 4IO3A 1Z7ME 3AXFA 5CI5A 3PU5A 5I57B 5H8HB 3TCFA 2HFBA 5CBRA 4NHBA 4EXLA 1US5A 2ABHA 4PDDA 3C32A 2ZMBA 2DWJA 3G3HA 3SDFA 3G3FA 3F11A 2Y7WA 1MDP1 1NMUA 2GHAA 4KQPA 4HW8A 4YMBA 3KJ7A 3CI8A 4I1DA 4YMAA 1FQEA 4X1BA 5H8FB 2ZYOA 4MX6A 1H3DA 3QAXA 4POXA 3TQWA 1ZIUA 3I6VA 3KN7A 4BDLA 2F34A 4PF8A 3VVDA 1JW5A 1MY0A 1F9BA 2VOZA 4WEDA 4XKNA 5I5PA 1ZTYA 4R2FA 3CFXA 1PB7A 1NKXA 1S7YA 4LZ8A 4JWOA 5I7IA 4JB7A 2DE3A 1MS7A 2V84A 4F3SA 2E1SA 1AOVA 2V25A 4MMPA 1FTKA 3FVGA 3E4RA 3IB2A 3KN8A 2RC9A 3PUVE 3KGCA 1LAGE 1EZ9A 1AL3A 2WKYA 2KLFA 3B6QA 3MP6A 2GRVA 5ITPA 3MPLA 3Q28A 1WDNA 4ZEKA 2ZXTA 4F19A 1VFEA 3O66A 3VXBA 4AQ4A 4OFLA 2DQVA 4H6DA 1NNTA 4GIZA 4OMBA 3DP4A 4PE5B 4L17A 4R74A 3O2AA 3S9NC 3ONMA 3FATA 2O68A 5L8DA 1MXXA 4N8YA 4C1TA 1MRPA 4EUOA 4P9KA 3MVWA 4OQOA 1L5TA 1B3FA 1USYE 2X7QA 4G4PA 1DMBA 5M2VA 1FQBA 1UQWA 3TTKA 3C35A 4ONYA 2CEYA 4RPOA 3O29A 3O97A 3OO6A 4DCYA 3FVKA 4ZEBA 3FXUA 1MXZA 1B32A 3TCHA 4NGUA 5AA4B 1A40A 3VV5A 3PUZE 3IJOB 1B7HA 4PBHA 5I58B 1N04A 5FTIA 2PFZA 2H98A 2ZNTA 1B2HA 4X8RA 5HPQA 3N6UA 3C34A 1LGBC 2OZZA 4QF9A 3K6WA 1Y1ZA 4DCXA 3BKIB 1FTJA 4ZEFA 4N15A 4UACA 2ONSA 1EH3A 4Q0CA 2QS4A 3KJTA 3ODBA 4DXUA 2ONKE 1NNPA 3OXNA 1Y4CA 5EYFA 3HO7A 4PDHA 1B46A 4OETA 2NOOA 1B3LA 4KCCA 3FGSA 4ELQA 3IJXB 4U22A 4F2OA 1MPBA 4GWOA 1FTOA 3GZGA 4JSOA 4YB6A 1RYOA 1GV8A 2B3FA 3KBRA 4OVTA 3PGFA 5KZTA 4P3LA 4ZECA 3RT8A 5IGAA 1CE2A 1LAHE 1SYHA 3K1MA 3EQ1A 2QMWA 3C31A 2P0SA 4NF8A 2Y7PA 5H8QB 1SI0A 3VLUA 2XXHA 1B7UA 4QFKA 5AA3A 1MM6A 5DVJA 1MY3A 1MY2A 4DLDA 3OENA 3MWBA 1I6QA 3DM0A 3H6TA 2G93A 1LAXA 4OESA 1FW0A 1PDAA 4OEUA 3MUQA 3CFLA 4MF3A 5CMMA 1QVSA 3OSRA 3TPAA 3IORA 2XXXA 3PD8A 3U94A 1DTZA 2XX7A 1TT1A 3HHFA 4NF4B 3MJNA 3K02A 4R73A 4P56A 4LN5A 3W15C 3MAMA 2GFEA 3PPOA 3R26A 3RGYA 5HBCA 4GL0A 2Y84A 2QS2A 1M5FA 2R71A 2H4IA 3K1NA 4O7MA 5KCJA 4P8BA 5CMBA 2HCAA 2ZYKA 1MY1A 5I59B 3U8QA 3WAFA 1JNFA 1BTJA 2QJEA 4IO4A 2F97A 5K2YA 4JDFA 4KYDA 2QPQA 5I2KA 3OO8A 3KOTA 3EHTA 3H6UA 4OVSA 4YZZA 3K0VA 4NF5B 3PUWE 4H1XA 4U23A 4G8NA 3FJ7A 1IITA 2Z8EA 3C33A 3TAJA 2H99A 1N7WA 1B9JA 3MZ1A 3S2VA 1NNFA 4HCWA 5FHOA 1PBPA 3PMXA 1MH3A 3H3GA 4TLLB 1IXHA 3A09A 3FUZA 5CM6A 2UVHA 4XFEA 4Z7EA 2DP8A 1FQFA 1OVBA 5F1QA 4LONB 3T22A 1LB9A 2I4BA 2F8DA 1B6HA 1HSLA 2REGA 5H8SA 1Y20A 2Y7RA 4ELOA 4H67A 2OLBA 4NWDA 4IY6A 2AL5A 4H5FA 1B51A 4DDDA 1ZMGA 2G29A 3CSBA 3I3VA 1NNKA 2UVJA 3HV1A 1GR2A 4GFRA 1POY1 4N4UA 1N3WA 2DXRA 2WYKA 2GH9A 1R9LA 3LSLA 2I0CA 3RN8A 4Q8RA 4R6KA 3MPKA 3ZS6A 1R1NA 3IAZA 4DZ1A 2XD3A 3RUMA 4EF1A 4RPNA 3C9HA 1YAEA 4IGRA 1RKMA 3O6GA 1B5IA 2F6GA 4LZ7A 3BBRA 4OTEA 2FYIA 1BKAA 3PPRA 3SEUA 1Q35A 4NTLA 2CEXA 4R75A 2X7PA 3MVXA 2OJTA 4EF2A 4FE8A 2X26A 4Q30B 2UYFA 4EQBA 3UK4A 4MEVA 3C36A 1QJMA 1QULA 1UIUA 1B52A 2ZZWA 2XWVA 3MBPA 2V3TA 4IY5A 1II5A 3OELA 5JTYB 2NVUB 3KN3A 3OO9A 1D3KA 4G8HA 3S9LC 3VXCA 1JW1A 2RF1A 4YKJA 1PC3A 1TFDA 1SDXA 1EZPA 2O1LA 4QFOA 5TP9B 4OWDA 1R9QA 4QSDA 2ONRA 2Z8DA 3T96B 2O7IA 5TU0A 4F31B 1I6AA 4C0RA 1B3GA 4XEQA 3K6UA 1LBCA 4OENA 3OO7A 2DSFA 4OFJA 1VR5A 4ZE8A 2NXOA 4MLQA 4YKPA 2QSXA 1P1NA 2XXWA 4IO7A 5AA2B 2HAVA 3MC2A 4ESXA 1UTBB 4FEDA 2V4CA 2I4CA 1MPCA 1Y3QA 3CRBA 1O63A 3S9EA 4P0GA 4MCOA 3JV9A 5B7DA 5I84A 4R2BA 3HHGA 4ZZAA 3IOWA 3MZ9A 1QKBA 2HZLA 3RT6B 4FIMA 4NF0A 1B5HA 5DEXA 4PCDA 1Y9UA 2DS9A 4PFUA 1JW4A 3U72A 2DYXA 1D9VA 4F1UA 3PUYE 4JSDA 2F35A 4E0WA 2B3BA 4OVJA 3VLWA 1Y1MA 3S9MC 3SEWA 1FTMA 1OQHA 3MP1A 2D21A 3IO6A 2PYYA 1ANFA 2UVIA 1P99A 2XWIA 1IUDA 5H8NB 1IXGA 2XXUA 3PPQA 2VPOA 5A5XA 1SQYA 3D4CA 4TLMB 2Q2CA 5JEIA 2QS3A 3G7WA 3LUYA 4N07A 4YICA 1TFAA 4OFOA 3UN6A 4PFRA 4GXSB 1UTHB 2IEEA 4PFYA 4PGNA 3D4GA 2VD2A 4G68A 1WVJA 3HSTA 4YU0A 1MY4A 1ZLQA 1QKAA 3MW0A 2XHDA 2ZZXA 4BDMA 5I2NB 1B0HA 4MHFA 4LQ5A 5ISUA 2CMOA 4OZ9A 1H44A 5I56A 4HCYA
chains in the Genus database with same CATH superfamily
1IMCA 4NQ8A 4IO2A 1D4NA 1FJ6A 3T66A 1SD3A 3SETA 4MH5A 2Y7KA 4I40A 4ISUA 3HFUA 3L6HA 2PT1A 2XXPA 3T9UA 3T93B 3A3UA 4DIGA 5EHMA 4O3BA 3W9WA 5IM2A 3BIGA 1NV1A 5ET5A 5KDTA 3IX1A 1N7XA 2ZYNA 3KEIA 1SPIA 4KR5A 2P1SA 1S50A 5TPAA 2OK2A 3TEPA 2ANJA 4HS7A 5DW8A 1MXVA 4YKIA 4U1ZA 1FQDA 2F36A 3OMBA 3TUSA 1QUJA 3T9HB 4WKMA 2I0BA 4DI4B 2OWZA 1LB8A 1ELJA 3LBSA 2RKMA 1XHYA 1XT8A 3OD7A 1Y4TA 4RJZA 3O9PA 1MQDA 3LR1A 4GWZA 3PUXE 3G3KA 3SESA 2UVGA 3ISPA 3PMVA 1NV2A 3LUZA 4MBPA 1LBWA 3OOAA 4NAPA 2HHMA 3JZJA 3A3CA 3B50A 1SYIA 2RC8A 3B6TA 2HEUA 3LSFB 4QSEA 2DXYA 3K6VA 3BFTA 3T9XB 1SW5A 4F22A 1AIVA 5CC2A 4OXVA 1D9YA 1BP5A 3VLVA 1FPLA 2WX9A 2XXRA 2A5TA 4KYSA 3M3KA 5EQ8A 1FQAA 3QK6A 3RTWB 2QVVA 2XX9A 4MIJA 3VVEA 5EYGA 1URDA 3CVGA 2H9BA 3TQLA 1OLCA 3G3IA 3IO4A 4PTKA 2RCBA 3GXAA 4NN3A 3TELA 1I6BA 5I57A 2V3QA 3M3LA 5JK4A 3MVZA 4PETA 1URSA 4O3AA 4ZEIA 1WODA 3MSTA 1RYXA 2O84X 4LP2B 4PAFA 4G2ZA 1ZU0A 3QYTA 1IXIA 4EQ7A 1H76A 4PFTA 1LFIA 3T9VA 1OLAA 1B7ZA 4ZE9A 5DYHA 5EQ9A 2I49A 3FIRA 5CBSA 1JVXA 3PPPA 5K2XA 2YLNA 4F18A 4X9TA 2ZYMA 3K4UA 1Q9DA 2ZNSA 1MQGA 4N6KA 4U4XA 4MNIA 4XKPA 4N91A 2Q8MA 3MVYA 1B4ZA 1VFDA 2Z8FA 5H8FA 3B7DA 4PFWA 1B58A 2PBWA 1P1QA 4EQ9A 5A5LA 1HSJA 1RDYA 3GYYA 2I58A 4Z0IA 4THIA 2ZNUA 1B1XA 2L5VA 4OERA 5A5XB 4GBVA 1H45A 5BWJA 3UA8A 4LATA 3ZSFA 3H6VA 1IQ7A 4KFQA 2Z23A 3H6WA 3EF7A 4GD5A 2F6PA 3T0JA 4RXLA 3FVNA 1A54A 4PGPA 1NFTA 2PMSA 4XIGQ 1OMPA 1NV7A 3NOHA 1DPPA 3IB0A 4XF5A 2OCUA 1LBYA 1GVCA 1US4A 5HM4B 2UXAA 1B05A 4GX3A 3IL1B 2THIA 3K6XA 3DP6A 3IOUA 4NEDA 3IOVA 1AWBA 4NF6A 3Q26A 4YB7A 2NUVA 1ZJLA 2YPNA 3FJGA 4H65A 4MLVA 1NV4A 2PCRA 3FZVA 2H5YA 4FECA 4M1VA 1MG1A 1N84A 4TQUQ 1ZBMA 2KQZA 3E3KA 3LSXA 1ATGA 4ECFA 3CSGA 5DTBA 2FBPA 4IGTA 4XKRA 3KSXA 4QSCA 1N76A 2QS1A 4KHZE 2CZLA 4PFBA 3O6IA 2Q2AA 2F78A 4KD5A 3TFLA 2Q74A 1FRPA 1FPGA 3ECRA 4P0IA 2FA7A 1P1OA 4YKKA 4NMYA 2PX1A 2F3DA 4F3PA 4ESWA 2O1MA 2UYEA 4MAGA 4UABA 2VPNA 5T3JA 5ET7A 1YTVA 1O7TA 1QW0A 1MPDA 1SW1A 4QRZA 2OWTA 1FCKA 5FBPA 4PC9A 4XKQA 3TODA 2F3BA 3HPIA 2XA5A 2OBGA 1M5CA 3DELB 4QFPA 3RQTA 1IXCA 1IMBA 5J16A 4DXBA 3PTYA 2GHBA 2WYPA 1SBPA 3EN3A 1JQFA 5IAIA 1XOCA 3TTRA 4NF8B 4YAHX 3BFUA 4E0XA 1XS5A 1MXWA 4JBZA 1IEJA 4OYVA 2VHAA 5AA4A 3KSJA 3WAEA 3DLNA 4MFIA 4I62A 5I58A 3U1OA 2F5XA 5LTCA 3R6UA 4LQ2A 4GF8A 2AIXA 1DSNA 4N8GA 3V5AA 1MXUA 1MQIA 2Q8JA 3RTFB 1YYZA 2Y7IA 3DP8A 1HSEA 3PV0E 4FBPA 1PB8A 4NG7A 3B6WA 1FBDA 4K3FA 4N6PA 3V89B 4QFNA 1FPBA 1XVYA 3EPEA 3CFZA 1A7LA 2DVCA 4ZZEA 2VP1A 3R7XA 1XC1A 2DVZA 3TMGA 2HXWA 4I3YA 5KCJB 2XXVA 4R9GA 3H06B 1YCJA 1LSTA 2O6AA 1LCFA 4AS5A 3OSQA 4AS4A 3LSWA 4NE4A 4U21A 2QL3A 1JVYA 5I2KB 1BLFA 5EYHA 3FXRA 1DOTA 4OANA 4AB5A 1EU8A 1POTA 1NH8A 1T0KA 3Q29A 3TTNA 1M5EA 3ZKLA 3VDFA 5ELVA 3QUFA 1OVTA 3CR9A 4KPTA 1FTLA 2DWHA 5H8QA 3SERA 4GRKA 2RINA 4FAJA 3K01A 4KCDA 5J1DA 4GQOA 4QHQA 4R9FA 4F3BA 4FEBA 4G68C 3K1PA 1PBQA 4RA1A 2Z22A 2XX8A 4NF6B 5L9OA 4BLAA 4MNPA 4FJPA 2D5WA 3CG3A 3N94A 3QUJA 2O69A 4GXAA 5BUUA 2XWOA 4GVOA 4JVIA 5LOMA 1DBZA 1LLSA 3RYDA 2P2AA 4IB2A 1UIVA 5ICQA 1KWHA 4NF4A 2XXQA 3C4MA 4JVDA 4PFIA 4ELPA 4ELRA 2AYSA 4OVRA 1M5BA 4XXUA 5F24A 5FHNA 2F7AA 5EHSA 4OVQA 4P47A 2BJIA 4RK9A 4HTGA 1I69A 1NV6A 1FPKA 4YB5A 3TZAA 3KC1A 5I59A 5IKBA 5DVIA 3FV2A 5FTHA 3FVOA 4R6YA 2FVZA 3EKIA 4GX6A 4ZS9A 4PF6A 4G8MA 4X04A 1VSOA 5DVFA 1S9TA 2I3WA 1TWYA 3K00A 4H5GA 1JEUA 1FJ9A 3SEYA 3PMWA 1INPA 4PAIA 1OQGA 2W7YA 1SW2A 1ZKBA 4NF5A 2O7UA 2VD3A 3S4UA 3TTLA 4PAKA 3PPNA 3HN0A 2ESNA 3N5LA 4P1EA 4H8IA 4N6DA 3SEVA 3TCGA 4R72A 3RPWA 1B0LA 1Z7NE 1P1UA 4DE8A 1TXFA 2AL4A 2JJKA 5CMKA 1EYKA 4LVQA 2A5SA 3P7IA 1URGA 4MNCA 3V8XB 2FHYA 4G77A 1MXYA 4F2QA 2XXTA 5ITOA 3B8BA 3H4ZA 4FORA 4JWXA 3IR1A 3TTMA 1MM7A 2PFYA 2F7CA 4U4SA 2KR0A 3FJMA 3FD3A 4OA4A 3ILUB 2DWAA 1NUYA 3Q25A 2DE4A 4GOTA 3GLBA 1VDWA 4H0WA 5ET8A 3M3FA 4GWYA 4POWA 2RC7A 1Y3NA 5ICTA 1XVXA 4HXVA 3G3GA 1CNQA 2V3UA 1GTKA 4Q5TA 1O64A 2HZKA 4M4GA 1OIBA 4FATA 1A99A 4BDOA 3THIA 1SW4A 4GX4A 1BIYA 2I3VA 2QRYA 1MH4A 4NX1A 5ET6A 1LBBA 1FPDA 5IZZA 4PP0A 1FSAA 3KOSA 2QMXA 1R6ZA 3QSLA 2REJA 2B65A 4NWCA 3MP8A 4PQJA 4DXCA 5LDZA 2O51A 4KI0E 4OEVA 4BDNA 3EHUA 2D3IA 4BDRA 2E0SA 1B1HA 3RY3A 4O8MA 4ZDMA 3RPLA 4LZ5A 2CZHA 3LC8A 4H8JA 2Q9TA 1QUKA 1MQJA 4LA9A 4I8CA 3U93A 3E13X 5H8HA 1MDQA 3L6GA 2OWSA 3FXQA 1GGGA 3H03A 2Q88A 4X1DA 3ILTB 1IZ1A 2QVRA 3O6HA 2ALUA 1SVXB 1LFHA 4QFLA 1H43A 2LAOA 2VT5A 3UIFA 2M8CA 5DEXB 3V83A 4AB6A 4TOZA 1P1WA 3CHGA 2R6GE 4KYEA 4PBQA 4U2RA 2XXKA 3UORA 3KFMA 2ZZVA 4N17A 3O28A 2OX3A 3RLFE 4P11A 5JTYA 1KA1A 4EXKA 3QXMA 2Q89A 1JETA 1NUWA 2H25A 3IFAA 1B5JA 4IO5A 3FV1A 3GBBA 3EHSA 3FXBA 3N26A 5F7VA 4LUBA 2R9JA 1DTGA 3MQ9A 1USYH 2I6EA 1KZ8A 2F7BA 3PD9A 1LBZA 3G3JA 5TP9A 3KG2A 4F3GA 4ZEDA 2DOJA 5IZ3B 5L9SA 1CB6A 4RNSA 4C1UA 4OVPA 2HAUA 3OEMA 4XTCQ 1LFGA 3N6TA 4G68B 1N0TA 5AA1A 1PB9A 3CG1A 5CRYA 2YJPA 4DI3D 1AMFA 2XWKA 5AA2A 1B3HA 1B3EA 1J1NA 3VVFA 1UTBA 3IK6B 1VE4A 3IOTA 4X48A 2XD2A 5I56B 4F29A 2XXYA 4P1LA 4R6HA 3E9XA 2I48A 1MQHA 1QGXA 4HE0A 3RNNA 1JEVA 5L9MA 1N3XA 1B4HA 1NL5A 4RY1A 3M8UA 4EDPA 1LBVA 5KDTB 2FNCA 3FASA 4RYAA 3K2DA 1B40A 3ZKKA 4JWYA 2V93A 4WEPA 3UGWA 4GLIA 4IO6A 4O3CA 3USDA 3I5OA 2BJJX 3JYRA 1FPEA 4U1OA 3SEXA 4F39A 2IA4A 4BDQA 1JP4A 1IIWA 4WXJA 2NWJA 2WBDA 5TPAB 3VFJA 1A8FA 1LAFE 2Y5LA 4I9DA 1NI9A 2DE2A 1EZOA 4JXIA 1QUIA 1SI1A 4O94A 3QIMA 3TDJA 3MZBA 2DDKA 3TKDA 5AA2D 1Q1KA 5ESYA 1LCTA 3H7MA 1YPNA 1PEBA 4GL8A 4RK2A 1AH5A 1A55A 3SKPA 4GBWA 1IMFA 4ND9A 5AE4A 2P3VA 5CMCA 5B70A 1M5DA 5H8NA 1KA0A 5IZ1A 3KZGA 3U65A 3MYUA 2CZIA 4OHNA 3CIJA 3W9VA 3TYHA 2GQ1A 4UA8A 4F1YA 1UTHA 1NH7A 3GBAA 2RCAA 4PE3A 4KXPA 2PVUA 3OEKA 3U92A 1LBXA 5FHMA 2XXIA 2A5TB 1DPEA 4F1VA 3VE1B 3UP9A 5DT6A 3IB1A 2PT2A 1FQCA 2HPGA 2VGQA 5I2NA 3HCQA 1A8EA 2DWIA 3Q27A 1YXIA 1Y3PA 2HQ0A 4N13A 4IO3A 1Z7ME 1NUZA 3AXFA 5CI5A 4H46A 3PU5A 5I57B 5H8HB 3TCFA 2HFBA 5CBRA 4NHBA 4EXLA 1US5A 4N81A 2ABHA 4PDDA 3C32A 2ZMBA 1EYJA 2DWJA 3G3HA 3SDFA 3G3FA 3F11A 2Y7WA 1LEVA 1MDP1 4MJOA 1NMUA 2GHAA 4KQPA 4HW8A 1RDZA 4YMBA 3KJ7A 4GWUA 3CI8A 4I1DA 4YMAA 1FQEA 4X1BA 5H8FB 2ZYOA 4JVCA 4MX6A 1H3DA 3QAXA 4POXA 3TQWA 1ZIUA 3I6VA 3KN7A 2B4MA 3KC0A 4BDLA 1G0HA 2F34A 4PF8A 3VVDA 1JW5A 1MY0A 1F9BA 2VOZA 4WEDA 5I3SA 4XKNA 5I5PA 5EQAA 1ZTYA 4R2FA 1BK4A 3CFXA 1PB7A 1NKXA 1S7YA 2HXRA 4LZ8A 1FBFA 1FTAA 4JWOA 5I7IA 4JB7A 2DE3A 1MS7A 2V84A 4F3SA 2E1SA 1AOVA 2V25A 2QFLA 4MMPA 1FTKA 3FVGA 3E4RA 3IB2A 3KN8A 2RC9A 3PUVE 3KGCA 1LAGE 1EZ9A 1AL3A 2WKYA 2KLFA 3B6QA 3MP6A 2GRVA 5ITPA 3MPLA 3Q28A 1WDNA 4ZEKA 2ZXTA 4F19A 1VFEA 3O66A 3VXBA 4AQ4A 4OFLA 2R8TA 2DQVA 4H6DA 1NNTA 4GIZA 4OMBA 5EQ7A 3DP4A 4PE5B 1D9QA 4L17A 4R74A 3O2AA 3S9NC 3ONMA 3FATA 2O68A 5L8DA 1MXXA 4N8YA 4C1TA 1MRPA 4EUOA 4P9KA 3MVWA 4OQOA 1L5TA 1B3FA 1USYE 2X7QA 4G4PA 1DMBA 5M2VA 1K9ZA 1FQBA 1UQWA 3TTKA 3C35A 4ONYA 2CEYA 4RPOA 3O29A 3O97A 3OO6A 1NUXA 3FVKA 4DCYA 4ZEBA 3FXUA 1G0IA 1MXZA 1XI6A 1B32A 3TCHA 4NGUA 5AA4B 1A40A 3VV5A 1IMAA 3PUZE 3IJOB 1B7HA 4PBHA 2FIEA 5I58B 1N04A 5FTIA 2PFZA 2H98A 2ZNTA 1B2HA 1EYIA 4X8RA 5HPQA 3FBPA 3N6UA 3C34A 1LGBC 2OZZA 4QF9A 3K6WA 1Y1ZA 1IMEA 4DCXA 3BKIB 1FTJA 4H45A 4ZEFA 4N15A 4UACA 2ONSA 1EH3A 4Q0CA 2QS4A 3KJTA 4QXDA 3ODBA 4DXUA 2ONKE 1NNPA 3OXNA 1Y4CA 5EYFA 3HO7A 4O7IA 4PDHA 1B46A 1NV5A 4OETA 2NOOA 1B3LA 1NV0A 4KCCA 3FGSA 4ELQA 2Y5KA 3IJXB 4U22A 4F2OA 3A29A 1MPBA 1IMDA 4GWOA 1FTOA 3GZGA 4JSOA 3ROJA 4YB6A 1RYOA 1GV8A 2B3FA 3KBRA 4OVTA 3PGFA 3BIHA 4P3LA 5KZTA 4ZECA 3RT8A 5IGAA 1CE2A 1LAHE 1SYHA 3K1MA 3EQ1A 2QMWA 3C31A 2P0SA 3E79A 4NF8A 2Y7PA 5H8QB 1SI0A 2B4LA 3VLUA 1FBCA 2XXHA 1B7UA 4QFKA 5AA3A 1MM6A 2WBBA 5DVJA 1MY3A 1MY2A 4DLDA 4HE2A 3OENA 3MWBA 1I6QA 3QMFA 3DM0A 3H6TA 2G93A 1LAXA 4OESA 1FW0A 1PDAA 1FPJA 4OEUA 3MUQA 3CFLA 4MF3A 5CMMA 1QVSA 3OSRA 3TPAA 3IORA 2XXXA 3PD8A 3U94A 1DTZA 2XX7A 1TT1A 3HHFA 4NF4B 3MJNA 3K02A 4R73A 2FIXA 4P56A 4LN5A 3W15C 3MAMA 2GFEA 3PPOA 3R26A 3RGYA 5HBCA 4GL0A 2Y84A 2QS2A 1M5FA 2R71A 2H4IA 3K1NA 4O7MA 5KCJA 4P8BA 5CMBA 2HCAA 2ZYKA 1MY1A 5I59B 3U8QA 3WAFA 1JNFA 4GWSA 1BTJA 2P3NA 2QJEA 4IO4A 2F97A 5K2YA 4JDFA 4KYDA 2QPQA 5I2KA 3OO8A 4G61A 3KOTA 2MKZA 3EHTA 3D1RA 3H6UA 2QVUA 4OVSA 4YZZA 3K0VA 4NF5B 3IFCA 3PUWE 4H1XA 4U23A 4G8NA 3FJ7A 1IITA 2Z8EA 3C33A 3TAJA 2H99A 1N7WA 2WEFA 1B9JA 3MZ1A 3S2VA 1NNFA 4HCWA 5FHOA 1PBPA 3PMXA 1MH3A 3H3GA 4TLLB 1IXHA 3A09A 3FUZA 5CM6A 2UVHA 4XFEA 4Z7EA 2DP8A 1FQFA 1OVBA 5F1QA 4LONB 3T22A 1LB9A 2I4BA 2F8DA 1B6HA 1FBHA 1HSLA 2REGA 5H8SA 1Y20A 2Y7RA 4ELOA 1DCUA 4H67A 2OLBA 4NWDA 4IY6A 2AL5A 4H5FA 1B51A 1DK4A 4DDDA 1ZMGA 2G29A 3CSBA 3I3VA 1NNKA 4HE1A 2UVJA 3HV1A 1GR2A 4GFRA 1POY1 4N4UA 1N3WA 2DXRA 2WYKA 2GH9A 1R9LA 3LSLA 1FBGA 2I0CA 3RN8A 4Q8RA 1FBPA 4R6KA 3MPKA 3ZS6A 1R1NA 3IAZA 4DZ1A 2XD3A 3LV0A 3RUMA 4EF1A 4RPNA 3RPLB 3C9HA 1YAEA 4IGRA 1RKMA 3O6GA 1B5IA 2F6GA 4LZ7A 3T1BA 3BBRA 4OTEA 2FYIA 1BKAA 3PPRA 3SEUA 1Q35A 4NTLA 2CEXA 4R75A 2X7PA 3MVXA 2OJTA 2CZKA 4EF2A 4FE8A 2X26A 4Q30B 2UYFA 4EQBA 3UK4A 1NV3A 4MEVA 3C36A 1QJMA 1QULA 1UIUA 1B52A 4IR8A 2ZZWA 1FPFA 2XWVA 3MBPA 2V3TA 4IY5A 1II5A 3OELA 5JTYB 2NVUB 4GWWA 3KN3A 3OO9A 1D3KA 4G8HA 3S9LC 3VXCA 1JW1A 2RF1A 4YKJA 1PC3A 1SDXA 1TFDA 1EZPA 2O1LA 4QFOA 5TP9B 4OWDA 1R9QA 4QSDA 2ONRA 2Z8DA 3T96B 2O7IA 5TU0A 4F31B 1I6AA 4C0RA 1B3GA 4XEQA 3K6UA 1LBCA 4OENA 3OO7A 2DSFA 4OFJA 3KBZA 1VR5A 1FPIA 4ZE8A 2NXOA 4MLQA 4YKPA 2QSXA 1P1NA 2XXWA 4IO7A 5AA2B 2HAVA 3MC2A 1YZ0A 1K9YA 4ESXA 1UTBB 2V4CA 4FEDA 2I4CA 1MPCA 1Y3QA 3CRBA 1O63A 3S9EA 4P0GA 4MCOA 3JV9A 5B7DA 5I84A 4R2BA 3HHGA 4I3EA 4ZZAA 3IOWA 3MZ9A 1QKBA 2HZLA 3RT6B 4FIMA 4NF0A 1B5HA 5DEXA 4PCDA 1Y9UA 2DS9A 4PFUA 1JW4A 3U72A 2DYXA 4QBAA 1D9VA 3SZPA 4F1UA 3PUYE 4JSDA 2F35A 4E0WA 2B3BA 4OVJA 3VLWA 1Y1MA 3S9MC 3SEWA 1FBEA 1FTMA 1OQHA 3MP1A 4GWXA 2D21A 3IO6A 2PYYA 1ANFA 2UVIA 3E78A 1P99A 2XWIA 1IUDA 5H8NB 1IXGA 2XXUA 3PPQA 2VPOA 5IZ3A 5A5XA 1SQYA 3D4CA 4TLMB 2Q2CA 5JEIA 2QS3A 3G7WA 3LUYA 4N07A 4YICA 1TFAA 4OFOA 3UN6A 4PFRA 4GXSB 1UTHB 2IEEA 4PFYA 4PGNA 3D4GA 2VD2A 4G68A 1WVJA 1RDXA 3HSTA 4YU0A 1MY4A 1ZLQA 1QKAA 3MW0A 2XHDA 2ZZXA 4BDMA 5I2NB 1B0HA 4MHFA 4LQ5A 5ISUA 2CMOA 4OZ9A 1H44A 5I56A 4HCYA
chains in the Genus database with same CATH topology
1IMCA 4NQ8A 4IO2A 1D4NA 3T66A 1FJ6A 1SD3A 3SETA 4MH5A 2Y7KA 4ISUA 4I40A 3HFUA 3L6HA 2PT1A 2XXPA 3T9UA 3T93B 3A3UA 4DIGA 5EHMA 4O3BA 3W9WA 5IM2A 3BIGA 1NV1A 5ET5A 5KDTA 3IX1A 1N7XA 2ZYNA 3KEIA 1SPIA 4KR5A 2P1SA 1S50A 5TPAA 2OK2A 3TEPA 2ANJA 4HS7A 5DW8A 1MXVA 4YKIA 4U1ZA 1FQDA 2F36A 3OMBA 3TUSA 1QUJA 3T9HB 4WKMA 2I0BA 4DI4B 2OWZA 1LB8A 1ELJA 3LBSA 2RKMA 1XHYA 1XT8A 3OD7A 1Y4TA 4RJZA 3O9PA 1MQDA 3LR1A 4GWZA 3PUXE 3G3KA 3SESA 2UVGA 3ISPA 3PMVA 1NV2A 3LUZA 4MBPA 3OOAA 1LBWA 4NAPA 2HHMA 3JZJA 3A3CA 3B50A 1SYIA 2RC8A 3B6TA 4F22A 2HEUA 3LSFB 2DXYA 3K6VA 3BFTA 4QSEA 1SW5A 3T9XB 1AIVA 5CC2A 4OXVA 1D9YA 1BP5A 3VLVA 1FPLA 2WX9A 2XXRA 2A5TA 4KYSA 3M3KA 5EQ8A 1FQAA 3QK6A 3RTWB 2QVVA 2XX9A 4MIJA 3VVEA 5EYGA 1URDA 3CVGA 2H9BA 3TQLA 1OLCA 3G3IA 3IO4A 4PTKA 2RCBA 3GXAA 4NN3A 3TELA 1I6BA 5I57A 2V3QA 3M3LA 5JK4A 3MVZA 4PETA 1URSA 4O3AA 4ZEIA 1WODA 3MSTA 1RYXA 2O84X 4LP2B 4PAFA 4G2ZA 1ZU0A 3QYTA 1IXIA 4EQ7A 1H76A 4PFTA 1LFIA 3T9VA 1OLAA 1B7ZA 4ZE9A 5DYHA 5EQ9A 2I49A 3FIRA 5CBSA 1JVXA 3PPPA 5K2XA 2YLNA 4F18A 4X9TA 2ZYMA 3K4UA 1Q9DA 2ZNSA 1MQGA 4U4XA 4N6KA 4XKPA 4MNIA 4N91A 2Q8MA 3MVYA 1B4ZA 1VFDA 2Z8FA 5H8FA 3B7DA 4PFWA 1B58A 2PBWA 1P1QA 4EQ9A 5A5LA 1HSJA 1RDYA 3GYYA 2I58A 4Z0IA 4THIA 2ZNUA 1B1XA 2L5VA 4OERA 5A5XB 4GBVA 1H45A 5BWJA 3UA8A 4LATA 3ZSFA 3H6VA 1IQ7A 4KFQA 2Z23A 3H6WA 3EF7A 4GD5A 2F6PA 3T0JA 4RXLA 3FVNA 1A54A 4PGPA 1NFTA 2PMSA 4XIGQ 1OMPA 1NV7A 3NOHA 1DPPA 3IB0A 4XF5A 2OCUA 1GVCA 1LBYA 1US4A 5HM4B 2UXAA 1B05A 4GX3A 3IL1B 2THIA 3K6XA 3DP6A 3IOUA 4NEDA 3IOVA 1AWBA 4NF6A 3Q26A 4YB7A 2NUVA 1ZJLA 2YPNA 3FJGA 4H65A 4MLVA 1NV4A 2PCRA 3FZVA 2H5YA 4FECA 4M1VA 1MG1A 1N84A 4TQUQ 1ZBMA 3E3KA 2KQZA 3LSXA 1ATGA 4ECFA 3CSGA 5DTBA 2FBPA 4IGTA 4XKRA 3KSXA 4QSCA 1N76A 2QS1A 4KHZE 2CZLA 4PFBA 3O6IA 2Q2AA 2F78A 4KD5A 3TFLA 2Q74A 1FRPA 1FPGA 3ECRA 4P0IA 2FA7A 1P1OA 4YKKA 4NMYA 2PX1A 2F3DA 4F3PA 4ESWA 2O1MA 2UYEA 4MAGA 4UABA 2VPNA 5T3JA 5ET7A 1YTVA 1O7TA 1QW0A 1MPDA 1SW1A 4QRZA 2OWTA 1FCKA 5FBPA 4PC9A 4XKQA 3TODA 2F3BA 3HPIA 3DELB 2OBGA 1M5CA 2XA5A 4QFPA 3RQTA 1IXCA 1IMBA 5J16A 4DXBA 3PTYA 2GHBA 2WYPA 1SBPA 3EN3A 1JQFA 5IAIA 1XOCA 3TTRA 4NF8B 4YAHX 3BFUA 4E0XA 1XS5A 1MXWA 4JBZA 1IEJA 4OYVA 2VHAA 5AA4A 3KSJA 3WAEA 3DLNA 4MFIA 4I62A 5I58A 3U1OA 2F5XA 5LTCA 3R6UA 4LQ2A 4GF8A 2AIXA 1DSNA 4N8GA 3V5AA 1MXUA 1MQIA 2Q8JA 3RTFB 1YYZA 2Y7IA 3DP8A 1HSEA 3PV0E 4FBPA 1PB8A 4NG7A 3B6WA 1FBDA 4K3FA 4N6PA 3V89B 4QFNA 1XVYA 1FPBA 3EPEA 3CFZA 1A7LA 2DVCA 4ZZEA 2VP1A 3R7XA 1XC1A 3TMGA 2DVZA 2HXWA 4I3YA 5KCJB 2XXVA 4R9GA 3H06B 1YCJA 1LSTA 2O6AA 1LCFA 4AS5A 3OSQA 4AS4A 3LSWA 4NE4A 4U21A 2QL3A 1JVYA 5I2KB 1BLFA 5EYHA 3FXRA 1DOTA 4OANA 4AB5A 1EU8A 1POTA 1NH8A 1T0KA 3Q29A 3TTNA 1M5EA 3ZKLA 3VDFA 5ELVA 3QUFA 1OVTA 3CR9A 4KPTA 1FTLA 2DWHA 5H8QA 3SERA 4GRKA 2RINA 4FAJA 3K01A 4KCDA 5J1DA 4GQOA 4QHQA 4R9FA 4F3BA 4FEBA 4G68C 3K1PA 1PBQA 4RA1A 2Z22A 2XX8A 4NF6B 5L9OA 4BLAA 4MNPA 4FJPA 2D5WA 3CG3A 3N94A 3QUJA 2O69A 4GXAA 5BUUA 4GVOA 2XWOA 4JVIA 5LOMA 1DBZA 1LLSA 3RYDA 2P2AA 4IB2A 1UIVA 5ICQA 1KWHA 4NF4A 2XXQA 3C4MA 4JVDA 4PFIA 4ELPA 4ELRA 2AYSA 4OVRA 1M5BA 4XXUA 5F24A 5FHNA 2F7AA 5EHSA 4OVQA 4P47A 2BJIA 4RK9A 4HTGA 1I69A 1NV6A 3TZAA 4YB5A 1FPKA 5I59A 3KC1A 5IKBA 5DVIA 3FV2A 5FTHA 3FVOA 4R6YA 2FVZA 3EKIA 4ZS9A 4GX6A 4PF6A 4G8MA 4X04A 1VSOA 5DVFA 1S9TA 2I3WA 1TWYA 3K00A 4H5GA 1JEUA 1FJ9A 3SEYA 3PMWA 1INPA 1OQGA 2W7YA 4PAIA 1SW2A 1ZKBA 4NF5A 2O7UA 2VD3A 3S4UA 3TTLA 4PAKA 3PPNA 3HN0A 2ESNA 3N5LA 4P1EA 4H8IA 3SEVA 4N6DA 3TCGA 4R72A 3RPWA 1B0LA 1Z7NE 1P1UA 4DE8A 1TXFA 2AL4A 5CMKA 2JJKA 1EYKA 4LVQA 2A5SA 3P7IA 1URGA 4MNCA 3V8XB 2FHYA 4G77A 1MXYA 4F2QA 2XXTA 5ITOA 3B8BA 3H4ZA 4FORA 4JWXA 3IR1A 3TTMA 1MM7A 2PFYA 2F7CA 4U4SA 3FJMA 2KR0A 3FD3A 4OA4A 3ILUB 2DWAA 1NUYA 3Q25A 2DE4A 4GOTA 3GLBA 1VDWA 4H0WA 5ET8A 3M3FA 4GWYA 4POWA 2RC7A 1Y3NA 5ICTA 1XVXA 4HXVA 3G3GA 1CNQA 2V3UA 1GTKA 4Q5TA 1O64A 2HZKA 4M4GA 1OIBA 4FATA 1A99A 4BDOA 3THIA 1SW4A 4GX4A 1BIYA 2I3VA 2QRYA 1MH4A 4NX1A 5ET6A 1LBBA 1FPDA 5IZZA 4PP0A 1FSAA 3KOSA 2QMXA 1R6ZA 3QSLA 2REJA 2B65A 4NWCA 3MP8A 4PQJA 4DXCA 5LDZA 2O51A 4KI0E 4OEVA 4BDNA 3EHUA 2D3IA 4BDRA 2E0SA 1B1HA 3RY3A 4ZDMA 4O8MA 3RPLA 4LZ5A 2CZHA 3LC8A 4H8JA 2Q9TA 1QUKA 1MQJA 4LA9A 4I8CA 3U93A 3E13X 5H8HA 1MDQA 3L6GA 2OWSA 3FXQA 1GGGA 3H03A 2Q88A 4X1DA 3ILTB 1IZ1A 2QVRA 3O6HA 2ALUA 1SVXB 1LFHA 4QFLA 1H43A 2LAOA 3UIFA 2VT5A 2M8CA 5DEXB 3V83A 4AB6A 4TOZA 1P1WA 3CHGA 2R6GE 4KYEA 4PBQA 4U2RA 3UORA 2XXKA 3KFMA 2ZZVA 4N17A 3O28A 3RLFE 2OX3A 4P11A 5JTYA 1KA1A 4EXKA 3QXMA 2Q89A 1JETA 1NUWA 2H25A 3IFAA 1B5JA 4IO5A 3FV1A 3GBBA 3EHSA 3FXBA 3N26A 5F7VA 4LUBA 2R9JA 1DTGA 3MQ9A 1USYH 2I6EA 1KZ8A 2F7BA 3PD9A 3G3JA 1LBZA 5TP9A 3KG2A 4F3GA 4ZEDA 2DOJA 5L9SA 5IZ3B 1CB6A 4RNSA 4C1UA 4OVPA 2HAUA 3OEMA 4XTCQ 1LFGA 3N6TA 4G68B 1N0TA 5AA1A 1PB9A 3CG1A 5CRYA 2YJPA 4DI3D 1AMFA 2XWKA 5AA2A 1B3HA 1B3EA 1J1NA 3VVFA 1UTBA 3IK6B 1VE4A 3IOTA 4X48A 2XD2A 5I56B 4F29A 2XXYA 4P1LA 4R6HA 3E9XA 2I48A 1MQHA 3RNNA 1QGXA 4HE0A 1JEVA 5L9MA 1N3XA 1B4HA 1NL5A 4RY1A 3M8UA 4EDPA 1LBVA 5KDTB 2FNCA 3FASA 4RYAA 3K2DA 1B40A 3ZKKA 4JWYA 2V93A 3UGWA 4WEPA 4GLIA 4IO6A 4O3CA 3USDA 3I5OA 2BJJX 3JYRA 4U1OA 3SEXA 4F39A 1FPEA 4BDQA 2IA4A 1JP4A 1IIWA 4WXJA 2NWJA 2WBDA 5TPAB 3VFJA 1A8FA 1LAFE 2Y5LA 4I9DA 1NI9A 2DE2A 1EZOA 4JXIA 1QUIA 1SI1A 4O94A 3QIMA 3TDJA 3MZBA 2DDKA 3TKDA 5AA2D 1Q1KA 5ESYA 1LCTA 3H7MA 1YPNA 1PEBA 4GL8A 4RK2A 1AH5A 1A55A 3SKPA 4ND9A 5AE4A 1IMFA 4GBWA 2P3VA 5CMCA 5B70A 1M5DA 5H8NA 1KA0A 5IZ1A 3KZGA 3U65A 3MYUA 2CZIA 4OHNA 3CIJA 3W9VA 3TYHA 2GQ1A 4UA8A 4F1YA 1UTHA 1NH7A 3GBAA 2RCAA 4PE3A 4KXPA 2PVUA 3OEKA 3U92A 1LBXA 5FHMA 2XXIA 2A5TB 1DPEA 4F1VA 3VE1B 3UP9A 5DT6A 3IB1A 2PT2A 1FQCA 2HPGA 2VGQA 5I2NA 3HCQA 1A8EA 2DWIA 3Q27A 1YXIA 1Y3PA 2HQ0A 4N13A 4IO3A 1Z7ME 1NUZA 3AXFA 5CI5A 4H46A 3PU5A 5I57B 5H8HB 3TCFA 2HFBA 5CBRA 4NHBA 4EXLA 1US5A 4N81A 2ABHA 4PDDA 3C32A 2ZMBA 1EYJA 2DWJA 3G3HA 3SDFA 3G3FA 3F11A 2Y7WA 1LEVA 1MDP1 4MJOA 1NMUA 2GHAA 4KQPA 4HW8A 1RDZA 4YMBA 3KJ7A 4GWUA 3CI8A 4I1DA 4YMAA 1FQEA 4X1BA 5H8FB 2ZYOA 4JVCA 4MX6A 1H3DA 3QAXA 4POXA 3TQWA 1ZIUA 3I6VA 3KN7A 2B4MA 3KC0A 4BDLA 2F34A 1G0HA 4PF8A 3VVDA 1JW5A 1MY0A 1F9BA 2VOZA 4WEDA 5I3SA 4XKNA 5I5PA 5EQAA 1ZTYA 4R2FA 1BK4A 3CFXA 1PB7A 1NKXA 1S7YA 4LZ8A 2HXRA 1FBFA 1FTAA 4JWOA 5I7IA 4JB7A 2DE3A 1MS7A 2V84A 4F3SA 2E1SA 1AOVA 2V25A 2QFLA 4MMPA 1FTKA 3FVGA 3E4RA 3IB2A 3KN8A 2RC9A 3PUVE 3KGCA 1LAGE 1EZ9A 1AL3A 2WKYA 2KLFA 3B6QA 3MP6A 2GRVA 5ITPA 3MPLA 3Q28A 1WDNA 4ZEKA 2ZXTA 4F19A 1VFEA 3O66A 3VXBA 4AQ4A 4OFLA 2R8TA 2DQVA 4H6DA 1NNTA 4GIZA 4OMBA 5EQ7A 3DP4A 4PE5B 1D9QA 4L17A 4R74A 3O2AA 3S9NC 3ONMA 3FATA 2O68A 5L8DA 1MXXA 4N8YA 4C1TA 1MRPA 4EUOA 4P9KA 3MVWA 4OQOA 1L5TA 1B3FA 1USYE 2X7QA 4G4PA 1DMBA 5M2VA 1K9ZA 1FQBA 1UQWA 3TTKA 3C35A 4ONYA 2CEYA 4RPOA 3O29A 3O97A 3OO6A 4DCYA 3FVKA 1NUXA 4ZEBA 3FXUA 1MXZA 1G0IA 1XI6A 1B32A 3TCHA 4NGUA 5AA4B 1A40A 3VV5A 1IMAA 3PUZE 3IJOB 1B7HA 4PBHA 2FIEA 5I58B 1N04A 5FTIA 2PFZA 2H98A 2ZNTA 1B2HA 1EYIA 4X8RA 5HPQA 3FBPA 3N6UA 3C34A 1LGBC 2OZZA 4QF9A 3K6WA 1Y1ZA 1IMEA 4DCXA 3BKIB 1FTJA 4H45A 4ZEFA 4N15A 4UACA 2ONSA 1EH3A 4Q0CA 2QS4A 3KJTA 4QXDA 3ODBA 4DXUA 2ONKE 1NNPA 3OXNA 1Y4CA 5EYFA 3HO7A 4O7IA 4PDHA 1B46A 1NV5A 4OETA 2NOOA 1B3LA 1NV0A 4KCCA 3FGSA 4ELQA 2Y5KA 3IJXB 4U22A 4F2OA 3A29A 1MPBA 1IMDA 4GWOA 1FTOA 3GZGA 4JSOA 3ROJA 4YB6A 1RYOA 1GV8A 2B3FA 3KBRA 4OVTA 3PGFA 5KZTA 3BIHA 4P3LA 4ZECA 3RT8A 5IGAA 1CE2A 1LAHE 1SYHA 3K1MA 3EQ1A 2QMWA 3C31A 2P0SA 4NF8A 3E79A 2Y7PA 5H8QB 1SI0A 2B4LA 3VLUA 1FBCA 2XXHA 1B7UA 4QFKA 5AA3A 1MM6A 5DVJA 2WBBA 1MY3A 1MY2A 4DLDA 4HE2A 3OENA 3MWBA 1I6QA 3QMFA 3DM0A 3H6TA 2G93A 1LAXA 4OESA 1FW0A 1PDAA 1FPJA 4OEUA 3MUQA 3CFLA 4MF3A 5CMMA 1QVSA 3OSRA 3TPAA 3IORA 2XXXA 3PD8A 3U94A 1DTZA 2XX7A 1TT1A 3HHFA 4NF4B 3MJNA 3K02A 4R73A 2FIXA 4P56A 4LN5A 3W15C 3MAMA 2GFEA 3PPOA 3R26A 3RGYA 5HBCA 4GL0A 2Y84A 2QS2A 1M5FA 2R71A 2H4IA 3K1NA 4O7MA 5KCJA 4P8BA 5CMBA 2HCAA 2ZYKA 1MY1A 5I59B 3U8QA 3WAFA 1JNFA 4GWSA 1BTJA 2P3NA 2QJEA 4IO4A 2F97A 5K2YA 4JDFA 4KYDA 2QPQA 5I2KA 3OO8A 4G61A 3KOTA 3EHTA 2MKZA 3D1RA 3H6UA 2QVUA 4OVSA 4YZZA 3K0VA 4NF5B 3PUWE 3IFCA 4H1XA 4U23A 4G8NA 3FJ7A 1IITA 2Z8EA 3C33A 3TAJA 2H99A 1N7WA 2WEFA 1B9JA 3MZ1A 3S2VA 1NNFA 4HCWA 5FHOA 1PBPA 3PMXA 1MH3A 3H3GA 4TLLB 1IXHA 3A09A 3FUZA 5CM6A 2UVHA 4XFEA 4Z7EA 2DP8A 1FQFA 1OVBA 5F1QA 4LONB 3T22A 1LB9A 2I4BA 2F8DA 1B6HA 1FBHA 1HSLA 2REGA 5H8SA 1Y20A 2Y7RA 4ELOA 1DCUA 4H67A 2OLBA 4NWDA 4IY6A 2AL5A 4H5FA 1B51A 4DDDA 1DK4A 1ZMGA 2G29A 3CSBA 3I3VA 1NNKA 4HE1A 2UVJA 3HV1A 1GR2A 4GFRA 1POY1 4N4UA 1N3WA 2DXRA 2WYKA 2GH9A 1R9LA 3LSLA 1FBGA 2I0CA 3RN8A 4Q8RA 1FBPA 4R6KA 3MPKA 3ZS6A 1R1NA 3IAZA 4DZ1A 2XD3A 3LV0A 3RUMA 4EF1A 4RPNA 3RPLB 3C9HA 1YAEA 4IGRA 1RKMA 3O6GA 1B5IA 2F6GA 4LZ7A 3T1BA 3BBRA 4OTEA 2FYIA 1BKAA 3PPRA 3SEUA 1Q35A 4NTLA 2CEXA 4R75A 2X7PA 3MVXA 2OJTA 2CZKA 4EF2A 4FE8A 2X26A 4Q30B 2UYFA 4EQBA 3UK4A 1NV3A 4MEVA 3C36A 1QJMA 1QULA 1UIUA 1B52A 4IR8A 2ZZWA 1FPFA 2XWVA 3MBPA 2V3TA 4IY5A 1II5A 3OELA 5JTYB 2NVUB 4GWWA 3KN3A 3OO9A 1D3KA 4G8HA 3S9LC 3VXCA 1JW1A 2RF1A 4YKJA 1PC3A 1TFDA 1SDXA 1EZPA 2O1LA 4QFOA 5TP9B 4OWDA 1R9QA 4QSDA 2ONRA 2Z8DA 3T96B 2O7IA 5TU0A 4F31B 1I6AA 4C0RA 1B3GA 4XEQA 3K6UA 1LBCA 4OENA 3OO7A 2DSFA 4OFJA 3KBZA 1VR5A 1FPIA 4ZE8A 2NXOA 4MLQA 4YKPA 2QSXA 1P1NA 2XXWA 4IO7A 5AA2B 2HAVA 3MC2A 1YZ0A 1K9YA 4ESXA 1UTBB 4FEDA 2V4CA 2I4CA 1MPCA 1Y3QA 3CRBA 1O63A 3S9EA 4P0GA 4MCOA 3JV9A 5B7DA 5I84A 4R2BA 3HHGA 4I3EA 4ZZAA 3IOWA 3MZ9A 1QKBA 2HZLA 3RT6B 4FIMA 4NF0A 1B5HA 5DEXA 4PCDA 1Y9UA 2DS9A 4PFUA 1JW4A 3U72A 2DYXA 4QBAA 1D9VA 3SZPA 4F1UA 3PUYE 4JSDA 2F35A 4E0WA 2B3BA 4OVJA 3VLWA 1Y1MA 3S9MC 3SEWA 1FBEA 1FTMA 1OQHA 3MP1A 4GWXA 2D21A 3IO6A 2PYYA 1ANFA 2UVIA 3E78A 1P99A 2XWIA 1IUDA 5H8NB 1IXGA 2XXUA 3PPQA 2VPOA 5IZ3A 5A5XA 1SQYA 3D4CA 4TLMB 2Q2CA 5JEIA 2QS3A 3G7WA 3LUYA 4N07A 4YICA 1TFAA 4OFOA 3UN6A 4PFRA 4GXSB 1UTHB 2IEEA 4PFYA 4PGNA 3D4GA 2VD2A 4G68A 1WVJA 3HSTA 1RDXA 4YU0A 1MY4A 1ZLQA 1QKAA 3MW0A 2XHDA 2ZZXA 4BDMA 5I2NB 1B0HA 4MHFA 4LQ5A 5ISUA 2CMOA 4OZ9A 1H44A 5I56A 4HCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ8 A;  4IO2 A;  1D4N A;  3T66 A;  1SD3 A;  3SET A;  4MH5 A;  2Y7K A;  4ISU A;  3L6H A;  2PT1 A;  2XXP A;  3T9U A;  3T93 B;  3A3U A;  4DIG A;  5EHM A;  4O3B A;  3W9W A;  5IM2 A;  5KDT A;  3IX1 A;  1N7X A;  2ZYN A;  3KEI A;  4KR5 A;  2P1S A;  1S50 A;  5TPA A;  2OK2 A;  3TEP A;  2ANJ A;  4HS7 A;  1MXV A;  4YKI A;  4U1Z A;  1FQD A;  2F36 A;  3OMB A;  3TUS A;  1QUJ A;  3T9H B;  4WKM A;  2I0B A;  4DI4 B;  1LB8 A;  1ELJ A;  3LBS A;  2RKM A;  1XHY A;  1XT8 A;  3OD7 A;  1Y4T A;  4RJZ A;  3O9P A;  1MQD A;  3LR1 A;  3PUX E;  3G3K A;  3SES A;  2UVG A;  3PMV A;  4MBP A;  3OOA A;  4NAP A;  3JZJ A;  3A3C A;  3B50 A;  1SYI A;  2RC8 A;  3B6T A;  4F22 A;  2HEU A;  3LSF B;  2DXY A;  3K6V A;  3BFT A;  4QSE A;  1SW5 A;  3T9X B;  1AIV A;  5CC2 A;  4OXV A;  1D9Y A;  1BP5 A;  3VLV A;  2WX9 A;  2XXR A;  2A5T A;  4KYS A;  3M3K A;  1FQA A;  3QK6 A;  3RTW B;  2XX9 A;  4MIJ A;  3VVE A;  1URD A;  3CVG A;  2H9B A;  3TQL A;  1OLC A;  3G3I A;  3IO4 A;  2RCB A;  3GXA A;  4NN3 A;  3TEL A;  1I6B A;  5I57 A;  2V3Q A;  3M3L A;  5JK4 A;  3MVZ A;  4PET A;  1URS A;  4O3A A;  4ZEI A;  1WOD A;  1RYX A;  2O84 X;  4LP2 B;  4PAF A;  4G2Z A;  1ZU0 A;  3QYT A;  1IXI A;  4EQ7 A;  1H76 A;  4PFT A;  1LFI A;  3T9V A;  1OLA A;  1B7Z A;  4ZE9 A;  5DYH A;  2I49 A;  3FIR A;  5CBS A;  1JVX A;  3PPP A;  5K2X A;  2YLN A;  4F18 A;  4X9T A;  2ZYM A;  3K4U A;  2ZNS A;  1MQG A;  4U4X A;  4N6K A;  4XKP A;  4MNI A;  4N91 A;  3MVY A;  1B4Z A;  1VFD A;  2Z8F A;  5H8F A;  3B7D A;  4PFW A;  1B58 A;  2PBW A;  1P1Q A;  4EQ9 A;  1HSJ A;  3GYY A;  2I58 A;  4Z0I A;  4THI A;  2ZNU A;  1B1X A;  4OER A;  5A5X B;  1H45 A;  5BWJ A;  3UA8 A;  4LAT A;  3ZSF A;  3H6V A;  1IQ7 A;  4KFQ A;  2Z23 A;  3H6W A;  3EF7 A;  4GD5 A;  2F6P A;  4RXL A;  3FVN A;  1A54 A;  4PGP A;  1NFT A;  2PMS A;  4XIG Q;  1OMP A;  1DPP A;  3IB0 A;  4XF5 A;  2OCU A;  1GVC A;  1US4 A;  5HM4 B;  2UXA A;  1B05 A;  3IL1 B;  2THI A;  3K6X A;  3DP6 A;  3IOU A;  4NED A;  3IOV A;  4NF6 A;  3Q26 A;  4YB7 A;  2NUV A;  1ZJL A;  2YPN A;  3FJG A;  4H65 A;  4MLV A;  3FZV A;  2H5Y A;  4FEC A;  4M1V A;  1MG1 A;  1N84 A;  4TQU Q;  1ZBM A;  3E3K A;  3LSX A;  1ATG A;  4ECF A;  3CSG A;  5DTB A;  4IGT A;  4XKR A;  3KSX A;  4QSC A;  1N76 A;  2QS1 A;  4KHZ E;  2CZL A;  4PFB A;  3O6I A;  2Q2A A;  2F78 A;  4KD5 A;  3TFL A;  3ECR A;  4P0I A;  2FA7 A;  1P1O A;  4YKK A;  4NMY A;  2PX1 A;  4F3P A;  4ESW A;  2O1M A;  2UYE A;  4MAG A;  4UAB A;  2VPN A;  1YTV A;  1O7T A;  1QW0 A;  1MPD A;  1SW1 A;  4QRZ A;  2OWT A;  1FCK A;  4PC9 A;  4XKQ A;  3TOD A;  3HPI A;  3DEL B;  2OBG A;  1M5C A;  2XA5 A;  4QFP A;  3RQT A;  1IXC A;  4DXB A;  2GHB A;  2WYP A;  1SBP A;  3EN3 A;  1JQF A;  5IAI A;  1XOC A;  3TTR A;  4NF8 B;  4YAH X;  3BFU A;  4E0X A;  1XS5 A;  1MXW A;  4JBZ A;  1IEJ A;  4OYV A;  2VHA A;  5AA4 A;  3KSJ A;  3WAE A;  3DLN A;  4MFI A;  4I62 A;  5I58 A;  3U1O A;  2F5X A;  5LTC A;  3R6U A;  4LQ2 A;  4GF8 A;  2AIX A;  1DSN A;  4N8G A;  3V5A A;  1MXU A;  1MQI A;  2Q8J A;  3RTF B;  2Y7I A;  3DP8 A;  1HSE A;  3PV0 E;  1PB8 A;  4NG7 A;  3B6W A;  4K3F A;  4N6P A;  3V89 B;  4QFN A;  1XVY A;  3EPE A;  3CFZ A;  1A7L A;  2DVC A;  4ZZE A;  2VP1 A;  3R7X A;  1XC1 A;  3TMG A;  2DVZ A;  2HXW A;  5KCJ B;  2XXV A;  4R9G A;  3H06 B;  1YCJ A;  1LST A;  2O6A A;  1LCF A;  3OSQ A;  3LSW A;  4NE4 A;  4U21 A;  2QL3 A;  1JVY A;  5I2K B;  1BLF A;  3FXR A;  1DOT A;  4OAN A;  4AB5 A;  1EU8 A;  1POT A;  1NH8 A;  1T0K A;  3Q29 A;  3TTN A;  1M5E A;  3ZKL A;  3VDF A;  5ELV A;  3QUF A;  1OVT A;  3CR9 A;  4KPT A;  1FTL A;  2DWH A;  5H8Q A;  3SER A;  4GRK A;  2RIN A;  4FAJ A;  3K01 A;  4KCD A;  5J1D A;  4GQO A;  4QHQ A;  4R9F A;  4F3B A;  4FEB A;  4G68 C;  3K1P A;  1PBQ A;  4RA1 A;  2Z22 A;  2XX8 A;  4NF6 B;  5L9O A;  4BLA A;  4MNP A;  4FJP A;  2D5W A;  3CG3 A;  3N94 A;  3QUJ A;  2O69 A;  4GXA A;  5BUU A;  4GVO A;  2XWO A;  5LOM A;  1LLS A;  2P2A A;  4IB2 A;  1UIV A;  5ICQ A;  1KWH A;  4NF4 A;  2XXQ A;  3C4M A;  4PFI A;  4ELP A;  4ELR A;  2AYS A;  4OVR A;  1M5B A;  4XXU A;  5FHN A;  2F7A A;  5EHS A;  4OVQ A;  4P47 A;  4RK9 A;  4HTG A;  1I69 A;  3TZA A;  4YB5 A;  5I59 A;  5IKB A;  5DVI A;  3FV2 A;  5FTH A;  3FVO A;  4R6Y A;  4ZS9 A;  4PF6 A;  4G8M A;  4X04 A;  1VSO A;  5DVF A;  1S9T A;  2I3W A;  1TWY A;  3K00 A;  4H5G A;  1JEU A;  3SEY A;  3PMW A;  1OQG A;  2W7Y A;  4PAI A;  1SW2 A;  1ZKB A;  4NF5 A;  2O7U A;  2VD3 A;  3S4U A;  3TTL A;  4PAK A;  3PPN A;  3HN0 A;  2ESN A;  3N5L A;  4P1E A;  4H8I A;  3SEV A;  4N6D A;  3TCG A;  4R72 A;  3RPW A;  1B0L A;  1Z7N E;  1P1U A;  4DE8 A;  1TXF A;  2AL4 A;  5CMK A;  4LVQ A;  2A5S A;  3P7I A;  1URG A;  4MNC A;  3V8X B;  4G77 A;  1MXY A;  4F2Q A;  2XXT A;  5ITO A;  3H4Z A;  4FOR A;  4JWX A;  3IR1 A;  3TTM A;  1MM7 A;  2PFY A;  2F7C A;  4U4S A;  3FJM A;  3FD3 A;  4OA4 A;  3ILU B;  2DWA A;  3Q25 A;  2DE4 A;  4GOT A;  3GLB A;  4H0W A;  3M3F A;  4POW A;  2RC7 A;  1Y3N A;  5ICT A;  1XVX A;  3G3G A;  2V3U A;  1GTK A;  4Q5T A;  1O64 A;  2HZK A;  4M4G A;  1OIB A;  4FAT A;  1A99 A;  4BDO A;  3THI A;  1SW4 A;  1BIY A;  2I3V A;  2QRY A;  1MH4 A;  4NX1 A;  1LBB A;  5IZZ A;  4PP0 A;  3KOS A;  2QMX A;  1R6Z A;  3QSL A;  2REJ A;  2B65 A;  4NWC A;  3MP8 A;  4PQJ A;  4DXC A;  2O51 A;  4KI0 E;  4OEV A;  4BDN A;  3EHU A;  2D3I A;  4BDR A;  2E0S A;  1B1H A;  3RY3 A;  4ZDM A;  4O8M A;  4LZ5 A;  3LC8 A;  4H8J A;  2Q9T A;  1QUK A;  1MQJ A;  4LA9 A;  4I8C A;  3U93 A;  3E13 X;  5H8H A;  1MDQ A;  3L6G A;  2OWS A;  3FXQ A;  1GGG A;  3H03 A;  2Q88 A;  4X1D A;  3ILT B;  1IZ1 A;  3O6H A;  2ALU A;  1SVX B;  1LFH A;  4QFL A;  1H43 A;  2LAO A;  3UIF A;  2M8C A;  5DEX B;  3V83 A;  4AB6 A;  4TOZ A;  1P1W A;  2R6G E;  4KYE A;  4PBQ A;  4U2R A;  3UOR A;  2XXK A;  3KFM A;  2ZZV A;  4N17 A;  3O28 A;  3RLF E;  4P11 A;  5JTY A;  4EXK A;  3QXM A;  2Q89 A;  1JET A;  2H25 A;  1B5J A;  4IO5 A;  3FV1 A;  3GBB A;  3EHS A;  3FXB A;  3N26 A;  5F7V A;  4LUB A;  2R9J A;  1DTG A;  3MQ9 A;  1USY H;  2I6E A;  2F7B A;  3PD9 A;  3G3J A;  5TP9 A;  3KG2 A;  4F3G A;  4ZED A;  2DOJ A;  5L9S A;  1CB6 A;  4RNS A;  4C1U A;  4OVP A;  2HAU A;  3OEM A;  4XTC Q;  1LFG A;  3N6T A;  4G68 B;  1N0T A;  5AA1 A;  1PB9 A;  3CG1 A;  5CRY A;  2YJP A;  4DI3 D;  1AMF A;  2XWK A;  5AA2 A;  1B3H A;  1B3E A;  1J1N A;  3VVF A;  1UTB A;  3IK6 B;  1VE4 A;  3IOT A;  4X48 A;  2XD2 A;  5I56 B;  4F29 A;  2XXY A;  4P1L A;  4R6H A;  3E9X A;  2I48 A;  1MQH A;  3RNN A;  1JEV A;  5L9M A;  1N3X A;  1B4H A;  1NL5 A;  4RY1 A;  3M8U A;  4EDP A;  5KDT B;  2FNC A;  3FAS A;  4RYA A;  3K2D A;  1B40 A;  3ZKK A;  4JWY A;  2V93 A;  3UGW A;  4WEP A;  4GLI A;  4IO6 A;  4O3C A;  3USD A;  3I5O A;  2BJJ X;  3JYR A;  4U1O A;  3SEX A;  4F39 A;  4BDQ A;  2IA4 A;  1IIW A;  4WXJ A;  2NWJ A;  5TPA B;  3VFJ A;  1A8F A;  1LAF E;  4I9D A;  2DE2 A;  1EZO A;  4JXI A;  1QUI A;  1SI1 A;  4O94 A;  3QIM A;  3TDJ A;  3MZB A;  3TKD A;  5AA2 D;  1Q1K A;  1LCT A;  3H7M A;  1YPN A;  1PEB A;  4GL8 A;  4RK2 A;  1AH5 A;  1A55 A;  3SKP A;  4ND9 A;  5AE4 A;  5CMC A;  5B70 A;  1M5D A;  5H8N A;  3KZG A;  3U65 A;  4OHN A;  3CIJ A;  3W9V A;  3TYH A;  4UA8 A;  4F1Y A;  1UTH A;  1NH7 A;  3GBA A;  2RCA A;  4PE3 A;  2PVU A;  3OEK A;  3U92 A;  5FHM A;  2XXI A;  2A5T B;  1DPE A;  4F1V A;  3VE1 B;  3UP9 A;  5DT6 A;  3IB1 A;  2PT2 A;  1FQC A;  2HPG A;  2VGQ A;  5I2N A;  3HCQ A;  1A8E A;  2DWI A;  3Q27 A;  1Y3P A;  2HQ0 A;  4N13 A;  4IO3 A;  1Z7M E;  3AXF A;  5CI5 A;  3PU5 A;  5I57 B;  5H8H B;  3TCF A;  2HFB A;  5CBR A;  4NHB A;  4EXL A;  1US5 A;  2ABH A;  4PDD A;  3C32 A;  2ZMB A;  2DWJ A;  3G3H A;  3SDF A;  3G3F A;  3F11 A;  2Y7W A;  1MDP 1;  1NMU A;  2GHA A;  4KQP A;  4HW8 A;  4YMB A;  3KJ7 A;  3CI8 A;  4I1D A;  4YMA A;  1FQE A;  4X1B A;  5H8F B;  2ZYO A;  4MX6 A;  1H3D A;  3QAX A;  4POX A;  3TQW A;  1ZIU A;  3I6V A;  3KN7 A;  4BDL A;  2F34 A;  4PF8 A;  3VVD A;  1JW5 A;  1MY0 A;  1F9B A;  2VOZ A;  4WED A;  4XKN A;  5I5P A;  1ZTY A;  4R2F A;  3CFX A;  1PB7 A;  1NKX A;  1S7Y A;  4LZ8 A;  4JWO A;  5I7I A;  4JB7 A;  2DE3 A;  1MS7 A;  2V84 A;  4F3S A;  2E1S A;  1AOV A;  2V25 A;  4MMP A;  1FTK A;  3FVG A;  3E4R A;  3IB2 A;  3KN8 A;  2RC9 A;  3PUV E;  3KGC A;  1LAG E;  1EZ9 A;  1AL3 A;  2WKY A;  2KLF A;  3B6Q A;  3MP6 A;  2GRV A;  5ITP A;  3MPL A;  3Q28 A;  1WDN A;  4ZEK A;  2ZXT A;  4F19 A;  1VFE A;  3O66 A;  3VXB A;  4AQ4 A;  4OFL A;  2DQV A;  4H6D A;  1NNT A;  4GIZ A;  4OMB A;  3DP4 A;  4PE5 B;  4L17 A;  4R74 A;  3O2A A;  3S9N C;  3ONM A;  3FAT A;  2O68 A;  5L8D A;  1MXX A;  4N8Y A;  4C1T A;  1MRP A;  4EUO A;  4P9K A;  3MVW A;  4OQO A;  1L5T A;  1B3F A;  1USY E;  2X7Q A;  4G4P A;  1DMB A;  5M2V A;  1FQB A;  1UQW A;  3TTK A;  3C35 A;  4ONY A;  2CEY A;  4RPO A;  3O29 A;  3O97 A;  3OO6 A;  4DCY A;  3FVK A;  4ZEB A;  3FXU A;  1MXZ A;  1B32 A;  3TCH A;  4NGU A;  5AA4 B;  1A40 A;  3VV5 A;  3PUZ E;  3IJO B;  1B7H A;  4PBH A;  5I58 B;  1N04 A;  5FTI A;  2PFZ A;  2H98 A;  2ZNT A;  1B2H A;  4X8R A;  5HPQ A;  3N6U A;  3C34 A;  1LGB C;  2OZZ A;  4QF9 A;  3K6W A;  1Y1Z A;  4DCX A;  3BKI B;  1FTJ A;  4ZEF A;  4N15 A;  4UAC A;  2ONS A;  1EH3 A;  4Q0C A;  2QS4 A;  3KJT A;  3ODB A;  4DXU A;  2ONK E;  1NNP A;  3OXN A;  1Y4C A;  5EYF A;  3HO7 A;  4PDH A;  1B46 A;  4OET A;  2NOO A;  1B3L A;  4KCC A;  3FGS A;  4ELQ A;  3IJX B;  4U22 A;  4F2O A;  1MPB A;  4GWO A;  1FTO A;  3GZG A;  4JSO A;  4YB6 A;  1RYO A;  1GV8 A;  2B3F A;  3KBR A;  4OVT A;  3PGF A;  5KZT A;  4P3L A;  4ZEC A;  3RT8 A;  5IGA A;  1CE2 A;  1LAH E;  1SYH A;  3K1M A;  3EQ1 A;  2QMW A;  3C31 A;  2P0S A;  4NF8 A;  2Y7P A;  5H8Q B;  1SI0 A;  3VLU A;  2XXH A;  1B7U A;  4QFK A;  5AA3 A;  1MM6 A;  5DVJ A;  1MY3 A;  1MY2 A;  4DLD A;  3OEN A;  3MWB A;  1I6Q A;  3DM0 A;  3H6T A;  2G93 A;  1LAX A;  4OES A;  1FW0 A;  1PDA A;  4OEU A;  3MUQ A;  3CFL A;  4MF3 A;  5CMM A;  1QVS A;  3OSR A;  3TPA A;  3IOR A;  2XXX A;  3PD8 A;  3U94 A;  1DTZ A;  2XX7 A;  1TT1 A;  3HHF A;  4NF4 B;  3MJN A;  3K02 A;  4R73 A;  4P56 A;  4LN5 A;  3W15 C;  3MAM A;  2GFE A;  3PPO A;  3R26 A;  3RGY A;  5HBC A;  4GL0 A;  2Y84 A;  2QS2 A;  1M5F A;  2R71 A;  2H4I A;  3K1N A;  4O7M A;  5KCJ A;  4P8B A;  5CMB A;  2HCA A;  2ZYK A;  1MY1 A;  5I59 B;  3U8Q A;  3WAF A;  1JNF A;  1BTJ A;  2QJE A;  4IO4 A;  2F97 A;  5K2Y A;  4JDF A;  4KYD A;  2QPQ A;  5I2K A;  3OO8 A;  3KOT A;  3EHT A;  3H6U A;  4OVS A;  4YZZ A;  3K0V A;  4NF5 B;  3PUW E;  4H1X A;  4U23 A;  4G8N A;  3FJ7 A;  1IIT A;  2Z8E A;  3C33 A;  3TAJ A;  2H99 A;  1N7W A;  1B9J A;  3MZ1 A;  3S2V A;  1NNF A;  4HCW A;  5FHO A;  1PBP A;  3PMX A;  1MH3 A;  3H3G A;  4TLL B;  1IXH A;  3A09 A;  3FUZ A;  5CM6 A;  2UVH A;  4XFE A;  4Z7E A;  2DP8 A;  1FQF A;  1OVB A;  5F1Q A;  4LON B;  3T22 A;  1LB9 A;  2I4B A;  2F8D A;  1B6H A;  1HSL A;  2REG A;  5H8S A;  1Y20 A;  2Y7R A;  4ELO A;  4H67 A;  2OLB A;  4NWD A;  4IY6 A;  2AL5 A;  4H5F A;  1B51 A;  4DDD A;  1ZMG A;  2G29 A;  3CSB A;  3I3V A;  1NNK A;  2UVJ A;  3HV1 A;  1GR2 A;  4GFR A;  1POY 1;  4N4U A;  1N3W A;  2DXR A;  2WYK A;  2GH9 A;  1R9L A;  3LSL A;  2I0C A;  3RN8 A;  4Q8R A;  4R6K A;  3MPK A;  3ZS6 A;  1R1N A;  3IAZ A;  4DZ1 A;  2XD3 A;  3RUM A;  4EF1 A;  4RPN A;  3C9H A;  1YAE A;  4IGR A;  1RKM A;  3O6G A;  1B5I A;  2F6G A;  4LZ7 A;  3BBR A;  4OTE A;  2FYI A;  1BKA A;  3PPR A;  3SEU A;  1Q35 A;  4NTL A;  2CEX A;  4R75 A;  2X7P A;  3MVX A;  2OJT A;  4EF2 A;  4FE8 A;  2X26 A;  4Q30 B;  2UYF A;  4EQB A;  3UK4 A;  4MEV A;  3C36 A;  1QJM A;  1QUL A;  1UIU A;  1B52 A;  2ZZW A;  2XWV A;  3MBP A;  2V3T A;  4IY5 A;  1II5 A;  3OEL A;  5JTY B;  2NVU B;  3KN3 A;  3OO9 A;  1D3K A;  4G8H A;  3S9L C;  3VXC A;  1JW1 A;  2RF1 A;  4YKJ A;  1PC3 A;  1TFD A;  1SDX A;  1EZP A;  2O1L A;  4QFO A;  5TP9 B;  4OWD A;  1R9Q A;  4QSD A;  2ONR A;  2Z8D A;  3T96 B;  2O7I A;  5TU0 A;  4F31 B;  1I6A A;  4C0R A;  1B3G A;  4XEQ A;  3K6U A;  1LBC A;  4OEN A;  3OO7 A;  2DSF A;  4OFJ A;  1VR5 A;  4ZE8 A;  2NXO A;  4MLQ A;  4YKP A;  2QSX A;  1P1N A;  2XXW A;  4IO7 A;  5AA2 B;  2HAV A;  3MC2 A;  4ESX A;  1UTB B;  4FED A;  2V4C A;  2I4C A;  1MPC A;  1Y3Q A;  3CRB A;  1O63 A;  3S9E A;  4P0G A;  4MCO A;  3JV9 A;  5B7D A;  5I84 A;  4R2B A;  3HHG A;  4ZZA A;  3IOW A;  3MZ9 A;  1QKB A;  2HZL A;  3RT6 B;  4FIM A;  4NF0 A;  1B5H A;  5DEX A;  4PCD A;  1Y9U A;  2DS9 A;  4PFU A;  1JW4 A;  3U72 A;  2DYX A;  1D9V A;  4F1U A;  3PUY E;  4JSD A;  2F35 A;  4E0W A;  2B3B A;  4OVJ A;  3VLW A;  1Y1M A;  3S9M C;  3SEW A;  1FTM A;  1OQH A;  3MP1 A;  2D21 A;  3IO6 A;  2PYY A;  1ANF A;  2UVI A;  1P99 A;  2XWI A;  1IUD A;  5H8N B;  1IXG A;  2XXU A;  3PPQ A;  2VPO A;  5A5X A;  1SQY A;  3D4C A;  4TLM B;  2Q2C A;  5JEI A;  2QS3 A;  3G7W A;  3LUY A;  4N07 A;  4YIC A;  1TFA A;  4OFO A;  3UN6 A;  4PFR A;  4GXS B;  1UTH B;  2IEE A;  4PFY A;  4PGN A;  3D4G A;  2VD2 A;  4G68 A;  1WVJ A;  3HST A;  4YU0 A;  1MY4 A;  1ZLQ A;  1QKA A;  3MW0 A;  2XHD A;  2ZZX A;  4BDM A;  5I2N B;  1B0H A;  4MHF A;  4LQ5 A;  5ISU A;  2CMO A;  4OZ9 A;  1H44 A;  5I56 A;  4HCY A; 
#chains in the Genus database with same CATH topology
 1IMC A;  4NQ8 A;  4IO2 A;  1D4N A;  1FJ6 A;  3T66 A;  1SD3 A;  3SET A;  4MH5 A;  2Y7K A;  4I40 A;  4ISU A;  3HFU A;  3L6H A;  2PT1 A;  2XXP A;  3T9U A;  3T93 B;  3A3U A;  4DIG A;  5EHM A;  4O3B A;  3W9W A;  5IM2 A;  3BIG A;  1NV1 A;  5ET5 A;  5KDT A;  3IX1 A;  1N7X A;  2ZYN A;  3KEI A;  1SPI A;  4KR5 A;  2P1S A;  1S50 A;  5TPA A;  2OK2 A;  3TEP A;  2ANJ A;  4HS7 A;  5DW8 A;  1MXV A;  4YKI A;  4U1Z A;  1FQD A;  2F36 A;  3OMB A;  3TUS A;  1QUJ A;  3T9H B;  4WKM A;  2I0B A;  4DI4 B;  2OWZ A;  1LB8 A;  1ELJ A;  3LBS A;  2RKM A;  1XHY A;  1XT8 A;  3OD7 A;  1Y4T A;  4RJZ A;  3O9P A;  1MQD A;  3LR1 A;  4GWZ A;  3PUX E;  3G3K A;  3SES A;  2UVG A;  3ISP A;  3PMV A;  1NV2 A;  3LUZ A;  4MBP A;  1LBW A;  3OOA A;  4NAP A;  2HHM A;  3JZJ A;  3A3C A;  3B50 A;  1SYI A;  2RC8 A;  3B6T A;  2HEU A;  3LSF B;  4QSE A;  2DXY A;  3K6V A;  3BFT A;  3T9X B;  1SW5 A;  4F22 A;  1AIV A;  5CC2 A;  4OXV A;  1D9Y A;  1BP5 A;  3VLV A;  1FPL A;  2WX9 A;  2XXR A;  2A5T A;  4KYS A;  3M3K A;  5EQ8 A;  1FQA A;  3QK6 A;  3RTW B;  2QVV A;  2XX9 A;  4MIJ A;  3VVE A;  5EYG A;  1URD A;  3CVG A;  2H9B A;  3TQL A;  1OLC A;  3G3I A;  3IO4 A;  4PTK A;  2RCB A;  3GXA A;  4NN3 A;  3TEL A;  1I6B A;  5I57 A;  2V3Q A;  3M3L A;  5JK4 A;  3MVZ A;  4PET A;  1URS A;  4O3A A;  4ZEI A;  1WOD A;  3MST A;  1RYX A;  2O84 X;  4LP2 B;  4PAF A;  4G2Z A;  1ZU0 A;  3QYT A;  1IXI A;  4EQ7 A;  1H76 A;  4PFT A;  1LFI A;  3T9V A;  1OLA A;  1B7Z A;  4ZE9 A;  5DYH A;  5EQ9 A;  2I49 A;  3FIR A;  5CBS A;  1JVX A;  3PPP A;  5K2X A;  2YLN A;  4F18 A;  4X9T A;  2ZYM A;  3K4U A;  1Q9D A;  2ZNS A;  1MQG A;  4N6K A;  4U4X A;  4MNI A;  4XKP A;  4N91 A;  2Q8M A;  3MVY A;  1B4Z A;  1VFD A;  2Z8F A;  5H8F A;  3B7D A;  4PFW A;  1B58 A;  2PBW A;  1P1Q A;  4EQ9 A;  5A5L A;  1HSJ A;  1RDY A;  3GYY A;  2I58 A;  4Z0I A;  4THI A;  2ZNU A;  1B1X A;  2L5V A;  4OER A;  5A5X B;  4GBV A;  1H45 A;  5BWJ A;  3UA8 A;  4LAT A;  3ZSF A;  3H6V A;  1IQ7 A;  4KFQ A;  2Z23 A;  3H6W A;  3EF7 A;  4GD5 A;  2F6P A;  3T0J A;  4RXL A;  3FVN A;  1A54 A;  4PGP A;  1NFT A;  2PMS A;  4XIG Q;  1OMP A;  1NV7 A;  3NOH A;  1DPP A;  3IB0 A;  4XF5 A;  2OCU A;  1LBY A;  1GVC A;  1US4 A;  5HM4 B;  2UXA A;  1B05 A;  4GX3 A;  3IL1 B;  2THI A;  3K6X A;  3DP6 A;  3IOU A;  4NED A;  3IOV A;  1AWB A;  4NF6 A;  3Q26 A;  4YB7 A;  2NUV A;  1ZJL A;  2YPN A;  3FJG A;  4H65 A;  4MLV A;  1NV4 A;  2PCR A;  3FZV A;  2H5Y A;  4FEC A;  4M1V A;  1MG1 A;  1N84 A;  4TQU Q;  1ZBM A;  2KQZ A;  3E3K A;  3LSX A;  1ATG A;  4ECF A;  3CSG A;  5DTB A;  2FBP A;  4IGT A;  4XKR A;  3KSX A;  4QSC A;  1N76 A;  2QS1 A;  4KHZ E;  2CZL A;  4PFB A;  3O6I A;  2Q2A A;  2F78 A;  4KD5 A;  3TFL A;  2Q74 A;  1FRP A;  1FPG A;  3ECR A;  4P0I A;  2FA7 A;  1P1O A;  4YKK A;  4NMY A;  2PX1 A;  2F3D A;  4F3P A;  4ESW A;  2O1M A;  2UYE A;  4MAG A;  4UAB A;  2VPN A;  5T3J A;  5ET7 A;  1YTV A;  1O7T A;  1QW0 A;  1MPD A;  1SW1 A;  4QRZ A;  2OWT A;  1FCK A;  5FBP A;  4PC9 A;  4XKQ A;  3TOD A;  2F3B A;  3HPI A;  2XA5 A;  2OBG A;  1M5C A;  3DEL B;  4QFP A;  3RQT A;  1IXC A;  1IMB A;  5J16 A;  4DXB A;  3PTY A;  2GHB A;  2WYP A;  1SBP A;  3EN3 A;  1JQF A;  5IAI A;  1XOC A;  3TTR A;  4NF8 B;  4YAH X;  3BFU A;  4E0X A;  1XS5 A;  1MXW A;  4JBZ A;  1IEJ A;  4OYV A;  2VHA A;  5AA4 A;  3KSJ A;  3WAE A;  3DLN A;  4MFI A;  4I62 A;  5I58 A;  3U1O A;  2F5X A;  5LTC A;  3R6U A;  4LQ2 A;  4GF8 A;  2AIX A;  1DSN A;  4N8G A;  3V5A A;  1MXU A;  1MQI A;  2Q8J A;  3RTF B;  1YYZ A;  2Y7I A;  3DP8 A;  1HSE A;  3PV0 E;  4FBP A;  1PB8 A;  4NG7 A;  3B6W A;  1FBD A;  4K3F A;  4N6P A;  3V89 B;  4QFN A;  1FPB A;  1XVY A;  3EPE A;  3CFZ A;  1A7L A;  2DVC A;  4ZZE A;  2VP1 A;  3R7X A;  1XC1 A;  2DVZ A;  3TMG A;  2HXW A;  4I3Y A;  5KCJ B;  2XXV A;  4R9G A;  3H06 B;  1YCJ A;  1LST A;  2O6A A;  1LCF A;  4AS5 A;  3OSQ A;  4AS4 A;  3LSW A;  4NE4 A;  4U21 A;  2QL3 A;  1JVY A;  5I2K B;  1BLF A;  5EYH A;  3FXR A;  1DOT A;  4OAN A;  4AB5 A;  1EU8 A;  1POT A;  1NH8 A;  1T0K A;  3Q29 A;  3TTN A;  1M5E A;  3ZKL A;  3VDF A;  5ELV A;  3QUF A;  1OVT A;  3CR9 A;  4KPT A;  1FTL A;  2DWH A;  5H8Q A;  3SER A;  4GRK A;  2RIN A;  4FAJ A;  3K01 A;  4KCD A;  5J1D A;  4GQO A;  4QHQ A;  4R9F A;  4F3B A;  4FEB A;  4G68 C;  3K1P A;  1PBQ A;  4RA1 A;  2Z22 A;  2XX8 A;  4NF6 B;  5L9O A;  4BLA A;  4MNP A;  4FJP A;  2D5W A;  3CG3 A;  3N94 A;  3QUJ A;  2O69 A;  4GXA A;  5BUU A;  2XWO A;  4GVO A;  4JVI A;  5LOM A;  1DBZ A;  1LLS A;  3RYD A;  2P2A A;  4IB2 A;  1UIV A;  5ICQ A;  1KWH A;  4NF4 A;  2XXQ A;  3C4M A;  4JVD A;  4PFI A;  4ELP A;  4ELR A;  2AYS A;  4OVR A;  1M5B A;  4XXU A;  5F24 A;  5FHN A;  2F7A A;  5EHS A;  4OVQ A;  4P47 A;  2BJI A;  4RK9 A;  4HTG A;  1I69 A;  1NV6 A;  1FPK A;  4YB5 A;  3TZA A;  3KC1 A;  5I59 A;  5IKB A;  5DVI A;  3FV2 A;  5FTH A;  3FVO A;  4R6Y A;  2FVZ A;  3EKI A;  4GX6 A;  4ZS9 A;  4PF6 A;  4G8M A;  4X04 A;  1VSO A;  5DVF A;  1S9T A;  2I3W A;  1TWY A;  3K00 A;  4H5G A;  1JEU A;  1FJ9 A;  3SEY A;  3PMW A;  1INP A;  4PAI A;  1OQG A;  2W7Y A;  1SW2 A;  1ZKB A;  4NF5 A;  2O7U A;  2VD3 A;  3S4U A;  3TTL A;  4PAK A;  3PPN A;  3HN0 A;  2ESN A;  3N5L A;  4P1E A;  4H8I A;  4N6D A;  3SEV A;  3TCG A;  4R72 A;  3RPW A;  1B0L A;  1Z7N E;  1P1U A;  4DE8 A;  1TXF A;  2AL4 A;  2JJK A;  5CMK A;  1EYK A;  4LVQ A;  2A5S A;  3P7I A;  1URG A;  4MNC A;  3V8X B;  2FHY A;  4G77 A;  1MXY A;  4F2Q A;  2XXT A;  5ITO A;  3B8B A;  3H4Z A;  4FOR A;  4JWX A;  3IR1 A;  3TTM A;  1MM7 A;  2PFY A;  2F7C A;  4U4S A;  2KR0 A;  3FJM A;  3FD3 A;  4OA4 A;  3ILU B;  2DWA A;  1NUY A;  3Q25 A;  2DE4 A;  4GOT A;  3GLB A;  1VDW A;  4H0W A;  5ET8 A;  3M3F A;  4GWY A;  4POW A;  2RC7 A;  1Y3N A;  5ICT A;  1XVX A;  4HXV A;  3G3G A;  1CNQ A;  2V3U A;  1GTK A;  4Q5T A;  1O64 A;  2HZK A;  4M4G A;  1OIB A;  4FAT A;  1A99 A;  4BDO A;  3THI A;  1SW4 A;  4GX4 A;  1BIY A;  2I3V A;  2QRY A;  1MH4 A;  4NX1 A;  5ET6 A;  1LBB A;  1FPD A;  5IZZ A;  4PP0 A;  1FSA A;  3KOS A;  2QMX A;  1R6Z A;  3QSL A;  2REJ A;  2B65 A;  4NWC A;  3MP8 A;  4PQJ A;  4DXC A;  5LDZ A;  2O51 A;  4KI0 E;  4OEV A;  4BDN A;  3EHU A;  2D3I A;  4BDR A;  2E0S A;  1B1H A;  3RY3 A;  4O8M A;  4ZDM A;  3RPL A;  4LZ5 A;  2CZH A;  3LC8 A;  4H8J A;  2Q9T A;  1QUK A;  1MQJ A;  4LA9 A;  4I8C A;  3U93 A;  3E13 X;  5H8H A;  1MDQ A;  3L6G A;  2OWS A;  3FXQ A;  1GGG A;  3H03 A;  2Q88 A;  4X1D A;  3ILT B;  1IZ1 A;  2QVR A;  3O6H A;  2ALU A;  1SVX B;  1LFH A;  4QFL A;  1H43 A;  2LAO A;  2VT5 A;  3UIF A;  2M8C A;  5DEX B;  3V83 A;  4AB6 A;  4TOZ A;  1P1W A;  3CHG A;  2R6G E;  4KYE A;  4PBQ A;  4U2R A;  2XXK A;  3UOR A;  3KFM A;  2ZZV A;  4N17 A;  3O28 A;  2OX3 A;  3RLF E;  4P11 A;  5JTY A;  1KA1 A;  4EXK A;  3QXM A;  2Q89 A;  1JET A;  1NUW A;  2H25 A;  3IFA A;  1B5J A;  4IO5 A;  3FV1 A;  3GBB A;  3EHS A;  3FXB A;  3N26 A;  5F7V A;  4LUB A;  2R9J A;  1DTG A;  3MQ9 A;  1USY H;  2I6E A;  1KZ8 A;  2F7B A;  3PD9 A;  1LBZ A;  3G3J A;  5TP9 A;  3KG2 A;  4F3G A;  4ZED A;  2DOJ A;  5IZ3 B;  5L9S A;  1CB6 A;  4RNS A;  4C1U A;  4OVP A;  2HAU A;  3OEM A;  4XTC Q;  1LFG A;  3N6T A;  4G68 B;  1N0T A;  5AA1 A;  1PB9 A;  3CG1 A;  5CRY A;  2YJP A;  4DI3 D;  1AMF A;  2XWK A;  5AA2 A;  1B3H A;  1B3E A;  1J1N A;  3VVF A;  1UTB A;  3IK6 B;  1VE4 A;  3IOT A;  4X48 A;  2XD2 A;  5I56 B;  4F29 A;  2XXY A;  4P1L A;  4R6H A;  3E9X A;  2I48 A;  1MQH A;  1QGX A;  4HE0 A;  3RNN A;  1JEV A;  5L9M A;  1N3X A;  1B4H A;  1NL5 A;  4RY1 A;  3M8U A;  4EDP A;  1LBV A;  5KDT B;  2FNC A;  3FAS A;  4RYA A;  3K2D A;  1B40 A;  3ZKK A;  4JWY A;  2V93 A;  4WEP A;  3UGW A;  4GLI A;  4IO6 A;  4O3C A;  3USD A;  3I5O A;  2BJJ X;  3JYR A;  1FPE A;  4U1O A;  3SEX A;  4F39 A;  2IA4 A;  4BDQ A;  1JP4 A;  1IIW A;  4WXJ A;  2NWJ A;  2WBD A;  5TPA B;  3VFJ A;  1A8F A;  1LAF E;  2Y5L A;  4I9D A;  1NI9 A;  2DE2 A;  1EZO A;  4JXI A;  1QUI A;  1SI1 A;  4O94 A;  3QIM A;  3TDJ A;  3MZB A;  2DDK A;  3TKD A;  5AA2 D;  1Q1K A;  5ESY A;  1LCT A;  3H7M A;  1YPN A;  1PEB A;  4GL8 A;  4RK2 A;  1AH5 A;  1A55 A;  3SKP A;  4GBW A;  1IMF A;  4ND9 A;  5AE4 A;  2P3V A;  5CMC A;  5B70 A;  1M5D A;  5H8N A;  1KA0 A;  5IZ1 A;  3KZG A;  3U65 A;  3MYU A;  2CZI A;  4OHN A;  3CIJ A;  3W9V A;  3TYH A;  2GQ1 A;  4UA8 A;  4F1Y A;  1UTH A;  1NH7 A;  3GBA A;  2RCA A;  4PE3 A;  4KXP A;  2PVU A;  3OEK A;  3U92 A;  1LBX A;  5FHM A;  2XXI A;  2A5T B;  1DPE A;  4F1V A;  3VE1 B;  3UP9 A;  5DT6 A;  3IB1 A;  2PT2 A;  1FQC A;  2HPG A;  2VGQ A;  5I2N A;  3HCQ A;  1A8E A;  2DWI A;  3Q27 A;  1YXI A;  1Y3P A;  2HQ0 A;  4N13 A;  4IO3 A;  1Z7M E;  1NUZ A;  3AXF A;  5CI5 A;  4H46 A;  3PU5 A;  5I57 B;  5H8H B;  3TCF A;  2HFB A;  5CBR A;  4NHB A;  4EXL A;  1US5 A;  4N81 A;  2ABH A;  4PDD A;  3C32 A;  2ZMB A;  1EYJ A;  2DWJ A;  3G3H A;  3SDF A;  3G3F A;  3F11 A;  2Y7W A;  1LEV A;  1MDP 1;  4MJO A;  1NMU A;  2GHA A;  4KQP A;  4HW8 A;  1RDZ A;  4YMB A;  3KJ7 A;  4GWU A;  3CI8 A;  4I1D A;  4YMA A;  1FQE A;  4X1B A;  5H8F B;  2ZYO A;  4JVC A;  4MX6 A;  1H3D A;  3QAX A;  4POX A;  3TQW A;  1ZIU A;  3I6V A;  3KN7 A;  2B4M A;  3KC0 A;  4BDL A;  1G0H A;  2F34 A;  4PF8 A;  3VVD A;  1JW5 A;  1MY0 A;  1F9B A;  2VOZ A;  4WED A;  5I3S A;  4XKN A;  5I5P A;  5EQA A;  1ZTY A;  4R2F A;  1BK4 A;  3CFX A;  1PB7 A;  1NKX A;  1S7Y A;  2HXR A;  4LZ8 A;  1FBF A;  1FTA A;  4JWO A;  5I7I A;  4JB7 A;  2DE3 A;  1MS7 A;  2V84 A;  4F3S A;  2E1S A;  1AOV A;  2V25 A;  2QFL A;  4MMP A;  1FTK A;  3FVG A;  3E4R A;  3IB2 A;  3KN8 A;  2RC9 A;  3PUV E;  3KGC A;  1LAG E;  1EZ9 A;  1AL3 A;  2WKY A;  2KLF A;  3B6Q A;  3MP6 A;  2GRV A;  5ITP A;  3MPL A;  3Q28 A;  1WDN A;  4ZEK A;  2ZXT A;  4F19 A;  1VFE A;  3O66 A;  3VXB A;  4AQ4 A;  4OFL A;  2R8T A;  2DQV A;  4H6D A;  1NNT A;  4GIZ A;  4OMB A;  5EQ7 A;  3DP4 A;  4PE5 B;  1D9Q A;  4L17 A;  4R74 A;  3O2A A;  3S9N C;  3ONM A;  3FAT A;  2O68 A;  5L8D A;  1MXX A;  4N8Y A;  4C1T A;  1MRP A;  4EUO A;  4P9K A;  3MVW A;  4OQO A;  1L5T A;  1B3F A;  1USY E;  2X7Q A;  4G4P A;  1DMB A;  5M2V A;  1K9Z A;  1FQB A;  1UQW A;  3TTK A;  3C35 A;  4ONY A;  2CEY A;  4RPO A;  3O29 A;  3O97 A;  3OO6 A;  1NUX A;  3FVK A;  4DCY A;  4ZEB A;  3FXU A;  1G0I A;  1MXZ A;  1XI6 A;  1B32 A;  3TCH A;  4NGU A;  5AA4 B;  1A40 A;  3VV5 A;  1IMA A;  3PUZ E;  3IJO B;  1B7H A;  4PBH A;  2FIE A;  5I58 B;  1N04 A;  5FTI A;  2PFZ A;  2H98 A;  2ZNT A;  1B2H A;  1EYI A;  4X8R A;  5HPQ A;  3FBP A;  3N6U A;  3C34 A;  1LGB C;  2OZZ A;  4QF9 A;  3K6W A;  1Y1Z A;  1IME A;  4DCX A;  3BKI B;  1FTJ A;  4H45 A;  4ZEF A;  4N15 A;  4UAC A;  2ONS A;  1EH3 A;  4Q0C A;  2QS4 A;  3KJT A;  4QXD A;  3ODB A;  4DXU A;  2ONK E;  1NNP A;  3OXN A;  1Y4C A;  5EYF A;  3HO7 A;  4O7I A;  4PDH A;  1B46 A;  1NV5 A;  4OET A;  2NOO A;  1B3L A;  1NV0 A;  4KCC A;  3FGS A;  4ELQ A;  2Y5K A;  3IJX B;  4U22 A;  4F2O A;  3A29 A;  1MPB A;  1IMD A;  4GWO A;  1FTO A;  3GZG A;  4JSO A;  3ROJ A;  4YB6 A;  1RYO A;  1GV8 A;  2B3F A;  3KBR A;  4OVT A;  3PGF A;  3BIH A;  4P3L A;  5KZT A;  4ZEC A;  3RT8 A;  5IGA A;  1CE2 A;  1LAH E;  1SYH A;  3K1M A;  3EQ1 A;  2QMW A;  3C31 A;  2P0S A;  3E79 A;  4NF8 A;  2Y7P A;  5H8Q B;  1SI0 A;  2B4L A;  3VLU A;  1FBC A;  2XXH A;  1B7U A;  4QFK A;  5AA3 A;  1MM6 A;  2WBB A;  5DVJ A;  1MY3 A;  1MY2 A;  4DLD A;  4HE2 A;  3OEN A;  3MWB A;  1I6Q A;  3QMF A;  3DM0 A;  3H6T A;  2G93 A;  1LAX A;  4OES A;  1FW0 A;  1PDA A;  1FPJ A;  4OEU A;  3MUQ A;  3CFL A;  4MF3 A;  5CMM A;  1QVS A;  3OSR A;  3TPA A;  3IOR A;  2XXX A;  3PD8 A;  3U94 A;  1DTZ A;  2XX7 A;  1TT1 A;  3HHF A;  4NF4 B;  3MJN A;  3K02 A;  4R73 A;  2FIX A;  4P56 A;  4LN5 A;  3W15 C;  3MAM A;  2GFE A;  3PPO A;  3R26 A;  3RGY A;  5HBC A;  4GL0 A;  2Y84 A;  2QS2 A;  1M5F A;  2R71 A;  2H4I A;  3K1N A;  4O7M A;  5KCJ A;  4P8B A;  5CMB A;  2HCA A;  2ZYK A;  1MY1 A;  5I59 B;  3U8Q A;  3WAF A;  1JNF A;  4GWS A;  1BTJ A;  2P3N A;  2QJE A;  4IO4 A;  2F97 A;  5K2Y A;  4JDF A;  4KYD A;  2QPQ A;  5I2K A;  3OO8 A;  4G61 A;  3KOT A;  2MKZ A;  3EHT A;  3D1R A;  3H6U A;  2QVU A;  4OVS A;  4YZZ A;  3K0V A;  4NF5 B;  3IFC A;  3PUW E;  4H1X A;  4U23 A;  4G8N A;  3FJ7 A;  1IIT A;  2Z8E A;  3C33 A;  3TAJ A;  2H99 A;  1N7W A;  2WEF A;  1B9J A;  3MZ1 A;  3S2V A;  1NNF A;  4HCW A;  5FHO A;  1PBP A;  3PMX A;  1MH3 A;  3H3G A;  4TLL B;  1IXH A;  3A09 A;  3FUZ A;  5CM6 A;  2UVH A;  4XFE A;  4Z7E A;  2DP8 A;  1FQF A;  1OVB A;  5F1Q A;  4LON B;  3T22 A;  1LB9 A;  2I4B A;  2F8D A;  1B6H A;  1FBH A;  1HSL A;  2REG A;  5H8S A;  1Y20 A;  2Y7R A;  4ELO A;  1DCU A;  4H67 A;  2OLB A;  4NWD A;  4IY6 A;  2AL5 A;  4H5F A;  1B51 A;  1DK4 A;  4DDD A;  1ZMG A;  2G29 A;  3CSB A;  3I3V A;  1NNK A;  4HE1 A;  2UVJ A;  3HV1 A;  1GR2 A;  4GFR A;  1POY 1;  4N4U A;  1N3W A;  2DXR A;  2WYK A;  2GH9 A;  1R9L A;  3LSL A;  1FBG A;  2I0C A;  3RN8 A;  4Q8R A;  1FBP A;  4R6K A;  3MPK A;  3ZS6 A;  1R1N A;  3IAZ A;  4DZ1 A;  2XD3 A;  3LV0 A;  3RUM A;  4EF1 A;  4RPN A;  3RPL B;  3C9H A;  1YAE A;  4IGR A;  1RKM A;  3O6G A;  1B5I A;  2F6G A;  4LZ7 A;  3T1B A;  3BBR A;  4OTE A;  2FYI A;  1BKA A;  3PPR A;  3SEU A;  1Q35 A;  4NTL A;  2CEX A;  4R75 A;  2X7P A;  3MVX A;  2OJT A;  2CZK A;  4EF2 A;  4FE8 A;  2X26 A;  4Q30 B;  2UYF A;  4EQB A;  3UK4 A;  1NV3 A;  4MEV A;  3C36 A;  1QJM A;  1QUL A;  1UIU A;  1B52 A;  4IR8 A;  2ZZW A;  1FPF A;  2XWV A;  3MBP A;  2V3T A;  4IY5 A;  1II5 A;  3OEL A;  5JTY B;  2NVU B;  4GWW A;  3KN3 A;  3OO9 A;  1D3K A;  4G8H A;  3S9L C;  3VXC A;  1JW1 A;  2RF1 A;  4YKJ A;  1PC3 A;  1SDX A;  1TFD A;  1EZP A;  2O1L A;  4QFO A;  5TP9 B;  4OWD A;  1R9Q A;  4QSD A;  2ONR A;  2Z8D A;  3T96 B;  2O7I A;  5TU0 A;  4F31 B;  1I6A A;  4C0R A;  1B3G A;  4XEQ A;  3K6U A;  1LBC A;  4OEN A;  3OO7 A;  2DSF A;  4OFJ A;  3KBZ A;  1VR5 A;  1FPI A;  4ZE8 A;  2NXO A;  4MLQ A;  4YKP A;  2QSX A;  1P1N A;  2XXW A;  4IO7 A;  5AA2 B;  2HAV A;  3MC2 A;  1YZ0 A;  1K9Y A;  4ESX A;  1UTB B;  2V4C A;  4FED A;  2I4C A;  1MPC A;  1Y3Q A;  3CRB A;  1O63 A;  3S9E A;  4P0G A;  4MCO A;  3JV9 A;  5B7D A;  5I84 A;  4R2B A;  3HHG A;  4I3E A;  4ZZA A;  3IOW A;  3MZ9 A;  1QKB A;  2HZL A;  3RT6 B;  4FIM A;  4NF0 A;  1B5H A;  5DEX A;  4PCD A;  1Y9U A;  2DS9 A;  4PFU A;  1JW4 A;  3U72 A;  2DYX A;  4QBA A;  1D9V A;  3SZP A;  4F1U A;  3PUY E;  4JSD A;  2F35 A;  4E0W A;  2B3B A;  4OVJ A;  3VLW A;  1Y1M A;  3S9M C;  3SEW A;  1FBE A;  1FTM A;  1OQH A;  3MP1 A;  4GWX A;  2D21 A;  3IO6 A;  2PYY A;  1ANF A;  2UVI A;  3E78 A;  1P99 A;  2XWI A;  1IUD A;  5H8N B;  1IXG A;  2XXU A;  3PPQ A;  2VPO A;  5IZ3 A;  5A5X A;  1SQY A;  3D4C A;  4TLM B;  2Q2C A;  5JEI A;  2QS3 A;  3G7W A;  3LUY A;  4N07 A;  4YIC A;  1TFA A;  4OFO A;  3UN6 A;  4PFR A;  4GXS B;  1UTH B;  2IEE A;  4PFY A;  4PGN A;  3D4G A;  2VD2 A;  4G68 A;  1WVJ A;  1RDX A;  3HST A;  4YU0 A;  1MY4 A;  1ZLQ A;  1QKA A;  3MW0 A;  2XHD A;  2ZZX A;  4BDM A;  5I2N B;  1B0H A;  4MHF A;  4LQ5 A;  5ISU A;  2CMO A;  4OZ9 A;  1H44 A;  5I56 A;  4HCY A; 
#chains in the Genus database with same CATH homology
 1IMC A;  4NQ8 A;  4IO2 A;  1D4N A;  3T66 A;  1FJ6 A;  1SD3 A;  3SET A;  4MH5 A;  2Y7K A;  4ISU A;  4I40 A;  3HFU A;  3L6H A;  2PT1 A;  2XXP A;  3T9U A;  3T93 B;  3A3U A;  4DIG A;  5EHM A;  4O3B A;  3W9W A;  5IM2 A;  3BIG A;  1NV1 A;  5ET5 A;  5KDT A;  3IX1 A;  1N7X A;  2ZYN A;  3KEI A;  1SPI A;  4KR5 A;  2P1S A;  1S50 A;  5TPA A;  2OK2 A;  3TEP A;  2ANJ A;  4HS7 A;  5DW8 A;  1MXV A;  4YKI A;  4U1Z A;  1FQD A;  2F36 A;  3OMB A;  3TUS A;  1QUJ A;  3T9H B;  4WKM A;  2I0B A;  4DI4 B;  2OWZ A;  1LB8 A;  1ELJ A;  3LBS A;  2RKM A;  1XHY A;  1XT8 A;  3OD7 A;  1Y4T A;  4RJZ A;  3O9P A;  1MQD A;  3LR1 A;  4GWZ A;  3PUX E;  3G3K A;  3SES A;  2UVG A;  3ISP A;  3PMV A;  1NV2 A;  3LUZ A;  4MBP A;  3OOA A;  1LBW A;  4NAP A;  2HHM A;  3JZJ A;  3A3C A;  3B50 A;  1SYI A;  2RC8 A;  3B6T A;  4F22 A;  2HEU A;  3LSF B;  2DXY A;  3K6V A;  3BFT A;  4QSE A;  1SW5 A;  3T9X B;  1AIV A;  5CC2 A;  4OXV A;  1D9Y A;  1BP5 A;  3VLV A;  1FPL A;  2WX9 A;  2XXR A;  2A5T A;  4KYS A;  3M3K A;  5EQ8 A;  1FQA A;  3QK6 A;  3RTW B;  2QVV A;  2XX9 A;  4MIJ A;  3VVE A;  5EYG A;  1URD A;  3CVG A;  2H9B A;  3TQL A;  1OLC A;  3G3I A;  3IO4 A;  4PTK A;  2RCB A;  3GXA A;  4NN3 A;  3TEL A;  1I6B A;  5I57 A;  2V3Q A;  3M3L A;  5JK4 A;  3MVZ A;  4PET A;  1URS A;  4O3A A;  4ZEI A;  1WOD A;  3MST A;  1RYX A;  2O84 X;  4LP2 B;  4PAF A;  4G2Z A;  1ZU0 A;  3QYT A;  1IXI A;  4EQ7 A;  1H76 A;  4PFT A;  1LFI A;  3T9V A;  1OLA A;  1B7Z A;  4ZE9 A;  5DYH A;  5EQ9 A;  2I49 A;  3FIR A;  5CBS A;  1JVX A;  3PPP A;  5K2X A;  2YLN A;  4F18 A;  4X9T A;  2ZYM A;  3K4U A;  1Q9D A;  2ZNS A;  1MQG A;  4U4X A;  4N6K A;  4XKP A;  4MNI A;  4N91 A;  2Q8M A;  3MVY A;  1B4Z A;  1VFD A;  2Z8F A;  5H8F A;  3B7D A;  4PFW A;  1B58 A;  2PBW A;  1P1Q A;  4EQ9 A;  5A5L A;  1HSJ A;  1RDY A;  3GYY A;  2I58 A;  4Z0I A;  4THI A;  2ZNU A;  1B1X A;  2L5V A;  4OER A;  5A5X B;  4GBV A;  1H45 A;  5BWJ A;  3UA8 A;  4LAT A;  3ZSF A;  3H6V A;  1IQ7 A;  4KFQ A;  2Z23 A;  3H6W A;  3EF7 A;  4GD5 A;  2F6P A;  3T0J A;  4RXL A;  3FVN A;  1A54 A;  4PGP A;  1NFT A;  2PMS A;  4XIG Q;  1OMP A;  1NV7 A;  3NOH A;  1DPP A;  3IB0 A;  4XF5 A;  2OCU A;  1GVC A;  1LBY A;  1US4 A;  5HM4 B;  2UXA A;  1B05 A;  4GX3 A;  3IL1 B;  2THI A;  3K6X A;  3DP6 A;  3IOU A;  4NED A;  3IOV A;  1AWB A;  4NF6 A;  3Q26 A;  4YB7 A;  2NUV A;  1ZJL A;  2YPN A;  3FJG A;  4H65 A;  4MLV A;  1NV4 A;  2PCR A;  3FZV A;  2H5Y A;  4FEC A;  4M1V A;  1MG1 A;  1N84 A;  4TQU Q;  1ZBM A;  3E3K A;  2KQZ A;  3LSX A;  1ATG A;  4ECF A;  3CSG A;  5DTB A;  2FBP A;  4IGT A;  4XKR A;  3KSX A;  4QSC A;  1N76 A;  2QS1 A;  4KHZ E;  2CZL A;  4PFB A;  3O6I A;  2Q2A A;  2F78 A;  4KD5 A;  3TFL A;  2Q74 A;  1FRP A;  1FPG A;  3ECR A;  4P0I A;  2FA7 A;  1P1O A;  4YKK A;  4NMY A;  2PX1 A;  2F3D A;  4F3P A;  4ESW A;  2O1M A;  2UYE A;  4MAG A;  4UAB A;  2VPN A;  5T3J A;  5ET7 A;  1YTV A;  1O7T A;  1QW0 A;  1MPD A;  1SW1 A;  4QRZ A;  2OWT A;  1FCK A;  5FBP A;  4PC9 A;  4XKQ A;  3TOD A;  2F3B A;  3HPI A;  3DEL B;  2OBG A;  1M5C A;  2XA5 A;  4QFP A;  3RQT A;  1IXC A;  1IMB A;  5J16 A;  4DXB A;  3PTY A;  2GHB A;  2WYP A;  1SBP A;  3EN3 A;  1JQF A;  5IAI A;  1XOC A;  3TTR A;  4NF8 B;  4YAH X;  3BFU A;  4E0X A;  1XS5 A;  1MXW A;  4JBZ A;  1IEJ A;  4OYV A;  2VHA A;  5AA4 A;  3KSJ A;  3WAE A;  3DLN A;  4MFI A;  4I62 A;  5I58 A;  3U1O A;  2F5X A;  5LTC A;  3R6U A;  4LQ2 A;  4GF8 A;  2AIX A;  1DSN A;  4N8G A;  3V5A A;  1MXU A;  1MQI A;  2Q8J A;  3RTF B;  1YYZ A;  2Y7I A;  3DP8 A;  1HSE A;  3PV0 E;  4FBP A;  1PB8 A;  4NG7 A;  3B6W A;  1FBD A;  4K3F A;  4N6P A;  3V89 B;  4QFN A;  1XVY A;  1FPB A;  3EPE A;  3CFZ A;  1A7L A;  2DVC A;  4ZZE A;  2VP1 A;  3R7X A;  1XC1 A;  3TMG A;  2DVZ A;  2HXW A;  4I3Y A;  5KCJ B;  2XXV A;  4R9G A;  3H06 B;  1YCJ A;  1LST A;  2O6A A;  1LCF A;  4AS5 A;  3OSQ A;  4AS4 A;  3LSW A;  4NE4 A;  4U21 A;  2QL3 A;  1JVY A;  5I2K B;  1BLF A;  5EYH A;  3FXR A;  1DOT A;  4OAN A;  4AB5 A;  1EU8 A;  1POT A;  1NH8 A;  1T0K A;  3Q29 A;  3TTN A;  1M5E A;  3ZKL A;  3VDF A;  5ELV A;  3QUF A;  1OVT A;  3CR9 A;  4KPT A;  1FTL A;  2DWH A;  5H8Q A;  3SER A;  4GRK A;  2RIN A;  4FAJ A;  3K01 A;  4KCD A;  5J1D A;  4GQO A;  4QHQ A;  4R9F A;  4F3B A;  4FEB A;  4G68 C;  3K1P A;  1PBQ A;  4RA1 A;  2Z22 A;  2XX8 A;  4NF6 B;  5L9O A;  4BLA A;  4MNP A;  4FJP A;  2D5W A;  3CG3 A;  3N94 A;  3QUJ A;  2O69 A;  4GXA A;  5BUU A;  4GVO A;  2XWO A;  4JVI A;  5LOM A;  1DBZ A;  1LLS A;  3RYD A;  2P2A A;  4IB2 A;  1UIV A;  5ICQ A;  1KWH A;  4NF4 A;  2XXQ A;  3C4M A;  4JVD A;  4PFI A;  4ELP A;  4ELR A;  2AYS A;  4OVR A;  1M5B A;  4XXU A;  5F24 A;  5FHN A;  2F7A A;  5EHS A;  4OVQ A;  4P47 A;  2BJI A;  4RK9 A;  4HTG A;  1I69 A;  1NV6 A;  3TZA A;  4YB5 A;  1FPK A;  5I59 A;  3KC1 A;  5IKB A;  5DVI A;  3FV2 A;  5FTH A;  3FVO A;  4R6Y A;  2FVZ A;  3EKI A;  4ZS9 A;  4GX6 A;  4PF6 A;  4G8M A;  4X04 A;  1VSO A;  5DVF A;  1S9T A;  2I3W A;  1TWY A;  3K00 A;  4H5G A;  1JEU A;  1FJ9 A;  3SEY A;  3PMW A;  1INP A;  1OQG A;  2W7Y A;  4PAI A;  1SW2 A;  1ZKB A;  4NF5 A;  2O7U A;  2VD3 A;  3S4U A;  3TTL A;  4PAK A;  3PPN A;  3HN0 A;  2ESN A;  3N5L A;  4P1E A;  4H8I A;  3SEV A;  4N6D A;  3TCG A;  4R72 A;  3RPW A;  1B0L A;  1Z7N E;  1P1U A;  4DE8 A;  1TXF A;  2AL4 A;  5CMK A;  2JJK A;  1EYK A;  4LVQ A;  2A5S A;  3P7I A;  1URG A;  4MNC A;  3V8X B;  2FHY A;  4G77 A;  1MXY A;  4F2Q A;  2XXT A;  5ITO A;  3B8B A;  3H4Z A;  4FOR A;  4JWX A;  3IR1 A;  3TTM A;  1MM7 A;  2PFY A;  2F7C A;  4U4S A;  3FJM A;  2KR0 A;  3FD3 A;  4OA4 A;  3ILU B;  2DWA A;  1NUY A;  3Q25 A;  2DE4 A;  4GOT A;  3GLB A;  1VDW A;  4H0W A;  5ET8 A;  3M3F A;  4GWY A;  4POW A;  2RC7 A;  1Y3N A;  5ICT A;  1XVX A;  4HXV A;  3G3G A;  1CNQ A;  2V3U A;  1GTK A;  4Q5T A;  1O64 A;  2HZK A;  4M4G A;  1OIB A;  4FAT A;  1A99 A;  4BDO A;  3THI A;  1SW4 A;  4GX4 A;  1BIY A;  2I3V A;  2QRY A;  1MH4 A;  4NX1 A;  5ET6 A;  1LBB A;  1FPD A;  5IZZ A;  4PP0 A;  1FSA A;  3KOS A;  2QMX A;  1R6Z A;  3QSL A;  2REJ A;  2B65 A;  4NWC A;  3MP8 A;  4PQJ A;  4DXC A;  5LDZ A;  2O51 A;  4KI0 E;  4OEV A;  4BDN A;  3EHU A;  2D3I A;  4BDR A;  2E0S A;  1B1H A;  3RY3 A;  4ZDM A;  4O8M A;  3RPL A;  4LZ5 A;  2CZH A;  3LC8 A;  4H8J A;  2Q9T A;  1QUK A;  1MQJ A;  4LA9 A;  4I8C A;  3U93 A;  3E13 X;  5H8H A;  1MDQ A;  3L6G A;  2OWS A;  3FXQ A;  1GGG A;  3H03 A;  2Q88 A;  4X1D A;  3ILT B;  1IZ1 A;  2QVR A;  3O6H A;  2ALU A;  1SVX B;  1LFH A;  4QFL A;  1H43 A;  2LAO A;  3UIF A;  2VT5 A;  2M8C A;  5DEX B;  3V83 A;  4AB6 A;  4TOZ A;  1P1W A;  3CHG A;  2R6G E;  4KYE A;  4PBQ A;  4U2R A;  3UOR A;  2XXK A;  3KFM A;  2ZZV A;  4N17 A;  3O28 A;  3RLF E;  2OX3 A;  4P11 A;  5JTY A;  1KA1 A;  4EXK A;  3QXM A;  2Q89 A;  1JET A;  1NUW A;  2H25 A;  3IFA A;  1B5J A;  4IO5 A;  3FV1 A;  3GBB A;  3EHS A;  3FXB A;  3N26 A;  5F7V A;  4LUB A;  2R9J A;  1DTG A;  3MQ9 A;  1USY H;  2I6E A;  1KZ8 A;  2F7B A;  3PD9 A;  3G3J A;  1LBZ A;  5TP9 A;  3KG2 A;  4F3G A;  4ZED A;  2DOJ A;  5L9S A;  5IZ3 B;  1CB6 A;  4RNS A;  4C1U A;  4OVP A;  2HAU A;  3OEM A;  4XTC Q;  1LFG A;  3N6T A;  4G68 B;  1N0T A;  5AA1 A;  1PB9 A;  3CG1 A;  5CRY A;  2YJP A;  4DI3 D;  1AMF A;  2XWK A;  5AA2 A;  1B3H A;  1B3E A;  1J1N A;  3VVF A;  1UTB A;  3IK6 B;  1VE4 A;  3IOT A;  4X48 A;  2XD2 A;  5I56 B;  4F29 A;  2XXY A;  4P1L A;  4R6H A;  3E9X A;  2I48 A;  1MQH A;  3RNN A;  1QGX A;  4HE0 A;  1JEV A;  5L9M A;  1N3X A;  1B4H A;  1NL5 A;  4RY1 A;  3M8U A;  4EDP A;  1LBV A;  5KDT B;  2FNC A;  3FAS A;  4RYA A;  3K2D A;  1B40 A;  3ZKK A;  4JWY A;  2V93 A;  3UGW A;  4WEP A;  4GLI A;  4IO6 A;  4O3C A;  3USD A;  3I5O A;  2BJJ X;  3JYR A;  4U1O A;  3SEX A;  4F39 A;  1FPE A;  4BDQ A;  2IA4 A;  1JP4 A;  1IIW A;  4WXJ A;  2NWJ A;  2WBD A;  5TPA B;  3VFJ A;  1A8F A;  1LAF E;  2Y5L A;  4I9D A;  1NI9 A;  2DE2 A;  1EZO A;  4JXI A;  1QUI A;  1SI1 A;  4O94 A;  3QIM A;  3TDJ A;  3MZB A;  2DDK A;  3TKD A;  5AA2 D;  1Q1K A;  5ESY A;  1LCT A;  3H7M A;  1YPN A;  1PEB A;  4GL8 A;  4RK2 A;  1AH5 A;  1A55 A;  3SKP A;  4ND9 A;  5AE4 A;  1IMF A;  4GBW A;  2P3V A;  5CMC A;  5B70 A;  1M5D A;  5H8N A;  1KA0 A;  5IZ1 A;  3KZG A;  3U65 A;  3MYU A;  2CZI A;  4OHN A;  3CIJ A;  3W9V A;  3TYH A;  2GQ1 A;  4UA8 A;  4F1Y A;  1UTH A;  1NH7 A;  3GBA A;  2RCA A;  4PE3 A;  4KXP A;  2PVU A;  3OEK A;  3U92 A;  1LBX A;  5FHM A;  2XXI A;  2A5T B;  1DPE A;  4F1V A;  3VE1 B;  3UP9 A;  5DT6 A;  3IB1 A;  2PT2 A;  1FQC A;  2HPG A;  2VGQ A;  5I2N A;  3HCQ A;  1A8E A;  2DWI A;  3Q27 A;  1YXI A;  1Y3P A;  2HQ0 A;  4N13 A;  4IO3 A;  1Z7M E;  1NUZ A;  3AXF A;  5CI5 A;  4H46 A;  3PU5 A;  5I57 B;  5H8H B;  3TCF A;  2HFB A;  5CBR A;  4NHB A;  4EXL A;  1US5 A;  4N81 A;  2ABH A;  4PDD A;  3C32 A;  2ZMB A;  1EYJ A;  2DWJ A;  3G3H A;  3SDF A;  3G3F A;  3F11 A;  2Y7W A;  1LEV A;  1MDP 1;  4MJO A;  1NMU A;  2GHA A;  4KQP A;  4HW8 A;  1RDZ A;  4YMB A;  3KJ7 A;  4GWU A;  3CI8 A;  4I1D A;  4YMA A;  1FQE A;  4X1B A;  5H8F B;  2ZYO A;  4JVC A;  4MX6 A;  1H3D A;  3QAX A;  4POX A;  3TQW A;  1ZIU A;  3I6V A;  3KN7 A;  2B4M A;  3KC0 A;  4BDL A;  2F34 A;  1G0H A;  4PF8 A;  3VVD A;  1JW5 A;  1MY0 A;  1F9B A;  2VOZ A;  4WED A;  5I3S A;  4XKN A;  5I5P A;  5EQA A;  1ZTY A;  4R2F A;  1BK4 A;  3CFX A;  1PB7 A;  1NKX A;  1S7Y A;  4LZ8 A;  2HXR A;  1FBF A;  1FTA A;  4JWO A;  5I7I A;  4JB7 A;  2DE3 A;  1MS7 A;  2V84 A;  4F3S A;  2E1S A;  1AOV A;  2V25 A;  2QFL A;  4MMP A;  1FTK A;  3FVG A;  3E4R A;  3IB2 A;  3KN8 A;  2RC9 A;  3PUV E;  3KGC A;  1LAG E;  1EZ9 A;  1AL3 A;  2WKY A;  2KLF A;  3B6Q A;  3MP6 A;  2GRV A;  5ITP A;  3MPL A;  3Q28 A;  1WDN A;  4ZEK A;  2ZXT A;  4F19 A;  1VFE A;  3O66 A;  3VXB A;  4AQ4 A;  4OFL A;  2R8T A;  2DQV A;  4H6D A;  1NNT A;  4GIZ A;  4OMB A;  5EQ7 A;  3DP4 A;  4PE5 B;  1D9Q A;  4L17 A;  4R74 A;  3O2A A;  3S9N C;  3ONM A;  3FAT A;  2O68 A;  5L8D A;  1MXX A;  4N8Y A;  4C1T A;  1MRP A;  4EUO A;  4P9K A;  3MVW A;  4OQO A;  1L5T A;  1B3F A;  1USY E;  2X7Q A;  4G4P A;  1DMB A;  5M2V A;  1K9Z A;  1FQB A;  1UQW A;  3TTK A;  3C35 A;  4ONY A;  2CEY A;  4RPO A;  3O29 A;  3O97 A;  3OO6 A;  4DCY A;  3FVK A;  1NUX A;  4ZEB A;  3FXU A;  1MXZ A;  1G0I A;  1XI6 A;  1B32 A;  3TCH A;  4NGU A;  5AA4 B;  1A40 A;  3VV5 A;  1IMA A;  3PUZ E;  3IJO B;  1B7H A;  4PBH A;  2FIE A;  5I58 B;  1N04 A;  5FTI A;  2PFZ A;  2H98 A;  2ZNT A;  1B2H A;  1EYI A;  4X8R A;  5HPQ A;  3FBP A;  3N6U A;  3C34 A;  1LGB C;  2OZZ A;  4QF9 A;  3K6W A;  1Y1Z A;  1IME A;  4DCX A;  3BKI B;  1FTJ A;  4H45 A;  4ZEF A;  4N15 A;  4UAC A;  2ONS A;  1EH3 A;  4Q0C A;  2QS4 A;  3KJT A;  4QXD A;  3ODB A;  4DXU A;  2ONK E;  1NNP A;  3OXN A;  1Y4C A;  5EYF A;  3HO7 A;  4O7I A;  4PDH A;  1B46 A;  1NV5 A;  4OET A;  2NOO A;  1B3L A;  1NV0 A;  4KCC A;  3FGS A;  4ELQ A;  2Y5K A;  3IJX B;  4U22 A;  4F2O A;  3A29 A;  1MPB A;  1IMD A;  4GWO A;  1FTO A;  3GZG A;  4JSO A;  3ROJ A;  4YB6 A;  1RYO A;  1GV8 A;  2B3F A;  3KBR A;  4OVT A;  3PGF A;  5KZT A;  3BIH A;  4P3L A;  4ZEC A;  3RT8 A;  5IGA A;  1CE2 A;  1LAH E;  1SYH A;  3K1M A;  3EQ1 A;  2QMW A;  3C31 A;  2P0S A;  4NF8 A;  3E79 A;  2Y7P A;  5H8Q B;  1SI0 A;  2B4L A;  3VLU A;  1FBC A;  2XXH A;  1B7U A;  4QFK A;  5AA3 A;  1MM6 A;  5DVJ A;  2WBB A;  1MY3 A;  1MY2 A;  4DLD A;  4HE2 A;  3OEN A;  3MWB A;  1I6Q A;  3QMF A;  3DM0 A;  3H6T A;  2G93 A;  1LAX A;  4OES A;  1FW0 A;  1PDA A;  1FPJ A;  4OEU A;  3MUQ A;  3CFL A;  4MF3 A;  5CMM A;  1QVS A;  3OSR A;  3TPA A;  3IOR A;  2XXX A;  3PD8 A;  3U94 A;  1DTZ A;  2XX7 A;  1TT1 A;  3HHF A;  4NF4 B;  3MJN A;  3K02 A;  4R73 A;  2FIX A;  4P56 A;  4LN5 A;  3W15 C;  3MAM A;  2GFE A;  3PPO A;  3R26 A;  3RGY A;  5HBC A;  4GL0 A;  2Y84 A;  2QS2 A;  1M5F A;  2R71 A;  2H4I A;  3K1N A;  4O7M A;  5KCJ A;  4P8B A;  5CMB A;  2HCA A;  2ZYK A;  1MY1 A;  5I59 B;  3U8Q A;  3WAF A;  1JNF A;  4GWS A;  1BTJ A;  2P3N A;  2QJE A;  4IO4 A;  2F97 A;  5K2Y A;  4JDF A;  4KYD A;  2QPQ A;  5I2K A;  3OO8 A;  4G61 A;  3KOT A;  3EHT A;  2MKZ A;  3D1R A;  3H6U A;  2QVU A;  4OVS A;  4YZZ A;  3K0V A;  4NF5 B;  3PUW E;  3IFC A;  4H1X A;  4U23 A;  4G8N A;  3FJ7 A;  1IIT A;  2Z8E A;  3C33 A;  3TAJ A;  2H99 A;  1N7W A;  2WEF A;  1B9J A;  3MZ1 A;  3S2V A;  1NNF A;  4HCW A;  5FHO A;  1PBP A;  3PMX A;  1MH3 A;  3H3G A;  4TLL B;  1IXH A;  3A09 A;  3FUZ A;  5CM6 A;  2UVH A;  4XFE A;  4Z7E A;  2DP8 A;  1FQF A;  1OVB A;  5F1Q A;  4LON B;  3T22 A;  1LB9 A;  2I4B A;  2F8D A;  1B6H A;  1FBH A;  1HSL A;  2REG A;  5H8S A;  1Y20 A;  2Y7R A;  4ELO A;  1DCU A;  4H67 A;  2OLB A;  4NWD A;  4IY6 A;  2AL5 A;  4H5F A;  1B51 A;  4DDD A;  1DK4 A;  1ZMG A;  2G29 A;  3CSB A;  3I3V A;  1NNK A;  4HE1 A;  2UVJ A;  3HV1 A;  1GR2 A;  4GFR A;  1POY 1;  4N4U A;  1N3W A;  2DXR A;  2WYK A;  2GH9 A;  1R9L A;  3LSL A;  1FBG A;  2I0C A;  3RN8 A;  4Q8R A;  1FBP A;  4R6K A;  3MPK A;  3ZS6 A;  1R1N A;  3IAZ A;  4DZ1 A;  2XD3 A;  3LV0 A;  3RUM A;  4EF1 A;  4RPN A;  3RPL B;  3C9H A;  1YAE A;  4IGR A;  1RKM A;  3O6G A;  1B5I A;  2F6G A;  4LZ7 A;  3T1B A;  3BBR A;  4OTE A;  2FYI A;  1BKA A;  3PPR A;  3SEU A;  1Q35 A;  4NTL A;  2CEX A;  4R75 A;  2X7P A;  3MVX A;  2OJT A;  2CZK A;  4EF2 A;  4FE8 A;  2X26 A;  4Q30 B;  2UYF A;  4EQB A;  3UK4 A;  1NV3 A;  4MEV A;  3C36 A;  1QJM A;  1QUL A;  1UIU A;  1B52 A;  4IR8 A;  2ZZW A;  1FPF A;  2XWV A;  3MBP A;  2V3T A;  4IY5 A;  1II5 A;  3OEL A;  5JTY B;  2NVU B;  4GWW A;  3KN3 A;  3OO9 A;  1D3K A;  4G8H A;  3S9L C;  3VXC A;  1JW1 A;  2RF1 A;  4YKJ A;  1PC3 A;  1TFD A;  1SDX A;  1EZP A;  2O1L A;  4QFO A;  5TP9 B;  4OWD A;  1R9Q A;  4QSD A;  2ONR A;  2Z8D A;  3T96 B;  2O7I A;  5TU0 A;  4F31 B;  1I6A A;  4C0R A;  1B3G A;  4XEQ A;  3K6U A;  1LBC A;  4OEN A;  3OO7 A;  2DSF A;  4OFJ A;  3KBZ A;  1VR5 A;  1FPI A;  4ZE8 A;  2NXO A;  4MLQ A;  4YKP A;  2QSX A;  1P1N A;  2XXW A;  4IO7 A;  5AA2 B;  2HAV A;  3MC2 A;  1YZ0 A;  1K9Y A;  4ESX A;  1UTB B;  4FED A;  2V4C A;  2I4C A;  1MPC A;  1Y3Q A;  3CRB A;  1O63 A;  3S9E A;  4P0G A;  4MCO A;  3JV9 A;  5B7D A;  5I84 A;  4R2B A;  3HHG A;  4I3E A;  4ZZA A;  3IOW A;  3MZ9 A;  1QKB A;  2HZL A;  3RT6 B;  4FIM A;  4NF0 A;  1B5H A;  5DEX A;  4PCD A;  1Y9U A;  2DS9 A;  4PFU A;  1JW4 A;  3U72 A;  2DYX A;  4QBA A;  1D9V A;  3SZP A;  4F1U A;  3PUY E;  4JSD A;  2F35 A;  4E0W A;  2B3B A;  4OVJ A;  3VLW A;  1Y1M A;  3S9M C;  3SEW A;  1FBE A;  1FTM A;  1OQH A;  3MP1 A;  4GWX A;  2D21 A;  3IO6 A;  2PYY A;  1ANF A;  2UVI A;  3E78 A;  1P99 A;  2XWI A;  1IUD A;  5H8N B;  1IXG A;  2XXU A;  3PPQ A;  2VPO A;  5IZ3 A;  5A5X A;  1SQY A;  3D4C A;  4TLM B;  2Q2C A;  5JEI A;  2QS3 A;  3G7W A;  3LUY A;  4N07 A;  4YIC A;  1TFA A;  4OFO A;  3UN6 A;  4PFR A;  4GXS B;  1UTH B;  2IEE A;  4PFY A;  4PGN A;  3D4G A;  2VD2 A;  4G68 A;  1WVJ A;  3HST A;  1RDX A;  4YU0 A;  1MY4 A;  1ZLQ A;  1QKA A;  3MW0 A;  2XHD A;  2ZZX A;  4BDM A;  5I2N B;  1B0H A;  4MHF A;  4LQ5 A;  5ISU A;  2CMO A;  4OZ9 A;  1H44 A;  5I56 A;  4HCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...