4YICA

Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) with bound picolinic acid
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
344
structure length
344
Chain Sequence
ANPTVRWRMSTSWPKSLDTIYGSADELCKRVGQLTDGKFEIRAFPGGELVPSAQNMDAVSNGTVECNHVLSTMYIGKNTALTFDTGLSFGLNARQHNAWIHYGGGLQQLRELYKKYNIVNHVCGNVGVQMGGWYRKEIKSTADLNGLNMRIGGIGGMVLSKLGVVPQQIPPGDIYPALEKGTIDAAEWIGPYDDEKLGFNKVAPYYYSPGWFEGSASITSMVNDKAWEALPPAYQAAFEAACGEQSMRMLANYDARNPLALRKLIAGGAKVSFFPKEVMDAVYKASQQLWTELSEKNPDFKAIYPGWKKFQEDEAGWFRVAENALDNYTFAAVARAQAKAENLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
publication title CRYSTAL STRUCTURE OF A TRAP TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM BORDETELLA BRONCHISEPTICA RB50 (BB0280, TARGET EFI-500035) WITH BOUND PICOLINIC ACID
rcsb
source organism Bordetella bronchiseptica
total genus 135
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4yicA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4yicA01
1M5BA 4DCXA 1VR5A 3CFLA 4OXVA 4MF3A 1ZTYA 3G3GA 4RA1A 2QMXA 4MAGA 1GR2A 1H45A 1P1WA 2VOZA 4BLAA 3CFZA 1QKBA 3PUYE 1P1QA 3THIA 3GXAA 4I9DA 3EF7A 5CRYA 1USYH 4IO4A 1FTOA 4F3BA 2F7AA 2XWKA 1IXIA 3KG2A 4WEPA 1LBBA 5FTIA 5H8HA 4R6HA 3FXBA 2I48A 5DVIA 3M3LA 3I5OA 3PPNA 4OVPA 5F1QA 3HV1A 4F2OA 1NNFA 4QFKA 4R6YA 4EQBA 4THIA 4BDQA 1MRPA 1VFEA 1PDAA 4YB5A 4OANA 4H6DA 3OSRA 2HXWA 3T93B 2ONRA 3C32A 2H5YA 4QFOA 5FHOA 4PFBA 2OK2A 4R6KA 2D21A 4QSEA 4R74A 2PT1A 1AOVA 4R73A 2D5WA 3DLNA 1RYXA 2AL5A 2ONKE 4KHZE 1H3DA 1TT1A 4IO2A 4PE3A 4PC9A 3K0VA 3TODA 1SW1A 4DZ1A 3H6VA 1S50A 3TCHA 3TUSA 3ZSFA 2O1MA 5AA2A 4Q0CA 4RK9A 3OEMA 1I69A 2UXAA 1MXYA 2XXVA 4ZE8A 4F19A 2RCAA 4NF4A 1Q1KA 1NKXA 2RC8A 4PDDA 3SEVA 2UYEA 4G68C 3VV5A 2V25A 4YMBA 3AXFA 5H8FA 4GOTA 3FXUA 2QS2A 4F3PA 2Q89A 4GIZA 5A5XB 2I4CA 5FHNA 1MDP1 1QJMA 3EHTA 2PX1A 2HEUA 4OZ9A 3TCFA 4NG7A 4X9TA 2PFYA 4FECA 3IB2A 1FQBA 3LUYA 3MW0A 1B6HA 3S9EA 4XXUA 4NE4A 2DS9A 3RN8A 3U65A 3UN6A 5KCJB 3PUVE 1B7ZA 3MQ9A 3RT6B 1LCFA 3IOTA 4JBZA 1EZPA 1LB9A 4LUBA 2DVCA 4OVRA 4GF8A 5CBSA 1XT8A 2F6GA 3VE1B 4MNPA 3IJOB 4PBQA 4ZEIA 5KZTA 3KBRA 4LN5A 2DWJA 4DXCA 5DYHA 1DOTA 2RINA 3MVYA 1B3FA 1S7YA 1OIBA 3MZ9A 4OYVA 3KEIA 2QRYA 4DLDA 2E1SA 5I7IA 4YMAA 1NFTA 3FIRA 3OMBA 4EF2A 3Q25A 2OZZA 4F1VA 1LLSA 3RQTA 3HSTA 2WYPA 4P3LA 2DVZA 3ONMA 1A40A 1VFDA 2REJA 3R26A 5CMMA 3TQLA 1MPDA 5I2NA 2BJJX 1UTHA 2REGA 1NL5A 4N8YA 3TTRA 3PMXA 2QMWA 4H67A 5K2XA 1ATGA 3IO6A 3H06B 4GD5A 2XXPA 3DP6A 1R9QA 1O63A 1SW4A 2H4IA 3TCGA 4QFNA 2Y7RA 4NWCA 4P1LA 4RPOA 4EXLA 1TFAA 4PFWA 3TTMA 3G3JA 1POTA 1WODA 3O6GA 3KN8A 4EQ7A 1B5JA 3ILTB 3IORA 1HSJA 4R75A 2ZNTA 3U1OA 4X04A 2A5SA 3FASA 5EHSA 2QL3A 1MY1A 1LAHE 2B3BA 4KR5A 3W9WA 1B32A 1SYHA 1CB6A 2X7QA 3W15C 2XXXA 3PPOA 4G68B 2ZZVA 3UORA 1N04A 3EN3A 5H8QB 2X7PA 1Y1MA 5F7VA 2Z8FA 3MVWA 1WVJA 3IR1A 1M5EA 4RNSA 4ZECA 5EHMA 3TFLA 5JK4A 3RUMA 3K6WA 1PB8A 2XWVA 2H98A 3QUFA 2ZMBA 3KJTA 1RYOA 2F35A 5H8FB 3U8QA 2RF1A 3C4MA 5L9OA 4PAIA 2DXRA 4NEDA 3T96B 3BBRA 3N6TA 3HCQA 1JNFA 5ICQA 1US5A 3OD7A 4FEBA 1B3HA 1SBPA 3K6XA 2GH9A 5H8NB 2ONSA 4ZEKA 3T9VA 2DSFA 1A99A 2CMOA 4NX1A 4QSCA 1I6QA 5EYFA 3O97A 3CSBA 2FYIA 2B3FA 4NF8A 3I3VA 3K2DA 3S9LC 4F39A 2Z23A 1QKAA 2O84X 1OQHA 1OQGA 4GVOA 1JEVA 5AA1A 3OELA 1GV8A 1MS7A 3HO7A 4QSDA 3DM0A 3PUXE 4ND9A 4UABA 1Y1ZA 5DTBA 3V5AA 2I6EA 2OLBA 3C33A 4LATA 4PFUA 4H8IA 1EH3A 2M8CA 2Q88A 1P1UA 3IJXB 4PFYA 4FAJA 4KFQA 3SKPA 4OVSA 1BTJA 1OLCA 2ZNUA 1MQIA 3KGCA 2F5XA 1B9JA 4F1YA 1FTLA 4ISUA 4IGRA 4FEDA 3FJMA 1D9VA 4MHFA 4EQ9A 4XIGQ 3G3HA 3CRBA 3KN3A 3SEYA 1HSEA 4H1XA 4I1DA 4KCCA 2Y7IA 3PPQA 5A5XA 3LBSA 4G2ZA 4MX6A 3V89B 3PUZE 1IXHA 4K3FA 5CI5A 2V84A 1SI0A 1PB7A 1PBPA 2RC9A 4AB5A 3A3UA 1LB8A 2UVGA 4RY1A 3SESA 4XKNA 2DOJA 1ZMGA 1TFDA 3K1NA 4MBPA 1D4NA 3U94A 2Q2AA 3QXMA 2RC7A 2DP8A 1TWYA 3UP9A 1Y3QA 3F11A 3TMGA 1XS5A 1I6AA 2F8DA 3M3FA 4YB6A 1MQHA 3G3KA 4FE8A 4O3AA 3VLUA 3DELB 4R9FA 4BDOA 4GXAA 3FVOA 3MP1A 4C1TA 4FIMA 1QVSA 4NHBA 2QJEA 4N91A 4POXA 1BKAA 3A09A 4OWDA 2OWTA 4KYEA 3TQWA 3OO7A 5I5PA 1N0TA 3K01A 1M5FA 3BKIB 1LBCA 2DE2A 4F3GA 2I3VA 3BFTA 1B3GA 3PU5A 3OEKA 4AQ4A 4DI3D 2CEXA 2DQVA 4P0GA 2OJTA 1MY3A 2GHBA 2DE4A 1SQYA 4OENA 2Y7KA 4PFRA 4IO3A 2ZYNA 4UACA 3QIMA 3O6HA 1GGGA 3M8UA 2LAOA 1N3WA 3N6UA 5BWJA 3QSLA 3GYYA 2ALUA 3UGWA 1XC1A 2XX9A 1DPEA 1QUKA 2UYFA 3H03A 3Q26A 1MDQA 4NF8B 3CSGA 1Y20A 2XXQA 3TTKA 4DXUA 1MM7A 3ECRA 2H9BA 1MG1A 2XA5A 2NVUB 4MLVA 2PT2A 1H76A 3C35A 4MLQA 4C0RA 1SI1A 3TEPA 1B2HA 4IY5A 1XVXA 2F97A 2Y7WA 1RKMA 3QUJA 2Y7PA 5AA3A 2PBWA 4MNIA 3EHUA 1LAFE 1H44A 1B52A 2XWOA 2HZLA 3G3FA 1B51A 4G68A 3RLFE 5TP9B 1UTBB 4G4PA 3H6TA 5H8QA 2H25A 2CEYA 4N8GA 3A3CA 3K6UA 3O9PA 4EDPA 2V3UA 2XXUA 2UVHA 3OO6A 2PMSA 3MWBA 4ELRA 5CMCA 4JXIA 3MVXA 4OMBA 2DWAA 4F18A 5HBCA 5I58A 3MJNA 3O6IA 2XXRA 4F1UA 3V83A 4MNCA 2Z8EA 4QHQA 5L8DA 5IAIA 5H8NA 1WDNA 2ZZWA 4WEDA 3O29A 5HM4B 1P99A 4N6DA 2ZYOA 2O7UA 4O3CA 4WKMA 5LTCA 3T9XB 3FV1A 1FTKA 1B5IA 1URGA 2QS4A 3IOVA 3CI8A 1R9LA 1M5CA 3VLVA 4H8JA 4LZ7A 2NWJA 2I49A 4YU0A 2HQ0A 4DIGA 2V4CA 2V3QA 1B05A 3OSQA 1FQDA 3G7WA 1MPBA 4POWA 1ANFA 3KSXA 1N7WA 3VLWA 5DEXA 3IB1A 2ZYKA 4OVTA 1MM6A 2GFEA 3LSWA 1N7XA 3WAEA 2XXIA 5JEIA 3UIFA 3IK6B 4ZEBA 2V93A 4DXBA 4QFLA 3IB0A 4ZZAA 4LQ5A 3JZJA 3GLBA 1FQCA 3FJGA 4GXSB 3QK6A 3U93A 4JSDA 1FTMA 5IM2A 3HHGA 1Y3NA 2I0BA 2HPGA 1Z7NE 2VD2A 1N3XA 1LFGA 1JQFA 3SEXA 4N15A 4QRZA 1NNTA 3S9NC 4GFRA 4NMYA 5I84A 2XHDA 4LVQA 1H43A 3PPPA 5I57A 1BP5A 1SD3A 3LSXA 2P2AA 4EUOA 3RTWB 4LZ5A 5DT6A 5TPAB 5TU0A 4YB7A 2KLFA 3VVEA 2R9JA 3MPLA 3FATA 4O7MA 1QUJA 3KJ7A 3MPKA 4OEUA 3UK4A 4PE5B 2OCUA 4O8MA 3T66A 5CBRA 2XWIA 2QS3A 4R72A 1S9TA 3RY3A 1B4HA 2H99A 5AA4B 4BDRA 5AE4A 5J1DA 4XFEA 1B3EA 4C1UA 5M2VA 1R6ZA 2QSXA 3CR9A 1LCTA 3IOWA 3T22A 3TKDA 2XXHA 1SW5A 1IIWA 2F6PA 3E13X 4OTEA 3SEWA 2VPOA 3K6VA 3GZGA 3MBPA 1LGBC 1IXCA 3O2AA 4X1BA 1SYIA 2ABHA 3FGSA 4XTCQ 3HHFA 5I58B 2W7YA 5HPQA 2Z22A 4RPNA 1B40A 4U21A 5IGAA 1AH5A 4RYAA 3KFMA 4DI4B 3P7IA 4NQ8A 3FVNA 2YJPA 4Z0IA 1Y4TA 4F3SA 5H8SA 4E0WA 1B58A 4JWXA 4BDNA 4E0XA 4FATA 3TDJA 3FD3A 2E0SA 4MIJA 3FUZA 3S9MC 3K1MA 4OFOA 1LAGE 2Z8DA 3IOUA 4OHNA 3B50A 4PQJA 5DEXB 3SETA 2F7CA 4P56A 4NGUA 1ELJA 1POY1 1LSTA 1NNKA 2D3IA 3M3KA 1VE4A 5B7DA 3S2VA 1MQGA 2FA7A 5ISUA 1SVXB 1Q35A 5BUUA 5CC2A 4IO6A 1LFHA 2O51A 3VDFA 1PEBA 4O94A 4ZEDA 3MUQA 3OO8A 4KPTA 3FVGA 4R2FA 5TP9A 1URSA 4WXJA 1UTBA 1OVTA 2Q9TA 3FV2A 3KN7A 1UQWA 5KDTB 2P1SA 1QW0A 3FXQA 4F2QA 3N94A 4YKIA 3LSLA 2VD3A 1MXWA 1YTVA 5I57B 4F31B 4GL0A 5CMBA 3W9VA 1JEUA 2O1LA 3LR1A 4JSOA 4KI0E 3Q28A 3B6WA 2F7BA 4NF6B 2ESNA 4TLMB 4M4GA 1N84A 2RCBA 4U4XA 2PYYA 1MY2A 3K02A 3B6QA 4GRKA 4P47A 4O3BA 3OOAA 1IXGA 3TZAA 2DXYA 5I56B 3TELA 2AL4A 3MVZA 4XF5A 2QS1A 3C9HA 1SW2A 3TPAA 4IGTA 4U2RA 4TOZA 4PBHA 4PGPA 1EU8A 3K4UA 1DTZA 4IB2A 3MC2A 1MY4A 4OERA 3PGFA 1BIYA 4HW8A 5ELVA 3U92A 4U4SA 1XHYA 2GHAA 3JV9A 1JVXA 3H6UA 1Y9UA 1ZLQA 2IEEA 3N26A 3KZGA 1DPPA 4IY6A 3VXBA 4RJZA 4OETA 3KOSA 1UIVA 4OA4A 2XD2A 3D4GA 2HFBA 1ZU0A 2V3TA 2CZLA 4KQPA 4H5GA 1A54A 3E4RA 5FTHA 3T9UA 4TLLB 4MEVA 4ESWA 1JETA 5CMKA 1A7LA 3R6UA 3DP4A 4YKPA 1YCJA 3MZBA 2DWHA 5I59A 4G8NA 4KYSA 5K2YA 1A8FA 4IO7A 4NF5A 4EXKA 5TPAA 1NH8A 1JW1A 5B70A 3FVKA 1PBQA 1Y4CA 3IX1A 2XXTA 2AYSA 1VSOA 1LFIA 1DTGA 2R71A 4ONYA 2I4BA 3O28A 2F34A 2HCAA 4HTGA 4FORA 1B0HA 1O64A 1FQEA 5AA4A 3RT8A 2YPNA 3OENA 4N07A 3G3IA 3L6GA 2A5TA 3MP6A 4L17A 1US4A 1ZIUA 1I6BA 2VHAA 4Q5TA 3FXRA 4ZDMA 3ZKLA 2Y84A 4AB6A 3IAZA 4R2BA 1GVCA 2YLNA 2NUVA 4LZ8A 2ANJA 3R7XA 1B1XA 1B0LA 4N13A 3RNNA 1AIVA 2VPNA 3USDA 2FNCA 2ZXTA 5ITOA 4F29A 4NAPA 4PCDA 2B65A 2WX9A 2ZNSA 3GBBA 1FQAA 4YKKA 4JDFA 3TAJA 3JYRA 4XKPA 3H4ZA 4HCYA 3CIJA 1B7UA 5L9SA 1AMFA 2XD3A 4ESXA 4QFPA 4ELOA 3PD8A 3EQ1A 1Z7ME 1Y3PA 1MXXA 1SDXA 3K00A 3HPIA 1XOCA 2WYKA 1MY0A 2XXYA 3C36A 4HS7A 1M5DA 4KYDA 3PPRA 5JTYA 4KD5A 5L9MA 4YZZA 4GLIA 4G8HA 1PC3A 3T9HB 5ITPA 4U23A 5DVJA 1XVYA 4X1DA 1UIUA 3C31A 5I2KB 3O66A 1DSNA 2O69A 4PP0A 4OEVA 2R6GE 4DDDA 4PGNA 1MH3A 3PMVA 4PAKA 4H65A 4KCDA 3PD9A 2ZZXA 3EHSA 4P1EA 1D3KA 5AA2D 4LA9A 4ZS9A 1IZ1A 3RGYA 2I0CA 1T0KA 4YKJA 2F36A 4U1ZA 2QPQA 4X48A 4JWYA 2HAVA 4RK2A 5KDTA 1NNPA 4BDLA 4MCOA 1QUIA 4XEQA 1MPCA 4FJPA 2P0SA 1QULA 1R1NA 4I8CA 4N4UA 4XKQA 3V8XB 5I59B 5CM6A 5H8HB 4JB7A 4NF5B 2G93A 4NF6A 1URDA 3MZ1A 1D9YA 1IEJA 2XXWA 4RXLA 2THIA 1P1OA 4Z7EA 2O7IA 4ELPA 5I56A 2Q8JA 3FZVA 1II5A 4LQ2A 3TTNA 2ZYMA 3KOTA 1CE2A 2DYXA 1B7HA 5IZZA 2O68A 2VGQA 3PUWE 2IA4A 4G77A 1MXUA 2WKYA 2XX8A 4OVQA 3H7MA 4DE8A 2A5TB 3KSJA 3LC8A 3E9XA 4U1OA 1JW4A 4NF0A 5AA2B 1YPNA 3E3KA 3HN0A 4ZEFA 4ECFA 1TXFA 4NWDA 1EZ9A 1AL3A 3LSFB 3VXCA 3CVGA 1USYE 3IO4A 4NF4B 2HAUA 1B1HA 3CFXA 1J1NA 3PV0E 3SEUA 1OLAA 4GL8A 1L5TA 4P0IA 3EPEA 4H5FA 3IL1B 1PB9A 4PETA 2PVUA 4PF8A 4Q30B 3RPWA 5IKBA 2Q2CA 3ZS6A 1YAEA 4N17A 1N76A 4OFJA 3ILUB 1B4ZA 4GQOA 3K1PA 4TQUQ 1P1NA 4N6PA 4YICA 4GWOA 5JTYB 4QF9A 1ZBMA 1OMPA 3SERA 3CG1A 3RTFB 3TTLA 3QAXA 3SDFA 4DCYA 3BFUA 4ZZEA 4ELQA 4PFTA 1NMUA 3VVDA 1JVYA 1B3LA 4LONB 2NXOA 1MQDA 4PDHA 4M1VA 4N6KA 2HZKA 4UA8A 1MQJA 1B46A 4G8MA 2G29A 3I6VA 3QYTA 2XXKA 4P9KA 2NOOA 1O7TA 2I58A 3Q29A 3MAMA 4F22A 4H0WA 4BDMA 1KWHA 4IO5A 3TYHA 3U72A 4OESA 3ODBA 3D4CA 4JWOA 3DP8A 4PFIA 4YAHX 5I2NB 1BLFA 1A8EA 3OO9A 3H3GA 4R9GA 1UTHB 5ICTA 3ZKKA 4ZE9A 2VP1A 3N5LA 1MXZA 2UVJA 4OFLA 2I3WA 1IITA 1FCKA 4Q8RA 1IQ7A 4PF6A 5FHMA 4NTLA 4OVJA 4I62A 1DMBA 2GRVA 3WAFA 3MP8A 3GBAA 4PAFA 1GTKA 1NH7A 2UVIA 1FW0A 3VFJA 3B7DA 4MMPA 3UA8A 1FTJA 2DWIA 3PMWA 1EZOA 3S4UA 2O6AA 1MXVA 2X26A 3FJ7A 5KCJA 4NN3A 1FQFA 1ZJLA 2OWSA 5DVFA 5I2KA 3H6WA 1A55A 5LOMA 2F78A 4MH5A 4U22A 2PFZA 4EF1A 3CG3A 4OQOA 1JW5A 1MH4A 1F9BA 1ZKBA 1B5HA 2RKMA 4XKRA 4MFIA 2XX7A 4HCWA 4X8RA 2AIXA 3C34A 1OVBA 2OBGA 1IUDA 1LAXA 4P8BA 2DE3A 3Q27A 3B6TA 3L6HA 4P11A 3VVFA 4LP2B 3OXNA 1HSLA
chains in the Genus database with same CATH superfamily
1M5BA 4DCXA 1VR5A 3CFLA 4OXVA 4MF3A 1ZTYA 3G3GA 3T0JA 4HE0A 4RA1A 2QMXA 4MAGA 1GR2A 1H45A 1P1WA 2VOZA 4BLAA 3CFZA 1QKBA 3PUYE 1P1QA 3THIA 3GXAA 4I9DA 3EF7A 5CRYA 1USYH 4IO4A 1FTOA 4F3BA 2F7AA 2XWKA 1IXIA 3KG2A 4WEPA 1LBBA 5FTIA 5H8HA 4R6HA 3FXBA 2I48A 5DVIA 3M3LA 3I5OA 3PPNA 4OVPA 5F1QA 3HV1A 3HFUA 4F2OA 1NNFA 4QFKA 4R6YA 4EQBA 4THIA 4BDQA 1MRPA 1VFEA 1PDAA 4YB5A 4OANA 4H6DA 3OSRA 2HXWA 3T93B 2ONRA 3C32A 2H5YA 4QFOA 4PFBA 5FHOA 2OK2A 4R6KA 3E79A 2D21A 4QSEA 4R74A 2PT1A 1AOVA 4R73A 2D5WA 3DLNA 1RYXA 2AL5A 2ONKE 4KHZE 1H3DA 4GWYA 1TT1A 4IO2A 4PE3A 4PC9A 3K0VA 1NV7A 3TODA 1SW1A 4DZ1A 3H6VA 1S50A 3TCHA 3TUSA 3ZSFA 2O1MA 5AA2A 4Q0CA 4RK9A 3OEMA 1I69A 2UXAA 2CZKA 1MXYA 2XXVA 4ZE8A 4F19A 2RCAA 4NF4A 1Q1KA 1NKXA 2RC8A 4PDDA 3SEVA 2UYEA 4G68C 3VV5A 2V25A 4YMBA 3AXFA 5H8FA 4GOTA 3FXUA 2QS2A 4F3PA 2Q89A 4GIZA 5A5XB 2I4CA 5FHNA 1MDP1 1QJMA 3EHTA 2PX1A 2HEUA 4OZ9A 3TCFA 4NG7A 2PFYA 4X9TA 4FECA 3IB2A 1FQBA 3LUYA 3MW0A 1B6HA 3S9EA 4XXUA 4NE4A 2DS9A 3RN8A 3U65A 3UN6A 5KCJB 3PUVE 1B7ZA 3MQ9A 3RT6B 1LCFA 3IOTA 4JBZA 1EZPA 1LB9A 4LUBA 2DVCA 4OVRA 4GF8A 5CBSA 1XT8A 2F6GA 4MNPA 3VE1B 3IJOB 4PBQA 4ZEIA 5KZTA 3KBRA 2HXRA 4LN5A 2DWJA 4DXCA 5DYHA 1DOTA 2RINA 3MVYA 1B3FA 1S7YA 1OIBA 3MZ9A 4OYVA 3KEIA 2QRYA 4DLDA 2E1SA 5I7IA 4YMAA 1NFTA 3FIRA 1NV0A 3OMBA 4EF2A 3Q25A 2OZZA 4F1VA 1LLSA 3MYUA 3RQTA 3HSTA 2WYPA 4P3LA 2DVZA 3ONMA 1A40A 1VFDA 2REJA 3R26A 5CMMA 3TQLA 1MPDA 5I2NA 4H45A 2BJJX 3EKIA 1UTHA 2REGA 1NL5A 4N8YA 3TTRA 3PMXA 1NUWA 2QMWA 4H67A 5K2XA 1ATGA 3IO6A 3H06B 4GD5A 2XXPA 3DP6A 1R9QA 1O63A 1SW4A 2H4IA 3TCGA 4QFNA 2Y7RA 2CZIA 4NWCA 1DCUA 3NOHA 4P1LA 4GWXA 4RPOA 4EXLA 2WEFA 1TFAA 4PFWA 1NV3A 4PTKA 3TTMA 2FBPA 3G3JA 1POTA 5FBPA 1WODA 3O6GA 3KN8A 4EQ7A 1B5JA 3ILTB 3IORA 1HSJA 4R75A 2ZNTA 3U1OA 4X04A 2A5SA 3FASA 5EHSA 2QL3A 1MY1A 1LAHE 1FPBA 2B3BA 4KR5A 3W9WA 1B32A 1SYHA 1CB6A 2X7QA 3W15C 2XXXA 3PPOA 4G68B 2ZZVA 2HHMA 3UORA 1N04A 3EN3A 5H8QB 2X7PA 1Y1MA 5F7VA 2Z8FA 3MVWA 1WVJA 3IR1A 1M5EA 4RNSA 4ZECA 5EHMA 3TFLA 5JK4A 3RUMA 2XWVA 1PB8A 3K6WA 2H98A 3QUFA 2ZMBA 3KJTA 1CNQA 1RYOA 2F35A 5H8FB 1NV6A 3U8QA 2RF1A 3C4MA 5L9OA 4PAIA 2DXRA 4NEDA 3T96B 3BBRA 3N6TA 3HCQA 1JNFA 5ICQA 1US5A 3OD7A 4FEBA 1B3HA 1SBPA 3K6XA 2GH9A 5H8NB 2ONSA 4ZEKA 3T9VA 2DSFA 1A99A 2GQ1A 4I40A 2CMOA 4NX1A 4QSCA 1AWBA 5IZ1A 1I6QA 2FIEA 5EYFA 3O97A 1FRPA 3CSBA 2FYIA 2B3FA 3FBPA 4NF8A 3I3VA 3K2DA 3S9LC 4F39A 2Z23A 1QKAA 1G0HA 2O84X 1OQHA 1OQGA 4GVOA 1JEVA 5AA1A 3OELA 1GV8A 1MS7A 3HO7A 4QSDA 3DM0A 1NI9A 3PUXE 4ND9A 4UABA 1Y1ZA 5DTBA 3V5AA 5IZ3A 2I6EA 2OLBA 3C33A 4LATA 4PFUA 4H8IA 1IMAA 1EH3A 2M8CA 2Q88A 1P1UA 3IJXB 4PFYA 4FAJA 4JVIA 1DK4A 4KFQA 3SKPA 4GWSA 5ET5A 4OVSA 1BTJA 3RPLB 1OLCA 2ZNUA 1MQIA 2OX3A 3KGCA 2F5XA 1B9JA 4F1YA 1FTLA 4ISUA 4IGRA 4FEDA 4FBPA 3FJMA 1D9VA 4MHFA 4EQ9A 4XIGQ 3G3HA 3CRBA 3KN3A 3SEYA 1HSEA 4H1XA 4I1DA 4KCCA 2Y7IA 2F3BA 3PPQA 5A5XA 3LBSA 4G2ZA 4MX6A 3V89B 3PUZE 1IXHA 1IMDA 1SPIA 4K3FA 5CI5A 2V84A 1SI0A 1PB7A 1PBPA 2RC9A 4AB5A 3A3UA 1LB8A 2UVGA 2QVUA 4RY1A 1Q9DA 4XKNA 3SESA 2DOJA 1ZMGA 1TFDA 3K1NA 5A5LA 3LUZA 4MBPA 1D4NA 1FPKA 3U94A 2Q2AA 3QXMA 2RC7A 2DP8A 1TWYA 3UP9A 1Y3QA 3F11A 3TMGA 1XS5A 1I6AA 2F8DA 3M3FA 4YB6A 1MQHA 3G3KA 4FE8A 3T1BA 4O3AA 3VLUA 3DELB 4R9FA 1FSAA 4BDOA 4GXAA 3FVOA 3MP1A 4C1TA 4FIMA 1QVSA 4NHBA 2QJEA 4N91A 4POXA 1BKAA 3A09A 4OWDA 2OWTA 4KYEA 3TQWA 1FTAA 3OO7A 5I5PA 1N0TA 3K01A 1M5FA 3BKIB 1LBCA 2DE2A 4F3GA 2I3VA 3BFTA 1B3GA 3PU5A 3OEKA 4AQ4A 4DI3D 2CEXA 2DQVA 4P0GA 1LBXA 2OJTA 1MY3A 2GHBA 2DE4A 1SQYA 4OENA 2Y7KA 4QBAA 4PFRA 4IO3A 1LEVA 2ZYNA 4UACA 3QIMA 3O6HA 1FJ9A 1GGGA 3M8UA 1FPGA 2LAOA 1N3WA 3IFAA 3N6UA 5BWJA 3GYYA 3QSLA 2ALUA 3UGWA 1XC1A 2XX9A 1DPEA 1QUKA 2UYFA 3H03A 3Q26A 1MDQA 1QGXA 4NF8B 3CSGA 1Y20A 2XXQA 1DBZA 1RDXA 3TTKA 4DXUA 1MM7A 3ECRA 2H9BA 1MG1A 2XA5A 2NVUB 4MLVA 2PT2A 1H76A 3C35A 5I3SA 1VDWA 4MLQA 4C0RA 1SI1A 3TEPA 1B2HA 4IY5A 1XVXA 2F97A 5IZ3B 2Y7WA 1RKMA 3QUJA 2Y7PA 4I3YA 4JVDA 2PBWA 5AA3A 4MNIA 3EHUA 1LAFE 4GX6A 1H44A 1B52A 2XWOA 2HZLA 3G3FA 1B51A 1LBZA 4G68A 3RLFE 5TP9B 1UTBB 4G4PA 3H6TA 5H8QA 4AS5A 2H25A 2CEYA 4N8GA 3A3CA 3K6UA 3O9PA 4EDPA 2V3UA 2XXUA 2UVHA 3OO6A 2PMSA 1LBVA 3MWBA 4ELRA 5CMCA 4JXIA 3MVXA 4OMBA 2DWAA 4F18A 2Q74A 5HBCA 5I58A 3MJNA 2P3NA 3O6IA 2XXRA 4MNCA 4F1UA 3V83A 2Z8EA 4QHQA 5L8DA 1NV5A 5IAIA 5H8NA 1WDNA 2ZZWA 4WEDA 3O29A 1LBYA 5HM4B 1FPFA 1FBHA 1P99A 1YYZA 2O7UA 2ZYOA 4N6DA 4O3CA 4WKMA 5EQ7A 5LTCA 3T9XB 3FV1A 1FTKA 1B5IA 1URGA 2QS4A 3IOVA 3CI8A 1R9LA 1M5CA 3VLVA 1FPIA 4H8JA 4LZ7A 2NWJA 2I49A 4YU0A 3KBZA 2HQ0A 4DIGA 2V4CA 2V3QA 1B05A 3OSQA 1FQDA 2R8TA 1FPEA 3G7WA 1MPBA 4POWA 1ANFA 3KSXA 1N7WA 1FBCA 3VLWA 5DEXA 1IMCA 3IB1A 3QMFA 2ZYKA 4OVTA 1MM6A 1FBEA 2GFEA 3LSWA 1N7XA 3WAEA 2XXIA 2BJIA 5JEIA 3UIFA 3IK6B 4ZEBA 2V93A 1EYKA 4DXBA 4KXPA 4QFLA 3IB0A 4ZZAA 4LQ5A 3JZJA 1NV2A 3GLBA 1FQCA 3FJGA 4GXSB 3QK6A 3U93A 3RPLA 4JSDA 1FTMA 5IM2A 4GWWA 5F24A 3HHGA 1Y3NA 4N81A 2I0BA 2HPGA 1Z7NE 2VD2A 1N3XA 1LFGA 1JQFA 3SEXA 4N15A 4QRZA 1NNTA 3S9NC 4GFRA 4NMYA 2B4MA 5I84A 2XHDA 4LVQA 1H43A 3PPPA 5I57A 3E78A 1BP5A 1SD3A 3LSXA 2F3DA 2P2AA 4EUOA 3RTWB 5EYHA 4LZ5A 5DT6A 5TPAB 5TU0A 4YB7A 2KLFA 5T3JA 3VVEA 2R9JA 3MPLA 3FATA 4O7MA 1QUJA 3KJ7A 3MPKA 3ISPA 4OEUA 3UK4A 4PE5B 2OCUA 4O8MA 3T66A 5CBRA 2XWIA 2QS3A 4R72A 1S9TA 3RY3A 1B4HA 2H99A 2QFLA 5AA4B 4BDRA 5AE4A 5J1DA 4XFEA 1B3EA 4C1UA 5M2VA 1R6ZA 2QSXA 3CR9A 1LCTA 3IOWA 3T22A 3TKDA 2XXHA 1SW5A 1IIWA 2F6PA 3E13X 4OTEA 3SEWA 1FBDA 2VPOA 3K6VA 1RDZA 3GZGA 3MBPA 1LGBC 1IXCA 3O2AA 4X1BA 2Q8MA 1SYIA 2ABHA 3FGSA 4XTCQ 3HHFA 5I58B 2W7YA 5ET6A 5HPQA 2Z22A 4RPNA 1B40A 4U21A 5IGAA 1AH5A 4RYAA 3KFMA 4DI4B 3P7IA 4NQ8A 3FVNA 2YJPA 4Z0IA 1Y4TA 4F3SA 5H8SA 4E0WA 1B58A 4JWXA 4BDNA 4E0XA 4O7IA 4FATA 3TDJA 3FD3A 2E0SA 4MIJA 3FUZA 3S9MC 3K1MA 4OFOA 1LAGE 2Z8DA 2WBBA 3IOUA 4OHNA 3B50A 4PQJA 5DEXB 3SETA 2F7CA 4P56A 4NGUA 1ELJA 1IMBA 1POY1 1LSTA 1NNKA 2D3IA 3M3KA 1VE4A 5B7DA 3S2VA 1XI6A 1MQGA 2FA7A 5ISUA 4GBVA 1SVXB 1Q35A 5BUUA 5CC2A 4IO6A 1LFHA 2O51A 3VDFA 1PEBA 4O94A 4ZEDA 3MUQA 3OO8A 4KPTA 3FVGA 4GX4A 4R2FA 5TP9A 1URSA 2QVVA 4WXJA 1UTBA 1OVTA 2Q9TA 3KC0A 3FV2A 1FPDA 3KN7A 5EQAA 1UQWA 2WBDA 5KDTB 2P1SA 4AS4A 1QW0A 3FXQA 2DDKA 3B8BA 4F2QA 3N94A 4YKIA 3LSLA 2VD3A 1MXWA 1YTVA 5I57B 4F31B 4GL0A 5CMBA 3W9VA 2B4LA 1JEUA 2O1LA 3LR1A 4JSOA 2Y5LA 3Q28A 4KI0E 3B6WA 3A29A 2F7BA 4NF6B 2ESNA 1NUYA 4TLMB 4M4GA 1N84A 2RCBA 4U4XA 2PYYA 1MY2A 3K02A 4JVCA 3B6QA 4MJOA 4GRKA 4P47A 4O3BA 3OOAA 1IXGA 3TZAA 2DXYA 5I56B 3TELA 2AL4A 3MVZA 4XF5A 2QS1A 3C9HA 1SW2A 3TPAA 4IGTA 4U2RA 1EYIA 4TOZA 4PBHA 4PGPA 1EU8A 3K4UA 1NUZA 1DTZA 4IB2A 3MC2A 1FJ6A 1MY4A 4OERA 3PGFA 1BIYA 4HW8A 2JJKA 1FPJA 5ELVA 3U92A 4U4SA 1XHYA 2GHAA 3JV9A 3KC1A 1JVXA 3H6UA 1Y9UA 1K9ZA 1ZLQA 2IEEA 3N26A 3KZGA 1DPPA 4IY6A 3RYDA 3VXBA 4RJZA 4OETA 3KOSA 1UIVA 4OA4A 2XD2A 3D4GA 2HFBA 1ZU0A 2V3TA 1KA1A 2CZLA 3IFCA 4KQPA 4H5GA 1A54A 3E4RA 5FTHA 3T9UA 4TLLB 4MEVA 4ESWA 1JETA 5CMKA 1A7LA 3R6UA 3DP4A 4YKPA 1YCJA 3MZBA 4HE1A 2DWHA 3ROJA 1KZ8A 5I59A 4G8NA 4KYSA 5K2YA 1A8FA 2CZHA 4IO7A 4NF5A 4EXKA 3BIGA 5TPAA 1NH8A 1JW1A 5B70A 3FVKA 1PBQA 1Y4CA 3IX1A 1KA0A 2XXTA 2AYSA 1VSOA 1LFIA 1DTGA 2R71A 4ONYA 2I4BA 3O28A 2F34A 4GWZA 2HCAA 4HTGA 4FORA 1B0HA 1O64A 1FQEA 5AA4A 3RT8A 2Y5KA 2YPNA 3OENA 4N07A 3G3IA 3L6GA 2A5TA 3MP6A 4L17A 1US4A 1ZIUA 1I6BA 2VHAA 4Q5TA 3FXRA 4ZDMA 3ZKLA 2Y84A 4AB6A 3IAZA 4R2BA 1NV1A 5ESYA 1GVCA 3SZPA 2YLNA 2NUVA 4LZ8A 2ANJA 3R7XA 1B1XA 1B0LA 4N13A 3RNNA 4GWUA 1AIVA 2VPNA 3USDA 2FNCA 2ZXTA 5ITOA 4F29A 4NAPA 4PCDA 2B65A 2WX9A 2ZNSA 3GBBA 1FQAA 4YKKA 4JDFA 3TAJA 3JYRA 4XKPA 3H4ZA 4HCYA 3CIJA 1B7UA 5L9SA 1AMFA 2XD3A 4ESXA 4QFPA 4ELOA 3PD8A 3EQ1A 1Z7ME 1Y3PA 1MXXA 1SDXA 3K00A 3HPIA 1XOCA 1FBFA 1G0IA 2WYKA 1MY0A 2XXYA 3C36A 4HS7A 1M5DA 4KYDA 3PPRA 5JTYA 4KD5A 5L9MA 4YZZA 4GLIA 4G8HA 1PC3A 3T9HB 5ITPA 4U23A 5DVJA 1XVYA 4X1DA 1UIUA 3C31A 5I2KB 2L5VA 3O66A 1DSNA 2O69A 4GX3A 4PP0A 4OEVA 2MKZA 2R6GE 4DDDA 4HXVA 4PGNA 1MH3A 3PMVA 4PAKA 4H65A 3PTYA 4KCDA 3PD9A 2ZZXA 3EHSA 4P1EA 1D3KA 4LA9A 4ZS9A 5AA2D 1IZ1A 3RGYA 2I0CA 1T0KA 1LBWA 4YKJA 2F36A 4U1ZA 1D9QA 2QPQA 2OWZA 2HAVA 4JWYA 4X48A 4RK2A 5KDTA 1NNPA 4BDLA 4MCOA 1QUIA 4XEQA 1MPCA 4GBWA 4FJPA 2P0SA 3D1RA 1QULA 1R1NA 4I8CA 4N4UA 4XKQA 3V8XB 5I59B 5CM6A 5H8HB 4JB7A 5ET7A 4NF5B 2G93A 4NF6A 1URDA 3MZ1A 1D9YA 1IEJA 2XXWA 4RXLA 2THIA 1P1OA 4Z7EA 5EQ9A 2O7IA 4ELPA 5I56A 2Q8JA 3FZVA 1II5A 4LQ2A 3TTNA 2ZYMA 3KOTA 1CE2A 2DYXA 1B7HA 1EYJA 5IZZA 2O68A 2VGQA 3PUWE 2IA4A 4G77A 1MXUA 2WKYA 2XX8A 4OVQA 3H7MA 4DE8A 2A5TB 3KSJA 3LC8A 3BIHA 2VT5A 2PCRA 3E9XA 4U1OA 1JW4A 4NF0A 5AA2B 1YPNA 3E3KA 3HN0A 4ZEFA 4ECFA 1TXFA 4NWDA 1YZ0A 1EZ9A 4IR8A 1AL3A 3LSFB 3VXCA 3CVGA 1USYE 3IO4A 4NF4B 2HAUA 1B1HA 3CFXA 1J1NA 3PV0E 1IMEA 3SEUA 1OLAA 4GL8A 3CHGA 1L5TA 5ET8A 4P0IA 3EPEA 4H5FA 3IL1B 5J16A 1PB9A 4PETA 2PVUA 4PF8A 4Q30B 3RPWA 5IKBA 2Q2CA 3ZS6A 1YAEA 1K9YA 4N17A 1N76A 4OFJA 3ILUB 1B4ZA 4GQOA 3K1PA 4TQUQ 1P1NA 4N6PA 2FIXA 4YICA 4GWOA 4H46A 5JTYB 4QF9A 5DW8A 1ZBMA 1OMPA 3SERA 3CG1A 3RTFB 3TTLA 3QAXA 3SDFA 4DCYA 3BFUA 4ZZEA 1NUXA 4ELQA 4PFTA 1NMUA 3VVDA 1JVYA 2QVRA 1B3LA 4LONB 3MSTA 2NXOA 1MQDA 1NV4A 4PDHA 4M1VA 4N6KA 2HZKA 4UA8A 1MQJA 1B46A 1RDYA 4G8MA 2KQZA 2G29A 3I6VA 3QYTA 2XXKA 4P9KA 4G61A 2NOOA 1O7TA 4HE2A 2I58A 1JP4A 3Q29A 3MAMA 4F22A 1INPA 4H0WA 4BDMA 1KWHA 4IO5A 3TYHA 3U72A 4OESA 3ODBA 3D4CA 4JWOA 3DP8A 4I3EA 4PFIA 4YAHX 5I2NB 1BLFA 1A8EA 3OO9A 4QXDA 3H3GA 4R9GA 1UTHB 5ICTA 3ZKKA 4ZE9A 2VP1A 3N5LA 2FHYA 1MXZA 2UVJA 2P3VA 4OFLA 2I3WA 1IITA 1FCKA 1YXIA 4Q8RA 1IQ7A 4PF6A 5FHMA 4NTLA 4OVJA 4I62A 1DMBA 1FBPA 2GRVA 3WAFA 5EQ8A 3MP8A 3GBAA 4PAFA 1GTKA 1NH7A 2UVIA 1FW0A 3VFJA 1FBGA 3B7DA 4MMPA 1IMFA 3UA8A 1FTJA 2DWIA 3PMWA 1EZOA 3S4UA 2O6AA 1MXVA 2X26A 3FJ7A 5KCJA 4NN3A 1FQFA 1ZJLA 2OWSA 2KR0A 5DVFA 1FPLA 5I2KA 3H6WA 1A55A 5LOMA 2F78A 4MH5A 4U22A 2PFZA 5EYGA 4EF1A 3CG3A 4OQOA 1BK4A 1JW5A 1MH4A 2FVZA 1F9BA 1ZKBA 1B5HA 2RKMA 4XKRA 4MFIA 2XX7A 4HCWA 4X8RA 3LV0A 2AIXA 3C34A 1OVBA 2OBGA 1IUDA 1LAXA 4P8BA 2DE3A 3Q27A 3B6TA 5LDZA 3L6HA 4P11A 3VVFA 4LP2B 3OXNA 1HSLA
chains in the Genus database with same CATH topology
1M5BA 4DCXA 1VR5A 3CFLA 4OXVA 4MF3A 1ZTYA 3G3GA 3T0JA 4HE0A 4RA1A 2QMXA 4MAGA 1GR2A 1H45A 1P1WA 2VOZA 4BLAA 3CFZA 1QKBA 3PUYE 1P1QA 3THIA 3GXAA 4I9DA 3EF7A 5CRYA 1USYH 4IO4A 1FTOA 4F3BA 2F7AA 2XWKA 1IXIA 3KG2A 4WEPA 1LBBA 5FTIA 5H8HA 4R6HA 3FXBA 2I48A 5DVIA 3M3LA 3I5OA 3PPNA 4OVPA 5F1QA 3HV1A 4F2OA 3HFUA 1NNFA 4QFKA 4R6YA 4EQBA 4THIA 4BDQA 1MRPA 1VFEA 1PDAA 4YB5A 4OANA 4H6DA 3OSRA 2HXWA 3T93B 2ONRA 3C32A 2H5YA 4QFOA 5FHOA 4PFBA 2OK2A 4R6KA 3E79A 2D21A 4QSEA 4R74A 2PT1A 1AOVA 4R73A 2D5WA 3DLNA 1RYXA 2AL5A 2ONKE 4KHZE 1H3DA 4GWYA 1TT1A 4IO2A 4PE3A 4PC9A 3K0VA 1NV7A 3TODA 1SW1A 4DZ1A 3H6VA 1S50A 3TCHA 3TUSA 3ZSFA 2O1MA 5AA2A 4Q0CA 4RK9A 3OEMA 1I69A 2UXAA 2CZKA 1MXYA 2XXVA 4ZE8A 4F19A 2RCAA 4NF4A 1Q1KA 1NKXA 2RC8A 4PDDA 3SEVA 2UYEA 4G68C 3VV5A 2V25A 4YMBA 3AXFA 5H8FA 4GOTA 3FXUA 2QS2A 4F3PA 2Q89A 4GIZA 5A5XB 2I4CA 5FHNA 1MDP1 1QJMA 3EHTA 2PX1A 2HEUA 4OZ9A 3TCFA 4NG7A 4X9TA 2PFYA 4FECA 3IB2A 1FQBA 3LUYA 3MW0A 1B6HA 3S9EA 4XXUA 4NE4A 2DS9A 3RN8A 3U65A 3UN6A 5KCJB 3PUVE 1B7ZA 3MQ9A 3RT6B 1LCFA 3IOTA 4JBZA 1EZPA 1LB9A 4LUBA 2DVCA 4OVRA 4GF8A 5CBSA 1XT8A 2F6GA 3VE1B 4MNPA 3IJOB 4PBQA 4ZEIA 5KZTA 3KBRA 2HXRA 4LN5A 2DWJA 4DXCA 5DYHA 1DOTA 2RINA 3MVYA 1B3FA 1S7YA 1OIBA 3MZ9A 4OYVA 3KEIA 2QRYA 4DLDA 2E1SA 5I7IA 4YMAA 1NFTA 3FIRA 1NV0A 3OMBA 4EF2A 3Q25A 2OZZA 4F1VA 1LLSA 3MYUA 3RQTA 3HSTA 2WYPA 4P3LA 2DVZA 3ONMA 1A40A 1VFDA 2REJA 3R26A 5CMMA 3TQLA 1MPDA 5I2NA 4H45A 2BJJX 3EKIA 1UTHA 2REGA 1NL5A 4N8YA 3TTRA 3PMXA 2QMWA 1NUWA 4H67A 5K2XA 1ATGA 3IO6A 3H06B 4GD5A 2XXPA 3DP6A 1R9QA 1O63A 1SW4A 2H4IA 3TCGA 4QFNA 2Y7RA 4NWCA 2CZIA 1DCUA 3NOHA 4P1LA 4RPOA 4GWXA 4EXLA 2WEFA 1TFAA 4PFWA 1NV3A 4PTKA 3TTMA 3G3JA 2FBPA 1POTA 5FBPA 1WODA 3O6GA 3KN8A 4EQ7A 1B5JA 3ILTB 3IORA 1HSJA 4R75A 2ZNTA 3U1OA 4X04A 2A5SA 3FASA 5EHSA 2QL3A 1MY1A 1LAHE 1FPBA 2B3BA 4KR5A 3W9WA 1B32A 1SYHA 1CB6A 2X7QA 3W15C 2XXXA 3PPOA 4G68B 2ZZVA 2HHMA 3UORA 1N04A 3EN3A 5H8QB 2X7PA 1Y1MA 5F7VA 2Z8FA 3MVWA 1WVJA 3IR1A 1M5EA 4RNSA 4ZECA 5EHMA 3TFLA 5JK4A 3RUMA 3K6WA 1PB8A 2XWVA 2H98A 3QUFA 2ZMBA 3KJTA 1CNQA 1RYOA 2F35A 5H8FB 1NV6A 3U8QA 2RF1A 3C4MA 5L9OA 4PAIA 2DXRA 4NEDA 3T96B 3BBRA 3N6TA 3HCQA 1JNFA 5ICQA 1US5A 3OD7A 4FEBA 1B3HA 1SBPA 3K6XA 2GH9A 5H8NB 2ONSA 4ZEKA 3T9VA 2DSFA 1A99A 2GQ1A 4I40A 2CMOA 4NX1A 4QSCA 1AWBA 5IZ1A 1I6QA 2FIEA 5EYFA 3O97A 1FRPA 3CSBA 2FYIA 2B3FA 3FBPA 4NF8A 3I3VA 3K2DA 3S9LC 4F39A 2Z23A 1QKAA 1G0HA 2O84X 1OQHA 1OQGA 4GVOA 1JEVA 5AA1A 3OELA 1GV8A 1MS7A 3HO7A 4QSDA 3DM0A 3PUXE 1NI9A 4ND9A 4UABA 1Y1ZA 5DTBA 3V5AA 5IZ3A 2I6EA 2OLBA 3C33A 4LATA 4PFUA 4H8IA 1IMAA 1EH3A 2M8CA 2Q88A 1P1UA 3IJXB 4PFYA 4FAJA 4JVIA 1DK4A 4KFQA 3SKPA 4GWSA 5ET5A 4OVSA 1BTJA 3RPLB 1OLCA 2ZNUA 1MQIA 3KGCA 2OX3A 2F5XA 1B9JA 4F1YA 1FTLA 4ISUA 4IGRA 4FEDA 4FBPA 3FJMA 1D9VA 4MHFA 4EQ9A 4XIGQ 3G3HA 3CRBA 3KN3A 3SEYA 1HSEA 4H1XA 4I1DA 4KCCA 2Y7IA 2F3BA 3PPQA 5A5XA 3LBSA 4G2ZA 4MX6A 3V89B 3PUZE 1IXHA 1IMDA 1SPIA 4K3FA 5CI5A 2V84A 1SI0A 1PB7A 1PBPA 2RC9A 4AB5A 3A3UA 1LB8A 2UVGA 2QVUA 4RY1A 3SESA 4XKNA 1Q9DA 2DOJA 1ZMGA 1TFDA 3K1NA 5A5LA 3LUZA 4MBPA 1D4NA 1FPKA 3U94A 2Q2AA 3QXMA 2RC7A 2DP8A 1TWYA 3UP9A 1Y3QA 3F11A 3TMGA 1XS5A 1I6AA 2F8DA 3M3FA 4YB6A 1MQHA 3G3KA 4FE8A 3T1BA 4O3AA 3VLUA 3DELB 4R9FA 4BDOA 1FSAA 4GXAA 3FVOA 3MP1A 4C1TA 4FIMA 1QVSA 4NHBA 2QJEA 4N91A 4POXA 1BKAA 3A09A 4OWDA 2OWTA 4KYEA 3TQWA 1FTAA 3OO7A 5I5PA 1N0TA 3K01A 1M5FA 3BKIB 1LBCA 2DE2A 4F3GA 2I3VA 3BFTA 1B3GA 3PU5A 3OEKA 4AQ4A 4DI3D 2CEXA 2DQVA 4P0GA 1LBXA 2OJTA 1MY3A 2GHBA 2DE4A 1SQYA 4OENA 2Y7KA 4QBAA 4PFRA 4IO3A 1LEVA 2ZYNA 4UACA 3QIMA 3O6HA 1FJ9A 1GGGA 3M8UA 1FPGA 2LAOA 1N3WA 3IFAA 3N6UA 5BWJA 3QSLA 3GYYA 2ALUA 3UGWA 1XC1A 2XX9A 1DPEA 1QUKA 2UYFA 3H03A 3Q26A 1MDQA 1QGXA 4NF8B 3CSGA 1Y20A 2XXQA 1DBZA 1RDXA 3TTKA 4DXUA 1MM7A 3ECRA 2H9BA 1MG1A 2XA5A 2NVUB 4MLVA 2PT2A 1H76A 3C35A 5I3SA 1VDWA 4MLQA 4C0RA 1SI1A 3TEPA 1B2HA 4IY5A 1XVXA 2F97A 5IZ3B 2Y7WA 1RKMA 3QUJA 2Y7PA 4I3YA 5AA3A 2PBWA 4JVDA 4MNIA 3EHUA 1LAFE 4GX6A 1H44A 1B52A 2XWOA 2HZLA 3G3FA 1B51A 1LBZA 4G68A 3RLFE 5TP9B 1UTBB 4G4PA 3H6TA 5H8QA 4AS5A 2H25A 2CEYA 4N8GA 3A3CA 3K6UA 3O9PA 4EDPA 2V3UA 2XXUA 2UVHA 3OO6A 2PMSA 1LBVA 3MWBA 4ELRA 5CMCA 4JXIA 3MVXA 4OMBA 2DWAA 4F18A 2Q74A 5HBCA 5I58A 3MJNA 3O6IA 2P3NA 2XXRA 4F1UA 3V83A 4MNCA 2Z8EA 4QHQA 5L8DA 1NV5A 5IAIA 5H8NA 1WDNA 2ZZWA 4WEDA 3O29A 1LBYA 5HM4B 1FPFA 1P99A 1FBHA 2ZYOA 2O7UA 1YYZA 4N6DA 4O3CA 4WKMA 5EQ7A 5LTCA 3T9XB 3FV1A 1FTKA 1B5IA 1URGA 2QS4A 3IOVA 3CI8A 1R9LA 1M5CA 3VLVA 1FPIA 4H8JA 4LZ7A 2NWJA 2I49A 4YU0A 3KBZA 2HQ0A 4DIGA 2V4CA 2V3QA 1B05A 3OSQA 1FQDA 2R8TA 1FPEA 3G7WA 1MPBA 4POWA 1ANFA 3KSXA 1N7WA 1FBCA 3VLWA 5DEXA 1IMCA 3IB1A 3QMFA 2ZYKA 4OVTA 1MM6A 2GFEA 3LSWA 1FBEA 1N7XA 3WAEA 2XXIA 5JEIA 2BJIA 3UIFA 3IK6B 4ZEBA 2V93A 1EYKA 4DXBA 4KXPA 4QFLA 3IB0A 4ZZAA 4LQ5A 3JZJA 3GLBA 1NV2A 1FQCA 3FJGA 4GXSB 3QK6A 3U93A 3RPLA 4JSDA 1FTMA 5IM2A 4GWWA 5F24A 3HHGA 1Y3NA 4N81A 2I0BA 2HPGA 1Z7NE 2VD2A 1N3XA 1LFGA 1JQFA 3SEXA 4N15A 4QRZA 1NNTA 3S9NC 4GFRA 4NMYA 2B4MA 5I84A 2XHDA 4LVQA 1H43A 3PPPA 5I57A 3E78A 1BP5A 1SD3A 3LSXA 2F3DA 2P2AA 4EUOA 3RTWB 5EYHA 4LZ5A 5DT6A 5TPAB 5TU0A 4YB7A 2KLFA 5T3JA 3VVEA 2R9JA 3MPLA 3FATA 4O7MA 1QUJA 3KJ7A 3MPKA 4OEUA 3ISPA 3UK4A 4PE5B 2OCUA 4O8MA 3T66A 5CBRA 2XWIA 2QS3A 4R72A 1S9TA 3RY3A 1B4HA 2H99A 2QFLA 5AA4B 4BDRA 5AE4A 5J1DA 4XFEA 1B3EA 4C1UA 5M2VA 1R6ZA 2QSXA 3CR9A 1LCTA 3IOWA 3T22A 3TKDA 2XXHA 1SW5A 1IIWA 2F6PA 3E13X 4OTEA 3SEWA 1FBDA 2VPOA 3K6VA 1RDZA 3GZGA 3MBPA 1LGBC 1IXCA 3O2AA 4X1BA 2Q8MA 1SYIA 2ABHA 3FGSA 4XTCQ 3HHFA 5I58B 2W7YA 5ET6A 5HPQA 2Z22A 4RPNA 1B40A 4U21A 5IGAA 1AH5A 4RYAA 3KFMA 4DI4B 3P7IA 4NQ8A 3FVNA 2YJPA 4Z0IA 1Y4TA 4F3SA 5H8SA 4E0WA 1B58A 4JWXA 4BDNA 4E0XA 4O7IA 4FATA 3TDJA 3FD3A 2E0SA 4MIJA 3FUZA 3S9MC 3K1MA 4OFOA 1LAGE 2Z8DA 3IOUA 2WBBA 4OHNA 3B50A 4PQJA 5DEXB 3SETA 2F7CA 4P56A 4NGUA 1ELJA 1IMBA 1POY1 1LSTA 1NNKA 2D3IA 3M3KA 1VE4A 5B7DA 3S2VA 1XI6A 1MQGA 2FA7A 5ISUA 4GBVA 1SVXB 1Q35A 5BUUA 5CC2A 4IO6A 1LFHA 2O51A 3VDFA 1PEBA 4O94A 4ZEDA 3MUQA 3OO8A 4KPTA 3FVGA 4GX4A 4R2FA 5TP9A 1URSA 2QVVA 4WXJA 1UTBA 1OVTA 2Q9TA 3KC0A 3FV2A 3KN7A 1FPDA 5EQAA 1UQWA 2WBDA 5KDTB 2P1SA 4AS4A 1QW0A 3FXQA 2DDKA 3B8BA 4F2QA 3N94A 4YKIA 3LSLA 2VD3A 1MXWA 1YTVA 5I57B 4F31B 4GL0A 5CMBA 3W9VA 2B4LA 1JEUA 2O1LA 3LR1A 4JSOA 4KI0E 3Q28A 2Y5LA 3B6WA 3A29A 2F7BA 4NF6B 2ESNA 4TLMB 1NUYA 4M4GA 1N84A 2RCBA 4U4XA 2PYYA 1MY2A 3K02A 4JVCA 3B6QA 4MJOA 4GRKA 4P47A 4O3BA 3OOAA 1IXGA 3TZAA 2DXYA 5I56B 3TELA 2AL4A 3MVZA 4XF5A 2QS1A 3C9HA 1SW2A 3TPAA 4IGTA 4U2RA 4TOZA 1EYIA 4PBHA 4PGPA 1EU8A 3K4UA 1NUZA 1DTZA 4IB2A 3MC2A 1FJ6A 1MY4A 4OERA 3PGFA 1BIYA 4HW8A 2JJKA 1FPJA 5ELVA 3U92A 4U4SA 1XHYA 2GHAA 3JV9A 3KC1A 1JVXA 3H6UA 1Y9UA 1K9ZA 1ZLQA 2IEEA 3N26A 3KZGA 1DPPA 4IY6A 3VXBA 3RYDA 4RJZA 4OETA 3KOSA 1UIVA 4OA4A 2XD2A 3D4GA 2HFBA 1ZU0A 2V3TA 1KA1A 2CZLA 4KQPA 3IFCA 4H5GA 1A54A 3E4RA 5FTHA 3T9UA 4TLLB 4MEVA 4ESWA 1JETA 5CMKA 1A7LA 3R6UA 3DP4A 4YKPA 1YCJA 3MZBA 4HE1A 2DWHA 3ROJA 1KZ8A 5I59A 4G8NA 4KYSA 5K2YA 1A8FA 2CZHA 4IO7A 4NF5A 4EXKA 3BIGA 5TPAA 1NH8A 1JW1A 5B70A 3FVKA 1PBQA 1Y4CA 3IX1A 1KA0A 2XXTA 2AYSA 1VSOA 1LFIA 1DTGA 2R71A 4ONYA 2I4BA 3O28A 2F34A 4GWZA 2HCAA 4HTGA 4FORA 1B0HA 1O64A 1FQEA 5AA4A 3RT8A 2Y5KA 2YPNA 3OENA 4N07A 3G3IA 3L6GA 2A5TA 3MP6A 4L17A 1US4A 1ZIUA 1I6BA 2VHAA 4Q5TA 3FXRA 4ZDMA 3ZKLA 2Y84A 4AB6A 3IAZA 4R2BA 1NV1A 5ESYA 1GVCA 3SZPA 2YLNA 2NUVA 4LZ8A 2ANJA 3R7XA 1B1XA 1B0LA 4N13A 3RNNA 4GWUA 1AIVA 2VPNA 3USDA 2FNCA 2ZXTA 5ITOA 4F29A 4NAPA 4PCDA 2B65A 2WX9A 2ZNSA 3GBBA 1FQAA 4YKKA 4JDFA 3TAJA 3JYRA 4XKPA 3H4ZA 4HCYA 3CIJA 1B7UA 5L9SA 1AMFA 2XD3A 4ESXA 4QFPA 4ELOA 3PD8A 3EQ1A 1Z7ME 1Y3PA 1MXXA 1SDXA 3K00A 3HPIA 1XOCA 1FBFA 1G0IA 2WYKA 1MY0A 2XXYA 3C36A 4HS7A 1M5DA 4KYDA 3PPRA 5JTYA 4KD5A 5L9MA 4YZZA 4GLIA 4G8HA 1PC3A 3T9HB 5ITPA 4U23A 5DVJA 1XVYA 4X1DA 1UIUA 3C31A 5I2KB 3O66A 2L5VA 1DSNA 2O69A 4GX3A 4PP0A 4OEVA 2MKZA 2R6GE 4DDDA 4HXVA 4PGNA 1MH3A 3PMVA 4PAKA 4H65A 3PTYA 4KCDA 3PD9A 2ZZXA 3EHSA 4P1EA 1D3KA 5AA2D 4LA9A 4ZS9A 1IZ1A 3RGYA 2I0CA 1T0KA 1LBWA 4YKJA 2F36A 4U1ZA 2QPQA 4X48A 4JWYA 2HAVA 1D9QA 2OWZA 4RK2A 5KDTA 1NNPA 4BDLA 4MCOA 1QUIA 4XEQA 1MPCA 4GBWA 4FJPA 2P0SA 3D1RA 1QULA 1R1NA 4I8CA 4N4UA 4XKQA 3V8XB 5I59B 5CM6A 5H8HB 4JB7A 5ET7A 4NF5B 2G93A 4NF6A 1URDA 3MZ1A 1D9YA 1IEJA 2XXWA 4RXLA 2THIA 1P1OA 4Z7EA 5EQ9A 2O7IA 4ELPA 5I56A 2Q8JA 3FZVA 1II5A 4LQ2A 3TTNA 2ZYMA 3KOTA 1CE2A 2DYXA 1B7HA 1EYJA 5IZZA 2O68A 2VGQA 3PUWE 2IA4A 4G77A 1MXUA 2WKYA 2XX8A 4OVQA 3H7MA 4DE8A 2A5TB 3KSJA 3LC8A 3BIHA 2VT5A 2PCRA 3E9XA 4U1OA 1JW4A 4NF0A 5AA2B 1YPNA 3E3KA 3HN0A 4ZEFA 4ECFA 1TXFA 4NWDA 1YZ0A 1EZ9A 4IR8A 1AL3A 3LSFB 3VXCA 3CVGA 1USYE 3IO4A 4NF4B 2HAUA 1B1HA 3CFXA 1J1NA 3PV0E 1IMEA 3SEUA 1OLAA 4GL8A 3CHGA 1L5TA 5ET8A 4P0IA 3EPEA 4H5FA 3IL1B 5J16A 1PB9A 4PETA 2PVUA 4PF8A 4Q30B 3RPWA 5IKBA 2Q2CA 3ZS6A 1YAEA 1K9YA 4N17A 1N76A 4OFJA 3ILUB 1B4ZA 4GQOA 3K1PA 4TQUQ 1P1NA 4N6PA 2FIXA 4YICA 4GWOA 4H46A 5JTYB 4QF9A 5DW8A 1ZBMA 1OMPA 3SERA 3CG1A 3RTFB 3TTLA 3QAXA 3SDFA 4DCYA 3BFUA 4ZZEA 1NUXA 4ELQA 4PFTA 1NMUA 3VVDA 1JVYA 2QVRA 1B3LA 4LONB 3MSTA 2NXOA 1MQDA 1NV4A 4PDHA 4M1VA 4N6KA 2HZKA 4UA8A 1MQJA 1B46A 1RDYA 4G8MA 2KQZA 2G29A 3I6VA 3QYTA 2XXKA 4P9KA 4G61A 2NOOA 1O7TA 4HE2A 2I58A 3Q29A 1JP4A 3MAMA 4F22A 1INPA 4H0WA 4BDMA 1KWHA 4IO5A 3TYHA 3U72A 4OESA 3ODBA 3D4CA 4JWOA 3DP8A 4I3EA 4PFIA 4YAHX 5I2NB 1BLFA 1A8EA 3OO9A 4QXDA 3H3GA 4R9GA 1UTHB 5ICTA 3ZKKA 4ZE9A 2VP1A 3N5LA 2FHYA 1MXZA 2UVJA 2P3VA 4OFLA 2I3WA 1IITA 1FCKA 1YXIA 4Q8RA 1IQ7A 4PF6A 5FHMA 4NTLA 4OVJA 4I62A 1DMBA 1FBPA 2GRVA 3WAFA 5EQ8A 3MP8A 3GBAA 4PAFA 1GTKA 1NH7A 2UVIA 1FW0A 3VFJA 1FBGA 3B7DA 4MMPA 1IMFA 3UA8A 1FTJA 2DWIA 3PMWA 1EZOA 3S4UA 2O6AA 1MXVA 2X26A 3FJ7A 5KCJA 4NN3A 1FQFA 1ZJLA 2OWSA 2KR0A 5DVFA 1FPLA 5I2KA 3H6WA 1A55A 5LOMA 2F78A 4MH5A 4U22A 2PFZA 5EYGA 4EF1A 3CG3A 4OQOA 1BK4A 1JW5A 1MH4A 2FVZA 1F9BA 1ZKBA 1B5HA 2RKMA 4XKRA 4MFIA 2XX7A 4HCWA 4X8RA 3LV0A 2AIXA 3C34A 1OVBA 2OBGA 1IUDA 1LAXA 4P8BA 2DE3A 3Q27A 3B6TA 5LDZA 3L6HA 4P11A 3VVFA 4LP2B 3OXNA 1HSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5B A;  4DCX A;  1VR5 A;  3CFL A;  4OXV A;  4MF3 A;  1ZTY A;  3G3G A;  4RA1 A;  2QMX A;  4MAG A;  1GR2 A;  1H45 A;  1P1W A;  2VOZ A;  4BLA A;  3CFZ A;  1QKB A;  3PUY E;  1P1Q A;  3THI A;  3GXA A;  4I9D A;  3EF7 A;  5CRY A;  1USY H;  4IO4 A;  1FTO A;  4F3B A;  2F7A A;  2XWK A;  1IXI A;  3KG2 A;  4WEP A;  1LBB A;  5FTI A;  5H8H A;  4R6H A;  3FXB A;  2I48 A;  5DVI A;  3M3L A;  3I5O A;  3PPN A;  4OVP A;  5F1Q A;  3HV1 A;  4F2O A;  1NNF A;  4QFK A;  4R6Y A;  4EQB A;  4THI A;  4BDQ A;  1MRP A;  1VFE A;  1PDA A;  4YB5 A;  4OAN A;  4H6D A;  3OSR A;  2HXW A;  3T93 B;  2ONR A;  3C32 A;  2H5Y A;  4QFO A;  5FHO A;  4PFB A;  2OK2 A;  4R6K A;  2D21 A;  4QSE A;  4R74 A;  2PT1 A;  1AOV A;  4R73 A;  2D5W A;  3DLN A;  1RYX A;  2AL5 A;  2ONK E;  4KHZ E;  1H3D A;  1TT1 A;  4IO2 A;  4PE3 A;  4PC9 A;  3K0V A;  3TOD A;  1SW1 A;  4DZ1 A;  3H6V A;  1S50 A;  3TCH A;  3TUS A;  3ZSF A;  2O1M A;  5AA2 A;  4Q0C A;  4RK9 A;  3OEM A;  1I69 A;  2UXA A;  1MXY A;  2XXV A;  4ZE8 A;  4F19 A;  2RCA A;  4NF4 A;  1Q1K A;  1NKX A;  2RC8 A;  4PDD A;  3SEV A;  2UYE A;  4G68 C;  3VV5 A;  2V25 A;  4YMB A;  3AXF A;  5H8F A;  4GOT A;  3FXU A;  2QS2 A;  4F3P A;  2Q89 A;  4GIZ A;  5A5X B;  2I4C A;  5FHN A;  1MDP 1;  1QJM A;  3EHT A;  2PX1 A;  2HEU A;  4OZ9 A;  3TCF A;  4NG7 A;  4X9T A;  2PFY A;  4FEC A;  3IB2 A;  1FQB A;  3LUY A;  3MW0 A;  1B6H A;  3S9E A;  4XXU A;  4NE4 A;  2DS9 A;  3RN8 A;  3U65 A;  3UN6 A;  5KCJ B;  3PUV E;  1B7Z A;  3MQ9 A;  3RT6 B;  1LCF A;  3IOT A;  4JBZ A;  1EZP A;  1LB9 A;  4LUB A;  2DVC A;  4OVR A;  4GF8 A;  5CBS A;  1XT8 A;  2F6G A;  3VE1 B;  4MNP A;  3IJO B;  4PBQ A;  4ZEI A;  5KZT A;  3KBR A;  4LN5 A;  2DWJ A;  4DXC A;  5DYH A;  1DOT A;  2RIN A;  3MVY A;  1B3F A;  1S7Y A;  1OIB A;  3MZ9 A;  4OYV A;  3KEI A;  2QRY A;  4DLD A;  2E1S A;  5I7I A;  4YMA A;  1NFT A;  3FIR A;  3OMB A;  4EF2 A;  3Q25 A;  2OZZ A;  4F1V A;  1LLS A;  3RQT A;  3HST A;  2WYP A;  4P3L A;  2DVZ A;  3ONM A;  1A40 A;  1VFD A;  2REJ A;  3R26 A;  5CMM A;  3TQL A;  1MPD A;  5I2N A;  2BJJ X;  1UTH A;  2REG A;  1NL5 A;  4N8Y A;  3TTR A;  3PMX A;  2QMW A;  4H67 A;  5K2X A;  1ATG A;  3IO6 A;  3H06 B;  4GD5 A;  2XXP A;  3DP6 A;  1R9Q A;  1O63 A;  1SW4 A;  2H4I A;  3TCG A;  4QFN A;  2Y7R A;  4NWC A;  4P1L A;  4RPO A;  4EXL A;  1TFA A;  4PFW A;  3TTM A;  3G3J A;  1POT A;  1WOD A;  3O6G A;  3KN8 A;  4EQ7 A;  1B5J A;  3ILT B;  3IOR A;  1HSJ A;  4R75 A;  2ZNT A;  3U1O A;  4X04 A;  2A5S A;  3FAS A;  5EHS A;  2QL3 A;  1MY1 A;  1LAH E;  2B3B A;  4KR5 A;  3W9W A;  1B32 A;  1SYH A;  1CB6 A;  2X7Q A;  3W15 C;  2XXX A;  3PPO A;  4G68 B;  2ZZV A;  3UOR A;  1N04 A;  3EN3 A;  5H8Q B;  2X7P A;  1Y1M A;  5F7V A;  2Z8F A;  3MVW A;  1WVJ A;  3IR1 A;  1M5E A;  4RNS A;  4ZEC A;  5EHM A;  3TFL A;  5JK4 A;  3RUM A;  3K6W A;  1PB8 A;  2XWV A;  2H98 A;  3QUF A;  2ZMB A;  3KJT A;  1RYO A;  2F35 A;  5H8F B;  3U8Q A;  2RF1 A;  3C4M A;  5L9O A;  4PAI A;  2DXR A;  4NED A;  3T96 B;  3BBR A;  3N6T A;  3HCQ A;  1JNF A;  5ICQ A;  1US5 A;  3OD7 A;  4FEB A;  1B3H A;  1SBP A;  3K6X A;  2GH9 A;  5H8N B;  2ONS A;  4ZEK A;  3T9V A;  2DSF A;  1A99 A;  2CMO A;  4NX1 A;  4QSC A;  1I6Q A;  5EYF A;  3O97 A;  3CSB A;  2FYI A;  2B3F A;  4NF8 A;  3I3V A;  3K2D A;  3S9L C;  4F39 A;  2Z23 A;  1QKA A;  2O84 X;  1OQH A;  1OQG A;  4GVO A;  1JEV A;  5AA1 A;  3OEL A;  1GV8 A;  1MS7 A;  3HO7 A;  4QSD A;  3DM0 A;  3PUX E;  4ND9 A;  4UAB A;  1Y1Z A;  5DTB A;  3V5A A;  2I6E A;  2OLB A;  3C33 A;  4LAT A;  4PFU A;  4H8I A;  1EH3 A;  2M8C A;  2Q88 A;  1P1U A;  3IJX B;  4PFY A;  4FAJ A;  4KFQ A;  3SKP A;  4OVS A;  1BTJ A;  1OLC A;  2ZNU A;  1MQI A;  3KGC A;  2F5X A;  1B9J A;  4F1Y A;  1FTL A;  4ISU A;  4IGR A;  4FED A;  3FJM A;  1D9V A;  4MHF A;  4EQ9 A;  4XIG Q;  3G3H A;  3CRB A;  3KN3 A;  3SEY A;  1HSE A;  4H1X A;  4I1D A;  4KCC A;  2Y7I A;  3PPQ A;  5A5X A;  3LBS A;  4G2Z A;  4MX6 A;  3V89 B;  3PUZ E;  1IXH A;  4K3F A;  5CI5 A;  2V84 A;  1SI0 A;  1PB7 A;  1PBP A;  2RC9 A;  4AB5 A;  3A3U A;  1LB8 A;  2UVG A;  4RY1 A;  3SES A;  4XKN A;  2DOJ A;  1ZMG A;  1TFD A;  3K1N A;  4MBP A;  1D4N A;  3U94 A;  2Q2A A;  3QXM A;  2RC7 A;  2DP8 A;  1TWY A;  3UP9 A;  1Y3Q A;  3F11 A;  3TMG A;  1XS5 A;  1I6A A;  2F8D A;  3M3F A;  4YB6 A;  1MQH A;  3G3K A;  4FE8 A;  4O3A A;  3VLU A;  3DEL B;  4R9F A;  4BDO A;  4GXA A;  3FVO A;  3MP1 A;  4C1T A;  4FIM A;  1QVS A;  4NHB A;  2QJE A;  4N91 A;  4POX A;  1BKA A;  3A09 A;  4OWD A;  2OWT A;  4KYE A;  3TQW A;  3OO7 A;  5I5P A;  1N0T A;  3K01 A;  1M5F A;  3BKI B;  1LBC A;  2DE2 A;  4F3G A;  2I3V A;  3BFT A;  1B3G A;  3PU5 A;  3OEK A;  4AQ4 A;  4DI3 D;  2CEX A;  2DQV A;  4P0G A;  2OJT A;  1MY3 A;  2GHB A;  2DE4 A;  1SQY A;  4OEN A;  2Y7K A;  4PFR A;  4IO3 A;  2ZYN A;  4UAC A;  3QIM A;  3O6H A;  1GGG A;  3M8U A;  2LAO A;  1N3W A;  3N6U A;  5BWJ A;  3QSL A;  3GYY A;  2ALU A;  3UGW A;  1XC1 A;  2XX9 A;  1DPE A;  1QUK A;  2UYF A;  3H03 A;  3Q26 A;  1MDQ A;  4NF8 B;  3CSG A;  1Y20 A;  2XXQ A;  3TTK A;  4DXU A;  1MM7 A;  3ECR A;  2H9B A;  1MG1 A;  2XA5 A;  2NVU B;  4MLV A;  2PT2 A;  1H76 A;  3C35 A;  4MLQ A;  4C0R A;  1SI1 A;  3TEP A;  1B2H A;  4IY5 A;  1XVX A;  2F97 A;  2Y7W A;  1RKM A;  3QUJ A;  2Y7P A;  5AA3 A;  2PBW A;  4MNI A;  3EHU A;  1LAF E;  1H44 A;  1B52 A;  2XWO A;  2HZL A;  3G3F A;  1B51 A;  4G68 A;  3RLF E;  5TP9 B;  1UTB B;  4G4P A;  3H6T A;  5H8Q A;  2H25 A;  2CEY A;  4N8G A;  3A3C A;  3K6U A;  3O9P A;  4EDP A;  2V3U A;  2XXU A;  2UVH A;  3OO6 A;  2PMS A;  3MWB A;  4ELR A;  5CMC A;  4JXI A;  3MVX A;  4OMB A;  2DWA A;  4F18 A;  5HBC A;  5I58 A;  3MJN A;  3O6I A;  2XXR A;  4F1U A;  3V83 A;  4MNC A;  2Z8E A;  4QHQ A;  5L8D A;  5IAI A;  5H8N A;  1WDN A;  2ZZW A;  4WED A;  3O29 A;  5HM4 B;  1P99 A;  4N6D A;  2ZYO A;  2O7U A;  4O3C A;  4WKM A;  5LTC A;  3T9X B;  3FV1 A;  1FTK A;  1B5I A;  1URG A;  2QS4 A;  3IOV A;  3CI8 A;  1R9L A;  1M5C A;  3VLV A;  4H8J A;  4LZ7 A;  2NWJ A;  2I49 A;  4YU0 A;  2HQ0 A;  4DIG A;  2V4C A;  2V3Q A;  1B05 A;  3OSQ A;  1FQD A;  3G7W A;  1MPB A;  4POW A;  1ANF A;  3KSX A;  1N7W A;  3VLW A;  5DEX A;  3IB1 A;  2ZYK A;  4OVT A;  1MM6 A;  2GFE A;  3LSW A;  1N7X A;  3WAE A;  2XXI A;  5JEI A;  3UIF A;  3IK6 B;  4ZEB A;  2V93 A;  4DXB A;  4QFL A;  3IB0 A;  4ZZA A;  4LQ5 A;  3JZJ A;  3GLB A;  1FQC A;  3FJG A;  4GXS B;  3QK6 A;  3U93 A;  4JSD A;  1FTM A;  5IM2 A;  3HHG A;  1Y3N A;  2I0B A;  2HPG A;  1Z7N E;  2VD2 A;  1N3X A;  1LFG A;  1JQF A;  3SEX A;  4N15 A;  4QRZ A;  1NNT A;  3S9N C;  4GFR A;  4NMY A;  5I84 A;  2XHD A;  4LVQ A;  1H43 A;  3PPP A;  5I57 A;  1BP5 A;  1SD3 A;  3LSX A;  2P2A A;  4EUO A;  3RTW B;  4LZ5 A;  5DT6 A;  5TPA B;  5TU0 A;  4YB7 A;  2KLF A;  3VVE A;  2R9J A;  3MPL A;  3FAT A;  4O7M A;  1QUJ A;  3KJ7 A;  3MPK A;  4OEU A;  3UK4 A;  4PE5 B;  2OCU A;  4O8M A;  3T66 A;  5CBR A;  2XWI A;  2QS3 A;  4R72 A;  1S9T A;  3RY3 A;  1B4H A;  2H99 A;  5AA4 B;  4BDR A;  5AE4 A;  5J1D A;  4XFE A;  1B3E A;  4C1U A;  5M2V A;  1R6Z A;  2QSX A;  3CR9 A;  1LCT A;  3IOW A;  3T22 A;  3TKD A;  2XXH A;  1SW5 A;  1IIW A;  2F6P A;  3E13 X;  4OTE A;  3SEW A;  2VPO A;  3K6V A;  3GZG A;  3MBP A;  1LGB C;  1IXC A;  3O2A A;  4X1B A;  1SYI A;  2ABH A;  3FGS A;  4XTC Q;  3HHF A;  5I58 B;  2W7Y A;  5HPQ A;  2Z22 A;  4RPN A;  1B40 A;  4U21 A;  5IGA A;  1AH5 A;  4RYA A;  3KFM A;  4DI4 B;  3P7I A;  4NQ8 A;  3FVN A;  2YJP A;  4Z0I A;  1Y4T A;  4F3S A;  5H8S A;  4E0W A;  1B58 A;  4JWX A;  4BDN A;  4E0X A;  4FAT A;  3TDJ A;  3FD3 A;  2E0S A;  4MIJ A;  3FUZ A;  3S9M C;  3K1M A;  4OFO A;  1LAG E;  2Z8D A;  3IOU A;  4OHN A;  3B50 A;  4PQJ A;  5DEX B;  3SET A;  2F7C A;  4P56 A;  4NGU A;  1ELJ A;  1POY 1;  1LST A;  1NNK A;  2D3I A;  3M3K A;  1VE4 A;  5B7D A;  3S2V A;  1MQG A;  2FA7 A;  5ISU A;  1SVX B;  1Q35 A;  5BUU A;  5CC2 A;  4IO6 A;  1LFH A;  2O51 A;  3VDF A;  1PEB A;  4O94 A;  4ZED A;  3MUQ A;  3OO8 A;  4KPT A;  3FVG A;  4R2F A;  5TP9 A;  1URS A;  4WXJ A;  1UTB A;  1OVT A;  2Q9T A;  3FV2 A;  3KN7 A;  1UQW A;  5KDT B;  2P1S A;  1QW0 A;  3FXQ A;  4F2Q A;  3N94 A;  4YKI A;  3LSL A;  2VD3 A;  1MXW A;  1YTV A;  5I57 B;  4F31 B;  4GL0 A;  5CMB A;  3W9V A;  1JEU A;  2O1L A;  3LR1 A;  4JSO A;  4KI0 E;  3Q28 A;  3B6W A;  2F7B A;  4NF6 B;  2ESN A;  4TLM B;  4M4G A;  1N84 A;  2RCB A;  4U4X A;  2PYY A;  1MY2 A;  3K02 A;  3B6Q A;  4GRK A;  4P47 A;  4O3B A;  3OOA A;  1IXG A;  3TZA A;  2DXY A;  5I56 B;  3TEL A;  2AL4 A;  3MVZ A;  4XF5 A;  2QS1 A;  3C9H A;  1SW2 A;  3TPA A;  4IGT A;  4U2R A;  4TOZ A;  4PBH A;  4PGP A;  1EU8 A;  3K4U A;  1DTZ A;  4IB2 A;  3MC2 A;  1MY4 A;  4OER A;  3PGF A;  1BIY A;  4HW8 A;  5ELV A;  3U92 A;  4U4S A;  1XHY A;  2GHA A;  3JV9 A;  1JVX A;  3H6U A;  1Y9U A;  1ZLQ A;  2IEE A;  3N26 A;  3KZG A;  1DPP A;  4IY6 A;  3VXB A;  4RJZ A;  4OET A;  3KOS A;  1UIV A;  4OA4 A;  2XD2 A;  3D4G A;  2HFB A;  1ZU0 A;  2V3T A;  2CZL A;  4KQP A;  4H5G A;  1A54 A;  3E4R A;  5FTH A;  3T9U A;  4TLL B;  4MEV A;  4ESW A;  1JET A;  5CMK A;  1A7L A;  3R6U A;  3DP4 A;  4YKP A;  1YCJ A;  3MZB A;  2DWH A;  5I59 A;  4G8N A;  4KYS A;  5K2Y A;  1A8F A;  4IO7 A;  4NF5 A;  4EXK A;  5TPA A;  1NH8 A;  1JW1 A;  5B70 A;  3FVK A;  1PBQ A;  1Y4C A;  3IX1 A;  2XXT A;  2AYS A;  1VSO A;  1LFI A;  1DTG A;  2R71 A;  4ONY A;  2I4B A;  3O28 A;  2F34 A;  2HCA A;  4HTG A;  4FOR A;  1B0H A;  1O64 A;  1FQE A;  5AA4 A;  3RT8 A;  2YPN A;  3OEN A;  4N07 A;  3G3I A;  3L6G A;  2A5T A;  3MP6 A;  4L17 A;  1US4 A;  1ZIU A;  1I6B A;  2VHA A;  4Q5T A;  3FXR A;  4ZDM A;  3ZKL A;  2Y84 A;  4AB6 A;  3IAZ A;  4R2B A;  1GVC A;  2YLN A;  2NUV A;  4LZ8 A;  2ANJ A;  3R7X A;  1B1X A;  1B0L A;  4N13 A;  3RNN A;  1AIV A;  2VPN A;  3USD A;  2FNC A;  2ZXT A;  5ITO A;  4F29 A;  4NAP A;  4PCD A;  2B65 A;  2WX9 A;  2ZNS A;  3GBB A;  1FQA A;  4YKK A;  4JDF A;  3TAJ A;  3JYR A;  4XKP A;  3H4Z A;  4HCY A;  3CIJ A;  1B7U A;  5L9S A;  1AMF A;  2XD3 A;  4ESX A;  4QFP A;  4ELO A;  3PD8 A;  3EQ1 A;  1Z7M E;  1Y3P A;  1MXX A;  1SDX A;  3K00 A;  3HPI A;  1XOC A;  2WYK A;  1MY0 A;  2XXY A;  3C36 A;  4HS7 A;  1M5D A;  4KYD A;  3PPR A;  5JTY A;  4KD5 A;  5L9M A;  4YZZ A;  4GLI A;  4G8H A;  1PC3 A;  3T9H B;  5ITP A;  4U23 A;  5DVJ A;  1XVY A;  4X1D A;  1UIU A;  3C31 A;  5I2K B;  3O66 A;  1DSN A;  2O69 A;  4PP0 A;  4OEV A;  2R6G E;  4DDD A;  4PGN A;  1MH3 A;  3PMV A;  4PAK A;  4H65 A;  4KCD A;  3PD9 A;  2ZZX A;  3EHS A;  4P1E A;  1D3K A;  5AA2 D;  4LA9 A;  4ZS9 A;  1IZ1 A;  3RGY A;  2I0C A;  1T0K A;  4YKJ A;  2F36 A;  4U1Z A;  2QPQ A;  4X48 A;  4JWY A;  2HAV A;  4RK2 A;  5KDT A;  1NNP A;  4BDL A;  4MCO A;  1QUI A;  4XEQ A;  1MPC A;  4FJP A;  2P0S A;  1QUL A;  1R1N A;  4I8C A;  4N4U A;  4XKQ A;  3V8X B;  5I59 B;  5CM6 A;  5H8H B;  4JB7 A;  4NF5 B;  2G93 A;  4NF6 A;  1URD A;  3MZ1 A;  1D9Y A;  1IEJ A;  2XXW A;  4RXL A;  2THI A;  1P1O A;  4Z7E A;  2O7I A;  4ELP A;  5I56 A;  2Q8J A;  3FZV A;  1II5 A;  4LQ2 A;  3TTN A;  2ZYM A;  3KOT A;  1CE2 A;  2DYX A;  1B7H A;  5IZZ A;  2O68 A;  2VGQ A;  3PUW E;  2IA4 A;  4G77 A;  1MXU A;  2WKY A;  2XX8 A;  4OVQ A;  3H7M A;  4DE8 A;  2A5T B;  3KSJ A;  3LC8 A;  3E9X A;  4U1O A;  1JW4 A;  4NF0 A;  5AA2 B;  1YPN A;  3E3K A;  3HN0 A;  4ZEF A;  4ECF A;  1TXF A;  4NWD A;  1EZ9 A;  1AL3 A;  3LSF B;  3VXC A;  3CVG A;  1USY E;  3IO4 A;  4NF4 B;  2HAU A;  1B1H A;  3CFX A;  1J1N A;  3PV0 E;  3SEU A;  1OLA A;  4GL8 A;  1L5T A;  4P0I A;  3EPE A;  4H5F A;  3IL1 B;  1PB9 A;  4PET A;  2PVU A;  4PF8 A;  4Q30 B;  3RPW A;  5IKB A;  2Q2C A;  3ZS6 A;  1YAE A;  4N17 A;  1N76 A;  4OFJ A;  3ILU B;  1B4Z A;  4GQO A;  3K1P A;  4TQU Q;  1P1N A;  4N6P A;  4YIC A;  4GWO A;  5JTY B;  4QF9 A;  1ZBM A;  1OMP A;  3SER A;  3CG1 A;  3RTF B;  3TTL A;  3QAX A;  3SDF A;  4DCY A;  3BFU A;  4ZZE A;  4ELQ A;  4PFT A;  1NMU A;  3VVD A;  1JVY A;  1B3L A;  4LON B;  2NXO A;  1MQD A;  4PDH A;  4M1V A;  4N6K A;  2HZK A;  4UA8 A;  1MQJ A;  1B46 A;  4G8M A;  2G29 A;  3I6V A;  3QYT A;  2XXK A;  4P9K A;  2NOO A;  1O7T A;  2I58 A;  3Q29 A;  3MAM A;  4F22 A;  4H0W A;  4BDM A;  1KWH A;  4IO5 A;  3TYH A;  3U72 A;  4OES A;  3ODB A;  3D4C A;  4JWO A;  3DP8 A;  4PFI A;  4YAH X;  5I2N B;  1BLF A;  1A8E A;  3OO9 A;  3H3G A;  4R9G A;  1UTH B;  5ICT A;  3ZKK A;  4ZE9 A;  2VP1 A;  3N5L A;  1MXZ A;  2UVJ A;  4OFL A;  2I3W A;  1IIT A;  1FCK A;  4Q8R A;  1IQ7 A;  4PF6 A;  5FHM A;  4NTL A;  4OVJ A;  4I62 A;  1DMB A;  2GRV A;  3WAF A;  3MP8 A;  3GBA A;  4PAF A;  1GTK A;  1NH7 A;  2UVI A;  1FW0 A;  3VFJ A;  3B7D A;  4MMP A;  3UA8 A;  1FTJ A;  2DWI A;  3PMW A;  1EZO A;  3S4U A;  2O6A A;  1MXV A;  2X26 A;  3FJ7 A;  5KCJ A;  4NN3 A;  1FQF A;  1ZJL A;  2OWS A;  5DVF A;  5I2K A;  3H6W A;  1A55 A;  5LOM A;  2F78 A;  4MH5 A;  4U22 A;  2PFZ A;  4EF1 A;  3CG3 A;  4OQO A;  1JW5 A;  1MH4 A;  1F9B A;  1ZKB A;  1B5H A;  2RKM A;  4XKR A;  4MFI A;  2XX7 A;  4HCW A;  4X8R A;  2AIX A;  3C34 A;  1OVB A;  2OBG A;  1IUD A;  1LAX A;  4P8B A;  2DE3 A;  3Q27 A;  3B6T A;  3L6H A;  4P11 A;  3VVF A;  4LP2 B;  3OXN A;  1HSL A; 
#chains in the Genus database with same CATH topology
 1M5B A;  4DCX A;  1VR5 A;  3CFL A;  4OXV A;  4MF3 A;  1ZTY A;  3G3G A;  3T0J A;  4HE0 A;  4RA1 A;  2QMX A;  4MAG A;  1GR2 A;  1H45 A;  1P1W A;  2VOZ A;  4BLA A;  3CFZ A;  1QKB A;  3PUY E;  1P1Q A;  3THI A;  3GXA A;  4I9D A;  3EF7 A;  5CRY A;  1USY H;  4IO4 A;  1FTO A;  4F3B A;  2F7A A;  2XWK A;  1IXI A;  3KG2 A;  4WEP A;  1LBB A;  5FTI A;  5H8H A;  4R6H A;  3FXB A;  2I48 A;  5DVI A;  3M3L A;  3I5O A;  3PPN A;  4OVP A;  5F1Q A;  3HV1 A;  3HFU A;  4F2O A;  1NNF A;  4QFK A;  4R6Y A;  4EQB A;  4THI A;  4BDQ A;  1MRP A;  1VFE A;  1PDA A;  4YB5 A;  4OAN A;  4H6D A;  3OSR A;  2HXW A;  3T93 B;  2ONR A;  3C32 A;  2H5Y A;  4QFO A;  4PFB A;  5FHO A;  2OK2 A;  4R6K A;  3E79 A;  2D21 A;  4QSE A;  4R74 A;  2PT1 A;  1AOV A;  4R73 A;  2D5W A;  3DLN A;  1RYX A;  2AL5 A;  2ONK E;  4KHZ E;  1H3D A;  4GWY A;  1TT1 A;  4IO2 A;  4PE3 A;  4PC9 A;  3K0V A;  1NV7 A;  3TOD A;  1SW1 A;  4DZ1 A;  3H6V A;  1S50 A;  3TCH A;  3TUS A;  3ZSF A;  2O1M A;  5AA2 A;  4Q0C A;  4RK9 A;  3OEM A;  1I69 A;  2UXA A;  2CZK A;  1MXY A;  2XXV A;  4ZE8 A;  4F19 A;  2RCA A;  4NF4 A;  1Q1K A;  1NKX A;  2RC8 A;  4PDD A;  3SEV A;  2UYE A;  4G68 C;  3VV5 A;  2V25 A;  4YMB A;  3AXF A;  5H8F A;  4GOT A;  3FXU A;  2QS2 A;  4F3P A;  2Q89 A;  4GIZ A;  5A5X B;  2I4C A;  5FHN A;  1MDP 1;  1QJM A;  3EHT A;  2PX1 A;  2HEU A;  4OZ9 A;  3TCF A;  4NG7 A;  2PFY A;  4X9T A;  4FEC A;  3IB2 A;  1FQB A;  3LUY A;  3MW0 A;  1B6H A;  3S9E A;  4XXU A;  4NE4 A;  2DS9 A;  3RN8 A;  3U65 A;  3UN6 A;  5KCJ B;  3PUV E;  1B7Z A;  3MQ9 A;  3RT6 B;  1LCF A;  3IOT A;  4JBZ A;  1EZP A;  1LB9 A;  4LUB A;  2DVC A;  4OVR A;  4GF8 A;  5CBS A;  1XT8 A;  2F6G A;  4MNP A;  3VE1 B;  3IJO B;  4PBQ A;  4ZEI A;  5KZT A;  3KBR A;  2HXR A;  4LN5 A;  2DWJ A;  4DXC A;  5DYH A;  1DOT A;  2RIN A;  3MVY A;  1B3F A;  1S7Y A;  1OIB A;  3MZ9 A;  4OYV A;  3KEI A;  2QRY A;  4DLD A;  2E1S A;  5I7I A;  4YMA A;  1NFT A;  3FIR A;  1NV0 A;  3OMB A;  4EF2 A;  3Q25 A;  2OZZ A;  4F1V A;  1LLS A;  3MYU A;  3RQT A;  3HST A;  2WYP A;  4P3L A;  2DVZ A;  3ONM A;  1A40 A;  1VFD A;  2REJ A;  3R26 A;  5CMM A;  3TQL A;  1MPD A;  5I2N A;  4H45 A;  2BJJ X;  3EKI A;  1UTH A;  2REG A;  1NL5 A;  4N8Y A;  3TTR A;  3PMX A;  1NUW A;  2QMW A;  4H67 A;  5K2X A;  1ATG A;  3IO6 A;  3H06 B;  4GD5 A;  2XXP A;  3DP6 A;  1R9Q A;  1O63 A;  1SW4 A;  2H4I A;  3TCG A;  4QFN A;  2Y7R A;  2CZI A;  4NWC A;  1DCU A;  3NOH A;  4P1L A;  4GWX A;  4RPO A;  4EXL A;  2WEF A;  1TFA A;  4PFW A;  1NV3 A;  4PTK A;  3TTM A;  2FBP A;  3G3J A;  1POT A;  5FBP A;  1WOD A;  3O6G A;  3KN8 A;  4EQ7 A;  1B5J A;  3ILT B;  3IOR A;  1HSJ A;  4R75 A;  2ZNT A;  3U1O A;  4X04 A;  2A5S A;  3FAS A;  5EHS A;  2QL3 A;  1MY1 A;  1LAH E;  1FPB A;  2B3B A;  4KR5 A;  3W9W A;  1B32 A;  1SYH A;  1CB6 A;  2X7Q A;  3W15 C;  2XXX A;  3PPO A;  4G68 B;  2ZZV A;  2HHM A;  3UOR A;  1N04 A;  3EN3 A;  5H8Q B;  2X7P A;  1Y1M A;  5F7V A;  2Z8F A;  3MVW A;  1WVJ A;  3IR1 A;  1M5E A;  4RNS A;  4ZEC A;  5EHM A;  3TFL A;  5JK4 A;  3RUM A;  2XWV A;  1PB8 A;  3K6W A;  2H98 A;  3QUF A;  2ZMB A;  3KJT A;  1CNQ A;  1RYO A;  2F35 A;  5H8F B;  1NV6 A;  3U8Q A;  2RF1 A;  3C4M A;  5L9O A;  4PAI A;  2DXR A;  4NED A;  3T96 B;  3BBR A;  3N6T A;  3HCQ A;  1JNF A;  5ICQ A;  1US5 A;  3OD7 A;  4FEB A;  1B3H A;  1SBP A;  3K6X A;  2GH9 A;  5H8N B;  2ONS A;  4ZEK A;  3T9V A;  2DSF A;  1A99 A;  2GQ1 A;  4I40 A;  2CMO A;  4NX1 A;  4QSC A;  1AWB A;  5IZ1 A;  1I6Q A;  2FIE A;  5EYF A;  3O97 A;  1FRP A;  3CSB A;  2FYI A;  2B3F A;  3FBP A;  4NF8 A;  3I3V A;  3K2D A;  3S9L C;  4F39 A;  2Z23 A;  1QKA A;  1G0H A;  2O84 X;  1OQH A;  1OQG A;  4GVO A;  1JEV A;  5AA1 A;  3OEL A;  1GV8 A;  1MS7 A;  3HO7 A;  4QSD A;  3DM0 A;  1NI9 A;  3PUX E;  4ND9 A;  4UAB A;  1Y1Z A;  5DTB A;  3V5A A;  5IZ3 A;  2I6E A;  2OLB A;  3C33 A;  4LAT A;  4PFU A;  4H8I A;  1IMA A;  1EH3 A;  2M8C A;  2Q88 A;  1P1U A;  3IJX B;  4PFY A;  4FAJ A;  4JVI A;  1DK4 A;  4KFQ A;  3SKP A;  4GWS A;  5ET5 A;  4OVS A;  1BTJ A;  3RPL B;  1OLC A;  2ZNU A;  1MQI A;  2OX3 A;  3KGC A;  2F5X A;  1B9J A;  4F1Y A;  1FTL A;  4ISU A;  4IGR A;  4FED A;  4FBP A;  3FJM A;  1D9V A;  4MHF A;  4EQ9 A;  4XIG Q;  3G3H A;  3CRB A;  3KN3 A;  3SEY A;  1HSE A;  4H1X A;  4I1D A;  4KCC A;  2Y7I A;  2F3B A;  3PPQ A;  5A5X A;  3LBS A;  4G2Z A;  4MX6 A;  3V89 B;  3PUZ E;  1IXH A;  1IMD A;  1SPI A;  4K3F A;  5CI5 A;  2V84 A;  1SI0 A;  1PB7 A;  1PBP A;  2RC9 A;  4AB5 A;  3A3U A;  1LB8 A;  2UVG A;  2QVU A;  4RY1 A;  1Q9D A;  4XKN A;  3SES A;  2DOJ A;  1ZMG A;  1TFD A;  3K1N A;  5A5L A;  3LUZ A;  4MBP A;  1D4N A;  1FPK A;  3U94 A;  2Q2A A;  3QXM A;  2RC7 A;  2DP8 A;  1TWY A;  3UP9 A;  1Y3Q A;  3F11 A;  3TMG A;  1XS5 A;  1I6A A;  2F8D A;  3M3F A;  4YB6 A;  1MQH A;  3G3K A;  4FE8 A;  3T1B A;  4O3A A;  3VLU A;  3DEL B;  4R9F A;  1FSA A;  4BDO A;  4GXA A;  3FVO A;  3MP1 A;  4C1T A;  4FIM A;  1QVS A;  4NHB A;  2QJE A;  4N91 A;  4POX A;  1BKA A;  3A09 A;  4OWD A;  2OWT A;  4KYE A;  3TQW A;  1FTA A;  3OO7 A;  5I5P A;  1N0T A;  3K01 A;  1M5F A;  3BKI B;  1LBC A;  2DE2 A;  4F3G A;  2I3V A;  3BFT A;  1B3G A;  3PU5 A;  3OEK A;  4AQ4 A;  4DI3 D;  2CEX A;  2DQV A;  4P0G A;  1LBX A;  2OJT A;  1MY3 A;  2GHB A;  2DE4 A;  1SQY A;  4OEN A;  2Y7K A;  4QBA A;  4PFR A;  4IO3 A;  1LEV A;  2ZYN A;  4UAC A;  3QIM A;  3O6H A;  1FJ9 A;  1GGG A;  3M8U A;  1FPG A;  2LAO A;  1N3W A;  3IFA A;  3N6U A;  5BWJ A;  3GYY A;  3QSL A;  2ALU A;  3UGW A;  1XC1 A;  2XX9 A;  1DPE A;  1QUK A;  2UYF A;  3H03 A;  3Q26 A;  1MDQ A;  1QGX A;  4NF8 B;  3CSG A;  1Y20 A;  2XXQ A;  1DBZ A;  1RDX A;  3TTK A;  4DXU A;  1MM7 A;  3ECR A;  2H9B A;  1MG1 A;  2XA5 A;  2NVU B;  4MLV A;  2PT2 A;  1H76 A;  3C35 A;  5I3S A;  1VDW A;  4MLQ A;  4C0R A;  1SI1 A;  3TEP A;  1B2H A;  4IY5 A;  1XVX A;  2F97 A;  5IZ3 B;  2Y7W A;  1RKM A;  3QUJ A;  2Y7P A;  4I3Y A;  4JVD A;  2PBW A;  5AA3 A;  4MNI A;  3EHU A;  1LAF E;  4GX6 A;  1H44 A;  1B52 A;  2XWO A;  2HZL A;  3G3F A;  1B51 A;  1LBZ A;  4G68 A;  3RLF E;  5TP9 B;  1UTB B;  4G4P A;  3H6T A;  5H8Q A;  4AS5 A;  2H25 A;  2CEY A;  4N8G A;  3A3C A;  3K6U A;  3O9P A;  4EDP A;  2V3U A;  2XXU A;  2UVH A;  3OO6 A;  2PMS A;  1LBV A;  3MWB A;  4ELR A;  5CMC A;  4JXI A;  3MVX A;  4OMB A;  2DWA A;  4F18 A;  2Q74 A;  5HBC A;  5I58 A;  3MJN A;  2P3N A;  3O6I A;  2XXR A;  4MNC A;  4F1U A;  3V83 A;  2Z8E A;  4QHQ A;  5L8D A;  1NV5 A;  5IAI A;  5H8N A;  1WDN A;  2ZZW A;  4WED A;  3O29 A;  1LBY A;  5HM4 B;  1FPF A;  1FBH A;  1P99 A;  1YYZ A;  2O7U A;  2ZYO A;  4N6D A;  4O3C A;  4WKM A;  5EQ7 A;  5LTC A;  3T9X B;  3FV1 A;  1FTK A;  1B5I A;  1URG A;  2QS4 A;  3IOV A;  3CI8 A;  1R9L A;  1M5C A;  3VLV A;  1FPI A;  4H8J A;  4LZ7 A;  2NWJ A;  2I49 A;  4YU0 A;  3KBZ A;  2HQ0 A;  4DIG A;  2V4C A;  2V3Q A;  1B05 A;  3OSQ A;  1FQD A;  2R8T A;  1FPE A;  3G7W A;  1MPB A;  4POW A;  1ANF A;  3KSX A;  1N7W A;  1FBC A;  3VLW A;  5DEX A;  1IMC A;  3IB1 A;  3QMF A;  2ZYK A;  4OVT A;  1MM6 A;  1FBE A;  2GFE A;  3LSW A;  1N7X A;  3WAE A;  2XXI A;  2BJI A;  5JEI A;  3UIF A;  3IK6 B;  4ZEB A;  2V93 A;  1EYK A;  4DXB A;  4KXP A;  4QFL A;  3IB0 A;  4ZZA A;  4LQ5 A;  3JZJ A;  1NV2 A;  3GLB A;  1FQC A;  3FJG A;  4GXS B;  3QK6 A;  3U93 A;  3RPL A;  4JSD A;  1FTM A;  5IM2 A;  4GWW A;  5F24 A;  3HHG A;  1Y3N A;  4N81 A;  2I0B A;  2HPG A;  1Z7N E;  2VD2 A;  1N3X A;  1LFG A;  1JQF A;  3SEX A;  4N15 A;  4QRZ A;  1NNT A;  3S9N C;  4GFR A;  4NMY A;  2B4M A;  5I84 A;  2XHD A;  4LVQ A;  1H43 A;  3PPP A;  5I57 A;  3E78 A;  1BP5 A;  1SD3 A;  3LSX A;  2F3D A;  2P2A A;  4EUO A;  3RTW B;  5EYH A;  4LZ5 A;  5DT6 A;  5TPA B;  5TU0 A;  4YB7 A;  2KLF A;  5T3J A;  3VVE A;  2R9J A;  3MPL A;  3FAT A;  4O7M A;  1QUJ A;  3KJ7 A;  3MPK A;  3ISP A;  4OEU A;  3UK4 A;  4PE5 B;  2OCU A;  4O8M A;  3T66 A;  5CBR A;  2XWI A;  2QS3 A;  4R72 A;  1S9T A;  3RY3 A;  1B4H A;  2H99 A;  2QFL A;  5AA4 B;  4BDR A;  5AE4 A;  5J1D A;  4XFE A;  1B3E A;  4C1U A;  5M2V A;  1R6Z A;  2QSX A;  3CR9 A;  1LCT A;  3IOW A;  3T22 A;  3TKD A;  2XXH A;  1SW5 A;  1IIW A;  2F6P A;  3E13 X;  4OTE A;  3SEW A;  1FBD A;  2VPO A;  3K6V A;  1RDZ A;  3GZG A;  3MBP A;  1LGB C;  1IXC A;  3O2A A;  4X1B A;  2Q8M A;  1SYI A;  2ABH A;  3FGS A;  4XTC Q;  3HHF A;  5I58 B;  2W7Y A;  5ET6 A;  5HPQ A;  2Z22 A;  4RPN A;  1B40 A;  4U21 A;  5IGA A;  1AH5 A;  4RYA A;  3KFM A;  4DI4 B;  3P7I A;  4NQ8 A;  3FVN A;  2YJP A;  4Z0I A;  1Y4T A;  4F3S A;  5H8S A;  4E0W A;  1B58 A;  4JWX A;  4BDN A;  4E0X A;  4O7I A;  4FAT A;  3TDJ A;  3FD3 A;  2E0S A;  4MIJ A;  3FUZ A;  3S9M C;  3K1M A;  4OFO A;  1LAG E;  2Z8D A;  2WBB A;  3IOU A;  4OHN A;  3B50 A;  4PQJ A;  5DEX B;  3SET A;  2F7C A;  4P56 A;  4NGU A;  1ELJ A;  1IMB A;  1POY 1;  1LST A;  1NNK A;  2D3I A;  3M3K A;  1VE4 A;  5B7D A;  3S2V A;  1XI6 A;  1MQG A;  2FA7 A;  5ISU A;  4GBV A;  1SVX B;  1Q35 A;  5BUU A;  5CC2 A;  4IO6 A;  1LFH A;  2O51 A;  3VDF A;  1PEB A;  4O94 A;  4ZED A;  3MUQ A;  3OO8 A;  4KPT A;  3FVG A;  4GX4 A;  4R2F A;  5TP9 A;  1URS A;  2QVV A;  4WXJ A;  1UTB A;  1OVT A;  2Q9T A;  3KC0 A;  3FV2 A;  1FPD A;  3KN7 A;  5EQA A;  1UQW A;  2WBD A;  5KDT B;  2P1S A;  4AS4 A;  1QW0 A;  3FXQ A;  2DDK A;  3B8B A;  4F2Q A;  3N94 A;  4YKI A;  3LSL A;  2VD3 A;  1MXW A;  1YTV A;  5I57 B;  4F31 B;  4GL0 A;  5CMB A;  3W9V A;  2B4L A;  1JEU A;  2O1L A;  3LR1 A;  4JSO A;  2Y5L A;  3Q28 A;  4KI0 E;  3B6W A;  3A29 A;  2F7B A;  4NF6 B;  2ESN A;  1NUY A;  4TLM B;  4M4G A;  1N84 A;  2RCB A;  4U4X A;  2PYY A;  1MY2 A;  3K02 A;  4JVC A;  3B6Q A;  4MJO A;  4GRK A;  4P47 A;  4O3B A;  3OOA A;  1IXG A;  3TZA A;  2DXY A;  5I56 B;  3TEL A;  2AL4 A;  3MVZ A;  4XF5 A;  2QS1 A;  3C9H A;  1SW2 A;  3TPA A;  4IGT A;  4U2R A;  1EYI A;  4TOZ A;  4PBH A;  4PGP A;  1EU8 A;  3K4U A;  1NUZ A;  1DTZ A;  4IB2 A;  3MC2 A;  1FJ6 A;  1MY4 A;  4OER A;  3PGF A;  1BIY A;  4HW8 A;  2JJK A;  1FPJ A;  5ELV A;  3U92 A;  4U4S A;  1XHY A;  2GHA A;  3JV9 A;  3KC1 A;  1JVX A;  3H6U A;  1Y9U A;  1K9Z A;  1ZLQ A;  2IEE A;  3N26 A;  3KZG A;  1DPP A;  4IY6 A;  3RYD A;  3VXB A;  4RJZ A;  4OET A;  3KOS A;  1UIV A;  4OA4 A;  2XD2 A;  3D4G A;  2HFB A;  1ZU0 A;  2V3T A;  1KA1 A;  2CZL A;  3IFC A;  4KQP A;  4H5G A;  1A54 A;  3E4R A;  5FTH A;  3T9U A;  4TLL B;  4MEV A;  4ESW A;  1JET A;  5CMK A;  1A7L A;  3R6U A;  3DP4 A;  4YKP A;  1YCJ A;  3MZB A;  4HE1 A;  2DWH A;  3ROJ A;  1KZ8 A;  5I59 A;  4G8N A;  4KYS A;  5K2Y A;  1A8F A;  2CZH A;  4IO7 A;  4NF5 A;  4EXK A;  3BIG A;  5TPA A;  1NH8 A;  1JW1 A;  5B70 A;  3FVK A;  1PBQ A;  1Y4C A;  3IX1 A;  1KA0 A;  2XXT A;  2AYS A;  1VSO A;  1LFI A;  1DTG A;  2R71 A;  4ONY A;  2I4B A;  3O28 A;  2F34 A;  4GWZ A;  2HCA A;  4HTG A;  4FOR A;  1B0H A;  1O64 A;  1FQE A;  5AA4 A;  3RT8 A;  2Y5K A;  2YPN A;  3OEN A;  4N07 A;  3G3I A;  3L6G A;  2A5T A;  3MP6 A;  4L17 A;  1US4 A;  1ZIU A;  1I6B A;  2VHA A;  4Q5T A;  3FXR A;  4ZDM A;  3ZKL A;  2Y84 A;  4AB6 A;  3IAZ A;  4R2B A;  1NV1 A;  5ESY A;  1GVC A;  3SZP A;  2YLN A;  2NUV A;  4LZ8 A;  2ANJ A;  3R7X A;  1B1X A;  1B0L A;  4N13 A;  3RNN A;  4GWU A;  1AIV A;  2VPN A;  3USD A;  2FNC A;  2ZXT A;  5ITO A;  4F29 A;  4NAP A;  4PCD A;  2B65 A;  2WX9 A;  2ZNS A;  3GBB A;  1FQA A;  4YKK A;  4JDF A;  3TAJ A;  3JYR A;  4XKP A;  3H4Z A;  4HCY A;  3CIJ A;  1B7U A;  5L9S A;  1AMF A;  2XD3 A;  4ESX A;  4QFP A;  4ELO A;  3PD8 A;  3EQ1 A;  1Z7M E;  1Y3P A;  1MXX A;  1SDX A;  3K00 A;  3HPI A;  1XOC A;  1FBF A;  1G0I A;  2WYK A;  1MY0 A;  2XXY A;  3C36 A;  4HS7 A;  1M5D A;  4KYD A;  3PPR A;  5JTY A;  4KD5 A;  5L9M A;  4YZZ A;  4GLI A;  4G8H A;  1PC3 A;  3T9H B;  5ITP A;  4U23 A;  5DVJ A;  1XVY A;  4X1D A;  1UIU A;  3C31 A;  5I2K B;  2L5V A;  3O66 A;  1DSN A;  2O69 A;  4GX3 A;  4PP0 A;  4OEV A;  2MKZ A;  2R6G E;  4DDD A;  4HXV A;  4PGN A;  1MH3 A;  3PMV A;  4PAK A;  4H65 A;  3PTY A;  4KCD A;  3PD9 A;  2ZZX A;  3EHS A;  4P1E A;  1D3K A;  4LA9 A;  4ZS9 A;  5AA2 D;  1IZ1 A;  3RGY A;  2I0C A;  1T0K A;  1LBW A;  4YKJ A;  2F36 A;  4U1Z A;  1D9Q A;  2QPQ A;  2OWZ A;  2HAV A;  4JWY A;  4X48 A;  4RK2 A;  5KDT A;  1NNP A;  4BDL A;  4MCO A;  1QUI A;  4XEQ A;  1MPC A;  4GBW A;  4FJP A;  2P0S A;  3D1R A;  1QUL A;  1R1N A;  4I8C A;  4N4U A;  4XKQ A;  3V8X B;  5I59 B;  5CM6 A;  5H8H B;  4JB7 A;  5ET7 A;  4NF5 B;  2G93 A;  4NF6 A;  1URD A;  3MZ1 A;  1D9Y A;  1IEJ A;  2XXW A;  4RXL A;  2THI A;  1P1O A;  4Z7E A;  5EQ9 A;  2O7I A;  4ELP A;  5I56 A;  2Q8J A;  3FZV A;  1II5 A;  4LQ2 A;  3TTN A;  2ZYM A;  3KOT A;  1CE2 A;  2DYX A;  1B7H A;  1EYJ A;  5IZZ A;  2O68 A;  2VGQ A;  3PUW E;  2IA4 A;  4G77 A;  1MXU A;  2WKY A;  2XX8 A;  4OVQ A;  3H7M A;  4DE8 A;  2A5T B;  3KSJ A;  3LC8 A;  3BIH A;  2VT5 A;  2PCR A;  3E9X A;  4U1O A;  1JW4 A;  4NF0 A;  5AA2 B;  1YPN A;  3E3K A;  3HN0 A;  4ZEF A;  4ECF A;  1TXF A;  4NWD A;  1YZ0 A;  1EZ9 A;  4IR8 A;  1AL3 A;  3LSF B;  3VXC A;  3CVG A;  1USY E;  3IO4 A;  4NF4 B;  2HAU A;  1B1H A;  3CFX A;  1J1N A;  3PV0 E;  1IME A;  3SEU A;  1OLA A;  4GL8 A;  3CHG A;  1L5T A;  5ET8 A;  4P0I A;  3EPE A;  4H5F A;  3IL1 B;  5J16 A;  1PB9 A;  4PET A;  2PVU A;  4PF8 A;  4Q30 B;  3RPW A;  5IKB A;  2Q2C A;  3ZS6 A;  1YAE A;  1K9Y A;  4N17 A;  1N76 A;  4OFJ A;  3ILU B;  1B4Z A;  4GQO A;  3K1P A;  4TQU Q;  1P1N A;  4N6P A;  2FIX A;  4YIC A;  4GWO A;  4H46 A;  5JTY B;  4QF9 A;  5DW8 A;  1ZBM A;  1OMP A;  3SER A;  3CG1 A;  3RTF B;  3TTL A;  3QAX A;  3SDF A;  4DCY A;  3BFU A;  4ZZE A;  1NUX A;  4ELQ A;  4PFT A;  1NMU A;  3VVD A;  1JVY A;  2QVR A;  1B3L A;  4LON B;  3MST A;  2NXO A;  1MQD A;  1NV4 A;  4PDH A;  4M1V A;  4N6K A;  2HZK A;  4UA8 A;  1MQJ A;  1B46 A;  1RDY A;  4G8M A;  2KQZ A;  2G29 A;  3I6V A;  3QYT A;  2XXK A;  4P9K A;  4G61 A;  2NOO A;  1O7T A;  4HE2 A;  2I58 A;  1JP4 A;  3Q29 A;  3MAM A;  4F22 A;  1INP A;  4H0W A;  4BDM A;  1KWH A;  4IO5 A;  3TYH A;  3U72 A;  4OES A;  3ODB A;  3D4C A;  4JWO A;  3DP8 A;  4I3E A;  4PFI A;  4YAH X;  5I2N B;  1BLF A;  1A8E A;  3OO9 A;  4QXD A;  3H3G A;  4R9G A;  1UTH B;  5ICT A;  3ZKK A;  4ZE9 A;  2VP1 A;  3N5L A;  2FHY A;  1MXZ A;  2UVJ A;  2P3V A;  4OFL A;  2I3W A;  1IIT A;  1FCK A;  1YXI A;  4Q8R A;  1IQ7 A;  4PF6 A;  5FHM A;  4NTL A;  4OVJ A;  4I62 A;  1DMB A;  1FBP A;  2GRV A;  3WAF A;  5EQ8 A;  3MP8 A;  3GBA A;  4PAF A;  1GTK A;  1NH7 A;  2UVI A;  1FW0 A;  3VFJ A;  1FBG A;  3B7D A;  4MMP A;  1IMF A;  3UA8 A;  1FTJ A;  2DWI A;  3PMW A;  1EZO A;  3S4U A;  2O6A A;  1MXV A;  2X26 A;  3FJ7 A;  5KCJ A;  4NN3 A;  1FQF A;  1ZJL A;  2OWS A;  2KR0 A;  5DVF A;  1FPL A;  5I2K A;  3H6W A;  1A55 A;  5LOM A;  2F78 A;  4MH5 A;  4U22 A;  2PFZ A;  5EYG A;  4EF1 A;  3CG3 A;  4OQO A;  1BK4 A;  1JW5 A;  1MH4 A;  2FVZ A;  1F9B A;  1ZKB A;  1B5H A;  2RKM A;  4XKR A;  4MFI A;  2XX7 A;  4HCW A;  4X8R A;  3LV0 A;  2AIX A;  3C34 A;  1OVB A;  2OBG A;  1IUD A;  1LAX A;  4P8B A;  2DE3 A;  3Q27 A;  3B6T A;  5LDZ A;  3L6H A;  4P11 A;  3VVF A;  4LP2 B;  3OXN A;  1HSL A; 
#chains in the Genus database with same CATH homology
 1M5B A;  4DCX A;  1VR5 A;  3CFL A;  4OXV A;  4MF3 A;  1ZTY A;  3G3G A;  3T0J A;  4HE0 A;  4RA1 A;  2QMX A;  4MAG A;  1GR2 A;  1H45 A;  1P1W A;  2VOZ A;  4BLA A;  3CFZ A;  1QKB A;  3PUY E;  1P1Q A;  3THI A;  3GXA A;  4I9D A;  3EF7 A;  5CRY A;  1USY H;  4IO4 A;  1FTO A;  4F3B A;  2F7A A;  2XWK A;  1IXI A;  3KG2 A;  4WEP A;  1LBB A;  5FTI A;  5H8H A;  4R6H A;  3FXB A;  2I48 A;  5DVI A;  3M3L A;  3I5O A;  3PPN A;  4OVP A;  5F1Q A;  3HV1 A;  4F2O A;  3HFU A;  1NNF A;  4QFK A;  4R6Y A;  4EQB A;  4THI A;  4BDQ A;  1MRP A;  1VFE A;  1PDA A;  4YB5 A;  4OAN A;  4H6D A;  3OSR A;  2HXW A;  3T93 B;  2ONR A;  3C32 A;  2H5Y A;  4QFO A;  5FHO A;  4PFB A;  2OK2 A;  4R6K A;  3E79 A;  2D21 A;  4QSE A;  4R74 A;  2PT1 A;  1AOV A;  4R73 A;  2D5W A;  3DLN A;  1RYX A;  2AL5 A;  2ONK E;  4KHZ E;  1H3D A;  4GWY A;  1TT1 A;  4IO2 A;  4PE3 A;  4PC9 A;  3K0V A;  1NV7 A;  3TOD A;  1SW1 A;  4DZ1 A;  3H6V A;  1S50 A;  3TCH A;  3TUS A;  3ZSF A;  2O1M A;  5AA2 A;  4Q0C A;  4RK9 A;  3OEM A;  1I69 A;  2UXA A;  2CZK A;  1MXY A;  2XXV A;  4ZE8 A;  4F19 A;  2RCA A;  4NF4 A;  1Q1K A;  1NKX A;  2RC8 A;  4PDD A;  3SEV A;  2UYE A;  4G68 C;  3VV5 A;  2V25 A;  4YMB A;  3AXF A;  5H8F A;  4GOT A;  3FXU A;  2QS2 A;  4F3P A;  2Q89 A;  4GIZ A;  5A5X B;  2I4C A;  5FHN A;  1MDP 1;  1QJM A;  3EHT A;  2PX1 A;  2HEU A;  4OZ9 A;  3TCF A;  4NG7 A;  4X9T A;  2PFY A;  4FEC A;  3IB2 A;  1FQB A;  3LUY A;  3MW0 A;  1B6H A;  3S9E A;  4XXU A;  4NE4 A;  2DS9 A;  3RN8 A;  3U65 A;  3UN6 A;  5KCJ B;  3PUV E;  1B7Z A;  3MQ9 A;  3RT6 B;  1LCF A;  3IOT A;  4JBZ A;  1EZP A;  1LB9 A;  4LUB A;  2DVC A;  4OVR A;  4GF8 A;  5CBS A;  1XT8 A;  2F6G A;  3VE1 B;  4MNP A;  3IJO B;  4PBQ A;  4ZEI A;  5KZT A;  3KBR A;  2HXR A;  4LN5 A;  2DWJ A;  4DXC A;  5DYH A;  1DOT A;  2RIN A;  3MVY A;  1B3F A;  1S7Y A;  1OIB A;  3MZ9 A;  4OYV A;  3KEI A;  2QRY A;  4DLD A;  2E1S A;  5I7I A;  4YMA A;  1NFT A;  3FIR A;  1NV0 A;  3OMB A;  4EF2 A;  3Q25 A;  2OZZ A;  4F1V A;  1LLS A;  3MYU A;  3RQT A;  3HST A;  2WYP A;  4P3L A;  2DVZ A;  3ONM A;  1A40 A;  1VFD A;  2REJ A;  3R26 A;  5CMM A;  3TQL A;  1MPD A;  5I2N A;  4H45 A;  2BJJ X;  3EKI A;  1UTH A;  2REG A;  1NL5 A;  4N8Y A;  3TTR A;  3PMX A;  2QMW A;  1NUW A;  4H67 A;  5K2X A;  1ATG A;  3IO6 A;  3H06 B;  4GD5 A;  2XXP A;  3DP6 A;  1R9Q A;  1O63 A;  1SW4 A;  2H4I A;  3TCG A;  4QFN A;  2Y7R A;  4NWC A;  2CZI A;  1DCU A;  3NOH A;  4P1L A;  4RPO A;  4GWX A;  4EXL A;  2WEF A;  1TFA A;  4PFW A;  1NV3 A;  4PTK A;  3TTM A;  3G3J A;  2FBP A;  1POT A;  5FBP A;  1WOD A;  3O6G A;  3KN8 A;  4EQ7 A;  1B5J A;  3ILT B;  3IOR A;  1HSJ A;  4R75 A;  2ZNT A;  3U1O A;  4X04 A;  2A5S A;  3FAS A;  5EHS A;  2QL3 A;  1MY1 A;  1LAH E;  1FPB A;  2B3B A;  4KR5 A;  3W9W A;  1B32 A;  1SYH A;  1CB6 A;  2X7Q A;  3W15 C;  2XXX A;  3PPO A;  4G68 B;  2ZZV A;  2HHM A;  3UOR A;  1N04 A;  3EN3 A;  5H8Q B;  2X7P A;  1Y1M A;  5F7V A;  2Z8F A;  3MVW A;  1WVJ A;  3IR1 A;  1M5E A;  4RNS A;  4ZEC A;  5EHM A;  3TFL A;  5JK4 A;  3RUM A;  3K6W A;  1PB8 A;  2XWV A;  2H98 A;  3QUF A;  2ZMB A;  3KJT A;  1CNQ A;  1RYO A;  2F35 A;  5H8F B;  1NV6 A;  3U8Q A;  2RF1 A;  3C4M A;  5L9O A;  4PAI A;  2DXR A;  4NED A;  3T96 B;  3BBR A;  3N6T A;  3HCQ A;  1JNF A;  5ICQ A;  1US5 A;  3OD7 A;  4FEB A;  1B3H A;  1SBP A;  3K6X A;  2GH9 A;  5H8N B;  2ONS A;  4ZEK A;  3T9V A;  2DSF A;  1A99 A;  2GQ1 A;  4I40 A;  2CMO A;  4NX1 A;  4QSC A;  1AWB A;  5IZ1 A;  1I6Q A;  2FIE A;  5EYF A;  3O97 A;  1FRP A;  3CSB A;  2FYI A;  2B3F A;  3FBP A;  4NF8 A;  3I3V A;  3K2D A;  3S9L C;  4F39 A;  2Z23 A;  1QKA A;  1G0H A;  2O84 X;  1OQH A;  1OQG A;  4GVO A;  1JEV A;  5AA1 A;  3OEL A;  1GV8 A;  1MS7 A;  3HO7 A;  4QSD A;  3DM0 A;  3PUX E;  1NI9 A;  4ND9 A;  4UAB A;  1Y1Z A;  5DTB A;  3V5A A;  5IZ3 A;  2I6E A;  2OLB A;  3C33 A;  4LAT A;  4PFU A;  4H8I A;  1IMA A;  1EH3 A;  2M8C A;  2Q88 A;  1P1U A;  3IJX B;  4PFY A;  4FAJ A;  4JVI A;  1DK4 A;  4KFQ A;  3SKP A;  4GWS A;  5ET5 A;  4OVS A;  1BTJ A;  3RPL B;  1OLC A;  2ZNU A;  1MQI A;  3KGC A;  2OX3 A;  2F5X A;  1B9J A;  4F1Y A;  1FTL A;  4ISU A;  4IGR A;  4FED A;  4FBP A;  3FJM A;  1D9V A;  4MHF A;  4EQ9 A;  4XIG Q;  3G3H A;  3CRB A;  3KN3 A;  3SEY A;  1HSE A;  4H1X A;  4I1D A;  4KCC A;  2Y7I A;  2F3B A;  3PPQ A;  5A5X A;  3LBS A;  4G2Z A;  4MX6 A;  3V89 B;  3PUZ E;  1IXH A;  1IMD A;  1SPI A;  4K3F A;  5CI5 A;  2V84 A;  1SI0 A;  1PB7 A;  1PBP A;  2RC9 A;  4AB5 A;  3A3U A;  1LB8 A;  2UVG A;  2QVU A;  4RY1 A;  3SES A;  4XKN A;  1Q9D A;  2DOJ A;  1ZMG A;  1TFD A;  3K1N A;  5A5L A;  3LUZ A;  4MBP A;  1D4N A;  1FPK A;  3U94 A;  2Q2A A;  3QXM A;  2RC7 A;  2DP8 A;  1TWY A;  3UP9 A;  1Y3Q A;  3F11 A;  3TMG A;  1XS5 A;  1I6A A;  2F8D A;  3M3F A;  4YB6 A;  1MQH A;  3G3K A;  4FE8 A;  3T1B A;  4O3A A;  3VLU A;  3DEL B;  4R9F A;  4BDO A;  1FSA A;  4GXA A;  3FVO A;  3MP1 A;  4C1T A;  4FIM A;  1QVS A;  4NHB A;  2QJE A;  4N91 A;  4POX A;  1BKA A;  3A09 A;  4OWD A;  2OWT A;  4KYE A;  3TQW A;  1FTA A;  3OO7 A;  5I5P A;  1N0T A;  3K01 A;  1M5F A;  3BKI B;  1LBC A;  2DE2 A;  4F3G A;  2I3V A;  3BFT A;  1B3G A;  3PU5 A;  3OEK A;  4AQ4 A;  4DI3 D;  2CEX A;  2DQV A;  4P0G A;  1LBX A;  2OJT A;  1MY3 A;  2GHB A;  2DE4 A;  1SQY A;  4OEN A;  2Y7K A;  4QBA A;  4PFR A;  4IO3 A;  1LEV A;  2ZYN A;  4UAC A;  3QIM A;  3O6H A;  1FJ9 A;  1GGG A;  3M8U A;  1FPG A;  2LAO A;  1N3W A;  3IFA A;  3N6U A;  5BWJ A;  3QSL A;  3GYY A;  2ALU A;  3UGW A;  1XC1 A;  2XX9 A;  1DPE A;  1QUK A;  2UYF A;  3H03 A;  3Q26 A;  1MDQ A;  1QGX A;  4NF8 B;  3CSG A;  1Y20 A;  2XXQ A;  1DBZ A;  1RDX A;  3TTK A;  4DXU A;  1MM7 A;  3ECR A;  2H9B A;  1MG1 A;  2XA5 A;  2NVU B;  4MLV A;  2PT2 A;  1H76 A;  3C35 A;  5I3S A;  1VDW A;  4MLQ A;  4C0R A;  1SI1 A;  3TEP A;  1B2H A;  4IY5 A;  1XVX A;  2F97 A;  5IZ3 B;  2Y7W A;  1RKM A;  3QUJ A;  2Y7P A;  4I3Y A;  5AA3 A;  2PBW A;  4JVD A;  4MNI A;  3EHU A;  1LAF E;  4GX6 A;  1H44 A;  1B52 A;  2XWO A;  2HZL A;  3G3F A;  1B51 A;  1LBZ A;  4G68 A;  3RLF E;  5TP9 B;  1UTB B;  4G4P A;  3H6T A;  5H8Q A;  4AS5 A;  2H25 A;  2CEY A;  4N8G A;  3A3C A;  3K6U A;  3O9P A;  4EDP A;  2V3U A;  2XXU A;  2UVH A;  3OO6 A;  2PMS A;  1LBV A;  3MWB A;  4ELR A;  5CMC A;  4JXI A;  3MVX A;  4OMB A;  2DWA A;  4F18 A;  2Q74 A;  5HBC A;  5I58 A;  3MJN A;  3O6I A;  2P3N A;  2XXR A;  4F1U A;  3V83 A;  4MNC A;  2Z8E A;  4QHQ A;  5L8D A;  1NV5 A;  5IAI A;  5H8N A;  1WDN A;  2ZZW A;  4WED A;  3O29 A;  1LBY A;  5HM4 B;  1FPF A;  1P99 A;  1FBH A;  2ZYO A;  2O7U A;  1YYZ A;  4N6D A;  4O3C A;  4WKM A;  5EQ7 A;  5LTC A;  3T9X B;  3FV1 A;  1FTK A;  1B5I A;  1URG A;  2QS4 A;  3IOV A;  3CI8 A;  1R9L A;  1M5C A;  3VLV A;  1FPI A;  4H8J A;  4LZ7 A;  2NWJ A;  2I49 A;  4YU0 A;  3KBZ A;  2HQ0 A;  4DIG A;  2V4C A;  2V3Q A;  1B05 A;  3OSQ A;  1FQD A;  2R8T A;  1FPE A;  3G7W A;  1MPB A;  4POW A;  1ANF A;  3KSX A;  1N7W A;  1FBC A;  3VLW A;  5DEX A;  1IMC A;  3IB1 A;  3QMF A;  2ZYK A;  4OVT A;  1MM6 A;  2GFE A;  3LSW A;  1FBE A;  1N7X A;  3WAE A;  2XXI A;  5JEI A;  2BJI A;  3UIF A;  3IK6 B;  4ZEB A;  2V93 A;  1EYK A;  4DXB A;  4KXP A;  4QFL A;  3IB0 A;  4ZZA A;  4LQ5 A;  3JZJ A;  3GLB A;  1NV2 A;  1FQC A;  3FJG A;  4GXS B;  3QK6 A;  3U93 A;  3RPL A;  4JSD A;  1FTM A;  5IM2 A;  4GWW A;  5F24 A;  3HHG A;  1Y3N A;  4N81 A;  2I0B A;  2HPG A;  1Z7N E;  2VD2 A;  1N3X A;  1LFG A;  1JQF A;  3SEX A;  4N15 A;  4QRZ A;  1NNT A;  3S9N C;  4GFR A;  4NMY A;  2B4M A;  5I84 A;  2XHD A;  4LVQ A;  1H43 A;  3PPP A;  5I57 A;  3E78 A;  1BP5 A;  1SD3 A;  3LSX A;  2F3D A;  2P2A A;  4EUO A;  3RTW B;  5EYH A;  4LZ5 A;  5DT6 A;  5TPA B;  5TU0 A;  4YB7 A;  2KLF A;  5T3J A;  3VVE A;  2R9J A;  3MPL A;  3FAT A;  4O7M A;  1QUJ A;  3KJ7 A;  3MPK A;  4OEU A;  3ISP A;  3UK4 A;  4PE5 B;  2OCU A;  4O8M A;  3T66 A;  5CBR A;  2XWI A;  2QS3 A;  4R72 A;  1S9T A;  3RY3 A;  1B4H A;  2H99 A;  2QFL A;  5AA4 B;  4BDR A;  5AE4 A;  5J1D A;  4XFE A;  1B3E A;  4C1U A;  5M2V A;  1R6Z A;  2QSX A;  3CR9 A;  1LCT A;  3IOW A;  3T22 A;  3TKD A;  2XXH A;  1SW5 A;  1IIW A;  2F6P A;  3E13 X;  4OTE A;  3SEW A;  1FBD A;  2VPO A;  3K6V A;  1RDZ A;  3GZG A;  3MBP A;  1LGB C;  1IXC A;  3O2A A;  4X1B A;  2Q8M A;  1SYI A;  2ABH A;  3FGS A;  4XTC Q;  3HHF A;  5I58 B;  2W7Y A;  5ET6 A;  5HPQ A;  2Z22 A;  4RPN A;  1B40 A;  4U21 A;  5IGA A;  1AH5 A;  4RYA A;  3KFM A;  4DI4 B;  3P7I A;  4NQ8 A;  3FVN A;  2YJP A;  4Z0I A;  1Y4T A;  4F3S A;  5H8S A;  4E0W A;  1B58 A;  4JWX A;  4BDN A;  4E0X A;  4O7I A;  4FAT A;  3TDJ A;  3FD3 A;  2E0S A;  4MIJ A;  3FUZ A;  3S9M C;  3K1M A;  4OFO A;  1LAG E;  2Z8D A;  3IOU A;  2WBB A;  4OHN A;  3B50 A;  4PQJ A;  5DEX B;  3SET A;  2F7C A;  4P56 A;  4NGU A;  1ELJ A;  1IMB A;  1POY 1;  1LST A;  1NNK A;  2D3I A;  3M3K A;  1VE4 A;  5B7D A;  3S2V A;  1XI6 A;  1MQG A;  2FA7 A;  5ISU A;  4GBV A;  1SVX B;  1Q35 A;  5BUU A;  5CC2 A;  4IO6 A;  1LFH A;  2O51 A;  3VDF A;  1PEB A;  4O94 A;  4ZED A;  3MUQ A;  3OO8 A;  4KPT A;  3FVG A;  4GX4 A;  4R2F A;  5TP9 A;  1URS A;  2QVV A;  4WXJ A;  1UTB A;  1OVT A;  2Q9T A;  3KC0 A;  3FV2 A;  3KN7 A;  1FPD A;  5EQA A;  1UQW A;  2WBD A;  5KDT B;  2P1S A;  4AS4 A;  1QW0 A;  3FXQ A;  2DDK A;  3B8B A;  4F2Q A;  3N94 A;  4YKI A;  3LSL A;  2VD3 A;  1MXW A;  1YTV A;  5I57 B;  4F31 B;  4GL0 A;  5CMB A;  3W9V A;  2B4L A;  1JEU A;  2O1L A;  3LR1 A;  4JSO A;  4KI0 E;  3Q28 A;  2Y5L A;  3B6W A;  3A29 A;  2F7B A;  4NF6 B;  2ESN A;  4TLM B;  1NUY A;  4M4G A;  1N84 A;  2RCB A;  4U4X A;  2PYY A;  1MY2 A;  3K02 A;  4JVC A;  3B6Q A;  4MJO A;  4GRK A;  4P47 A;  4O3B A;  3OOA A;  1IXG A;  3TZA A;  2DXY A;  5I56 B;  3TEL A;  2AL4 A;  3MVZ A;  4XF5 A;  2QS1 A;  3C9H A;  1SW2 A;  3TPA A;  4IGT A;  4U2R A;  4TOZ A;  1EYI A;  4PBH A;  4PGP A;  1EU8 A;  3K4U A;  1NUZ A;  1DTZ A;  4IB2 A;  3MC2 A;  1FJ6 A;  1MY4 A;  4OER A;  3PGF A;  1BIY A;  4HW8 A;  2JJK A;  1FPJ A;  5ELV A;  3U92 A;  4U4S A;  1XHY A;  2GHA A;  3JV9 A;  3KC1 A;  1JVX A;  3H6U A;  1Y9U A;  1K9Z A;  1ZLQ A;  2IEE A;  3N26 A;  3KZG A;  1DPP A;  4IY6 A;  3VXB A;  3RYD A;  4RJZ A;  4OET A;  3KOS A;  1UIV A;  4OA4 A;  2XD2 A;  3D4G A;  2HFB A;  1ZU0 A;  2V3T A;  1KA1 A;  2CZL A;  4KQP A;  3IFC A;  4H5G A;  1A54 A;  3E4R A;  5FTH A;  3T9U A;  4TLL B;  4MEV A;  4ESW A;  1JET A;  5CMK A;  1A7L A;  3R6U A;  3DP4 A;  4YKP A;  1YCJ A;  3MZB A;  4HE1 A;  2DWH A;  3ROJ A;  1KZ8 A;  5I59 A;  4G8N A;  4KYS A;  5K2Y A;  1A8F A;  2CZH A;  4IO7 A;  4NF5 A;  4EXK A;  3BIG A;  5TPA A;  1NH8 A;  1JW1 A;  5B70 A;  3FVK A;  1PBQ A;  1Y4C A;  3IX1 A;  1KA0 A;  2XXT A;  2AYS A;  1VSO A;  1LFI A;  1DTG A;  2R71 A;  4ONY A;  2I4B A;  3O28 A;  2F34 A;  4GWZ A;  2HCA A;  4HTG A;  4FOR A;  1B0H A;  1O64 A;  1FQE A;  5AA4 A;  3RT8 A;  2Y5K A;  2YPN A;  3OEN A;  4N07 A;  3G3I A;  3L6G A;  2A5T A;  3MP6 A;  4L17 A;  1US4 A;  1ZIU A;  1I6B A;  2VHA A;  4Q5T A;  3FXR A;  4ZDM A;  3ZKL A;  2Y84 A;  4AB6 A;  3IAZ A;  4R2B A;  1NV1 A;  5ESY A;  1GVC A;  3SZP A;  2YLN A;  2NUV A;  4LZ8 A;  2ANJ A;  3R7X A;  1B1X A;  1B0L A;  4N13 A;  3RNN A;  4GWU A;  1AIV A;  2VPN A;  3USD A;  2FNC A;  2ZXT A;  5ITO A;  4F29 A;  4NAP A;  4PCD A;  2B65 A;  2WX9 A;  2ZNS A;  3GBB A;  1FQA A;  4YKK A;  4JDF A;  3TAJ A;  3JYR A;  4XKP A;  3H4Z A;  4HCY A;  3CIJ A;  1B7U A;  5L9S A;  1AMF A;  2XD3 A;  4ESX A;  4QFP A;  4ELO A;  3PD8 A;  3EQ1 A;  1Z7M E;  1Y3P A;  1MXX A;  1SDX A;  3K00 A;  3HPI A;  1XOC A;  1FBF A;  1G0I A;  2WYK A;  1MY0 A;  2XXY A;  3C36 A;  4HS7 A;  1M5D A;  4KYD A;  3PPR A;  5JTY A;  4KD5 A;  5L9M A;  4YZZ A;  4GLI A;  4G8H A;  1PC3 A;  3T9H B;  5ITP A;  4U23 A;  5DVJ A;  1XVY A;  4X1D A;  1UIU A;  3C31 A;  5I2K B;  3O66 A;  2L5V A;  1DSN A;  2O69 A;  4GX3 A;  4PP0 A;  4OEV A;  2MKZ A;  2R6G E;  4DDD A;  4HXV A;  4PGN A;  1MH3 A;  3PMV A;  4PAK A;  4H65 A;  3PTY A;  4KCD A;  3PD9 A;  2ZZX A;  3EHS A;  4P1E A;  1D3K A;  5AA2 D;  4LA9 A;  4ZS9 A;  1IZ1 A;  3RGY A;  2I0C A;  1T0K A;  1LBW A;  4YKJ A;  2F36 A;  4U1Z A;  2QPQ A;  4X48 A;  4JWY A;  2HAV A;  1D9Q A;  2OWZ A;  4RK2 A;  5KDT A;  1NNP A;  4BDL A;  4MCO A;  1QUI A;  4XEQ A;  1MPC A;  4GBW A;  4FJP A;  2P0S A;  3D1R A;  1QUL A;  1R1N A;  4I8C A;  4N4U A;  4XKQ A;  3V8X B;  5I59 B;  5CM6 A;  5H8H B;  4JB7 A;  5ET7 A;  4NF5 B;  2G93 A;  4NF6 A;  1URD A;  3MZ1 A;  1D9Y A;  1IEJ A;  2XXW A;  4RXL A;  2THI A;  1P1O A;  4Z7E A;  5EQ9 A;  2O7I A;  4ELP A;  5I56 A;  2Q8J A;  3FZV A;  1II5 A;  4LQ2 A;  3TTN A;  2ZYM A;  3KOT A;  1CE2 A;  2DYX A;  1B7H A;  1EYJ A;  5IZZ A;  2O68 A;  2VGQ A;  3PUW E;  2IA4 A;  4G77 A;  1MXU A;  2WKY A;  2XX8 A;  4OVQ A;  3H7M A;  4DE8 A;  2A5T B;  3KSJ A;  3LC8 A;  3BIH A;  2VT5 A;  2PCR A;  3E9X A;  4U1O A;  1JW4 A;  4NF0 A;  5AA2 B;  1YPN A;  3E3K A;  3HN0 A;  4ZEF A;  4ECF A;  1TXF A;  4NWD A;  1YZ0 A;  1EZ9 A;  4IR8 A;  1AL3 A;  3LSF B;  3VXC A;  3CVG A;  1USY E;  3IO4 A;  4NF4 B;  2HAU A;  1B1H A;  3CFX A;  1J1N A;  3PV0 E;  1IME A;  3SEU A;  1OLA A;  4GL8 A;  3CHG A;  1L5T A;  5ET8 A;  4P0I A;  3EPE A;  4H5F A;  3IL1 B;  5J16 A;  1PB9 A;  4PET A;  2PVU A;  4PF8 A;  4Q30 B;  3RPW A;  5IKB A;  2Q2C A;  3ZS6 A;  1YAE A;  1K9Y A;  4N17 A;  1N76 A;  4OFJ A;  3ILU B;  1B4Z A;  4GQO A;  3K1P A;  4TQU Q;  1P1N A;  4N6P A;  2FIX A;  4YIC A;  4GWO A;  4H46 A;  5JTY B;  4QF9 A;  5DW8 A;  1ZBM A;  1OMP A;  3SER A;  3CG1 A;  3RTF B;  3TTL A;  3QAX A;  3SDF A;  4DCY A;  3BFU A;  4ZZE A;  1NUX A;  4ELQ A;  4PFT A;  1NMU A;  3VVD A;  1JVY A;  2QVR A;  1B3L A;  4LON B;  3MST A;  2NXO A;  1MQD A;  1NV4 A;  4PDH A;  4M1V A;  4N6K A;  2HZK A;  4UA8 A;  1MQJ A;  1B46 A;  1RDY A;  4G8M A;  2KQZ A;  2G29 A;  3I6V A;  3QYT A;  2XXK A;  4P9K A;  4G61 A;  2NOO A;  1O7T A;  4HE2 A;  2I58 A;  3Q29 A;  1JP4 A;  3MAM A;  4F22 A;  1INP A;  4H0W A;  4BDM A;  1KWH A;  4IO5 A;  3TYH A;  3U72 A;  4OES A;  3ODB A;  3D4C A;  4JWO A;  3DP8 A;  4I3E A;  4PFI A;  4YAH X;  5I2N B;  1BLF A;  1A8E A;  3OO9 A;  4QXD A;  3H3G A;  4R9G A;  1UTH B;  5ICT A;  3ZKK A;  4ZE9 A;  2VP1 A;  3N5L A;  2FHY A;  1MXZ A;  2UVJ A;  2P3V A;  4OFL A;  2I3W A;  1IIT A;  1FCK A;  1YXI A;  4Q8R A;  1IQ7 A;  4PF6 A;  5FHM A;  4NTL A;  4OVJ A;  4I62 A;  1DMB A;  1FBP A;  2GRV A;  3WAF A;  5EQ8 A;  3MP8 A;  3GBA A;  4PAF A;  1GTK A;  1NH7 A;  2UVI A;  1FW0 A;  3VFJ A;  1FBG A;  3B7D A;  4MMP A;  1IMF A;  3UA8 A;  1FTJ A;  2DWI A;  3PMW A;  1EZO A;  3S4U A;  2O6A A;  1MXV A;  2X26 A;  3FJ7 A;  5KCJ A;  4NN3 A;  1FQF A;  1ZJL A;  2OWS A;  2KR0 A;  5DVF A;  1FPL A;  5I2K A;  3H6W A;  1A55 A;  5LOM A;  2F78 A;  4MH5 A;  4U22 A;  2PFZ A;  5EYG A;  4EF1 A;  3CG3 A;  4OQO A;  1BK4 A;  1JW5 A;  1MH4 A;  2FVZ A;  1F9B A;  1ZKB A;  1B5H A;  2RKM A;  4XKR A;  4MFI A;  2XX7 A;  4HCW A;  4X8R A;  3LV0 A;  2AIX A;  3C34 A;  1OVB A;  2OBG A;  1IUD A;  1LAX A;  4P8B A;  2DE3 A;  3Q27 A;  3B6T A;  5LDZ A;  3L6H A;  4P11 A;  3VVF A;  4LP2 B;  3OXN A;  1HSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...