4YICA

Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) with bound picolinic acid
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
344
structure length
344
Chain Sequence
ANPTVRWRMSTSWPKSLDTIYGSADELCKRVGQLTDGKFEIRAFPGGELVPSAQNMDAVSNGTVECNHVLSTMYIGKNTALTFDTGLSFGLNARQHNAWIHYGGGLQQLRELYKKYNIVNHVCGNVGVQMGGWYRKEIKSTADLNGLNMRIGGIGGMVLSKLGVVPQQIPPGDIYPALEKGTIDAAEWIGPYDDEKLGFNKVAPYYYSPGWFEGSASITSMVNDKAWEALPPAYQAAFEAACGEQSMRMLANYDARNPLALRKLIAGGAKVSFFPKEVMDAVYKASQQLWTELSEKNPDFKAIYPGWKKFQEDEAGWFRVAENALDNYTFAAVARAQAKAENLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF A TRAP TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM BORDETELLA BRONCHISEPTICA RB50 (BB0280, TARGET EFI-500035) WITH BOUND PICOLINIC ACID
rcsb
source organism Bordetella bronchiseptica
molecule tags Transport protein
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
total genus 135
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4yicA02
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4yicA01
3RNNA 2B3BA 4OYVA 1LFIA 1UTBA 2I0CA 3SEYA 2RCAA 1IEJA 5KCJA 3T9VA 1FQFA 3U92A 4PFWA 4F31B 3IO6A 4MBPA 1TFAA 5TP9B 3WAFA 3I5OA 3JZJA 1DTGA 2VGQA 5LTCA 2PX1A 1JQFA 2QMWA 4P56A 1B7ZA 2Q88A 4DZ1A 1YPNA 1LBBA 2ZNSA 3R6UA 1D9VA 4NTLA 1BIYA 4PF6A 4MAGA 1LCTA 2VPOA 2V93A 5H8FB 2WX9A 4KYSA 5DT6A 4QSCA 3EN3A 1N0TA 2D5WA 2ZZWA 1SW4A 4N15A 5ISUA 5FTHA 3CFZA 4FORA 2XXVA 1OLCA 3E4RA 1NKXA 5CRYA 1B5JA 3T96B 2REJA 1B4ZA 4OVRA 4NF5A 4OWDA 4M4GA 5AA2B 4KI0E 1TWYA 2DSFA 2UYEA 4OFJA 4TOZA 3PPOA 4G77A 4PFRA 1WVJA 2DWJA 1SBPA 3RPWA 2ALUA 1ZKBA 1SDXA 3T93B 3K6WA 1NL5A 4I62A 5CM6A 1B46A 4EDPA 3TTLA 3FVKA 3O97A 2WYPA 4NMYA 2DVZA 2DOJA 4PGPA 4F1YA 3TQLA 1AH5A 4XF5A 1B1HA 1FQBA 5I2NB 2DE3A 5CMKA 1A8EA 2Y7WA 1PB7A 3PPRA 2I3VA 1B5HA 4F3SA 5I2KA 1N3WA 5L8DA 4ELQA 4ELPA 1P1UA 1LFHA 3TQWA 2D3IA 5ICQA 4F39A 4E0XA 1NFTA 4F1UA 4NF4A 2RC8A 1ANFA 3SETA 5F7VA 4JWXA 3KSXA 1EZ9A 2ONKE 4GF8A 4PAKA 4DLDA 2Y7PA 4KFQA 1DSNA 1JNFA 2V3TA 3ILUB 5AA2A 2QRYA 1IXHA 2AIXA 2XX8A 1EZPA 1POTA 3A3CA 4IO5A 2O84X 3G3JA 4U23A 4BDOA 1MS7A 2XX9A 3A09A 4NWCA 4DCYA 1A7LA 1B3FA 2OCUA 4N6DA 4LP2B 2QL3A 2YJPA 1USYE 3GBBA 4EUOA 4O8MA 4ESXA 1M5BA 4PP0A 1ZTYA 3T22A 2HPGA 2V3UA 3CFLA 1O7TA 1DMBA 3CSGA 4TLLB 4FEDA 3CG1A 1DTZA 2H98A 4BDQA 5DTBA 3ODBA 4ZEDA 4MEVA 3N94A 4GL0A 1T0KA 3S9EA 1MXYA 4DI3D 1R9QA 4GOTA 3PGFA 3Q28A 2OZZA 3MPLA 4OMBA 3L6GA 4JDFA 4PF8A 4NF4B 2H25A 2NXOA 2DWIA 4XTCQ 1J1NA 2F6PA 3MVWA 1FTJA 1H44A 2ZYMA 4YAHX 4X48A 2DQVA 2AYSA 1NNKA 1MDP1 2OLBA 4ZEIA 2XXQA 4G68B 2PFYA 3DLNA 3RLFE 4PETA 5JK4A 5K2YA 5H8QB 4F3BA 4LUBA 3E13X 4BDRA 3T9HB 3PMXA 1MXVA 4Q0CA 3IX1A 2CZLA 3H6VA 2O7IA 3KJ7A 4KYDA 3DP6A 3TCHA 3FJ7A 5I7IA 5AE4A 3OO7A 2O1LA 4NF5B 4THIA 1MQHA 3TUSA 3B6WA 3IOWA 3DELB 4IY6A 5B7DA 4O3CA 3FASA 2DP8A 2G93A 2OK2A 3N5LA 4U21A 2A5TB 2UVHA 1S50A 4NF8A 3SEWA 3V89B 3MP1A 1OIBA 4MHFA 4H5GA 4OVSA 3IJOB 2A5SA 4N17A 4P11A 2X26A 1MY1A 4IGTA 3M3LA 3TMGA 2O69A 4PFYA 1BP5A 5DVFA 3FD3A 5JEIA 4LA9A 3FV2A 5HPQA 3T9UA 3O6HA 2Q2CA 3PUVE 3W9VA 4DCXA 1MQIA 4POXA 1HSJA 2PYYA 3CFXA 1Z7ME 4PFUA 3OOAA 3VLVA 3LSWA 2REGA 3KN7A 3RN8A 2WKYA 5AA2D 2XD2A 4PQJA 2HXWA 2DYXA 5AA4A 4G8HA 4AB5A 5JTYB 5CMCA 3C33A 3FATA 2RF1A 1LFGA 4ZEKA 3FUZA 1WDNA 4LVQA 4U4XA 3S9LC 4NF8B 4PDHA 1MQJA 4NGUA 1N7WA 2W7YA 2XWVA 3EQ1A 3IL1B 1ATGA 3MP6A 4EXKA 3LR1A 4KQPA 2PT1A 3IOTA 2RC9A 4NG7A 3TTKA 2QS2A 4EF2A 5ELVA 4PAFA 1MPCA 3B7DA 2CEYA 1B7UA 4EQBA 4MMPA 1YCJA 3KOSA 1FQEA 2Y7KA 3K6UA 5ICTA 2AL4A 3UP9A 3S9MC 4NAPA 4RPNA 1MDQA 2E1SA 3B6TA 3U8QA 4H8JA 3PD9A 3VE1B 5BWJA 5DYHA 3E3KA 3MPKA 5IKBA 2YPNA 4RK9A 1RYOA 4OTEA 5JTYA 4RNSA 4WEPA 1EZOA 4H1XA 2GRVA 4OQOA 1Y3NA 4GL8A 1EH3A 1B0LA 5I58A 2Z22A 1Y1MA 1SW5A 4R73A 3DP4A 3H6WA 4FECA 4PC9A 4JSOA 2WYKA 4AQ4A 3CIJA 3N6TA 4YB5A 1B3HA 4NQ8A 5IAIA 4ZEBA 2I49A 3K6XA 1S7YA 3K4UA 4IGRA 4P1LA 1A55A 1XT8A 1D9YA 2AL5A 1Q1KA 2VHAA 4H65A 3H6UA 1FQCA 4JB7A 3MVYA 1IITA 3H7MA 3IORA 3MQ9A 1P1OA 4MCOA 3U65A 2RKMA 4KCCA 1S9TA 1ZU0A 4QSEA 3K02A 3HV1A 3QYTA 1Y20A 1AMFA 2GH9A 4YKIA 5I59A 3W15C 4HW8A 2I4BA 1B6HA 1N84A 1NH7A 5A5XA 1WODA 2Q2AA 4N8GA 3UA8A 4XKNA 1MM7A 4PDDA 1LBCA 3K1MA 4O7MA 1PC3A 5CI5A 2ZNUA 4R9FA 3EHUA 2VPNA 3GZGA 4KYEA 4I9DA 4DXUA 5DVJA 2XXRA 1USYH 4QF9A 1MXZA 2Q8JA 4PAIA 2Y7RA 3K1NA 3B50A 2Q9TA 5I5PA 4NF0A 4DIGA 4OHNA 4LONB 4N4UA 1LAXA 3D4CA 2IA4A 2R9JA 4U2RA 1SI0A 3TTRA 3HHGA 5KZTA 4GXAA 5KDTB 3IR1A 3K0VA 4GLIA 5EYFA 3H03A 1FQDA 3USDA 2DS9A 3O6GA 3GXAA 1SVXB 3A3UA 1D3KA 1TFDA 2F34A 3O9PA 3C4MA 5H8QA 2DWAA 4PBHA 3JV9A 4PGNA 1IIWA 1MXWA 1R9LA 4NX1A 4IO4A 4JWYA 4LZ7A 1M5EA 3O29A 4R72A 4Q8RA 3RGYA 5BUUA 2O7UA 3TODA 2DE4A 3AXFA 4XKQA 4YZZA 3PPPA 4K3FA 2LAOA 1XHYA 5I59B 2XXIA 3OO8A 3IB2A 4R9GA 4XFEA 2THIA 2NWJA 2DE2A 2ZZXA 1TT1A 3SEUA 2F5XA 3MZBA 1MG1A 1FTOA 2QS4A 2UVJA 3MAMA 1JW4A 1UTBB 3MBPA 4G8MA 4MF3A 4X1BA 4OESA 5FHOA 4L17A 5CMBA 4GIZA 3RQTA 3H3GA 4MLQA 4BDLA 1QVSA 1OVBA 3HHFA 5ITOA 3CG3A 1LSTA 3CR9A 1D4NA 1BKAA 3QIMA 4R6HA 4RPOA 1P1QA 4U22A 5I58B 2O68A 2ZXTA 4JSDA 4F29A 1P99A 4DDDA 1JVXA 3KZGA 3V8XB 3QSLA 1Q35A 3TZAA 4PE5B 4XIGQ 5TP9A 3PPNA 1GVCA 4EF1A 4GVOA 2F35A 3FGSA 3HPIA 3IB1A 1B51A 1JETA 2F36A 4OVPA 2QJEA 4QRZA 4G8NA 1MY0A 1UIVA 5EHMA 1URGA 3PMVA 4I8CA 2PT2A 4ZS9A 1M5DA 1B3LA 2XA5A 2NUVA 2BJJX 4P8BA 3FXRA 3OO9A 4YICA 2VOZA 4DE8A 1Y3PA 4MH5A 1GV8A 4YB6A 4ZEFA 4UABA 3VDFA 3FJGA 1A54A 3OELA 1JW1A 4ELRA 2XXKA 3K6VA 2H9BA 2PBWA 3QUJA 2F78A 2FA7A 2ZYOA 4OFLA 4YKPA 3W9WA 4OFOA 1MXXA 1QUIA 4FIMA 2ZNTA 3S9NC 4P0GA 3LBSA 3MJNA 4ZZEA 2VD3A 3TCFA 2B65A 5AA4B 4NEDA 4Q5TA 2F7CA 3KEIA 3KN3A 5HBCA 4N8YA 1SW1A 3BFUA 4YU0A 3V5AA 1UIUA 2FYIA 4Q30B 4U1OA 4PFIA 2OWTA 2H5YA 3SDFA 2VD2A 2X7PA 4R2BA 1LAFE 4LATA 4H5FA 4IO6A 4XXUA 2HQ0A 1JEVA 5I2KB 4H0WA 1ELJA 3C34A 3HSTA 1R1NA 2XWIA 3TAJA 1B3GA 4H8IA 3UK4A 2CMOA 3PUWE 5DVIA 4R2FA 3V83A 2RC7A 3KN8A 3I6VA 3HN0A 3K2DA 1PDAA 1IXCA 3EHTA 4N07A 1FTKA 3PUZE 1LGBC 4RYAA 4F18A 4MFIA 4AB6A 3IAZA 1QJMA 3K1PA 3RTWB 3C31A 4KHZE 5K2XA 3ZKKA 1VR5A 3S2VA 4OETA 3U93A 2G29A 1HSLA 3D4GA 1ZBMA 4O94A 2GHBA 4NWDA 3RTFB 1MY4A 3KGCA 1Y4TA 3S4UA 3OENA 4HS7A 4LZ8A 1Y1ZA 1BTJA 3LUYA 3BKIB 3UORA 1URSA 4MLVA 3QK6A 3VFJA 1MQDA 4XEQA 3FVNA 1LB8A 2QPQA 3L6HA 2P2AA 2F6GA 1MM6A 3EF7A 3TTMA 3KFMA 1MRPA 1XOCA 4ZZAA 1A8FA 4G2ZA 1MQGA 3MZ9A 3MUQA 3C36A 1H45A 3IOVA 3RUMA 3EPEA 3KBRA 1I69A 1I6AA 3VLUA 4M1VA 5CC2A 4NE4A 5CBRA 3OEKA 2Z23A 3Q25A 4G68A 2ZMBA 4ZE8A 1A99A 1HSEA 1H76A 3GLBA 1QKBA 4Z7EA 4MIJA 4FATA 4PCDA 3N26A 4YKKA 5IZZA 3RT6B 3UN6A 1VFDA 4G4PA 4C0RA 4IO2A 1H3DA 5FHMA 3LSFB 1FTLA 1YAEA 4IO7A 4UA8A 2R6GE 4MNCA 4ONYA 3VV5A 3CI8A 3K01A 2OWSA 1SI1A 4P1EA 4U1ZA 4QSDA 3TFLA 3SERA 1R6ZA 2DXRA 2PFZA 3TDJA 3QXMA 3I3VA 1MH4A 3TTNA 4YMBA 3U94A 4POWA 5H8HA 2DWHA 3U1OA 1B0HA 2I4CA 3B6QA 1B1XA 1II5A 3MVXA 5M2VA 2DXYA 1OLAA 3LC8A 4DXCA 4F1VA 2XWOA 3VVFA 5IM2A 4PFTA 4OVTA 4OVQA 3E9XA 1IQ7A 2I58A 4R6KA 1LAHE 4UACA 2GHAA 4EQ7A 3KSJA 2XXWA 1B58A 4O3AA 5KCJB 4OEVA 4X9TA 2ONRA 3EHSA 3MC2A 4BDNA 4LN5A 3TKDA 3SEVA 1VSOA 3FXUA 2RINA 2QS1A 1US5A 2XWKA 3ILTB 4YKJA 3C32A 2NOOA 3C35A 4WKMA 1IXGA 5DEXB 1Y3QA 4YB7A 1OQGA 1B40A 1MPBA 2FNCA 1B9JA 3G3IA 5I84A 2IEEA 3H06B 3M3FA 4QFLA 1GR2A 3ZKLA 3TELA 1SD3A 1IUDA 4E0WA 4R74A 2XHDA 1ZMGA 1EU8A 1MY2A 1B4HA 3O6IA 3R26A 4OA4A 1AOVA 4Z0IA 4JXIA 1M5CA 3BBRA 1MXUA 3MWBA 2XX7A 5TU0A 2V25A 2PMSA 2V3QA 4F3GA 4OENA 1B05A 4YMAA 1NMUA 2UVIA 4TLMB 3HO7A 5CBSA 1BLFA 5FHNA 3O2AA 4QFPA 1B5IA 3O66A 5H8SA 4FJPA 5I57B 3PPQA 5TPAA 2F7BA 3CRBA 2R71A 4P9KA 2F8DA 3PUXE 1UTHA 1TXFA 1LB9A 5DEXA 2YLNA 1QKAA 1NH8A 4N13A 4FEBA 2Z8EA 2P1SA 1B3EA 1IXIA 4HCWA 1Y9UA 1AIVA 1H43A 1NNPA 4NN3A 1OMPA 2QSXA 2O1MA 1XVYA 2Z8FA 3K00A 2VP1A 4KCDA 4F3PA 2Q89A 2I6EA 1XS5A 1LAGE 3KOTA 5CMMA 4X8RA 3U72A 1FCKA 3FV1A 3PMWA 3G3GA 3FVOA 1Y4CA 1CE2A 1N7XA 3VXBA 1SW2A 3PD8A 3P7IA 5ITPA 4HCYA 2A5TA 5I56B 3OEMA 2XXHA 2XXXA 1NNTA 4OANA 2B3FA 2XXYA 3G3FA 3PUYE 2XD3A 4QFOA 3CSBA 4MNIA 4I1DA 5H8FA 1MY3A 4P47A 2Y7IA 1JEUA 3DM0A 5H8HB 2V84A 4GRKA 4N6KA 2ONSA 3QUFA 3OO6A 2F97A 4F22A 3T9XB 3VXCA 4IO3A 4QFKA 5L9OA 3ECRA 2HFBA 5TPAB 1GGGA 3Q26A 4GQOA 2HZKA 2OBGA 3ZS6A 1RKMA 4X04A 4GFRA 4N6PA 3ONMA 4OXVA 3SEXA 1FQAA 3OD7A 4FE8A 3BFTA 4HTGA 3IJXB 3KG2A 3OSRA 1N3XA 3THIA 1OQHA 1YTVA 4ZECA 5I56A 3SKPA 3CVGA 4EQ9A 5L9SA 2XXPA 3PV0E 1US4A 1O64A 4R75A 3DP8A 3TEPA 3QAXA 4QHQA 4GXSB 1OVTA 4IB2A 1N04A 4KR5A 3OMBA 5H8NB 1RYXA 1XVXA 1AL3A 3VVEA 4NF6A 4JWOA 4N91A 3FVGA 2PVUA 5AA3A 1URDA 1NNFA 4DI4B 1I6QA 5IGAA 1F9BA 4FAJA 3HCQA 2CEXA 1I6BA 4ND9A 4X1DA 2D21A 4P0IA 3FXBA 1QUKA 4H67A 5I2NA 2ZYNA 1A40A 3Q27A 3TCGA 4GD5A 1O63A 3KJTA 4BLAA 1GTKA 3IK6B 1LCFA 4OVJA 2RCBA 3H6TA 5F1QA 3LSXA 3RY3A 1ZLQA 3T66A 4KPTA 4OZ9A 1XC1A 5B70A 4PFBA 3GBAA 3RT8A 2UYFA 3VLWA 2XXUA 4ECFA 2E0SA 5LOMA 5FTIA 1FTMA 2I3WA 2DVCA 4TQUQ 1PB9A 4ELOA 2KLFA 4MX6A 1L5TA 2Z8DA 3F11A 4U4SA 2OJTA 1SQYA 1MH3A 4XKRA 2GFEA 4LZ5A 1PBQA 4P3LA 4ZDMA 4C1TA 5J1DA 4GWOA 3TYHA 3C9HA 1B2HA 4RJZA 4EXLA 3TPAA 4MNPA 4ESWA 1SYHA 4NF6B 2F7AA 4LQ5A 1M5FA 1B52A 2ESNA 4NHBA 4BDMA 3IO4A 1P1WA 2H99A 4OERA 2QMXA 1POY1 1FW0A 5EHSA 4JBZA 2ZYKA 2NVUB 4F2QA 1Z7NE 2ABHA 1JW5A 4RXLA 2UXAA 3FIRA 5A5XB 4RK2A 1PEBA 3OXNA 2X7QA 3G3HA 3SESA 2ZZVA 1MPDA 1JVYA 2HZLA 2HCAA 1SYIA 4RY1A 2P0SA 4WEDA 2XXTA 2H4IA 4WXJA 4LQ2A 3M3KA 2HEUA 4PBQA 1QULA 4KD5A 1PBPA 3UIFA 1ZIUA 3M8UA 3N6UA 3FXQA 1KWHA 2UVGA 3FZVA 4G68C 2ANJA 4RA1A 1VFEA 1DPPA 4R6YA 3ZSFA 2HAUA 2V4CA 3MW0A 4IY5A 5I57A 1P1NA 4DXBA 4XKPA 1UTHB 2I48A 3LSLA 5KDTA 1B32A 1DOTA 4H6DA 4C1UA 1N76A 2M8CA 5HM4B 1QW0A 3MZ1A 2O6AA 2HAVA 2I0BA 1CB6A 5H8NA 1DPEA 3Q29A 3OSQA 4F2OA 1B7HA 3IOUA 3FJMA 5AA1A 1UQWA 3IB0A 3H4ZA 2Y84A 3MVZA 3O28A 3R7XA 4ZE9A 3GYYA 3JYRA 2QS3A 4QFNA 1IZ1A 5L9MA 3MP8A 3PU5A 4PE3A 4O3BA 3UGWA 4F19A 3G3KA 1VE4A 3G7WA 3WAEA 2O51A 1QUJA 4ISUA 1PB8A 4OEUA 1ZJLA 3VVDA 1LLSA
chains in the Genus database with same CATH superfamily
3RNNA 2B3BA 4OYVA 1LFIA 2L5VA 1UTBA 2I0CA 3SEYA 2RCAA 1IEJA 5KCJA 3T9VA 1FQFA 3U92A 4PFWA 4F31B 3IO6A 4MBPA 1TFAA 5TP9B 3WAFA 3I5OA 3JZJA 1DTGA 2VGQA 5LTCA 2PX1A 1JQFA 2QMWA 4P56A 1B7ZA 2Q88A 4DZ1A 1YPNA 1LBBA 2ZNSA 3R6UA 1FPJA 1D9VA 4NTLA 1BIYA 4PF6A 4MAGA 1LCTA 2VPOA 2V93A 5H8FB 2WX9A 4KYSA 5DT6A 4QSCA 3BIHA 3EN3A 1N0TA 2D5WA 5EQ9A 2ZZWA 1SW4A 4N15A 5ISUA 5FTHA 3CFZA 4FORA 2XXVA 1OLCA 2MKZA 3E4RA 1NKXA 5CRYA 1B5JA 3T96B 2REJA 1B4ZA 4OVRA 4NF5A 4OWDA 4M4GA 5AA2B 1FRPA 4KI0E 1TWYA 2DSFA 2UYEA 4OFJA 4TOZA 3PPOA 4G77A 4PFRA 1WVJA 2FHYA 2DWJA 1SBPA 3RPWA 2ALUA 1ZKBA 1NV0A 1SDXA 3T93B 3K6WA 3MSTA 5I3SA 1NL5A 4I62A 5CM6A 1B46A 4EDPA 3TTLA 3FVKA 2WYPA 3O97A 4NMYA 2DVZA 2DOJA 2OWZA 4PGPA 4F1YA 3TQLA 1AH5A 4XF5A 4HE1A 1B1HA 1LBYA 1FQBA 5I2NB 2DE3A 5CMKA 1A8EA 2Y7WA 1PB7A 3PPRA 2I3VA 1B5HA 4F3SA 5I2KA 5DW8A 1N3WA 5L8DA 4ELQA 4ELPA 1P1UA 1LFHA 3TQWA 1JP4A 2D3IA 5ICQA 4F39A 4E0XA 3RPLB 1NFTA 4F1UA 4NF4A 2RC8A 1ANFA 3SETA 5F7VA 4JWXA 3KSXA 1EZ9A 2ONKE 4GF8A 4PAKA 4DLDA 1NUZA 2Y7PA 4KFQA 1DSNA 1JNFA 2V3TA 3ILUB 5AA2A 2QRYA 1IXHA 2AIXA 2XX8A 1NUYA 1EZPA 1POTA 3A3CA 4IO5A 2O84X 3G3JA 4U23A 4BDOA 1MS7A 2XX9A 3A09A 4NWCA 1NV6A 4DCYA 1A7LA 1B3FA 2OCUA 4N6DA 4LP2B 2QL3A 2YJPA 1USYE 3GBBA 4EUOA 4O8MA 1FTAA 4ESXA 1M5BA 4PP0A 1ZTYA 3T22A 2HPGA 2V3UA 3CFLA 1O7TA 1DMBA 3CSGA 4TLLB 4FEDA 4IR8A 3CG1A 1DTZA 2H98A 4BDQA 5DTBA 3ODBA 4ZEDA 4MEVA 3N94A 4GL0A 1T0KA 3S9EA 1MXYA 1FPFA 4DI3D 1R9QA 4GOTA 3PGFA 3Q28A 2OZZA 3MPLA 4OMBA 3L6GA 4JDFA 4PF8A 4NF4B 2H25A 2NXOA 2DWIA 4XTCQ 1J1NA 5IZ3B 2F6PA 3MVWA 1FTJA 2Q8MA 1H44A 2ZYMA 1FPLA 4YAHX 2CZKA 4X48A 2DQVA 2AYSA 1NNKA 5EQ8A 1MDP1 2OLBA 4ZEIA 2XXQA 4G68B 2PFYA 3DLNA 3RLFE 4PETA 5JK4A 5K2YA 5H8QB 1IMCA 4F3BA 4LUBA 3E13X 4BDRA 3T9HB 3PMXA 1MXVA 4Q0CA 1LBWA 4HE0A 3IX1A 1AWBA 2CZLA 3H6VA 2O7IA 3KJ7A 3NOHA 4KYDA 3DP6A 3TCHA 3FJ7A 5I7IA 5AE4A 3OO7A 2O1LA 4NF5B 4THIA 1MQHA 3TUSA 3B6WA 3IOWA 3DELB 4IY6A 5B7DA 4O3CA 3FASA 5ET6A 1BK4A 2DP8A 2G93A 2OK2A 3N5LA 4QBAA 4U21A 2A5TB 2UVHA 1S50A 4NF8A 1NUWA 4AS4A 3SEWA 3V89B 3MP1A 1OIBA 4MHFA 4H5GA 4OVSA 3IJOB 1EYIA 2A5SA 4N17A 4P11A 2X26A 1MY1A 4IGTA 3M3LA 3TMGA 2O69A 4PFYA 3LUZA 1BP5A 5DVFA 3FD3A 5JEIA 4LA9A 2KR0A 1NV1A 3FV2A 5HPQA 3T9UA 3O6HA 1FBFA 2Q2CA 3PUVE 3W9VA 4DCXA 1MQIA 4POXA 1HSJA 2PYYA 5ET5A 3CFXA 1Z7ME 4PFUA 3OOAA 3VLVA 3LSWA 2P3NA 2REGA 3KN7A 3RN8A 2WKYA 5AA2D 2XD2A 4PQJA 2HXWA 1VDWA 5LDZA 2DYXA 1DBZA 5AA4A 4G8HA 4AB5A 5JTYB 5CMCA 3C33A 3FATA 2RF1A 1LFGA 4ZEKA 3FUZA 1WDNA 4KXPA 4LVQA 4U4XA 3S9LC 4NF8B 4PDHA 1MQJA 4NGUA 1N7WA 2W7YA 2XWVA 3EQ1A 3IL1B 1ATGA 3MP6A 4EXKA 3LR1A 4KQPA 2PT1A 3IOTA 1RDYA 2RC9A 4NG7A 3TTKA 2QS2A 4EF2A 5ELVA 4GBWA 4PAFA 1MPCA 2CEYA 3B7DA 1YYZA 1B7UA 4EQBA 4MMPA 1FBPA 4JVIA 1YCJA 3KOSA 1FQEA 2Y7KA 3K6UA 5ICTA 2AL4A 3UP9A 4FBPA 3S9MC 4NAPA 4RPNA 1MDQA 2E1SA 3B6TA 3HFUA 3U8QA 4H8JA 2F3DA 5IZ3A 3PD9A 3VE1B 5BWJA 5DYHA 3E3KA 3MPKA 2P3VA 2FIEA 5IKBA 2YPNA 4RK9A 1RYOA 4OTEA 5JTYA 4RNSA 4WEPA 1EZOA 4H1XA 2GRVA 4OQOA 1Y3NA 2F3BA 4GL8A 1EH3A 1B0LA 5I58A 2Z22A 1Y1MA 5ET7A 1SW5A 4R73A 3DP4A 3H6WA 3IFAA 4FECA 2VT5A 4PC9A 4JSOA 2WYKA 4AQ4A 3SZPA 3CIJA 3N6TA 4YB5A 1B3HA 4NQ8A 5IAIA 4ZEBA 2I49A 3K6XA 1S7YA 1IMDA 3K4UA 4IGRA 4P1LA 1A55A 1XT8A 1D9YA 3FBPA 2AL5A 1Q1KA 2VHAA 3KBZA 4H65A 3H6UA 1FQCA 4JB7A 3MVYA 1FSAA 1IITA 3H7MA 1IMEA 3IORA 3MYUA 2Y5KA 3MQ9A 1P1OA 4MCOA 3U65A 2RKMA 4KCCA 1S9TA 1ZU0A 4QSEA 3K02A 3HV1A 3QYTA 1Y20A 1AMFA 2GH9A 4YKIA 5I59A 3W15C 2PCRA 4HW8A 2I4BA 1B6HA 1N84A 1NH7A 5A5XA 1WODA 2OX3A 2Q2AA 4N8GA 3UA8A 1FBDA 4XKNA 1MM7A 4PDDA 1LBCA 1IMFA 3K1MA 4O7MA 1PC3A 5CI5A 2ZNUA 4R9FA 3EHUA 2VPNA 1QGXA 3GZGA 4KYEA 4I9DA 4DXUA 5DVJA 2XXRA 1USYH 4QF9A 1MXZA 2Q8JA 4PAIA 2Y7RA 3K1NA 3B50A 2Q9TA 5I5PA 4NF0A 4DIGA 4N4UA 4LONB 4OHNA 1LAXA 3D4CA 3LV0A 2IA4A 2R9JA 4U2RA 3D1RA 1SI0A 3TTRA 2WEFA 3BIGA 3HHGA 5KZTA 4GXAA 3IR1A 5KDTB 3K0VA 4GLIA 5EYFA 3H03A 1FQDA 3USDA 2DS9A 3O6GA 3GXAA 1SVXB 3A3UA 1D3KA 1TFDA 2F34A 3O9PA 3C4MA 5H8QA 2DWAA 4PBHA 3JV9A 4PGNA 1IIWA 1MXWA 1R9LA 4QXDA 4NX1A 4IO4A 4JWYA 4LZ7A 1M5EA 3O29A 4R72A 4Q8RA 3RGYA 5BUUA 2O7UA 3TODA 2DE4A 3AXFA 4XKQA 4YZZA 2Q74A 3PPPA 4K3FA 2LAOA 1XHYA 5I59B 2XXIA 3OO8A 3IB2A 4R9GA 4XFEA 2THIA 2NWJA 2DE2A 2ZZXA 1TT1A 3SEUA 2F5XA 4I3YA 3MZBA 1MG1A 1FTOA 2QS4A 2UVJA 3MAMA 1JW4A 1UTBB 3MBPA 4G8MA 4MF3A 4X1BA 4OESA 3QMFA 5FHOA 4L17A 5CMBA 4GIZA 3RQTA 3H3GA 4MLQA 4BDLA 1K9ZA 1QVSA 2B4MA 1OVBA 3HHFA 5ITOA 3CG3A 1LSTA 3CR9A 1D4NA 1BKAA 3QIMA 4R6HA 4RPOA 1P1QA 4U22A 4H45A 5I58B 2O68A 2ZXTA 4JSDA 4F29A 1P99A 4DDDA 1JVXA 3KZGA 3V8XB 3QSLA 1Q35A 3TZAA 4PE5B 1NV5A 4XIGQ 5TP9A 1RDXA 1IMAA 3PPNA 1GVCA 4EF1A 4GVOA 1D9QA 3IFCA 3CHGA 2F35A 3FGSA 3HPIA 3IB1A 3E78A 1B51A 1JETA 2F36A 4OVPA 2QJEA 4QRZA 4G8NA 1MY0A 1UIVA 5EHMA 2JJKA 1URGA 5FBPA 3PMVA 4I8CA 2PT2A 4ZS9A 1M5DA 1B3LA 2XA5A 2NUVA 2CZIA 3EKIA 2BJJX 4P8BA 3FXRA 1FPEA 3OO9A 4YICA 2VOZA 4DE8A 2QVVA 1Y3PA 4MH5A 1GV8A 4YB6A 4ZEFA 4UABA 4MJOA 3VDFA 3FJGA 1A54A 3OELA 1FBHA 1JW1A 2XXKA 4ELRA 3K6VA 2H9BA 4O7IA 2PBWA 3QUJA 2F78A 3E79A 2FA7A 2ZYOA 4OFLA 1FPBA 4YKPA 3W9WA 4OFOA 1MXXA 1QUIA 4FIMA 2ZNTA 3S9NC 4P0GA 3LBSA 3MJNA 4ZZEA 2VD3A 3TCFA 2B65A 5AA4B 4NEDA 4Q5TA 2F7CA 3KEIA 3KN3A 4G61A 5HBCA 4N8YA 1SW1A 3BFUA 4YU0A 3V5AA 4I3EA 1UIUA 2FYIA 4Q30B 4U1OA 4PFIA 2OWTA 2H5YA 2QFLA 3SDFA 2VD2A 2X7PA 4R2BA 1LAFE 4LATA 1YXIA 4H5FA 4IO6A 4XXUA 2HQ0A 1JEVA 5I2KB 4H0WA 1ELJA 3C34A 3HSTA 1R1NA 2XWIA 3TAJA 1B3GA 4H8IA 3UK4A 2CMOA 3PUWE 5DVIA 4R2FA 3V83A 2RC7A 3KN8A 3I6VA 3HN0A 3K2DA 1PDAA 1IXCA 3EHTA 4N07A 1FTKA 3PUZE 1LGBC 4RYAA 4F18A 4MFIA 4AB6A 3IAZA 1QJMA 4N81A 4GX6A 3K1PA 3RTWB 3C31A 4KHZE 5K2XA 3ZKKA 1VR5A 1NV4A 3S2VA 4OETA 3U93A 2G29A 1HSLA 3D4GA 1ZBMA 4O94A 2GHBA 5ET8A 4NWDA 3RTFB 1MY4A 3KGCA 1Y4TA 3S4UA 3OENA 4HS7A 4LZ8A 1Y1ZA 1BTJA 3LUYA 3BKIB 1YZ0A 3UORA 1URSA 4MLVA 2B4LA 3QK6A 1MQDA 3VFJA 4XEQA 5EYGA 3FVNA 1G0IA 1LB8A 2QPQA 3L6HA 2P2AA 2F6GA 1MM6A 4GBVA 3EF7A 3TTMA 3KFMA 1MRPA 1XOCA 4ZZAA 1A8FA 2R8TA 4G2ZA 3T1BA 1LBXA 1MQGA 3MZ9A 3MUQA 3C36A 1H45A 3IOVA 3RUMA 3EPEA 3KBRA 1I69A 1I6AA 3VLUA 4M1VA 5CC2A 4NE4A 5CBRA 3OEKA 2Z23A 3Q25A 4G68A 2ZMBA 4ZE8A 1A99A 1HSEA 1H76A 3GLBA 1QKBA 4Z7EA 4MIJA 5EQAA 4FATA 4PCDA 3N26A 4YKKA 2CZHA 5IZZA 3RT6B 3UN6A 1VFDA 4G4PA 4C0RA 4IO2A 1H3DA 5FHMA 3LSFB 1FTLA 1YAEA 4IO7A 4UA8A 2R6GE 4MNCA 1K9YA 4ONYA 3VV5A 3CI8A 4JVCA 3K01A 2OWSA 1SI1A 4P1EA 4U1ZA 2QVUA 4QSDA 3TFLA 2FIXA 3SERA 1R6ZA 2BJIA 2DXRA 2PFZA 3TDJA 3QXMA 3I3VA 1MH4A 3TTNA 4YMBA 3U94A 4POWA 5H8HA 2DWHA 3U1OA 1B0HA 1XI6A 2I4CA 4H46A 3B6QA 1B1XA 1II5A 3MVXA 5M2VA 2DXYA 1OLAA 3LC8A 4DXCA 4F1VA 2XWOA 3VVFA 5IM2A 1FPGA 4PFTA 4OVTA 4OVQA 2QVRA 3E9XA 1IQ7A 2I58A 4R6KA 1LAHE 4I40A 4UACA 2GHAA 4EQ7A 3KSJA 2XXWA 4GX4A 1B58A 4O3AA 5KCJB 4OEVA 4X9TA 2ONRA 3EHSA 3MC2A 1EYJA 4BDNA 4LN5A 3TKDA 3SEVA 1VSOA 3FXUA 2RINA 2QS1A 1US5A 2XWKA 3ILTB 4YKJA 3C32A 2NOOA 3C35A 4WKMA 1IXGA 5DEXB 1Y3QA 4YB7A 1EYKA 1OQGA 1B40A 1MPBA 2FNCA 1B9JA 3G3IA 5I84A 2IEEA 3H06B 3M3FA 4QFLA 4GWYA 1GR2A 3ZKLA 5ESYA 3ISPA 3TELA 1SD3A 2GQ1A 1IUDA 4E0WA 4R74A 2XHDA 3B8BA 1ZMGA 1EU8A 1MY2A 1B4HA 1FBGA 3O6IA 3R26A 4OA4A 1AOVA 4Z0IA 4JXIA 1M5CA 3BBRA 1MXUA 3MWBA 2XX7A 5TU0A 2V25A 2PMSA 2V3QA 4F3GA 5T3JA 4OENA 1B05A 4YMAA 1NMUA 2UVIA 4TLMB 3HO7A 5CBSA 1BLFA 5FHNA 3O2AA 4QFPA 1B5IA 3O66A 3RYDA 5H8SA 1IMBA 4FJPA 5I57B 3PPQA 5TPAA 2F7BA 3CRBA 2R71A 4P9KA 3KC0A 1DK4A 2F8DA 3PUXE 1UTHA 5IZ1A 1TXFA 1LB9A 5DEXA 2YLNA 1QKAA 5EYHA 1NH8A 4N13A 4FEBA 2Z8EA 2P1SA 1B3EA 1IXIA 4HCWA 1Y9UA 1AIVA 1H43A 1NNPA 2FVZA 4NN3A 1OMPA 2QSXA 2O1MA 3RPLA 1XVYA 5A5LA 2Z8FA 3K00A 2VP1A 4KCDA 4F3PA 2Q89A 2I6EA 1XS5A 1LAGE 3KOTA 5CMMA 4X8RA 3U72A 1KA0A 1FCKA 3FV1A 3PMWA 1KZ8A 3G3GA 1FPKA 3FVOA 1Y4CA 1CE2A 1N7XA 3VXBA 4GWWA 1SW2A 3PD8A 3P7IA 5ITPA 4HCYA 2A5TA 4GWZA 5I56B 1G0HA 3OEMA 1NV7A 2XXHA 2XXXA 1NNTA 4OANA 2B3FA 2HHMA 2XXYA 3G3FA 3PUYE 2XD3A 4QFOA 3T0JA 3CSBA 4MNIA 1FBCA 1FJ6A 4I1DA 5H8FA 1MY3A 4P47A 2Y7IA 1JEUA 3DM0A 5H8HB 2V84A 4GRKA 4N6KA 2ONSA 3QUFA 3OO6A 3PTYA 2F97A 4F22A 3T9XB 3VXCA 4IO3A 4QFKA 5L9OA 3ECRA 2HFBA 5TPAB 1GGGA 3Q26A 4GQOA 2HZKA 2OBGA 3ZS6A 1RKMA 4X04A 4GFRA 4N6PA 3ONMA 4OXVA 1KA1A 1FQAA 3SEXA 3OD7A 4FE8A 3BFTA 4HTGA 3IJXB 3KG2A 3OSRA 1N3XA 3THIA 1OQHA 1YTVA 4ZECA 5I56A 3SKPA 3CVGA 4EQ9A 5L9SA 2XXPA 3PV0E 1NUXA 1US4A 1O64A 2WBBA 4R75A 3DP8A 3TEPA 3QAXA 4QHQA 4GWUA 4GXSB 1OVTA 4IB2A 1N04A 4KR5A 3OMBA 5H8NB 1RYXA 5J16A 1XVXA 1AL3A 3VVEA 5F24A 4NF6A 4JWOA 4N91A 3FVGA 2PVUA 5AA3A 1URDA 1NNFA 4DI4B 1I6QA 5IGAA 1F9BA 1CNQA 4FAJA 3HCQA 2CEXA 2DDKA 1I6BA 4ND9A 4X1DA 2D21A 4P0IA 3FXBA 1QUKA 4H67A 5I2NA 2ZYNA 1A40A 3Q27A 4GD5A 3TCGA 1O63A 3KJTA 4BLAA 1GTKA 3IK6B 1LCFA 4GWSA 4OVJA 2RCBA 3H6TA 5F1QA 3LSXA 3RY3A 1ZLQA 3T66A 4KPTA 4OZ9A 1XC1A 5B70A 4PFBA 3GBAA 3RT8A 2UYFA 3VLWA 1LBZA 2XXUA 4GX3A 4ECFA 2E0SA 5LOMA 1INPA 5FTIA 4HE2A 1FTMA 2I3WA 2DVCA 4TQUQ 1PB9A 4ELOA 2KLFA 4MX6A 1L5TA 2Z8DA 3F11A 2KQZA 1Q9DA 4U4SA 2OJTA 1SQYA 1MH3A 4XKRA 2GFEA 4LZ5A 1PBQA 4P3LA 4ZDMA 4C1TA 5J1DA 4GWOA 1LEVA 3TYHA 3C9HA 1B2HA 4RJZA 1NI9A 4MNPA 3TPAA 4EXLA 4ESWA 1SYHA 4NF6B 2F7AA 4LQ5A 1M5FA 1B52A 2ESNA 4NHBA 4BDMA 3IO4A 1P1WA 2H99A 4OERA 2QMXA 1POY1 1DCUA 3A29A 1FJ9A 1FW0A 5EHSA 4JBZA 2ZYKA 1LBVA 2NVUB 1NV3A 4F2QA 1Z7NE 2ABHA 1JW5A 1RDZA 4RXLA 2UXAA 3FIRA 5A5XB 4RK2A 1FBEA 1PEBA 3OXNA 2X7QA 3G3HA 3SESA 2ZZVA 1FPIA 1FPDA 1MPDA 4GWXA 1JVYA 2HZLA 2HCAA 1SYIA 3KC1A 4RY1A 2P0SA 4WEDA 2XXTA 2H4IA 4WXJA 5EQ7A 4LQ2A 3M3KA 2HEUA 4PBQA 1QULA 4KD5A 1PBPA 3UIFA 1ZIUA 3M8UA 3N6UA 3FXQA 1KWHA 2UVGA 4AS5A 3FZVA 4G68C 4HXVA 2ANJA 2WBDA 4RA1A 1VFEA 1DPPA 4R6YA 3ROJA 3ZSFA 2HAUA 2V4CA 3MW0A 4IY5A 5I57A 1P1NA 4DXBA 4XKPA 1UTHB 2I48A 3LSLA 5KDTA 1B32A 1DOTA 4H6DA 4JVDA 4C1UA 1N76A 2M8CA 5HM4B 1QW0A 3MZ1A 2O6AA 2HAVA 2I0BA 2Y5LA 1CB6A 5H8NA 1DPEA 3Q29A 3OSQA 1SPIA 4F2OA 1B7HA 3IOUA 3FJMA 5AA1A 1UQWA 3IB0A 3H4ZA 2Y84A 3MVZA 3O28A 3R7XA 4ZE9A 3GYYA 3JYRA 2QS3A 4QFNA 1IZ1A 5L9MA 3MP8A 3PU5A 4PE3A 4O3BA 3UGWA 4F19A 3G3KA 1VE4A 3G7WA 1NV2A 3WAEA 2O51A 1QUJA 4ISUA 1PB8A 4OEUA 1ZJLA 2HXRA 3VVDA 2FBPA 1LLSA 4PTKA
chains in the Genus database with same CATH topology
3RNNA 2B3BA 4OYVA 1LFIA 2L5VA 1UTBA 2I0CA 3SEYA 2RCAA 1IEJA 5KCJA 3T9VA 1FQFA 3U92A 4PFWA 4F31B 3IO6A 4MBPA 1TFAA 5TP9B 3WAFA 3I5OA 3JZJA 1DTGA 2VGQA 5LTCA 2PX1A 1JQFA 2QMWA 4P56A 1B7ZA 2Q88A 4DZ1A 1YPNA 1LBBA 2ZNSA 3R6UA 1FPJA 1D9VA 4NTLA 1BIYA 4PF6A 4MAGA 1LCTA 2VPOA 2V93A 5H8FB 2WX9A 4KYSA 5DT6A 4QSCA 3BIHA 3EN3A 1N0TA 2D5WA 5EQ9A 2ZZWA 1SW4A 4N15A 5ISUA 5FTHA 3CFZA 4FORA 2XXVA 1OLCA 2MKZA 3E4RA 1NKXA 5CRYA 1B5JA 3T96B 2REJA 1B4ZA 4OVRA 4NF5A 4OWDA 4M4GA 5AA2B 1FRPA 4KI0E 1TWYA 2DSFA 2UYEA 4OFJA 4TOZA 3PPOA 4G77A 4PFRA 1WVJA 2FHYA 2DWJA 1SBPA 3RPWA 2ALUA 1ZKBA 1NV0A 1SDXA 3T93B 3K6WA 3MSTA 5I3SA 1NL5A 4I62A 5CM6A 1B46A 4EDPA 3TTLA 3FVKA 3O97A 2WYPA 4NMYA 2DVZA 2DOJA 2OWZA 4PGPA 4F1YA 3TQLA 1AH5A 4XF5A 4HE1A 1B1HA 1LBYA 1FQBA 5I2NB 2DE3A 5CMKA 1A8EA 2Y7WA 1PB7A 3PPRA 2I3VA 1B5HA 4F3SA 5I2KA 5DW8A 1N3WA 5L8DA 4ELQA 4ELPA 1P1UA 1LFHA 3TQWA 1JP4A 2D3IA 5ICQA 4F39A 4E0XA 3RPLB 1NFTA 4F1UA 4NF4A 2RC8A 1ANFA 3SETA 5F7VA 4JWXA 3KSXA 1EZ9A 2ONKE 4GF8A 4PAKA 4DLDA 1NUZA 2Y7PA 4KFQA 1DSNA 1JNFA 2V3TA 3ILUB 5AA2A 2QRYA 1IXHA 2AIXA 2XX8A 1NUYA 1EZPA 1POTA 3A3CA 4IO5A 2O84X 3G3JA 4U23A 4BDOA 1MS7A 2XX9A 3A09A 4NWCA 1NV6A 4DCYA 1A7LA 1B3FA 2OCUA 4N6DA 4LP2B 2QL3A 2YJPA 1USYE 3GBBA 4EUOA 4O8MA 4ESXA 1FTAA 1M5BA 4PP0A 1ZTYA 3T22A 2HPGA 2V3UA 3CFLA 1O7TA 1DMBA 3CSGA 4TLLB 4FEDA 4IR8A 3CG1A 1DTZA 2H98A 4BDQA 5DTBA 3ODBA 4ZEDA 4MEVA 3N94A 4GL0A 1T0KA 3S9EA 1MXYA 1FPFA 4DI3D 1R9QA 4GOTA 3PGFA 3Q28A 2OZZA 3MPLA 4OMBA 3L6GA 4JDFA 4PF8A 4NF4B 2H25A 2NXOA 2DWIA 4XTCQ 1J1NA 5IZ3B 2F6PA 3MVWA 1FTJA 2Q8MA 1H44A 2ZYMA 1FPLA 4YAHX 2CZKA 4X48A 2DQVA 2AYSA 1NNKA 5EQ8A 1MDP1 2OLBA 4ZEIA 2XXQA 4G68B 2PFYA 3DLNA 3RLFE 4PETA 5JK4A 5K2YA 5H8QB 1IMCA 4F3BA 4LUBA 3E13X 4BDRA 3T9HB 3PMXA 1MXVA 4Q0CA 1LBWA 4HE0A 3IX1A 1AWBA 2CZLA 3H6VA 2O7IA 3KJ7A 3NOHA 4KYDA 3DP6A 3TCHA 3FJ7A 5I7IA 5AE4A 3OO7A 2O1LA 4NF5B 4THIA 1MQHA 3TUSA 3B6WA 3IOWA 3DELB 4IY6A 5B7DA 4O3CA 3FASA 5ET6A 1BK4A 2DP8A 2G93A 2OK2A 3N5LA 4QBAA 4U21A 2A5TB 2UVHA 1S50A 4NF8A 1NUWA 4AS4A 3SEWA 3V89B 3MP1A 1OIBA 4MHFA 4H5GA 4OVSA 3IJOB 1EYIA 2A5SA 4N17A 4P11A 2X26A 1MY1A 4IGTA 3M3LA 3TMGA 2O69A 4PFYA 3LUZA 1BP5A 5DVFA 3FD3A 5JEIA 4LA9A 2KR0A 1NV1A 3FV2A 5HPQA 3T9UA 3O6HA 1FBFA 2Q2CA 3PUVE 3W9VA 4DCXA 1MQIA 4POXA 1HSJA 2PYYA 3CFXA 1Z7ME 4PFUA 5ET5A 3OOAA 3VLVA 3LSWA 2P3NA 2REGA 3KN7A 3RN8A 2WKYA 5AA2D 2XD2A 4PQJA 2HXWA 1VDWA 5LDZA 2DYXA 1DBZA 5AA4A 4G8HA 4AB5A 5JTYB 5CMCA 3C33A 3FATA 2RF1A 1LFGA 4ZEKA 3FUZA 1WDNA 4LVQA 4U4XA 3S9LC 4KXPA 4NF8B 4PDHA 1MQJA 4NGUA 1N7WA 2W7YA 2XWVA 3EQ1A 3IL1B 1ATGA 3MP6A 4EXKA 3LR1A 4KQPA 2PT1A 3IOTA 1RDYA 2RC9A 4NG7A 3TTKA 2QS2A 4EF2A 5ELVA 4GBWA 4PAFA 1MPCA 3B7DA 2CEYA 1YYZA 1B7UA 4EQBA 4MMPA 1FBPA 4JVIA 1YCJA 3KOSA 1FQEA 2Y7KA 3K6UA 5ICTA 2AL4A 3UP9A 4FBPA 3S9MC 4NAPA 4RPNA 1MDQA 2E1SA 3B6TA 3HFUA 3U8QA 4H8JA 2F3DA 5IZ3A 3PD9A 3VE1B 5BWJA 5DYHA 3E3KA 3MPKA 2P3VA 2FIEA 5IKBA 2YPNA 4RK9A 1RYOA 4OTEA 5JTYA 4RNSA 4WEPA 1EZOA 4H1XA 2GRVA 4OQOA 1Y3NA 2F3BA 4GL8A 1EH3A 1B0LA 5I58A 2Z22A 1Y1MA 5ET7A 1SW5A 4R73A 3DP4A 3H6WA 3IFAA 4FECA 2VT5A 4PC9A 4JSOA 2WYKA 4AQ4A 3SZPA 3CIJA 3N6TA 4YB5A 1B3HA 4NQ8A 5IAIA 4ZEBA 2I49A 3K6XA 1S7YA 1IMDA 3K4UA 4IGRA 4P1LA 1A55A 1XT8A 1D9YA 3FBPA 2AL5A 1Q1KA 2VHAA 3KBZA 4H65A 3H6UA 1FQCA 4JB7A 3MVYA 1FSAA 1IITA 3H7MA 1IMEA 3IORA 3MYUA 2Y5KA 3MQ9A 1P1OA 4MCOA 3U65A 2RKMA 4KCCA 1S9TA 1ZU0A 4QSEA 3K02A 3HV1A 3QYTA 1Y20A 1AMFA 2GH9A 4YKIA 5I59A 3W15C 4HW8A 2PCRA 2I4BA 1B6HA 1N84A 1NH7A 5A5XA 1WODA 2OX3A 2Q2AA 4N8GA 3UA8A 1FBDA 4XKNA 1MM7A 4PDDA 1LBCA 1IMFA 3K1MA 4O7MA 1PC3A 5CI5A 2ZNUA 4R9FA 3EHUA 2VPNA 1QGXA 3GZGA 4KYEA 4I9DA 4DXUA 5DVJA 2XXRA 1USYH 4QF9A 1MXZA 2Q8JA 4PAIA 2Y7RA 3K1NA 3B50A 2Q9TA 5I5PA 4NF0A 4DIGA 4OHNA 4LONB 4N4UA 1LAXA 3D4CA 3LV0A 2IA4A 2R9JA 4U2RA 3D1RA 1SI0A 3TTRA 2WEFA 3BIGA 3HHGA 5KZTA 4GXAA 5KDTB 3IR1A 3K0VA 4GLIA 5EYFA 3H03A 1FQDA 3USDA 2DS9A 3O6GA 3GXAA 1SVXB 3A3UA 1D3KA 1TFDA 2F34A 3O9PA 3C4MA 5H8QA 2DWAA 4PBHA 3JV9A 4PGNA 1IIWA 1MXWA 1R9LA 4QXDA 4NX1A 4IO4A 4JWYA 4LZ7A 1M5EA 3O29A 4R72A 4Q8RA 3RGYA 5BUUA 2O7UA 3TODA 2DE4A 3AXFA 4XKQA 4YZZA 3PPPA 2Q74A 4K3FA 2LAOA 1XHYA 5I59B 2XXIA 3OO8A 3IB2A 4R9GA 4XFEA 2THIA 2NWJA 2DE2A 2ZZXA 1TT1A 3SEUA 2F5XA 4I3YA 3MZBA 1MG1A 1FTOA 2QS4A 2UVJA 3MAMA 1JW4A 1UTBB 3MBPA 4G8MA 4MF3A 4X1BA 4OESA 5FHOA 3QMFA 4L17A 5CMBA 4GIZA 3RQTA 3H3GA 4MLQA 4BDLA 1K9ZA 1QVSA 2B4MA 1OVBA 3HHFA 5ITOA 3CG3A 1LSTA 3CR9A 1D4NA 1BKAA 3QIMA 4R6HA 4RPOA 1P1QA 4U22A 5I58B 4H45A 2O68A 2ZXTA 4JSDA 4F29A 1P99A 4DDDA 1JVXA 3KZGA 3V8XB 3QSLA 1Q35A 3TZAA 4PE5B 1NV5A 4XIGQ 5TP9A 1RDXA 1IMAA 3PPNA 1GVCA 4EF1A 4GVOA 1D9QA 3IFCA 3CHGA 2F35A 3FGSA 3HPIA 3IB1A 3E78A 1B51A 1JETA 2F36A 4OVPA 2QJEA 4QRZA 4G8NA 1MY0A 1UIVA 5EHMA 2JJKA 1URGA 5FBPA 3PMVA 4I8CA 2PT2A 4ZS9A 1M5DA 1B3LA 2XA5A 2NUVA 2CZIA 3EKIA 2BJJX 4P8BA 3FXRA 1FPEA 3OO9A 4YICA 2VOZA 4DE8A 2QVVA 1Y3PA 4MH5A 1GV8A 4YB6A 4ZEFA 4UABA 4MJOA 3VDFA 3FJGA 1A54A 3OELA 1FBHA 1JW1A 4ELRA 2XXKA 3K6VA 2H9BA 4O7IA 2PBWA 3QUJA 2F78A 3E79A 2FA7A 2ZYOA 4OFLA 4YKPA 1FPBA 3W9WA 4OFOA 1MXXA 1QUIA 4FIMA 2ZNTA 3S9NC 4P0GA 3LBSA 3MJNA 4ZZEA 2VD3A 3TCFA 2B65A 5AA4B 4NEDA 4Q5TA 2F7CA 3KEIA 3KN3A 4G61A 5HBCA 4N8YA 1SW1A 3BFUA 4YU0A 3V5AA 4I3EA 1UIUA 2FYIA 4Q30B 4U1OA 4PFIA 2OWTA 2H5YA 2QFLA 3SDFA 2VD2A 2X7PA 4R2BA 1LAFE 4LATA 1YXIA 4H5FA 4IO6A 4XXUA 2HQ0A 1JEVA 5I2KB 4H0WA 1ELJA 3C34A 3HSTA 1R1NA 2XWIA 3TAJA 1B3GA 4H8IA 3UK4A 2CMOA 3PUWE 5DVIA 4R2FA 3V83A 2RC7A 3KN8A 3I6VA 3HN0A 3K2DA 1PDAA 1IXCA 3EHTA 4N07A 1FTKA 3PUZE 1LGBC 4RYAA 4F18A 4MFIA 4AB6A 3IAZA 1QJMA 4N81A 4GX6A 3K1PA 3RTWB 3C31A 4KHZE 5K2XA 3ZKKA 1VR5A 3S2VA 1NV4A 4OETA 3U93A 2G29A 1HSLA 3D4GA 1ZBMA 4O94A 2GHBA 5ET8A 4NWDA 3RTFB 1MY4A 3KGCA 1Y4TA 3S4UA 3OENA 4HS7A 4LZ8A 1Y1ZA 1BTJA 3LUYA 3BKIB 1YZ0A 3UORA 1URSA 4MLVA 3QK6A 3VFJA 1MQDA 2B4LA 4XEQA 5EYGA 3FVNA 1G0IA 1LB8A 2QPQA 3L6HA 2P2AA 2F6GA 1MM6A 4GBVA 3EF7A 3TTMA 3KFMA 1MRPA 1XOCA 4ZZAA 1A8FA 2R8TA 4G2ZA 3T1BA 1LBXA 1MQGA 3MZ9A 3MUQA 3C36A 1H45A 3IOVA 3RUMA 3EPEA 3KBRA 1I69A 1I6AA 3VLUA 4M1VA 5CC2A 4NE4A 5CBRA 3OEKA 2Z23A 3Q25A 4G68A 2ZMBA 4ZE8A 1A99A 1HSEA 1H76A 3GLBA 1QKBA 4Z7EA 4MIJA 5EQAA 4FATA 4PCDA 3N26A 4YKKA 2CZHA 5IZZA 3RT6B 3UN6A 1VFDA 4G4PA 4C0RA 4IO2A 1H3DA 5FHMA 3LSFB 1FTLA 1YAEA 4IO7A 4UA8A 2R6GE 4MNCA 1K9YA 4ONYA 3VV5A 3CI8A 4JVCA 3K01A 2OWSA 1SI1A 4P1EA 4U1ZA 4QSDA 2QVUA 3TFLA 2FIXA 3SERA 1R6ZA 2BJIA 2DXRA 2PFZA 3TDJA 3QXMA 3I3VA 1MH4A 3TTNA 4YMBA 3U94A 4POWA 5H8HA 2DWHA 3U1OA 1B0HA 1XI6A 2I4CA 4H46A 3B6QA 1B1XA 1II5A 3MVXA 5M2VA 2DXYA 1OLAA 3LC8A 4DXCA 4F1VA 2XWOA 3VVFA 5IM2A 1FPGA 4PFTA 4OVTA 4OVQA 2QVRA 3E9XA 1IQ7A 2I58A 4R6KA 1LAHE 4I40A 4UACA 2GHAA 4EQ7A 3KSJA 2XXWA 4GX4A 1B58A 4O3AA 5KCJB 4OEVA 4X9TA 2ONRA 3EHSA 3MC2A 1EYJA 4BDNA 4LN5A 3TKDA 3SEVA 1VSOA 3FXUA 2RINA 2QS1A 1US5A 2XWKA 3ILTB 4YKJA 3C32A 2NOOA 3C35A 4WKMA 1IXGA 5DEXB 1Y3QA 4YB7A 1OQGA 1EYKA 1B40A 1MPBA 2FNCA 1B9JA 3G3IA 5I84A 2IEEA 3H06B 3M3FA 4QFLA 4GWYA 1GR2A 3ZKLA 5ESYA 3ISPA 3TELA 1SD3A 2GQ1A 1IUDA 4E0WA 4R74A 2XHDA 3B8BA 1ZMGA 1EU8A 1MY2A 1B4HA 1FBGA 3O6IA 3R26A 4OA4A 1AOVA 4Z0IA 4JXIA 1M5CA 3BBRA 1MXUA 3MWBA 2XX7A 5TU0A 2V25A 2PMSA 2V3QA 4F3GA 5T3JA 4OENA 1B05A 4YMAA 1NMUA 2UVIA 4TLMB 3HO7A 5CBSA 1BLFA 5FHNA 3O2AA 4QFPA 1B5IA 3O66A 3RYDA 5H8SA 1IMBA 4FJPA 5I57B 3PPQA 5TPAA 2F7BA 3CRBA 2R71A 4P9KA 3KC0A 2F8DA 1DK4A 3PUXE 1UTHA 5IZ1A 1TXFA 1LB9A 5DEXA 2YLNA 1QKAA 5EYHA 1NH8A 4N13A 4FEBA 2Z8EA 2P1SA 1B3EA 1IXIA 4HCWA 1Y9UA 1AIVA 1H43A 1NNPA 2FVZA 4NN3A 1OMPA 2QSXA 2O1MA 1XVYA 3RPLA 5A5LA 2Z8FA 3K00A 2VP1A 4KCDA 4F3PA 2Q89A 2I6EA 1XS5A 1LAGE 3KOTA 5CMMA 4X8RA 3U72A 1KA0A 1FCKA 3FV1A 3PMWA 3G3GA 1KZ8A 1FPKA 3FVOA 1Y4CA 1CE2A 1N7XA 3VXBA 4GWWA 1SW2A 3PD8A 3P7IA 5ITPA 4HCYA 2A5TA 5I56B 4GWZA 1G0HA 3OEMA 1NV7A 2XXHA 2XXXA 1NNTA 4OANA 2B3FA 2HHMA 2XXYA 3G3FA 3PUYE 2XD3A 4QFOA 3T0JA 3CSBA 4MNIA 1FBCA 1FJ6A 4I1DA 5H8FA 1MY3A 4P47A 2Y7IA 1JEUA 3DM0A 5H8HB 2V84A 4GRKA 4N6KA 2ONSA 3QUFA 3OO6A 3PTYA 2F97A 4F22A 3T9XB 3VXCA 4IO3A 4QFKA 5L9OA 3ECRA 2HFBA 5TPAB 1GGGA 3Q26A 4GQOA 2HZKA 2OBGA 3ZS6A 1RKMA 4X04A 4GFRA 4N6PA 3ONMA 4OXVA 3SEXA 1FQAA 1KA1A 3OD7A 4FE8A 3BFTA 4HTGA 3IJXB 3KG2A 3OSRA 1N3XA 3THIA 1OQHA 1YTVA 4ZECA 5I56A 3SKPA 3CVGA 4EQ9A 5L9SA 2XXPA 3PV0E 1NUXA 1US4A 1O64A 2WBBA 4R75A 3DP8A 3TEPA 3QAXA 4QHQA 4GWUA 4GXSB 1OVTA 4IB2A 1N04A 4KR5A 3OMBA 5H8NB 1RYXA 5J16A 1XVXA 1AL3A 3VVEA 5F24A 4NF6A 4JWOA 4N91A 3FVGA 2PVUA 5AA3A 1URDA 1NNFA 4DI4B 1I6QA 5IGAA 1F9BA 1CNQA 4FAJA 3HCQA 2CEXA 2DDKA 1I6BA 4ND9A 4X1DA 2D21A 4P0IA 3FXBA 1QUKA 4H67A 5I2NA 2ZYNA 1A40A 3Q27A 3TCGA 4GD5A 1O63A 3KJTA 4BLAA 1GTKA 3IK6B 1LCFA 4GWSA 4OVJA 2RCBA 3H6TA 5F1QA 3LSXA 3RY3A 1ZLQA 3T66A 4KPTA 4OZ9A 1XC1A 5B70A 4PFBA 3GBAA 3RT8A 2UYFA 3VLWA 1LBZA 2XXUA 4GX3A 4ECFA 2E0SA 5LOMA 5FTIA 1INPA 4HE2A 1FTMA 2I3WA 2DVCA 4TQUQ 1PB9A 4ELOA 2KLFA 4MX6A 1L5TA 2Z8DA 3F11A 2KQZA 1Q9DA 4U4SA 2OJTA 1SQYA 1MH3A 4XKRA 2GFEA 4LZ5A 1PBQA 4P3LA 4ZDMA 4C1TA 5J1DA 4GWOA 1LEVA 3TYHA 3C9HA 1B2HA 4RJZA 1NI9A 4EXLA 3TPAA 4MNPA 4ESWA 1SYHA 4NF6B 2F7AA 4LQ5A 1M5FA 1B52A 2ESNA 4NHBA 4BDMA 3IO4A 1P1WA 2H99A 4OERA 2QMXA 1POY1 1DCUA 3A29A 1FJ9A 1FW0A 5EHSA 4JBZA 2ZYKA 1LBVA 2NVUB 1NV3A 4F2QA 1Z7NE 2ABHA 1JW5A 1RDZA 4RXLA 2UXAA 3FIRA 5A5XB 4RK2A 1FBEA 1PEBA 3OXNA 2X7QA 3G3HA 3SESA 2ZZVA 1FPIA 1FPDA 1MPDA 4GWXA 1JVYA 2HZLA 2HCAA 1SYIA 3KC1A 4RY1A 2P0SA 4WEDA 2XXTA 2H4IA 4WXJA 5EQ7A 4LQ2A 3M3KA 2HEUA 4PBQA 1QULA 4KD5A 1PBPA 3UIFA 1ZIUA 3M8UA 3N6UA 3FXQA 1KWHA 2UVGA 4AS5A 3FZVA 4G68C 4HXVA 2ANJA 2WBDA 4RA1A 1VFEA 1DPPA 4R6YA 3ROJA 3ZSFA 2HAUA 2V4CA 3MW0A 4IY5A 5I57A 1P1NA 4DXBA 4XKPA 1UTHB 2I48A 3LSLA 5KDTA 1B32A 1DOTA 4H6DA 4JVDA 4C1UA 1N76A 2M8CA 5HM4B 1QW0A 3MZ1A 2O6AA 2HAVA 2I0BA 2Y5LA 1CB6A 5H8NA 1DPEA 3Q29A 3OSQA 1SPIA 4F2OA 1B7HA 3IOUA 3FJMA 5AA1A 1UQWA 3IB0A 3H4ZA 2Y84A 3MVZA 3O28A 3R7XA 4ZE9A 3GYYA 3JYRA 2QS3A 4QFNA 1IZ1A 5L9MA 3MP8A 3PU5A 4PE3A 4O3BA 3UGWA 4F19A 3G3KA 1VE4A 3G7WA 1NV2A 3WAEA 2O51A 1QUJA 4ISUA 1PB8A 4OEUA 1ZJLA 3VVDA 2HXRA 2FBPA 1LLSA 4PTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNN A;  2B3B A;  4OYV A;  1LFI A;  1UTB A;  2I0C A;  3SEY A;  2RCA A;  1IEJ A;  5KCJ A;  3T9V A;  1FQF A;  3U92 A;  4PFW A;  4F31 B;  3IO6 A;  4MBP A;  1TFA A;  5TP9 B;  3WAF A;  3I5O A;  3JZJ A;  1DTG A;  2VGQ A;  5LTC A;  2PX1 A;  1JQF A;  2QMW A;  4P56 A;  1B7Z A;  2Q88 A;  4DZ1 A;  1YPN A;  1LBB A;  2ZNS A;  3R6U A;  1D9V A;  4NTL A;  1BIY A;  4PF6 A;  4MAG A;  1LCT A;  2VPO A;  2V93 A;  5H8F B;  2WX9 A;  4KYS A;  5DT6 A;  4QSC A;  3EN3 A;  1N0T A;  2D5W A;  2ZZW A;  1SW4 A;  4N15 A;  5ISU A;  5FTH A;  3CFZ A;  4FOR A;  2XXV A;  1OLC A;  3E4R A;  1NKX A;  5CRY A;  1B5J A;  3T96 B;  2REJ A;  1B4Z A;  4OVR A;  4NF5 A;  4OWD A;  4M4G A;  5AA2 B;  4KI0 E;  1TWY A;  2DSF A;  2UYE A;  4OFJ A;  4TOZ A;  3PPO A;  4G77 A;  4PFR A;  1WVJ A;  2DWJ A;  1SBP A;  3RPW A;  2ALU A;  1ZKB A;  1SDX A;  3T93 B;  3K6W A;  1NL5 A;  4I62 A;  5CM6 A;  1B46 A;  4EDP A;  3TTL A;  3FVK A;  3O97 A;  2WYP A;  4NMY A;  2DVZ A;  2DOJ A;  4PGP A;  4F1Y A;  3TQL A;  1AH5 A;  4XF5 A;  1B1H A;  1FQB A;  5I2N B;  2DE3 A;  5CMK A;  1A8E A;  2Y7W A;  1PB7 A;  3PPR A;  2I3V A;  1B5H A;  4F3S A;  5I2K A;  1N3W A;  5L8D A;  4ELQ A;  4ELP A;  1P1U A;  1LFH A;  3TQW A;  2D3I A;  5ICQ A;  4F39 A;  4E0X A;  1NFT A;  4F1U A;  4NF4 A;  2RC8 A;  1ANF A;  3SET A;  5F7V A;  4JWX A;  3KSX A;  1EZ9 A;  2ONK E;  4GF8 A;  4PAK A;  4DLD A;  2Y7P A;  4KFQ A;  1DSN A;  1JNF A;  2V3T A;  3ILU B;  5AA2 A;  2QRY A;  1IXH A;  2AIX A;  2XX8 A;  1EZP A;  1POT A;  3A3C A;  4IO5 A;  2O84 X;  3G3J A;  4U23 A;  4BDO A;  1MS7 A;  2XX9 A;  3A09 A;  4NWC A;  4DCY A;  1A7L A;  1B3F A;  2OCU A;  4N6D A;  4LP2 B;  2QL3 A;  2YJP A;  1USY E;  3GBB A;  4EUO A;  4O8M A;  4ESX A;  1M5B A;  4PP0 A;  1ZTY A;  3T22 A;  2HPG A;  2V3U A;  3CFL A;  1O7T A;  1DMB A;  3CSG A;  4TLL B;  4FED A;  3CG1 A;  1DTZ A;  2H98 A;  4BDQ A;  5DTB A;  3ODB A;  4ZED A;  4MEV A;  3N94 A;  4GL0 A;  1T0K A;  3S9E A;  1MXY A;  4DI3 D;  1R9Q A;  4GOT A;  3PGF A;  3Q28 A;  2OZZ A;  3MPL A;  4OMB A;  3L6G A;  4JDF A;  4PF8 A;  4NF4 B;  2H25 A;  2NXO A;  2DWI A;  4XTC Q;  1J1N A;  2F6P A;  3MVW A;  1FTJ A;  1H44 A;  2ZYM A;  4YAH X;  4X48 A;  2DQV A;  2AYS A;  1NNK A;  1MDP 1;  2OLB A;  4ZEI A;  2XXQ A;  4G68 B;  2PFY A;  3DLN A;  3RLF E;  4PET A;  5JK4 A;  5K2Y A;  5H8Q B;  4F3B A;  4LUB A;  3E13 X;  4BDR A;  3T9H B;  3PMX A;  1MXV A;  4Q0C A;  3IX1 A;  2CZL A;  3H6V A;  2O7I A;  3KJ7 A;  4KYD A;  3DP6 A;  3TCH A;  3FJ7 A;  5I7I A;  5AE4 A;  3OO7 A;  2O1L A;  4NF5 B;  4THI A;  1MQH A;  3TUS A;  3B6W A;  3IOW A;  3DEL B;  4IY6 A;  5B7D A;  4O3C A;  3FAS A;  2DP8 A;  2G93 A;  2OK2 A;  3N5L A;  4U21 A;  2A5T B;  2UVH A;  1S50 A;  4NF8 A;  3SEW A;  3V89 B;  3MP1 A;  1OIB A;  4MHF A;  4H5G A;  4OVS A;  3IJO B;  2A5S A;  4N17 A;  4P11 A;  2X26 A;  1MY1 A;  4IGT A;  3M3L A;  3TMG A;  2O69 A;  4PFY A;  1BP5 A;  5DVF A;  3FD3 A;  5JEI A;  4LA9 A;  3FV2 A;  5HPQ A;  3T9U A;  3O6H A;  2Q2C A;  3PUV E;  3W9V A;  4DCX A;  1MQI A;  4POX A;  1HSJ A;  2PYY A;  3CFX A;  1Z7M E;  4PFU A;  3OOA A;  3VLV A;  3LSW A;  2REG A;  3KN7 A;  3RN8 A;  2WKY A;  5AA2 D;  2XD2 A;  4PQJ A;  2HXW A;  2DYX A;  5AA4 A;  4G8H A;  4AB5 A;  5JTY B;  5CMC A;  3C33 A;  3FAT A;  2RF1 A;  1LFG A;  4ZEK A;  3FUZ A;  1WDN A;  4LVQ A;  4U4X A;  3S9L C;  4NF8 B;  4PDH A;  1MQJ A;  4NGU A;  1N7W A;  2W7Y A;  2XWV A;  3EQ1 A;  3IL1 B;  1ATG A;  3MP6 A;  4EXK A;  3LR1 A;  4KQP A;  2PT1 A;  3IOT A;  2RC9 A;  4NG7 A;  3TTK A;  2QS2 A;  4EF2 A;  5ELV A;  4PAF A;  1MPC A;  3B7D A;  2CEY A;  1B7U A;  4EQB A;  4MMP A;  1YCJ A;  3KOS A;  1FQE A;  2Y7K A;  3K6U A;  5ICT A;  2AL4 A;  3UP9 A;  3S9M C;  4NAP A;  4RPN A;  1MDQ A;  2E1S A;  3B6T A;  3U8Q A;  4H8J A;  3PD9 A;  3VE1 B;  5BWJ A;  5DYH A;  3E3K A;  3MPK A;  5IKB A;  2YPN A;  4RK9 A;  1RYO A;  4OTE A;  5JTY A;  4RNS A;  4WEP A;  1EZO A;  4H1X A;  2GRV A;  4OQO A;  1Y3N A;  4GL8 A;  1EH3 A;  1B0L A;  5I58 A;  2Z22 A;  1Y1M A;  1SW5 A;  4R73 A;  3DP4 A;  3H6W A;  4FEC A;  4PC9 A;  4JSO A;  2WYK A;  4AQ4 A;  3CIJ A;  3N6T A;  4YB5 A;  1B3H A;  4NQ8 A;  5IAI A;  4ZEB A;  2I49 A;  3K6X A;  1S7Y A;  3K4U A;  4IGR A;  4P1L A;  1A55 A;  1XT8 A;  1D9Y A;  2AL5 A;  1Q1K A;  2VHA A;  4H65 A;  3H6U A;  1FQC A;  4JB7 A;  3MVY A;  1IIT A;  3H7M A;  3IOR A;  3MQ9 A;  1P1O A;  4MCO A;  3U65 A;  2RKM A;  4KCC A;  1S9T A;  1ZU0 A;  4QSE A;  3K02 A;  3HV1 A;  3QYT A;  1Y20 A;  1AMF A;  2GH9 A;  4YKI A;  5I59 A;  3W15 C;  4HW8 A;  2I4B A;  1B6H A;  1N84 A;  1NH7 A;  5A5X A;  1WOD A;  2Q2A A;  4N8G A;  3UA8 A;  4XKN A;  1MM7 A;  4PDD A;  1LBC A;  3K1M A;  4O7M A;  1PC3 A;  5CI5 A;  2ZNU A;  4R9F A;  3EHU A;  2VPN A;  3GZG A;  4KYE A;  4I9D A;  4DXU A;  5DVJ A;  2XXR A;  1USY H;  4QF9 A;  1MXZ A;  2Q8J A;  4PAI A;  2Y7R A;  3K1N A;  3B50 A;  2Q9T A;  5I5P A;  4NF0 A;  4DIG A;  4OHN A;  4LON B;  4N4U A;  1LAX A;  3D4C A;  2IA4 A;  2R9J A;  4U2R A;  1SI0 A;  3TTR A;  3HHG A;  5KZT A;  4GXA A;  5KDT B;  3IR1 A;  3K0V A;  4GLI A;  5EYF A;  3H03 A;  1FQD A;  3USD A;  2DS9 A;  3O6G A;  3GXA A;  1SVX B;  3A3U A;  1D3K A;  1TFD A;  2F34 A;  3O9P A;  3C4M A;  5H8Q A;  2DWA A;  4PBH A;  3JV9 A;  4PGN A;  1IIW A;  1MXW A;  1R9L A;  4NX1 A;  4IO4 A;  4JWY A;  4LZ7 A;  1M5E A;  3O29 A;  4R72 A;  4Q8R A;  3RGY A;  5BUU A;  2O7U A;  3TOD A;  2DE4 A;  3AXF A;  4XKQ A;  4YZZ A;  3PPP A;  4K3F A;  2LAO A;  1XHY A;  5I59 B;  2XXI A;  3OO8 A;  3IB2 A;  4R9G A;  4XFE A;  2THI A;  2NWJ A;  2DE2 A;  2ZZX A;  1TT1 A;  3SEU A;  2F5X A;  3MZB A;  1MG1 A;  1FTO A;  2QS4 A;  2UVJ A;  3MAM A;  1JW4 A;  1UTB B;  3MBP A;  4G8M A;  4MF3 A;  4X1B A;  4OES A;  5FHO A;  4L17 A;  5CMB A;  4GIZ A;  3RQT A;  3H3G A;  4MLQ A;  4BDL A;  1QVS A;  1OVB A;  3HHF A;  5ITO A;  3CG3 A;  1LST A;  3CR9 A;  1D4N A;  1BKA A;  3QIM A;  4R6H A;  4RPO A;  1P1Q A;  4U22 A;  5I58 B;  2O68 A;  2ZXT A;  4JSD A;  4F29 A;  1P99 A;  4DDD A;  1JVX A;  3KZG A;  3V8X B;  3QSL A;  1Q35 A;  3TZA A;  4PE5 B;  4XIG Q;  5TP9 A;  3PPN A;  1GVC A;  4EF1 A;  4GVO A;  2F35 A;  3FGS A;  3HPI A;  3IB1 A;  1B51 A;  1JET A;  2F36 A;  4OVP A;  2QJE A;  4QRZ A;  4G8N A;  1MY0 A;  1UIV A;  5EHM A;  1URG A;  3PMV A;  4I8C A;  2PT2 A;  4ZS9 A;  1M5D A;  1B3L A;  2XA5 A;  2NUV A;  2BJJ X;  4P8B A;  3FXR A;  3OO9 A;  4YIC A;  2VOZ A;  4DE8 A;  1Y3P A;  4MH5 A;  1GV8 A;  4YB6 A;  4ZEF A;  4UAB A;  3VDF A;  3FJG A;  1A54 A;  3OEL A;  1JW1 A;  4ELR A;  2XXK A;  3K6V A;  2H9B A;  2PBW A;  3QUJ A;  2F78 A;  2FA7 A;  2ZYO A;  4OFL A;  4YKP A;  3W9W A;  4OFO A;  1MXX A;  1QUI A;  4FIM A;  2ZNT A;  3S9N C;  4P0G A;  3LBS A;  3MJN A;  4ZZE A;  2VD3 A;  3TCF A;  2B65 A;  5AA4 B;  4NED A;  4Q5T A;  2F7C A;  3KEI A;  3KN3 A;  5HBC A;  4N8Y A;  1SW1 A;  3BFU A;  4YU0 A;  3V5A A;  1UIU A;  2FYI A;  4Q30 B;  4U1O A;  4PFI A;  2OWT A;  2H5Y A;  3SDF A;  2VD2 A;  2X7P A;  4R2B A;  1LAF E;  4LAT A;  4H5F A;  4IO6 A;  4XXU A;  2HQ0 A;  1JEV A;  5I2K B;  4H0W A;  1ELJ A;  3C34 A;  3HST A;  1R1N A;  2XWI A;  3TAJ A;  1B3G A;  4H8I A;  3UK4 A;  2CMO A;  3PUW E;  5DVI A;  4R2F A;  3V83 A;  2RC7 A;  3KN8 A;  3I6V A;  3HN0 A;  3K2D A;  1PDA A;  1IXC A;  3EHT A;  4N07 A;  1FTK A;  3PUZ E;  1LGB C;  4RYA A;  4F18 A;  4MFI A;  4AB6 A;  3IAZ A;  1QJM A;  3K1P A;  3RTW B;  3C31 A;  4KHZ E;  5K2X A;  3ZKK A;  1VR5 A;  3S2V A;  4OET A;  3U93 A;  2G29 A;  1HSL A;  3D4G A;  1ZBM A;  4O94 A;  2GHB A;  4NWD A;  3RTF B;  1MY4 A;  3KGC A;  1Y4T A;  3S4U A;  3OEN A;  4HS7 A;  4LZ8 A;  1Y1Z A;  1BTJ A;  3LUY A;  3BKI B;  3UOR A;  1URS A;  4MLV A;  3QK6 A;  3VFJ A;  1MQD A;  4XEQ A;  3FVN A;  1LB8 A;  2QPQ A;  3L6H A;  2P2A A;  2F6G A;  1MM6 A;  3EF7 A;  3TTM A;  3KFM A;  1MRP A;  1XOC A;  4ZZA A;  1A8F A;  4G2Z A;  1MQG A;  3MZ9 A;  3MUQ A;  3C36 A;  1H45 A;  3IOV A;  3RUM A;  3EPE A;  3KBR A;  1I69 A;  1I6A A;  3VLU A;  4M1V A;  5CC2 A;  4NE4 A;  5CBR A;  3OEK A;  2Z23 A;  3Q25 A;  4G68 A;  2ZMB A;  4ZE8 A;  1A99 A;  1HSE A;  1H76 A;  3GLB A;  1QKB A;  4Z7E A;  4MIJ A;  4FAT A;  4PCD A;  3N26 A;  4YKK A;  5IZZ A;  3RT6 B;  3UN6 A;  1VFD A;  4G4P A;  4C0R A;  4IO2 A;  1H3D A;  5FHM A;  3LSF B;  1FTL A;  1YAE A;  4IO7 A;  4UA8 A;  2R6G E;  4MNC A;  4ONY A;  3VV5 A;  3CI8 A;  3K01 A;  2OWS A;  1SI1 A;  4P1E A;  4U1Z A;  4QSD A;  3TFL A;  3SER A;  1R6Z A;  2DXR A;  2PFZ A;  3TDJ A;  3QXM A;  3I3V A;  1MH4 A;  3TTN A;  4YMB A;  3U94 A;  4POW A;  5H8H A;  2DWH A;  3U1O A;  1B0H A;  2I4C A;  3B6Q A;  1B1X A;  1II5 A;  3MVX A;  5M2V A;  2DXY A;  1OLA A;  3LC8 A;  4DXC A;  4F1V A;  2XWO A;  3VVF A;  5IM2 A;  4PFT A;  4OVT A;  4OVQ A;  3E9X A;  1IQ7 A;  2I58 A;  4R6K A;  1LAH E;  4UAC A;  2GHA A;  4EQ7 A;  3KSJ A;  2XXW A;  1B58 A;  4O3A A;  5KCJ B;  4OEV A;  4X9T A;  2ONR A;  3EHS A;  3MC2 A;  4BDN A;  4LN5 A;  3TKD A;  3SEV A;  1VSO A;  3FXU A;  2RIN A;  2QS1 A;  1US5 A;  2XWK A;  3ILT B;  4YKJ A;  3C32 A;  2NOO A;  3C35 A;  4WKM A;  1IXG A;  5DEX B;  1Y3Q A;  4YB7 A;  1OQG A;  1B40 A;  1MPB A;  2FNC A;  1B9J A;  3G3I A;  5I84 A;  2IEE A;  3H06 B;  3M3F A;  4QFL A;  1GR2 A;  3ZKL A;  3TEL A;  1SD3 A;  1IUD A;  4E0W A;  4R74 A;  2XHD A;  1ZMG A;  1EU8 A;  1MY2 A;  1B4H A;  3O6I A;  3R26 A;  4OA4 A;  1AOV A;  4Z0I A;  4JXI A;  1M5C A;  3BBR A;  1MXU A;  3MWB A;  2XX7 A;  5TU0 A;  2V25 A;  2PMS A;  2V3Q A;  4F3G A;  4OEN A;  1B05 A;  4YMA A;  1NMU A;  2UVI A;  4TLM B;  3HO7 A;  5CBS A;  1BLF A;  5FHN A;  3O2A A;  4QFP A;  1B5I A;  3O66 A;  5H8S A;  4FJP A;  5I57 B;  3PPQ A;  5TPA A;  2F7B A;  3CRB A;  2R71 A;  4P9K A;  2F8D A;  3PUX E;  1UTH A;  1TXF A;  1LB9 A;  5DEX A;  2YLN A;  1QKA A;  1NH8 A;  4N13 A;  4FEB A;  2Z8E A;  2P1S A;  1B3E A;  1IXI A;  4HCW A;  1Y9U A;  1AIV A;  1H43 A;  1NNP A;  4NN3 A;  1OMP A;  2QSX A;  2O1M A;  1XVY A;  2Z8F A;  3K00 A;  2VP1 A;  4KCD A;  4F3P A;  2Q89 A;  2I6E A;  1XS5 A;  1LAG E;  3KOT A;  5CMM A;  4X8R A;  3U72 A;  1FCK A;  3FV1 A;  3PMW A;  3G3G A;  3FVO A;  1Y4C A;  1CE2 A;  1N7X A;  3VXB A;  1SW2 A;  3PD8 A;  3P7I A;  5ITP A;  4HCY A;  2A5T A;  5I56 B;  3OEM A;  2XXH A;  2XXX A;  1NNT A;  4OAN A;  2B3F A;  2XXY A;  3G3F A;  3PUY E;  2XD3 A;  4QFO A;  3CSB A;  4MNI A;  4I1D A;  5H8F A;  1MY3 A;  4P47 A;  2Y7I A;  1JEU A;  3DM0 A;  5H8H B;  2V84 A;  4GRK A;  4N6K A;  2ONS A;  3QUF A;  3OO6 A;  2F97 A;  4F22 A;  3T9X B;  3VXC A;  4IO3 A;  4QFK A;  5L9O A;  3ECR A;  2HFB A;  5TPA B;  1GGG A;  3Q26 A;  4GQO A;  2HZK A;  2OBG A;  3ZS6 A;  1RKM A;  4X04 A;  4GFR A;  4N6P A;  3ONM A;  4OXV A;  3SEX A;  1FQA A;  3OD7 A;  4FE8 A;  3BFT A;  4HTG A;  3IJX B;  3KG2 A;  3OSR A;  1N3X A;  3THI A;  1OQH A;  1YTV A;  4ZEC A;  5I56 A;  3SKP A;  3CVG A;  4EQ9 A;  5L9S A;  2XXP A;  3PV0 E;  1US4 A;  1O64 A;  4R75 A;  3DP8 A;  3TEP A;  3QAX A;  4QHQ A;  4GXS B;  1OVT A;  4IB2 A;  1N04 A;  4KR5 A;  3OMB A;  5H8N B;  1RYX A;  1XVX A;  1AL3 A;  3VVE A;  4NF6 A;  4JWO A;  4N91 A;  3FVG A;  2PVU A;  5AA3 A;  1URD A;  1NNF A;  4DI4 B;  1I6Q A;  5IGA A;  1F9B A;  4FAJ A;  3HCQ A;  2CEX A;  1I6B A;  4ND9 A;  4X1D A;  2D21 A;  4P0I A;  3FXB A;  1QUK A;  4H67 A;  5I2N A;  2ZYN A;  1A40 A;  3Q27 A;  3TCG A;  4GD5 A;  1O63 A;  3KJT A;  4BLA A;  1GTK A;  3IK6 B;  1LCF A;  4OVJ A;  2RCB A;  3H6T A;  5F1Q A;  3LSX A;  3RY3 A;  1ZLQ A;  3T66 A;  4KPT A;  4OZ9 A;  1XC1 A;  5B70 A;  4PFB A;  3GBA A;  3RT8 A;  2UYF A;  3VLW A;  2XXU A;  4ECF A;  2E0S A;  5LOM A;  5FTI A;  1FTM A;  2I3W A;  2DVC A;  4TQU Q;  1PB9 A;  4ELO A;  2KLF A;  4MX6 A;  1L5T A;  2Z8D A;  3F11 A;  4U4S A;  2OJT A;  1SQY A;  1MH3 A;  4XKR A;  2GFE A;  4LZ5 A;  1PBQ A;  4P3L A;  4ZDM A;  4C1T A;  5J1D A;  4GWO A;  3TYH A;  3C9H A;  1B2H A;  4RJZ A;  4EXL A;  3TPA A;  4MNP A;  4ESW A;  1SYH A;  4NF6 B;  2F7A A;  4LQ5 A;  1M5F A;  1B52 A;  2ESN A;  4NHB A;  4BDM A;  3IO4 A;  1P1W A;  2H99 A;  4OER A;  2QMX A;  1POY 1;  1FW0 A;  5EHS A;  4JBZ A;  2ZYK A;  2NVU B;  4F2Q A;  1Z7N E;  2ABH A;  1JW5 A;  4RXL A;  2UXA A;  3FIR A;  5A5X B;  4RK2 A;  1PEB A;  3OXN A;  2X7Q A;  3G3H A;  3SES A;  2ZZV A;  1MPD A;  1JVY A;  2HZL A;  2HCA A;  1SYI A;  4RY1 A;  2P0S A;  4WED A;  2XXT A;  2H4I A;  4WXJ A;  4LQ2 A;  3M3K A;  2HEU A;  4PBQ A;  1QUL A;  4KD5 A;  1PBP A;  3UIF A;  1ZIU A;  3M8U A;  3N6U A;  3FXQ A;  1KWH A;  2UVG A;  3FZV A;  4G68 C;  2ANJ A;  4RA1 A;  1VFE A;  1DPP A;  4R6Y A;  3ZSF A;  2HAU A;  2V4C A;  3MW0 A;  4IY5 A;  5I57 A;  1P1N A;  4DXB A;  4XKP A;  1UTH B;  2I48 A;  3LSL A;  5KDT A;  1B32 A;  1DOT A;  4H6D A;  4C1U A;  1N76 A;  2M8C A;  5HM4 B;  1QW0 A;  3MZ1 A;  2O6A A;  2HAV A;  2I0B A;  1CB6 A;  5H8N A;  1DPE A;  3Q29 A;  3OSQ A;  4F2O A;  1B7H A;  3IOU A;  3FJM A;  5AA1 A;  1UQW A;  3IB0 A;  3H4Z A;  2Y84 A;  3MVZ A;  3O28 A;  3R7X A;  4ZE9 A;  3GYY A;  3JYR A;  2QS3 A;  4QFN A;  1IZ1 A;  5L9M A;  3MP8 A;  3PU5 A;  4PE3 A;  4O3B A;  3UGW A;  4F19 A;  3G3K A;  1VE4 A;  3G7W A;  3WAE A;  2O51 A;  1QUJ A;  4ISU A;  1PB8 A;  4OEU A;  1ZJL A;  3VVD A;  1LLS A; 
#chains in the Genus database with same CATH topology
 3RNN A;  2B3B A;  4OYV A;  1LFI A;  2L5V A;  1UTB A;  2I0C A;  3SEY A;  2RCA A;  1IEJ A;  5KCJ A;  3T9V A;  1FQF A;  3U92 A;  4PFW A;  4F31 B;  3IO6 A;  4MBP A;  1TFA A;  5TP9 B;  3WAF A;  3I5O A;  3JZJ A;  1DTG A;  2VGQ A;  5LTC A;  2PX1 A;  1JQF A;  2QMW A;  4P56 A;  1B7Z A;  2Q88 A;  4DZ1 A;  1YPN A;  1LBB A;  2ZNS A;  3R6U A;  1FPJ A;  1D9V A;  4NTL A;  1BIY A;  4PF6 A;  4MAG A;  1LCT A;  2VPO A;  2V93 A;  5H8F B;  2WX9 A;  4KYS A;  5DT6 A;  4QSC A;  3BIH A;  3EN3 A;  1N0T A;  2D5W A;  5EQ9 A;  2ZZW A;  1SW4 A;  4N15 A;  5ISU A;  5FTH A;  3CFZ A;  4FOR A;  2XXV A;  1OLC A;  2MKZ A;  3E4R A;  1NKX A;  5CRY A;  1B5J A;  3T96 B;  2REJ A;  1B4Z A;  4OVR A;  4NF5 A;  4OWD A;  4M4G A;  5AA2 B;  1FRP A;  4KI0 E;  1TWY A;  2DSF A;  2UYE A;  4OFJ A;  4TOZ A;  3PPO A;  4G77 A;  4PFR A;  1WVJ A;  2FHY A;  2DWJ A;  1SBP A;  3RPW A;  2ALU A;  1ZKB A;  1NV0 A;  1SDX A;  3T93 B;  3K6W A;  3MST A;  5I3S A;  1NL5 A;  4I62 A;  5CM6 A;  1B46 A;  4EDP A;  3TTL A;  3FVK A;  2WYP A;  3O97 A;  4NMY A;  2DVZ A;  2DOJ A;  2OWZ A;  4PGP A;  4F1Y A;  3TQL A;  1AH5 A;  4XF5 A;  4HE1 A;  1B1H A;  1LBY A;  1FQB A;  5I2N B;  2DE3 A;  5CMK A;  1A8E A;  2Y7W A;  1PB7 A;  3PPR A;  2I3V A;  1B5H A;  4F3S A;  5I2K A;  5DW8 A;  1N3W A;  5L8D A;  4ELQ A;  4ELP A;  1P1U A;  1LFH A;  3TQW A;  1JP4 A;  2D3I A;  5ICQ A;  4F39 A;  4E0X A;  3RPL B;  1NFT A;  4F1U A;  4NF4 A;  2RC8 A;  1ANF A;  3SET A;  5F7V A;  4JWX A;  3KSX A;  1EZ9 A;  2ONK E;  4GF8 A;  4PAK A;  4DLD A;  1NUZ A;  2Y7P A;  4KFQ A;  1DSN A;  1JNF A;  2V3T A;  3ILU B;  5AA2 A;  2QRY A;  1IXH A;  2AIX A;  2XX8 A;  1NUY A;  1EZP A;  1POT A;  3A3C A;  4IO5 A;  2O84 X;  3G3J A;  4U23 A;  4BDO A;  1MS7 A;  2XX9 A;  3A09 A;  4NWC A;  1NV6 A;  4DCY A;  1A7L A;  1B3F A;  2OCU A;  4N6D A;  4LP2 B;  2QL3 A;  2YJP A;  1USY E;  3GBB A;  4EUO A;  4O8M A;  1FTA A;  4ESX A;  1M5B A;  4PP0 A;  1ZTY A;  3T22 A;  2HPG A;  2V3U A;  3CFL A;  1O7T A;  1DMB A;  3CSG A;  4TLL B;  4FED A;  4IR8 A;  3CG1 A;  1DTZ A;  2H98 A;  4BDQ A;  5DTB A;  3ODB A;  4ZED A;  4MEV A;  3N94 A;  4GL0 A;  1T0K A;  3S9E A;  1MXY A;  1FPF A;  4DI3 D;  1R9Q A;  4GOT A;  3PGF A;  3Q28 A;  2OZZ A;  3MPL A;  4OMB A;  3L6G A;  4JDF A;  4PF8 A;  4NF4 B;  2H25 A;  2NXO A;  2DWI A;  4XTC Q;  1J1N A;  5IZ3 B;  2F6P A;  3MVW A;  1FTJ A;  2Q8M A;  1H44 A;  2ZYM A;  1FPL A;  4YAH X;  2CZK A;  4X48 A;  2DQV A;  2AYS A;  1NNK A;  5EQ8 A;  1MDP 1;  2OLB A;  4ZEI A;  2XXQ A;  4G68 B;  2PFY A;  3DLN A;  3RLF E;  4PET A;  5JK4 A;  5K2Y A;  5H8Q B;  1IMC A;  4F3B A;  4LUB A;  3E13 X;  4BDR A;  3T9H B;  3PMX A;  1MXV A;  4Q0C A;  1LBW A;  4HE0 A;  3IX1 A;  1AWB A;  2CZL A;  3H6V A;  2O7I A;  3KJ7 A;  3NOH A;  4KYD A;  3DP6 A;  3TCH A;  3FJ7 A;  5I7I A;  5AE4 A;  3OO7 A;  2O1L A;  4NF5 B;  4THI A;  1MQH A;  3TUS A;  3B6W A;  3IOW A;  3DEL B;  4IY6 A;  5B7D A;  4O3C A;  3FAS A;  5ET6 A;  1BK4 A;  2DP8 A;  2G93 A;  2OK2 A;  3N5L A;  4QBA A;  4U21 A;  2A5T B;  2UVH A;  1S50 A;  4NF8 A;  1NUW A;  4AS4 A;  3SEW A;  3V89 B;  3MP1 A;  1OIB A;  4MHF A;  4H5G A;  4OVS A;  3IJO B;  1EYI A;  2A5S A;  4N17 A;  4P11 A;  2X26 A;  1MY1 A;  4IGT A;  3M3L A;  3TMG A;  2O69 A;  4PFY A;  3LUZ A;  1BP5 A;  5DVF A;  3FD3 A;  5JEI A;  4LA9 A;  2KR0 A;  1NV1 A;  3FV2 A;  5HPQ A;  3T9U A;  3O6H A;  1FBF A;  2Q2C A;  3PUV E;  3W9V A;  4DCX A;  1MQI A;  4POX A;  1HSJ A;  2PYY A;  5ET5 A;  3CFX A;  1Z7M E;  4PFU A;  3OOA A;  3VLV A;  3LSW A;  2P3N A;  2REG A;  3KN7 A;  3RN8 A;  2WKY A;  5AA2 D;  2XD2 A;  4PQJ A;  2HXW A;  1VDW A;  5LDZ A;  2DYX A;  1DBZ A;  5AA4 A;  4G8H A;  4AB5 A;  5JTY B;  5CMC A;  3C33 A;  3FAT A;  2RF1 A;  1LFG A;  4ZEK A;  3FUZ A;  1WDN A;  4KXP A;  4LVQ A;  4U4X A;  3S9L C;  4NF8 B;  4PDH A;  1MQJ A;  4NGU A;  1N7W A;  2W7Y A;  2XWV A;  3EQ1 A;  3IL1 B;  1ATG A;  3MP6 A;  4EXK A;  3LR1 A;  4KQP A;  2PT1 A;  3IOT A;  1RDY A;  2RC9 A;  4NG7 A;  3TTK A;  2QS2 A;  4EF2 A;  5ELV A;  4GBW A;  4PAF A;  1MPC A;  2CEY A;  3B7D A;  1YYZ A;  1B7U A;  4EQB A;  4MMP A;  1FBP A;  4JVI A;  1YCJ A;  3KOS A;  1FQE A;  2Y7K A;  3K6U A;  5ICT A;  2AL4 A;  3UP9 A;  4FBP A;  3S9M C;  4NAP A;  4RPN A;  1MDQ A;  2E1S A;  3B6T A;  3HFU A;  3U8Q A;  4H8J A;  2F3D A;  5IZ3 A;  3PD9 A;  3VE1 B;  5BWJ A;  5DYH A;  3E3K A;  3MPK A;  2P3V A;  2FIE A;  5IKB A;  2YPN A;  4RK9 A;  1RYO A;  4OTE A;  5JTY A;  4RNS A;  4WEP A;  1EZO A;  4H1X A;  2GRV A;  4OQO A;  1Y3N A;  2F3B A;  4GL8 A;  1EH3 A;  1B0L A;  5I58 A;  2Z22 A;  1Y1M A;  5ET7 A;  1SW5 A;  4R73 A;  3DP4 A;  3H6W A;  3IFA A;  4FEC A;  2VT5 A;  4PC9 A;  4JSO A;  2WYK A;  4AQ4 A;  3SZP A;  3CIJ A;  3N6T A;  4YB5 A;  1B3H A;  4NQ8 A;  5IAI A;  4ZEB A;  2I49 A;  3K6X A;  1S7Y A;  1IMD A;  3K4U A;  4IGR A;  4P1L A;  1A55 A;  1XT8 A;  1D9Y A;  3FBP A;  2AL5 A;  1Q1K A;  2VHA A;  3KBZ A;  4H65 A;  3H6U A;  1FQC A;  4JB7 A;  3MVY A;  1FSA A;  1IIT A;  3H7M A;  1IME A;  3IOR A;  3MYU A;  2Y5K A;  3MQ9 A;  1P1O A;  4MCO A;  3U65 A;  2RKM A;  4KCC A;  1S9T A;  1ZU0 A;  4QSE A;  3K02 A;  3HV1 A;  3QYT A;  1Y20 A;  1AMF A;  2GH9 A;  4YKI A;  5I59 A;  3W15 C;  2PCR A;  4HW8 A;  2I4B A;  1B6H A;  1N84 A;  1NH7 A;  5A5X A;  1WOD A;  2OX3 A;  2Q2A A;  4N8G A;  3UA8 A;  1FBD A;  4XKN A;  1MM7 A;  4PDD A;  1LBC A;  1IMF A;  3K1M A;  4O7M A;  1PC3 A;  5CI5 A;  2ZNU A;  4R9F A;  3EHU A;  2VPN A;  1QGX A;  3GZG A;  4KYE A;  4I9D A;  4DXU A;  5DVJ A;  2XXR A;  1USY H;  4QF9 A;  1MXZ A;  2Q8J A;  4PAI A;  2Y7R A;  3K1N A;  3B50 A;  2Q9T A;  5I5P A;  4NF0 A;  4DIG A;  4N4U A;  4LON B;  4OHN A;  1LAX A;  3D4C A;  3LV0 A;  2IA4 A;  2R9J A;  4U2R A;  3D1R A;  1SI0 A;  3TTR A;  2WEF A;  3BIG A;  3HHG A;  5KZT A;  4GXA A;  3IR1 A;  5KDT B;  3K0V A;  4GLI A;  5EYF A;  3H03 A;  1FQD A;  3USD A;  2DS9 A;  3O6G A;  3GXA A;  1SVX B;  3A3U A;  1D3K A;  1TFD A;  2F34 A;  3O9P A;  3C4M A;  5H8Q A;  2DWA A;  4PBH A;  3JV9 A;  4PGN A;  1IIW A;  1MXW A;  1R9L A;  4QXD A;  4NX1 A;  4IO4 A;  4JWY A;  4LZ7 A;  1M5E A;  3O29 A;  4R72 A;  4Q8R A;  3RGY A;  5BUU A;  2O7U A;  3TOD A;  2DE4 A;  3AXF A;  4XKQ A;  4YZZ A;  2Q74 A;  3PPP A;  4K3F A;  2LAO A;  1XHY A;  5I59 B;  2XXI A;  3OO8 A;  3IB2 A;  4R9G A;  4XFE A;  2THI A;  2NWJ A;  2DE2 A;  2ZZX A;  1TT1 A;  3SEU A;  2F5X A;  4I3Y A;  3MZB A;  1MG1 A;  1FTO A;  2QS4 A;  2UVJ A;  3MAM A;  1JW4 A;  1UTB B;  3MBP A;  4G8M A;  4MF3 A;  4X1B A;  4OES A;  3QMF A;  5FHO A;  4L17 A;  5CMB A;  4GIZ A;  3RQT A;  3H3G A;  4MLQ A;  4BDL A;  1K9Z A;  1QVS A;  2B4M A;  1OVB A;  3HHF A;  5ITO A;  3CG3 A;  1LST A;  3CR9 A;  1D4N A;  1BKA A;  3QIM A;  4R6H A;  4RPO A;  1P1Q A;  4U22 A;  4H45 A;  5I58 B;  2O68 A;  2ZXT A;  4JSD A;  4F29 A;  1P99 A;  4DDD A;  1JVX A;  3KZG A;  3V8X B;  3QSL A;  1Q35 A;  3TZA A;  4PE5 B;  1NV5 A;  4XIG Q;  5TP9 A;  1RDX A;  1IMA A;  3PPN A;  1GVC A;  4EF1 A;  4GVO A;  1D9Q A;  3IFC A;  3CHG A;  2F35 A;  3FGS A;  3HPI A;  3IB1 A;  3E78 A;  1B51 A;  1JET A;  2F36 A;  4OVP A;  2QJE A;  4QRZ A;  4G8N A;  1MY0 A;  1UIV A;  5EHM A;  2JJK A;  1URG A;  5FBP A;  3PMV A;  4I8C A;  2PT2 A;  4ZS9 A;  1M5D A;  1B3L A;  2XA5 A;  2NUV A;  2CZI A;  3EKI A;  2BJJ X;  4P8B A;  3FXR A;  1FPE A;  3OO9 A;  4YIC A;  2VOZ A;  4DE8 A;  2QVV A;  1Y3P A;  4MH5 A;  1GV8 A;  4YB6 A;  4ZEF A;  4UAB A;  4MJO A;  3VDF A;  3FJG A;  1A54 A;  3OEL A;  1FBH A;  1JW1 A;  2XXK A;  4ELR A;  3K6V A;  2H9B A;  4O7I A;  2PBW A;  3QUJ A;  2F78 A;  3E79 A;  2FA7 A;  2ZYO A;  4OFL A;  1FPB A;  4YKP A;  3W9W A;  4OFO A;  1MXX A;  1QUI A;  4FIM A;  2ZNT A;  3S9N C;  4P0G A;  3LBS A;  3MJN A;  4ZZE A;  2VD3 A;  3TCF A;  2B65 A;  5AA4 B;  4NED A;  4Q5T A;  2F7C A;  3KEI A;  3KN3 A;  4G61 A;  5HBC A;  4N8Y A;  1SW1 A;  3BFU A;  4YU0 A;  3V5A A;  4I3E A;  1UIU A;  2FYI A;  4Q30 B;  4U1O A;  4PFI A;  2OWT A;  2H5Y A;  2QFL A;  3SDF A;  2VD2 A;  2X7P A;  4R2B A;  1LAF E;  4LAT A;  1YXI A;  4H5F A;  4IO6 A;  4XXU A;  2HQ0 A;  1JEV A;  5I2K B;  4H0W A;  1ELJ A;  3C34 A;  3HST A;  1R1N A;  2XWI A;  3TAJ A;  1B3G A;  4H8I A;  3UK4 A;  2CMO A;  3PUW E;  5DVI A;  4R2F A;  3V83 A;  2RC7 A;  3KN8 A;  3I6V A;  3HN0 A;  3K2D A;  1PDA A;  1IXC A;  3EHT A;  4N07 A;  1FTK A;  3PUZ E;  1LGB C;  4RYA A;  4F18 A;  4MFI A;  4AB6 A;  3IAZ A;  1QJM A;  4N81 A;  4GX6 A;  3K1P A;  3RTW B;  3C31 A;  4KHZ E;  5K2X A;  3ZKK A;  1VR5 A;  1NV4 A;  3S2V A;  4OET A;  3U93 A;  2G29 A;  1HSL A;  3D4G A;  1ZBM A;  4O94 A;  2GHB A;  5ET8 A;  4NWD A;  3RTF B;  1MY4 A;  3KGC A;  1Y4T A;  3S4U A;  3OEN A;  4HS7 A;  4LZ8 A;  1Y1Z A;  1BTJ A;  3LUY A;  3BKI B;  1YZ0 A;  3UOR A;  1URS A;  4MLV A;  2B4L A;  3QK6 A;  1MQD A;  3VFJ A;  4XEQ A;  5EYG A;  3FVN A;  1G0I A;  1LB8 A;  2QPQ A;  3L6H A;  2P2A A;  2F6G A;  1MM6 A;  4GBV A;  3EF7 A;  3TTM A;  3KFM A;  1MRP A;  1XOC A;  4ZZA A;  1A8F A;  2R8T A;  4G2Z A;  3T1B A;  1LBX A;  1MQG A;  3MZ9 A;  3MUQ A;  3C36 A;  1H45 A;  3IOV A;  3RUM A;  3EPE A;  3KBR A;  1I69 A;  1I6A A;  3VLU A;  4M1V A;  5CC2 A;  4NE4 A;  5CBR A;  3OEK A;  2Z23 A;  3Q25 A;  4G68 A;  2ZMB A;  4ZE8 A;  1A99 A;  1HSE A;  1H76 A;  3GLB A;  1QKB A;  4Z7E A;  4MIJ A;  5EQA A;  4FAT A;  4PCD A;  3N26 A;  4YKK A;  2CZH A;  5IZZ A;  3RT6 B;  3UN6 A;  1VFD A;  4G4P A;  4C0R A;  4IO2 A;  1H3D A;  5FHM A;  3LSF B;  1FTL A;  1YAE A;  4IO7 A;  4UA8 A;  2R6G E;  4MNC A;  1K9Y A;  4ONY A;  3VV5 A;  3CI8 A;  4JVC A;  3K01 A;  2OWS A;  1SI1 A;  4P1E A;  4U1Z A;  2QVU A;  4QSD A;  3TFL A;  2FIX A;  3SER A;  1R6Z A;  2BJI A;  2DXR A;  2PFZ A;  3TDJ A;  3QXM A;  3I3V A;  1MH4 A;  3TTN A;  4YMB A;  3U94 A;  4POW A;  5H8H A;  2DWH A;  3U1O A;  1B0H A;  1XI6 A;  2I4C A;  4H46 A;  3B6Q A;  1B1X A;  1II5 A;  3MVX A;  5M2V A;  2DXY A;  1OLA A;  3LC8 A;  4DXC A;  4F1V A;  2XWO A;  3VVF A;  5IM2 A;  1FPG A;  4PFT A;  4OVT A;  4OVQ A;  2QVR A;  3E9X A;  1IQ7 A;  2I58 A;  4R6K A;  1LAH E;  4I40 A;  4UAC A;  2GHA A;  4EQ7 A;  3KSJ A;  2XXW A;  4GX4 A;  1B58 A;  4O3A A;  5KCJ B;  4OEV A;  4X9T A;  2ONR A;  3EHS A;  3MC2 A;  1EYJ A;  4BDN A;  4LN5 A;  3TKD A;  3SEV A;  1VSO A;  3FXU A;  2RIN A;  2QS1 A;  1US5 A;  2XWK A;  3ILT B;  4YKJ A;  3C32 A;  2NOO A;  3C35 A;  4WKM A;  1IXG A;  5DEX B;  1Y3Q A;  4YB7 A;  1EYK A;  1OQG A;  1B40 A;  1MPB A;  2FNC A;  1B9J A;  3G3I A;  5I84 A;  2IEE A;  3H06 B;  3M3F A;  4QFL A;  4GWY A;  1GR2 A;  3ZKL A;  5ESY A;  3ISP A;  3TEL A;  1SD3 A;  2GQ1 A;  1IUD A;  4E0W A;  4R74 A;  2XHD A;  3B8B A;  1ZMG A;  1EU8 A;  1MY2 A;  1B4H A;  1FBG A;  3O6I A;  3R26 A;  4OA4 A;  1AOV A;  4Z0I A;  4JXI A;  1M5C A;  3BBR A;  1MXU A;  3MWB A;  2XX7 A;  5TU0 A;  2V25 A;  2PMS A;  2V3Q A;  4F3G A;  5T3J A;  4OEN A;  1B05 A;  4YMA A;  1NMU A;  2UVI A;  4TLM B;  3HO7 A;  5CBS A;  1BLF A;  5FHN A;  3O2A A;  4QFP A;  1B5I A;  3O66 A;  3RYD A;  5H8S A;  1IMB A;  4FJP A;  5I57 B;  3PPQ A;  5TPA A;  2F7B A;  3CRB A;  2R71 A;  4P9K A;  3KC0 A;  1DK4 A;  2F8D A;  3PUX E;  1UTH A;  5IZ1 A;  1TXF A;  1LB9 A;  5DEX A;  2YLN A;  1QKA A;  5EYH A;  1NH8 A;  4N13 A;  4FEB A;  2Z8E A;  2P1S A;  1B3E A;  1IXI A;  4HCW A;  1Y9U A;  1AIV A;  1H43 A;  1NNP A;  2FVZ A;  4NN3 A;  1OMP A;  2QSX A;  2O1M A;  3RPL A;  1XVY A;  5A5L A;  2Z8F A;  3K00 A;  2VP1 A;  4KCD A;  4F3P A;  2Q89 A;  2I6E A;  1XS5 A;  1LAG E;  3KOT A;  5CMM A;  4X8R A;  3U72 A;  1KA0 A;  1FCK A;  3FV1 A;  3PMW A;  1KZ8 A;  3G3G A;  1FPK A;  3FVO A;  1Y4C A;  1CE2 A;  1N7X A;  3VXB A;  4GWW A;  1SW2 A;  3PD8 A;  3P7I A;  5ITP A;  4HCY A;  2A5T A;  4GWZ A;  5I56 B;  1G0H A;  3OEM A;  1NV7 A;  2XXH A;  2XXX A;  1NNT A;  4OAN A;  2B3F A;  2HHM A;  2XXY A;  3G3F A;  3PUY E;  2XD3 A;  4QFO A;  3T0J A;  3CSB A;  4MNI A;  1FBC A;  1FJ6 A;  4I1D A;  5H8F A;  1MY3 A;  4P47 A;  2Y7I A;  1JEU A;  3DM0 A;  5H8H B;  2V84 A;  4GRK A;  4N6K A;  2ONS A;  3QUF A;  3OO6 A;  3PTY A;  2F97 A;  4F22 A;  3T9X B;  3VXC A;  4IO3 A;  4QFK A;  5L9O A;  3ECR A;  2HFB A;  5TPA B;  1GGG A;  3Q26 A;  4GQO A;  2HZK A;  2OBG A;  3ZS6 A;  1RKM A;  4X04 A;  4GFR A;  4N6P A;  3ONM A;  4OXV A;  1KA1 A;  1FQA A;  3SEX A;  3OD7 A;  4FE8 A;  3BFT A;  4HTG A;  3IJX B;  3KG2 A;  3OSR A;  1N3X A;  3THI A;  1OQH A;  1YTV A;  4ZEC A;  5I56 A;  3SKP A;  3CVG A;  4EQ9 A;  5L9S A;  2XXP A;  3PV0 E;  1NUX A;  1US4 A;  1O64 A;  2WBB A;  4R75 A;  3DP8 A;  3TEP A;  3QAX A;  4QHQ A;  4GWU A;  4GXS B;  1OVT A;  4IB2 A;  1N04 A;  4KR5 A;  3OMB A;  5H8N B;  1RYX A;  5J16 A;  1XVX A;  1AL3 A;  3VVE A;  5F24 A;  4NF6 A;  4JWO A;  4N91 A;  3FVG A;  2PVU A;  5AA3 A;  1URD A;  1NNF A;  4DI4 B;  1I6Q A;  5IGA A;  1F9B A;  1CNQ A;  4FAJ A;  3HCQ A;  2CEX A;  2DDK A;  1I6B A;  4ND9 A;  4X1D A;  2D21 A;  4P0I A;  3FXB A;  1QUK A;  4H67 A;  5I2N A;  2ZYN A;  1A40 A;  3Q27 A;  4GD5 A;  3TCG A;  1O63 A;  3KJT A;  4BLA A;  1GTK A;  3IK6 B;  1LCF A;  4GWS A;  4OVJ A;  2RCB A;  3H6T A;  5F1Q A;  3LSX A;  3RY3 A;  1ZLQ A;  3T66 A;  4KPT A;  4OZ9 A;  1XC1 A;  5B70 A;  4PFB A;  3GBA A;  3RT8 A;  2UYF A;  3VLW A;  1LBZ A;  2XXU A;  4GX3 A;  4ECF A;  2E0S A;  5LOM A;  1INP A;  5FTI A;  4HE2 A;  1FTM A;  2I3W A;  2DVC A;  4TQU Q;  1PB9 A;  4ELO A;  2KLF A;  4MX6 A;  1L5T A;  2Z8D A;  3F11 A;  2KQZ A;  1Q9D A;  4U4S A;  2OJT A;  1SQY A;  1MH3 A;  4XKR A;  2GFE A;  4LZ5 A;  1PBQ A;  4P3L A;  4ZDM A;  4C1T A;  5J1D A;  4GWO A;  1LEV A;  3TYH A;  3C9H A;  1B2H A;  4RJZ A;  1NI9 A;  4MNP A;  3TPA A;  4EXL A;  4ESW A;  1SYH A;  4NF6 B;  2F7A A;  4LQ5 A;  1M5F A;  1B52 A;  2ESN A;  4NHB A;  4BDM A;  3IO4 A;  1P1W A;  2H99 A;  4OER A;  2QMX A;  1POY 1;  1DCU A;  3A29 A;  1FJ9 A;  1FW0 A;  5EHS A;  4JBZ A;  2ZYK A;  1LBV A;  2NVU B;  1NV3 A;  4F2Q A;  1Z7N E;  2ABH A;  1JW5 A;  1RDZ A;  4RXL A;  2UXA A;  3FIR A;  5A5X B;  4RK2 A;  1FBE A;  1PEB A;  3OXN A;  2X7Q A;  3G3H A;  3SES A;  2ZZV A;  1FPI A;  1FPD A;  1MPD A;  4GWX A;  1JVY A;  2HZL A;  2HCA A;  1SYI A;  3KC1 A;  4RY1 A;  2P0S A;  4WED A;  2XXT A;  2H4I A;  4WXJ A;  5EQ7 A;  4LQ2 A;  3M3K A;  2HEU A;  4PBQ A;  1QUL A;  4KD5 A;  1PBP A;  3UIF A;  1ZIU A;  3M8U A;  3N6U A;  3FXQ A;  1KWH A;  2UVG A;  4AS5 A;  3FZV A;  4G68 C;  4HXV A;  2ANJ A;  2WBD A;  4RA1 A;  1VFE A;  1DPP A;  4R6Y A;  3ROJ A;  3ZSF A;  2HAU A;  2V4C A;  3MW0 A;  4IY5 A;  5I57 A;  1P1N A;  4DXB A;  4XKP A;  1UTH B;  2I48 A;  3LSL A;  5KDT A;  1B32 A;  1DOT A;  4H6D A;  4JVD A;  4C1U A;  1N76 A;  2M8C A;  5HM4 B;  1QW0 A;  3MZ1 A;  2O6A A;  2HAV A;  2I0B A;  2Y5L A;  1CB6 A;  5H8N A;  1DPE A;  3Q29 A;  3OSQ A;  1SPI A;  4F2O A;  1B7H A;  3IOU A;  3FJM A;  5AA1 A;  1UQW A;  3IB0 A;  3H4Z A;  2Y84 A;  3MVZ A;  3O28 A;  3R7X A;  4ZE9 A;  3GYY A;  3JYR A;  2QS3 A;  4QFN A;  1IZ1 A;  5L9M A;  3MP8 A;  3PU5 A;  4PE3 A;  4O3B A;  3UGW A;  4F19 A;  3G3K A;  1VE4 A;  3G7W A;  1NV2 A;  3WAE A;  2O51 A;  1QUJ A;  4ISU A;  1PB8 A;  4OEU A;  1ZJL A;  2HXR A;  3VVD A;  2FBP A;  1LLS A;  4PTK A; 
#chains in the Genus database with same CATH homology
 3RNN A;  2B3B A;  4OYV A;  1LFI A;  2L5V A;  1UTB A;  2I0C A;  3SEY A;  2RCA A;  1IEJ A;  5KCJ A;  3T9V A;  1FQF A;  3U92 A;  4PFW A;  4F31 B;  3IO6 A;  4MBP A;  1TFA A;  5TP9 B;  3WAF A;  3I5O A;  3JZJ A;  1DTG A;  2VGQ A;  5LTC A;  2PX1 A;  1JQF A;  2QMW A;  4P56 A;  1B7Z A;  2Q88 A;  4DZ1 A;  1YPN A;  1LBB A;  2ZNS A;  3R6U A;  1FPJ A;  1D9V A;  4NTL A;  1BIY A;  4PF6 A;  4MAG A;  1LCT A;  2VPO A;  2V93 A;  5H8F B;  2WX9 A;  4KYS A;  5DT6 A;  4QSC A;  3BIH A;  3EN3 A;  1N0T A;  2D5W A;  5EQ9 A;  2ZZW A;  1SW4 A;  4N15 A;  5ISU A;  5FTH A;  3CFZ A;  4FOR A;  2XXV A;  1OLC A;  2MKZ A;  3E4R A;  1NKX A;  5CRY A;  1B5J A;  3T96 B;  2REJ A;  1B4Z A;  4OVR A;  4NF5 A;  4OWD A;  4M4G A;  5AA2 B;  1FRP A;  4KI0 E;  1TWY A;  2DSF A;  2UYE A;  4OFJ A;  4TOZ A;  3PPO A;  4G77 A;  4PFR A;  1WVJ A;  2FHY A;  2DWJ A;  1SBP A;  3RPW A;  2ALU A;  1ZKB A;  1NV0 A;  1SDX A;  3T93 B;  3K6W A;  3MST A;  5I3S A;  1NL5 A;  4I62 A;  5CM6 A;  1B46 A;  4EDP A;  3TTL A;  3FVK A;  3O97 A;  2WYP A;  4NMY A;  2DVZ A;  2DOJ A;  2OWZ A;  4PGP A;  4F1Y A;  3TQL A;  1AH5 A;  4XF5 A;  4HE1 A;  1B1H A;  1LBY A;  1FQB A;  5I2N B;  2DE3 A;  5CMK A;  1A8E A;  2Y7W A;  1PB7 A;  3PPR A;  2I3V A;  1B5H A;  4F3S A;  5I2K A;  5DW8 A;  1N3W A;  5L8D A;  4ELQ A;  4ELP A;  1P1U A;  1LFH A;  3TQW A;  1JP4 A;  2D3I A;  5ICQ A;  4F39 A;  4E0X A;  3RPL B;  1NFT A;  4F1U A;  4NF4 A;  2RC8 A;  1ANF A;  3SET A;  5F7V A;  4JWX A;  3KSX A;  1EZ9 A;  2ONK E;  4GF8 A;  4PAK A;  4DLD A;  1NUZ A;  2Y7P A;  4KFQ A;  1DSN A;  1JNF A;  2V3T A;  3ILU B;  5AA2 A;  2QRY A;  1IXH A;  2AIX A;  2XX8 A;  1NUY A;  1EZP A;  1POT A;  3A3C A;  4IO5 A;  2O84 X;  3G3J A;  4U23 A;  4BDO A;  1MS7 A;  2XX9 A;  3A09 A;  4NWC A;  1NV6 A;  4DCY A;  1A7L A;  1B3F A;  2OCU A;  4N6D A;  4LP2 B;  2QL3 A;  2YJP A;  1USY E;  3GBB A;  4EUO A;  4O8M A;  4ESX A;  1FTA A;  1M5B A;  4PP0 A;  1ZTY A;  3T22 A;  2HPG A;  2V3U A;  3CFL A;  1O7T A;  1DMB A;  3CSG A;  4TLL B;  4FED A;  4IR8 A;  3CG1 A;  1DTZ A;  2H98 A;  4BDQ A;  5DTB A;  3ODB A;  4ZED A;  4MEV A;  3N94 A;  4GL0 A;  1T0K A;  3S9E A;  1MXY A;  1FPF A;  4DI3 D;  1R9Q A;  4GOT A;  3PGF A;  3Q28 A;  2OZZ A;  3MPL A;  4OMB A;  3L6G A;  4JDF A;  4PF8 A;  4NF4 B;  2H25 A;  2NXO A;  2DWI A;  4XTC Q;  1J1N A;  5IZ3 B;  2F6P A;  3MVW A;  1FTJ A;  2Q8M A;  1H44 A;  2ZYM A;  1FPL A;  4YAH X;  2CZK A;  4X48 A;  2DQV A;  2AYS A;  1NNK A;  5EQ8 A;  1MDP 1;  2OLB A;  4ZEI A;  2XXQ A;  4G68 B;  2PFY A;  3DLN A;  3RLF E;  4PET A;  5JK4 A;  5K2Y A;  5H8Q B;  1IMC A;  4F3B A;  4LUB A;  3E13 X;  4BDR A;  3T9H B;  3PMX A;  1MXV A;  4Q0C A;  1LBW A;  4HE0 A;  3IX1 A;  1AWB A;  2CZL A;  3H6V A;  2O7I A;  3KJ7 A;  3NOH A;  4KYD A;  3DP6 A;  3TCH A;  3FJ7 A;  5I7I A;  5AE4 A;  3OO7 A;  2O1L A;  4NF5 B;  4THI A;  1MQH A;  3TUS A;  3B6W A;  3IOW A;  3DEL B;  4IY6 A;  5B7D A;  4O3C A;  3FAS A;  5ET6 A;  1BK4 A;  2DP8 A;  2G93 A;  2OK2 A;  3N5L A;  4QBA A;  4U21 A;  2A5T B;  2UVH A;  1S50 A;  4NF8 A;  1NUW A;  4AS4 A;  3SEW A;  3V89 B;  3MP1 A;  1OIB A;  4MHF A;  4H5G A;  4OVS A;  3IJO B;  1EYI A;  2A5S A;  4N17 A;  4P11 A;  2X26 A;  1MY1 A;  4IGT A;  3M3L A;  3TMG A;  2O69 A;  4PFY A;  3LUZ A;  1BP5 A;  5DVF A;  3FD3 A;  5JEI A;  4LA9 A;  2KR0 A;  1NV1 A;  3FV2 A;  5HPQ A;  3T9U A;  3O6H A;  1FBF A;  2Q2C A;  3PUV E;  3W9V A;  4DCX A;  1MQI A;  4POX A;  1HSJ A;  2PYY A;  3CFX A;  1Z7M E;  4PFU A;  5ET5 A;  3OOA A;  3VLV A;  3LSW A;  2P3N A;  2REG A;  3KN7 A;  3RN8 A;  2WKY A;  5AA2 D;  2XD2 A;  4PQJ A;  2HXW A;  1VDW A;  5LDZ A;  2DYX A;  1DBZ A;  5AA4 A;  4G8H A;  4AB5 A;  5JTY B;  5CMC A;  3C33 A;  3FAT A;  2RF1 A;  1LFG A;  4ZEK A;  3FUZ A;  1WDN A;  4LVQ A;  4U4X A;  3S9L C;  4KXP A;  4NF8 B;  4PDH A;  1MQJ A;  4NGU A;  1N7W A;  2W7Y A;  2XWV A;  3EQ1 A;  3IL1 B;  1ATG A;  3MP6 A;  4EXK A;  3LR1 A;  4KQP A;  2PT1 A;  3IOT A;  1RDY A;  2RC9 A;  4NG7 A;  3TTK A;  2QS2 A;  4EF2 A;  5ELV A;  4GBW A;  4PAF A;  1MPC A;  3B7D A;  2CEY A;  1YYZ A;  1B7U A;  4EQB A;  4MMP A;  1FBP A;  4JVI A;  1YCJ A;  3KOS A;  1FQE A;  2Y7K A;  3K6U A;  5ICT A;  2AL4 A;  3UP9 A;  4FBP A;  3S9M C;  4NAP A;  4RPN A;  1MDQ A;  2E1S A;  3B6T A;  3HFU A;  3U8Q A;  4H8J A;  2F3D A;  5IZ3 A;  3PD9 A;  3VE1 B;  5BWJ A;  5DYH A;  3E3K A;  3MPK A;  2P3V A;  2FIE A;  5IKB A;  2YPN A;  4RK9 A;  1RYO A;  4OTE A;  5JTY A;  4RNS A;  4WEP A;  1EZO A;  4H1X A;  2GRV A;  4OQO A;  1Y3N A;  2F3B A;  4GL8 A;  1EH3 A;  1B0L A;  5I58 A;  2Z22 A;  1Y1M A;  5ET7 A;  1SW5 A;  4R73 A;  3DP4 A;  3H6W A;  3IFA A;  4FEC A;  2VT5 A;  4PC9 A;  4JSO A;  2WYK A;  4AQ4 A;  3SZP A;  3CIJ A;  3N6T A;  4YB5 A;  1B3H A;  4NQ8 A;  5IAI A;  4ZEB A;  2I49 A;  3K6X A;  1S7Y A;  1IMD A;  3K4U A;  4IGR A;  4P1L A;  1A55 A;  1XT8 A;  1D9Y A;  3FBP A;  2AL5 A;  1Q1K A;  2VHA A;  3KBZ A;  4H65 A;  3H6U A;  1FQC A;  4JB7 A;  3MVY A;  1FSA A;  1IIT A;  3H7M A;  1IME A;  3IOR A;  3MYU A;  2Y5K A;  3MQ9 A;  1P1O A;  4MCO A;  3U65 A;  2RKM A;  4KCC A;  1S9T A;  1ZU0 A;  4QSE A;  3K02 A;  3HV1 A;  3QYT A;  1Y20 A;  1AMF A;  2GH9 A;  4YKI A;  5I59 A;  3W15 C;  4HW8 A;  2PCR A;  2I4B A;  1B6H A;  1N84 A;  1NH7 A;  5A5X A;  1WOD A;  2OX3 A;  2Q2A A;  4N8G A;  3UA8 A;  1FBD A;  4XKN A;  1MM7 A;  4PDD A;  1LBC A;  1IMF A;  3K1M A;  4O7M A;  1PC3 A;  5CI5 A;  2ZNU A;  4R9F A;  3EHU A;  2VPN A;  1QGX A;  3GZG A;  4KYE A;  4I9D A;  4DXU A;  5DVJ A;  2XXR A;  1USY H;  4QF9 A;  1MXZ A;  2Q8J A;  4PAI A;  2Y7R A;  3K1N A;  3B50 A;  2Q9T A;  5I5P A;  4NF0 A;  4DIG A;  4OHN A;  4LON B;  4N4U A;  1LAX A;  3D4C A;  3LV0 A;  2IA4 A;  2R9J A;  4U2R A;  3D1R A;  1SI0 A;  3TTR A;  2WEF A;  3BIG A;  3HHG A;  5KZT A;  4GXA A;  5KDT B;  3IR1 A;  3K0V A;  4GLI A;  5EYF A;  3H03 A;  1FQD A;  3USD A;  2DS9 A;  3O6G A;  3GXA A;  1SVX B;  3A3U A;  1D3K A;  1TFD A;  2F34 A;  3O9P A;  3C4M A;  5H8Q A;  2DWA A;  4PBH A;  3JV9 A;  4PGN A;  1IIW A;  1MXW A;  1R9L A;  4QXD A;  4NX1 A;  4IO4 A;  4JWY A;  4LZ7 A;  1M5E A;  3O29 A;  4R72 A;  4Q8R A;  3RGY A;  5BUU A;  2O7U A;  3TOD A;  2DE4 A;  3AXF A;  4XKQ A;  4YZZ A;  3PPP A;  2Q74 A;  4K3F A;  2LAO A;  1XHY A;  5I59 B;  2XXI A;  3OO8 A;  3IB2 A;  4R9G A;  4XFE A;  2THI A;  2NWJ A;  2DE2 A;  2ZZX A;  1TT1 A;  3SEU A;  2F5X A;  4I3Y A;  3MZB A;  1MG1 A;  1FTO A;  2QS4 A;  2UVJ A;  3MAM A;  1JW4 A;  1UTB B;  3MBP A;  4G8M A;  4MF3 A;  4X1B A;  4OES A;  5FHO A;  3QMF A;  4L17 A;  5CMB A;  4GIZ A;  3RQT A;  3H3G A;  4MLQ A;  4BDL A;  1K9Z A;  1QVS A;  2B4M A;  1OVB A;  3HHF A;  5ITO A;  3CG3 A;  1LST A;  3CR9 A;  1D4N A;  1BKA A;  3QIM A;  4R6H A;  4RPO A;  1P1Q A;  4U22 A;  5I58 B;  4H45 A;  2O68 A;  2ZXT A;  4JSD A;  4F29 A;  1P99 A;  4DDD A;  1JVX A;  3KZG A;  3V8X B;  3QSL A;  1Q35 A;  3TZA A;  4PE5 B;  1NV5 A;  4XIG Q;  5TP9 A;  1RDX A;  1IMA A;  3PPN A;  1GVC A;  4EF1 A;  4GVO A;  1D9Q A;  3IFC A;  3CHG A;  2F35 A;  3FGS A;  3HPI A;  3IB1 A;  3E78 A;  1B51 A;  1JET A;  2F36 A;  4OVP A;  2QJE A;  4QRZ A;  4G8N A;  1MY0 A;  1UIV A;  5EHM A;  2JJK A;  1URG A;  5FBP A;  3PMV A;  4I8C A;  2PT2 A;  4ZS9 A;  1M5D A;  1B3L A;  2XA5 A;  2NUV A;  2CZI A;  3EKI A;  2BJJ X;  4P8B A;  3FXR A;  1FPE A;  3OO9 A;  4YIC A;  2VOZ A;  4DE8 A;  2QVV A;  1Y3P A;  4MH5 A;  1GV8 A;  4YB6 A;  4ZEF A;  4UAB A;  4MJO A;  3VDF A;  3FJG A;  1A54 A;  3OEL A;  1FBH A;  1JW1 A;  4ELR A;  2XXK A;  3K6V A;  2H9B A;  4O7I A;  2PBW A;  3QUJ A;  2F78 A;  3E79 A;  2FA7 A;  2ZYO A;  4OFL A;  4YKP A;  1FPB A;  3W9W A;  4OFO A;  1MXX A;  1QUI A;  4FIM A;  2ZNT A;  3S9N C;  4P0G A;  3LBS A;  3MJN A;  4ZZE A;  2VD3 A;  3TCF A;  2B65 A;  5AA4 B;  4NED A;  4Q5T A;  2F7C A;  3KEI A;  3KN3 A;  4G61 A;  5HBC A;  4N8Y A;  1SW1 A;  3BFU A;  4YU0 A;  3V5A A;  4I3E A;  1UIU A;  2FYI A;  4Q30 B;  4U1O A;  4PFI A;  2OWT A;  2H5Y A;  2QFL A;  3SDF A;  2VD2 A;  2X7P A;  4R2B A;  1LAF E;  4LAT A;  1YXI A;  4H5F A;  4IO6 A;  4XXU A;  2HQ0 A;  1JEV A;  5I2K B;  4H0W A;  1ELJ A;  3C34 A;  3HST A;  1R1N A;  2XWI A;  3TAJ A;  1B3G A;  4H8I A;  3UK4 A;  2CMO A;  3PUW E;  5DVI A;  4R2F A;  3V83 A;  2RC7 A;  3KN8 A;  3I6V A;  3HN0 A;  3K2D A;  1PDA A;  1IXC A;  3EHT A;  4N07 A;  1FTK A;  3PUZ E;  1LGB C;  4RYA A;  4F18 A;  4MFI A;  4AB6 A;  3IAZ A;  1QJM A;  4N81 A;  4GX6 A;  3K1P A;  3RTW B;  3C31 A;  4KHZ E;  5K2X A;  3ZKK A;  1VR5 A;  3S2V A;  1NV4 A;  4OET A;  3U93 A;  2G29 A;  1HSL A;  3D4G A;  1ZBM A;  4O94 A;  2GHB A;  5ET8 A;  4NWD A;  3RTF B;  1MY4 A;  3KGC A;  1Y4T A;  3S4U A;  3OEN A;  4HS7 A;  4LZ8 A;  1Y1Z A;  1BTJ A;  3LUY A;  3BKI B;  1YZ0 A;  3UOR A;  1URS A;  4MLV A;  3QK6 A;  3VFJ A;  1MQD A;  2B4L A;  4XEQ A;  5EYG A;  3FVN A;  1G0I A;  1LB8 A;  2QPQ A;  3L6H A;  2P2A A;  2F6G A;  1MM6 A;  4GBV A;  3EF7 A;  3TTM A;  3KFM A;  1MRP A;  1XOC A;  4ZZA A;  1A8F A;  2R8T A;  4G2Z A;  3T1B A;  1LBX A;  1MQG A;  3MZ9 A;  3MUQ A;  3C36 A;  1H45 A;  3IOV A;  3RUM A;  3EPE A;  3KBR A;  1I69 A;  1I6A A;  3VLU A;  4M1V A;  5CC2 A;  4NE4 A;  5CBR A;  3OEK A;  2Z23 A;  3Q25 A;  4G68 A;  2ZMB A;  4ZE8 A;  1A99 A;  1HSE A;  1H76 A;  3GLB A;  1QKB A;  4Z7E A;  4MIJ A;  5EQA A;  4FAT A;  4PCD A;  3N26 A;  4YKK A;  2CZH A;  5IZZ A;  3RT6 B;  3UN6 A;  1VFD A;  4G4P A;  4C0R A;  4IO2 A;  1H3D A;  5FHM A;  3LSF B;  1FTL A;  1YAE A;  4IO7 A;  4UA8 A;  2R6G E;  4MNC A;  1K9Y A;  4ONY A;  3VV5 A;  3CI8 A;  4JVC A;  3K01 A;  2OWS A;  1SI1 A;  4P1E A;  4U1Z A;  4QSD A;  2QVU A;  3TFL A;  2FIX A;  3SER A;  1R6Z A;  2BJI A;  2DXR A;  2PFZ A;  3TDJ A;  3QXM A;  3I3V A;  1MH4 A;  3TTN A;  4YMB A;  3U94 A;  4POW A;  5H8H A;  2DWH A;  3U1O A;  1B0H A;  1XI6 A;  2I4C A;  4H46 A;  3B6Q A;  1B1X A;  1II5 A;  3MVX A;  5M2V A;  2DXY A;  1OLA A;  3LC8 A;  4DXC A;  4F1V A;  2XWO A;  3VVF A;  5IM2 A;  1FPG A;  4PFT A;  4OVT A;  4OVQ A;  2QVR A;  3E9X A;  1IQ7 A;  2I58 A;  4R6K A;  1LAH E;  4I40 A;  4UAC A;  2GHA A;  4EQ7 A;  3KSJ A;  2XXW A;  4GX4 A;  1B58 A;  4O3A A;  5KCJ B;  4OEV A;  4X9T A;  2ONR A;  3EHS A;  3MC2 A;  1EYJ A;  4BDN A;  4LN5 A;  3TKD A;  3SEV A;  1VSO A;  3FXU A;  2RIN A;  2QS1 A;  1US5 A;  2XWK A;  3ILT B;  4YKJ A;  3C32 A;  2NOO A;  3C35 A;  4WKM A;  1IXG A;  5DEX B;  1Y3Q A;  4YB7 A;  1OQG A;  1EYK A;  1B40 A;  1MPB A;  2FNC A;  1B9J A;  3G3I A;  5I84 A;  2IEE A;  3H06 B;  3M3F A;  4QFL A;  4GWY A;  1GR2 A;  3ZKL A;  5ESY A;  3ISP A;  3TEL A;  1SD3 A;  2GQ1 A;  1IUD A;  4E0W A;  4R74 A;  2XHD A;  3B8B A;  1ZMG A;  1EU8 A;  1MY2 A;  1B4H A;  1FBG A;  3O6I A;  3R26 A;  4OA4 A;  1AOV A;  4Z0I A;  4JXI A;  1M5C A;  3BBR A;  1MXU A;  3MWB A;  2XX7 A;  5TU0 A;  2V25 A;  2PMS A;  2V3Q A;  4F3G A;  5T3J A;  4OEN A;  1B05 A;  4YMA A;  1NMU A;  2UVI A;  4TLM B;  3HO7 A;  5CBS A;  1BLF A;  5FHN A;  3O2A A;  4QFP A;  1B5I A;  3O66 A;  3RYD A;  5H8S A;  1IMB A;  4FJP A;  5I57 B;  3PPQ A;  5TPA A;  2F7B A;  3CRB A;  2R71 A;  4P9K A;  3KC0 A;  2F8D A;  1DK4 A;  3PUX E;  1UTH A;  5IZ1 A;  1TXF A;  1LB9 A;  5DEX A;  2YLN A;  1QKA A;  5EYH A;  1NH8 A;  4N13 A;  4FEB A;  2Z8E A;  2P1S A;  1B3E A;  1IXI A;  4HCW A;  1Y9U A;  1AIV A;  1H43 A;  1NNP A;  2FVZ A;  4NN3 A;  1OMP A;  2QSX A;  2O1M A;  1XVY A;  3RPL A;  5A5L A;  2Z8F A;  3K00 A;  2VP1 A;  4KCD A;  4F3P A;  2Q89 A;  2I6E A;  1XS5 A;  1LAG E;  3KOT A;  5CMM A;  4X8R A;  3U72 A;  1KA0 A;  1FCK A;  3FV1 A;  3PMW A;  3G3G A;  1KZ8 A;  1FPK A;  3FVO A;  1Y4C A;  1CE2 A;  1N7X A;  3VXB A;  4GWW A;  1SW2 A;  3PD8 A;  3P7I A;  5ITP A;  4HCY A;  2A5T A;  5I56 B;  4GWZ A;  1G0H A;  3OEM A;  1NV7 A;  2XXH A;  2XXX A;  1NNT A;  4OAN A;  2B3F A;  2HHM A;  2XXY A;  3G3F A;  3PUY E;  2XD3 A;  4QFO A;  3T0J A;  3CSB A;  4MNI A;  1FBC A;  1FJ6 A;  4I1D A;  5H8F A;  1MY3 A;  4P47 A;  2Y7I A;  1JEU A;  3DM0 A;  5H8H B;  2V84 A;  4GRK A;  4N6K A;  2ONS A;  3QUF A;  3OO6 A;  3PTY A;  2F97 A;  4F22 A;  3T9X B;  3VXC A;  4IO3 A;  4QFK A;  5L9O A;  3ECR A;  2HFB A;  5TPA B;  1GGG A;  3Q26 A;  4GQO A;  2HZK A;  2OBG A;  3ZS6 A;  1RKM A;  4X04 A;  4GFR A;  4N6P A;  3ONM A;  4OXV A;  3SEX A;  1FQA A;  1KA1 A;  3OD7 A;  4FE8 A;  3BFT A;  4HTG A;  3IJX B;  3KG2 A;  3OSR A;  1N3X A;  3THI A;  1OQH A;  1YTV A;  4ZEC A;  5I56 A;  3SKP A;  3CVG A;  4EQ9 A;  5L9S A;  2XXP A;  3PV0 E;  1NUX A;  1US4 A;  1O64 A;  2WBB A;  4R75 A;  3DP8 A;  3TEP A;  3QAX A;  4QHQ A;  4GWU A;  4GXS B;  1OVT A;  4IB2 A;  1N04 A;  4KR5 A;  3OMB A;  5H8N B;  1RYX A;  5J16 A;  1XVX A;  1AL3 A;  3VVE A;  5F24 A;  4NF6 A;  4JWO A;  4N91 A;  3FVG A;  2PVU A;  5AA3 A;  1URD A;  1NNF A;  4DI4 B;  1I6Q A;  5IGA A;  1F9B A;  1CNQ A;  4FAJ A;  3HCQ A;  2CEX A;  2DDK A;  1I6B A;  4ND9 A;  4X1D A;  2D21 A;  4P0I A;  3FXB A;  1QUK A;  4H67 A;  5I2N A;  2ZYN A;  1A40 A;  3Q27 A;  3TCG A;  4GD5 A;  1O63 A;  3KJT A;  4BLA A;  1GTK A;  3IK6 B;  1LCF A;  4GWS A;  4OVJ A;  2RCB A;  3H6T A;  5F1Q A;  3LSX A;  3RY3 A;  1ZLQ A;  3T66 A;  4KPT A;  4OZ9 A;  1XC1 A;  5B70 A;  4PFB A;  3GBA A;  3RT8 A;  2UYF A;  3VLW A;  1LBZ A;  2XXU A;  4GX3 A;  4ECF A;  2E0S A;  5LOM A;  5FTI A;  1INP A;  4HE2 A;  1FTM A;  2I3W A;  2DVC A;  4TQU Q;  1PB9 A;  4ELO A;  2KLF A;  4MX6 A;  1L5T A;  2Z8D A;  3F11 A;  2KQZ A;  1Q9D A;  4U4S A;  2OJT A;  1SQY A;  1MH3 A;  4XKR A;  2GFE A;  4LZ5 A;  1PBQ A;  4P3L A;  4ZDM A;  4C1T A;  5J1D A;  4GWO A;  1LEV A;  3TYH A;  3C9H A;  1B2H A;  4RJZ A;  1NI9 A;  4EXL A;  3TPA A;  4MNP A;  4ESW A;  1SYH A;  4NF6 B;  2F7A A;  4LQ5 A;  1M5F A;  1B52 A;  2ESN A;  4NHB A;  4BDM A;  3IO4 A;  1P1W A;  2H99 A;  4OER A;  2QMX A;  1POY 1;  1DCU A;  3A29 A;  1FJ9 A;  1FW0 A;  5EHS A;  4JBZ A;  2ZYK A;  1LBV A;  2NVU B;  1NV3 A;  4F2Q A;  1Z7N E;  2ABH A;  1JW5 A;  1RDZ A;  4RXL A;  2UXA A;  3FIR A;  5A5X B;  4RK2 A;  1FBE A;  1PEB A;  3OXN A;  2X7Q A;  3G3H A;  3SES A;  2ZZV A;  1FPI A;  1FPD A;  1MPD A;  4GWX A;  1JVY A;  2HZL A;  2HCA A;  1SYI A;  3KC1 A;  4RY1 A;  2P0S A;  4WED A;  2XXT A;  2H4I A;  4WXJ A;  5EQ7 A;  4LQ2 A;  3M3K A;  2HEU A;  4PBQ A;  1QUL A;  4KD5 A;  1PBP A;  3UIF A;  1ZIU A;  3M8U A;  3N6U A;  3FXQ A;  1KWH A;  2UVG A;  4AS5 A;  3FZV A;  4G68 C;  4HXV A;  2ANJ A;  2WBD A;  4RA1 A;  1VFE A;  1DPP A;  4R6Y A;  3ROJ A;  3ZSF A;  2HAU A;  2V4C A;  3MW0 A;  4IY5 A;  5I57 A;  1P1N A;  4DXB A;  4XKP A;  1UTH B;  2I48 A;  3LSL A;  5KDT A;  1B32 A;  1DOT A;  4H6D A;  4JVD A;  4C1U A;  1N76 A;  2M8C A;  5HM4 B;  1QW0 A;  3MZ1 A;  2O6A A;  2HAV A;  2I0B A;  2Y5L A;  1CB6 A;  5H8N A;  1DPE A;  3Q29 A;  3OSQ A;  1SPI A;  4F2O A;  1B7H A;  3IOU A;  3FJM A;  5AA1 A;  1UQW A;  3IB0 A;  3H4Z A;  2Y84 A;  3MVZ A;  3O28 A;  3R7X A;  4ZE9 A;  3GYY A;  3JYR A;  2QS3 A;  4QFN A;  1IZ1 A;  5L9M A;  3MP8 A;  3PU5 A;  4PE3 A;  4O3B A;  3UGW A;  4F19 A;  3G3K A;  1VE4 A;  3G7W A;  1NV2 A;  3WAE A;  2O51 A;  1QUJ A;  4ISU A;  1PB8 A;  4OEU A;  1ZJL A;  3VVD A;  2HXR A;  2FBP A;  1LLS A;  4PTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...