3TTNA

Crystal structures of polyamine receptors spud and spue from pseudomonas aeruginosa
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
335
structure length
335
Chain Sequence
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Polyamine transport protein
publication title Structural Basis of Substrate Binding Specificity Revealed by the Crystal Structures of Polyamine Receptors SpuD and SpuE from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 114
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttnA02
3HPIA 3HV1A 3E13X 4NTLA 3M8UA 4PP0A 2Z8EA 3V89B 3WAFA 2NVUB 3FVOA 1AH5A 1P1WA 3C32A 4ZEDA 3OO8A 1MDP1 4DXUA 2ONRA 2RC8A 3IK6B 1HSJA 1SD3A 3PUXE 3N6TA 1OLCA 4AB6A 5IAIA 1Y3QA 2Q88A 2UVJA 3EHUA 4ELRA 1B6HA 4N07A 4EF2A 4DDDA 3TYHA 1O63A 1PBPA 5KCJA 1D9VA 3QIMA 2Z8DA 1M5CA 4G68A 3CFZA 3K6VA 4H6DA 1M5DA 1SQYA 3V5AA 2D21A 3M3KA 3SKPA 3QUJA 1URGA 3MAMA 1UIUA 1B3EA 1SI1A 3MQ9A 2XXRA 1B40A 1LAGE 1XVXA 3KG2A 1VE4A 4TLLB 3D4GA 1QKBA 4ESXA 1OIBA 2HFBA 1H43A 2HXWA 4XIGQ 3IOUA 4ISUA 1SW2A 4YZZA 3W15C 2DWIA 3UIFA 3IB0A 5CM6A 4NF8A 4GF8A 3O97A 2Y7WA 2NXOA 1B46A 1Q1KA 4MFIA 3PU5A 3CI8A 4F18A 2I3WA 5AA2A 1HSEA 3G3IA 4F2QA 1SDXA 2O51A 2HQ0A 2V3QA 1RYOA 1AIVA 4NF6A 2Y7KA 5AA2D 3KBRA 3PPPA 1P1NA 3PD9A 4YB6A 3N26A 1Y20A 3MVYA 4R72A 2ABHA 3RUMA 4LZ7A 3FVKA 4QSEA 1SW4A 3QUFA 4GL8A 1FTKA 3A3UA 4BDLA 3E4RA 4QSCA 3TCFA 4X9TA 1Y9UA 3MBPA 2F7BA 1B0HA 3OSRA 1BIYA 1IXIA 5ITPA 1ELJA 1POY1 1B52A 3VVDA 2F97A 3PPOA 4RNSA 5KCJB 4YICA 4LZ8A 4Z0IA 4EF1A 4DIGA 2XD2A 3PMXA 3TTLA 2VHAA 2D3IA 3TQWA 4EXKA 4EQ9A 1LAHE 5CMMA 1LCFA 4F1YA 3MVWA 3T9VA 4M1VA 1N76A 2Q9TA 1LFHA 3FXRA 1SI0A 1LCTA 3SEWA 1MY1A 3IO4A 2OWSA 1H44A 3VXCA 3MP6A 4FEDA 1A8EA 1Y1ZA 3MVZA 3DP6A 1MPDA 1NKXA 2XXQA 4NF8B 2QS4A 4R9GA 2RF1A 4PFTA 1MXWA 1QJMA 4NF4A 4U21A 4Z7EA 5CBSA 4OEVA 4RPNA 4OMBA 3LSLA 5AA2B 3K0VA 3IO6A 3G3GA 4R6YA 4RJZA 2XD3A 2ZYMA 4GRKA 4NF6B 4R75A 2ALUA 1ZBMA 3EQ1A 3K6WA 4JWOA 3GBBA 3PV0E 2HAVA 2ZYNA 1FQFA 1PB9A 2QJEA 1GV8A 3T66A 1MXYA 3G7WA 1SYHA 3KSXA 1MQDA 5LOMA 3CRBA 4ZEIA 5AA1A 1B7UA 3RT6B 3L6HA 3BBRA 3I5OA 4NWDA 2DS9A 3U93A 5AA3A 4ZECA 1KWHA 1IEJA 5ELVA 4HW8A 4U22A 1M5FA 2RC7A 1UTHA 1FTJA 1JETA 4U2RA 1TWYA 2Q8JA 4GVOA 1SVXB 1DTZA 3K01A 2I4BA 1Z7NE 4H0WA 3RN8A 1NNKA 5I57A 1J1NA 1ZU0A 4OENA 1ZLQA 3RPWA 4G8HA 4ESWA 3PMVA 4H8JA 4YKJA 4ELPA 2X7PA 4IO6A 2QMXA 3RQTA 2CZLA 1NMUA 2XX8A 3JYRA 4FORA 1OLAA 3CFLA 4GIZA 5JTYA 2R9JA 2I4CA 4I8CA 3K4UA 4DXCA 3M3LA 5HBCA 4XTCQ 4F2OA 4JB7A 2VD3A 4NF4B 4JDFA 5CBRA 3MW0A 1D4NA 3EF7A 1OQGA 5I2KA 5KDTA 1H3DA 4P11A 5DYHA 1XC1A 3KN3A 5ITOA 4KCDA 1S7YA 3R26A 4F19A 4OFLA 1FQCA 3EHSA 4JWXA 1S9TA 3K02A 1LFGA 1B4HA 1M5BA 3HN0A 1YCJA 4RXLA 2XXUA 2Z8FA 3O29A 5TP9B 2XXTA 1NH8A 4JSOA 1ATGA 1A8FA 1DTGA 1PBQA 3CVGA 4RK9A 3T9XB 5ICQA 2Q2CA 4U4SA 1B0LA 4ONYA 2R71A 2QS1A 2PT1A 5B70A 4PE5B 2ZXTA 4OESA 3WAEA 5L8DA 3H6UA 5DVFA 4H65A 2G29A 1MH4A 4OXVA 1ZKBA 2H98A 3T9HB 2DQVA 2XXVA 3BKIB 2NWJA 1A7LA 3FV1A 1PB7A 1UTHB 1N3WA 1MXUA 3D4CA 2H4IA 1IXHA 3CG1A 4FJPA 1MQJA 1JW1A 2DVZA 2REGA 4QF9A 5I57B 5KZTA 4O3CA 5DVIA 4JWYA 2XX7A 1AMFA 3SDFA 4RA1A 3KOTA 4IY6A 1UQWA 3ILTB 2A5TB 1EZ9A 1FQEA 4GOTA 5F7VA 3H3GA 2P0SA 4Q8RA 2F7AA 3TQLA 2KLFA 4TOZA 3UN6A 4ZS9A 5FHMA 4F1UA 4GWOA 3KGCA 1QULA 4JXIA 4FIMA 1II5A 1QUJA 3TPAA 3OOAA 4G8MA 3C35A 4YKKA 5KDTB 1XT8A 5BUUA 3B6TA 4PFYA 4WEPA 1N0TA 2I3VA 5AA4A 3UORA 1VFDA 3DP8A 2Q89A 5EYFA 4YKIA 4F3BA 3K6UA 2UYEA 3RGYA 4GQOA 3S4UA 3BFUA 1B9JA 4THIA 1P99A 3IX1A 1AOVA 4H8IA 3QYTA 2E1SA 3FUZA 5CMKA 3IB1A 4I9DA 2QS2A 2XXHA 2H99A 4E0XA 3GBAA 4FAJA 5FHOA 3T9UA 5H8HA 3L6GA 3UGWA 1ZTYA 1SW5A 3Q25A 1Y3NA 3IOVA 3O6HA 4X1BA 4FECA 1OVBA 2O1MA 4BDMA 1FQDA 4RPOA 4P0IA 4XKRA 3C36A 1L5TA 3VLVA 5AE4A 1LBBA 4POWA 3O28A 2V3TA 2VD2A 2O6AA 3FVNA 4RYAA 3CSGA 4BDRA 3H4ZA 2YLNA 1GGGA 3U72A 2V93A 3SEYA 1YAEA 4OVJA 5BWJA 5TU0A 3O2AA 3GXAA 2THIA 4OTEA 3G3FA 3K2DA 5H8NA 4TQUQ 2DE4A 3S9EA 3Q28A 2ONKE 4I62A 3IOTA 4KCCA 5H8SA 3PD8A 4U23A 3RLFE 1D9YA 4QFPA 4WXJA 1JVYA 4H1XA 3V83A 2FYIA 4X1DA 5HPQA 1LB8A 3VLUA 2LAOA 4F31B 4YAHX 4LUBA 1D3KA 3TFLA 5ICTA 2HZKA 3RT8A 3S2VA 5AA4B 3S9MC 4O3AA 1MDQA 3GZGA 3S9NC 4NF5A 3TCHA 2R6GE 3VLWA 1MS7A 1NNFA 1N84A 2DE3A 4OZ9A 3R7XA 3H6TA 2QRYA 1YTVA 3O9PA 5L9OA 1MXXA 4G68B 5H8HB 2O1LA 3PPNA 4PFUA 5CI5A 3VFJA 3VV5A 2M8CA 1IIWA 1YPNA 4OYVA 3O6IA 2DOJA 3EPEA 4JSDA 4DCXA 4Q5TA 1N3XA 3GLBA 4NWCA 2H9BA 4KD5A 3TDJA 4WKMA 3PUVE 3Q27A 3W9VA 2RINA 2OWTA 3RTFB 2UXAA 1B5JA 4OERA 2X26A 1NNPA 2DXYA 1BKAA 2OBGA 2Y7PA 3FJMA 3RY3A 3DELB 3KFMA 4G68C 1HSLA 3N94A 2REJA 1JW4A 3ZSFA 4FE8A 4IGRA 4RK2A 4F29A 3T22A 2RCBA 1MPBA 1B7ZA 4R2BA 4Q0CA 4G2ZA 2QL3A 4C1TA 3SEUA 1PB8A 1US4A 1IZ1A 1A99A 3V8XB 2F35A 3H6VA 3I6VA 1MY4A 4E0WA 1SW1A 1WVJA 2Z23A 4O3BA 1EH3A 1LAFE 4LVQA 1BP5A 3FJGA 3IORA 4FATA 2UVGA 3CIJA 4KPTA 4YKPA 2NUVA 3THIA 3TODA 4QFOA 3B6WA 3FATA 1GTKA 4OWDA 4IO5A 1I6AA 3B6QA 1A40A 1B3GA 1ZJLA 2O7UA 4NF5B 2XXPA 1MXVA 2RCAA 1B3FA 1B5IA 5B7DA 3SEXA 1MQGA 3DM0A 2V25A 3ECRA 4YB5A 2DP8A 1XVYA 2V3UA 1CE2A 2ZNTA 3OMBA 2IEEA 4IO7A 2V84A 4GXAA 3LSWA 3MUQA 3H7MA 3VE1B 5CRYA 2QS3A 1JQFA 3MPKA 1O64A 4QFNA 3U8QA 3CR9A 5IKBA 4XKPA 2I0CA 1TT1A 1IXGA 1JNFA 2VOZA 1OQHA 3UP9A 1MQIA 2I6EA 4KHZE 2FA7A 1R9QA 3FJ7A 3G3HA 3KOSA 5I56A 1B7HA 2F5XA 4POXA 4IO4A 3A09A 3C33A 3O6GA 3TZAA 4UACA 3VVFA 2QMWA 1GR2A 1DPEA 3KJ7A 3N6UA 1WODA 3MWBA 4K3FA 4HCWA 1XS5A 2HCAA 1JEUA 4BLAA 4OFOA 3LSXA 2NOOA 2B3BA 1JVXA 3OELA 1F9BA 4R2FA 3ODBA 1B58A 1FCKA 4DLDA 1B3LA 3FGSA 4GXSB 2DWAA 1B51A 3H03A 2W7YA 5JK4A 1QUKA 4ZEFA 3U94A 2B3FA 3IOWA 3MZ9A 3CFXA 2HAUA 3Q26A 2I0BA 3OSQA 2UVHA 4R73A 3IR1A 3H06B 2PT2A 1SYIA 5I58A 3PPQA 3FZVA 1FQBA 4QFLA 3IJXB 1PDAA 1OVTA 4ZE9A 2F36A 1GVCA 4F39A 4RY1A 1LBCA 1DMBA 4MLQA 4OHNA 1B4ZA 4DXBA 3KZGA 3TEPA 2ZNSA 4L17A 2F8DA 4WEDA 2O68A 5DVJA 1VSOA 4NMYA 4LONB 1B1XA 4OFJA 4LZ5A 4PQJA 3MP8A 2Q2AA 3OENA 5K2YA 3C31A 4QSDA 2RKMA 4NE4A 3OO9A 5H8FA 1M5EA 3HO7A 3PUZE 5JTYB 1R6ZA 3SETA 4YMBA 2DXRA 1TFAA 5CC2A 2P2AA 3W9WA 2F6PA 4H5GA 3G3KA 4EQ7A 4C0RA 1MY3A 3FD3A 1POTA 3MP1A 5I2KB 5I59A 2AL5A 2XXWA 1UTBA 2ZNUA 1QW0A 1IXCA 3RTWB 1FTMA 4DE8A 5DT6A 3OO6A 3KN8A 4EXLA 1MG1A 4QRZA 4F1VA 1Y1MA 2CMOA 3FXUA 4HS7A 3CSBA 3FXQA 1I6QA 2PYYA 4ZZEA 2OZZA 1LFIA 5DEXA 3U1OA 1Y3PA 2P1SA 3PUWE 2DSFA 1LGBC 1JW5A 1Q35A 1VR5A 3ZKKA 4GFRA 1ZMGA 1RKMA 1N7WA 1MPCA 2GFEA 4QHQA 5I58B 3K6XA 3USDA 4M4GA 3OEKA 2OJTA 2OLBA 3T96B 4GLIA 5H8QA 1NFTA 4C1UA 1DOTA 4DCYA 4ECFA 3SEVA 3TTMA 4YMAA 3JV9A 3OO7A 4OEUA 4OETA 3TTRA 3CG3A 2ZMBA 4EDPA 1N04A 2AYSA 2O7IA 3M3FA 1A55A 4U1ZA 1IQ7A 4G4PA 4ZEBA 1FW0A 3KSJA 1B05A 4IY5A 1US5A 3N5LA 4KYSA 4HCYA 3LUYA 4FEBA 1H76A 3U92A 5H8FB 2H25A 1CB6A 4Q30B 4YU0A 3KEIA 4U4XA 3IB2A 1NH7A 4N6PA 3QK6A 3K1NA 4ZZAA 3C4MA 5FHNA 5DTBA 1QVSA 3O66A 2I58A 4F22A 3KN7A 1MY0A 4H67A 1PC3A 2DVCA 1DSNA 3K1MA 4LQ5A 2ANJA 4MF3A 4HTGA 5I59B 3DLNA 3TKDA 1UTBB 2UYFA 5CMCA 3Q29A 4DZ1A 2O69A 3PGFA 2DWHA 3E9XA 2AL4A 4R9FA 5FTIA 4LP2B 4KQPA 1RYXA 3LR1A 1AL3A 3KJTA 3TAJA 2GHBA 1MY2A 5DEXB 3PMWA 4QFKA 4R6KA 4R74A 5J1DA 1URDA 4YB7A 3I3VA 3ZS6A 4F3SA 3SERA 2GH9A 2I49A 1A54A 4X48A 4PFWA 2Y7RA 1O7TA 1MM6A 5EHMA 2ESNA 4TLMB 1S50A 1DPPA 1B1HA 4MLVA 1IUDA 2PX1A 2PBWA 1MXZA 5H8QB 1T0KA 1USYH 3H6WA 1MM7A 2D5WA 4JBZA 4IO3A 5I84A 4KFQA 4ZEKA 5TPAA 2DE2A 1LAXA 1TFDA 2Z22A 3MZBA 1WDNA 4IO2A 3TCGA 5CMBA 4EQBA 4ZE8A 2XX9A 2I48A 1B32A 2QPQA 3ILUB 3MPLA 3TMGA 4GD5A 3T93B 4I1DA 4IGTA 2OCUA 3IAZA 4EUOA 3R6UA 1P1UA 1EZOA 1H45A 5FTHA 2HZLA 3G3JA 3HSTA 1JEVA 4F3GA 3S9LC 4ND9A 2DYXA 3E3KA 3EHTA 3RNNA 3IJOB 5ISUA 4KYDA 1USYE 5H8NB 2XXIA 4XXUA 3MZ1A 1BLFA 1PEBA 1MQHA 4H5FA 3B7DA 4ZDMA 2UVIA 3OD7A 2OK2A 3OXNA 4UA8A 2Y84A 4KYEA 3TUSA 2XXXA 4G8NA 1VFEA 1QKAA 5TP9A 3PUYE 3K1PA 1I69A 3IL1B 1LB9A 2ZYOA 4LQ2A 3OEMA 1B2HA 5HM4B 4PETA 1R9LA 2F34A 4LA9A 1SBPA 1EZPA 5I2NA 5A5XA 4BDNA 4ELOA 1N7XA 2Y7IA 4AQ4A 5EHSA 4ELQA 2X7QA 1ANFA 5M2VA 2F7CA 4G77A 4N13A 3ZKLA 4BDOA 4U1OA 2F6GA 1FQAA 1ZIUA 2G93A 2YPNA 2VP1A 3LSFB 2WKYA 2QSXA 1NNTA 3FVGA 3F11A 2BJJX 3UA8A 3BFTA 1MH3A 2AIXA 5TPAB 2A5TA 3A3CA 4F3PA 2HEUA 4XKQA 2IA4A 3QAXA 1BTJA 3LC8A 1IITA 2GRVA 1R1NA 3TTKA 4R6HA 1FTOA 5JEIA 4OQOA 1FTLA 2VGQA 1QUIA 4IB2A 3UK4A 4KI0E 5K2XA 3C34A 3K00A 4NEDA 2A5SA 5F1QA 3LBSA 4LATA 3P7IA 3QSLA 4KR5A 2E0SA 2ZYKA 1B3HA 4BDQA 1EU8A 1P1OA 3VXBA 2PVUA 1Z7ME 2DWJA 2XXYA 3HCQA 4MBPA 1Y4CA 1P1QA 3EN3A 2PMSA 3JZJA 3ONMA 1Y4TA 1XOCA 4P0GA 3MVXA 3C9HA 2FNCA 3MJNA 2O84X 3HHFA 3TTNA 3VDFA 1TXFA 4AB5A 4XKNA 1XHYA 3FIRA 2B65A 5I2NB 2GHAA 3AXFA 2XHDA 5A5XB 3QXMA 3SESA 4GL0A 5L9MA 1LLSA 3TELA 3FV2A 3FASA 4MH5A 3DP4A 1OMPA 1MRPA 3MC2A 1B5HA 3PPRA 2RC9A 5I56B 1UIVA 3HHGA 3VVEA 1I6BA 2H5YA 2F78A 1NL5A 1LSTA 5L9SA 1URSA 2YJPA 2ONSA
chains in the Genus database with same CATH superfamily
4PFIA 3HPIA 3HV1A 3E13X 4NTLA 3M8UA 1IMFA 4PP0A 2Z8EA 3V89B 1FJ9A 3WAFA 1KA0A 5EQ9A 2NVUB 3FVOA 1AH5A 1P1WA 3C32A 1FRPA 4ZEDA 3OO8A 1MDP1 4DXUA 2ONRA 2RC8A 3LUZA 1DK4A 3IK6B 4MNCA 4PDHA 1HSJA 1SD3A 3PUXE 3N6TA 1OLCA 4AB6A 5IAIA 1Y3QA 2Q88A 1QGXA 2UVJA 3EHUA 1NV6A 4AS5A 4ELRA 1FPIA 1B6HA 4N07A 4EF2A 4DDDA 3TYHA 1O63A 2CEXA 2CZKA 5IZ1A 1PBPA 5KCJA 3HFUA 1D9VA 3QIMA 4I3YA 2Z8DA 5EQ8A 1M5CA 4G68A 3CFZA 3K6VA 4H6DA 1M5DA 1SQYA 3V5AA 1D9QA 2D21A 3M3KA 3SKPA 3QUJA 1URGA 4DI3D 3MAMA 1UIUA 1B3EA 1SI1A 3MQ9A 2MKZA 2XXRA 4FBPA 4MMPA 1B40A 1LAGE 1FJ6A 1XVXA 3KG2A 3E78A 1VE4A 4N6KA 1FSAA 4TLLB 3D4GA 1QKBA 4ESXA 1OIBA 2HFBA 1H43A 2HXWA 4XIGQ 3IOUA 4ISUA 1SW2A 4YZZA 3W15C 2DWIA 3UIFA 3IB0A 5CM6A 4NF8A 4GF8A 3O97A 1EYKA 2Y7WA 5A5LA 2NXOA 4HXVA 1B46A 1Q1KA 4GX6A 4MFIA 3PU5A 3CI8A 4F18A 2I3WA 4N8YA 5AA2A 2QVUA 1HSEA 3G3IA 2JJKA 4F2QA 3KC1A 1SDXA 2O51A 2HQ0A 2V3QA 1RYOA 1AIVA 4NF6A 2Y7KA 5AA2D 3KBRA 3PPPA 1P1NA 3PD9A 3MYUA 4YB6A 3N26A 1Y20A 3MVYA 4R72A 2ABHA 3RUMA 4LZ7A 5EYHA 3FVKA 4QSEA 1SW4A 3QUFA 3IFAA 1FBCA 4GL8A 1FTKA 3A3UA 4BDLA 3E4RA 4QSCA 3TCFA 4X9TA 1Y9UA 3MBPA 2F7BA 1B0HA 3OSRA 1BIYA 1IXIA 5ITPA 1ELJA 1POY1 1B52A 3VVDA 4P3LA 4PFRA 2F97A 3PPOA 5F24A 4HE2A 4RNSA 1NUYA 5KCJB 4XF5A 1YYZA 4YICA 4LZ8A 4Z0IA 1KA1A 4EF1A 4DIGA 2XD2A 3PMXA 4GWXA 3TTLA 2VHAA 2CZHA 2D3IA 3TQWA 4EXKA 4EQ9A 1LAHE 5CMMA 1LCFA 4F1YA 3MVWA 3T9VA 3BIGA 4M1VA 1N76A 2Q9TA 4QXDA 1LFHA 3FXRA 1SI0A 5ET5A 1LCTA 3SEWA 1MY1A 3IO4A 2OWSA 3IFCA 1H44A 2PFZA 3VXCA 3MP6A 4FEDA 1A8EA 1Y1ZA 2WEFA 3MVZA 3DP6A 1MPDA 1RDYA 4NF8B 4R9GA 1NKXA 2L5VA 2QS4A 2XXQA 4AS4A 2RF1A 4PFTA 1MXWA 1QJMA 4NF4A 4NQ8A 4U21A 4Z7EA 5CBSA 4OEVA 4RPNA 3PTYA 4OMBA 1AWBA 2CEYA 3LSLA 4O7MA 5AA2B 3K0VA 3IO6A 3G3GA 4R6YA 4RJZA 2XD3A 2ZYMA 4N8GA 4GRKA 4NF6B 1FPJA 4R75A 2ALUA 1ZBMA 1NI9A 3EQ1A 3K6WA 4JWOA 3GBBA 3PV0E 2HAVA 2ZYNA 1FQFA 1PB9A 2QJEA 1GV8A 3T66A 1MXYA 3G7WA 1SYHA 3KSXA 1MQDA 5LOMA 4PDDA 1YXIA 3CRBA 4ZEIA 5AA1A 1B7UA 3RT6B 3L6HA 3BBRA 3I5OA 4NWDA 4O8MA 2DS9A 3U93A 5AA3A 4ZECA 1KWHA 1IEJA 5ELVA 4HW8A 4U22A 1M5FA 2RC7A 1UTHA 1FTJA 1JETA 1FTAA 4U2RA 1TWYA 4MAGA 2Q8JA 4GVOA 1SVXB 1DTZA 3K01A 2I4BA 1Z7NE 4H0WA 3RN8A 1NNKA 5I57A 1IMDA 1J1NA 1ZU0A 4OENA 1ZLQA 4PAKA 4PAFA 3RPWA 4G8HA 4ESWA 3PMVA 4H8JA 4YKJA 1G0IA 4ELPA 2X7PA 5LDZA 4IO6A 4OA4A 2QMXA 3RQTA 2CZLA 1NMUA 2XX8A 3JYRA 4FORA 1OLAA 3CFLA 1LBVA 4GIZA 5JTYA 2R9JA 2I4CA 4I8CA 3K4UA 4DXCA 3M3LA 4PF6A 5HBCA 4XTCQ 4F2OA 4JB7A 2VD3A 4NF4B 4JDFA 5CBRA 3MW0A 1D4NA 3EF7A 1OQGA 5I2KA 2B4LA 5KDTA 4N91A 1H3DA 4NF0A 4P11A 5DYHA 1XC1A 2FIXA 3KN3A 5ITOA 4KCDA 5T3JA 3CHGA 1S7YA 3R26A 4F19A 4OFLA 1FQCA 3EHSA 4JWXA 1S9TA 3K02A 1LFGA 1B4HA 1M5BA 3HN0A 4PTKA 1YCJA 4RXLA 2XXUA 2Z8FA 3O29A 5TP9B 4MNPA 1NV4A 2XXTA 1NH8A 4JSOA 1ATGA 4N4UA 1A8FA 1DTGA 1PBQA 3CVGA 4RK9A 3T9XB 5ICQA 2Q2CA 4U4SA 1B0LA 4ONYA 2R71A 2QS1A 3B50A 2PT1A 5B70A 4PE5B 2ZXTA 4OESA 3WAEA 5L8DA 3H6UA 5DVFA 4H65A 2G29A 1MH4A 4OXVA 1ZKBA 1EYJA 2H98A 3T9HB 2DQVA 2XXVA 3BKIB 2NWJA 1A7LA 3FV1A 1PB7A 2KQZA 1UTHB 1N3WA 1MXUA 3D4CA 2H4IA 1NV7A 1FBEA 1IXHA 3CG1A 4FJPA 1MQJA 1JW1A 2DVZA 2REGA 4QF9A 5I57B 5KZTA 4O3CA 5DVIA 4JWYA 2XX7A 1AMFA 5I5PA 3SDFA 4RA1A 3KOTA 4IY6A 1UQWA 3ILTB 2A5TB 1EZ9A 1FBHA 1FQEA 4GOTA 5F7VA 3H3GA 2P0SA 4Q8RA 2F7AA 3TQLA 2KLFA 4TOZA 3UN6A 4ZS9A 2KR0A 5FHMA 4F1UA 2QVRA 4GWOA 4XEQA 3A29A 3KGCA 1QULA 4JXIA 4FIMA 1II5A 1QUJA 3TPAA 3OOAA 4G8MA 3C35A 4YKKA 5KDTB 1XT8A 5BUUA 3B6TA 4PFYA 4WEPA 1N0TA 2I3VA 5AA4A 3UORA 1VFDA 3DP8A 2WBDA 2Q89A 5EYFA 4YKIA 4F3BA 3ISPA 3K6UA 2UYEA 3RGYA 4GQOA 3S4UA 3BFUA 1B9JA 4THIA 1P99A 3IX1A 1AOVA 4H8IA 3QYTA 2E1SA 3FUZA 5CMKA 3IB1A 2WYKA 4I9DA 2QS2A 2XXHA 2H99A 4E0XA 3GBAA 4FAJA 5FHOA 3T9UA 5H8HA 3L6GA 3QMFA 3UGWA 1ZTYA 4IR8A 1SW5A 3Q25A 4PC9A 1Y3NA 3IOVA 3O6HA 4X1BA 4FECA 1OVBA 2O1MA 4BDMA 1FQDA 4RPOA 4JVIA 4P0IA 1LBYA 5ESYA 4XKRA 3C36A 1L5TA 3VLVA 1LBBA 4POWA 5AE4A 3O28A 2V3TA 2P3VA 4P1EA 1K9YA 2VD2A 2O6AA 3FVNA 2PCRA 4RYAA 3CSGA 4BDRA 2ZZVA 3H4ZA 2YLNA 1GGGA 3U72A 2V93A 3SEYA 1YAEA 4OVJA 5IZ3A 5BWJA 5TU0A 3O2AA 3GXAA 2THIA 4OTEA 3G3FA 3K2DA 4GWWA 5H8NA 4TQUQ 2DE4A 4PGNA 1NUWA 3S9EA 3Q28A 2ONKE 4I62A 3IOTA 4KCCA 2XWKA 5H8SA 3PD8A 4U23A 3RLFE 1D9YA 4PBHA 4QFPA 4WXJA 1JVYA 4H1XA 3V83A 2FYIA 4X1DA 5HPQA 1DCUA 1LB8A 2HPGA 3VLUA 5ET7A 2LAOA 4F31B 4YAHX 4LUBA 1D3KA 3TFLA 5ICTA 2HZKA 3RT8A 3S2VA 5AA4B 3S9MC 4O3AA 1MDQA 5EQ7A 3GZGA 3S9NC 4NF5A 1RDZA 3TCHA 2R6GE 4UABA 4PGPA 1FPLA 3VLWA 2F3BA 1FPBA 1MS7A 1NNFA 1N84A 2DE3A 4OZ9A 3R7XA 2B4MA 3H6TA 2QRYA 1YTVA 3O9PA 5L9OA 1MXXA 4G68B 5H8HB 2DDKA 5LTCA 2O1LA 3PPNA 3E79A 4PFUA 5CI5A 3VFJA 3VV5A 2M8CA 4OVPA 1IIWA 1YPNA 4OYVA 3O6IA 2DOJA 3EPEA 1EYIA 4JSDA 1FBDA 4DCXA 4NHBA 4Q5TA 1N3XA 3GLBA 4NWCA 2H9BA 4XFEA 4KD5A 3TDJA 4WKMA 3PUVE 3Q27A 3W9VA 2RINA 2OWTA 3RTFB 2UXAA 1B5JA 4OERA 2X26A 1NNPA 2DXYA 1BKAA 2OBGA 4MEVA 2Y7PA 3FJMA 3RY3A 3DELB 3KFMA 4G68C 1HSLA 3N94A 2REJA 1JW4A 5IZ3B 4OVRA 3ZSFA 4FE8A 4IGRA 4RK2A 4F29A 3T22A 2RCBA 1MPBA 4DI4B 1B7ZA 4R2BA 4Q0CA 4G2ZA 2QL3A 4C1TA 3SEUA 2P3NA 3T0JA 1PB8A 1US4A 2Y5LA 1IZ1A 1A99A 3V8XB 2F35A 3H6VA 4PBQA 3I6VA 1MY4A 4E0WA 1SW1A 1WVJA 2Z23A 1YZ0A 4O3BA 1EH3A 1LAFE 4LVQA 1BP5A 3FJGA 3IORA 4FATA 2UVGA 3CIJA 4KPTA 4YKPA 2NUVA 3THIA 3TODA 4QFOA 3B6WA 3FATA 1GTKA 4OWDA 4P9KA 4PFBA 2VT5A 4IO5A 1I6AA 3B6QA 1A40A 1B3GA 1ZJLA 2O7UA 4NF5B 2XXPA 1MXVA 2RCAA 4OANA 1B3FA 1SPIA 1B5IA 5B7DA 3SEXA 1MQGA 3DM0A 4GWYA 1XI6A 2V25A 3ECRA 2FHYA 4YB5A 2DP8A 1XVYA 2V3UA 1CE2A 2ZNTA 3OMBA 2IEEA 4MX6A 4IO7A 2V84A 4GXAA 3LSWA 3MUQA 3H7MA 3ROJA 3VE1B 2WYPA 3B8BA 5CRYA 2QS3A 1JQFA 3MPKA 1O64A 4QFNA 3U8QA 3CR9A 3T1BA 5IKBA 4XKPA 2I0CA 1TT1A 1IXGA 1JNFA 2VOZA 1FPKA 1LBZA 1OQHA 3UP9A 1MQIA 2I6EA 4KHZE 2FA7A 1R9QA 3FJ7A 3G3HA 3KOSA 4MIJA 5I56A 1B7HA 4HE0A 2F5XA 4POXA 3MSTA 4IO4A 3A09A 3C33A 3O6GA 3TZAA 4UACA 4I3EA 3VVFA 2QMWA 1GR2A 2WX9A 4X04A 1DPEA 5FBPA 3KJ7A 1K9ZA 2VPOA 1IMCA 3N6UA 3RPLA 1WODA 3MWBA 4K3FA 4HCWA 1XS5A 2HCAA 1JEUA 4BLAA 4OFOA 3LSXA 1Q9DA 2NOOA 2B3BA 1JVXA 2QVVA 1JP4A 3OELA 1F9BA 4PE3A 4R2FA 3ODBA 1B58A 1FCKA 4DLDA 1B3LA 3FGSA 4GXSB 2DWAA 1B51A 3H03A 4H45A 2W7YA 1FBPA 5JK4A 2FBPA 1QUKA 4H46A 4ZEFA 3U94A 2B3FA 3IOWA 3MZ9A 3CFXA 2HAUA 2XWOA 4KXPA 2Q8MA 3Q26A 2I0BA 2OX3A 4OVQA 3OSQA 2UVHA 4R73A 3IR1A 2ZZWA 3H06B 2PT2A 1SYIA 5I58A 3PPQA 3FZVA 1FQBA 2F3DA 4QFLA 3IJXB 1PDAA 1OVTA 4ZE9A 2F36A 1GVCA 4F39A 1G0HA 4RY1A 1LBCA 4GWSA 1DMBA 4N15A 4MLQA 1IMBA 1LBXA 4PCDA 4OHNA 3NOHA 1B4ZA 4DXBA 3KZGA 1RDXA 3TEPA 2ZNSA 3LV0A 4L17A 2F8DA 4WEDA 2O68A 5DVJA 1VSOA 4NMYA 4LONB 1B1XA 4OFJA 4LZ5A 4PQJA 3MP8A 2Q2AA 3OENA 5K2YA 1FPEA 3C31A 4NN3A 4QSDA 2RKMA 2CZIA 4NE4A 5J16A 1FBFA 5IGAA 4NX1A 4QBAA 1FPFA 3OO9A 5H8FA 5IZZA 2Y5KA 1M5EA 1VDWA 3BIHA 3HO7A 3PUZE 5JTYB 4N17A 1R6ZA 3SETA 4YMBA 2DXRA 3FXBA 1TFAA 5CC2A 2P2AA 3W9WA 2F6PA 4H5GA 3G3KA 4EQ7A 4C0RA 1MY3A 3FD3A 3RPLB 1POTA 3MP1A 5I2KB 5I59A 2AL5A 2XXWA 1UTBA 2ZNUA 1QW0A 1IXCA 3RYDA 3RTWB 4P56A 1FTMA 4DE8A 5DT6A 3OO6A 3KN8A 4EXLA 1MG1A 4QRZA 4F1VA 1Y1MA 2CMOA 3FXUA 4HS7A 3CSBA 3FXQA 1I6QA 2PYYA 4ZZEA 2OZZA 1LFIA 5DEXA 3U1OA 1Y3PA 2P1SA 2XWIA 3PUWE 2DSFA 1LGBC 1JW5A 1Q35A 1FPGA 5I3SA 1VR5A 3ZKKA 4GFRA 1ZMGA 1RKMA 1N7WA 1MPCA 2GFEA 4QHQA 5I58B 3K6XA 3USDA 4O7IA 4M4GA 3OEKA 2OJTA 2OLBA 4HE1A 3T96B 4GLIA 4PAIA 1NFTA 5H8QA 4C1UA 1DOTA 4DCYA 4ECFA 3SEVA 3TTMA 4YMAA 2FIEA 3JV9A 4GBWA 3OO7A 4GWUA 4OEUA 4I40A 5EYGA 4OETA 3TTRA 3CG3A 2ZMBA 4EDPA 1N04A 2AYSA 2O7IA 3M3FA 1A55A 4N81A 4U1ZA 1IQ7A 4GWZA 4G4PA 4ZEBA 1FW0A 2GQ1A 1B05A 3KSJA 4IY5A 1US5A 3N5LA 4KYSA 4HCYA 3LUYA 1INPA 4FEBA 1H76A 3U92A 5H8FB 2H25A 1CB6A 4Q30B 4YU0A 3KEIA 4U4XA 3IB2A 1NH7A 4N6PA 3QK6A 3K1NA 4ZZAA 3C4MA 3D1RA 5FHNA 5DTBA 2XXKA 1QVSA 3O66A 2VPNA 2I58A 4F22A 3KN7A 4JVCA 1MY0A 4H67A 1PC3A 5ET6A 2DVCA 1DSNA 3K1MA 4LQ5A 2ANJA 4MF3A 4HTGA 5I59B 3DLNA 3TKDA 1UTBB 2UYFA 5CMCA 3Q29A 4DZ1A 2O69A 3PGFA 2DWHA 3E9XA 2AL4A 4R9FA 2Q74A 5FTIA 4LP2B 4KQPA 1RYXA 3LR1A 1AL3A 3KJTA 3TAJA 2GHBA 1MY2A 5DEXB 3PMWA 5IM2A 4QFKA 4R6KA 4R74A 4MCOA 5J1DA 1URDA 2HXRA 4YB7A 3I3VA 3ZS6A 4F3SA 3SERA 1NV2A 2GH9A 2I49A 1A54A 4X48A 4PFWA 2Y7RA 1O7TA 1MM6A 5EHMA 1LBWA 2ESNA 4OVSA 1S50A 4TLMB 1DPPA 1B1HA 4MLVA 1IUDA 4GX4A 2PX1A 2PBWA 1BK4A 1MXZA 5H8QB 1T0KA 4MNIA 1USYH 3H6WA 1MM7A 2D5WA 4JBZA 3U65A 4IO3A 5I84A 4O94A 1NUZA 4KFQA 4ZEKA 5TPAA 2DE2A 1LAXA 1TFDA 2Z22A 3MZBA 1WDNA 2XWVA 4IO2A 3SZPA 5CMBA 3TCGA 4ZE8A 4EQBA 4P47A 2XX9A 2I48A 1B32A 2QPQA 3ILUB 3MPLA 3TMGA 4GD5A 4I1DA 3T93B 4IGTA 2OCUA 3IAZA 4EUOA 3R6UA 5I7IA 1P1UA 1EZOA 1H45A 5FTHA 2HZLA 3G3JA 1NV5A 3HSTA 1JEVA 4F3GA 3S9LC 4ND9A 1LEVA 2DYXA 3E3KA 3EHTA 3RNNA 3IJOB 5ISUA 4KYDA 1USYE 5H8NB 2XXIA 2QFLA 4XXUA 2WBBA 3MZ1A 1BLFA 1PEBA 1MQHA 4H5FA 3B7DA 4ZDMA 3FBPA 2UVIA 3OD7A 2OK2A 3OXNA 4UA8A 2Y84A 4KYEA 3TUSA 2PFYA 2XXXA 4G8NA 2V4CA 1VFEA 1DBZA 4G61A 1QKAA 2OWZA 5TP9A 3PUYE 3K1PA 1I69A 3IL1B 5ET8A 4P1LA 1NV0A 1LB9A 3KC0A 2ZYOA 4LQ2A 3OEMA 1B2HA 5HM4B 1NV3A 4PETA 1IMEA 1R9LA 2F34A 4LN5A 4LA9A 1SBPA 1EZPA 5I2NA 5A5XA 3EKIA 1NV1A 4BDNA 4ELOA 1N7XA 1IMAA 2Y7IA 4AQ4A 5EHSA 4ELQA 2X7QA 1ANFA 5M2VA 2F7CA 4G77A 4N13A 3ZKLA 4BDOA 4U1OA 2F6GA 1FQAA 1ZIUA 2G93A 2YPNA 2VP1A 3LSFB 5EQAA 2WKYA 4P8BA 2QSXA 1NNTA 2XA5A 3FVGA 3F11A 2BJJX 3UA8A 3BFTA 1MH3A 2AIXA 5TPAB 2A5TA 3A3CA 4N6DA 4F3PA 2HEUA 4XKQA 2IA4A 3QAXA 1BTJA 3LC8A 1IITA 2GRVA 1R1NA 4NAPA 3TTKA 4R6HA 1FTOA 5JEIA 4OQOA 1FTLA 2VGQA 1QUIA 4IB2A 3UK4A 4KI0E 5K2XA 3C34A 3K00A 4NEDA 4X8RA 2A5SA 5F1QA 3LBSA 4LATA 3P7IA 3QSLA 4KR5A 2E0SA 2ZYKA 1B3HA 4BDQA 4GBVA 1EU8A 1P1OA 3VXBA 2PVUA 4OVTA 1Z7ME 2DWJA 2XXYA 3HCQA 4PF8A 4MBPA 1Y4CA 1P1QA 2FVZA 3EN3A 2PMSA 3JZJA 1NUXA 1Y4TA 3ONMA 4MJOA 1XOCA 2BJIA 1FBGA 4P0GA 3MVXA 3C9HA 4NG7A 2FNCA 3MJNA 2O84X 3HHFA 3TTNA 3VDFA 2R8TA 1TXFA 4NGUA 4AB5A 4XKNA 1KZ8A 1XHYA 3FIRA 2B65A 1CNQA 5I2NB 2GHAA 3AXFA 2XHDA 5A5XB 2ZZXA 3QXMA 3SESA 2HHMA 4GL0A 5L9MA 1LLSA 4JVDA 3TELA 3FV2A 3FASA 4MH5A 3DP4A 4MHFA 1OMPA 1MRPA 3GYYA 3MC2A 1B5HA 3PPRA 3KBZA 2RC9A 5I56B 1UIVA 5DW8A 3HHGA 1FPDA 3VVEA 1I6BA 2H5YA 2F78A 1NL5A 1LSTA 5L9SA 1URSA 2YJPA 4GX3A 2ONSA
chains in the Genus database with same CATH topology
3HPIA 3HV1A 3E13X 4NTLA 3M8UA 4PP0A 2Z8EA 3V89B 3WAFA 2NVUB 3FVOA 1AH5A 1P1WA 3C32A 4ZEDA 3OO8A 1MDP1 4DXUA 2ONRA 2RC8A 3IK6B 1HSJA 1SD3A 3PUXE 3N6TA 1OLCA 4AB6A 5IAIA 1Y3QA 2Q88A 2UVJA 3EHUA 4ELRA 1B6HA 4N07A 4EF2A 4DDDA 3TYHA 1O63A 1PBPA 5KCJA 1D9VA 3QIMA 2Z8DA 1M5CA 4G68A 3CFZA 3K6VA 4H6DA 1M5DA 1SQYA 3V5AA 2D21A 3M3KA 3SKPA 3QUJA 1URGA 3MAMA 1UIUA 1B3EA 1SI1A 3MQ9A 2XXRA 1B40A 1LAGE 1XVXA 3KG2A 1VE4A 4TLLB 3D4GA 1QKBA 4ESXA 1OIBA 2HFBA 1H43A 2HXWA 4XIGQ 3IOUA 4ISUA 1SW2A 4YZZA 3W15C 2DWIA 3UIFA 3IB0A 5CM6A 4NF8A 4GF8A 3O97A 2Y7WA 2NXOA 1B46A 1Q1KA 4MFIA 3PU5A 3CI8A 4F18A 2I3WA 5AA2A 1HSEA 3G3IA 4F2QA 1SDXA 2O51A 2HQ0A 2V3QA 1RYOA 1AIVA 4NF6A 2Y7KA 5AA2D 3KBRA 3PPPA 1P1NA 3PD9A 4YB6A 3N26A 1Y20A 3MVYA 4R72A 2ABHA 3RUMA 4LZ7A 3FVKA 4QSEA 1SW4A 3QUFA 4GL8A 1FTKA 3A3UA 4BDLA 3E4RA 4QSCA 3TCFA 4X9TA 1Y9UA 3MBPA 2F7BA 1B0HA 3OSRA 1BIYA 1IXIA 5ITPA 1ELJA 1POY1 1B52A 3VVDA 2F97A 3PPOA 4RNSA 5KCJB 4YICA 4LZ8A 4Z0IA 4EF1A 4DIGA 2XD2A 3PMXA 3TTLA 2VHAA 2D3IA 3TQWA 4EXKA 4EQ9A 1LAHE 5CMMA 1LCFA 4F1YA 3MVWA 3T9VA 4M1VA 1N76A 2Q9TA 1LFHA 3FXRA 1SI0A 1LCTA 3SEWA 1MY1A 3IO4A 2OWSA 1H44A 3VXCA 3MP6A 4FEDA 1A8EA 1Y1ZA 3MVZA 3DP6A 1MPDA 1NKXA 2XXQA 4NF8B 2QS4A 4R9GA 2RF1A 4PFTA 1MXWA 1QJMA 4NF4A 4U21A 4Z7EA 5CBSA 4OEVA 4RPNA 4OMBA 3LSLA 5AA2B 3K0VA 3IO6A 3G3GA 4R6YA 4RJZA 2XD3A 2ZYMA 4GRKA 4NF6B 4R75A 2ALUA 1ZBMA 3EQ1A 3K6WA 4JWOA 3GBBA 3PV0E 2HAVA 2ZYNA 1FQFA 1PB9A 2QJEA 1GV8A 3T66A 1MXYA 3G7WA 1SYHA 3KSXA 1MQDA 5LOMA 3CRBA 4ZEIA 5AA1A 1B7UA 3RT6B 3L6HA 3BBRA 3I5OA 4NWDA 2DS9A 3U93A 5AA3A 4ZECA 1KWHA 1IEJA 5ELVA 4HW8A 4U22A 1M5FA 2RC7A 1UTHA 1FTJA 1JETA 4U2RA 1TWYA 2Q8JA 4GVOA 1SVXB 1DTZA 3K01A 2I4BA 1Z7NE 4H0WA 3RN8A 1NNKA 5I57A 1J1NA 1ZU0A 4OENA 1ZLQA 3RPWA 4G8HA 4ESWA 3PMVA 4H8JA 4YKJA 4ELPA 2X7PA 4IO6A 2QMXA 3RQTA 2CZLA 1NMUA 2XX8A 3JYRA 4FORA 1OLAA 3CFLA 4GIZA 5JTYA 2R9JA 2I4CA 4I8CA 3K4UA 4DXCA 3M3LA 5HBCA 4XTCQ 4F2OA 4JB7A 2VD3A 4NF4B 4JDFA 5CBRA 3MW0A 1D4NA 3EF7A 1OQGA 5I2KA 5KDTA 1H3DA 4P11A 5DYHA 1XC1A 3KN3A 5ITOA 4KCDA 1S7YA 3R26A 4F19A 4OFLA 1FQCA 3EHSA 4JWXA 1S9TA 3K02A 1LFGA 1B4HA 1M5BA 3HN0A 1YCJA 4RXLA 2XXUA 2Z8FA 3O29A 5TP9B 2XXTA 1NH8A 4JSOA 1ATGA 1A8FA 1DTGA 1PBQA 3CVGA 4RK9A 3T9XB 5ICQA 2Q2CA 4U4SA 1B0LA 4ONYA 2R71A 2QS1A 2PT1A 5B70A 4PE5B 2ZXTA 4OESA 3WAEA 5L8DA 3H6UA 5DVFA 4H65A 2G29A 1MH4A 4OXVA 1ZKBA 2H98A 3T9HB 2DQVA 2XXVA 3BKIB 2NWJA 1A7LA 3FV1A 1PB7A 1UTHB 1N3WA 1MXUA 3D4CA 2H4IA 1IXHA 3CG1A 4FJPA 1MQJA 1JW1A 2DVZA 2REGA 4QF9A 5I57B 5KZTA 4O3CA 5DVIA 4JWYA 2XX7A 1AMFA 3SDFA 4RA1A 3KOTA 4IY6A 1UQWA 3ILTB 2A5TB 1EZ9A 1FQEA 4GOTA 5F7VA 3H3GA 2P0SA 4Q8RA 2F7AA 3TQLA 2KLFA 4TOZA 3UN6A 4ZS9A 5FHMA 4F1UA 4GWOA 3KGCA 1QULA 4JXIA 4FIMA 1II5A 1QUJA 3TPAA 3OOAA 4G8MA 3C35A 4YKKA 5KDTB 1XT8A 5BUUA 3B6TA 4PFYA 4WEPA 1N0TA 2I3VA 5AA4A 3UORA 1VFDA 3DP8A 2Q89A 5EYFA 4YKIA 4F3BA 3K6UA 2UYEA 3RGYA 4GQOA 3S4UA 3BFUA 1B9JA 4THIA 1P99A 3IX1A 1AOVA 4H8IA 3QYTA 2E1SA 3FUZA 5CMKA 3IB1A 4I9DA 2QS2A 2XXHA 2H99A 4E0XA 3GBAA 4FAJA 5FHOA 3T9UA 5H8HA 3L6GA 3UGWA 1ZTYA 1SW5A 3Q25A 1Y3NA 3IOVA 3O6HA 4X1BA 4FECA 1OVBA 2O1MA 4BDMA 1FQDA 4RPOA 4P0IA 4XKRA 3C36A 1L5TA 3VLVA 5AE4A 1LBBA 4POWA 3O28A 2V3TA 2VD2A 2O6AA 3FVNA 4RYAA 3CSGA 4BDRA 3H4ZA 2YLNA 1GGGA 3U72A 2V93A 3SEYA 1YAEA 4OVJA 5BWJA 5TU0A 3O2AA 3GXAA 2THIA 4OTEA 3G3FA 3K2DA 5H8NA 4TQUQ 2DE4A 3S9EA 3Q28A 2ONKE 4I62A 3IOTA 4KCCA 5H8SA 3PD8A 4U23A 3RLFE 1D9YA 4QFPA 4WXJA 1JVYA 4H1XA 3V83A 2FYIA 4X1DA 5HPQA 1LB8A 3VLUA 2LAOA 4F31B 4YAHX 4LUBA 1D3KA 3TFLA 5ICTA 2HZKA 3RT8A 3S2VA 5AA4B 3S9MC 4O3AA 1MDQA 3GZGA 3S9NC 4NF5A 3TCHA 2R6GE 3VLWA 1MS7A 1NNFA 1N84A 2DE3A 4OZ9A 3R7XA 3H6TA 2QRYA 1YTVA 3O9PA 5L9OA 1MXXA 4G68B 5H8HB 2O1LA 3PPNA 4PFUA 5CI5A 3VFJA 3VV5A 2M8CA 1IIWA 1YPNA 4OYVA 3O6IA 2DOJA 3EPEA 4JSDA 4DCXA 4Q5TA 1N3XA 3GLBA 4NWCA 2H9BA 4KD5A 3TDJA 4WKMA 3PUVE 3Q27A 3W9VA 2RINA 2OWTA 3RTFB 2UXAA 1B5JA 4OERA 2X26A 1NNPA 2DXYA 1BKAA 2OBGA 2Y7PA 3FJMA 3RY3A 3DELB 3KFMA 4G68C 1HSLA 3N94A 2REJA 1JW4A 3ZSFA 4FE8A 4IGRA 4RK2A 4F29A 3T22A 2RCBA 1MPBA 1B7ZA 4R2BA 4Q0CA 4G2ZA 2QL3A 4C1TA 3SEUA 1PB8A 1US4A 1IZ1A 1A99A 3V8XB 2F35A 3H6VA 3I6VA 1MY4A 4E0WA 1SW1A 1WVJA 2Z23A 4O3BA 1EH3A 1LAFE 4LVQA 1BP5A 3FJGA 3IORA 4FATA 2UVGA 3CIJA 4KPTA 4YKPA 2NUVA 3THIA 3TODA 4QFOA 3B6WA 3FATA 1GTKA 4OWDA 4IO5A 1I6AA 3B6QA 1A40A 1B3GA 1ZJLA 2O7UA 4NF5B 2XXPA 1MXVA 2RCAA 1B3FA 1B5IA 5B7DA 3SEXA 1MQGA 3DM0A 2V25A 3ECRA 4YB5A 2DP8A 1XVYA 2V3UA 1CE2A 2ZNTA 3OMBA 2IEEA 4IO7A 2V84A 4GXAA 3LSWA 3MUQA 3H7MA 3VE1B 5CRYA 2QS3A 1JQFA 3MPKA 1O64A 4QFNA 3U8QA 3CR9A 5IKBA 4XKPA 2I0CA 1TT1A 1IXGA 1JNFA 2VOZA 1OQHA 3UP9A 1MQIA 2I6EA 4KHZE 2FA7A 1R9QA 3FJ7A 3G3HA 3KOSA 5I56A 1B7HA 2F5XA 4POXA 4IO4A 3A09A 3C33A 3O6GA 3TZAA 4UACA 3VVFA 2QMWA 1GR2A 1DPEA 3KJ7A 3N6UA 1WODA 3MWBA 4K3FA 4HCWA 1XS5A 2HCAA 1JEUA 4BLAA 4OFOA 3LSXA 2NOOA 2B3BA 1JVXA 3OELA 1F9BA 4R2FA 3ODBA 1B58A 1FCKA 4DLDA 1B3LA 3FGSA 4GXSB 2DWAA 1B51A 3H03A 2W7YA 5JK4A 1QUKA 4ZEFA 3U94A 2B3FA 3IOWA 3MZ9A 3CFXA 2HAUA 3Q26A 2I0BA 3OSQA 2UVHA 4R73A 3IR1A 3H06B 2PT2A 1SYIA 5I58A 3PPQA 3FZVA 1FQBA 4QFLA 3IJXB 1PDAA 1OVTA 4ZE9A 2F36A 1GVCA 4F39A 4RY1A 1LBCA 1DMBA 4MLQA 4OHNA 1B4ZA 4DXBA 3KZGA 3TEPA 2ZNSA 4L17A 2F8DA 4WEDA 2O68A 5DVJA 1VSOA 4NMYA 4LONB 1B1XA 4OFJA 4LZ5A 4PQJA 3MP8A 2Q2AA 3OENA 5K2YA 3C31A 4QSDA 2RKMA 4NE4A 3OO9A 5H8FA 1M5EA 3HO7A 3PUZE 5JTYB 1R6ZA 3SETA 4YMBA 2DXRA 1TFAA 5CC2A 2P2AA 3W9WA 2F6PA 4H5GA 3G3KA 4EQ7A 4C0RA 1MY3A 3FD3A 1POTA 3MP1A 5I2KB 5I59A 2AL5A 2XXWA 1UTBA 2ZNUA 1QW0A 1IXCA 3RTWB 1FTMA 4DE8A 5DT6A 3OO6A 3KN8A 4EXLA 1MG1A 4QRZA 4F1VA 1Y1MA 2CMOA 3FXUA 4HS7A 3CSBA 3FXQA 1I6QA 2PYYA 4ZZEA 2OZZA 1LFIA 5DEXA 3U1OA 1Y3PA 2P1SA 3PUWE 2DSFA 1LGBC 1JW5A 1Q35A 1VR5A 3ZKKA 4GFRA 1ZMGA 1RKMA 1N7WA 1MPCA 2GFEA 4QHQA 5I58B 3K6XA 3USDA 4M4GA 3OEKA 2OJTA 2OLBA 3T96B 4GLIA 5H8QA 1NFTA 4C1UA 1DOTA 4DCYA 4ECFA 3SEVA 3TTMA 4YMAA 3JV9A 3OO7A 4OEUA 4OETA 3TTRA 3CG3A 2ZMBA 4EDPA 1N04A 2AYSA 2O7IA 3M3FA 1A55A 4U1ZA 1IQ7A 4G4PA 4ZEBA 1FW0A 3KSJA 1B05A 4IY5A 1US5A 3N5LA 4KYSA 4HCYA 3LUYA 4FEBA 1H76A 3U92A 5H8FB 2H25A 1CB6A 4Q30B 4YU0A 3KEIA 4U4XA 3IB2A 1NH7A 4N6PA 3QK6A 3K1NA 4ZZAA 3C4MA 5FHNA 5DTBA 1QVSA 3O66A 2I58A 4F22A 3KN7A 1MY0A 4H67A 1PC3A 2DVCA 1DSNA 3K1MA 4LQ5A 2ANJA 4MF3A 4HTGA 5I59B 3DLNA 3TKDA 1UTBB 2UYFA 5CMCA 3Q29A 4DZ1A 2O69A 3PGFA 2DWHA 3E9XA 2AL4A 4R9FA 5FTIA 4LP2B 4KQPA 1RYXA 3LR1A 1AL3A 3KJTA 3TAJA 2GHBA 1MY2A 5DEXB 3PMWA 4QFKA 4R6KA 4R74A 5J1DA 1URDA 4YB7A 3I3VA 3ZS6A 4F3SA 3SERA 2GH9A 2I49A 1A54A 4X48A 4PFWA 2Y7RA 1O7TA 1MM6A 5EHMA 2ESNA 4TLMB 1S50A 1DPPA 1B1HA 4MLVA 1IUDA 2PX1A 2PBWA 1MXZA 5H8QB 1T0KA 1USYH 3H6WA 1MM7A 2D5WA 4JBZA 4IO3A 5I84A 4KFQA 4ZEKA 5TPAA 2DE2A 1LAXA 1TFDA 2Z22A 3MZBA 1WDNA 4IO2A 3TCGA 5CMBA 4EQBA 4ZE8A 2XX9A 2I48A 1B32A 2QPQA 3ILUB 3MPLA 3TMGA 4GD5A 3T93B 4I1DA 4IGTA 2OCUA 3IAZA 4EUOA 3R6UA 1P1UA 1EZOA 1H45A 5FTHA 2HZLA 3G3JA 3HSTA 1JEVA 4F3GA 3S9LC 4ND9A 2DYXA 3E3KA 3EHTA 3RNNA 3IJOB 5ISUA 4KYDA 1USYE 5H8NB 2XXIA 4XXUA 3MZ1A 1BLFA 1PEBA 1MQHA 4H5FA 3B7DA 4ZDMA 2UVIA 3OD7A 2OK2A 3OXNA 4UA8A 2Y84A 4KYEA 3TUSA 2XXXA 4G8NA 1VFEA 1QKAA 5TP9A 3PUYE 3K1PA 1I69A 3IL1B 1LB9A 2ZYOA 4LQ2A 3OEMA 1B2HA 5HM4B 4PETA 1R9LA 2F34A 4LA9A 1SBPA 1EZPA 5I2NA 5A5XA 4BDNA 4ELOA 1N7XA 2Y7IA 4AQ4A 5EHSA 4ELQA 2X7QA 1ANFA 5M2VA 2F7CA 4G77A 4N13A 3ZKLA 4BDOA 4U1OA 2F6GA 1FQAA 1ZIUA 2G93A 2YPNA 2VP1A 3LSFB 2WKYA 2QSXA 1NNTA 3FVGA 3F11A 2BJJX 3UA8A 3BFTA 1MH3A 2AIXA 5TPAB 2A5TA 3A3CA 4F3PA 2HEUA 4XKQA 2IA4A 3QAXA 1BTJA 3LC8A 1IITA 2GRVA 1R1NA 3TTKA 4R6HA 1FTOA 5JEIA 4OQOA 1FTLA 2VGQA 1QUIA 4IB2A 3UK4A 4KI0E 5K2XA 3C34A 3K00A 4NEDA 2A5SA 5F1QA 3LBSA 4LATA 3P7IA 3QSLA 4KR5A 2E0SA 2ZYKA 1B3HA 4BDQA 1EU8A 1P1OA 3VXBA 2PVUA 1Z7ME 2DWJA 2XXYA 3HCQA 4MBPA 1Y4CA 1P1QA 3EN3A 2PMSA 3JZJA 3ONMA 1Y4TA 1XOCA 4P0GA 3MVXA 3C9HA 2FNCA 3MJNA 2O84X 3HHFA 3TTNA 3VDFA 1TXFA 4AB5A 4XKNA 1XHYA 3FIRA 2B65A 5I2NB 2GHAA 3AXFA 2XHDA 5A5XB 3QXMA 3SESA 4GL0A 5L9MA 1LLSA 3TELA 3FV2A 3FASA 4MH5A 3DP4A 1OMPA 1MRPA 3MC2A 1B5HA 3PPRA 2RC9A 5I56B 1UIVA 3HHGA 3VVEA 1I6BA 2H5YA 2F78A 1NL5A 1LSTA 5L9SA 1URSA 2YJPA 2ONSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPI A;  3HV1 A;  3E13 X;  4NTL A;  3M8U A;  4PP0 A;  2Z8E A;  3V89 B;  3WAF A;  2NVU B;  3FVO A;  1AH5 A;  1P1W A;  3C32 A;  4ZED A;  3OO8 A;  1MDP 1;  4DXU A;  2ONR A;  2RC8 A;  3IK6 B;  1HSJ A;  1SD3 A;  3PUX E;  3N6T A;  1OLC A;  4AB6 A;  5IAI A;  1Y3Q A;  2Q88 A;  2UVJ A;  3EHU A;  4ELR A;  1B6H A;  4N07 A;  4EF2 A;  4DDD A;  3TYH A;  1O63 A;  1PBP A;  5KCJ A;  1D9V A;  3QIM A;  2Z8D A;  1M5C A;  4G68 A;  3CFZ A;  3K6V A;  4H6D A;  1M5D A;  1SQY A;  3V5A A;  2D21 A;  3M3K A;  3SKP A;  3QUJ A;  1URG A;  3MAM A;  1UIU A;  1B3E A;  1SI1 A;  3MQ9 A;  2XXR A;  1B40 A;  1LAG E;  1XVX A;  3KG2 A;  1VE4 A;  4TLL B;  3D4G A;  1QKB A;  4ESX A;  1OIB A;  2HFB A;  1H43 A;  2HXW A;  4XIG Q;  3IOU A;  4ISU A;  1SW2 A;  4YZZ A;  3W15 C;  2DWI A;  3UIF A;  3IB0 A;  5CM6 A;  4NF8 A;  4GF8 A;  3O97 A;  2Y7W A;  2NXO A;  1B46 A;  1Q1K A;  4MFI A;  3PU5 A;  3CI8 A;  4F18 A;  2I3W A;  5AA2 A;  1HSE A;  3G3I A;  4F2Q A;  1SDX A;  2O51 A;  2HQ0 A;  2V3Q A;  1RYO A;  1AIV A;  4NF6 A;  2Y7K A;  5AA2 D;  3KBR A;  3PPP A;  1P1N A;  3PD9 A;  4YB6 A;  3N26 A;  1Y20 A;  3MVY A;  4R72 A;  2ABH A;  3RUM A;  4LZ7 A;  3FVK A;  4QSE A;  1SW4 A;  3QUF A;  4GL8 A;  1FTK A;  3A3U A;  4BDL A;  3E4R A;  4QSC A;  3TCF A;  4X9T A;  1Y9U A;  3MBP A;  2F7B A;  1B0H A;  3OSR A;  1BIY A;  1IXI A;  5ITP A;  1ELJ A;  1POY 1;  1B52 A;  3VVD A;  2F97 A;  3PPO A;  4RNS A;  5KCJ B;  4YIC A;  4LZ8 A;  4Z0I A;  4EF1 A;  4DIG A;  2XD2 A;  3PMX A;  3TTL A;  2VHA A;  2D3I A;  3TQW A;  4EXK A;  4EQ9 A;  1LAH E;  5CMM A;  1LCF A;  4F1Y A;  3MVW A;  3T9V A;  4M1V A;  1N76 A;  2Q9T A;  1LFH A;  3FXR A;  1SI0 A;  1LCT A;  3SEW A;  1MY1 A;  3IO4 A;  2OWS A;  1H44 A;  3VXC A;  3MP6 A;  4FED A;  1A8E A;  1Y1Z A;  3MVZ A;  3DP6 A;  1MPD A;  1NKX A;  2XXQ A;  4NF8 B;  2QS4 A;  4R9G A;  2RF1 A;  4PFT A;  1MXW A;  1QJM A;  4NF4 A;  4U21 A;  4Z7E A;  5CBS A;  4OEV A;  4RPN A;  4OMB A;  3LSL A;  5AA2 B;  3K0V A;  3IO6 A;  3G3G A;  4R6Y A;  4RJZ A;  2XD3 A;  2ZYM A;  4GRK A;  4NF6 B;  4R75 A;  2ALU A;  1ZBM A;  3EQ1 A;  3K6W A;  4JWO A;  3GBB A;  3PV0 E;  2HAV A;  2ZYN A;  1FQF A;  1PB9 A;  2QJE A;  1GV8 A;  3T66 A;  1MXY A;  3G7W A;  1SYH A;  3KSX A;  1MQD A;  5LOM A;  3CRB A;  4ZEI A;  5AA1 A;  1B7U A;  3RT6 B;  3L6H A;  3BBR A;  3I5O A;  4NWD A;  2DS9 A;  3U93 A;  5AA3 A;  4ZEC A;  1KWH A;  1IEJ A;  5ELV A;  4HW8 A;  4U22 A;  1M5F A;  2RC7 A;  1UTH A;  1FTJ A;  1JET A;  4U2R A;  1TWY A;  2Q8J A;  4GVO A;  1SVX B;  1DTZ A;  3K01 A;  2I4B A;  1Z7N E;  4H0W A;  3RN8 A;  1NNK A;  5I57 A;  1J1N A;  1ZU0 A;  4OEN A;  1ZLQ A;  3RPW A;  4G8H A;  4ESW A;  3PMV A;  4H8J A;  4YKJ A;  4ELP A;  2X7P A;  4IO6 A;  2QMX A;  3RQT A;  2CZL A;  1NMU A;  2XX8 A;  3JYR A;  4FOR A;  1OLA A;  3CFL A;  4GIZ A;  5JTY A;  2R9J A;  2I4C A;  4I8C A;  3K4U A;  4DXC A;  3M3L A;  5HBC A;  4XTC Q;  4F2O A;  4JB7 A;  2VD3 A;  4NF4 B;  4JDF A;  5CBR A;  3MW0 A;  1D4N A;  3EF7 A;  1OQG A;  5I2K A;  5KDT A;  1H3D A;  4P11 A;  5DYH A;  1XC1 A;  3KN3 A;  5ITO A;  4KCD A;  1S7Y A;  3R26 A;  4F19 A;  4OFL A;  1FQC A;  3EHS A;  4JWX A;  1S9T A;  3K02 A;  1LFG A;  1B4H A;  1M5B A;  3HN0 A;  1YCJ A;  4RXL A;  2XXU A;  2Z8F A;  3O29 A;  5TP9 B;  2XXT A;  1NH8 A;  4JSO A;  1ATG A;  1A8F A;  1DTG A;  1PBQ A;  3CVG A;  4RK9 A;  3T9X B;  5ICQ A;  2Q2C A;  4U4S A;  1B0L A;  4ONY A;  2R71 A;  2QS1 A;  2PT1 A;  5B70 A;  4PE5 B;  2ZXT A;  4OES A;  3WAE A;  5L8D A;  3H6U A;  5DVF A;  4H65 A;  2G29 A;  1MH4 A;  4OXV A;  1ZKB A;  2H98 A;  3T9H B;  2DQV A;  2XXV A;  3BKI B;  2NWJ A;  1A7L A;  3FV1 A;  1PB7 A;  1UTH B;  1N3W A;  1MXU A;  3D4C A;  2H4I A;  1IXH A;  3CG1 A;  4FJP A;  1MQJ A;  1JW1 A;  2DVZ A;  2REG A;  4QF9 A;  5I57 B;  5KZT A;  4O3C A;  5DVI A;  4JWY A;  2XX7 A;  1AMF A;  3SDF A;  4RA1 A;  3KOT A;  4IY6 A;  1UQW A;  3ILT B;  2A5T B;  1EZ9 A;  1FQE A;  4GOT A;  5F7V A;  3H3G A;  2P0S A;  4Q8R A;  2F7A A;  3TQL A;  2KLF A;  4TOZ A;  3UN6 A;  4ZS9 A;  5FHM A;  4F1U A;  4GWO A;  3KGC A;  1QUL A;  4JXI A;  4FIM A;  1II5 A;  1QUJ A;  3TPA A;  3OOA A;  4G8M A;  3C35 A;  4YKK A;  5KDT B;  1XT8 A;  5BUU A;  3B6T A;  4PFY A;  4WEP A;  1N0T A;  2I3V A;  5AA4 A;  3UOR A;  1VFD A;  3DP8 A;  2Q89 A;  5EYF A;  4YKI A;  4F3B A;  3K6U A;  2UYE A;  3RGY A;  4GQO A;  3S4U A;  3BFU A;  1B9J A;  4THI A;  1P99 A;  3IX1 A;  1AOV A;  4H8I A;  3QYT A;  2E1S A;  3FUZ A;  5CMK A;  3IB1 A;  4I9D A;  2QS2 A;  2XXH A;  2H99 A;  4E0X A;  3GBA A;  4FAJ A;  5FHO A;  3T9U A;  5H8H A;  3L6G A;  3UGW A;  1ZTY A;  1SW5 A;  3Q25 A;  1Y3N A;  3IOV A;  3O6H A;  4X1B A;  4FEC A;  1OVB A;  2O1M A;  4BDM A;  1FQD A;  4RPO A;  4P0I A;  4XKR A;  3C36 A;  1L5T A;  3VLV A;  5AE4 A;  1LBB A;  4POW A;  3O28 A;  2V3T A;  2VD2 A;  2O6A A;  3FVN A;  4RYA A;  3CSG A;  4BDR A;  3H4Z A;  2YLN A;  1GGG A;  3U72 A;  2V93 A;  3SEY A;  1YAE A;  4OVJ A;  5BWJ A;  5TU0 A;  3O2A A;  3GXA A;  2THI A;  4OTE A;  3G3F A;  3K2D A;  5H8N A;  4TQU Q;  2DE4 A;  3S9E A;  3Q28 A;  2ONK E;  4I62 A;  3IOT A;  4KCC A;  5H8S A;  3PD8 A;  4U23 A;  3RLF E;  1D9Y A;  4QFP A;  4WXJ A;  1JVY A;  4H1X A;  3V83 A;  2FYI A;  4X1D A;  5HPQ A;  1LB8 A;  3VLU A;  2LAO A;  4F31 B;  4YAH X;  4LUB A;  1D3K A;  3TFL A;  5ICT A;  2HZK A;  3RT8 A;  3S2V A;  5AA4 B;  3S9M C;  4O3A A;  1MDQ A;  3GZG A;  3S9N C;  4NF5 A;  3TCH A;  2R6G E;  3VLW A;  1MS7 A;  1NNF A;  1N84 A;  2DE3 A;  4OZ9 A;  3R7X A;  3H6T A;  2QRY A;  1YTV A;  3O9P A;  5L9O A;  1MXX A;  4G68 B;  5H8H B;  2O1L A;  3PPN A;  4PFU A;  5CI5 A;  3VFJ A;  3VV5 A;  2M8C A;  1IIW A;  1YPN A;  4OYV A;  3O6I A;  2DOJ A;  3EPE A;  4JSD A;  4DCX A;  4Q5T A;  1N3X A;  3GLB A;  4NWC A;  2H9B A;  4KD5 A;  3TDJ A;  4WKM A;  3PUV E;  3Q27 A;  3W9V A;  2RIN A;  2OWT A;  3RTF B;  2UXA A;  1B5J A;  4OER A;  2X26 A;  1NNP A;  2DXY A;  1BKA A;  2OBG A;  2Y7P A;  3FJM A;  3RY3 A;  3DEL B;  3KFM A;  4G68 C;  1HSL A;  3N94 A;  2REJ A;  1JW4 A;  3ZSF A;  4FE8 A;  4IGR A;  4RK2 A;  4F29 A;  3T22 A;  2RCB A;  1MPB A;  1B7Z A;  4R2B A;  4Q0C A;  4G2Z A;  2QL3 A;  4C1T A;  3SEU A;  1PB8 A;  1US4 A;  1IZ1 A;  1A99 A;  3V8X B;  2F35 A;  3H6V A;  3I6V A;  1MY4 A;  4E0W A;  1SW1 A;  1WVJ A;  2Z23 A;  4O3B A;  1EH3 A;  1LAF E;  4LVQ A;  1BP5 A;  3FJG A;  3IOR A;  4FAT A;  2UVG A;  3CIJ A;  4KPT A;  4YKP A;  2NUV A;  3THI A;  3TOD A;  4QFO A;  3B6W A;  3FAT A;  1GTK A;  4OWD A;  4IO5 A;  1I6A A;  3B6Q A;  1A40 A;  1B3G A;  1ZJL A;  2O7U A;  4NF5 B;  2XXP A;  1MXV A;  2RCA A;  1B3F A;  1B5I A;  5B7D A;  3SEX A;  1MQG A;  3DM0 A;  2V25 A;  3ECR A;  4YB5 A;  2DP8 A;  1XVY A;  2V3U A;  1CE2 A;  2ZNT A;  3OMB A;  2IEE A;  4IO7 A;  2V84 A;  4GXA A;  3LSW A;  3MUQ A;  3H7M A;  3VE1 B;  5CRY A;  2QS3 A;  1JQF A;  3MPK A;  1O64 A;  4QFN A;  3U8Q A;  3CR9 A;  5IKB A;  4XKP A;  2I0C A;  1TT1 A;  1IXG A;  1JNF A;  2VOZ A;  1OQH A;  3UP9 A;  1MQI A;  2I6E A;  4KHZ E;  2FA7 A;  1R9Q A;  3FJ7 A;  3G3H A;  3KOS A;  5I56 A;  1B7H A;  2F5X A;  4POX A;  4IO4 A;  3A09 A;  3C33 A;  3O6G A;  3TZA A;  4UAC A;  3VVF A;  2QMW A;  1GR2 A;  1DPE A;  3KJ7 A;  3N6U A;  1WOD A;  3MWB A;  4K3F A;  4HCW A;  1XS5 A;  2HCA A;  1JEU A;  4BLA A;  4OFO A;  3LSX A;  2NOO A;  2B3B A;  1JVX A;  3OEL A;  1F9B A;  4R2F A;  3ODB A;  1B58 A;  1FCK A;  4DLD A;  1B3L A;  3FGS A;  4GXS B;  2DWA A;  1B51 A;  3H03 A;  2W7Y A;  5JK4 A;  1QUK A;  4ZEF A;  3U94 A;  2B3F A;  3IOW A;  3MZ9 A;  3CFX A;  2HAU A;  3Q26 A;  2I0B A;  3OSQ A;  2UVH A;  4R73 A;  3IR1 A;  3H06 B;  2PT2 A;  1SYI A;  5I58 A;  3PPQ A;  3FZV A;  1FQB A;  4QFL A;  3IJX B;  1PDA A;  1OVT A;  4ZE9 A;  2F36 A;  1GVC A;  4F39 A;  4RY1 A;  1LBC A;  1DMB A;  4MLQ A;  4OHN A;  1B4Z A;  4DXB A;  3KZG A;  3TEP A;  2ZNS A;  4L17 A;  2F8D A;  4WED A;  2O68 A;  5DVJ A;  1VSO A;  4NMY A;  4LON B;  1B1X A;  4OFJ A;  4LZ5 A;  4PQJ A;  3MP8 A;  2Q2A A;  3OEN A;  5K2Y A;  3C31 A;  4QSD A;  2RKM A;  4NE4 A;  3OO9 A;  5H8F A;  1M5E A;  3HO7 A;  3PUZ E;  5JTY B;  1R6Z A;  3SET A;  4YMB A;  2DXR A;  1TFA A;  5CC2 A;  2P2A A;  3W9W A;  2F6P A;  4H5G A;  3G3K A;  4EQ7 A;  4C0R A;  1MY3 A;  3FD3 A;  1POT A;  3MP1 A;  5I2K B;  5I59 A;  2AL5 A;  2XXW A;  1UTB A;  2ZNU A;  1QW0 A;  1IXC A;  3RTW B;  1FTM A;  4DE8 A;  5DT6 A;  3OO6 A;  3KN8 A;  4EXL A;  1MG1 A;  4QRZ A;  4F1V A;  1Y1M A;  2CMO A;  3FXU A;  4HS7 A;  3CSB A;  3FXQ A;  1I6Q A;  2PYY A;  4ZZE A;  2OZZ A;  1LFI A;  5DEX A;  3U1O A;  1Y3P A;  2P1S A;  3PUW E;  2DSF A;  1LGB C;  1JW5 A;  1Q35 A;  1VR5 A;  3ZKK A;  4GFR A;  1ZMG A;  1RKM A;  1N7W A;  1MPC A;  2GFE A;  4QHQ A;  5I58 B;  3K6X A;  3USD A;  4M4G A;  3OEK A;  2OJT A;  2OLB A;  3T96 B;  4GLI A;  5H8Q A;  1NFT A;  4C1U A;  1DOT A;  4DCY A;  4ECF A;  3SEV A;  3TTM A;  4YMA A;  3JV9 A;  3OO7 A;  4OEU A;  4OET A;  3TTR A;  3CG3 A;  2ZMB A;  4EDP A;  1N04 A;  2AYS A;  2O7I A;  3M3F A;  1A55 A;  4U1Z A;  1IQ7 A;  4G4P A;  4ZEB A;  1FW0 A;  3KSJ A;  1B05 A;  4IY5 A;  1US5 A;  3N5L A;  4KYS A;  4HCY A;  3LUY A;  4FEB A;  1H76 A;  3U92 A;  5H8F B;  2H25 A;  1CB6 A;  4Q30 B;  4YU0 A;  3KEI A;  4U4X A;  3IB2 A;  1NH7 A;  4N6P A;  3QK6 A;  3K1N A;  4ZZA A;  3C4M A;  5FHN A;  5DTB A;  1QVS A;  3O66 A;  2I58 A;  4F22 A;  3KN7 A;  1MY0 A;  4H67 A;  1PC3 A;  2DVC A;  1DSN A;  3K1M A;  4LQ5 A;  2ANJ A;  4MF3 A;  4HTG A;  5I59 B;  3DLN A;  3TKD A;  1UTB B;  2UYF A;  5CMC A;  3Q29 A;  4DZ1 A;  2O69 A;  3PGF A;  2DWH A;  3E9X A;  2AL4 A;  4R9F A;  5FTI A;  4LP2 B;  4KQP A;  1RYX A;  3LR1 A;  1AL3 A;  3KJT A;  3TAJ A;  2GHB A;  1MY2 A;  5DEX B;  3PMW A;  4QFK A;  4R6K A;  4R74 A;  5J1D A;  1URD A;  4YB7 A;  3I3V A;  3ZS6 A;  4F3S A;  3SER A;  2GH9 A;  2I49 A;  1A54 A;  4X48 A;  4PFW A;  2Y7R A;  1O7T A;  1MM6 A;  5EHM A;  2ESN A;  4TLM B;  1S50 A;  1DPP A;  1B1H A;  4MLV A;  1IUD A;  2PX1 A;  2PBW A;  1MXZ A;  5H8Q B;  1T0K A;  1USY H;  3H6W A;  1MM7 A;  2D5W A;  4JBZ A;  4IO3 A;  5I84 A;  4KFQ A;  4ZEK A;  5TPA A;  2DE2 A;  1LAX A;  1TFD A;  2Z22 A;  3MZB A;  1WDN A;  4IO2 A;  3TCG A;  5CMB A;  4EQB A;  4ZE8 A;  2XX9 A;  2I48 A;  1B32 A;  2QPQ A;  3ILU B;  3MPL A;  3TMG A;  4GD5 A;  3T93 B;  4I1D A;  4IGT A;  2OCU A;  3IAZ A;  4EUO A;  3R6U A;  1P1U A;  1EZO A;  1H45 A;  5FTH A;  2HZL A;  3G3J A;  3HST A;  1JEV A;  4F3G A;  3S9L C;  4ND9 A;  2DYX A;  3E3K A;  3EHT A;  3RNN A;  3IJO B;  5ISU A;  4KYD A;  1USY E;  5H8N B;  2XXI A;  4XXU A;  3MZ1 A;  1BLF A;  1PEB A;  1MQH A;  4H5F A;  3B7D A;  4ZDM A;  2UVI A;  3OD7 A;  2OK2 A;  3OXN A;  4UA8 A;  2Y84 A;  4KYE A;  3TUS A;  2XXX A;  4G8N A;  1VFE A;  1QKA A;  5TP9 A;  3PUY E;  3K1P A;  1I69 A;  3IL1 B;  1LB9 A;  2ZYO A;  4LQ2 A;  3OEM A;  1B2H A;  5HM4 B;  4PET A;  1R9L A;  2F34 A;  4LA9 A;  1SBP A;  1EZP A;  5I2N A;  5A5X A;  4BDN A;  4ELO A;  1N7X A;  2Y7I A;  4AQ4 A;  5EHS A;  4ELQ A;  2X7Q A;  1ANF A;  5M2V A;  2F7C A;  4G77 A;  4N13 A;  3ZKL A;  4BDO A;  4U1O A;  2F6G A;  1FQA A;  1ZIU A;  2G93 A;  2YPN A;  2VP1 A;  3LSF B;  2WKY A;  2QSX A;  1NNT A;  3FVG A;  3F11 A;  2BJJ X;  3UA8 A;  3BFT A;  1MH3 A;  2AIX A;  5TPA B;  2A5T A;  3A3C A;  4F3P A;  2HEU A;  4XKQ A;  2IA4 A;  3QAX A;  1BTJ A;  3LC8 A;  1IIT A;  2GRV A;  1R1N A;  3TTK A;  4R6H A;  1FTO A;  5JEI A;  4OQO A;  1FTL A;  2VGQ A;  1QUI A;  4IB2 A;  3UK4 A;  4KI0 E;  5K2X A;  3C34 A;  3K00 A;  4NED A;  2A5S A;  5F1Q A;  3LBS A;  4LAT A;  3P7I A;  3QSL A;  4KR5 A;  2E0S A;  2ZYK A;  1B3H A;  4BDQ A;  1EU8 A;  1P1O A;  3VXB A;  2PVU A;  1Z7M E;  2DWJ A;  2XXY A;  3HCQ A;  4MBP A;  1Y4C A;  1P1Q A;  3EN3 A;  2PMS A;  3JZJ A;  3ONM A;  1Y4T A;  1XOC A;  4P0G A;  3MVX A;  3C9H A;  2FNC A;  3MJN A;  2O84 X;  3HHF A;  3TTN A;  3VDF A;  1TXF A;  4AB5 A;  4XKN A;  1XHY A;  3FIR A;  2B65 A;  5I2N B;  2GHA A;  3AXF A;  2XHD A;  5A5X B;  3QXM A;  3SES A;  4GL0 A;  5L9M A;  1LLS A;  3TEL A;  3FV2 A;  3FAS A;  4MH5 A;  3DP4 A;  1OMP A;  1MRP A;  3MC2 A;  1B5H A;  3PPR A;  2RC9 A;  5I56 B;  1UIV A;  3HHG A;  3VVE A;  1I6B A;  2H5Y A;  2F78 A;  1NL5 A;  1LST A;  5L9S A;  1URS A;  2YJP A;  2ONS A; 
#chains in the Genus database with same CATH topology
 4PFI A;  3HPI A;  3HV1 A;  3E13 X;  4NTL A;  3M8U A;  1IMF A;  4PP0 A;  2Z8E A;  3V89 B;  1FJ9 A;  3WAF A;  1KA0 A;  5EQ9 A;  2NVU B;  3FVO A;  1AH5 A;  1P1W A;  3C32 A;  1FRP A;  4ZED A;  3OO8 A;  1MDP 1;  4DXU A;  2ONR A;  2RC8 A;  3LUZ A;  1DK4 A;  3IK6 B;  4MNC A;  4PDH A;  1HSJ A;  1SD3 A;  3PUX E;  3N6T A;  1OLC A;  4AB6 A;  5IAI A;  1Y3Q A;  2Q88 A;  1QGX A;  2UVJ A;  3EHU A;  1NV6 A;  4AS5 A;  4ELR A;  1FPI A;  1B6H A;  4N07 A;  4EF2 A;  4DDD A;  3TYH A;  1O63 A;  2CEX A;  2CZK A;  5IZ1 A;  1PBP A;  5KCJ A;  3HFU A;  1D9V A;  3QIM A;  4I3Y A;  2Z8D A;  5EQ8 A;  1M5C A;  4G68 A;  3CFZ A;  3K6V A;  4H6D A;  1M5D A;  1SQY A;  3V5A A;  1D9Q A;  2D21 A;  3M3K A;  3SKP A;  3QUJ A;  1URG A;  4DI3 D;  3MAM A;  1UIU A;  1B3E A;  1SI1 A;  3MQ9 A;  2MKZ A;  2XXR A;  4FBP A;  4MMP A;  1B40 A;  1LAG E;  1FJ6 A;  1XVX A;  3KG2 A;  3E78 A;  1VE4 A;  4N6K A;  1FSA A;  4TLL B;  3D4G A;  1QKB A;  4ESX A;  1OIB A;  2HFB A;  1H43 A;  2HXW A;  4XIG Q;  3IOU A;  4ISU A;  1SW2 A;  4YZZ A;  3W15 C;  2DWI A;  3UIF A;  3IB0 A;  5CM6 A;  4NF8 A;  4GF8 A;  3O97 A;  1EYK A;  2Y7W A;  5A5L A;  2NXO A;  4HXV A;  1B46 A;  1Q1K A;  4GX6 A;  4MFI A;  3PU5 A;  3CI8 A;  4F18 A;  2I3W A;  4N8Y A;  5AA2 A;  2QVU A;  1HSE A;  3G3I A;  2JJK A;  4F2Q A;  3KC1 A;  1SDX A;  2O51 A;  2HQ0 A;  2V3Q A;  1RYO A;  1AIV A;  4NF6 A;  2Y7K A;  5AA2 D;  3KBR A;  3PPP A;  1P1N A;  3PD9 A;  3MYU A;  4YB6 A;  3N26 A;  1Y20 A;  3MVY A;  4R72 A;  2ABH A;  3RUM A;  4LZ7 A;  5EYH A;  3FVK A;  4QSE A;  1SW4 A;  3QUF A;  3IFA A;  1FBC A;  4GL8 A;  1FTK A;  3A3U A;  4BDL A;  3E4R A;  4QSC A;  3TCF A;  4X9T A;  1Y9U A;  3MBP A;  2F7B A;  1B0H A;  3OSR A;  1BIY A;  1IXI A;  5ITP A;  1ELJ A;  1POY 1;  1B52 A;  3VVD A;  4P3L A;  4PFR A;  2F97 A;  3PPO A;  5F24 A;  4HE2 A;  4RNS A;  1NUY A;  5KCJ B;  4XF5 A;  1YYZ A;  4YIC A;  4LZ8 A;  4Z0I A;  1KA1 A;  4EF1 A;  4DIG A;  2XD2 A;  3PMX A;  4GWX A;  3TTL A;  2VHA A;  2CZH A;  2D3I A;  3TQW A;  4EXK A;  4EQ9 A;  1LAH E;  5CMM A;  1LCF A;  4F1Y A;  3MVW A;  3T9V A;  3BIG A;  4M1V A;  1N76 A;  2Q9T A;  4QXD A;  1LFH A;  3FXR A;  1SI0 A;  5ET5 A;  1LCT A;  3SEW A;  1MY1 A;  3IO4 A;  2OWS A;  3IFC A;  1H44 A;  2PFZ A;  3VXC A;  3MP6 A;  4FED A;  1A8E A;  1Y1Z A;  2WEF A;  3MVZ A;  3DP6 A;  1MPD A;  1RDY A;  4NF8 B;  4R9G A;  1NKX A;  2L5V A;  2QS4 A;  2XXQ A;  4AS4 A;  2RF1 A;  4PFT A;  1MXW A;  1QJM A;  4NF4 A;  4NQ8 A;  4U21 A;  4Z7E A;  5CBS A;  4OEV A;  4RPN A;  3PTY A;  4OMB A;  1AWB A;  2CEY A;  3LSL A;  4O7M A;  5AA2 B;  3K0V A;  3IO6 A;  3G3G A;  4R6Y A;  4RJZ A;  2XD3 A;  2ZYM A;  4N8G A;  4GRK A;  4NF6 B;  1FPJ A;  4R75 A;  2ALU A;  1ZBM A;  1NI9 A;  3EQ1 A;  3K6W A;  4JWO A;  3GBB A;  3PV0 E;  2HAV A;  2ZYN A;  1FQF A;  1PB9 A;  2QJE A;  1GV8 A;  3T66 A;  1MXY A;  3G7W A;  1SYH A;  3KSX A;  1MQD A;  5LOM A;  4PDD A;  1YXI A;  3CRB A;  4ZEI A;  5AA1 A;  1B7U A;  3RT6 B;  3L6H A;  3BBR A;  3I5O A;  4NWD A;  4O8M A;  2DS9 A;  3U93 A;  5AA3 A;  4ZEC A;  1KWH A;  1IEJ A;  5ELV A;  4HW8 A;  4U22 A;  1M5F A;  2RC7 A;  1UTH A;  1FTJ A;  1JET A;  1FTA A;  4U2R A;  1TWY A;  4MAG A;  2Q8J A;  4GVO A;  1SVX B;  1DTZ A;  3K01 A;  2I4B A;  1Z7N E;  4H0W A;  3RN8 A;  1NNK A;  5I57 A;  1IMD A;  1J1N A;  1ZU0 A;  4OEN A;  1ZLQ A;  4PAK A;  4PAF A;  3RPW A;  4G8H A;  4ESW A;  3PMV A;  4H8J A;  4YKJ A;  1G0I A;  4ELP A;  2X7P A;  5LDZ A;  4IO6 A;  4OA4 A;  2QMX A;  3RQT A;  2CZL A;  1NMU A;  2XX8 A;  3JYR A;  4FOR A;  1OLA A;  3CFL A;  1LBV A;  4GIZ A;  5JTY A;  2R9J A;  2I4C A;  4I8C A;  3K4U A;  4DXC A;  3M3L A;  4PF6 A;  5HBC A;  4XTC Q;  4F2O A;  4JB7 A;  2VD3 A;  4NF4 B;  4JDF A;  5CBR A;  3MW0 A;  1D4N A;  3EF7 A;  1OQG A;  5I2K A;  2B4L A;  5KDT A;  4N91 A;  1H3D A;  4NF0 A;  4P11 A;  5DYH A;  1XC1 A;  2FIX A;  3KN3 A;  5ITO A;  4KCD A;  5T3J A;  3CHG A;  1S7Y A;  3R26 A;  4F19 A;  4OFL A;  1FQC A;  3EHS A;  4JWX A;  1S9T A;  3K02 A;  1LFG A;  1B4H A;  1M5B A;  3HN0 A;  4PTK A;  1YCJ A;  4RXL A;  2XXU A;  2Z8F A;  3O29 A;  5TP9 B;  4MNP A;  1NV4 A;  2XXT A;  1NH8 A;  4JSO A;  1ATG A;  4N4U A;  1A8F A;  1DTG A;  1PBQ A;  3CVG A;  4RK9 A;  3T9X B;  5ICQ A;  2Q2C A;  4U4S A;  1B0L A;  4ONY A;  2R71 A;  2QS1 A;  3B50 A;  2PT1 A;  5B70 A;  4PE5 B;  2ZXT A;  4OES A;  3WAE A;  5L8D A;  3H6U A;  5DVF A;  4H65 A;  2G29 A;  1MH4 A;  4OXV A;  1ZKB A;  1EYJ A;  2H98 A;  3T9H B;  2DQV A;  2XXV A;  3BKI B;  2NWJ A;  1A7L A;  3FV1 A;  1PB7 A;  2KQZ A;  1UTH B;  1N3W A;  1MXU A;  3D4C A;  2H4I A;  1NV7 A;  1FBE A;  1IXH A;  3CG1 A;  4FJP A;  1MQJ A;  1JW1 A;  2DVZ A;  2REG A;  4QF9 A;  5I57 B;  5KZT A;  4O3C A;  5DVI A;  4JWY A;  2XX7 A;  1AMF A;  5I5P A;  3SDF A;  4RA1 A;  3KOT A;  4IY6 A;  1UQW A;  3ILT B;  2A5T B;  1EZ9 A;  1FBH A;  1FQE A;  4GOT A;  5F7V A;  3H3G A;  2P0S A;  4Q8R A;  2F7A A;  3TQL A;  2KLF A;  4TOZ A;  3UN6 A;  4ZS9 A;  2KR0 A;  5FHM A;  4F1U A;  2QVR A;  4GWO A;  4XEQ A;  3A29 A;  3KGC A;  1QUL A;  4JXI A;  4FIM A;  1II5 A;  1QUJ A;  3TPA A;  3OOA A;  4G8M A;  3C35 A;  4YKK A;  5KDT B;  1XT8 A;  5BUU A;  3B6T A;  4PFY A;  4WEP A;  1N0T A;  2I3V A;  5AA4 A;  3UOR A;  1VFD A;  3DP8 A;  2WBD A;  2Q89 A;  5EYF A;  4YKI A;  4F3B A;  3ISP A;  3K6U A;  2UYE A;  3RGY A;  4GQO A;  3S4U A;  3BFU A;  1B9J A;  4THI A;  1P99 A;  3IX1 A;  1AOV A;  4H8I A;  3QYT A;  2E1S A;  3FUZ A;  5CMK A;  3IB1 A;  2WYK A;  4I9D A;  2QS2 A;  2XXH A;  2H99 A;  4E0X A;  3GBA A;  4FAJ A;  5FHO A;  3T9U A;  5H8H A;  3L6G A;  3QMF A;  3UGW A;  1ZTY A;  4IR8 A;  1SW5 A;  3Q25 A;  4PC9 A;  1Y3N A;  3IOV A;  3O6H A;  4X1B A;  4FEC A;  1OVB A;  2O1M A;  4BDM A;  1FQD A;  4RPO A;  4JVI A;  4P0I A;  1LBY A;  5ESY A;  4XKR A;  3C36 A;  1L5T A;  3VLV A;  1LBB A;  4POW A;  5AE4 A;  3O28 A;  2V3T A;  2P3V A;  4P1E A;  1K9Y A;  2VD2 A;  2O6A A;  3FVN A;  2PCR A;  4RYA A;  3CSG A;  4BDR A;  2ZZV A;  3H4Z A;  2YLN A;  1GGG A;  3U72 A;  2V93 A;  3SEY A;  1YAE A;  4OVJ A;  5IZ3 A;  5BWJ A;  5TU0 A;  3O2A A;  3GXA A;  2THI A;  4OTE A;  3G3F A;  3K2D A;  4GWW A;  5H8N A;  4TQU Q;  2DE4 A;  4PGN A;  1NUW A;  3S9E A;  3Q28 A;  2ONK E;  4I62 A;  3IOT A;  4KCC A;  2XWK A;  5H8S A;  3PD8 A;  4U23 A;  3RLF E;  1D9Y A;  4PBH A;  4QFP A;  4WXJ A;  1JVY A;  4H1X A;  3V83 A;  2FYI A;  4X1D A;  5HPQ A;  1DCU A;  1LB8 A;  2HPG A;  3VLU A;  5ET7 A;  2LAO A;  4F31 B;  4YAH X;  4LUB A;  1D3K A;  3TFL A;  5ICT A;  2HZK A;  3RT8 A;  3S2V A;  5AA4 B;  3S9M C;  4O3A A;  1MDQ A;  5EQ7 A;  3GZG A;  3S9N C;  4NF5 A;  1RDZ A;  3TCH A;  2R6G E;  4UAB A;  4PGP A;  1FPL A;  3VLW A;  2F3B A;  1FPB A;  1MS7 A;  1NNF A;  1N84 A;  2DE3 A;  4OZ9 A;  3R7X A;  2B4M A;  3H6T A;  2QRY A;  1YTV A;  3O9P A;  5L9O A;  1MXX A;  4G68 B;  5H8H B;  2DDK A;  5LTC A;  2O1L A;  3PPN A;  3E79 A;  4PFU A;  5CI5 A;  3VFJ A;  3VV5 A;  2M8C A;  4OVP A;  1IIW A;  1YPN A;  4OYV A;  3O6I A;  2DOJ A;  3EPE A;  1EYI A;  4JSD A;  1FBD A;  4DCX A;  4NHB A;  4Q5T A;  1N3X A;  3GLB A;  4NWC A;  2H9B A;  4XFE A;  4KD5 A;  3TDJ A;  4WKM A;  3PUV E;  3Q27 A;  3W9V A;  2RIN A;  2OWT A;  3RTF B;  2UXA A;  1B5J A;  4OER A;  2X26 A;  1NNP A;  2DXY A;  1BKA A;  2OBG A;  4MEV A;  2Y7P A;  3FJM A;  3RY3 A;  3DEL B;  3KFM A;  4G68 C;  1HSL A;  3N94 A;  2REJ A;  1JW4 A;  5IZ3 B;  4OVR A;  3ZSF A;  4FE8 A;  4IGR A;  4RK2 A;  4F29 A;  3T22 A;  2RCB A;  1MPB A;  4DI4 B;  1B7Z A;  4R2B A;  4Q0C A;  4G2Z A;  2QL3 A;  4C1T A;  3SEU A;  2P3N A;  3T0J A;  1PB8 A;  1US4 A;  2Y5L A;  1IZ1 A;  1A99 A;  3V8X B;  2F35 A;  3H6V A;  4PBQ A;  3I6V A;  1MY4 A;  4E0W A;  1SW1 A;  1WVJ A;  2Z23 A;  1YZ0 A;  4O3B A;  1EH3 A;  1LAF E;  4LVQ A;  1BP5 A;  3FJG A;  3IOR A;  4FAT A;  2UVG A;  3CIJ A;  4KPT A;  4YKP A;  2NUV A;  3THI A;  3TOD A;  4QFO A;  3B6W A;  3FAT A;  1GTK A;  4OWD A;  4P9K A;  4PFB A;  2VT5 A;  4IO5 A;  1I6A A;  3B6Q A;  1A40 A;  1B3G A;  1ZJL A;  2O7U A;  4NF5 B;  2XXP A;  1MXV A;  2RCA A;  4OAN A;  1B3F A;  1SPI A;  1B5I A;  5B7D A;  3SEX A;  1MQG A;  3DM0 A;  4GWY A;  1XI6 A;  2V25 A;  3ECR A;  2FHY A;  4YB5 A;  2DP8 A;  1XVY A;  2V3U A;  1CE2 A;  2ZNT A;  3OMB A;  2IEE A;  4MX6 A;  4IO7 A;  2V84 A;  4GXA A;  3LSW A;  3MUQ A;  3H7M A;  3ROJ A;  3VE1 B;  2WYP A;  3B8B A;  5CRY A;  2QS3 A;  1JQF A;  3MPK A;  1O64 A;  4QFN A;  3U8Q A;  3CR9 A;  3T1B A;  5IKB A;  4XKP A;  2I0C A;  1TT1 A;  1IXG A;  1JNF A;  2VOZ A;  1FPK A;  1LBZ A;  1OQH A;  3UP9 A;  1MQI A;  2I6E A;  4KHZ E;  2FA7 A;  1R9Q A;  3FJ7 A;  3G3H A;  3KOS A;  4MIJ A;  5I56 A;  1B7H A;  4HE0 A;  2F5X A;  4POX A;  3MST A;  4IO4 A;  3A09 A;  3C33 A;  3O6G A;  3TZA A;  4UAC A;  4I3E A;  3VVF A;  2QMW A;  1GR2 A;  2WX9 A;  4X04 A;  1DPE A;  5FBP A;  3KJ7 A;  1K9Z A;  2VPO A;  1IMC A;  3N6U A;  3RPL A;  1WOD A;  3MWB A;  4K3F A;  4HCW A;  1XS5 A;  2HCA A;  1JEU A;  4BLA A;  4OFO A;  3LSX A;  1Q9D A;  2NOO A;  2B3B A;  1JVX A;  2QVV A;  1JP4 A;  3OEL A;  1F9B A;  4PE3 A;  4R2F A;  3ODB A;  1B58 A;  1FCK A;  4DLD A;  1B3L A;  3FGS A;  4GXS B;  2DWA A;  1B51 A;  3H03 A;  4H45 A;  2W7Y A;  1FBP A;  5JK4 A;  2FBP A;  1QUK A;  4H46 A;  4ZEF A;  3U94 A;  2B3F A;  3IOW A;  3MZ9 A;  3CFX A;  2HAU A;  2XWO A;  4KXP A;  2Q8M A;  3Q26 A;  2I0B A;  2OX3 A;  4OVQ A;  3OSQ A;  2UVH A;  4R73 A;  3IR1 A;  2ZZW A;  3H06 B;  2PT2 A;  1SYI A;  5I58 A;  3PPQ A;  3FZV A;  1FQB A;  2F3D A;  4QFL A;  3IJX B;  1PDA A;  1OVT A;  4ZE9 A;  2F36 A;  1GVC A;  4F39 A;  1G0H A;  4RY1 A;  1LBC A;  4GWS A;  1DMB A;  4N15 A;  4MLQ A;  1IMB A;  1LBX A;  4PCD A;  4OHN A;  3NOH A;  1B4Z A;  4DXB A;  3KZG A;  1RDX A;  3TEP A;  2ZNS A;  3LV0 A;  4L17 A;  2F8D A;  4WED A;  2O68 A;  5DVJ A;  1VSO A;  4NMY A;  4LON B;  1B1X A;  4OFJ A;  4LZ5 A;  4PQJ A;  3MP8 A;  2Q2A A;  3OEN A;  5K2Y A;  1FPE A;  3C31 A;  4NN3 A;  4QSD A;  2RKM A;  2CZI A;  4NE4 A;  5J16 A;  1FBF A;  5IGA A;  4NX1 A;  4QBA A;  1FPF A;  3OO9 A;  5H8F A;  5IZZ A;  2Y5K A;  1M5E A;  1VDW A;  3BIH A;  3HO7 A;  3PUZ E;  5JTY B;  4N17 A;  1R6Z A;  3SET A;  4YMB A;  2DXR A;  3FXB A;  1TFA A;  5CC2 A;  2P2A A;  3W9W A;  2F6P A;  4H5G A;  3G3K A;  4EQ7 A;  4C0R A;  1MY3 A;  3FD3 A;  3RPL B;  1POT A;  3MP1 A;  5I2K B;  5I59 A;  2AL5 A;  2XXW A;  1UTB A;  2ZNU A;  1QW0 A;  1IXC A;  3RYD A;  3RTW B;  4P56 A;  1FTM A;  4DE8 A;  5DT6 A;  3OO6 A;  3KN8 A;  4EXL A;  1MG1 A;  4QRZ A;  4F1V A;  1Y1M A;  2CMO A;  3FXU A;  4HS7 A;  3CSB A;  3FXQ A;  1I6Q A;  2PYY A;  4ZZE A;  2OZZ A;  1LFI A;  5DEX A;  3U1O A;  1Y3P A;  2P1S A;  2XWI A;  3PUW E;  2DSF A;  1LGB C;  1JW5 A;  1Q35 A;  1FPG A;  5I3S A;  1VR5 A;  3ZKK A;  4GFR A;  1ZMG A;  1RKM A;  1N7W A;  1MPC A;  2GFE A;  4QHQ A;  5I58 B;  3K6X A;  3USD A;  4O7I A;  4M4G A;  3OEK A;  2OJT A;  2OLB A;  4HE1 A;  3T96 B;  4GLI A;  4PAI A;  1NFT A;  5H8Q A;  4C1U A;  1DOT A;  4DCY A;  4ECF A;  3SEV A;  3TTM A;  4YMA A;  2FIE A;  3JV9 A;  4GBW A;  3OO7 A;  4GWU A;  4OEU A;  4I40 A;  5EYG A;  4OET A;  3TTR A;  3CG3 A;  2ZMB A;  4EDP A;  1N04 A;  2AYS A;  2O7I A;  3M3F A;  1A55 A;  4N81 A;  4U1Z A;  1IQ7 A;  4GWZ A;  4G4P A;  4ZEB A;  1FW0 A;  2GQ1 A;  1B05 A;  3KSJ A;  4IY5 A;  1US5 A;  3N5L A;  4KYS A;  4HCY A;  3LUY A;  1INP A;  4FEB A;  1H76 A;  3U92 A;  5H8F B;  2H25 A;  1CB6 A;  4Q30 B;  4YU0 A;  3KEI A;  4U4X A;  3IB2 A;  1NH7 A;  4N6P A;  3QK6 A;  3K1N A;  4ZZA A;  3C4M A;  3D1R A;  5FHN A;  5DTB A;  2XXK A;  1QVS A;  3O66 A;  2VPN A;  2I58 A;  4F22 A;  3KN7 A;  4JVC A;  1MY0 A;  4H67 A;  1PC3 A;  5ET6 A;  2DVC A;  1DSN A;  3K1M A;  4LQ5 A;  2ANJ A;  4MF3 A;  4HTG A;  5I59 B;  3DLN A;  3TKD A;  1UTB B;  2UYF A;  5CMC A;  3Q29 A;  4DZ1 A;  2O69 A;  3PGF A;  2DWH A;  3E9X A;  2AL4 A;  4R9F A;  2Q74 A;  5FTI A;  4LP2 B;  4KQP A;  1RYX A;  3LR1 A;  1AL3 A;  3KJT A;  3TAJ A;  2GHB A;  1MY2 A;  5DEX B;  3PMW A;  5IM2 A;  4QFK A;  4R6K A;  4R74 A;  4MCO A;  5J1D A;  1URD A;  2HXR A;  4YB7 A;  3I3V A;  3ZS6 A;  4F3S A;  3SER A;  1NV2 A;  2GH9 A;  2I49 A;  1A54 A;  4X48 A;  4PFW A;  2Y7R A;  1O7T A;  1MM6 A;  5EHM A;  1LBW A;  2ESN A;  4OVS A;  1S50 A;  4TLM B;  1DPP A;  1B1H A;  4MLV A;  1IUD A;  4GX4 A;  2PX1 A;  2PBW A;  1BK4 A;  1MXZ A;  5H8Q B;  1T0K A;  4MNI A;  1USY H;  3H6W A;  1MM7 A;  2D5W A;  4JBZ A;  3U65 A;  4IO3 A;  5I84 A;  4O94 A;  1NUZ A;  4KFQ A;  4ZEK A;  5TPA A;  2DE2 A;  1LAX A;  1TFD A;  2Z22 A;  3MZB A;  1WDN A;  2XWV A;  4IO2 A;  3SZP A;  5CMB A;  3TCG A;  4ZE8 A;  4EQB A;  4P47 A;  2XX9 A;  2I48 A;  1B32 A;  2QPQ A;  3ILU B;  3MPL A;  3TMG A;  4GD5 A;  4I1D A;  3T93 B;  4IGT A;  2OCU A;  3IAZ A;  4EUO A;  3R6U A;  5I7I A;  1P1U A;  1EZO A;  1H45 A;  5FTH A;  2HZL A;  3G3J A;  1NV5 A;  3HST A;  1JEV A;  4F3G A;  3S9L C;  4ND9 A;  1LEV A;  2DYX A;  3E3K A;  3EHT A;  3RNN A;  3IJO B;  5ISU A;  4KYD A;  1USY E;  5H8N B;  2XXI A;  2QFL A;  4XXU A;  2WBB A;  3MZ1 A;  1BLF A;  1PEB A;  1MQH A;  4H5F A;  3B7D A;  4ZDM A;  3FBP A;  2UVI A;  3OD7 A;  2OK2 A;  3OXN A;  4UA8 A;  2Y84 A;  4KYE A;  3TUS A;  2PFY A;  2XXX A;  4G8N A;  2V4C A;  1VFE A;  1DBZ A;  4G61 A;  1QKA A;  2OWZ A;  5TP9 A;  3PUY E;  3K1P A;  1I69 A;  3IL1 B;  5ET8 A;  4P1L A;  1NV0 A;  1LB9 A;  3KC0 A;  2ZYO A;  4LQ2 A;  3OEM A;  1B2H A;  5HM4 B;  1NV3 A;  4PET A;  1IME A;  1R9L A;  2F34 A;  4LN5 A;  4LA9 A;  1SBP A;  1EZP A;  5I2N A;  5A5X A;  3EKI A;  1NV1 A;  4BDN A;  4ELO A;  1N7X A;  1IMA A;  2Y7I A;  4AQ4 A;  5EHS A;  4ELQ A;  2X7Q A;  1ANF A;  5M2V A;  2F7C A;  4G77 A;  4N13 A;  3ZKL A;  4BDO A;  4U1O A;  2F6G A;  1FQA A;  1ZIU A;  2G93 A;  2YPN A;  2VP1 A;  3LSF B;  5EQA A;  2WKY A;  4P8B A;  2QSX A;  1NNT A;  2XA5 A;  3FVG A;  3F11 A;  2BJJ X;  3UA8 A;  3BFT A;  1MH3 A;  2AIX A;  5TPA B;  2A5T A;  3A3C A;  4N6D A;  4F3P A;  2HEU A;  4XKQ A;  2IA4 A;  3QAX A;  1BTJ A;  3LC8 A;  1IIT A;  2GRV A;  1R1N A;  4NAP A;  3TTK A;  4R6H A;  1FTO A;  5JEI A;  4OQO A;  1FTL A;  2VGQ A;  1QUI A;  4IB2 A;  3UK4 A;  4KI0 E;  5K2X A;  3C34 A;  3K00 A;  4NED A;  4X8R A;  2A5S A;  5F1Q A;  3LBS A;  4LAT A;  3P7I A;  3QSL A;  4KR5 A;  2E0S A;  2ZYK A;  1B3H A;  4BDQ A;  4GBV A;  1EU8 A;  1P1O A;  3VXB A;  2PVU A;  4OVT A;  1Z7M E;  2DWJ A;  2XXY A;  3HCQ A;  4PF8 A;  4MBP A;  1Y4C A;  1P1Q A;  2FVZ A;  3EN3 A;  2PMS A;  3JZJ A;  1NUX A;  1Y4T A;  3ONM A;  4MJO A;  1XOC A;  2BJI A;  1FBG A;  4P0G A;  3MVX A;  3C9H A;  4NG7 A;  2FNC A;  3MJN A;  2O84 X;  3HHF A;  3TTN A;  3VDF A;  2R8T A;  1TXF A;  4NGU A;  4AB5 A;  4XKN A;  1KZ8 A;  1XHY A;  3FIR A;  2B65 A;  1CNQ A;  5I2N B;  2GHA A;  3AXF A;  2XHD A;  5A5X B;  2ZZX A;  3QXM A;  3SES A;  2HHM A;  4GL0 A;  5L9M A;  1LLS A;  4JVD A;  3TEL A;  3FV2 A;  3FAS A;  4MH5 A;  3DP4 A;  4MHF A;  1OMP A;  1MRP A;  3GYY A;  3MC2 A;  1B5H A;  3PPR A;  3KBZ A;  2RC9 A;  5I56 B;  1UIV A;  5DW8 A;  3HHG A;  1FPD A;  3VVE A;  1I6B A;  2H5Y A;  2F78 A;  1NL5 A;  1LST A;  5L9S A;  1URS A;  2YJP A;  4GX3 A;  2ONS A; 
#chains in the Genus database with same CATH homology
 3HPI A;  3HV1 A;  3E13 X;  4NTL A;  3M8U A;  4PP0 A;  2Z8E A;  3V89 B;  3WAF A;  2NVU B;  3FVO A;  1AH5 A;  1P1W A;  3C32 A;  4ZED A;  3OO8 A;  1MDP 1;  4DXU A;  2ONR A;  2RC8 A;  3IK6 B;  1HSJ A;  1SD3 A;  3PUX E;  3N6T A;  1OLC A;  4AB6 A;  5IAI A;  1Y3Q A;  2Q88 A;  2UVJ A;  3EHU A;  4ELR A;  1B6H A;  4N07 A;  4EF2 A;  4DDD A;  3TYH A;  1O63 A;  1PBP A;  5KCJ A;  1D9V A;  3QIM A;  2Z8D A;  1M5C A;  4G68 A;  3CFZ A;  3K6V A;  4H6D A;  1M5D A;  1SQY A;  3V5A A;  2D21 A;  3M3K A;  3SKP A;  3QUJ A;  1URG A;  3MAM A;  1UIU A;  1B3E A;  1SI1 A;  3MQ9 A;  2XXR A;  1B40 A;  1LAG E;  1XVX A;  3KG2 A;  1VE4 A;  4TLL B;  3D4G A;  1QKB A;  4ESX A;  1OIB A;  2HFB A;  1H43 A;  2HXW A;  4XIG Q;  3IOU A;  4ISU A;  1SW2 A;  4YZZ A;  3W15 C;  2DWI A;  3UIF A;  3IB0 A;  5CM6 A;  4NF8 A;  4GF8 A;  3O97 A;  2Y7W A;  2NXO A;  1B46 A;  1Q1K A;  4MFI A;  3PU5 A;  3CI8 A;  4F18 A;  2I3W A;  5AA2 A;  1HSE A;  3G3I A;  4F2Q A;  1SDX A;  2O51 A;  2HQ0 A;  2V3Q A;  1RYO A;  1AIV A;  4NF6 A;  2Y7K A;  5AA2 D;  3KBR A;  3PPP A;  1P1N A;  3PD9 A;  4YB6 A;  3N26 A;  1Y20 A;  3MVY A;  4R72 A;  2ABH A;  3RUM A;  4LZ7 A;  3FVK A;  4QSE A;  1SW4 A;  3QUF A;  4GL8 A;  1FTK A;  3A3U A;  4BDL A;  3E4R A;  4QSC A;  3TCF A;  4X9T A;  1Y9U A;  3MBP A;  2F7B A;  1B0H A;  3OSR A;  1BIY A;  1IXI A;  5ITP A;  1ELJ A;  1POY 1;  1B52 A;  3VVD A;  2F97 A;  3PPO A;  4RNS A;  5KCJ B;  4YIC A;  4LZ8 A;  4Z0I A;  4EF1 A;  4DIG A;  2XD2 A;  3PMX A;  3TTL A;  2VHA A;  2D3I A;  3TQW A;  4EXK A;  4EQ9 A;  1LAH E;  5CMM A;  1LCF A;  4F1Y A;  3MVW A;  3T9V A;  4M1V A;  1N76 A;  2Q9T A;  1LFH A;  3FXR A;  1SI0 A;  1LCT A;  3SEW A;  1MY1 A;  3IO4 A;  2OWS A;  1H44 A;  3VXC A;  3MP6 A;  4FED A;  1A8E A;  1Y1Z A;  3MVZ A;  3DP6 A;  1MPD A;  1NKX A;  2XXQ A;  4NF8 B;  2QS4 A;  4R9G A;  2RF1 A;  4PFT A;  1MXW A;  1QJM A;  4NF4 A;  4U21 A;  4Z7E A;  5CBS A;  4OEV A;  4RPN A;  4OMB A;  3LSL A;  5AA2 B;  3K0V A;  3IO6 A;  3G3G A;  4R6Y A;  4RJZ A;  2XD3 A;  2ZYM A;  4GRK A;  4NF6 B;  4R75 A;  2ALU A;  1ZBM A;  3EQ1 A;  3K6W A;  4JWO A;  3GBB A;  3PV0 E;  2HAV A;  2ZYN A;  1FQF A;  1PB9 A;  2QJE A;  1GV8 A;  3T66 A;  1MXY A;  3G7W A;  1SYH A;  3KSX A;  1MQD A;  5LOM A;  3CRB A;  4ZEI A;  5AA1 A;  1B7U A;  3RT6 B;  3L6H A;  3BBR A;  3I5O A;  4NWD A;  2DS9 A;  3U93 A;  5AA3 A;  4ZEC A;  1KWH A;  1IEJ A;  5ELV A;  4HW8 A;  4U22 A;  1M5F A;  2RC7 A;  1UTH A;  1FTJ A;  1JET A;  4U2R A;  1TWY A;  2Q8J A;  4GVO A;  1SVX B;  1DTZ A;  3K01 A;  2I4B A;  1Z7N E;  4H0W A;  3RN8 A;  1NNK A;  5I57 A;  1J1N A;  1ZU0 A;  4OEN A;  1ZLQ A;  3RPW A;  4G8H A;  4ESW A;  3PMV A;  4H8J A;  4YKJ A;  4ELP A;  2X7P A;  4IO6 A;  2QMX A;  3RQT A;  2CZL A;  1NMU A;  2XX8 A;  3JYR A;  4FOR A;  1OLA A;  3CFL A;  4GIZ A;  5JTY A;  2R9J A;  2I4C A;  4I8C A;  3K4U A;  4DXC A;  3M3L A;  5HBC A;  4XTC Q;  4F2O A;  4JB7 A;  2VD3 A;  4NF4 B;  4JDF A;  5CBR A;  3MW0 A;  1D4N A;  3EF7 A;  1OQG A;  5I2K A;  5KDT A;  1H3D A;  4P11 A;  5DYH A;  1XC1 A;  3KN3 A;  5ITO A;  4KCD A;  1S7Y A;  3R26 A;  4F19 A;  4OFL A;  1FQC A;  3EHS A;  4JWX A;  1S9T A;  3K02 A;  1LFG A;  1B4H A;  1M5B A;  3HN0 A;  1YCJ A;  4RXL A;  2XXU A;  2Z8F A;  3O29 A;  5TP9 B;  2XXT A;  1NH8 A;  4JSO A;  1ATG A;  1A8F A;  1DTG A;  1PBQ A;  3CVG A;  4RK9 A;  3T9X B;  5ICQ A;  2Q2C A;  4U4S A;  1B0L A;  4ONY A;  2R71 A;  2QS1 A;  2PT1 A;  5B70 A;  4PE5 B;  2ZXT A;  4OES A;  3WAE A;  5L8D A;  3H6U A;  5DVF A;  4H65 A;  2G29 A;  1MH4 A;  4OXV A;  1ZKB A;  2H98 A;  3T9H B;  2DQV A;  2XXV A;  3BKI B;  2NWJ A;  1A7L A;  3FV1 A;  1PB7 A;  1UTH B;  1N3W A;  1MXU A;  3D4C A;  2H4I A;  1IXH A;  3CG1 A;  4FJP A;  1MQJ A;  1JW1 A;  2DVZ A;  2REG A;  4QF9 A;  5I57 B;  5KZT A;  4O3C A;  5DVI A;  4JWY A;  2XX7 A;  1AMF A;  3SDF A;  4RA1 A;  3KOT A;  4IY6 A;  1UQW A;  3ILT B;  2A5T B;  1EZ9 A;  1FQE A;  4GOT A;  5F7V A;  3H3G A;  2P0S A;  4Q8R A;  2F7A A;  3TQL A;  2KLF A;  4TOZ A;  3UN6 A;  4ZS9 A;  5FHM A;  4F1U A;  4GWO A;  3KGC A;  1QUL A;  4JXI A;  4FIM A;  1II5 A;  1QUJ A;  3TPA A;  3OOA A;  4G8M A;  3C35 A;  4YKK A;  5KDT B;  1XT8 A;  5BUU A;  3B6T A;  4PFY A;  4WEP A;  1N0T A;  2I3V A;  5AA4 A;  3UOR A;  1VFD A;  3DP8 A;  2Q89 A;  5EYF A;  4YKI A;  4F3B A;  3K6U A;  2UYE A;  3RGY A;  4GQO A;  3S4U A;  3BFU A;  1B9J A;  4THI A;  1P99 A;  3IX1 A;  1AOV A;  4H8I A;  3QYT A;  2E1S A;  3FUZ A;  5CMK A;  3IB1 A;  4I9D A;  2QS2 A;  2XXH A;  2H99 A;  4E0X A;  3GBA A;  4FAJ A;  5FHO A;  3T9U A;  5H8H A;  3L6G A;  3UGW A;  1ZTY A;  1SW5 A;  3Q25 A;  1Y3N A;  3IOV A;  3O6H A;  4X1B A;  4FEC A;  1OVB A;  2O1M A;  4BDM A;  1FQD A;  4RPO A;  4P0I A;  4XKR A;  3C36 A;  1L5T A;  3VLV A;  5AE4 A;  1LBB A;  4POW A;  3O28 A;  2V3T A;  2VD2 A;  2O6A A;  3FVN A;  4RYA A;  3CSG A;  4BDR A;  3H4Z A;  2YLN A;  1GGG A;  3U72 A;  2V93 A;  3SEY A;  1YAE A;  4OVJ A;  5BWJ A;  5TU0 A;  3O2A A;  3GXA A;  2THI A;  4OTE A;  3G3F A;  3K2D A;  5H8N A;  4TQU Q;  2DE4 A;  3S9E A;  3Q28 A;  2ONK E;  4I62 A;  3IOT A;  4KCC A;  5H8S A;  3PD8 A;  4U23 A;  3RLF E;  1D9Y A;  4QFP A;  4WXJ A;  1JVY A;  4H1X A;  3V83 A;  2FYI A;  4X1D A;  5HPQ A;  1LB8 A;  3VLU A;  2LAO A;  4F31 B;  4YAH X;  4LUB A;  1D3K A;  3TFL A;  5ICT A;  2HZK A;  3RT8 A;  3S2V A;  5AA4 B;  3S9M C;  4O3A A;  1MDQ A;  3GZG A;  3S9N C;  4NF5 A;  3TCH A;  2R6G E;  3VLW A;  1MS7 A;  1NNF A;  1N84 A;  2DE3 A;  4OZ9 A;  3R7X A;  3H6T A;  2QRY A;  1YTV A;  3O9P A;  5L9O A;  1MXX A;  4G68 B;  5H8H B;  2O1L A;  3PPN A;  4PFU A;  5CI5 A;  3VFJ A;  3VV5 A;  2M8C A;  1IIW A;  1YPN A;  4OYV A;  3O6I A;  2DOJ A;  3EPE A;  4JSD A;  4DCX A;  4Q5T A;  1N3X A;  3GLB A;  4NWC A;  2H9B A;  4KD5 A;  3TDJ A;  4WKM A;  3PUV E;  3Q27 A;  3W9V A;  2RIN A;  2OWT A;  3RTF B;  2UXA A;  1B5J A;  4OER A;  2X26 A;  1NNP A;  2DXY A;  1BKA A;  2OBG A;  2Y7P A;  3FJM A;  3RY3 A;  3DEL B;  3KFM A;  4G68 C;  1HSL A;  3N94 A;  2REJ A;  1JW4 A;  3ZSF A;  4FE8 A;  4IGR A;  4RK2 A;  4F29 A;  3T22 A;  2RCB A;  1MPB A;  1B7Z A;  4R2B A;  4Q0C A;  4G2Z A;  2QL3 A;  4C1T A;  3SEU A;  1PB8 A;  1US4 A;  1IZ1 A;  1A99 A;  3V8X B;  2F35 A;  3H6V A;  3I6V A;  1MY4 A;  4E0W A;  1SW1 A;  1WVJ A;  2Z23 A;  4O3B A;  1EH3 A;  1LAF E;  4LVQ A;  1BP5 A;  3FJG A;  3IOR A;  4FAT A;  2UVG A;  3CIJ A;  4KPT A;  4YKP A;  2NUV A;  3THI A;  3TOD A;  4QFO A;  3B6W A;  3FAT A;  1GTK A;  4OWD A;  4IO5 A;  1I6A A;  3B6Q A;  1A40 A;  1B3G A;  1ZJL A;  2O7U A;  4NF5 B;  2XXP A;  1MXV A;  2RCA A;  1B3F A;  1B5I A;  5B7D A;  3SEX A;  1MQG A;  3DM0 A;  2V25 A;  3ECR A;  4YB5 A;  2DP8 A;  1XVY A;  2V3U A;  1CE2 A;  2ZNT A;  3OMB A;  2IEE A;  4IO7 A;  2V84 A;  4GXA A;  3LSW A;  3MUQ A;  3H7M A;  3VE1 B;  5CRY A;  2QS3 A;  1JQF A;  3MPK A;  1O64 A;  4QFN A;  3U8Q A;  3CR9 A;  5IKB A;  4XKP A;  2I0C A;  1TT1 A;  1IXG A;  1JNF A;  2VOZ A;  1OQH A;  3UP9 A;  1MQI A;  2I6E A;  4KHZ E;  2FA7 A;  1R9Q A;  3FJ7 A;  3G3H A;  3KOS A;  5I56 A;  1B7H A;  2F5X A;  4POX A;  4IO4 A;  3A09 A;  3C33 A;  3O6G A;  3TZA A;  4UAC A;  3VVF A;  2QMW A;  1GR2 A;  1DPE A;  3KJ7 A;  3N6U A;  1WOD A;  3MWB A;  4K3F A;  4HCW A;  1XS5 A;  2HCA A;  1JEU A;  4BLA A;  4OFO A;  3LSX A;  2NOO A;  2B3B A;  1JVX A;  3OEL A;  1F9B A;  4R2F A;  3ODB A;  1B58 A;  1FCK A;  4DLD A;  1B3L A;  3FGS A;  4GXS B;  2DWA A;  1B51 A;  3H03 A;  2W7Y A;  5JK4 A;  1QUK A;  4ZEF A;  3U94 A;  2B3F A;  3IOW A;  3MZ9 A;  3CFX A;  2HAU A;  3Q26 A;  2I0B A;  3OSQ A;  2UVH A;  4R73 A;  3IR1 A;  3H06 B;  2PT2 A;  1SYI A;  5I58 A;  3PPQ A;  3FZV A;  1FQB A;  4QFL A;  3IJX B;  1PDA A;  1OVT A;  4ZE9 A;  2F36 A;  1GVC A;  4F39 A;  4RY1 A;  1LBC A;  1DMB A;  4MLQ A;  4OHN A;  1B4Z A;  4DXB A;  3KZG A;  3TEP A;  2ZNS A;  4L17 A;  2F8D A;  4WED A;  2O68 A;  5DVJ A;  1VSO A;  4NMY A;  4LON B;  1B1X A;  4OFJ A;  4LZ5 A;  4PQJ A;  3MP8 A;  2Q2A A;  3OEN A;  5K2Y A;  3C31 A;  4QSD A;  2RKM A;  4NE4 A;  3OO9 A;  5H8F A;  1M5E A;  3HO7 A;  3PUZ E;  5JTY B;  1R6Z A;  3SET A;  4YMB A;  2DXR A;  1TFA A;  5CC2 A;  2P2A A;  3W9W A;  2F6P A;  4H5G A;  3G3K A;  4EQ7 A;  4C0R A;  1MY3 A;  3FD3 A;  1POT A;  3MP1 A;  5I2K B;  5I59 A;  2AL5 A;  2XXW A;  1UTB A;  2ZNU A;  1QW0 A;  1IXC A;  3RTW B;  1FTM A;  4DE8 A;  5DT6 A;  3OO6 A;  3KN8 A;  4EXL A;  1MG1 A;  4QRZ A;  4F1V A;  1Y1M A;  2CMO A;  3FXU A;  4HS7 A;  3CSB A;  3FXQ A;  1I6Q A;  2PYY A;  4ZZE A;  2OZZ A;  1LFI A;  5DEX A;  3U1O A;  1Y3P A;  2P1S A;  3PUW E;  2DSF A;  1LGB C;  1JW5 A;  1Q35 A;  1VR5 A;  3ZKK A;  4GFR A;  1ZMG A;  1RKM A;  1N7W A;  1MPC A;  2GFE A;  4QHQ A;  5I58 B;  3K6X A;  3USD A;  4M4G A;  3OEK A;  2OJT A;  2OLB A;  3T96 B;  4GLI A;  5H8Q A;  1NFT A;  4C1U A;  1DOT A;  4DCY A;  4ECF A;  3SEV A;  3TTM A;  4YMA A;  3JV9 A;  3OO7 A;  4OEU A;  4OET A;  3TTR A;  3CG3 A;  2ZMB A;  4EDP A;  1N04 A;  2AYS A;  2O7I A;  3M3F A;  1A55 A;  4U1Z A;  1IQ7 A;  4G4P A;  4ZEB A;  1FW0 A;  3KSJ A;  1B05 A;  4IY5 A;  1US5 A;  3N5L A;  4KYS A;  4HCY A;  3LUY A;  4FEB A;  1H76 A;  3U92 A;  5H8F B;  2H25 A;  1CB6 A;  4Q30 B;  4YU0 A;  3KEI A;  4U4X A;  3IB2 A;  1NH7 A;  4N6P A;  3QK6 A;  3K1N A;  4ZZA A;  3C4M A;  5FHN A;  5DTB A;  1QVS A;  3O66 A;  2I58 A;  4F22 A;  3KN7 A;  1MY0 A;  4H67 A;  1PC3 A;  2DVC A;  1DSN A;  3K1M A;  4LQ5 A;  2ANJ A;  4MF3 A;  4HTG A;  5I59 B;  3DLN A;  3TKD A;  1UTB B;  2UYF A;  5CMC A;  3Q29 A;  4DZ1 A;  2O69 A;  3PGF A;  2DWH A;  3E9X A;  2AL4 A;  4R9F A;  5FTI A;  4LP2 B;  4KQP A;  1RYX A;  3LR1 A;  1AL3 A;  3KJT A;  3TAJ A;  2GHB A;  1MY2 A;  5DEX B;  3PMW A;  4QFK A;  4R6K A;  4R74 A;  5J1D A;  1URD A;  4YB7 A;  3I3V A;  3ZS6 A;  4F3S A;  3SER A;  2GH9 A;  2I49 A;  1A54 A;  4X48 A;  4PFW A;  2Y7R A;  1O7T A;  1MM6 A;  5EHM A;  2ESN A;  4TLM B;  1S50 A;  1DPP A;  1B1H A;  4MLV A;  1IUD A;  2PX1 A;  2PBW A;  1MXZ A;  5H8Q B;  1T0K A;  1USY H;  3H6W A;  1MM7 A;  2D5W A;  4JBZ A;  4IO3 A;  5I84 A;  4KFQ A;  4ZEK A;  5TPA A;  2DE2 A;  1LAX A;  1TFD A;  2Z22 A;  3MZB A;  1WDN A;  4IO2 A;  3TCG A;  5CMB A;  4EQB A;  4ZE8 A;  2XX9 A;  2I48 A;  1B32 A;  2QPQ A;  3ILU B;  3MPL A;  3TMG A;  4GD5 A;  3T93 B;  4I1D A;  4IGT A;  2OCU A;  3IAZ A;  4EUO A;  3R6U A;  1P1U A;  1EZO A;  1H45 A;  5FTH A;  2HZL A;  3G3J A;  3HST A;  1JEV A;  4F3G A;  3S9L C;  4ND9 A;  2DYX A;  3E3K A;  3EHT A;  3RNN A;  3IJO B;  5ISU A;  4KYD A;  1USY E;  5H8N B;  2XXI A;  4XXU A;  3MZ1 A;  1BLF A;  1PEB A;  1MQH A;  4H5F A;  3B7D A;  4ZDM A;  2UVI A;  3OD7 A;  2OK2 A;  3OXN A;  4UA8 A;  2Y84 A;  4KYE A;  3TUS A;  2XXX A;  4G8N A;  1VFE A;  1QKA A;  5TP9 A;  3PUY E;  3K1P A;  1I69 A;  3IL1 B;  1LB9 A;  2ZYO A;  4LQ2 A;  3OEM A;  1B2H A;  5HM4 B;  4PET A;  1R9L A;  2F34 A;  4LA9 A;  1SBP A;  1EZP A;  5I2N A;  5A5X A;  4BDN A;  4ELO A;  1N7X A;  2Y7I A;  4AQ4 A;  5EHS A;  4ELQ A;  2X7Q A;  1ANF A;  5M2V A;  2F7C A;  4G77 A;  4N13 A;  3ZKL A;  4BDO A;  4U1O A;  2F6G A;  1FQA A;  1ZIU A;  2G93 A;  2YPN A;  2VP1 A;  3LSF B;  2WKY A;  2QSX A;  1NNT A;  3FVG A;  3F11 A;  2BJJ X;  3UA8 A;  3BFT A;  1MH3 A;  2AIX A;  5TPA B;  2A5T A;  3A3C A;  4F3P A;  2HEU A;  4XKQ A;  2IA4 A;  3QAX A;  1BTJ A;  3LC8 A;  1IIT A;  2GRV A;  1R1N A;  3TTK A;  4R6H A;  1FTO A;  5JEI A;  4OQO A;  1FTL A;  2VGQ A;  1QUI A;  4IB2 A;  3UK4 A;  4KI0 E;  5K2X A;  3C34 A;  3K00 A;  4NED A;  2A5S A;  5F1Q A;  3LBS A;  4LAT A;  3P7I A;  3QSL A;  4KR5 A;  2E0S A;  2ZYK A;  1B3H A;  4BDQ A;  1EU8 A;  1P1O A;  3VXB A;  2PVU A;  1Z7M E;  2DWJ A;  2XXY A;  3HCQ A;  4MBP A;  1Y4C A;  1P1Q A;  3EN3 A;  2PMS A;  3JZJ A;  3ONM A;  1Y4T A;  1XOC A;  4P0G A;  3MVX A;  3C9H A;  2FNC A;  3MJN A;  2O84 X;  3HHF A;  3TTN A;  3VDF A;  1TXF A;  4AB5 A;  4XKN A;  1XHY A;  3FIR A;  2B65 A;  5I2N B;  2GHA A;  3AXF A;  2XHD A;  5A5X B;  3QXM A;  3SES A;  4GL0 A;  5L9M A;  1LLS A;  3TEL A;  3FV2 A;  3FAS A;  4MH5 A;  3DP4 A;  1OMP A;  1MRP A;  3MC2 A;  1B5H A;  3PPR A;  2RC9 A;  5I56 B;  1UIV A;  3HHG A;  3VVE A;  1I6B A;  2H5Y A;  2F78 A;  1NL5 A;  1LST A;  5L9S A;  1URS A;  2YJP A;  2ONS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...