3TTNA

Crystal structures of polyamine receptors spud and spue from pseudomonas aeruginosa
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
335
structure length
335
Chain Sequence
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyamine transport protein
publication title Structural Basis of Substrate Binding Specificity Revealed by the Crystal Structures of Polyamine Receptors SpuD and SpuE from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 114
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttnA02
4H67A 4FAJA 5ELVA 3B7DA 3K00A 4GIZA 3CI8A 3H06B 4ESWA 2THIA 3D4CA 4EDPA 4EQ9A 4R6HA 4OYVA 1P99A 5B7DA 2XX8A 1N7WA 3BBRA 5A5XA 3VXBA 2AYSA 2OZZA 4JWOA 2HFBA 4GL8A 4Q5TA 2F78A 3IOWA 3VLVA 2ZNTA 5H8SA 1NNTA 2H4IA 3AXFA 3G3HA 4F3SA 3ONMA 4OZ9A 1SW5A 3ODBA 2OK2A 2UXAA 3A09A 4OENA 3OD7A 4NTLA 1IXGA 4G68A 2Q89A 2VD2A 3HCQA 2V3UA 4KYDA 2RCBA 1I6AA 4YKJA 2UVIA 4ZZEA 4ELOA 3HPIA 3QAXA 2F6GA 4XKPA 1H43A 1SW4A 3G3IA 1MXYA 4I9DA 1URGA 2AL5A 3B6QA 2Z22A 2F36A 3SETA 5ITPA 3MVWA 1AOVA 5TP9B 3UA8A 3DP4A 1OVBA 2HCAA 2XXWA 2ONRA 4H5FA 4F29A 1O7TA 2GRVA 1FCKA 1SD3A 4AB5A 4C0RA 2DXYA 1NKXA 3M3KA 2DVCA 3FD3A 1MDQA 3VE1B 4QSDA 1LAGE 3U92A 3N6TA 2PT1A 2XXYA 1B5HA 4OMBA 4HS7A 4Q0CA 4BDRA 4TQUQ 1DMBA 2HAUA 1B40A 1S9TA 1GTKA 5JEIA 1II5A 5CMCA 4LVQA 1SQYA 2DOJA 4IO6A 5FTHA 2D5WA 5IKBA 1ZJLA 4QFOA 2B3BA 4GWOA 4NF6A 3EN3A 4F2QA 1FQCA 4F19A 3IB1A 4OFLA 3UK4A 4OERA 2GFEA 2M8CA 3PMXA 2Q2CA 3O29A 4PFTA 1WVJA 4Q30B 1UTHB 4H0WA 1AMFA 3K6XA 5K2XA 3PPPA 3D4GA 3IOVA 2DP8A 4U21A 2Z8FA 2H9BA 1Y4TA 2ANJA 1ATGA 1MH3A 1P1OA 1ANFA 2I6EA 2DE4A 3RY3A 2Z23A 3LUYA 1XOCA 4JDFA 2R9JA 3VFJA 1XVYA 4PQJA 2Y7PA 3TAJA 4NWDA 2H25A 2O7IA 3O28A 4I62A 3Q27A 1MQDA 4OXVA 4RYAA 3U72A 2H98A 3FGSA 3K1NA 2QRYA 3B6WA 4POWA 3IOTA 3Q29A 2ESNA 3PPNA 2ABHA 2I48A 3KN3A 3FVGA 1AIVA 3LBSA 4M4GA 2QS4A 2X7QA 4JXIA 3MVYA 4GL0A 5FHMA 4QRZA 2R6GE 3C34A 3EPEA 3LSLA 4IB2A 3S9EA 1O64A 1QKBA 2Q2AA 4DE8A 4BLAA 3HO7A 4PFWA 3U8QA 3IB2A 5EYFA 3PV0E 3MC2A 3K6UA 3E4RA 1TXFA 2I0CA 4EXKA 3KSXA 3ILUB 3FVNA 5DT6A 2FYIA 4U4XA 4M1VA 1O63A 1LSTA 4GXAA 1EU8A 2REJA 1Y4CA 2HAVA 3BFUA 2HZKA 1LGBC 3VVDA 3PU5A 4Z0IA 4KCDA 4DLDA 3CR9A 4U22A 2QMWA 5A5XB 1A8FA 4GVOA 4PFUA 4G2ZA 5TP9A 4YMAA 3Q26A 3VVEA 2B3FA 3OO8A 2ZNSA 1HSEA 5CRYA 3DLNA 2XX7A 3KOTA 1N76A 3LC8A 2O7UA 4ND9A 4LA9A 3S4UA 1Z7ME 4XTCQ 1FTJA 4UACA 4DIGA 1M5CA 1UTBA 3H3GA 2O68A 3KJTA 1IIWA 1YAEA 3EF7A 3E3KA 4IY5A 2PT2A 5I58A 4RA1A 5KDTB 3GBAA 3K2DA 1R1NA 4E0XA 4GFRA 4KR5A 4ECFA 3Q28A 1MQGA 5I2NA 3IORA 3S9MC 1JQFA 5B70A 3QUJA 3FV1A 2OWTA 2HZLA 1A99A 4LZ7A 3TODA 2V93A 4C1UA 3R7XA 3SEXA 1YCJA 1JW1A 3TCGA 2YLNA 3VV5A 2GHAA 1A40A 2OWSA 1M5DA 2VHAA 2XXXA 3PPRA 1NL5A 4YU0A 2F5XA 3FIRA 4WEDA 4JWYA 1B51A 3M8UA 2CMOA 4K3FA 1PC3A 4YKKA 4BDQA 4FEDA 1MY2A 3UP9A 3O6HA 3T9UA 3IR1A 3RUMA 1N3WA 1DTZA 3KN7A 1MS7A 4GRKA 3VLWA 5AE4A 3A3UA 1IQ7A 4ZE9A 1IXHA 4GQOA 2G29A 2E1SA 4R75A 2QJEA 2O84X 3RGYA 1JEVA 3MWBA 2Q8JA 2I4BA 1JW5A 1TFAA 4NF6B 3TEPA 1B7ZA 1B0LA 5DVJA 1I6BA 3PUWE 4G8HA 3MVZA 2DWIA 4QSCA 5AA2A 2B65A 4KPTA 3U1OA 2XXQA 2ZXTA 3H7MA 2UVHA 3P7IA 1SYHA 3OO7A 1IITA 1AL3A 3MVXA 5HM4B 3TELA 4Q8RA 5FTIA 4QFNA 4R6KA 2DS9A 4TLLB 2ALUA 4U4SA 1B46A 1A7LA 3S2VA 1NNKA 1PB8A 4YICA 1VFDA 4YB7A 2VGQA 1D3KA 5KZTA 1US4A 4R9GA 4NF4A 1XS5A 3K1PA 5KCJB 4TLMB 2W7YA 3WAFA 3SEVA 4LZ8A 3KZGA 1HSLA 5AA3A 2FNCA 5DVIA 1LBCA 3KEIA 1RYOA 4IO5A 1N0TA 4ZZAA 3ECRA 1EZ9A 1SW2A 2F7CA 2RF1A 1BKAA 1Y1ZA 1B3LA 3UORA 2P1SA 3IK6B 3QYTA 4I8CA 1POY1 3H6WA 2DE2A 2DSFA 1B3GA 3CG1A 2AL4A 5I57A 2OJTA 1UIVA 4THIA 4JSOA 3SEWA 4P0GA 4YKPA 3O9PA 2H99A 5KDTA 2DE3A 4NF5A 1MY1A 3FXUA 3C35A 3FVKA 3UGWA 4GXSB 3LSWA 1OLCA 3OSRA 1A8EA 1XT8A 4MLQA 4F18A 1YTVA 4HCYA 1MPBA 3SDFA 1JVYA 3ZS6A 2Y7WA 1FTOA 3O6GA 4R72A 4LATA 1I69A 5CBSA 2WKYA 5L9OA 4UA8A 3K0VA 3OEMA 1LAHE 1FQAA 4RK2A 1NMUA 5H8HA 1XHYA 4OQOA 4U23A 4YB5A 1UTBB 2GHBA 4DXBA 3T22A 3DELB 5DEXA 4H1XA 3MP1A 3IX1A 5I58B 1S7YA 5DYHA 2DWAA 1DSNA 1Q1KA 3IOUA 2XD3A 3OMBA 5I2NB 1M5FA 2Y84A 4ZEBA 4R2BA 2QS1A 2Q88A 3SKPA 2YJPA 4HW8A 3QSLA 1F9BA 4NEDA 1DOTA 1Y3NA 4NMYA 1PBPA 3FJ7A 1Y3QA 4MF3A 2HQ0A 4YAHX 3TTLA 1RKMA 3VDFA 4G68C 3HV1A 1N84A 1MDP1 3RN8A 1MXZA 3TCHA 2Z8EA 2QL3A 4MH5A 1ZU0A 3TFLA 1MXWA 1BIYA 3O6IA 4H8IA 3RTFB 2PYYA 4RPOA 2XXPA 1B5IA 3G7WA 3ZSFA 4EF1A 4MBPA 4E0WA 3G3FA 4X9TA 1B3EA 3KFMA 3V8XB 3K01A 5DVFA 4ELQA 1LLSA 3QUFA 4JWXA 5JTYA 3F11A 4DZ1A 1EH3A 5KCJA 4POXA 3KGCA 2XXRA 3M3FA 4U1ZA 3V89B 1LB9A 3MPKA 3VXCA 1B3HA 5J1DA 5AA4A 5AA2B 4IO2A 5CMKA 3SESA 1NFTA 1TWYA 4OETA 2ZNUA 1BLFA 2RC7A 2F8DA 1SDXA 3CVGA 4X1DA 1R9LA 4RXLA 3U93A 3IJOB 3G3JA 4XKNA 4WXJA 2QMXA 1POTA 5IAIA 4QFPA 1S50A 3TQLA 3PUXE 4OWDA 2DWJA 4OEVA 1SW1A 2FA7A 3OEKA 1ZTYA 1FTKA 4N13A 4NF4B 2I4CA 2NOOA 3HHFA 4R2FA 3K02A 1B9JA 1MXVA 1FW0A 3CSGA 2F35A 2RC8A 4FJPA 3FASA 4EQ7A 1B1XA 3ZKLA 5I84A 3CFXA 4C1TA 4G77A 1LB8A 1LAXA 3PGFA 3EHSA 4IGRA 5BWJA 4ZEKA 1LCFA 2YPNA 4PE5B 1B0HA 3OELA 1Y20A 1WDNA 5ISUA 5CC2A 2I49A 3G3GA 4P11A 3TYHA 2NWJA 1WODA 5I57B 1URSA 3KG2A 4LQ5A 4R74A 2BJJX 4ESXA 4NWCA 3T9HB 3MZBA 4H6DA 4OFJA 1PEBA 1T0KA 2UYFA 1H44A 4YKIA 4NF5B 1A55A 5H8QA 2RKMA 1USYE 4EXLA 4AQ4A 1A54A 5AA2D 2V3TA 3ZKKA 1B7HA 2ZYOA 4BDMA 1MM6A 2CZLA 3DP8A 3VLUA 1P1WA 1PDAA 4BDLA 2R71A 3H03A 3H6TA 4Z7EA 2XXVA 5TPAA 3BKIB 3LR1A 4XIGQ 4RNSA 3GXAA 5I59A 1VFEA 3TKDA 3V5AA 5ICQA 3TDJA 3PUZE 1OQGA 2V3QA 2OBGA 1ZIUA 3K6VA 2PBWA 5H8HB 1FTLA 1OVTA 3QXMA 2V84A 5DEXB 3R26A 1H45A 2ZYMA 4KCCA 4WEPA 1GVCA 4ZS9A 1KWHA 1NH8A 2UYEA 3T93B 4QFKA 1PBQA 4IO7A 2F97A 3TTNA 5L9MA 4OTEA 1LFIA 2I3WA 1B6HA 2VD3A 1MPDA 1JEUA 5M2VA 1Y1MA 5EHMA 3SERA 4KFQA 2DQVA 4ZEFA 3USDA 3RT6B 1QW0A 3JV9A 1B4ZA 1PB9A 5HBCA 3SEUA 3KSJA 4DXCA 3OO9A 3E9XA 3RTWB 1CB6A 3RT8A 1FQFA 4IO3A 3GBBA 1VR5A 1MY4A 4PETA 3L6GA 2XXUA 3M3LA 3OENA 1FQBA 4N07A 3FJGA 5HPQA 3TZAA 3HN0A 3IO4A 1MPCA 1VSOA 4KYSA 4GOTA 3FXQA 4F2OA 4KHZE 1J1NA 1QVSA 5I56A 1FQEA 2D3IA 3BFTA 5ITOA 4F22A 2XX9A 4R9FA 4LZ5A 2DVZA 4U1OA 3FXRA 5JTYB 2QS3A 1MXXA 2I0BA 1Z7NE 1QUKA 3O2AA 4F31B 4O3BA 4PFYA 3N94A 5CMBA 1B1HA 3TQWA 1B7UA 1N04A 5H8NA 3MP6A 1MM7A 4DCXA 4P0IA 3CIJA 3I5OA 3MZ1A 4X1BA 5AA4B 4RPNA 3KBRA 4OVJA 1SYIA 1PB7A 3CRBA 4OESA 4G8NA 1MQJA 3O66A 4BDNA 4O3CA 1EZPA 2DWHA 4L17A 5ICTA 1GGGA 3N26A 4RY1A 3T96B 4R6YA 4GD5A 2QS2A 4F39A 1TT1A 3OO6A 4JSDA 2NUVA 4AB6A 4OHNA 1NH7A 2O6AA 1URDA 2QPQA 3LSFB 3W15C 2H5YA 1NNPA 3CSBA 2O51A 3QIMA 5CM6A 4HCWA 3DM0A 3FJMA 1Q35A 2NVUB 1R9QA 1B5JA 4DDDA 2ZYKA 3TPAA 4LONB 4H5GA 3PUYE 3FVOA 2UVJA 3DP6A 2DXRA 1MQIA 1FQDA 4LUBA 3W9VA 2OLBA 4QSEA 5I2KB 4ZE8A 4H8JA 4FECA 3I6VA 1YPNA 1ZMGA 1UQWA 2REGA 3MP8A 3UIFA 1US5A 2F34A 4EQBA 3EQ1A 1MXUA 3FATA 4YMBA 1OIBA 5CMMA 1B52A 3KJ7A 4ZDMA 2RCAA 1CE2A 3C33A 5H8FA 3TTRA 4KD5A 3JYRA 5H8QB 3EHUA 2XHDA 3TUSA 3FUZA 1M5EA 1MY3A 4EF2A 4IO4A 2QSXA 3IO6A 2UVGA 4MFIA 2A5TA 2ZYNA 5TPAB 1SI1A 4LQ2A 3H6VA 1IXIA 5I59B 1JVXA 4XKQA 2O69A 3WAEA 1LFGA 4H65A 1LFHA 1IUDA 1AH5A 1XVXA 2F7BA 4FORA 4O3AA 4N6PA 5EHSA 3U94A 1QJMA 3W9WA 1FTMA 4R73A 1P1QA 3EHTA 2Z8DA 2F7AA 3GZGA 2O1MA 1OLAA 3ILTB 2XXTA 3PPOA 5JK4A 3GLBA 3I3VA 4HTGA 3T9XB 4RK9A 1Y3PA 4ZEDA 3K1MA 1EZOA 2I3VA 4NF8A 5K2YA 2D21A 3FV2A 5FHOA 4DXUA 5FHNA 4OEUA 3RPWA 4JB7A 3T9VA 4QF9A 3IB0A 1JW4A 1LCTA 3C32A 1IEJA 3Q25A 4KQPA 3IL1B 5DTBA 4TOZA 3LSXA 2A5SA 1H76A 1JNFA 3PUVE 2AIXA 1OQHA 1N7XA 2P0SA 1N3XA 3TTKA 1MY0A 4FATA 5L9SA 1XC1A 5F7VA 4F1UA 5AA1A 5I56B 1GR2A 4NE4A 3PMWA 1GV8A 1TFDA 1P1UA 4FE8A 3C36A 4F1VA 4ZECA 1D4NA 1MQHA 1SI0A 2V25A 3A3CA 1IZ1A 4QHQA 2Y7KA 2OCUA 2RC9A 1ELJA 1VE4A 1D9YA 5H8NB 1JETA 4ELRA 4G8MA 1ZLQA 3MAMA 1B58A 1ZKBA 1DTGA 1P1NA 1SVXB 5I2KA 5CBRA 4IGTA 4XXUA 3JZJA 2X7PA 1QUIA 3RNNA 1USYH 1LAFE 4PP0A 2XXIA 4WKMA 3MJNA 3TMGA 1UIUA 4YZZA 3QK6A 3HSTA 3THIA 4EUOA 2GH9A 3T66A 3N5LA 1B2HA 1I6QA 2VP1A 3V83A 3MBPA 4F3PA 3MZ9A 1D9VA 1RYXA 1OMPA 3RLFE 1B4HA 4BDOA 4G68B 3HHGA 2O1LA 2E0SA 1IXCA 3K4UA 5F1QA 1ZBMA 2IEEA 3H6UA 3H4ZA 2HEUA 4ELPA 4LP2B 3MPLA 3PPQA 3FZVA 4KI0E 1B3FA 4YB6A 3MQ9A 3S9NC 3OSQA 2G93A 3OOAA 2PVUA 4FEBA 2Y7RA 3S9LC 4ISUA 3C4MA 2XXHA 4F3GA 5H8FB 1BTJA 4U2RA 4I1DA 3O97A 3MUQA 3RQTA 1B32A 2NXOA 2DYXA 4MLVA 1QULA 2ONSA 2IA4A 1UTHA 4KYEA 3KN8A 3UN6A 2A5TB 2PMSA 2P2AA 2LAOA 3VVFA 4F3BA 1Y9UA 3KOSA 2PX1A 3TCFA 4JBZA 3MW0A 4ZEIA 1MRPA 4ONYA 2X26A 4OFOA 2KLFA 4GF8A 3B6TA 4GLIA 2ZMBA 3CFLA 4G4PA 5BUUA 5TU0A 2RINA 1QKAA 3IJXB 1R6ZA 5CI5A 3E13X 5L8DA 2Q9TA 3OXNA 3PD8A 2VOZA 4XKRA 4FIMA 1DPPA 4NF8B 4IY6A 3G3KA 1MH4A 4RJZA 1L5TA 1M5BA 3C9HA 1LBBA 1DPEA 4F1YA 1QUJA 1NNFA 1H3DA 3IAZA 3R6UA 4DCYA 5LOMA 3TTMA 2XD2A 3L6HA 2I58A 4QFLA 1MG1A 3C31A 1HSJA 3K6WA 1BP5A 2F6PA 2Y7IA 3SEYA 2HXWA 3PD9A 2ONKE 3N6UA 3CFZA 3PMVA 3CG3A 1SBPA 1B05A 4X48A
chains in the Genus database with same CATH superfamily
4H67A 4FAJA 5ELVA 3B7DA 3K00A 2OX3A 5DW8A 2ZZVA 4GIZA 3CI8A 1IMEA 3H06B 4ESWA 2THIA 3D4CA 4EDPA 4EQ9A 4R6HA 4OYVA 1P99A 5B7DA 2XX8A 1N7WA 3BBRA 5A5XA 3VXBA 2AYSA 2OZZA 4JWOA 2HFBA 4GL8A 4Q5TA 4NAPA 2F78A 3IOWA 3VLVA 2ZNTA 5H8SA 1NNTA 2H4IA 1AWBA 3AXFA 1FTAA 3G3HA 1LBZA 4F3SA 3ONMA 4OZ9A 1SW5A 3ODBA 4NGUA 2GQ1A 2OK2A 2UXAA 3A09A 4OENA 4PF6A 3OD7A 4H46A 4NTLA 1IXGA 4G68A 2Q89A 1EYJA 2CZIA 2DDKA 2VD2A 3HCQA 2V3UA 4KYDA 2RCBA 1I6AA 4YKJA 2UVIA 4ZZEA 4ELOA 3HPIA 3QAXA 1JP4A 2QVUA 2F6GA 4XKPA 1H43A 1SW4A 3G3IA 1MXYA 4I9DA 2B4MA 1URGA 1NV1A 1KA1A 2AL5A 3B6QA 2Z22A 2F36A 3SETA 5ITPA 3MVWA 1AOVA 5TP9B 3UA8A 3DP4A 1OVBA 2HCAA 2XXWA 4HE0A 4P3LA 1BK4A 2ONRA 1KZ8A 4H5FA 4F29A 1O7TA 2GRVA 1FCKA 4MAGA 3GYYA 4PDHA 1SD3A 4AB5A 4C0RA 2DXYA 1NKXA 3M3KA 2DVCA 3FD3A 1MDQA 2R8TA 3VE1B 4AS4A 4QSDA 1LAGE 3U92A 3N6TA 2PT1A 2XXYA 1B5HA 4QXDA 4OMBA 2Y5LA 4HS7A 4Q0CA 4BDRA 1NI9A 4TQUQ 1DMBA 2XWIA 2HAUA 1B40A 1S9TA 1GTKA 5JEIA 1II5A 5CMCA 4LVQA 1SQYA 2DOJA 4IO6A 5FTHA 2D5WA 4O7MA 5IKBA 1ZJLA 1FPFA 3D1RA 4QFOA 2B3BA 4GWOA 4NF6A 3EN3A 4F2QA 1FQCA 4P47A 4F19A 3IB1A 4OFLA 3B8BA 3UK4A 4OERA 2GFEA 2M8CA 3PMXA 2Q2CA 3O29A 4PFTA 5EQ7A 1WVJA 4Q30B 4JVDA 4JVCA 1UTHB 4H0WA 1AMFA 3K6XA 4GX4A 5K2XA 3PPPA 3D4GA 3IOVA 2DP8A 4U21A 2Z8FA 2H9BA 1Y4TA 2ANJA 1ATGA 1MH3A 1P1OA 1ANFA 2I6EA 2DE4A 5ET8A 3RY3A 2Z23A 3LUYA 1XOCA 4JDFA 2R9JA 3VFJA 1IMCA 1XVYA 4PQJA 2Y7PA 3TAJA 4NWDA 2H25A 2O7IA 3O28A 4I62A 3Q27A 1MQDA 4OXVA 4RYAA 4N91A 3U72A 4KXPA 4N4UA 2H98A 2Q74A 3FGSA 3K1NA 1FSAA 1NUWA 2QRYA 3B6WA 4POWA 3IOTA 3Q29A 2ESNA 4O7IA 3PPNA 2ABHA 2I48A 3MSTA 3KN3A 3FVGA 1AIVA 3LBSA 4M4GA 3RPLB 2QS4A 2X7QA 4JXIA 3MVYA 4GL0A 5FHMA 4QRZA 2R6GE 3C34A 3EPEA 3LSLA 4IB2A 3S9EA 1O64A 1QKBA 2Q2AA 4DE8A 4BLAA 3HO7A 4HE1A 2MKZA 4PFWA 3U8QA 3IB2A 5EYFA 3PV0E 3MC2A 3K6UA 3E4RA 1TXFA 2I0CA 1FBPA 4EXKA 3KSXA 3ILUB 3FVNA 1YYZA 5DT6A 2FYIA 4U4XA 4M1VA 1O63A 1LSTA 4GXAA 1EU8A 2REJA 1Y4CA 4GBVA 2XA5A 2FIXA 2HAVA 3BFUA 2HZKA 1LGBC 3VVDA 3PU5A 4Z0IA 4KCDA 4DLDA 3CR9A 4U22A 2QMWA 5A5XB 1A8FA 4GVOA 4PFUA 4G2ZA 5TP9A 4YMAA 3Q26A 3VVEA 2B3FA 3OO8A 2ZNSA 1NUXA 1HSEA 5CRYA 3DLNA 2XX7A 3KOTA 1N76A 3LC8A 2O7UA 4ND9A 2KR0A 4LA9A 3S4UA 1Z7ME 4XTCQ 1FTJA 4UACA 4DIGA 1M5CA 1UTBA 3H3GA 2O68A 3KJTA 1IIWA 1YAEA 3EF7A 2XWOA 3E3KA 4IY5A 2PT2A 5I58A 4RA1A 5KDTB 4N6KA 3GBAA 3K2DA 1R1NA 4PFRA 4E0XA 4GFRA 4KR5A 4ECFA 3Q28A 1MQGA 5I2NA 1LBXA 3IORA 3S9MC 1JQFA 5B70A 3QUJA 3FV1A 5ET6A 2OWTA 2HZLA 4LZ7A 1A99A 3TODA 2V93A 4C1UA 3R7XA 3SEXA 1YCJA 1JW1A 2KQZA 3TCGA 2YLNA 3VV5A 2GHAA 1A40A 2OWSA 1M5DA 2VHAA 2PFYA 3IFAA 2XXXA 3PPRA 4PE3A 1NL5A 4YU0A 4PCDA 2F5XA 3FIRA 4WEDA 4JWYA 1B51A 3M8UA 2CMOA 4K3FA 1DCUA 4P1EA 1PC3A 4YKKA 4BDQA 4FEDA 4N8GA 5T3JA 4H45A 1MY2A 3UP9A 3O6HA 3T9UA 3IR1A 3RUMA 4NQ8A 1N3WA 1DTZA 3KN7A 2B4LA 1MS7A 4GRKA 3VLWA 1NV6A 5AE4A 3A3UA 1IQ7A 4ZE9A 4DI4B 1IXHA 4GQOA 4NN3A 5IZ3A 2G29A 2E1SA 4R75A 4LN5A 2QJEA 2O84X 3RGYA 1JEVA 3MWBA 2Q8JA 2I4BA 1JW5A 4OVRA 1TFAA 3KC1A 4NF6B 3TEPA 1B7ZA 1B0LA 5DVJA 1I6BA 3PUWE 4G8HA 3MVZA 2DWIA 4N17A 4QSCA 5AA2A 1LBWA 2B65A 4KPTA 3U1OA 2XXQA 2ZXTA 3H7MA 2UVHA 2Q8MA 3P7IA 1FBDA 1SYHA 3OO7A 1IITA 1AL3A 3MVXA 5HM4B 3TELA 1NV3A 2Y5KA 4Q8RA 5FTIA 4QFNA 1FJ9A 4R6KA 2DS9A 4TLLB 2ALUA 4U4SA 1B46A 1A7LA 3S2VA 1NNKA 1PB8A 4PAFA 1FPGA 4YICA 1VFDA 4YB7A 2VGQA 1D3KA 5KZTA 1US4A 4R9GA 4NF4A 1XS5A 3K1PA 5KCJB 4TLMB 2W7YA 3WAFA 3SEVA 4LZ8A 3KZGA 4GWSA 1HSLA 5AA3A 2FNCA 5DVIA 1LBCA 3KEIA 1RYOA 4IO5A 1N0TA 4ZZAA 3ECRA 1EZ9A 1G0IA 1SW2A 2F7CA 2RF1A 1BKAA 1Y1ZA 1B3LA 3UORA 2P1SA 3IK6B 3QYTA 4I8CA 1POY1 3H6WA 2DE2A 1FPIA 4PAIA 2DSFA 2WX9A 1B3GA 3CG1A 2AL4A 5I57A 4PC9A 2OJTA 1UIVA 4THIA 4JSOA 3SEWA 2PFZA 2FIEA 4P0GA 4YKPA 3O9PA 2H99A 5KDTA 2DE3A 4NF5A 1MY1A 3FXUA 5I7IA 3C35A 1FJ6A 3FVKA 3UGWA 4GXSB 3LSWA 1OLCA 3OSRA 1A8EA 1XT8A 4MLQA 5LDZA 4F18A 1YTVA 2OWZA 4HCYA 1MPBA 3SDFA 1JVYA 3ZS6A 5IZZA 2Y7WA 1FTOA 3O6GA 4R72A 4LATA 1I69A 1IMDA 5CBSA 2WKYA 5L9OA 4FBPA 4UA8A 2VPOA 3K0VA 3OEMA 1LAHE 1FQAA 3EKIA 4RK2A 1NMUA 5H8HA 1XHYA 4OQOA 1FPBA 4U23A 4N81A 4YB5A 5ET7A 1UTBB 2GHBA 4DXBA 3T22A 3DELB 5DEXA 3KBZA 4H1XA 2XWVA 3MP1A 3IX1A 5I3SA 5I58B 1S7YA 4OVTA 5DYHA 2DWAA 1DSNA 1Q1KA 3IOUA 2XD3A 3OMBA 4N6DA 5I2NB 5ET5A 1M5FA 2Y84A 2CZHA 2HHMA 4ZEBA 4R2BA 2QS1A 2Q88A 3SKPA 4I3EA 2YJPA 4HW8A 3QSLA 1F9BA 4MNIA 4NEDA 1DOTA 1Y3NA 4NMYA 1PBPA 3FJ7A 1Y3QA 4MF3A 2HQ0A 4PFBA 4YAHX 3TTLA 1RKMA 3VDFA 4G68C 3HV1A 1N84A 1MDP1 4GWWA 3RN8A 1MXZA 3TCHA 2Z8EA 2QL3A 4MH5A 1ZU0A 3TFLA 1MXWA 3ROJA 1BIYA 3O6IA 4H8IA 3RTFB 2PYYA 4RPOA 2XXPA 3CHGA 4AS5A 1B5IA 3G7WA 3SZPA 3ZSFA 1FBFA 4EF1A 4MBPA 4E0WA 4PBQA 3G3FA 1Q9DA 4X9TA 1B3EA 3KFMA 3V8XB 3K01A 5DVFA 4ELQA 1LLSA 3QUFA 4JWXA 5JTYA 3F11A 2XXKA 5IZ3B 4DZ1A 1EH3A 5KCJA 4POXA 3KGCA 2BJIA 2XXRA 3M3FA 4U1ZA 3V89B 1NV7A 1LB9A 3MPKA 5EQAA 3VXCA 1B3HA 5J1DA 1LBVA 2QFLA 3U65A 5AA4A 5AA2B 4IO2A 5CMKA 3SESA 1NFTA 1TWYA 4OETA 2ZNUA 1BLFA 2RC7A 2F8DA 1SDXA 3CVGA 4UABA 4X1DA 1R9LA 4RXLA 4MJOA 3U93A 3IJOB 3G3JA 4XKNA 1EYKA 4WXJA 2QMXA 4MCOA 1POTA 5IAIA 4QFPA 1S50A 3TQLA 3PUXE 4OWDA 2DWJA 4OEVA 1SW1A 2FA7A 3OEKA 1ZTYA 1FTKA 4HE2A 4N13A 2HXRA 5IZ1A 4NF4B 1FPEA 2I4CA 2NOOA 3HHFA 4R2FA 3K02A 2VT5A 1B9JA 1MXVA 1FW0A 3CSGA 2F35A 2RC8A 4FJPA 3FASA 4EQ7A 1B1XA 3ZKLA 5I84A 3CFXA 4C1TA 4G77A 1LB8A 1LAXA 3PGFA 3EHSA 4IGRA 5BWJA 4GWZA 4ZEKA 3E78A 4O94A 1LCFA 2YPNA 4PE5B 5J16A 1B0HA 1RDZA 4OA4A 3OELA 1Y20A 1WDNA 5ISUA 5CC2A 2I49A 3G3GA 4P11A 3TYHA 2NWJA 1WODA 5I57B 1URSA 3KG2A 4LQ5A 4R74A 3FXBA 1IMBA 2BJJX 4ESXA 1CNQA 4NWCA 3T9HB 3MZBA 4H6DA 4OFJA 1D9QA 1PEBA 1T0KA 2UYFA 1H44A 4YKIA 4NF5B 3BIHA 2CEXA 1A55A 5H8QA 4GWXA 2RKMA 1USYE 4EXLA 4AQ4A 1A54A 5AA2D 2V3TA 4HXVA 3ZKKA 1B7HA 2ZYOA 4BDMA 1MM6A 2CZLA 3DP8A 3T0JA 3VLUA 1P1WA 1PDAA 4BDLA 2R71A 3H03A 1FBGA 3H6TA 4Z7EA 2XXVA 5LTCA 5TPAA 4GBWA 3BKIB 3LR1A 4XIGQ 4RNSA 3GXAA 5I59A 1VFEA 3TKDA 3V5AA 5ICQA 3TDJA 3ISPA 3PUZE 3RYDA 1OQGA 2V3QA 2OBGA 4OVPA 4P1LA 1ZIUA 3K6VA 2PBWA 5H8HB 1FTLA 4NG7A 1OVTA 1FPDA 3QXMA 5EQ8A 2V84A 4OVSA 5DEXB 3R26A 1H45A 2ZYMA 2ZZWA 4KCCA 4WEPA 1GVCA 4ZS9A 1KWHA 1NH8A 2UYEA 3T93B 1QGXA 4QFKA 1PBQA 4IO7A 2F97A 3TTNA 5L9MA 4OTEA 1LFIA 2I3WA 1B6HA 2VD3A 1MPDA 1JEUA 5M2VA 1Y1MA 3PTYA 4PBHA 5EHMA 3SERA 4KFQA 2DQVA 4ZEFA 3USDA 3RT6B 1QW0A 3HFUA 3JV9A 4P56A 1B4ZA 1PB9A 5HBCA 3SEUA 4NHBA 1LBYA 3KSJA 4IR8A 4DXCA 1NV5A 3OO9A 3E9XA 3RTWB 1CB6A 3RT8A 1FQFA 4IO3A 3GBBA 1VR5A 1MY4A 4PETA 1KA0A 3L6GA 2XXUA 2ZZXA 3M3LA 3OENA 1FQBA 4PGNA 4N07A 3FJGA 3BIGA 5HPQA 3TZAA 3HN0A 3IO4A 1MPCA 3LV0A 1VSOA 4KYSA 3MYUA 4GOTA 3FXQA 4JVIA 4F2OA 4KHZE 1J1NA 1QVSA 2P3VA 5I56A 1FQEA 2D3IA 3BFTA 2WBBA 5ITOA 4F22A 2XX9A 4R9FA 4LZ5A 2DVZA 4XEQA 4U1OA 3FXRA 2QS3A 5JTYB 1MXXA 2I0BA 1Z7NE 1QUKA 3O2AA 4F31B 4O3BA 2L5VA 4PFYA 3N94A 5CMBA 1B1HA 3TQWA 1B7UA 1N04A 1FBHA 1VDWA 5H8NA 3MP6A 1MM7A 4DCXA 4P0IA 3CIJA 3I5OA 3MZ1A 4X1BA 5AA4B 4RPNA 4X8RA 3KBRA 4OVJA 1SYIA 4O8MA 1PB7A 3CRBA 4OESA 4G8NA 1MQJA 3O66A 4BDNA 4O3CA 5IGAA 1EZPA 1G0HA 2DWHA 4L17A 5ICTA 1GGGA 3N26A 4RY1A 3T96B 1LEVA 4R6YA 4GD5A 2QS2A 4F39A 1TT1A 1FRPA 3OO6A 4JSDA 2NUVA 4AB6A 4OHNA 1NH7A 2O6AA 4PF8A 1URDA 2QPQA 4MEVA 3LSFB 3W15C 2H5YA 1NNPA 5IM2A 3CSBA 2O51A 3QIMA 5CM6A 4N15A 4HCWA 3DM0A 3FJMA 1Q35A 2NVUB 1R9QA 1B5JA 4DDDA 2ZYKA 3TPAA 4LONB 4H5GA 3PUYE 3FVOA 4GX3A 2UVJA 3DP6A 4MNCA 2DXRA 1MQIA 2CEYA 1FQDA 4LUBA 3W9VA 2OLBA 4GWYA 4QSEA 5I2KB 4ZE8A 4H8JA 4FECA 4OANA 3I6VA 1YPNA 1FPKA 2WEFA 1ZMGA 1UQWA 2REGA 3MP8A 3UIFA 1US5A 2F34A 4EQBA 3FBPA 3EQ1A 1MXUA 3FATA 1K9ZA 4YMBA 1OIBA 3QMFA 5CMMA 1B52A 3KJ7A 4ZDMA 2RCAA 1CE2A 3C33A 5H8FA 2QVVA 3TTRA 4KD5A 2F3BA 3JYRA 5H8QB 3EHUA 2XHDA 3TUSA 3FUZA 1M5EA 1NV0A 1MY3A 4EF2A 4IO4A 2JJKA 4NX1A 2QSXA 3IO6A 2UVGA 2VPNA 1IMAA 4MFIA 2A5TA 2ZYNA 4NF0A 5TPAB 1SI1A 4LQ2A 3H6VA 4MX6A 1IXIA 5I59B 1JVXA 4XKQA 2O69A 1SPIA 5EYGA 2FHYA 3WAEA 3A29A 1LFGA 4H65A 1LFHA 1IUDA 1AH5A 1NV2A 4PFIA 1XVXA 2F7BA 4FORA 4O3AA 4N6PA 5EHSA 3NOHA 3U94A 1YXIA 1QJMA 3W9WA 1FTMA 4R73A 1P1QA 3EHTA 2Z8DA 2F7AA 3GZGA 2V4CA 2O1MA 1OLAA 2CZKA 3ILTB 2XXTA 3PPOA 5JK4A 3GLBA 3I3VA 4HTGA 3T9XB 4RK9A 1Y3PA 4ZEDA 3K1MA 1EZOA 2I3VA 4NF8A 3LUZA 5K2YA 2D21A 3FV2A 5FHOA 4DXUA 5FHNA 4DI3D 4OEUA 1NV4A 3RPWA 4PAKA 4JB7A 3T9VA 4QF9A 3IB0A 1EYIA 1JW4A 1LCTA 1XI6A 3C32A 1IEJA 3Q25A 4KQPA 3IL1B 5DTBA 4TOZA 5EQ9A 3LSXA 2A5SA 1H76A 1JNFA 1NUYA 4PTKA 3PUVE 2AIXA 5A5LA 1OQHA 1N7XA 4I3YA 2P0SA 1N3XA 3TTKA 1MY0A 4FATA 5L9SA 1XC1A 5F7VA 4F1UA 3T1BA 4XFEA 5AA1A 5I56B 1GR2A 4NE4A 3PMWA 1GV8A 1TFDA 1P1UA 4FE8A 3C36A 4F1VA 4ZECA 1D4NA 1MQHA 1SI0A 2V25A 4GX6A 3A3CA 1IZ1A 4MIJA 4QHQA 2Y7KA 4PDDA 1DK4A 2OCUA 2RC9A 1ELJA 1VE4A 1D9YA 5H8NB 1JETA 4ELRA 4G8MA 1FPJA 1ZLQA 3MAMA 1B58A 1ZKBA 4MNPA 1DTGA 1P1NA 1SVXB 5I2KA 5CBRA 1FBCA 4GWUA 4IGTA 4XXUA 3JZJA 2X7PA 1QUIA 2F3DA 3IFCA 3RNNA 1USYH 1LAFE 4PP0A 2XWKA 1NUZA 2XXIA 4WKMA 3MJNA 3TMGA 1UIUA 1FBEA 4XF5A 4P9KA 4YZZA 5ESYA 3QK6A 3HSTA 3THIA 4EUOA 2GH9A 5EYHA 3N5LA 3T66A 1B2HA 1I6QA 2FVZA 2VP1A 3V83A 3MBPA 4F3PA 3MZ9A 1D9VA 1RYXA 1OMPA 3RLFE 2P3NA 3KC0A 1B4HA 4BDOA 4G68B 3HHGA 2O1LA 2E0SA 1IXCA 3K4UA 5F1QA 1ZBMA 2IEEA 3H6UA 3H4ZA 2HEUA 4ELPA 4LP2B 3MPLA 3PPQA 3FZVA 4KI0E 1B3FA 4YB6A 3MQ9A 3S9NC 3OSQA 2G93A 3OOAA 2PVUA 1RDYA 4FEBA 4PGPA 2Y7RA 4OVQA 3S9LC 4ISUA 5I5PA 3C4MA 2XXHA 4G61A 1YZ0A 4F3GA 5H8FB 1DBZA 4MHFA 1BTJA 4U2RA 4I1DA 3O97A 3MUQA 2WYKA 3RQTA 1B32A 2NXOA 2DYXA 4MLVA 1QULA 4MMPA 2ONSA 2IA4A 1UTHA 4KYEA 3E79A 3KN8A 1RDXA 3UN6A 2A5TB 1K9YA 2PMSA 2P2AA 2LAOA 3VVFA 4P8BA 4F3BA 1Y9UA 5FBPA 2FBPA 3KOSA 2PX1A 3TCFA 4JBZA 3MW0A 4ZEIA 1MRPA 4ONYA 2X26A 2PCRA 4X04A 4OFOA 2KLFA 4GF8A 3B6TA 4GLIA 2ZMBA 3CFLA 4G4PA 5BUUA 4QBAA 5TU0A 2RINA 1QKAA 3IJXB 1R6ZA 5CI5A 3E13X 5L8DA 2WBDA 2Q9TA 3OXNA 4I40A 1INPA 2HPGA 3PD8A 5F24A 2VOZA 4XKRA 4FIMA 3RPLA 1DPPA 4NF8B 4IY6A 4RJZA 3G3KA 1MH4A 2WYPA 1L5TA 1M5BA 3C9HA 1LBBA 1DPEA 4F1YA 1QUJA 1NNFA 1H3DA 3IAZA 3R6UA 4DCYA 5LOMA 3TTMA 2XD2A 4N8YA 1IMFA 1FPLA 3L6HA 3B50A 2I58A 4QFLA 1MG1A 3C31A 1HSJA 3K6WA 1BP5A 2F6PA 2Y7IA 3SEYA 2HXWA 2QVRA 3PD9A 2ONKE 3N6UA 3CFZA 3PMVA 3CG3A 1SBPA 1B05A 4X48A
chains in the Genus database with same CATH topology
4H67A 4FAJA 5ELVA 3B7DA 3K00A 4GIZA 3CI8A 3H06B 4ESWA 2THIA 3D4CA 4EDPA 4EQ9A 4R6HA 4OYVA 1P99A 5B7DA 2XX8A 1N7WA 3BBRA 5A5XA 3VXBA 2AYSA 2OZZA 4JWOA 2HFBA 4GL8A 4Q5TA 2F78A 3IOWA 3VLVA 2ZNTA 5H8SA 1NNTA 2H4IA 3AXFA 3G3HA 4F3SA 3ONMA 4OZ9A 1SW5A 3ODBA 2OK2A 2UXAA 3A09A 4OENA 3OD7A 4NTLA 1IXGA 4G68A 2Q89A 2VD2A 3HCQA 2V3UA 4KYDA 2RCBA 1I6AA 4YKJA 2UVIA 4ZZEA 4ELOA 3HPIA 3QAXA 2F6GA 4XKPA 1H43A 1SW4A 3G3IA 1MXYA 4I9DA 1URGA 2AL5A 3B6QA 2Z22A 2F36A 3SETA 5ITPA 3MVWA 1AOVA 5TP9B 3UA8A 3DP4A 1OVBA 2HCAA 2XXWA 2ONRA 4H5FA 4F29A 1O7TA 2GRVA 1FCKA 1SD3A 4AB5A 4C0RA 2DXYA 1NKXA 3M3KA 2DVCA 3FD3A 1MDQA 3VE1B 4QSDA 1LAGE 3U92A 3N6TA 2PT1A 2XXYA 1B5HA 4OMBA 4HS7A 4Q0CA 4BDRA 4TQUQ 1DMBA 2HAUA 1B40A 1S9TA 1GTKA 5JEIA 1II5A 5CMCA 4LVQA 1SQYA 2DOJA 4IO6A 5FTHA 2D5WA 5IKBA 1ZJLA 4QFOA 2B3BA 4GWOA 4NF6A 3EN3A 4F2QA 1FQCA 4F19A 3IB1A 4OFLA 3UK4A 4OERA 2GFEA 2M8CA 3PMXA 2Q2CA 3O29A 4PFTA 1WVJA 4Q30B 1UTHB 4H0WA 1AMFA 3K6XA 5K2XA 3PPPA 3D4GA 3IOVA 2DP8A 4U21A 2Z8FA 2H9BA 1Y4TA 2ANJA 1ATGA 1MH3A 1P1OA 1ANFA 2I6EA 2DE4A 3RY3A 2Z23A 3LUYA 1XOCA 4JDFA 2R9JA 3VFJA 1XVYA 4PQJA 2Y7PA 3TAJA 4NWDA 2H25A 2O7IA 3O28A 4I62A 3Q27A 1MQDA 4OXVA 4RYAA 3U72A 2H98A 3FGSA 3K1NA 2QRYA 3B6WA 4POWA 3IOTA 3Q29A 2ESNA 3PPNA 2ABHA 2I48A 3KN3A 3FVGA 1AIVA 3LBSA 4M4GA 2QS4A 2X7QA 4JXIA 3MVYA 4GL0A 5FHMA 4QRZA 2R6GE 3C34A 3EPEA 3LSLA 4IB2A 3S9EA 1O64A 1QKBA 2Q2AA 4DE8A 4BLAA 3HO7A 4PFWA 3U8QA 3IB2A 5EYFA 3PV0E 3MC2A 3K6UA 3E4RA 1TXFA 2I0CA 4EXKA 3KSXA 3ILUB 3FVNA 5DT6A 2FYIA 4U4XA 4M1VA 1O63A 1LSTA 4GXAA 1EU8A 2REJA 1Y4CA 2HAVA 3BFUA 2HZKA 1LGBC 3VVDA 3PU5A 4Z0IA 4KCDA 4DLDA 3CR9A 4U22A 2QMWA 5A5XB 1A8FA 4GVOA 4PFUA 4G2ZA 5TP9A 4YMAA 3Q26A 3VVEA 2B3FA 3OO8A 2ZNSA 1HSEA 5CRYA 3DLNA 2XX7A 3KOTA 1N76A 3LC8A 2O7UA 4ND9A 4LA9A 3S4UA 1Z7ME 4XTCQ 1FTJA 4UACA 4DIGA 1M5CA 1UTBA 3H3GA 2O68A 3KJTA 1IIWA 1YAEA 3EF7A 3E3KA 4IY5A 2PT2A 5I58A 4RA1A 5KDTB 3GBAA 3K2DA 1R1NA 4E0XA 4GFRA 4KR5A 4ECFA 3Q28A 1MQGA 5I2NA 3IORA 3S9MC 1JQFA 5B70A 3QUJA 3FV1A 2OWTA 2HZLA 1A99A 4LZ7A 3TODA 2V93A 4C1UA 3R7XA 3SEXA 1YCJA 1JW1A 3TCGA 2YLNA 3VV5A 2GHAA 1A40A 2OWSA 1M5DA 2VHAA 2XXXA 3PPRA 1NL5A 4YU0A 2F5XA 3FIRA 4WEDA 4JWYA 1B51A 3M8UA 2CMOA 4K3FA 1PC3A 4YKKA 4BDQA 4FEDA 1MY2A 3UP9A 3O6HA 3T9UA 3IR1A 3RUMA 1N3WA 1DTZA 3KN7A 1MS7A 4GRKA 3VLWA 5AE4A 3A3UA 1IQ7A 4ZE9A 1IXHA 4GQOA 2G29A 2E1SA 4R75A 2QJEA 2O84X 3RGYA 1JEVA 3MWBA 2Q8JA 2I4BA 1JW5A 1TFAA 4NF6B 3TEPA 1B7ZA 1B0LA 5DVJA 1I6BA 3PUWE 4G8HA 3MVZA 2DWIA 4QSCA 5AA2A 2B65A 4KPTA 3U1OA 2XXQA 2ZXTA 3H7MA 2UVHA 3P7IA 1SYHA 3OO7A 1IITA 1AL3A 3MVXA 5HM4B 3TELA 4Q8RA 5FTIA 4QFNA 4R6KA 2DS9A 4TLLB 2ALUA 4U4SA 1B46A 1A7LA 3S2VA 1NNKA 1PB8A 4YICA 1VFDA 4YB7A 2VGQA 1D3KA 5KZTA 1US4A 4R9GA 4NF4A 1XS5A 3K1PA 5KCJB 4TLMB 2W7YA 3WAFA 3SEVA 4LZ8A 3KZGA 1HSLA 5AA3A 2FNCA 5DVIA 1LBCA 3KEIA 1RYOA 4IO5A 1N0TA 4ZZAA 3ECRA 1EZ9A 1SW2A 2F7CA 2RF1A 1BKAA 1Y1ZA 1B3LA 3UORA 2P1SA 3IK6B 3QYTA 4I8CA 1POY1 3H6WA 2DE2A 2DSFA 1B3GA 3CG1A 2AL4A 5I57A 2OJTA 1UIVA 4THIA 4JSOA 3SEWA 4P0GA 4YKPA 3O9PA 2H99A 5KDTA 2DE3A 4NF5A 1MY1A 3FXUA 3C35A 3FVKA 3UGWA 4GXSB 3LSWA 1OLCA 3OSRA 1A8EA 1XT8A 4MLQA 4F18A 1YTVA 4HCYA 1MPBA 3SDFA 1JVYA 3ZS6A 2Y7WA 1FTOA 3O6GA 4R72A 4LATA 1I69A 5CBSA 2WKYA 5L9OA 4UA8A 3K0VA 3OEMA 1LAHE 1FQAA 4RK2A 1NMUA 5H8HA 1XHYA 4OQOA 4U23A 4YB5A 1UTBB 2GHBA 4DXBA 3T22A 3DELB 5DEXA 4H1XA 3MP1A 3IX1A 5I58B 1S7YA 5DYHA 2DWAA 1DSNA 1Q1KA 3IOUA 2XD3A 3OMBA 5I2NB 1M5FA 2Y84A 4ZEBA 4R2BA 2QS1A 2Q88A 3SKPA 2YJPA 4HW8A 3QSLA 1F9BA 4NEDA 1DOTA 1Y3NA 4NMYA 1PBPA 3FJ7A 1Y3QA 4MF3A 2HQ0A 4YAHX 3TTLA 1RKMA 3VDFA 4G68C 3HV1A 1N84A 1MDP1 3RN8A 1MXZA 3TCHA 2Z8EA 2QL3A 4MH5A 1ZU0A 3TFLA 1MXWA 1BIYA 3O6IA 4H8IA 3RTFB 2PYYA 4RPOA 2XXPA 1B5IA 3G7WA 3ZSFA 4EF1A 4MBPA 4E0WA 3G3FA 4X9TA 1B3EA 3KFMA 3V8XB 3K01A 5DVFA 4ELQA 1LLSA 3QUFA 4JWXA 5JTYA 3F11A 4DZ1A 1EH3A 5KCJA 4POXA 3KGCA 2XXRA 3M3FA 4U1ZA 3V89B 1LB9A 3MPKA 3VXCA 1B3HA 5J1DA 5AA4A 5AA2B 4IO2A 5CMKA 3SESA 1NFTA 1TWYA 4OETA 2ZNUA 1BLFA 2RC7A 2F8DA 1SDXA 3CVGA 4X1DA 1R9LA 4RXLA 3U93A 3IJOB 3G3JA 4XKNA 4WXJA 2QMXA 1POTA 5IAIA 4QFPA 1S50A 3TQLA 3PUXE 4OWDA 2DWJA 4OEVA 1SW1A 2FA7A 3OEKA 1ZTYA 1FTKA 4N13A 4NF4B 2I4CA 2NOOA 3HHFA 4R2FA 3K02A 1B9JA 1MXVA 1FW0A 3CSGA 2F35A 2RC8A 4FJPA 3FASA 4EQ7A 1B1XA 3ZKLA 5I84A 3CFXA 4C1TA 4G77A 1LB8A 1LAXA 3PGFA 3EHSA 4IGRA 5BWJA 4ZEKA 1LCFA 2YPNA 4PE5B 1B0HA 3OELA 1Y20A 1WDNA 5ISUA 5CC2A 2I49A 3G3GA 4P11A 3TYHA 2NWJA 1WODA 5I57B 1URSA 3KG2A 4LQ5A 4R74A 2BJJX 4ESXA 4NWCA 3T9HB 3MZBA 4H6DA 4OFJA 1PEBA 1T0KA 2UYFA 1H44A 4YKIA 4NF5B 1A55A 5H8QA 2RKMA 1USYE 4EXLA 4AQ4A 1A54A 5AA2D 2V3TA 3ZKKA 1B7HA 2ZYOA 4BDMA 1MM6A 2CZLA 3DP8A 3VLUA 1P1WA 1PDAA 4BDLA 2R71A 3H03A 3H6TA 4Z7EA 2XXVA 5TPAA 3BKIB 3LR1A 4XIGQ 4RNSA 3GXAA 5I59A 1VFEA 3TKDA 3V5AA 5ICQA 3TDJA 3PUZE 1OQGA 2V3QA 2OBGA 1ZIUA 3K6VA 2PBWA 5H8HB 1FTLA 1OVTA 3QXMA 2V84A 5DEXB 3R26A 1H45A 2ZYMA 4KCCA 4WEPA 1GVCA 4ZS9A 1KWHA 1NH8A 2UYEA 3T93B 4QFKA 1PBQA 4IO7A 2F97A 3TTNA 5L9MA 4OTEA 1LFIA 2I3WA 1B6HA 2VD3A 1MPDA 1JEUA 5M2VA 1Y1MA 5EHMA 3SERA 4KFQA 2DQVA 4ZEFA 3USDA 3RT6B 1QW0A 3JV9A 1B4ZA 1PB9A 5HBCA 3SEUA 3KSJA 4DXCA 3OO9A 3E9XA 3RTWB 1CB6A 3RT8A 1FQFA 4IO3A 3GBBA 1VR5A 1MY4A 4PETA 3L6GA 2XXUA 3M3LA 3OENA 1FQBA 4N07A 3FJGA 5HPQA 3TZAA 3HN0A 3IO4A 1MPCA 1VSOA 4KYSA 4GOTA 3FXQA 4F2OA 4KHZE 1J1NA 1QVSA 5I56A 1FQEA 2D3IA 3BFTA 5ITOA 4F22A 2XX9A 4R9FA 4LZ5A 2DVZA 4U1OA 3FXRA 5JTYB 2QS3A 1MXXA 2I0BA 1Z7NE 1QUKA 3O2AA 4F31B 4O3BA 4PFYA 3N94A 5CMBA 1B1HA 3TQWA 1B7UA 1N04A 5H8NA 3MP6A 1MM7A 4DCXA 4P0IA 3CIJA 3I5OA 3MZ1A 4X1BA 5AA4B 4RPNA 3KBRA 4OVJA 1SYIA 1PB7A 3CRBA 4OESA 4G8NA 1MQJA 3O66A 4BDNA 4O3CA 1EZPA 2DWHA 4L17A 5ICTA 1GGGA 3N26A 4RY1A 3T96B 4R6YA 4GD5A 2QS2A 4F39A 1TT1A 3OO6A 4JSDA 2NUVA 4AB6A 4OHNA 1NH7A 2O6AA 1URDA 2QPQA 3LSFB 3W15C 2H5YA 1NNPA 3CSBA 2O51A 3QIMA 5CM6A 4HCWA 3DM0A 3FJMA 1Q35A 2NVUB 1R9QA 1B5JA 4DDDA 2ZYKA 3TPAA 4LONB 4H5GA 3PUYE 3FVOA 2UVJA 3DP6A 2DXRA 1MQIA 1FQDA 4LUBA 3W9VA 2OLBA 4QSEA 5I2KB 4ZE8A 4H8JA 4FECA 3I6VA 1YPNA 1ZMGA 1UQWA 2REGA 3MP8A 3UIFA 1US5A 2F34A 4EQBA 3EQ1A 1MXUA 3FATA 4YMBA 1OIBA 5CMMA 1B52A 3KJ7A 4ZDMA 2RCAA 1CE2A 3C33A 5H8FA 3TTRA 4KD5A 3JYRA 5H8QB 3EHUA 2XHDA 3TUSA 3FUZA 1M5EA 1MY3A 4EF2A 4IO4A 2QSXA 3IO6A 2UVGA 4MFIA 2A5TA 2ZYNA 5TPAB 1SI1A 4LQ2A 3H6VA 1IXIA 5I59B 1JVXA 4XKQA 2O69A 3WAEA 1LFGA 4H65A 1LFHA 1IUDA 1AH5A 1XVXA 2F7BA 4FORA 4O3AA 4N6PA 5EHSA 3U94A 1QJMA 3W9WA 1FTMA 4R73A 1P1QA 3EHTA 2Z8DA 2F7AA 3GZGA 2O1MA 1OLAA 3ILTB 2XXTA 3PPOA 5JK4A 3GLBA 3I3VA 4HTGA 3T9XB 4RK9A 1Y3PA 4ZEDA 3K1MA 1EZOA 2I3VA 4NF8A 5K2YA 2D21A 3FV2A 5FHOA 4DXUA 5FHNA 4OEUA 3RPWA 4JB7A 3T9VA 4QF9A 3IB0A 1JW4A 1LCTA 3C32A 1IEJA 3Q25A 4KQPA 3IL1B 5DTBA 4TOZA 3LSXA 2A5SA 1H76A 1JNFA 3PUVE 2AIXA 1OQHA 1N7XA 2P0SA 1N3XA 3TTKA 1MY0A 4FATA 5L9SA 1XC1A 5F7VA 4F1UA 5AA1A 5I56B 1GR2A 4NE4A 3PMWA 1GV8A 1TFDA 1P1UA 4FE8A 3C36A 4F1VA 4ZECA 1D4NA 1MQHA 1SI0A 2V25A 3A3CA 1IZ1A 4QHQA 2Y7KA 2OCUA 2RC9A 1ELJA 1VE4A 1D9YA 5H8NB 1JETA 4ELRA 4G8MA 1ZLQA 3MAMA 1B58A 1ZKBA 1DTGA 1P1NA 1SVXB 5I2KA 5CBRA 4IGTA 4XXUA 3JZJA 2X7PA 1QUIA 3RNNA 1USYH 1LAFE 4PP0A 2XXIA 4WKMA 3MJNA 3TMGA 1UIUA 4YZZA 3QK6A 3HSTA 3THIA 4EUOA 2GH9A 3T66A 3N5LA 1B2HA 1I6QA 2VP1A 3V83A 3MBPA 4F3PA 3MZ9A 1D9VA 1RYXA 1OMPA 3RLFE 1B4HA 4BDOA 4G68B 3HHGA 2O1LA 2E0SA 1IXCA 3K4UA 5F1QA 1ZBMA 2IEEA 3H6UA 3H4ZA 2HEUA 4ELPA 4LP2B 3MPLA 3PPQA 3FZVA 4KI0E 1B3FA 4YB6A 3MQ9A 3S9NC 3OSQA 2G93A 3OOAA 2PVUA 4FEBA 2Y7RA 3S9LC 4ISUA 3C4MA 2XXHA 4F3GA 5H8FB 1BTJA 4U2RA 4I1DA 3O97A 3MUQA 3RQTA 1B32A 2NXOA 2DYXA 4MLVA 1QULA 2ONSA 2IA4A 1UTHA 4KYEA 3KN8A 3UN6A 2A5TB 2PMSA 2P2AA 2LAOA 3VVFA 4F3BA 1Y9UA 3KOSA 2PX1A 3TCFA 4JBZA 3MW0A 4ZEIA 1MRPA 4ONYA 2X26A 4OFOA 2KLFA 4GF8A 3B6TA 4GLIA 2ZMBA 3CFLA 4G4PA 5BUUA 5TU0A 2RINA 1QKAA 3IJXB 1R6ZA 5CI5A 3E13X 5L8DA 2Q9TA 3OXNA 3PD8A 2VOZA 4XKRA 4FIMA 1DPPA 4NF8B 4IY6A 3G3KA 1MH4A 4RJZA 1L5TA 1M5BA 3C9HA 1LBBA 1DPEA 4F1YA 1QUJA 1NNFA 1H3DA 3IAZA 3R6UA 4DCYA 5LOMA 3TTMA 2XD2A 3L6HA 2I58A 4QFLA 1MG1A 3C31A 1HSJA 3K6WA 1BP5A 2F6PA 2Y7IA 3SEYA 2HXWA 3PD9A 2ONKE 3N6UA 3CFZA 3PMVA 3CG3A 1SBPA 1B05A 4X48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H67 A;  4FAJ A;  5ELV A;  3B7D A;  3K00 A;  4GIZ A;  3CI8 A;  3H06 B;  4ESW A;  2THI A;  3D4C A;  4EDP A;  4EQ9 A;  4R6H A;  4OYV A;  1P99 A;  5B7D A;  2XX8 A;  1N7W A;  3BBR A;  5A5X A;  3VXB A;  2AYS A;  2OZZ A;  4JWO A;  2HFB A;  4GL8 A;  4Q5T A;  2F78 A;  3IOW A;  3VLV A;  2ZNT A;  5H8S A;  1NNT A;  2H4I A;  3AXF A;  3G3H A;  4F3S A;  3ONM A;  4OZ9 A;  1SW5 A;  3ODB A;  2OK2 A;  2UXA A;  3A09 A;  4OEN A;  3OD7 A;  4NTL A;  1IXG A;  4G68 A;  2Q89 A;  2VD2 A;  3HCQ A;  2V3U A;  4KYD A;  2RCB A;  1I6A A;  4YKJ A;  2UVI A;  4ZZE A;  4ELO A;  3HPI A;  3QAX A;  2F6G A;  4XKP A;  1H43 A;  1SW4 A;  3G3I A;  1MXY A;  4I9D A;  1URG A;  2AL5 A;  3B6Q A;  2Z22 A;  2F36 A;  3SET A;  5ITP A;  3MVW A;  1AOV A;  5TP9 B;  3UA8 A;  3DP4 A;  1OVB A;  2HCA A;  2XXW A;  2ONR A;  4H5F A;  4F29 A;  1O7T A;  2GRV A;  1FCK A;  1SD3 A;  4AB5 A;  4C0R A;  2DXY A;  1NKX A;  3M3K A;  2DVC A;  3FD3 A;  1MDQ A;  3VE1 B;  4QSD A;  1LAG E;  3U92 A;  3N6T A;  2PT1 A;  2XXY A;  1B5H A;  4OMB A;  4HS7 A;  4Q0C A;  4BDR A;  4TQU Q;  1DMB A;  2HAU A;  1B40 A;  1S9T A;  1GTK A;  5JEI A;  1II5 A;  5CMC A;  4LVQ A;  1SQY A;  2DOJ A;  4IO6 A;  5FTH A;  2D5W A;  5IKB A;  1ZJL A;  4QFO A;  2B3B A;  4GWO A;  4NF6 A;  3EN3 A;  4F2Q A;  1FQC A;  4F19 A;  3IB1 A;  4OFL A;  3UK4 A;  4OER A;  2GFE A;  2M8C A;  3PMX A;  2Q2C A;  3O29 A;  4PFT A;  1WVJ A;  4Q30 B;  1UTH B;  4H0W A;  1AMF A;  3K6X A;  5K2X A;  3PPP A;  3D4G A;  3IOV A;  2DP8 A;  4U21 A;  2Z8F A;  2H9B A;  1Y4T A;  2ANJ A;  1ATG A;  1MH3 A;  1P1O A;  1ANF A;  2I6E A;  2DE4 A;  3RY3 A;  2Z23 A;  3LUY A;  1XOC A;  4JDF A;  2R9J A;  3VFJ A;  1XVY A;  4PQJ A;  2Y7P A;  3TAJ A;  4NWD A;  2H25 A;  2O7I A;  3O28 A;  4I62 A;  3Q27 A;  1MQD A;  4OXV A;  4RYA A;  3U72 A;  2H98 A;  3FGS A;  3K1N A;  2QRY A;  3B6W A;  4POW A;  3IOT A;  3Q29 A;  2ESN A;  3PPN A;  2ABH A;  2I48 A;  3KN3 A;  3FVG A;  1AIV A;  3LBS A;  4M4G A;  2QS4 A;  2X7Q A;  4JXI A;  3MVY A;  4GL0 A;  5FHM A;  4QRZ A;  2R6G E;  3C34 A;  3EPE A;  3LSL A;  4IB2 A;  3S9E A;  1O64 A;  1QKB A;  2Q2A A;  4DE8 A;  4BLA A;  3HO7 A;  4PFW A;  3U8Q A;  3IB2 A;  5EYF A;  3PV0 E;  3MC2 A;  3K6U A;  3E4R A;  1TXF A;  2I0C A;  4EXK A;  3KSX A;  3ILU B;  3FVN A;  5DT6 A;  2FYI A;  4U4X A;  4M1V A;  1O63 A;  1LST A;  4GXA A;  1EU8 A;  2REJ A;  1Y4C A;  2HAV A;  3BFU A;  2HZK A;  1LGB C;  3VVD A;  3PU5 A;  4Z0I A;  4KCD A;  4DLD A;  3CR9 A;  4U22 A;  2QMW A;  5A5X B;  1A8F A;  4GVO A;  4PFU A;  4G2Z A;  5TP9 A;  4YMA A;  3Q26 A;  3VVE A;  2B3F A;  3OO8 A;  2ZNS A;  1HSE A;  5CRY A;  3DLN A;  2XX7 A;  3KOT A;  1N76 A;  3LC8 A;  2O7U A;  4ND9 A;  4LA9 A;  3S4U A;  1Z7M E;  4XTC Q;  1FTJ A;  4UAC A;  4DIG A;  1M5C A;  1UTB A;  3H3G A;  2O68 A;  3KJT A;  1IIW A;  1YAE A;  3EF7 A;  3E3K A;  4IY5 A;  2PT2 A;  5I58 A;  4RA1 A;  5KDT B;  3GBA A;  3K2D A;  1R1N A;  4E0X A;  4GFR A;  4KR5 A;  4ECF A;  3Q28 A;  1MQG A;  5I2N A;  3IOR A;  3S9M C;  1JQF A;  5B70 A;  3QUJ A;  3FV1 A;  2OWT A;  2HZL A;  1A99 A;  4LZ7 A;  3TOD A;  2V93 A;  4C1U A;  3R7X A;  3SEX A;  1YCJ A;  1JW1 A;  3TCG A;  2YLN A;  3VV5 A;  2GHA A;  1A40 A;  2OWS A;  1M5D A;  2VHA A;  2XXX A;  3PPR A;  1NL5 A;  4YU0 A;  2F5X A;  3FIR A;  4WED A;  4JWY A;  1B51 A;  3M8U A;  2CMO A;  4K3F A;  1PC3 A;  4YKK A;  4BDQ A;  4FED A;  1MY2 A;  3UP9 A;  3O6H A;  3T9U A;  3IR1 A;  3RUM A;  1N3W A;  1DTZ A;  3KN7 A;  1MS7 A;  4GRK A;  3VLW A;  5AE4 A;  3A3U A;  1IQ7 A;  4ZE9 A;  1IXH A;  4GQO A;  2G29 A;  2E1S A;  4R75 A;  2QJE A;  2O84 X;  3RGY A;  1JEV A;  3MWB A;  2Q8J A;  2I4B A;  1JW5 A;  1TFA A;  4NF6 B;  3TEP A;  1B7Z A;  1B0L A;  5DVJ A;  1I6B A;  3PUW E;  4G8H A;  3MVZ A;  2DWI A;  4QSC A;  5AA2 A;  2B65 A;  4KPT A;  3U1O A;  2XXQ A;  2ZXT A;  3H7M A;  2UVH A;  3P7I A;  1SYH A;  3OO7 A;  1IIT A;  1AL3 A;  3MVX A;  5HM4 B;  3TEL A;  4Q8R A;  5FTI A;  4QFN A;  4R6K A;  2DS9 A;  4TLL B;  2ALU A;  4U4S A;  1B46 A;  1A7L A;  3S2V A;  1NNK A;  1PB8 A;  4YIC A;  1VFD A;  4YB7 A;  2VGQ A;  1D3K A;  5KZT A;  1US4 A;  4R9G A;  4NF4 A;  1XS5 A;  3K1P A;  5KCJ B;  4TLM B;  2W7Y A;  3WAF A;  3SEV A;  4LZ8 A;  3KZG A;  1HSL A;  5AA3 A;  2FNC A;  5DVI A;  1LBC A;  3KEI A;  1RYO A;  4IO5 A;  1N0T A;  4ZZA A;  3ECR A;  1EZ9 A;  1SW2 A;  2F7C A;  2RF1 A;  1BKA A;  1Y1Z A;  1B3L A;  3UOR A;  2P1S A;  3IK6 B;  3QYT A;  4I8C A;  1POY 1;  3H6W A;  2DE2 A;  2DSF A;  1B3G A;  3CG1 A;  2AL4 A;  5I57 A;  2OJT A;  1UIV A;  4THI A;  4JSO A;  3SEW A;  4P0G A;  4YKP A;  3O9P A;  2H99 A;  5KDT A;  2DE3 A;  4NF5 A;  1MY1 A;  3FXU A;  3C35 A;  3FVK A;  3UGW A;  4GXS B;  3LSW A;  1OLC A;  3OSR A;  1A8E A;  1XT8 A;  4MLQ A;  4F18 A;  1YTV A;  4HCY A;  1MPB A;  3SDF A;  1JVY A;  3ZS6 A;  2Y7W A;  1FTO A;  3O6G A;  4R72 A;  4LAT A;  1I69 A;  5CBS A;  2WKY A;  5L9O A;  4UA8 A;  3K0V A;  3OEM A;  1LAH E;  1FQA A;  4RK2 A;  1NMU A;  5H8H A;  1XHY A;  4OQO A;  4U23 A;  4YB5 A;  1UTB B;  2GHB A;  4DXB A;  3T22 A;  3DEL B;  5DEX A;  4H1X A;  3MP1 A;  3IX1 A;  5I58 B;  1S7Y A;  5DYH A;  2DWA A;  1DSN A;  1Q1K A;  3IOU A;  2XD3 A;  3OMB A;  5I2N B;  1M5F A;  2Y84 A;  4ZEB A;  4R2B A;  2QS1 A;  2Q88 A;  3SKP A;  2YJP A;  4HW8 A;  3QSL A;  1F9B A;  4NED A;  1DOT A;  1Y3N A;  4NMY A;  1PBP A;  3FJ7 A;  1Y3Q A;  4MF3 A;  2HQ0 A;  4YAH X;  3TTL A;  1RKM A;  3VDF A;  4G68 C;  3HV1 A;  1N84 A;  1MDP 1;  3RN8 A;  1MXZ A;  3TCH A;  2Z8E A;  2QL3 A;  4MH5 A;  1ZU0 A;  3TFL A;  1MXW A;  1BIY A;  3O6I A;  4H8I A;  3RTF B;  2PYY A;  4RPO A;  2XXP A;  1B5I A;  3G7W A;  3ZSF A;  4EF1 A;  4MBP A;  4E0W A;  3G3F A;  4X9T A;  1B3E A;  3KFM A;  3V8X B;  3K01 A;  5DVF A;  4ELQ A;  1LLS A;  3QUF A;  4JWX A;  5JTY A;  3F11 A;  4DZ1 A;  1EH3 A;  5KCJ A;  4POX A;  3KGC A;  2XXR A;  3M3F A;  4U1Z A;  3V89 B;  1LB9 A;  3MPK A;  3VXC A;  1B3H A;  5J1D A;  5AA4 A;  5AA2 B;  4IO2 A;  5CMK A;  3SES A;  1NFT A;  1TWY A;  4OET A;  2ZNU A;  1BLF A;  2RC7 A;  2F8D A;  1SDX A;  3CVG A;  4X1D A;  1R9L A;  4RXL A;  3U93 A;  3IJO B;  3G3J A;  4XKN A;  4WXJ A;  2QMX A;  1POT A;  5IAI A;  4QFP A;  1S50 A;  3TQL A;  3PUX E;  4OWD A;  2DWJ A;  4OEV A;  1SW1 A;  2FA7 A;  3OEK A;  1ZTY A;  1FTK A;  4N13 A;  4NF4 B;  2I4C A;  2NOO A;  3HHF A;  4R2F A;  3K02 A;  1B9J A;  1MXV A;  1FW0 A;  3CSG A;  2F35 A;  2RC8 A;  4FJP A;  3FAS A;  4EQ7 A;  1B1X A;  3ZKL A;  5I84 A;  3CFX A;  4C1T A;  4G77 A;  1LB8 A;  1LAX A;  3PGF A;  3EHS A;  4IGR A;  5BWJ A;  4ZEK A;  1LCF A;  2YPN A;  4PE5 B;  1B0H A;  3OEL A;  1Y20 A;  1WDN A;  5ISU A;  5CC2 A;  2I49 A;  3G3G A;  4P11 A;  3TYH A;  2NWJ A;  1WOD A;  5I57 B;  1URS A;  3KG2 A;  4LQ5 A;  4R74 A;  2BJJ X;  4ESX A;  4NWC A;  3T9H B;  3MZB A;  4H6D A;  4OFJ A;  1PEB A;  1T0K A;  2UYF A;  1H44 A;  4YKI A;  4NF5 B;  1A55 A;  5H8Q A;  2RKM A;  1USY E;  4EXL A;  4AQ4 A;  1A54 A;  5AA2 D;  2V3T A;  3ZKK A;  1B7H A;  2ZYO A;  4BDM A;  1MM6 A;  2CZL A;  3DP8 A;  3VLU A;  1P1W A;  1PDA A;  4BDL A;  2R71 A;  3H03 A;  3H6T A;  4Z7E A;  2XXV A;  5TPA A;  3BKI B;  3LR1 A;  4XIG Q;  4RNS A;  3GXA A;  5I59 A;  1VFE A;  3TKD A;  3V5A A;  5ICQ A;  3TDJ A;  3PUZ E;  1OQG A;  2V3Q A;  2OBG A;  1ZIU A;  3K6V A;  2PBW A;  5H8H B;  1FTL A;  1OVT A;  3QXM A;  2V84 A;  5DEX B;  3R26 A;  1H45 A;  2ZYM A;  4KCC A;  4WEP A;  1GVC A;  4ZS9 A;  1KWH A;  1NH8 A;  2UYE A;  3T93 B;  4QFK A;  1PBQ A;  4IO7 A;  2F97 A;  3TTN A;  5L9M A;  4OTE A;  1LFI A;  2I3W A;  1B6H A;  2VD3 A;  1MPD A;  1JEU A;  5M2V A;  1Y1M A;  5EHM A;  3SER A;  4KFQ A;  2DQV A;  4ZEF A;  3USD A;  3RT6 B;  1QW0 A;  3JV9 A;  1B4Z A;  1PB9 A;  5HBC A;  3SEU A;  3KSJ A;  4DXC A;  3OO9 A;  3E9X A;  3RTW B;  1CB6 A;  3RT8 A;  1FQF A;  4IO3 A;  3GBB A;  1VR5 A;  1MY4 A;  4PET A;  3L6G A;  2XXU A;  3M3L A;  3OEN A;  1FQB A;  4N07 A;  3FJG A;  5HPQ A;  3TZA A;  3HN0 A;  3IO4 A;  1MPC A;  1VSO A;  4KYS A;  4GOT A;  3FXQ A;  4F2O A;  4KHZ E;  1J1N A;  1QVS A;  5I56 A;  1FQE A;  2D3I A;  3BFT A;  5ITO A;  4F22 A;  2XX9 A;  4R9F A;  4LZ5 A;  2DVZ A;  4U1O A;  3FXR A;  5JTY B;  2QS3 A;  1MXX A;  2I0B A;  1Z7N E;  1QUK A;  3O2A A;  4F31 B;  4O3B A;  4PFY A;  3N94 A;  5CMB A;  1B1H A;  3TQW A;  1B7U A;  1N04 A;  5H8N A;  3MP6 A;  1MM7 A;  4DCX A;  4P0I A;  3CIJ A;  3I5O A;  3MZ1 A;  4X1B A;  5AA4 B;  4RPN A;  3KBR A;  4OVJ A;  1SYI A;  1PB7 A;  3CRB A;  4OES A;  4G8N A;  1MQJ A;  3O66 A;  4BDN A;  4O3C A;  1EZP A;  2DWH A;  4L17 A;  5ICT A;  1GGG A;  3N26 A;  4RY1 A;  3T96 B;  4R6Y A;  4GD5 A;  2QS2 A;  4F39 A;  1TT1 A;  3OO6 A;  4JSD A;  2NUV A;  4AB6 A;  4OHN A;  1NH7 A;  2O6A A;  1URD A;  2QPQ A;  3LSF B;  3W15 C;  2H5Y A;  1NNP A;  3CSB A;  2O51 A;  3QIM A;  5CM6 A;  4HCW A;  3DM0 A;  3FJM A;  1Q35 A;  2NVU B;  1R9Q A;  1B5J A;  4DDD A;  2ZYK A;  3TPA A;  4LON B;  4H5G A;  3PUY E;  3FVO A;  2UVJ A;  3DP6 A;  2DXR A;  1MQI A;  1FQD A;  4LUB A;  3W9V A;  2OLB A;  4QSE A;  5I2K B;  4ZE8 A;  4H8J A;  4FEC A;  3I6V A;  1YPN A;  1ZMG A;  1UQW A;  2REG A;  3MP8 A;  3UIF A;  1US5 A;  2F34 A;  4EQB A;  3EQ1 A;  1MXU A;  3FAT A;  4YMB A;  1OIB A;  5CMM A;  1B52 A;  3KJ7 A;  4ZDM A;  2RCA A;  1CE2 A;  3C33 A;  5H8F A;  3TTR A;  4KD5 A;  3JYR A;  5H8Q B;  3EHU A;  2XHD A;  3TUS A;  3FUZ A;  1M5E A;  1MY3 A;  4EF2 A;  4IO4 A;  2QSX A;  3IO6 A;  2UVG A;  4MFI A;  2A5T A;  2ZYN A;  5TPA B;  1SI1 A;  4LQ2 A;  3H6V A;  1IXI A;  5I59 B;  1JVX A;  4XKQ A;  2O69 A;  3WAE A;  1LFG A;  4H65 A;  1LFH A;  1IUD A;  1AH5 A;  1XVX A;  2F7B A;  4FOR A;  4O3A A;  4N6P A;  5EHS A;  3U94 A;  1QJM A;  3W9W A;  1FTM A;  4R73 A;  1P1Q A;  3EHT A;  2Z8D A;  2F7A A;  3GZG A;  2O1M A;  1OLA A;  3ILT B;  2XXT A;  3PPO A;  5JK4 A;  3GLB A;  3I3V A;  4HTG A;  3T9X B;  4RK9 A;  1Y3P A;  4ZED A;  3K1M A;  1EZO A;  2I3V A;  4NF8 A;  5K2Y A;  2D21 A;  3FV2 A;  5FHO A;  4DXU A;  5FHN A;  4OEU A;  3RPW A;  4JB7 A;  3T9V A;  4QF9 A;  3IB0 A;  1JW4 A;  1LCT A;  3C32 A;  1IEJ A;  3Q25 A;  4KQP A;  3IL1 B;  5DTB A;  4TOZ A;  3LSX A;  2A5S A;  1H76 A;  1JNF A;  3PUV E;  2AIX A;  1OQH A;  1N7X A;  2P0S A;  1N3X A;  3TTK A;  1MY0 A;  4FAT A;  5L9S A;  1XC1 A;  5F7V A;  4F1U A;  5AA1 A;  5I56 B;  1GR2 A;  4NE4 A;  3PMW A;  1GV8 A;  1TFD A;  1P1U A;  4FE8 A;  3C36 A;  4F1V A;  4ZEC A;  1D4N A;  1MQH A;  1SI0 A;  2V25 A;  3A3C A;  1IZ1 A;  4QHQ A;  2Y7K A;  2OCU A;  2RC9 A;  1ELJ A;  1VE4 A;  1D9Y A;  5H8N B;  1JET A;  4ELR A;  4G8M A;  1ZLQ A;  3MAM A;  1B58 A;  1ZKB A;  1DTG A;  1P1N A;  1SVX B;  5I2K A;  5CBR A;  4IGT A;  4XXU A;  3JZJ A;  2X7P A;  1QUI A;  3RNN A;  1USY H;  1LAF E;  4PP0 A;  2XXI A;  4WKM A;  3MJN A;  3TMG A;  1UIU A;  4YZZ A;  3QK6 A;  3HST A;  3THI A;  4EUO A;  2GH9 A;  3T66 A;  3N5L A;  1B2H A;  1I6Q A;  2VP1 A;  3V83 A;  3MBP A;  4F3P A;  3MZ9 A;  1D9V A;  1RYX A;  1OMP A;  3RLF E;  1B4H A;  4BDO A;  4G68 B;  3HHG A;  2O1L A;  2E0S A;  1IXC A;  3K4U A;  5F1Q A;  1ZBM A;  2IEE A;  3H6U A;  3H4Z A;  2HEU A;  4ELP A;  4LP2 B;  3MPL A;  3PPQ A;  3FZV A;  4KI0 E;  1B3F A;  4YB6 A;  3MQ9 A;  3S9N C;  3OSQ A;  2G93 A;  3OOA A;  2PVU A;  4FEB A;  2Y7R A;  3S9L C;  4ISU A;  3C4M A;  2XXH A;  4F3G A;  5H8F B;  1BTJ A;  4U2R A;  4I1D A;  3O97 A;  3MUQ A;  3RQT A;  1B32 A;  2NXO A;  2DYX A;  4MLV A;  1QUL A;  2ONS A;  2IA4 A;  1UTH A;  4KYE A;  3KN8 A;  3UN6 A;  2A5T B;  2PMS A;  2P2A A;  2LAO A;  3VVF A;  4F3B A;  1Y9U A;  3KOS A;  2PX1 A;  3TCF A;  4JBZ A;  3MW0 A;  4ZEI A;  1MRP A;  4ONY A;  2X26 A;  4OFO A;  2KLF A;  4GF8 A;  3B6T A;  4GLI A;  2ZMB A;  3CFL A;  4G4P A;  5BUU A;  5TU0 A;  2RIN A;  1QKA A;  3IJX B;  1R6Z A;  5CI5 A;  3E13 X;  5L8D A;  2Q9T A;  3OXN A;  3PD8 A;  2VOZ A;  4XKR A;  4FIM A;  1DPP A;  4NF8 B;  4IY6 A;  3G3K A;  1MH4 A;  4RJZ A;  1L5T A;  1M5B A;  3C9H A;  1LBB A;  1DPE A;  4F1Y A;  1QUJ A;  1NNF A;  1H3D A;  3IAZ A;  3R6U A;  4DCY A;  5LOM A;  3TTM A;  2XD2 A;  3L6H A;  2I58 A;  4QFL A;  1MG1 A;  3C31 A;  1HSJ A;  3K6W A;  1BP5 A;  2F6P A;  2Y7I A;  3SEY A;  2HXW A;  3PD9 A;  2ONK E;  3N6U A;  3CFZ A;  3PMV A;  3CG3 A;  1SBP A;  1B05 A;  4X48 A; 
#chains in the Genus database with same CATH topology
 4H67 A;  4FAJ A;  5ELV A;  3B7D A;  3K00 A;  2OX3 A;  5DW8 A;  2ZZV A;  4GIZ A;  3CI8 A;  1IME A;  3H06 B;  4ESW A;  2THI A;  3D4C A;  4EDP A;  4EQ9 A;  4R6H A;  4OYV A;  1P99 A;  5B7D A;  2XX8 A;  1N7W A;  3BBR A;  5A5X A;  3VXB A;  2AYS A;  2OZZ A;  4JWO A;  2HFB A;  4GL8 A;  4Q5T A;  4NAP A;  2F78 A;  3IOW A;  3VLV A;  2ZNT A;  5H8S A;  1NNT A;  2H4I A;  1AWB A;  3AXF A;  1FTA A;  3G3H A;  1LBZ A;  4F3S A;  3ONM A;  4OZ9 A;  1SW5 A;  3ODB A;  4NGU A;  2GQ1 A;  2OK2 A;  2UXA A;  3A09 A;  4OEN A;  4PF6 A;  3OD7 A;  4H46 A;  4NTL A;  1IXG A;  4G68 A;  2Q89 A;  1EYJ A;  2CZI A;  2DDK A;  2VD2 A;  3HCQ A;  2V3U A;  4KYD A;  2RCB A;  1I6A A;  4YKJ A;  2UVI A;  4ZZE A;  4ELO A;  3HPI A;  3QAX A;  1JP4 A;  2QVU A;  2F6G A;  4XKP A;  1H43 A;  1SW4 A;  3G3I A;  1MXY A;  4I9D A;  2B4M A;  1URG A;  1NV1 A;  1KA1 A;  2AL5 A;  3B6Q A;  2Z22 A;  2F36 A;  3SET A;  5ITP A;  3MVW A;  1AOV A;  5TP9 B;  3UA8 A;  3DP4 A;  1OVB A;  2HCA A;  2XXW A;  4HE0 A;  4P3L A;  1BK4 A;  2ONR A;  1KZ8 A;  4H5F A;  4F29 A;  1O7T A;  2GRV A;  1FCK A;  4MAG A;  3GYY A;  4PDH A;  1SD3 A;  4AB5 A;  4C0R A;  2DXY A;  1NKX A;  3M3K A;  2DVC A;  3FD3 A;  1MDQ A;  2R8T A;  3VE1 B;  4AS4 A;  4QSD A;  1LAG E;  3U92 A;  3N6T A;  2PT1 A;  2XXY A;  1B5H A;  4QXD A;  4OMB A;  2Y5L A;  4HS7 A;  4Q0C A;  4BDR A;  1NI9 A;  4TQU Q;  1DMB A;  2XWI A;  2HAU A;  1B40 A;  1S9T A;  1GTK A;  5JEI A;  1II5 A;  5CMC A;  4LVQ A;  1SQY A;  2DOJ A;  4IO6 A;  5FTH A;  2D5W A;  4O7M A;  5IKB A;  1ZJL A;  1FPF A;  3D1R A;  4QFO A;  2B3B A;  4GWO A;  4NF6 A;  3EN3 A;  4F2Q A;  1FQC A;  4P47 A;  4F19 A;  3IB1 A;  4OFL A;  3B8B A;  3UK4 A;  4OER A;  2GFE A;  2M8C A;  3PMX A;  2Q2C A;  3O29 A;  4PFT A;  5EQ7 A;  1WVJ A;  4Q30 B;  4JVD A;  4JVC A;  1UTH B;  4H0W A;  1AMF A;  3K6X A;  4GX4 A;  5K2X A;  3PPP A;  3D4G A;  3IOV A;  2DP8 A;  4U21 A;  2Z8F A;  2H9B A;  1Y4T A;  2ANJ A;  1ATG A;  1MH3 A;  1P1O A;  1ANF A;  2I6E A;  2DE4 A;  5ET8 A;  3RY3 A;  2Z23 A;  3LUY A;  1XOC A;  4JDF A;  2R9J A;  3VFJ A;  1IMC A;  1XVY A;  4PQJ A;  2Y7P A;  3TAJ A;  4NWD A;  2H25 A;  2O7I A;  3O28 A;  4I62 A;  3Q27 A;  1MQD A;  4OXV A;  4RYA A;  4N91 A;  3U72 A;  4KXP A;  4N4U A;  2H98 A;  2Q74 A;  3FGS A;  3K1N A;  1FSA A;  1NUW A;  2QRY A;  3B6W A;  4POW A;  3IOT A;  3Q29 A;  2ESN A;  4O7I A;  3PPN A;  2ABH A;  2I48 A;  3MST A;  3KN3 A;  3FVG A;  1AIV A;  3LBS A;  4M4G A;  3RPL B;  2QS4 A;  2X7Q A;  4JXI A;  3MVY A;  4GL0 A;  5FHM A;  4QRZ A;  2R6G E;  3C34 A;  3EPE A;  3LSL A;  4IB2 A;  3S9E A;  1O64 A;  1QKB A;  2Q2A A;  4DE8 A;  4BLA A;  3HO7 A;  4HE1 A;  2MKZ A;  4PFW A;  3U8Q A;  3IB2 A;  5EYF A;  3PV0 E;  3MC2 A;  3K6U A;  3E4R A;  1TXF A;  2I0C A;  1FBP A;  4EXK A;  3KSX A;  3ILU B;  3FVN A;  1YYZ A;  5DT6 A;  2FYI A;  4U4X A;  4M1V A;  1O63 A;  1LST A;  4GXA A;  1EU8 A;  2REJ A;  1Y4C A;  4GBV A;  2XA5 A;  2FIX A;  2HAV A;  3BFU A;  2HZK A;  1LGB C;  3VVD A;  3PU5 A;  4Z0I A;  4KCD A;  4DLD A;  3CR9 A;  4U22 A;  2QMW A;  5A5X B;  1A8F A;  4GVO A;  4PFU A;  4G2Z A;  5TP9 A;  4YMA A;  3Q26 A;  3VVE A;  2B3F A;  3OO8 A;  2ZNS A;  1NUX A;  1HSE A;  5CRY A;  3DLN A;  2XX7 A;  3KOT A;  1N76 A;  3LC8 A;  2O7U A;  4ND9 A;  2KR0 A;  4LA9 A;  3S4U A;  1Z7M E;  4XTC Q;  1FTJ A;  4UAC A;  4DIG A;  1M5C A;  1UTB A;  3H3G A;  2O68 A;  3KJT A;  1IIW A;  1YAE A;  3EF7 A;  2XWO A;  3E3K A;  4IY5 A;  2PT2 A;  5I58 A;  4RA1 A;  5KDT B;  4N6K A;  3GBA A;  3K2D A;  1R1N A;  4PFR A;  4E0X A;  4GFR A;  4KR5 A;  4ECF A;  3Q28 A;  1MQG A;  5I2N A;  1LBX A;  3IOR A;  3S9M C;  1JQF A;  5B70 A;  3QUJ A;  3FV1 A;  5ET6 A;  2OWT A;  2HZL A;  4LZ7 A;  1A99 A;  3TOD A;  2V93 A;  4C1U A;  3R7X A;  3SEX A;  1YCJ A;  1JW1 A;  2KQZ A;  3TCG A;  2YLN A;  3VV5 A;  2GHA A;  1A40 A;  2OWS A;  1M5D A;  2VHA A;  2PFY A;  3IFA A;  2XXX A;  3PPR A;  4PE3 A;  1NL5 A;  4YU0 A;  4PCD A;  2F5X A;  3FIR A;  4WED A;  4JWY A;  1B51 A;  3M8U A;  2CMO A;  4K3F A;  1DCU A;  4P1E A;  1PC3 A;  4YKK A;  4BDQ A;  4FED A;  4N8G A;  5T3J A;  4H45 A;  1MY2 A;  3UP9 A;  3O6H A;  3T9U A;  3IR1 A;  3RUM A;  4NQ8 A;  1N3W A;  1DTZ A;  3KN7 A;  2B4L A;  1MS7 A;  4GRK A;  3VLW A;  1NV6 A;  5AE4 A;  3A3U A;  1IQ7 A;  4ZE9 A;  4DI4 B;  1IXH A;  4GQO A;  4NN3 A;  5IZ3 A;  2G29 A;  2E1S A;  4R75 A;  4LN5 A;  2QJE A;  2O84 X;  3RGY A;  1JEV A;  3MWB A;  2Q8J A;  2I4B A;  1JW5 A;  4OVR A;  1TFA A;  3KC1 A;  4NF6 B;  3TEP A;  1B7Z A;  1B0L A;  5DVJ A;  1I6B A;  3PUW E;  4G8H A;  3MVZ A;  2DWI A;  4N17 A;  4QSC A;  5AA2 A;  1LBW A;  2B65 A;  4KPT A;  3U1O A;  2XXQ A;  2ZXT A;  3H7M A;  2UVH A;  2Q8M A;  3P7I A;  1FBD A;  1SYH A;  3OO7 A;  1IIT A;  1AL3 A;  3MVX A;  5HM4 B;  3TEL A;  1NV3 A;  2Y5K A;  4Q8R A;  5FTI A;  4QFN A;  1FJ9 A;  4R6K A;  2DS9 A;  4TLL B;  2ALU A;  4U4S A;  1B46 A;  1A7L A;  3S2V A;  1NNK A;  1PB8 A;  4PAF A;  1FPG A;  4YIC A;  1VFD A;  4YB7 A;  2VGQ A;  1D3K A;  5KZT A;  1US4 A;  4R9G A;  4NF4 A;  1XS5 A;  3K1P A;  5KCJ B;  4TLM B;  2W7Y A;  3WAF A;  3SEV A;  4LZ8 A;  3KZG A;  4GWS A;  1HSL A;  5AA3 A;  2FNC A;  5DVI A;  1LBC A;  3KEI A;  1RYO A;  4IO5 A;  1N0T A;  4ZZA A;  3ECR A;  1EZ9 A;  1G0I A;  1SW2 A;  2F7C A;  2RF1 A;  1BKA A;  1Y1Z A;  1B3L A;  3UOR A;  2P1S A;  3IK6 B;  3QYT A;  4I8C A;  1POY 1;  3H6W A;  2DE2 A;  1FPI A;  4PAI A;  2DSF A;  2WX9 A;  1B3G A;  3CG1 A;  2AL4 A;  5I57 A;  4PC9 A;  2OJT A;  1UIV A;  4THI A;  4JSO A;  3SEW A;  2PFZ A;  2FIE A;  4P0G A;  4YKP A;  3O9P A;  2H99 A;  5KDT A;  2DE3 A;  4NF5 A;  1MY1 A;  3FXU A;  5I7I A;  3C35 A;  1FJ6 A;  3FVK A;  3UGW A;  4GXS B;  3LSW A;  1OLC A;  3OSR A;  1A8E A;  1XT8 A;  4MLQ A;  5LDZ A;  4F18 A;  1YTV A;  2OWZ A;  4HCY A;  1MPB A;  3SDF A;  1JVY A;  3ZS6 A;  5IZZ A;  2Y7W A;  1FTO A;  3O6G A;  4R72 A;  4LAT A;  1I69 A;  1IMD A;  5CBS A;  2WKY A;  5L9O A;  4FBP A;  4UA8 A;  2VPO A;  3K0V A;  3OEM A;  1LAH E;  1FQA A;  3EKI A;  4RK2 A;  1NMU A;  5H8H A;  1XHY A;  4OQO A;  1FPB A;  4U23 A;  4N81 A;  4YB5 A;  5ET7 A;  1UTB B;  2GHB A;  4DXB A;  3T22 A;  3DEL B;  5DEX A;  3KBZ A;  4H1X A;  2XWV A;  3MP1 A;  3IX1 A;  5I3S A;  5I58 B;  1S7Y A;  4OVT A;  5DYH A;  2DWA A;  1DSN A;  1Q1K A;  3IOU A;  2XD3 A;  3OMB A;  4N6D A;  5I2N B;  5ET5 A;  1M5F A;  2Y84 A;  2CZH A;  2HHM A;  4ZEB A;  4R2B A;  2QS1 A;  2Q88 A;  3SKP A;  4I3E A;  2YJP A;  4HW8 A;  3QSL A;  1F9B A;  4MNI A;  4NED A;  1DOT A;  1Y3N A;  4NMY A;  1PBP A;  3FJ7 A;  1Y3Q A;  4MF3 A;  2HQ0 A;  4PFB A;  4YAH X;  3TTL A;  1RKM A;  3VDF A;  4G68 C;  3HV1 A;  1N84 A;  1MDP 1;  4GWW A;  3RN8 A;  1MXZ A;  3TCH A;  2Z8E A;  2QL3 A;  4MH5 A;  1ZU0 A;  3TFL A;  1MXW A;  3ROJ A;  1BIY A;  3O6I A;  4H8I A;  3RTF B;  2PYY A;  4RPO A;  2XXP A;  3CHG A;  4AS5 A;  1B5I A;  3G7W A;  3SZP A;  3ZSF A;  1FBF A;  4EF1 A;  4MBP A;  4E0W A;  4PBQ A;  3G3F A;  1Q9D A;  4X9T A;  1B3E A;  3KFM A;  3V8X B;  3K01 A;  5DVF A;  4ELQ A;  1LLS A;  3QUF A;  4JWX A;  5JTY A;  3F11 A;  2XXK A;  5IZ3 B;  4DZ1 A;  1EH3 A;  5KCJ A;  4POX A;  3KGC A;  2BJI A;  2XXR A;  3M3F A;  4U1Z A;  3V89 B;  1NV7 A;  1LB9 A;  3MPK A;  5EQA A;  3VXC A;  1B3H A;  5J1D A;  1LBV A;  2QFL A;  3U65 A;  5AA4 A;  5AA2 B;  4IO2 A;  5CMK A;  3SES A;  1NFT A;  1TWY A;  4OET A;  2ZNU A;  1BLF A;  2RC7 A;  2F8D A;  1SDX A;  3CVG A;  4UAB A;  4X1D A;  1R9L A;  4RXL A;  4MJO A;  3U93 A;  3IJO B;  3G3J A;  4XKN A;  1EYK A;  4WXJ A;  2QMX A;  4MCO A;  1POT A;  5IAI A;  4QFP A;  1S50 A;  3TQL A;  3PUX E;  4OWD A;  2DWJ A;  4OEV A;  1SW1 A;  2FA7 A;  3OEK A;  1ZTY A;  1FTK A;  4HE2 A;  4N13 A;  2HXR A;  5IZ1 A;  4NF4 B;  1FPE A;  2I4C A;  2NOO A;  3HHF A;  4R2F A;  3K02 A;  2VT5 A;  1B9J A;  1MXV A;  1FW0 A;  3CSG A;  2F35 A;  2RC8 A;  4FJP A;  3FAS A;  4EQ7 A;  1B1X A;  3ZKL A;  5I84 A;  3CFX A;  4C1T A;  4G77 A;  1LB8 A;  1LAX A;  3PGF A;  3EHS A;  4IGR A;  5BWJ A;  4GWZ A;  4ZEK A;  3E78 A;  4O94 A;  1LCF A;  2YPN A;  4PE5 B;  5J16 A;  1B0H A;  1RDZ A;  4OA4 A;  3OEL A;  1Y20 A;  1WDN A;  5ISU A;  5CC2 A;  2I49 A;  3G3G A;  4P11 A;  3TYH A;  2NWJ A;  1WOD A;  5I57 B;  1URS A;  3KG2 A;  4LQ5 A;  4R74 A;  3FXB A;  1IMB A;  2BJJ X;  4ESX A;  1CNQ A;  4NWC A;  3T9H B;  3MZB A;  4H6D A;  4OFJ A;  1D9Q A;  1PEB A;  1T0K A;  2UYF A;  1H44 A;  4YKI A;  4NF5 B;  3BIH A;  2CEX A;  1A55 A;  5H8Q A;  4GWX A;  2RKM A;  1USY E;  4EXL A;  4AQ4 A;  1A54 A;  5AA2 D;  2V3T A;  4HXV A;  3ZKK A;  1B7H A;  2ZYO A;  4BDM A;  1MM6 A;  2CZL A;  3DP8 A;  3T0J A;  3VLU A;  1P1W A;  1PDA A;  4BDL A;  2R71 A;  3H03 A;  1FBG A;  3H6T A;  4Z7E A;  2XXV A;  5LTC A;  5TPA A;  4GBW A;  3BKI B;  3LR1 A;  4XIG Q;  4RNS A;  3GXA A;  5I59 A;  1VFE A;  3TKD A;  3V5A A;  5ICQ A;  3TDJ A;  3ISP A;  3PUZ E;  3RYD A;  1OQG A;  2V3Q A;  2OBG A;  4OVP A;  4P1L A;  1ZIU A;  3K6V A;  2PBW A;  5H8H B;  1FTL A;  4NG7 A;  1OVT A;  1FPD A;  3QXM A;  5EQ8 A;  2V84 A;  4OVS A;  5DEX B;  3R26 A;  1H45 A;  2ZYM A;  2ZZW A;  4KCC A;  4WEP A;  1GVC A;  4ZS9 A;  1KWH A;  1NH8 A;  2UYE A;  3T93 B;  1QGX A;  4QFK A;  1PBQ A;  4IO7 A;  2F97 A;  3TTN A;  5L9M A;  4OTE A;  1LFI A;  2I3W A;  1B6H A;  2VD3 A;  1MPD A;  1JEU A;  5M2V A;  1Y1M A;  3PTY A;  4PBH A;  5EHM A;  3SER A;  4KFQ A;  2DQV A;  4ZEF A;  3USD A;  3RT6 B;  1QW0 A;  3HFU A;  3JV9 A;  4P56 A;  1B4Z A;  1PB9 A;  5HBC A;  3SEU A;  4NHB A;  1LBY A;  3KSJ A;  4IR8 A;  4DXC A;  1NV5 A;  3OO9 A;  3E9X A;  3RTW B;  1CB6 A;  3RT8 A;  1FQF A;  4IO3 A;  3GBB A;  1VR5 A;  1MY4 A;  4PET A;  1KA0 A;  3L6G A;  2XXU A;  2ZZX A;  3M3L A;  3OEN A;  1FQB A;  4PGN A;  4N07 A;  3FJG A;  3BIG A;  5HPQ A;  3TZA A;  3HN0 A;  3IO4 A;  1MPC A;  3LV0 A;  1VSO A;  4KYS A;  3MYU A;  4GOT A;  3FXQ A;  4JVI A;  4F2O A;  4KHZ E;  1J1N A;  1QVS A;  2P3V A;  5I56 A;  1FQE A;  2D3I A;  3BFT A;  2WBB A;  5ITO A;  4F22 A;  2XX9 A;  4R9F A;  4LZ5 A;  2DVZ A;  4XEQ A;  4U1O A;  3FXR A;  2QS3 A;  5JTY B;  1MXX A;  2I0B A;  1Z7N E;  1QUK A;  3O2A A;  4F31 B;  4O3B A;  2L5V A;  4PFY A;  3N94 A;  5CMB A;  1B1H A;  3TQW A;  1B7U A;  1N04 A;  1FBH A;  1VDW A;  5H8N A;  3MP6 A;  1MM7 A;  4DCX A;  4P0I A;  3CIJ A;  3I5O A;  3MZ1 A;  4X1B A;  5AA4 B;  4RPN A;  4X8R A;  3KBR A;  4OVJ A;  1SYI A;  4O8M A;  1PB7 A;  3CRB A;  4OES A;  4G8N A;  1MQJ A;  3O66 A;  4BDN A;  4O3C A;  5IGA A;  1EZP A;  1G0H A;  2DWH A;  4L17 A;  5ICT A;  1GGG A;  3N26 A;  4RY1 A;  3T96 B;  1LEV A;  4R6Y A;  4GD5 A;  2QS2 A;  4F39 A;  1TT1 A;  1FRP A;  3OO6 A;  4JSD A;  2NUV A;  4AB6 A;  4OHN A;  1NH7 A;  2O6A A;  4PF8 A;  1URD A;  2QPQ A;  4MEV A;  3LSF B;  3W15 C;  2H5Y A;  1NNP A;  5IM2 A;  3CSB A;  2O51 A;  3QIM A;  5CM6 A;  4N15 A;  4HCW A;  3DM0 A;  3FJM A;  1Q35 A;  2NVU B;  1R9Q A;  1B5J A;  4DDD A;  2ZYK A;  3TPA A;  4LON B;  4H5G A;  3PUY E;  3FVO A;  4GX3 A;  2UVJ A;  3DP6 A;  4MNC A;  2DXR A;  1MQI A;  2CEY A;  1FQD A;  4LUB A;  3W9V A;  2OLB A;  4GWY A;  4QSE A;  5I2K B;  4ZE8 A;  4H8J A;  4FEC A;  4OAN A;  3I6V A;  1YPN A;  1FPK A;  2WEF A;  1ZMG A;  1UQW A;  2REG A;  3MP8 A;  3UIF A;  1US5 A;  2F34 A;  4EQB A;  3FBP A;  3EQ1 A;  1MXU A;  3FAT A;  1K9Z A;  4YMB A;  1OIB A;  3QMF A;  5CMM A;  1B52 A;  3KJ7 A;  4ZDM A;  2RCA A;  1CE2 A;  3C33 A;  5H8F A;  2QVV A;  3TTR A;  4KD5 A;  2F3B A;  3JYR A;  5H8Q B;  3EHU A;  2XHD A;  3TUS A;  3FUZ A;  1M5E A;  1NV0 A;  1MY3 A;  4EF2 A;  4IO4 A;  2JJK A;  4NX1 A;  2QSX A;  3IO6 A;  2UVG A;  2VPN A;  1IMA A;  4MFI A;  2A5T A;  2ZYN A;  4NF0 A;  5TPA B;  1SI1 A;  4LQ2 A;  3H6V A;  4MX6 A;  1IXI A;  5I59 B;  1JVX A;  4XKQ A;  2O69 A;  1SPI A;  5EYG A;  2FHY A;  3WAE A;  3A29 A;  1LFG A;  4H65 A;  1LFH A;  1IUD A;  1AH5 A;  1NV2 A;  4PFI A;  1XVX A;  2F7B A;  4FOR A;  4O3A A;  4N6P A;  5EHS A;  3NOH A;  3U94 A;  1YXI A;  1QJM A;  3W9W A;  1FTM A;  4R73 A;  1P1Q A;  3EHT A;  2Z8D A;  2F7A A;  3GZG A;  2V4C A;  2O1M A;  1OLA A;  2CZK A;  3ILT B;  2XXT A;  3PPO A;  5JK4 A;  3GLB A;  3I3V A;  4HTG A;  3T9X B;  4RK9 A;  1Y3P A;  4ZED A;  3K1M A;  1EZO A;  2I3V A;  4NF8 A;  3LUZ A;  5K2Y A;  2D21 A;  3FV2 A;  5FHO A;  4DXU A;  5FHN A;  4DI3 D;  4OEU A;  1NV4 A;  3RPW A;  4PAK A;  4JB7 A;  3T9V A;  4QF9 A;  3IB0 A;  1EYI A;  1JW4 A;  1LCT A;  1XI6 A;  3C32 A;  1IEJ A;  3Q25 A;  4KQP A;  3IL1 B;  5DTB A;  4TOZ A;  5EQ9 A;  3LSX A;  2A5S A;  1H76 A;  1JNF A;  1NUY A;  4PTK A;  3PUV E;  2AIX A;  5A5L A;  1OQH A;  1N7X A;  4I3Y A;  2P0S A;  1N3X A;  3TTK A;  1MY0 A;  4FAT A;  5L9S A;  1XC1 A;  5F7V A;  4F1U A;  3T1B A;  4XFE A;  5AA1 A;  5I56 B;  1GR2 A;  4NE4 A;  3PMW A;  1GV8 A;  1TFD A;  1P1U A;  4FE8 A;  3C36 A;  4F1V A;  4ZEC A;  1D4N A;  1MQH A;  1SI0 A;  2V25 A;  4GX6 A;  3A3C A;  1IZ1 A;  4MIJ A;  4QHQ A;  2Y7K A;  4PDD A;  1DK4 A;  2OCU A;  2RC9 A;  1ELJ A;  1VE4 A;  1D9Y A;  5H8N B;  1JET A;  4ELR A;  4G8M A;  1FPJ A;  1ZLQ A;  3MAM A;  1B58 A;  1ZKB A;  4MNP A;  1DTG A;  1P1N A;  1SVX B;  5I2K A;  5CBR A;  1FBC A;  4GWU A;  4IGT A;  4XXU A;  3JZJ A;  2X7P A;  1QUI A;  2F3D A;  3IFC A;  3RNN A;  1USY H;  1LAF E;  4PP0 A;  2XWK A;  1NUZ A;  2XXI A;  4WKM A;  3MJN A;  3TMG A;  1UIU A;  1FBE A;  4XF5 A;  4P9K A;  4YZZ A;  5ESY A;  3QK6 A;  3HST A;  3THI A;  4EUO A;  2GH9 A;  5EYH A;  3N5L A;  3T66 A;  1B2H A;  1I6Q A;  2FVZ A;  2VP1 A;  3V83 A;  3MBP A;  4F3P A;  3MZ9 A;  1D9V A;  1RYX A;  1OMP A;  3RLF E;  2P3N A;  3KC0 A;  1B4H A;  4BDO A;  4G68 B;  3HHG A;  2O1L A;  2E0S A;  1IXC A;  3K4U A;  5F1Q A;  1ZBM A;  2IEE A;  3H6U A;  3H4Z A;  2HEU A;  4ELP A;  4LP2 B;  3MPL A;  3PPQ A;  3FZV A;  4KI0 E;  1B3F A;  4YB6 A;  3MQ9 A;  3S9N C;  3OSQ A;  2G93 A;  3OOA A;  2PVU A;  1RDY A;  4FEB A;  4PGP A;  2Y7R A;  4OVQ A;  3S9L C;  4ISU A;  5I5P A;  3C4M A;  2XXH A;  4G61 A;  1YZ0 A;  4F3G A;  5H8F B;  1DBZ A;  4MHF A;  1BTJ A;  4U2R A;  4I1D A;  3O97 A;  3MUQ A;  2WYK A;  3RQT A;  1B32 A;  2NXO A;  2DYX A;  4MLV A;  1QUL A;  4MMP A;  2ONS A;  2IA4 A;  1UTH A;  4KYE A;  3E79 A;  3KN8 A;  1RDX A;  3UN6 A;  2A5T B;  1K9Y A;  2PMS A;  2P2A A;  2LAO A;  3VVF A;  4P8B A;  4F3B A;  1Y9U A;  5FBP A;  2FBP A;  3KOS A;  2PX1 A;  3TCF A;  4JBZ A;  3MW0 A;  4ZEI A;  1MRP A;  4ONY A;  2X26 A;  2PCR A;  4X04 A;  4OFO A;  2KLF A;  4GF8 A;  3B6T A;  4GLI A;  2ZMB A;  3CFL A;  4G4P A;  5BUU A;  4QBA A;  5TU0 A;  2RIN A;  1QKA A;  3IJX B;  1R6Z A;  5CI5 A;  3E13 X;  5L8D A;  2WBD A;  2Q9T A;  3OXN A;  4I40 A;  1INP A;  2HPG A;  3PD8 A;  5F24 A;  2VOZ A;  4XKR A;  4FIM A;  3RPL A;  1DPP A;  4NF8 B;  4IY6 A;  4RJZ A;  3G3K A;  1MH4 A;  2WYP A;  1L5T A;  1M5B A;  3C9H A;  1LBB A;  1DPE A;  4F1Y A;  1QUJ A;  1NNF A;  1H3D A;  3IAZ A;  3R6U A;  4DCY A;  5LOM A;  3TTM A;  2XD2 A;  4N8Y A;  1IMF A;  1FPL A;  3L6H A;  3B50 A;  2I58 A;  4QFL A;  1MG1 A;  3C31 A;  1HSJ A;  3K6W A;  1BP5 A;  2F6P A;  2Y7I A;  3SEY A;  2HXW A;  2QVR A;  3PD9 A;  2ONK E;  3N6U A;  3CFZ A;  3PMV A;  3CG3 A;  1SBP A;  1B05 A;  4X48 A; 
#chains in the Genus database with same CATH homology
 4H67 A;  4FAJ A;  5ELV A;  3B7D A;  3K00 A;  4GIZ A;  3CI8 A;  3H06 B;  4ESW A;  2THI A;  3D4C A;  4EDP A;  4EQ9 A;  4R6H A;  4OYV A;  1P99 A;  5B7D A;  2XX8 A;  1N7W A;  3BBR A;  5A5X A;  3VXB A;  2AYS A;  2OZZ A;  4JWO A;  2HFB A;  4GL8 A;  4Q5T A;  2F78 A;  3IOW A;  3VLV A;  2ZNT A;  5H8S A;  1NNT A;  2H4I A;  3AXF A;  3G3H A;  4F3S A;  3ONM A;  4OZ9 A;  1SW5 A;  3ODB A;  2OK2 A;  2UXA A;  3A09 A;  4OEN A;  3OD7 A;  4NTL A;  1IXG A;  4G68 A;  2Q89 A;  2VD2 A;  3HCQ A;  2V3U A;  4KYD A;  2RCB A;  1I6A A;  4YKJ A;  2UVI A;  4ZZE A;  4ELO A;  3HPI A;  3QAX A;  2F6G A;  4XKP A;  1H43 A;  1SW4 A;  3G3I A;  1MXY A;  4I9D A;  1URG A;  2AL5 A;  3B6Q A;  2Z22 A;  2F36 A;  3SET A;  5ITP A;  3MVW A;  1AOV A;  5TP9 B;  3UA8 A;  3DP4 A;  1OVB A;  2HCA A;  2XXW A;  2ONR A;  4H5F A;  4F29 A;  1O7T A;  2GRV A;  1FCK A;  1SD3 A;  4AB5 A;  4C0R A;  2DXY A;  1NKX A;  3M3K A;  2DVC A;  3FD3 A;  1MDQ A;  3VE1 B;  4QSD A;  1LAG E;  3U92 A;  3N6T A;  2PT1 A;  2XXY A;  1B5H A;  4OMB A;  4HS7 A;  4Q0C A;  4BDR A;  4TQU Q;  1DMB A;  2HAU A;  1B40 A;  1S9T A;  1GTK A;  5JEI A;  1II5 A;  5CMC A;  4LVQ A;  1SQY A;  2DOJ A;  4IO6 A;  5FTH A;  2D5W A;  5IKB A;  1ZJL A;  4QFO A;  2B3B A;  4GWO A;  4NF6 A;  3EN3 A;  4F2Q A;  1FQC A;  4F19 A;  3IB1 A;  4OFL A;  3UK4 A;  4OER A;  2GFE A;  2M8C A;  3PMX A;  2Q2C A;  3O29 A;  4PFT A;  1WVJ A;  4Q30 B;  1UTH B;  4H0W A;  1AMF A;  3K6X A;  5K2X A;  3PPP A;  3D4G A;  3IOV A;  2DP8 A;  4U21 A;  2Z8F A;  2H9B A;  1Y4T A;  2ANJ A;  1ATG A;  1MH3 A;  1P1O A;  1ANF A;  2I6E A;  2DE4 A;  3RY3 A;  2Z23 A;  3LUY A;  1XOC A;  4JDF A;  2R9J A;  3VFJ A;  1XVY A;  4PQJ A;  2Y7P A;  3TAJ A;  4NWD A;  2H25 A;  2O7I A;  3O28 A;  4I62 A;  3Q27 A;  1MQD A;  4OXV A;  4RYA A;  3U72 A;  2H98 A;  3FGS A;  3K1N A;  2QRY A;  3B6W A;  4POW A;  3IOT A;  3Q29 A;  2ESN A;  3PPN A;  2ABH A;  2I48 A;  3KN3 A;  3FVG A;  1AIV A;  3LBS A;  4M4G A;  2QS4 A;  2X7Q A;  4JXI A;  3MVY A;  4GL0 A;  5FHM A;  4QRZ A;  2R6G E;  3C34 A;  3EPE A;  3LSL A;  4IB2 A;  3S9E A;  1O64 A;  1QKB A;  2Q2A A;  4DE8 A;  4BLA A;  3HO7 A;  4PFW A;  3U8Q A;  3IB2 A;  5EYF A;  3PV0 E;  3MC2 A;  3K6U A;  3E4R A;  1TXF A;  2I0C A;  4EXK A;  3KSX A;  3ILU B;  3FVN A;  5DT6 A;  2FYI A;  4U4X A;  4M1V A;  1O63 A;  1LST A;  4GXA A;  1EU8 A;  2REJ A;  1Y4C A;  2HAV A;  3BFU A;  2HZK A;  1LGB C;  3VVD A;  3PU5 A;  4Z0I A;  4KCD A;  4DLD A;  3CR9 A;  4U22 A;  2QMW A;  5A5X B;  1A8F A;  4GVO A;  4PFU A;  4G2Z A;  5TP9 A;  4YMA A;  3Q26 A;  3VVE A;  2B3F A;  3OO8 A;  2ZNS A;  1HSE A;  5CRY A;  3DLN A;  2XX7 A;  3KOT A;  1N76 A;  3LC8 A;  2O7U A;  4ND9 A;  4LA9 A;  3S4U A;  1Z7M E;  4XTC Q;  1FTJ A;  4UAC A;  4DIG A;  1M5C A;  1UTB A;  3H3G A;  2O68 A;  3KJT A;  1IIW A;  1YAE A;  3EF7 A;  3E3K A;  4IY5 A;  2PT2 A;  5I58 A;  4RA1 A;  5KDT B;  3GBA A;  3K2D A;  1R1N A;  4E0X A;  4GFR A;  4KR5 A;  4ECF A;  3Q28 A;  1MQG A;  5I2N A;  3IOR A;  3S9M C;  1JQF A;  5B70 A;  3QUJ A;  3FV1 A;  2OWT A;  2HZL A;  1A99 A;  4LZ7 A;  3TOD A;  2V93 A;  4C1U A;  3R7X A;  3SEX A;  1YCJ A;  1JW1 A;  3TCG A;  2YLN A;  3VV5 A;  2GHA A;  1A40 A;  2OWS A;  1M5D A;  2VHA A;  2XXX A;  3PPR A;  1NL5 A;  4YU0 A;  2F5X A;  3FIR A;  4WED A;  4JWY A;  1B51 A;  3M8U A;  2CMO A;  4K3F A;  1PC3 A;  4YKK A;  4BDQ A;  4FED A;  1MY2 A;  3UP9 A;  3O6H A;  3T9U A;  3IR1 A;  3RUM A;  1N3W A;  1DTZ A;  3KN7 A;  1MS7 A;  4GRK A;  3VLW A;  5AE4 A;  3A3U A;  1IQ7 A;  4ZE9 A;  1IXH A;  4GQO A;  2G29 A;  2E1S A;  4R75 A;  2QJE A;  2O84 X;  3RGY A;  1JEV A;  3MWB A;  2Q8J A;  2I4B A;  1JW5 A;  1TFA A;  4NF6 B;  3TEP A;  1B7Z A;  1B0L A;  5DVJ A;  1I6B A;  3PUW E;  4G8H A;  3MVZ A;  2DWI A;  4QSC A;  5AA2 A;  2B65 A;  4KPT A;  3U1O A;  2XXQ A;  2ZXT A;  3H7M A;  2UVH A;  3P7I A;  1SYH A;  3OO7 A;  1IIT A;  1AL3 A;  3MVX A;  5HM4 B;  3TEL A;  4Q8R A;  5FTI A;  4QFN A;  4R6K A;  2DS9 A;  4TLL B;  2ALU A;  4U4S A;  1B46 A;  1A7L A;  3S2V A;  1NNK A;  1PB8 A;  4YIC A;  1VFD A;  4YB7 A;  2VGQ A;  1D3K A;  5KZT A;  1US4 A;  4R9G A;  4NF4 A;  1XS5 A;  3K1P A;  5KCJ B;  4TLM B;  2W7Y A;  3WAF A;  3SEV A;  4LZ8 A;  3KZG A;  1HSL A;  5AA3 A;  2FNC A;  5DVI A;  1LBC A;  3KEI A;  1RYO A;  4IO5 A;  1N0T A;  4ZZA A;  3ECR A;  1EZ9 A;  1SW2 A;  2F7C A;  2RF1 A;  1BKA A;  1Y1Z A;  1B3L A;  3UOR A;  2P1S A;  3IK6 B;  3QYT A;  4I8C A;  1POY 1;  3H6W A;  2DE2 A;  2DSF A;  1B3G A;  3CG1 A;  2AL4 A;  5I57 A;  2OJT A;  1UIV A;  4THI A;  4JSO A;  3SEW A;  4P0G A;  4YKP A;  3O9P A;  2H99 A;  5KDT A;  2DE3 A;  4NF5 A;  1MY1 A;  3FXU A;  3C35 A;  3FVK A;  3UGW A;  4GXS B;  3LSW A;  1OLC A;  3OSR A;  1A8E A;  1XT8 A;  4MLQ A;  4F18 A;  1YTV A;  4HCY A;  1MPB A;  3SDF A;  1JVY A;  3ZS6 A;  2Y7W A;  1FTO A;  3O6G A;  4R72 A;  4LAT A;  1I69 A;  5CBS A;  2WKY A;  5L9O A;  4UA8 A;  3K0V A;  3OEM A;  1LAH E;  1FQA A;  4RK2 A;  1NMU A;  5H8H A;  1XHY A;  4OQO A;  4U23 A;  4YB5 A;  1UTB B;  2GHB A;  4DXB A;  3T22 A;  3DEL B;  5DEX A;  4H1X A;  3MP1 A;  3IX1 A;  5I58 B;  1S7Y A;  5DYH A;  2DWA A;  1DSN A;  1Q1K A;  3IOU A;  2XD3 A;  3OMB A;  5I2N B;  1M5F A;  2Y84 A;  4ZEB A;  4R2B A;  2QS1 A;  2Q88 A;  3SKP A;  2YJP A;  4HW8 A;  3QSL A;  1F9B A;  4NED A;  1DOT A;  1Y3N A;  4NMY A;  1PBP A;  3FJ7 A;  1Y3Q A;  4MF3 A;  2HQ0 A;  4YAH X;  3TTL A;  1RKM A;  3VDF A;  4G68 C;  3HV1 A;  1N84 A;  1MDP 1;  3RN8 A;  1MXZ A;  3TCH A;  2Z8E A;  2QL3 A;  4MH5 A;  1ZU0 A;  3TFL A;  1MXW A;  1BIY A;  3O6I A;  4H8I A;  3RTF B;  2PYY A;  4RPO A;  2XXP A;  1B5I A;  3G7W A;  3ZSF A;  4EF1 A;  4MBP A;  4E0W A;  3G3F A;  4X9T A;  1B3E A;  3KFM A;  3V8X B;  3K01 A;  5DVF A;  4ELQ A;  1LLS A;  3QUF A;  4JWX A;  5JTY A;  3F11 A;  4DZ1 A;  1EH3 A;  5KCJ A;  4POX A;  3KGC A;  2XXR A;  3M3F A;  4U1Z A;  3V89 B;  1LB9 A;  3MPK A;  3VXC A;  1B3H A;  5J1D A;  5AA4 A;  5AA2 B;  4IO2 A;  5CMK A;  3SES A;  1NFT A;  1TWY A;  4OET A;  2ZNU A;  1BLF A;  2RC7 A;  2F8D A;  1SDX A;  3CVG A;  4X1D A;  1R9L A;  4RXL A;  3U93 A;  3IJO B;  3G3J A;  4XKN A;  4WXJ A;  2QMX A;  1POT A;  5IAI A;  4QFP A;  1S50 A;  3TQL A;  3PUX E;  4OWD A;  2DWJ A;  4OEV A;  1SW1 A;  2FA7 A;  3OEK A;  1ZTY A;  1FTK A;  4N13 A;  4NF4 B;  2I4C A;  2NOO A;  3HHF A;  4R2F A;  3K02 A;  1B9J A;  1MXV A;  1FW0 A;  3CSG A;  2F35 A;  2RC8 A;  4FJP A;  3FAS A;  4EQ7 A;  1B1X A;  3ZKL A;  5I84 A;  3CFX A;  4C1T A;  4G77 A;  1LB8 A;  1LAX A;  3PGF A;  3EHS A;  4IGR A;  5BWJ A;  4ZEK A;  1LCF A;  2YPN A;  4PE5 B;  1B0H A;  3OEL A;  1Y20 A;  1WDN A;  5ISU A;  5CC2 A;  2I49 A;  3G3G A;  4P11 A;  3TYH A;  2NWJ A;  1WOD A;  5I57 B;  1URS A;  3KG2 A;  4LQ5 A;  4R74 A;  2BJJ X;  4ESX A;  4NWC A;  3T9H B;  3MZB A;  4H6D A;  4OFJ A;  1PEB A;  1T0K A;  2UYF A;  1H44 A;  4YKI A;  4NF5 B;  1A55 A;  5H8Q A;  2RKM A;  1USY E;  4EXL A;  4AQ4 A;  1A54 A;  5AA2 D;  2V3T A;  3ZKK A;  1B7H A;  2ZYO A;  4BDM A;  1MM6 A;  2CZL A;  3DP8 A;  3VLU A;  1P1W A;  1PDA A;  4BDL A;  2R71 A;  3H03 A;  3H6T A;  4Z7E A;  2XXV A;  5TPA A;  3BKI B;  3LR1 A;  4XIG Q;  4RNS A;  3GXA A;  5I59 A;  1VFE A;  3TKD A;  3V5A A;  5ICQ A;  3TDJ A;  3PUZ E;  1OQG A;  2V3Q A;  2OBG A;  1ZIU A;  3K6V A;  2PBW A;  5H8H B;  1FTL A;  1OVT A;  3QXM A;  2V84 A;  5DEX B;  3R26 A;  1H45 A;  2ZYM A;  4KCC A;  4WEP A;  1GVC A;  4ZS9 A;  1KWH A;  1NH8 A;  2UYE A;  3T93 B;  4QFK A;  1PBQ A;  4IO7 A;  2F97 A;  3TTN A;  5L9M A;  4OTE A;  1LFI A;  2I3W A;  1B6H A;  2VD3 A;  1MPD A;  1JEU A;  5M2V A;  1Y1M A;  5EHM A;  3SER A;  4KFQ A;  2DQV A;  4ZEF A;  3USD A;  3RT6 B;  1QW0 A;  3JV9 A;  1B4Z A;  1PB9 A;  5HBC A;  3SEU A;  3KSJ A;  4DXC A;  3OO9 A;  3E9X A;  3RTW B;  1CB6 A;  3RT8 A;  1FQF A;  4IO3 A;  3GBB A;  1VR5 A;  1MY4 A;  4PET A;  3L6G A;  2XXU A;  3M3L A;  3OEN A;  1FQB A;  4N07 A;  3FJG A;  5HPQ A;  3TZA A;  3HN0 A;  3IO4 A;  1MPC A;  1VSO A;  4KYS A;  4GOT A;  3FXQ A;  4F2O A;  4KHZ E;  1J1N A;  1QVS A;  5I56 A;  1FQE A;  2D3I A;  3BFT A;  5ITO A;  4F22 A;  2XX9 A;  4R9F A;  4LZ5 A;  2DVZ A;  4U1O A;  3FXR A;  5JTY B;  2QS3 A;  1MXX A;  2I0B A;  1Z7N E;  1QUK A;  3O2A A;  4F31 B;  4O3B A;  4PFY A;  3N94 A;  5CMB A;  1B1H A;  3TQW A;  1B7U A;  1N04 A;  5H8N A;  3MP6 A;  1MM7 A;  4DCX A;  4P0I A;  3CIJ A;  3I5O A;  3MZ1 A;  4X1B A;  5AA4 B;  4RPN A;  3KBR A;  4OVJ A;  1SYI A;  1PB7 A;  3CRB A;  4OES A;  4G8N A;  1MQJ A;  3O66 A;  4BDN A;  4O3C A;  1EZP A;  2DWH A;  4L17 A;  5ICT A;  1GGG A;  3N26 A;  4RY1 A;  3T96 B;  4R6Y A;  4GD5 A;  2QS2 A;  4F39 A;  1TT1 A;  3OO6 A;  4JSD A;  2NUV A;  4AB6 A;  4OHN A;  1NH7 A;  2O6A A;  1URD A;  2QPQ A;  3LSF B;  3W15 C;  2H5Y A;  1NNP A;  3CSB A;  2O51 A;  3QIM A;  5CM6 A;  4HCW A;  3DM0 A;  3FJM A;  1Q35 A;  2NVU B;  1R9Q A;  1B5J A;  4DDD A;  2ZYK A;  3TPA A;  4LON B;  4H5G A;  3PUY E;  3FVO A;  2UVJ A;  3DP6 A;  2DXR A;  1MQI A;  1FQD A;  4LUB A;  3W9V A;  2OLB A;  4QSE A;  5I2K B;  4ZE8 A;  4H8J A;  4FEC A;  3I6V A;  1YPN A;  1ZMG A;  1UQW A;  2REG A;  3MP8 A;  3UIF A;  1US5 A;  2F34 A;  4EQB A;  3EQ1 A;  1MXU A;  3FAT A;  4YMB A;  1OIB A;  5CMM A;  1B52 A;  3KJ7 A;  4ZDM A;  2RCA A;  1CE2 A;  3C33 A;  5H8F A;  3TTR A;  4KD5 A;  3JYR A;  5H8Q B;  3EHU A;  2XHD A;  3TUS A;  3FUZ A;  1M5E A;  1MY3 A;  4EF2 A;  4IO4 A;  2QSX A;  3IO6 A;  2UVG A;  4MFI A;  2A5T A;  2ZYN A;  5TPA B;  1SI1 A;  4LQ2 A;  3H6V A;  1IXI A;  5I59 B;  1JVX A;  4XKQ A;  2O69 A;  3WAE A;  1LFG A;  4H65 A;  1LFH A;  1IUD A;  1AH5 A;  1XVX A;  2F7B A;  4FOR A;  4O3A A;  4N6P A;  5EHS A;  3U94 A;  1QJM A;  3W9W A;  1FTM A;  4R73 A;  1P1Q A;  3EHT A;  2Z8D A;  2F7A A;  3GZG A;  2O1M A;  1OLA A;  3ILT B;  2XXT A;  3PPO A;  5JK4 A;  3GLB A;  3I3V A;  4HTG A;  3T9X B;  4RK9 A;  1Y3P A;  4ZED A;  3K1M A;  1EZO A;  2I3V A;  4NF8 A;  5K2Y A;  2D21 A;  3FV2 A;  5FHO A;  4DXU A;  5FHN A;  4OEU A;  3RPW A;  4JB7 A;  3T9V A;  4QF9 A;  3IB0 A;  1JW4 A;  1LCT A;  3C32 A;  1IEJ A;  3Q25 A;  4KQP A;  3IL1 B;  5DTB A;  4TOZ A;  3LSX A;  2A5S A;  1H76 A;  1JNF A;  3PUV E;  2AIX A;  1OQH A;  1N7X A;  2P0S A;  1N3X A;  3TTK A;  1MY0 A;  4FAT A;  5L9S A;  1XC1 A;  5F7V A;  4F1U A;  5AA1 A;  5I56 B;  1GR2 A;  4NE4 A;  3PMW A;  1GV8 A;  1TFD A;  1P1U A;  4FE8 A;  3C36 A;  4F1V A;  4ZEC A;  1D4N A;  1MQH A;  1SI0 A;  2V25 A;  3A3C A;  1IZ1 A;  4QHQ A;  2Y7K A;  2OCU A;  2RC9 A;  1ELJ A;  1VE4 A;  1D9Y A;  5H8N B;  1JET A;  4ELR A;  4G8M A;  1ZLQ A;  3MAM A;  1B58 A;  1ZKB A;  1DTG A;  1P1N A;  1SVX B;  5I2K A;  5CBR A;  4IGT A;  4XXU A;  3JZJ A;  2X7P A;  1QUI A;  3RNN A;  1USY H;  1LAF E;  4PP0 A;  2XXI A;  4WKM A;  3MJN A;  3TMG A;  1UIU A;  4YZZ A;  3QK6 A;  3HST A;  3THI A;  4EUO A;  2GH9 A;  3T66 A;  3N5L A;  1B2H A;  1I6Q A;  2VP1 A;  3V83 A;  3MBP A;  4F3P A;  3MZ9 A;  1D9V A;  1RYX A;  1OMP A;  3RLF E;  1B4H A;  4BDO A;  4G68 B;  3HHG A;  2O1L A;  2E0S A;  1IXC A;  3K4U A;  5F1Q A;  1ZBM A;  2IEE A;  3H6U A;  3H4Z A;  2HEU A;  4ELP A;  4LP2 B;  3MPL A;  3PPQ A;  3FZV A;  4KI0 E;  1B3F A;  4YB6 A;  3MQ9 A;  3S9N C;  3OSQ A;  2G93 A;  3OOA A;  2PVU A;  4FEB A;  2Y7R A;  3S9L C;  4ISU A;  3C4M A;  2XXH A;  4F3G A;  5H8F B;  1BTJ A;  4U2R A;  4I1D A;  3O97 A;  3MUQ A;  3RQT A;  1B32 A;  2NXO A;  2DYX A;  4MLV A;  1QUL A;  2ONS A;  2IA4 A;  1UTH A;  4KYE A;  3KN8 A;  3UN6 A;  2A5T B;  2PMS A;  2P2A A;  2LAO A;  3VVF A;  4F3B A;  1Y9U A;  3KOS A;  2PX1 A;  3TCF A;  4JBZ A;  3MW0 A;  4ZEI A;  1MRP A;  4ONY A;  2X26 A;  4OFO A;  2KLF A;  4GF8 A;  3B6T A;  4GLI A;  2ZMB A;  3CFL A;  4G4P A;  5BUU A;  5TU0 A;  2RIN A;  1QKA A;  3IJX B;  1R6Z A;  5CI5 A;  3E13 X;  5L8D A;  2Q9T A;  3OXN A;  3PD8 A;  2VOZ A;  4XKR A;  4FIM A;  1DPP A;  4NF8 B;  4IY6 A;  3G3K A;  1MH4 A;  4RJZ A;  1L5T A;  1M5B A;  3C9H A;  1LBB A;  1DPE A;  4F1Y A;  1QUJ A;  1NNF A;  1H3D A;  3IAZ A;  3R6U A;  4DCY A;  5LOM A;  3TTM A;  2XD2 A;  3L6H A;  2I58 A;  4QFL A;  1MG1 A;  3C31 A;  1HSJ A;  3K6W A;  1BP5 A;  2F6P A;  2Y7I A;  3SEY A;  2HXW A;  3PD9 A;  2ONK E;  3N6U A;  3CFZ A;  3PMV A;  3CG3 A;  1SBP A;  1B05 A;  4X48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...