4OA4A

Crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4 (shew_1446), target efi-510273, with bound succinate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
PTEIKFSHVVAENTPKGQMALKFKQLVEERLPGEYQVNVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKDMDAVNRFQQSDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMASDVLAAQFQAVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTSNTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYLTPEQRAAWVNAMKPVWAQFEDKIGKDLIDAAVASNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Shewanella loihica
total genus 103
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4oa4A00
4NN3A 2CEYA 4UABA 4PAFA 2XXKA 4N4UA 2V4CA 4PFRA 4N8YA 4PDDA 4PFBA 2HZKA 4OA4A 4MNPA 2HPGA 4MAGA 4P8BA 2XWKA 4NX1A 4LN5A 4MMPA 4PGNA 2WYPA 4MNCA 4NG7A 4P3LA 4X04A 4P56A 4PGPA 4XEQA 4PF6A 4YZZA 4P1LA 4MIJA 4P9KA 4NAPA 2XWVA 2ZZVA 2XWOA 5IM2A 4N6KA 2HZLA 4MHFA 4XFEA 4N17A 3GYYA 4O8MA 5CM6A 4NF0A 4XF5A 2CEXA 4P1EA 4NGUA 2PFZA 4OVQA 5IZZA 4PC9A 4MCOA 2PFYA 5IGAA 2XWIA 4NQ8A 4MNIA 2VPOA 4X8RA 4PBHA 5LTCA 5I5PA 4N15A 4OVPA 4PAIA 4PF8A 4O7MA 4MX6A 4PETA 4P47A 2WYKA 4N8GA 4OVRA 4MEVA 2WX9A 2ZZWA 4O94A 3U65A 5I7IA 2VPNA 4PBQA 2XA5A 4DI3D 4PE3A 4YICA 3B50A 3FXBA 4OVSA 4N6DA 4N91A 4OANA 4DI4B 4PAKA 4PDHA 4PFIA 4OVTA 4NHBA 4PCDA 2ZZXA
chains in the Genus database with same CATH superfamily
4XKPA 3I6VA 4UABA 1N3WA 2ZYMA 2HAUA 2NVUB 2R6GE 3O6IA 4ELPA 5B70A 2CMOA 4LN5A 4AS5A 1B51A 4JVCA 5H8HA 1A99A 5IZ3B 2HCAA 1D4NA 1SD3A 4PGNA 4H5FA 2B3BA 4NWCA 3PPOA 4KCDA 5L9OA 2ONRA 4MLVA 1XC1A 1LAXA 4NEDA 5TU0A 3PPPA 4GD5A 4FEDA 1N04A 4H46A 3SEWA 3D4GA 1JNFA 4PQJA 3FUZA 5AA2A 4MHFA 5HBCA 3H7MA 3CRBA 5DVJA 3K02A 3SEXA 3BBRA 4KD5A 3QSLA 1YPNA 4PC9A 1FPDA 4EQBA 4NF4B 4HE0A 1PB8A 3R26A 3TTMA 2RC9A 1MXWA 2VHAA 5I59B 3MW0A 1OVTA 1UQWA 3CFZA 1IUDA 1QGXA 2NOOA 4TQUQ 3TTNA 1JEUA 1BTJA 2HAVA 2ZMBA 1B2HA 3O29A 2Z8EA 4HCYA 3DP4A 4I8CA 4Q30B 3U65A 3UORA 3P7IA 3TQWA 4QXDA 4Z0IA 4ZEDA 3JV9A 2XX8A 1IMFA 3MSTA 3A09A 2Z8DA 2A5TB 1ZU0A 3OD7A 1QUKA 3A3CA 3S9EA 3OEMA 5I2KB 5B7DA 1I6QA 4PDHA 3B6TA 1XI6A 1JW1A 3LSFB 3GLBA 2M8CA 3N6UA 3TDJA 4QF9A 3TZAA 4R2BA 3WAEA 4X1BA 4C0RA 2DS9A 3NOHA 1SI1A 4FE8A 2HEUA 3DLNA 1QULA 4RY1A 1LBWA 5IZ3A 2KR0A 1US4A 4XXUA 4G4PA 2P1SA 2GQ1A 2WKYA 5CBRA 3MVYA 3TTRA 4RK2A 3GYYA 3G7WA 1NV7A 1TT1A 3EHSA 5CMMA 4DCYA 4FAJA 5CM6A 1B3LA 1OVBA 4IO7A 5IGAA 5ISUA 4I3EA 3ILTB 1EZPA 4R74A 1B5JA 1ZLQA 4OEVA 4NF4A 2PX1A 1IXGA 3KN3A 4WEDA 4NMYA 4FATA 1MM7A 5FTIA 4MX6A 1PB7A 1XVYA 3QIMA 3LC8A 4F3BA 3V5AA 1VE4A 4O94A 2Z22A 2QS2A 2F6PA 2PVUA 4ESWA 1NFTA 2MKZA 5FBPA 1MQDA 3T93B 4H8IA 3TAJA 2XXPA 2CZIA 1B0LA 3VE1B 5EQ7A 3BFTA 5AE4A 2A5SA 4N07A 5I2KA 5EQ8A 5ET5A 4ZE9A 2O6AA 3W9WA 2CZLA 3M8UA 4OFOA 2QS1A 1B40A 1NV6A 4TOZA 3O9PA 3O97A 5F1QA 1Y9UA 1TXFA 4R6HA 1IXCA 2GHAA 3EQ1A 2I3VA 3PUXE 4MNCA 3VLVA 3O28A 1LBYA 5JEIA 2GH9A 3KJTA 4GXAA 1N84A 5EYHA 3CVGA 3HO7A 1LBVA 3IO4A 4BDNA 2DXYA 1B7ZA 3MBPA 4F1VA 1SDXA 3H6TA 3PD8A 3U93A 3Q29A 3LBSA 4IGTA 1MXUA 3UGWA 3TCGA 3BKIB 3QUFA 4ISUA 5M2VA 3E9XA 3A29A 2VP1A 3I3VA 1LEVA 2P3NA 3RTWB 4LQ2A 3MAMA 4R75A 1IMAA 1RDYA 3N5LA 4DXCA 1S50A 3KSJA 1QKAA 2REJA 5ITOA 1MXVA 4I62A 4DI3D 3S4UA 3VXBA 4F3GA 1B1HA 3IOVA 5DT6A 1DTGA 5IAIA 1B7UA 4F3SA 4EQ7A 3A3UA 1S7YA 3HFUA 4JVIA 2X7PA 4EF2A 2OWZA 1DPEA 3UN6A 3DELB 3TELA 3SERA 3T9HB 5CMCA 4U23A 2ALUA 1O64A 4ZEIA 4NF6A 4KHZE 2F3BA 1JVYA 4P9KA 4NAPA 5AA3A 3TFLA 4FIMA 4YB7A 2DXRA 2OWTA 4AB5A 1ANFA 3PUVE 2Y5KA 1EH3A 1GVCA 4ELOA 3ZS6A 2CEXA 2RC8A 2I58A 1B58A 2WBBA 2FA7A 3TKDA 1FPIA 2KQZA 4BDRA 1Y3NA 4MF3A 4OTEA 5I5PA 5EYGA 1VFDA 2ABHA 3HCQA 4ZS9A 4GXSB 3FXUA 5IZ1A 2F97A 1M5BA 2F7AA 1O63A 2FVZA 4FBPA 2Q9TA 4GBWA 1FPEA 3PPRA 2XXQA 4G8HA 3C4MA 2XXTA 4YMBA 3FIRA 3USDA 3OO7A 4NF8A 5AA4B 4PE3A 2Y7KA 4YICA 2XXRA 2ZYNA 1OQGA 4IY6A 3FATA 1OIBA 4QSCA 5EQAA 1XS5A 5FHNA 4DI4B 4EUOA 1A55A 1ZMGA 3MP1A 4PFWA 4JSOA 4Q5TA 2AIXA 2CEYA 4OENA 2XXKA 3UK4A 2UXAA 3K00A 1USYH 3U94A 4OA4A 3MUQA 2Q2AA 1NMUA 3KFMA 1LAGE 4U2RA 4E0XA 3RT6B 5L9MA 5I57B 5LOMA 4JXIA 4O3BA 5I58B 2DSFA 1FBDA 4NG7A 3DP8A 1WVJA 4LA9A 5I2NB 4MH5A 1SYHA 1UIUA 3K2DA 4H6DA 2IEEA 3PGFA 5TPAA 2XWVA 5H8SA 1FJ9A 2QRYA 1MXZA 2FBPA 4GVOA 2DWAA 2P0SA 1G0HA 3TUSA 3VLUA 1NH8A 5IKBA 4F19A 3FVKA 4OVQA 1LFHA 2BJIA 2ANJA 3CG1A 2QS4A 3KN8A 1JQFA 1R9LA 3KJ7A 1P1WA 4PETA 1FRPA 3G3KA 2REGA 3IK6B 1INPA 1N7XA 1XHYA 1PDAA 2B4LA 3C33A 2DVCA 3IB1A 3HN0A 1PEBA 4YMAA 1JEVA 3B7DA 5H8FB 4OYVA 4I40A 3K1PA 4X48A 3ZSFA 1I6BA 4YB6A 3B8BA 3HHGA 2UVJA 5H8NB 4MFIA 3MP6A 2HFBA 3OENA 3M3KA 3LUZA 4N8YA 4PDDA 3VVFA 3PMXA 4R6KA 4MAGA 4N6PA 1MG1A 2Q88A 3QUJA 4KI0E 4N81A 3MZBA 1FQCA 5L9SA 4BLAA 2UYEA 3C31A 4MMPA 4I1DA 2Z23A 1EYJA 2JJKA 3KZGA 3KEIA 5AA1A 3IJOB 4HS7A 4MIJA 3N26A 2YLNA 4GX3A 3I5OA 4C1UA 3OSQA 4QBAA 3SDFA 3T9UA 2XXVA 5ET8A 4GF8A 4QHQA 3K6WA 4G68B 1Q1KA 5DVFA 3RGYA 4GIZA 1IEJA 4MJOA 1URSA 4K3FA 1BKAA 2I6EA 4LATA 4Z7EA 4PBHA 2FIEA 1AWBA 1B4ZA 3TEPA 4G8MA 4JWXA 1AH5A 3EPEA 5DVIA 3N94A 1FQEA 4U1ZA 3IAZA 4QFKA 1H44A 2CZKA 1Y1ZA 1SW5A 5EYFA 2O51A 2FYIA 2ZZWA 1II5A 3IO6A 2KLFA 3TTLA 1LLSA 2ZYOA 1MQGA 4HXVA 4PTKA 3FVGA 5J16A 5K2XA 3IJXB 2OBGA 4DLDA 4H1XA 3JZJA 3TCHA 4NF5B 5H8FA 1UTHA 2V93A 4PP0A 4KPTA 2O69A 3MVXA 5JK4A 5I56B 4OWDA 2F78A 5TP9B 1WDNA 2Y7PA 4PFBA 3OSRA 5H8NA 1N3XA 3TODA 5J1DA 3FJMA 3IORA 1EZOA 3HHFA 2RCBA 3LSWA 4IO3A 4QSEA 2QMXA 1FQBA 2LAOA 3RUMA 1XVXA 4IO2A 2QS3A 2NWJA 2XX9A 1NNKA 3IOUA 4OFJA 1USYE 4DDDA 1MPCA 2YPNA 3Q25A 4XKQA 2GRVA 1LBCA 1YXIA 3PPNA 1FCKA 1H3DA 2E0SA 1FBHA 1IMEA 3RT8A 4WEPA 4XF5A 1CE2A 3W15C 4OFLA 4OQOA 4G68A 1GR2A 3OOAA 2PFYA 4MLQA 5CMKA 1AL3A 1SW2A 2CZHA 2WEFA 4OERA 1T0KA 4G61A 2HXWA 3S2VA 1LCFA 4N8GA 4OVRA 3LSXA 2QVUA 4H45A 3VVDA 3U8QA 3ODBA 2UVIA 1JETA 4F1UA 4ZECA 1K9YA 4F1YA 1ZKBA 3KGCA 3MVZA 1FTOA 1JW5A 3GBBA 2UYFA 2HXRA 5ET7A 1VDWA 2H25A 4PAKA 5CI5A 3IR1A 1DSNA 1B3GA 1DK4A 5I59A 3D1RA 4OVPA 4JWOA 4NN3A 3SEUA 3RTFB 3QAXA 4YU0A 2OCUA 2G29A 4FECA 4N4UA 1LFGA 3KG2A 1H45A 4YKIA 5BWJA 3PMWA 1R9QA 5TP9A 1MH4A 3RY3A 1NUWA 4R2FA 1R1NA 2H9BA 4QSDA 3EHTA 1NV4A 2Q8JA 3FGSA 3RPLB 1JW4A 2O7UA 2WYPA 2A5TA 3JYRA 4NTLA 3H6UA 3HPIA 4PGPA 1MY0A 1CB6A 4F31B 1XOCA 2HZLA 1S9TA 2VD2A 3FV1A 3FXRA 1MXXA 2I3WA 1GV8A 4NF0A 1YTVA 2AL4A 1FBGA 1Y1MA 3Q27A 1LBXA 3T96B 2QMWA 3S9NC 1RDXA 3VDFA 4ELQA 4N15A 3PUWE 1IMDA 4PAIA 2QJEA 4PF8A 1DCUA 1LBBA 4ZE8A 2DP8A 2PCRA 4OESA 1LCTA 3KN7A 3G3IA 4BDLA 4WKMA 2QVRA 3B50A 3MVWA 4N13A 1SPIA 4N91A 3KOSA 3PU5A 2X7QA 2DYXA 1NNPA 4GBVA 1JP4A 1BIYA 1AMFA 3GBAA 1B7HA 4JB7A 5I3SA 1Y4TA 3L6GA 4XKRA 1MPBA 4MNPA 1IITA 3H06B 1Z7NE 4PE5B 1MXYA 3KBRA 1LB9A 3TTKA 2FHYA 1Q35A 4F18A 2H99A 4KYEA 3CIJA 1LSTA 1VFEA 3C35A 3EKIA 3RPLA 4GQOA 2XX7A 4YAHX 4YZZA 4H0WA 4P1LA 2ONSA 5T3JA 5A5XB 4LZ8A 3W9VA 3G3GA 3IX1A 3M3FA 4Q0CA 4LQ5A 4OMBA 3E4RA 4LVQA 4QFNA 1KWHA 1FPKA 5JTYB 1QUJA 1JVXA 5KZTA 1M5EA 1IZ1A 3PUYE 1ELJA 1FQFA 1I6AA 5L8DA 4JBZA 5CMBA 3BFUA 3C32A 1FBCA 2XHDA 3E78A 4I3YA 4P0IA 3ONMA 4F22A 4LONB 5F7VA 5DYHA 4ZDMA 1Y20A 4IGRA 1BP5A 1R6ZA 4LZ5A 3QMFA 3CHGA 5DEXB 3TQLA 3TMGA 1B3EA 1NUZA 3SZPA 4NWDA 2E1SA 3R7XA 2Q89A 2HQ0A 3CR9A 1FTJA 1MY4A 2XXIA 4NHBA 3V8XB 2YJPA 4YKKA 1MY2A 3DP6A 5FTHA 1VSOA 3O66A 2QSXA 2ONKE 1D9VA 1FTLA 4EDPA 2XWKA 1POTA 5ICTA 3PV0E 4NX1A 2HHMA 2OJTA 3B6WA 5DW8A 4TLLB 2GHBA 1B52A 3CFLA 3LR1A 1NV3A 2I49A 1FTMA 1D9YA 1F9BA 4OZ9A 4YKJA 4O3CA 2QVVA 4ZEBA 3RN8A 3H3GA 5A5XA 2B65A 1UTBB 3K6XA 2RKMA 3T9XB 1URDA 1WODA 2PFZA 3UP9A 4POWA 4ZZAA 3MQ9A 3KC0A 4RA1A 2H5YA 1MPDA 3E79A 5JTYA 2ESNA 4GL0A 4R9GA 2D5WA 2L5VA 1KA1A 1DOTA 1A40A 1P1NA 1PB9A 3MWBA 2VPNA 4HCWA 1FBPA 1SW4A 2DQVA 4ESXA 1AIVA 4O3AA 3FXBA 1FPFA 5H8HB 1IMBA 1Z7ME 4EXKA 2V3TA 4GRKA 4OANA 1YYZA 4R73A 4JVDA 4GOTA 3L6HA 1RKMA 2DOJA 3K4UA 4IO6A 2Y7IA 4RJZA 3MPLA 2DE2A 3H6VA 2AYSA 1Y3QA 1FPJA 3EF7A 4XTCQ 3ECRA 4AQ4A 2DWHA 5ICQA 4OEUA 5AA4A 3DM0A 3WAFA 1Y4CA 1G0IA 3H6WA 4DCXA 2UVGA 1A54A 1B4HA 1PBQA 3ISPA 3FJGA 4ECFA 4P11A 2XWOA 1BK4A 1MDP1 1SBPA 1DPPA 4N17A 4LP2B 2Y84A 4TLMB 1H43A 4U4XA 3LUYA 5EHSA 2I0CA 4EF1A 2XWIA 5I57A 4MNIA 1UTBA 3IB2A 5I58A 5HM4B 1BLFA 1FW0A 2O68A 5DTBA 3IOTA 5I2NA 2OX3A 2VGQA 3E3KA 3C34A 4YB5A 3BIGA 3RYDA 4F2QA 3IL1B 4PBQA 2XA5A 2V84A 2G93A 3MZ9A 3GZGA 3UIFA 4OVSA 2ZNSA 5ET6A 2P2AA 3ZKLA 1KA0A 3LV0A 1CNQA 4OETA 2R8TA 3SETA 2F7BA 4GWWA 2DWJA 1MRPA 4OVTA 4RXLA 3VVEA 2ZZXA 1DTZA 5EHMA 3Q28A 3THIA 1ZIUA 3OXNA 3RNNA 1RYOA 1MS7A 2DE4A 5HPQA 4AB6A 2X26A 5AA2D 4GLIA 2DDKA 2Q8MA 3KBZA 1SYIA 4UA8A 1B32A 3LSLA 1QW0A 3ZKKA 2I0BA 3G3FA 4M4GA 4P3LA 4PF6A 1QVSA 4FORA 1ATGA 5ELVA 1K9ZA 1EYKA 3U92A 1B3HA 3MZ1A 3R6UA 4RPNA 4O8MA 1GTKA 1UIVA 4P1EA 2ZNTA 4JSDA 4X9TA 1B0HA 3QK6A 4MCOA 2NUVA 4NQ8A 1IIWA 5LTCA 5CBSA 1O7TA 2W7YA 4GFRA 4ZZEA 1N76A 4E0WA 4ELRA 2BJJX 2RCAA 1LFIA 4R6YA 3O6GA 1VR5A 4ONYA 1SW1A 4G8NA 4Q8RA 5ITPA 1M5FA 5LDZA 5KCJB 2XXHA 4R9FA 2O1MA 3FVOA 1FBEA 1M5DA 4R72A 4OXVA 1HSLA 2PYYA 4DZ1A 4N6DA 1B3FA 1LBZA 1OMPA 2F35A 1MDQA 3OMBA 4H5GA 4U22A 4THIA 5FHMA 3SESA 4GWXA 4KYDA 2VD3A 2FIXA 5KDTB 3OO9A 4RK9A 1MQJA 2O84X 1B5IA 2HZKA 1NV0A 2I4BA 4GWZA 2F5XA 4P8BA 1GGGA 1ZBMA 1FPGA 1M5CA 5CC2A 1POY1 2F36A 1US5A 2P3VA 3C36A 1NV1A 3TYHA 2DE3A 3TCFA 1J1NA 3FD3A 4NF5A 4G77A 4U1OA 4X04A 3PTYA 2I4CA 4F2OA 3BIHA 1B9JA 3T0JA 1SVXB 1QKBA 2FNCA 5I56A 1MQIA 3V83A 1TFAA 3MPKA 1IXIA 1FPBA 1B1XA 2OWSA 4M1VA 3HV1A 1PBPA 4KXPA 3MC2A 4UACA 2XXYA 5IZZA 2QPQA 3VXCA 4RNSA 1EYIA 4I9DA 5K2YA 4GWYA 5ESYA 3S9LC 2ZYKA 1N0TA 2PT2A 1IMCA 3GXAA 1NKXA 4X1DA 4RYAA 4O7MA 4ZEFA 3FJ7A 3SKPA 4MEVA 1L5TA 2V3QA 3T1BA 3D4CA 4IY5A 1NH7A 2F7CA 4BDMA 5KCJA 2F8DA 1SI0A 3K6VA 3PPQA 2UVHA 4QRZA 4HE1A 4NF6B 4DIGA 4PFIA 3VV5A 1HSEA 4PCDA 3FZVA 4KFQA 4NE4A 1P1UA 1RDZA 3FV2A 5KDTA 3U72A 4OHNA 2Y5LA 2O7IA 3QXMA 2OLBA 3M3LA 1YZ0A 1NNFA 4EXLA 2RC7A 2D21A 3IB0A 3PD9A 4PFUA 3FVNA 1YCJA 1LAFE 1KZ8A 4QFOA 4EQ9A 2I48A 4P56A 4XEQA 3S9MC 4DXBA 3TPAA 5FHOA 2ZZVA 5IM2A 3EHUA 2D3IA 1LGBC 4MBPA 4XFEA 4NF8B 1IQ7A 3CFXA 1I69A 2XD2A 4QFLA 2OK2A 1RYXA 4KCCA 4X8RA 2DWIA 5BUUA 1TWYA 3VFJA 3CSBA 2XD3A 3CSGA 4F39A 2R9JA 1D3KA 1QUIA 3PUZE 1LB8A 4IO4A 3FBPA 1FTAA 4QFPA 1MM6A 2WYKA 1FSAA 2V25A 3RPWA 1Q9DA 2PT1A 2QL3A 2PBWA 4JWYA 2ZXTA 2RF1A 4ZEKA 4WXJA 2AL5A 3OO6A 4KQPA 1YAEA 3O6HA 1FTKA 4HW8A 4LUBA 5A5LA 1LAHE 2H4IA 1D9QA 5CRYA 3B6QA 3OEKA 3N6TA 4IB2A 4GWUA 5TPAB 3H4ZA 1B05A 4PAFA 4PFRA 2V4CA 2DVZA 3RLFE 4GX4A 3OELA 1NUXA 1H76A 3K1NA 3T66A 1FBFA 2Y7RA 4O7IA 3HSTA 4IR8A 4FJPA 3SEVA 3IFCA 3G3JA 3MYUA 3MP8A 1NUYA 2B4MA 4GWOA 4RPOA 3O2AA 4C1TA 1OLCA 4PFTA 1NL5A 4KYSA 2Q2CA 2Z8FA 1FJ6A 1IXHA 3UA8A 2OZZA 1NI9A 1A7LA 2VT5A 3KSXA 4DXUA 1HSJA 2F34A 4NGUA 3SEYA 3C9HA 4DE8A 4OVJA 2VPOA 2XXWA 1MY3A 3CI8A 2B3FA 1FPLA 1MQHA 4BDQA 4AS4A 3OO8A 1Y3PA 4U21A 4XKNA 3QYTA 3AXFA 3U1OA 2WBDA 1QJMA 4JDFA 4KR5A 1AOVA 4P47A 3IFAA 4PFYA 2GFEA 4FEBA 1ZTYA 5I7IA 1TFDA 5H8QB 1XT8A 3K0VA 5I84A 3KOTA 2Q74A 1NNTA 4LZ7A 4H67A 2R71A 3K01A 4ND9A 2NXOA 2Y7WA 3FASA 1MH3A 3CG3A 1A8EA 4HTGA 3F11A 3K1MA 3Q26A 1B5HA 2HPGA 3RQTA 2PMSA 1EZ9A 4IO5A 2XXUA 5DEXA 2ZNUA 1ZJLA 1DBZA 1N7WA 4F29A 2THIA 1OLAA 3PMVA 4GWSA 4GL8A 1SQYA 4YKPA 5AA2B 1EU8A 3KC1A 2O1LA 3K6UA 3ROJA 3IOWA 2V3UA 2VOZA 3G3HA 1B6HA 1P99A 4G68C 4GX6A 2QFLA 1MY1A 1A8FA 5EQ9A 4BDOA 3H03A 1OQHA 5F24A 1FQAA 1UTHB 1B46A 3T22A 4HE2A 1FQDA 4G2ZA 2RINA 3T9VA 4F3PA 3VLWA 1NV5A 1P1QA 2WX9A 1DMBA 3E13X 4L17A 4P0GA 2XXXA 3MJNA 4U4SA 3FXQA 4POXA 4XIGQ 4H65A 3ILUB 2F3DA 1PC3A 2F6GA 1P1OA 5H8QA 2H98A 2IA4A 3V89B 1NV2A 4N6KA 3EN3A 1URGA 4H8JA
chains in the Genus database with same CATH topology
1JP4A 2FIXA 2CEYA 4UABA 5I3SA 2XXKA 2HZKA 1NV0A 4OA4A 4MNPA 4GWZA 2F5XA 4P8BA 1FPGA 4LN5A 4AS5A 2P3VA 2FHYA 4JVCA 5IZ3B 4F18A 1NV1A 2DE3A 4PGNA 1FBDA 4NG7A 3EKIA 3RPLA 4X04A 3PTYA 4YZZA 3BIHA 4P1LA 5T3JA 3T0JA 2XWVA 1FJ9A 4H46A 2FBPA 3W9VA 1G0HA 1FPBA 4MHFA 4M1VA 4KXPA 4F19A 4OVQA 5IZZA 4PC9A 1FPDA 2QPQA 2BJIA 1FPKA 4HE0A 1EYIA 4GWYA 5ESYA 1IMCA 1QGXA 4O7MA 1FBCA 4PETA 3E78A 4I3YA 1FRPA 4HCYA 4MEVA 2V3QA 1INPA 3U65A 3T1BA 2B4LA 4QXDA 3QMFA 1IMFA 3MSTA 3CHGA 4I40A 1NUZA 3SZPA 4HE1A 3B8BA 4PFIA 4NHBA 4PCDA 4PDHA 1XI6A 3LUZA 4N8YA 4PDDA 1RDZA 4MAGA 4N81A 2XWKA 2Y5LA 1YZ0A 4NX1A 2HHMA 3NOHA 5DW8A 4MMPA 1EYJA 2JJKA 1NV3A 1LBWA 5IZ3A 1KZ8A 2KR0A 4P56A 4XEQA 4MIJA 4GX3A 2ZZVA 2GQ1A 4QBAA 5IM2A 5ET8A 2QVVA 4XFEA 3GYYA 5CM6A 1NV7A 2PFZA 4MJOA 5IGAA 4I3EA 4X8RA 3KC0A 4PBHA 2FIEA 1AWBA 3E79A 2CZKA 4MX6A 2L5VA 1FTAA 3FBPA 1KA1A 2WYKA 1FSAA 1Q9DA 2ZZWA 4O94A 4HCWA 2VPNA 1FBPA 3FXBA 4HXVA 4PTKA 1FPFA 5J16A 2MKZA 1IMBA 4OANA 1YYZA 4JVDA 5A5LA 5FBPA 1D9QA 2CZIA 4GWUA 5JK4A 5EQ7A 4PAFA 4PFRA 2V4CA 2DVZA 4PFBA 5EQ8A 5ET5A 4GX4A 2DE2A 3W9WA 5J1DA 1FPJA 1NUXA 1NV6A 1FBFA 4O7IA 1G0IA 4IR8A 3IFCA 3MYUA 4MNCA 1NUYA 3ISPA 1LBYA 2B4MA 5EYHA 1YXIA 1FJ6A 2XWOA 1LBVA 1BK4A 4F1VA 1FBHA 1IMEA 1NI9A 4N17A 2VT5A 4XF5A 4NGUA 2PFYA 2XWIA 4MNIA 2VPOA 2CZHA 1FPLA 3A29A 2WEFA 1LEVA 4AS4A 4G61A 2WBDA 2P3NA 2OX3A 4P47A 4N8GA 3IFAA 4OVRA 3BIGA 1IMAA 1RDYA 2QVUA 4H45A 3RYDA 5I7IA 4PBQA 2XA5A 4DI3D 4F1UA 2Q74A 4OVSA 1K9YA 5ET6A 1KA0A 3LV0A 1CNQA 2R8TA 2HXRA 5ET7A 1VDWA 4PAKA 4GWWA 1DK4A 4OVTA 4OVPA 3D1RA 2ZZXA 4NN3A 3HFUA 4JVIA 4N4UA 2OWZA 2HPGA 2DE4A 1NUWA 1NV4A 2DDKA 2Q8MA 3KBZA 3RPLB 1DBZA 2WYPA 4P3LA 2F3BA 4PGPA 4GWSA 4PF6A 3KC1A 4P9KA 4NAPA 1K9ZA 1EYKA 3ROJA 2HZLA 2Y5KA 4O8MA 4NF0A 4GX6A 2QFLA 2CEXA 1FBGA 4P1EA 5EQ9A 4X9TA 1LBXA 4MCOA 2WBBA 4NQ8A 1FPIA 2KQZA 5F24A 5LTCA 5I5PA 1RDXA 4N15A 5EYGA 1IMDA 4PAIA 4HE2A 4PF8A 1DCUA 5IZ1A 2FVZA 4FBPA 2Q9TA 4GBWA 2PCRA 1FPEA 5LDZA 1NV5A 2WX9A 1FBEA 4PE3A 2QVRA 4YICA 3B50A 2F3DA 4N6DA 1LBZA 1SPIA 4N91A 5EQAA 4DI4B 1NV2A 4GWXA 4N6KA 4GBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NN3 A;  2CEY A;  4UAB A;  4PAF A;  2XXK A;  4N4U A;  2V4C A;  4PFR A;  4N8Y A;  4PDD A;  4PFB A;  2HZK A;  4OA4 A;  4MNP A;  2HPG A;  4MAG A;  4P8B A;  2XWK A;  4NX1 A;  4LN5 A;  4MMP A;  4PGN A;  2WYP A;  4MNC A;  4NG7 A;  4P3L A;  4X04 A;  4P56 A;  4PGP A;  4XEQ A;  4PF6 A;  4YZZ A;  4P1L A;  4MIJ A;  4P9K A;  4NAP A;  2XWV A;  2ZZV A;  2XWO A;  5IM2 A;  4N6K A;  2HZL A;  4MHF A;  4XFE A;  4N17 A;  3GYY A;  4O8M A;  5CM6 A;  4NF0 A;  4XF5 A;  2CEX A;  4P1E A;  4NGU A;  2PFZ A;  4OVQ A;  5IZZ A;  4PC9 A;  4MCO A;  2PFY A;  5IGA A;  2XWI A;  4NQ8 A;  4MNI A;  2VPO A;  4X8R A;  4PBH A;  5LTC A;  5I5P A;  4N15 A;  4OVP A;  4PAI A;  4PF8 A;  4O7M A;  4MX6 A;  4PET A;  4P47 A;  2WYK A;  4N8G A;  4OVR A;  4MEV A;  2WX9 A;  2ZZW A;  4O94 A;  3U65 A;  5I7I A;  2VPN A;  4PBQ A;  2XA5 A;  4DI3 D;  4PE3 A;  4YIC A;  3B50 A;  3FXB A;  4OVS A;  4N6D A;  4N91 A;  4OAN A;  4DI4 B;  4PAK A;  4PDH A;  4PFI A;  4OVT A;  4NHB A;  4PCD A;  2ZZX A; 
#chains in the Genus database with same CATH topology
 4XKP A;  3I6V A;  4UAB A;  1N3W A;  2ZYM A;  2HAU A;  2NVU B;  2R6G E;  3O6I A;  4ELP A;  5B70 A;  2CMO A;  4LN5 A;  4AS5 A;  1B51 A;  4JVC A;  5H8H A;  1A99 A;  5IZ3 B;  2HCA A;  1D4N A;  1SD3 A;  4PGN A;  4H5F A;  2B3B A;  4NWC A;  3PPO A;  4KCD A;  5L9O A;  2ONR A;  4MLV A;  1XC1 A;  1LAX A;  4NED A;  5TU0 A;  3PPP A;  4GD5 A;  4FED A;  1N04 A;  4H46 A;  3SEW A;  3D4G A;  1JNF A;  4PQJ A;  3FUZ A;  5AA2 A;  4MHF A;  5HBC A;  3H7M A;  3CRB A;  5DVJ A;  3K02 A;  3SEX A;  3BBR A;  4KD5 A;  3QSL A;  1YPN A;  4PC9 A;  1FPD A;  4EQB A;  4NF4 B;  4HE0 A;  1PB8 A;  3R26 A;  3TTM A;  2RC9 A;  1MXW A;  2VHA A;  5I59 B;  3MW0 A;  1OVT A;  1UQW A;  3CFZ A;  1IUD A;  1QGX A;  2NOO A;  4TQU Q;  3TTN A;  1JEU A;  1BTJ A;  2HAV A;  2ZMB A;  1B2H A;  3O29 A;  2Z8E A;  4HCY A;  3DP4 A;  4I8C A;  4Q30 B;  3U65 A;  3UOR A;  3P7I A;  3TQW A;  4QXD A;  4Z0I A;  4ZED A;  3JV9 A;  2XX8 A;  1IMF A;  3MST A;  3A09 A;  2Z8D A;  2A5T B;  1ZU0 A;  3OD7 A;  1QUK A;  3A3C A;  3S9E A;  3OEM A;  5I2K B;  5B7D A;  1I6Q A;  4PDH A;  3B6T A;  1XI6 A;  1JW1 A;  3LSF B;  3GLB A;  2M8C A;  3N6U A;  3TDJ A;  4QF9 A;  3TZA A;  4R2B A;  3WAE A;  4X1B A;  4C0R A;  2DS9 A;  3NOH A;  1SI1 A;  4FE8 A;  2HEU A;  3DLN A;  1QUL A;  4RY1 A;  1LBW A;  5IZ3 A;  2KR0 A;  1US4 A;  4XXU A;  4G4P A;  2P1S A;  2GQ1 A;  2WKY A;  5CBR A;  3MVY A;  3TTR A;  4RK2 A;  3GYY A;  3G7W A;  1NV7 A;  1TT1 A;  3EHS A;  5CMM A;  4DCY A;  4FAJ A;  5CM6 A;  1B3L A;  1OVB A;  4IO7 A;  5IGA A;  5ISU A;  4I3E A;  3ILT B;  1EZP A;  4R74 A;  1B5J A;  1ZLQ A;  4OEV A;  4NF4 A;  2PX1 A;  1IXG A;  3KN3 A;  4WED A;  4NMY A;  4FAT A;  1MM7 A;  5FTI A;  4MX6 A;  1PB7 A;  1XVY A;  3QIM A;  3LC8 A;  4F3B A;  3V5A A;  1VE4 A;  4O94 A;  2Z22 A;  2QS2 A;  2F6P A;  2PVU A;  4ESW A;  1NFT A;  2MKZ A;  5FBP A;  1MQD A;  3T93 B;  4H8I A;  3TAJ A;  2XXP A;  2CZI A;  1B0L A;  3VE1 B;  5EQ7 A;  3BFT A;  5AE4 A;  2A5S A;  4N07 A;  5I2K A;  5EQ8 A;  5ET5 A;  4ZE9 A;  2O6A A;  3W9W A;  2CZL A;  3M8U A;  4OFO A;  2QS1 A;  1B40 A;  1NV6 A;  4TOZ A;  3O9P A;  3O97 A;  5F1Q A;  1Y9U A;  1TXF A;  4R6H A;  1IXC A;  2GHA A;  3EQ1 A;  2I3V A;  3PUX E;  4MNC A;  3VLV A;  3O28 A;  1LBY A;  5JEI A;  2GH9 A;  3KJT A;  4GXA A;  1N84 A;  5EYH A;  3CVG A;  3HO7 A;  1LBV A;  3IO4 A;  4BDN A;  2DXY A;  1B7Z A;  3MBP A;  4F1V A;  1SDX A;  3H6T A;  3PD8 A;  3U93 A;  3Q29 A;  3LBS A;  4IGT A;  1MXU A;  3UGW A;  3TCG A;  3BKI B;  3QUF A;  4ISU A;  5M2V A;  3E9X A;  3A29 A;  2VP1 A;  3I3V A;  1LEV A;  2P3N A;  3RTW B;  4LQ2 A;  3MAM A;  4R75 A;  1IMA A;  1RDY A;  3N5L A;  4DXC A;  1S50 A;  3KSJ A;  1QKA A;  2REJ A;  5ITO A;  1MXV A;  4I62 A;  4DI3 D;  3S4U A;  3VXB A;  4F3G A;  1B1H A;  3IOV A;  5DT6 A;  1DTG A;  5IAI A;  1B7U A;  4F3S A;  4EQ7 A;  3A3U A;  1S7Y A;  3HFU A;  4JVI A;  2X7P A;  4EF2 A;  2OWZ A;  1DPE A;  3UN6 A;  3DEL B;  3TEL A;  3SER A;  3T9H B;  5CMC A;  4U23 A;  2ALU A;  1O64 A;  4ZEI A;  4NF6 A;  4KHZ E;  2F3B A;  1JVY A;  4P9K A;  4NAP A;  5AA3 A;  3TFL A;  4FIM A;  4YB7 A;  2DXR A;  2OWT A;  4AB5 A;  1ANF A;  3PUV E;  2Y5K A;  1EH3 A;  1GVC A;  4ELO A;  3ZS6 A;  2CEX A;  2RC8 A;  2I58 A;  1B58 A;  2WBB A;  2FA7 A;  3TKD A;  1FPI A;  2KQZ A;  4BDR A;  1Y3N A;  4MF3 A;  4OTE A;  5I5P A;  5EYG A;  1VFD A;  2ABH A;  3HCQ A;  4ZS9 A;  4GXS B;  3FXU A;  5IZ1 A;  2F97 A;  1M5B A;  2F7A A;  1O63 A;  2FVZ A;  4FBP A;  2Q9T A;  4GBW A;  1FPE A;  3PPR A;  2XXQ A;  4G8H A;  3C4M A;  2XXT A;  4YMB A;  3FIR A;  3USD A;  3OO7 A;  4NF8 A;  5AA4 B;  4PE3 A;  2Y7K A;  4YIC A;  2XXR A;  2ZYN A;  1OQG A;  4IY6 A;  3FAT A;  1OIB A;  4QSC A;  5EQA A;  1XS5 A;  5FHN A;  4DI4 B;  4EUO A;  1A55 A;  1ZMG A;  3MP1 A;  4PFW A;  4JSO A;  4Q5T A;  2AIX A;  2CEY A;  4OEN A;  2XXK A;  3UK4 A;  2UXA A;  3K00 A;  1USY H;  3U94 A;  4OA4 A;  3MUQ A;  2Q2A A;  1NMU A;  3KFM A;  1LAG E;  4U2R A;  4E0X A;  3RT6 B;  5L9M A;  5I57 B;  5LOM A;  4JXI A;  4O3B A;  5I58 B;  2DSF A;  1FBD A;  4NG7 A;  3DP8 A;  1WVJ A;  4LA9 A;  5I2N B;  4MH5 A;  1SYH A;  1UIU A;  3K2D A;  4H6D A;  2IEE A;  3PGF A;  5TPA A;  2XWV A;  5H8S A;  1FJ9 A;  2QRY A;  1MXZ A;  2FBP A;  4GVO A;  2DWA A;  2P0S A;  1G0H A;  3TUS A;  3VLU A;  1NH8 A;  5IKB A;  4F19 A;  3FVK A;  4OVQ A;  1LFH A;  2BJI A;  2ANJ A;  3CG1 A;  2QS4 A;  3KN8 A;  1JQF A;  1R9L A;  3KJ7 A;  1P1W A;  4PET A;  1FRP A;  3G3K A;  2REG A;  3IK6 B;  1INP A;  1N7X A;  1XHY A;  1PDA A;  2B4L A;  3C33 A;  2DVC A;  3IB1 A;  3HN0 A;  1PEB A;  4YMA A;  1JEV A;  3B7D A;  5H8F B;  4OYV A;  4I40 A;  3K1P A;  4X48 A;  3ZSF A;  1I6B A;  4YB6 A;  3B8B A;  3HHG A;  2UVJ A;  5H8N B;  4MFI A;  3MP6 A;  2HFB A;  3OEN A;  3M3K A;  3LUZ A;  4N8Y A;  4PDD A;  3VVF A;  3PMX A;  4R6K A;  4MAG A;  4N6P A;  1MG1 A;  2Q88 A;  3QUJ A;  4KI0 E;  4N81 A;  3MZB A;  1FQC A;  5L9S A;  4BLA A;  2UYE A;  3C31 A;  4MMP A;  4I1D A;  2Z23 A;  1EYJ A;  2JJK A;  3KZG A;  3KEI A;  5AA1 A;  3IJO B;  4HS7 A;  4MIJ A;  3N26 A;  2YLN A;  4GX3 A;  3I5O A;  4C1U A;  3OSQ A;  4QBA A;  3SDF A;  3T9U A;  2XXV A;  5ET8 A;  4GF8 A;  4QHQ A;  3K6W A;  4G68 B;  1Q1K A;  5DVF A;  3RGY A;  4GIZ A;  1IEJ A;  4MJO A;  1URS A;  4K3F A;  1BKA A;  2I6E A;  4LAT A;  4Z7E A;  4PBH A;  2FIE A;  1AWB A;  1B4Z A;  3TEP A;  4G8M A;  4JWX A;  1AH5 A;  3EPE A;  5DVI A;  3N94 A;  1FQE A;  4U1Z A;  3IAZ A;  4QFK A;  1H44 A;  2CZK A;  1Y1Z A;  1SW5 A;  5EYF A;  2O51 A;  2FYI A;  2ZZW A;  1II5 A;  3IO6 A;  2KLF A;  3TTL A;  1LLS A;  2ZYO A;  1MQG A;  4HXV A;  4PTK A;  3FVG A;  5J16 A;  5K2X A;  3IJX B;  2OBG A;  4DLD A;  4H1X A;  3JZJ A;  3TCH A;  4NF5 B;  5H8F A;  1UTH A;  2V93 A;  4PP0 A;  4KPT A;  2O69 A;  3MVX A;  5JK4 A;  5I56 B;  4OWD A;  2F78 A;  5TP9 B;  1WDN A;  2Y7P A;  4PFB A;  3OSR A;  5H8N A;  1N3X A;  3TOD A;  5J1D A;  3FJM A;  3IOR A;  1EZO A;  3HHF A;  2RCB A;  3LSW A;  4IO3 A;  4QSE A;  2QMX A;  1FQB A;  2LAO A;  3RUM A;  1XVX A;  4IO2 A;  2QS3 A;  2NWJ A;  2XX9 A;  1NNK A;  3IOU A;  4OFJ A;  1USY E;  4DDD A;  1MPC A;  2YPN A;  3Q25 A;  4XKQ A;  2GRV A;  1LBC A;  1YXI A;  3PPN A;  1FCK A;  1H3D A;  2E0S A;  1FBH A;  1IME A;  3RT8 A;  4WEP A;  4XF5 A;  1CE2 A;  3W15 C;  4OFL A;  4OQO A;  4G68 A;  1GR2 A;  3OOA A;  2PFY A;  4MLQ A;  5CMK A;  1AL3 A;  1SW2 A;  2CZH A;  2WEF A;  4OER A;  1T0K A;  4G61 A;  2HXW A;  3S2V A;  1LCF A;  4N8G A;  4OVR A;  3LSX A;  2QVU A;  4H45 A;  3VVD A;  3U8Q A;  3ODB A;  2UVI A;  1JET A;  4F1U A;  4ZEC A;  1K9Y A;  4F1Y A;  1ZKB A;  3KGC A;  3MVZ A;  1FTO A;  1JW5 A;  3GBB A;  2UYF A;  2HXR A;  5ET7 A;  1VDW A;  2H25 A;  4PAK A;  5CI5 A;  3IR1 A;  1DSN A;  1B3G A;  1DK4 A;  5I59 A;  3D1R A;  4OVP A;  4JWO A;  4NN3 A;  3SEU A;  3RTF B;  3QAX A;  4YU0 A;  2OCU A;  2G29 A;  4FEC A;  4N4U A;  1LFG A;  3KG2 A;  1H45 A;  4YKI A;  5BWJ A;  3PMW A;  1R9Q A;  5TP9 A;  1MH4 A;  3RY3 A;  1NUW A;  4R2F A;  1R1N A;  2H9B A;  4QSD A;  3EHT A;  1NV4 A;  2Q8J A;  3FGS A;  3RPL B;  1JW4 A;  2O7U A;  2WYP A;  2A5T A;  3JYR A;  4NTL A;  3H6U A;  3HPI A;  4PGP A;  1MY0 A;  1CB6 A;  4F31 B;  1XOC A;  2HZL A;  1S9T A;  2VD2 A;  3FV1 A;  3FXR A;  1MXX A;  2I3W A;  1GV8 A;  4NF0 A;  1YTV A;  2AL4 A;  1FBG A;  1Y1M A;  3Q27 A;  1LBX A;  3T96 B;  2QMW A;  3S9N C;  1RDX A;  3VDF A;  4ELQ A;  4N15 A;  3PUW E;  1IMD A;  4PAI A;  2QJE A;  4PF8 A;  1DCU A;  1LBB A;  4ZE8 A;  2DP8 A;  2PCR A;  4OES A;  1LCT A;  3KN7 A;  3G3I A;  4BDL A;  4WKM A;  2QVR A;  3B50 A;  3MVW A;  4N13 A;  1SPI A;  4N91 A;  3KOS A;  3PU5 A;  2X7Q A;  2DYX A;  1NNP A;  4GBV A;  1JP4 A;  1BIY A;  1AMF A;  3GBA A;  1B7H A;  4JB7 A;  5I3S A;  1Y4T A;  3L6G A;  4XKR A;  1MPB A;  4MNP A;  1IIT A;  3H06 B;  1Z7N E;  4PE5 B;  1MXY A;  3KBR A;  1LB9 A;  3TTK A;  2FHY A;  1Q35 A;  4F18 A;  2H99 A;  4KYE A;  3CIJ A;  1LST A;  1VFE A;  3C35 A;  3EKI A;  3RPL A;  4GQO A;  2XX7 A;  4YAH X;  4YZZ A;  4H0W A;  4P1L A;  2ONS A;  5T3J A;  5A5X B;  4LZ8 A;  3W9V A;  3G3G A;  3IX1 A;  3M3F A;  4Q0C A;  4LQ5 A;  4OMB A;  3E4R A;  4LVQ A;  4QFN A;  1KWH A;  1FPK A;  5JTY B;  1QUJ A;  1JVX A;  5KZT A;  1M5E A;  1IZ1 A;  3PUY E;  1ELJ A;  1FQF A;  1I6A A;  5L8D A;  4JBZ A;  5CMB A;  3BFU A;  3C32 A;  1FBC A;  2XHD A;  3E78 A;  4I3Y A;  4P0I A;  3ONM A;  4F22 A;  4LON B;  5F7V A;  5DYH A;  4ZDM A;  1Y20 A;  4IGR A;  1BP5 A;  1R6Z A;  4LZ5 A;  3QMF A;  3CHG A;  5DEX B;  3TQL A;  3TMG A;  1B3E A;  1NUZ A;  3SZP A;  4NWD A;  2E1S A;  3R7X A;  2Q89 A;  2HQ0 A;  3CR9 A;  1FTJ A;  1MY4 A;  2XXI A;  4NHB A;  3V8X B;  2YJP A;  4YKK A;  1MY2 A;  3DP6 A;  5FTH A;  1VSO A;  3O66 A;  2QSX A;  2ONK E;  1D9V A;  1FTL A;  4EDP A;  2XWK A;  1POT A;  5ICT A;  3PV0 E;  4NX1 A;  2HHM A;  2OJT A;  3B6W A;  5DW8 A;  4TLL B;  2GHB A;  1B52 A;  3CFL A;  3LR1 A;  1NV3 A;  2I49 A;  1FTM A;  1D9Y A;  1F9B A;  4OZ9 A;  4YKJ A;  4O3C A;  2QVV A;  4ZEB A;  3RN8 A;  3H3G A;  5A5X A;  2B65 A;  1UTB B;  3K6X A;  2RKM A;  3T9X B;  1URD A;  1WOD A;  2PFZ A;  3UP9 A;  4POW A;  4ZZA A;  3MQ9 A;  3KC0 A;  4RA1 A;  2H5Y A;  1MPD A;  3E79 A;  5JTY A;  2ESN A;  4GL0 A;  4R9G A;  2D5W A;  2L5V A;  1KA1 A;  1DOT A;  1A40 A;  1P1N A;  1PB9 A;  3MWB A;  2VPN A;  4HCW A;  1FBP A;  1SW4 A;  2DQV A;  4ESX A;  1AIV A;  4O3A A;  3FXB A;  1FPF A;  5H8H B;  1IMB A;  1Z7M E;  4EXK A;  2V3T A;  4GRK A;  4OAN A;  1YYZ A;  4R73 A;  4JVD A;  4GOT A;  3L6H A;  1RKM A;  2DOJ A;  3K4U A;  4IO6 A;  2Y7I A;  4RJZ A;  3MPL A;  2DE2 A;  3H6V A;  2AYS A;  1Y3Q A;  1FPJ A;  3EF7 A;  4XTC Q;  3ECR A;  4AQ4 A;  2DWH A;  5ICQ A;  4OEU A;  5AA4 A;  3DM0 A;  3WAF A;  1Y4C A;  1G0I A;  3H6W A;  4DCX A;  2UVG A;  1A54 A;  1B4H A;  1PBQ A;  3ISP A;  3FJG A;  4ECF A;  4P11 A;  2XWO A;  1BK4 A;  1MDP 1;  1SBP A;  1DPP A;  4N17 A;  4LP2 B;  2Y84 A;  4TLM B;  1H43 A;  4U4X A;  3LUY A;  5EHS A;  2I0C A;  4EF1 A;  2XWI A;  5I57 A;  4MNI A;  1UTB A;  3IB2 A;  5I58 A;  5HM4 B;  1BLF A;  1FW0 A;  2O68 A;  5DTB A;  3IOT A;  5I2N A;  2OX3 A;  2VGQ A;  3E3K A;  3C34 A;  4YB5 A;  3BIG A;  3RYD A;  4F2Q A;  3IL1 B;  4PBQ A;  2XA5 A;  2V84 A;  2G93 A;  3MZ9 A;  3GZG A;  3UIF A;  4OVS A;  2ZNS A;  5ET6 A;  2P2A A;  3ZKL A;  1KA0 A;  3LV0 A;  1CNQ A;  4OET A;  2R8T A;  3SET A;  2F7B A;  4GWW A;  2DWJ A;  1MRP A;  4OVT A;  4RXL A;  3VVE A;  2ZZX A;  1DTZ A;  5EHM A;  3Q28 A;  3THI A;  1ZIU A;  3OXN A;  3RNN A;  1RYO A;  1MS7 A;  2DE4 A;  5HPQ A;  4AB6 A;  2X26 A;  5AA2 D;  4GLI A;  2DDK A;  2Q8M A;  3KBZ A;  1SYI A;  4UA8 A;  1B32 A;  3LSL A;  1QW0 A;  3ZKK A;  2I0B A;  3G3F A;  4M4G A;  4P3L A;  4PF6 A;  1QVS A;  4FOR A;  1ATG A;  5ELV A;  1K9Z A;  1EYK A;  3U92 A;  1B3H A;  3MZ1 A;  3R6U A;  4RPN A;  4O8M A;  1GTK A;  1UIV A;  4P1E A;  2ZNT A;  4JSD A;  4X9T A;  1B0H A;  3QK6 A;  4MCO A;  2NUV A;  4NQ8 A;  1IIW A;  5LTC A;  5CBS A;  1O7T A;  2W7Y A;  4GFR A;  4ZZE A;  1N76 A;  4E0W A;  4ELR A;  2BJJ X;  2RCA A;  1LFI A;  4R6Y A;  3O6G A;  1VR5 A;  4ONY A;  1SW1 A;  4G8N A;  4Q8R A;  5ITP A;  1M5F A;  5LDZ A;  5KCJ B;  2XXH A;  4R9F A;  2O1M A;  3FVO A;  1FBE A;  1M5D A;  4R72 A;  4OXV A;  1HSL A;  2PYY A;  4DZ1 A;  4N6D A;  1B3F A;  1LBZ A;  1OMP A;  2F35 A;  1MDQ A;  3OMB A;  4H5G A;  4U22 A;  4THI A;  5FHM A;  3SES A;  4GWX A;  4KYD A;  2VD3 A;  2FIX A;  5KDT B;  3OO9 A;  4RK9 A;  1MQJ A;  2O84 X;  1B5I A;  2HZK A;  1NV0 A;  2I4B A;  4GWZ A;  2F5X A;  4P8B A;  1GGG A;  1ZBM A;  1FPG A;  1M5C A;  5CC2 A;  1POY 1;  2F36 A;  1US5 A;  2P3V A;  3C36 A;  1NV1 A;  3TYH A;  2DE3 A;  3TCF A;  1J1N A;  3FD3 A;  4NF5 A;  4G77 A;  4U1O A;  4X04 A;  3PTY A;  2I4C A;  4F2O A;  3BIH A;  1B9J A;  3T0J A;  1SVX B;  1QKB A;  2FNC A;  5I56 A;  1MQI A;  3V83 A;  1TFA A;  3MPK A;  1IXI A;  1FPB A;  1B1X A;  2OWS A;  4M1V A;  3HV1 A;  1PBP A;  4KXP A;  3MC2 A;  4UAC A;  2XXY A;  5IZZ A;  2QPQ A;  3VXC A;  4RNS A;  1EYI A;  4I9D A;  5K2Y A;  4GWY A;  5ESY A;  3S9L C;  2ZYK A;  1N0T A;  2PT2 A;  1IMC A;  3GXA A;  1NKX A;  4X1D A;  4RYA A;  4O7M A;  4ZEF A;  3FJ7 A;  3SKP A;  4MEV A;  1L5T A;  2V3Q A;  3T1B A;  3D4C A;  4IY5 A;  1NH7 A;  2F7C A;  4BDM A;  5KCJ A;  2F8D A;  1SI0 A;  3K6V A;  3PPQ A;  2UVH A;  4QRZ A;  4HE1 A;  4NF6 B;  4DIG A;  4PFI A;  3VV5 A;  1HSE A;  4PCD A;  3FZV A;  4KFQ A;  4NE4 A;  1P1U A;  1RDZ A;  3FV2 A;  5KDT A;  3U72 A;  4OHN A;  2Y5L A;  2O7I A;  3QXM A;  2OLB A;  3M3L A;  1YZ0 A;  1NNF A;  4EXL A;  2RC7 A;  2D21 A;  3IB0 A;  3PD9 A;  4PFU A;  3FVN A;  1YCJ A;  1LAF E;  1KZ8 A;  4QFO A;  4EQ9 A;  2I48 A;  4P56 A;  4XEQ A;  3S9M C;  4DXB A;  3TPA A;  5FHO A;  2ZZV A;  5IM2 A;  3EHU A;  2D3I A;  1LGB C;  4MBP A;  4XFE A;  4NF8 B;  1IQ7 A;  3CFX A;  1I69 A;  2XD2 A;  4QFL A;  2OK2 A;  1RYX A;  4KCC A;  4X8R A;  2DWI A;  5BUU A;  1TWY A;  3VFJ A;  3CSB A;  2XD3 A;  3CSG A;  4F39 A;  2R9J A;  1D3K A;  1QUI A;  3PUZ E;  1LB8 A;  4IO4 A;  3FBP A;  1FTA A;  4QFP A;  1MM6 A;  2WYK A;  1FSA A;  2V25 A;  3RPW A;  1Q9D A;  2PT1 A;  2QL3 A;  2PBW A;  4JWY A;  2ZXT A;  2RF1 A;  4ZEK A;  4WXJ A;  2AL5 A;  3OO6 A;  4KQP A;  1YAE A;  3O6H A;  1FTK A;  4HW8 A;  4LUB A;  5A5L A;  1LAH E;  2H4I A;  1D9Q A;  5CRY A;  3B6Q A;  3OEK A;  3N6T A;  4IB2 A;  4GWU A;  5TPA B;  3H4Z A;  1B05 A;  4PAF A;  4PFR A;  2V4C A;  2DVZ A;  3RLF E;  4GX4 A;  3OEL A;  1NUX A;  1H76 A;  3K1N A;  3T66 A;  1FBF A;  2Y7R A;  4O7I A;  3HST A;  4IR8 A;  4FJP A;  3SEV A;  3IFC A;  3G3J A;  3MYU A;  3MP8 A;  1NUY A;  2B4M A;  4GWO A;  4RPO A;  3O2A A;  4C1T A;  1OLC A;  4PFT A;  1NL5 A;  4KYS A;  2Q2C A;  2Z8F A;  1FJ6 A;  1IXH A;  3UA8 A;  2OZZ A;  1NI9 A;  1A7L A;  2VT5 A;  3KSX A;  4DXU A;  1HSJ A;  2F34 A;  4NGU A;  3SEY A;  3C9H A;  4DE8 A;  4OVJ A;  2VPO A;  2XXW A;  1MY3 A;  3CI8 A;  2B3F A;  1FPL A;  1MQH A;  4BDQ A;  4AS4 A;  3OO8 A;  1Y3P A;  4U21 A;  4XKN A;  3QYT A;  3AXF A;  3U1O A;  2WBD A;  1QJM A;  4JDF A;  4KR5 A;  1AOV A;  4P47 A;  3IFA A;  4PFY A;  2GFE A;  4FEB A;  1ZTY A;  5I7I A;  1TFD A;  5H8Q B;  1XT8 A;  3K0V A;  5I84 A;  3KOT A;  2Q74 A;  1NNT A;  4LZ7 A;  4H67 A;  2R71 A;  3K01 A;  4ND9 A;  2NXO A;  2Y7W A;  3FAS A;  1MH3 A;  3CG3 A;  1A8E A;  4HTG A;  3F11 A;  3K1M A;  3Q26 A;  1B5H A;  2HPG A;  3RQT A;  2PMS A;  1EZ9 A;  4IO5 A;  2XXU A;  5DEX A;  2ZNU A;  1ZJL A;  1DBZ A;  1N7W A;  4F29 A;  2THI A;  1OLA A;  3PMV A;  4GWS A;  4GL8 A;  1SQY A;  4YKP A;  5AA2 B;  1EU8 A;  3KC1 A;  2O1L A;  3K6U A;  3ROJ A;  3IOW A;  2V3U A;  2VOZ A;  3G3H A;  1B6H A;  1P99 A;  4G68 C;  4GX6 A;  2QFL A;  1MY1 A;  1A8F A;  5EQ9 A;  4BDO A;  3H03 A;  1OQH A;  5F24 A;  1FQA A;  1UTH B;  1B46 A;  3T22 A;  4HE2 A;  1FQD A;  4G2Z A;  2RIN A;  3T9V A;  4F3P A;  3VLW A;  1NV5 A;  1P1Q A;  2WX9 A;  1DMB A;  3E13 X;  4L17 A;  4P0G A;  2XXX A;  3MJN A;  4U4S A;  3FXQ A;  4POX A;  4XIG Q;  4H65 A;  3ILU B;  2F3D A;  1PC3 A;  2F6G A;  1P1O A;  5H8Q A;  2H98 A;  2IA4 A;  3V89 B;  1NV2 A;  4N6K A;  3EN3 A;  1URG A;  4H8J A; 
#chains in the Genus database with same CATH homology
 1JP4 A;  2FIX A;  2CEY A;  4UAB A;  5I3S A;  2XXK A;  2HZK A;  1NV0 A;  4OA4 A;  4MNP A;  4GWZ A;  2F5X A;  4P8B A;  1FPG A;  4LN5 A;  4AS5 A;  2P3V A;  2FHY A;  4JVC A;  5IZ3 B;  4F18 A;  1NV1 A;  2DE3 A;  4PGN A;  1FBD A;  4NG7 A;  3EKI A;  3RPL A;  4X04 A;  3PTY A;  4YZZ A;  3BIH A;  4P1L A;  5T3J A;  3T0J A;  2XWV A;  1FJ9 A;  4H46 A;  2FBP A;  3W9V A;  1G0H A;  1FPB A;  4MHF A;  4M1V A;  4KXP A;  4F19 A;  4OVQ A;  5IZZ A;  4PC9 A;  1FPD A;  2QPQ A;  2BJI A;  1FPK A;  4HE0 A;  1EYI A;  4GWY A;  5ESY A;  1IMC A;  1QGX A;  4O7M A;  1FBC A;  4PET A;  3E78 A;  4I3Y A;  1FRP A;  4HCY A;  4MEV A;  2V3Q A;  1INP A;  3U65 A;  3T1B A;  2B4L A;  4QXD A;  3QMF A;  1IMF A;  3MST A;  3CHG A;  4I40 A;  1NUZ A;  3SZP A;  4HE1 A;  3B8B A;  4PFI A;  4NHB A;  4PCD A;  4PDH A;  1XI6 A;  3LUZ A;  4N8Y A;  4PDD A;  1RDZ A;  4MAG A;  4N81 A;  2XWK A;  2Y5L A;  1YZ0 A;  4NX1 A;  2HHM A;  3NOH A;  5DW8 A;  4MMP A;  1EYJ A;  2JJK A;  1NV3 A;  1LBW A;  5IZ3 A;  1KZ8 A;  2KR0 A;  4P56 A;  4XEQ A;  4MIJ A;  4GX3 A;  2ZZV A;  2GQ1 A;  4QBA A;  5IM2 A;  5ET8 A;  2QVV A;  4XFE A;  3GYY A;  5CM6 A;  1NV7 A;  2PFZ A;  4MJO A;  5IGA A;  4I3E A;  4X8R A;  3KC0 A;  4PBH A;  2FIE A;  1AWB A;  3E79 A;  2CZK A;  4MX6 A;  2L5V A;  1FTA A;  3FBP A;  1KA1 A;  2WYK A;  1FSA A;  1Q9D A;  2ZZW A;  4O94 A;  4HCW A;  2VPN A;  1FBP A;  3FXB A;  4HXV A;  4PTK A;  1FPF A;  5J16 A;  2MKZ A;  1IMB A;  4OAN A;  1YYZ A;  4JVD A;  5A5L A;  5FBP A;  1D9Q A;  2CZI A;  4GWU A;  5JK4 A;  5EQ7 A;  4PAF A;  4PFR A;  2V4C A;  2DVZ A;  4PFB A;  5EQ8 A;  5ET5 A;  4GX4 A;  2DE2 A;  3W9W A;  5J1D A;  1FPJ A;  1NUX A;  1NV6 A;  1FBF A;  4O7I A;  1G0I A;  4IR8 A;  3IFC A;  3MYU A;  4MNC A;  1NUY A;  3ISP A;  1LBY A;  2B4M A;  5EYH A;  1YXI A;  1FJ6 A;  2XWO A;  1LBV A;  1BK4 A;  4F1V A;  1FBH A;  1IME A;  1NI9 A;  4N17 A;  2VT5 A;  4XF5 A;  4NGU A;  2PFY A;  2XWI A;  4MNI A;  2VPO A;  2CZH A;  1FPL A;  3A29 A;  2WEF A;  1LEV A;  4AS4 A;  4G61 A;  2WBD A;  2P3N A;  2OX3 A;  4P47 A;  4N8G A;  3IFA A;  4OVR A;  3BIG A;  1IMA A;  1RDY A;  2QVU A;  4H45 A;  3RYD A;  5I7I A;  4PBQ A;  2XA5 A;  4DI3 D;  4F1U A;  2Q74 A;  4OVS A;  1K9Y A;  5ET6 A;  1KA0 A;  3LV0 A;  1CNQ A;  2R8T A;  2HXR A;  5ET7 A;  1VDW A;  4PAK A;  4GWW A;  1DK4 A;  4OVT A;  4OVP A;  3D1R A;  2ZZX A;  4NN3 A;  3HFU A;  4JVI A;  4N4U A;  2OWZ A;  2HPG A;  2DE4 A;  1NUW A;  1NV4 A;  2DDK A;  2Q8M A;  3KBZ A;  3RPL B;  1DBZ A;  2WYP A;  4P3L A;  2F3B A;  4PGP A;  4GWS A;  4PF6 A;  3KC1 A;  4P9K A;  4NAP A;  1K9Z A;  1EYK A;  3ROJ A;  2HZL A;  2Y5K A;  4O8M A;  4NF0 A;  4GX6 A;  2QFL A;  2CEX A;  1FBG A;  4P1E A;  5EQ9 A;  4X9T A;  1LBX A;  4MCO A;  2WBB A;  4NQ8 A;  1FPI A;  2KQZ A;  5F24 A;  5LTC A;  5I5P A;  1RDX A;  4N15 A;  5EYG A;  1IMD A;  4PAI A;  4HE2 A;  4PF8 A;  1DCU A;  5IZ1 A;  2FVZ A;  4FBP A;  2Q9T A;  4GBW A;  2PCR A;  1FPE A;  5LDZ A;  1NV5 A;  2WX9 A;  1FBE A;  4PE3 A;  2QVR A;  4YIC A;  3B50 A;  2F3D A;  4N6D A;  1LBZ A;  1SPI A;  4N91 A;  5EQA A;  4DI4 B;  1NV2 A;  4GWX A;  4N6K A;  4GBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...