4OA4A

Crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4 (shew_1446), target efi-510273, with bound succinate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
PTEIKFSHVVAENTPKGQMALKFKQLVEERLPGEYQVNVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKDMDAVNRFQQSDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMASDVLAAQFQAVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTSNTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYLTPEQRAAWVNAMKPVWAQFEDKIGKDLIDAAVASNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Protein binding
total genus 103
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4oa4A00
4PDHA 4YZZA 2VPOA 4PETA 4MMPA 2HZKA 4O94A 4PFIA 2WYKA 2CEXA 4MIJA 3FXBA 4PC9A 2ZZVA 4MNCA 2PFZA 4NAPA 4NF0A 5IGAA 2WYPA 5IZZA 4N6KA 4PE3A 4MEVA 3B50A 4MNPA 4UABA 2PFYA 4N4UA 3GYYA 4YICA 4N15A 5I5PA 4OVRA 4MAGA 3U65A 2VPNA 5CM6A 2ZZWA 4N8YA 4PAIA 4N91A 4XF5A 4PAKA 4XFEA 4O7MA 4NN3A 4PGPA 2XWIA 4P3LA 4PF8A 4PBQA 2XWOA 4PDDA 5LTCA 4DI3D 4OANA 4P8BA 4LN5A 4OA4A 4NHBA 4N8GA 4PCDA 4NGUA 2ZZXA 4DI4B 2HZLA 4P1EA 4MX6A 2WX9A 4XEQA 2XWVA 4PAFA 4N17A 5I7IA 4P1LA 2XXKA 2XA5A 4P47A 2HPGA 2CEYA 4PFRA 4OVPA 4OVTA 4PBHA 4MNIA 4X8RA 4MHFA 4PGNA 2XWKA 4NX1A 4P9KA 4OVQA 4X04A 4NG7A 2V4CA 4N6DA 4OVSA 4NQ8A 4MCOA 5IM2A 4PFBA 4O8MA 4PF6A 4P56A
chains in the Genus database with same CATH superfamily
2R71A 4F3BA 2OLBA 5TPAB 3GZGA 2O7IA 1JW5A 4KXPA 1B0LA 1CE2A 3LUYA 3Q27A 3V83A 1N3WA 1BK4A 5EQ8A 1AMFA 1FQEA 1NV5A 1B3LA 4IGRA 3E13X 1M5CA 4PQJA 4N6KA 1PB7A 2YJPA 2VD2A 2M8CA 1AWBA 3B50A 1EYIA 3MP6A 2DE3A 4HW8A 4GLIA 4YICA 1VE4A 1DPEA 3SDFA 2XX7A 2Q8MA 3M8UA 3H4ZA 5ET8A 2R6GE 2P2AA 1P1QA 1KWHA 1F9BA 1PBQA 4H46A 3R26A 4RJZA 5EQ9A 1D9YA 1FW0A 4MBPA 1NH7A 2F3DA 3KBRA 1IMDA 3PUWE 2DXYA 1LCFA 4DCXA 2XXRA 2L5VA 3T9HB 4KCCA 1NNKA 1MS7A 1B1HA 2Y5LA 4XEQA 4IO2A 1JVXA 4H5FA 4C0RA 5JTYA 3O2AA 3MVZA 1FBCA 4PFUA 1MQGA 3KSXA 4JSOA 3N6UA 4LZ7A 2P0SA 3FJMA 3FVGA 4BLAA 5A5XB 4JXIA 3MVWA 2LAOA 1H3DA 3JZJA 1UIUA 1I6AA 1VDWA 3EF7A 5AA2D 4YZZA 4FBPA 3B6QA 2KR0A 1Q35A 3IK6B 4KYDA 4YKPA 5LDZA 3TQWA 3RPLB 1POY1 2JJKA 3GBAA 2QMXA 1NUXA 1MRPA 3MP1A 2A5TA 5IGAA 1NV7A 3CI8A 3TEPA 5FTIA 2OX3A 2VD3A 4FAJA 4MNPA 2HQ0A 2ZMBA 4E0XA 5F7VA 1Z7NE 5FBPA 3LBSA 3O29A 4BDMA 4GRKA 3K02A 4PAIA 2O84X 1DTZA 4GD5A 3S9EA 4XFEA 3M3KA 3N5LA 2RC7A 3A29A 1OVTA 4ZE8A 3E3KA 2UVJA 3IAZA 1MY3A 3SEUA 3IB2A 4LN5A 3T9UA 3SEWA 2GHAA 4KYSA 3VVFA 1JVYA 4WXJA 1IITA 2IA4A 1Y1ZA 2WX9A 1B7UA 1ZBMA 4P47A 1B32A 4I40A 1LBCA 1MXXA 1YZ0A 4ELOA 2RC9A 1FTJA 2FIXA 1LAGE 1RYOA 4QRZA 3WAFA 4U2RA 5I59B 4UACA 3DP4A 3VLWA 4F2OA 3KN3A 4NG7A 4TOZA 3MSTA 2I3VA 4FATA 4BDQA 1B52A 4G77A 2ZNUA 4O8MA 4EQBA 4F22A 1I6BA 1M5FA 2VPOA 2CEXA 3LSLA 3VVDA 1NV1A 3PUZE 3RY3A 5I56B 2PBWA 3VLUA 4R6KA 2Y7WA 4RA1A 1FQDA 1WVJA 3MAMA 5KDTB 1S9TA 2P1SA 2I4BA 3FVKA 3DLNA 2UXAA 2PFYA 3MC2A 1JEVA 4U4SA 3TFLA 2XXWA 3L6GA 2OK2A 4GWXA 4MF3A 3NOHA 4ZEFA 2DWIA 1B0HA 4IY6A 1FPEA 3KJ7A 3ODBA 2Y7PA 3H6TA 2XWIA 2QJEA 4GWSA 4RYAA 2UYEA 3D1RA 3PUXE 2B4MA 4DXBA 1VSOA 4NHBA 5ET7A 1SPIA 1ZMGA 2UVGA 3H03A 2DE2A 1MXZA 4NGUA 2VHAA 4H67A 4AS4A 1ANFA 4NF8B 1IMBA 3CG1A 5FTHA 3QYTA 4JDFA 4NE4A 4X8RA 3PGFA 1ZTYA 4YMBA 5CI5A 3MP8A 1RKMA 2KLFA 1NV0A 2QPQA 4QBAA 3KFMA 4KR5A 4F1YA 4N6DA 1SW5A 4OVSA 4NQ8A 2PX1A 4PF6A 4P56A 1Y9UA 2PCRA 2DXRA 4MMPA 1B46A 4H8IA 4WKMA 3V8XB 1USYE 1UTBA 1YAEA 3ZKKA 4MNCA 5J1DA 4ZECA 2PT2A 5I84A 3FASA 2WYPA 3QSLA 1NH8A 5L9SA 3FZVA 4MEVA 2B3FA 5I57A 4F1UA 2XX9A 4HXVA 1BKAA 4WEDA 4BDRA 5DVJA 4QSEA 1TFDA 2HCAA 1B51A 1B4ZA 4OETA 3H7MA 3DM0A 4R9FA 2FHYA 3VV5A 2Z8FA 4G8NA 4FJPA 2UVIA 3OO7A 3PU5A 3B7DA 4ND9A 1QW0A 2QRYA 3IFAA 1FJ9A 1FPFA 4GX4A 1N7XA 3FVNA 4R73A 3QMFA 4MJOA 3I6VA 3N94A 5I3SA 4NF6A 1L5TA 3RGYA 5EHSA 3EPEA 3MW0A 4GFRA 5AA4A 3C36A 3IOVA 1ATGA 3PPRA 4RXLA 1POTA 1II5A 2X26A 3K6UA 2Q74A 3WAEA 4YU0A 1RDZA 1R9QA 1D9VA 4YB5A 1JEUA 4Q5TA 2V25A 1R1NA 4O94A 3RLFE 1T0KA 2WYKA 1P1OA 4U22A 2I0CA 4G61A 2H25A 1IQ7A 4XKRA 1ELJA 1QVSA 1YXIA 4QFKA 3MJNA 3SEXA 1URGA 3CIJA 2XXYA 4PFWA 1WODA 3SESA 1YYZA 4Q30B 3OENA 1EZ9A 4JVIA 5I5PA 1RDYA 1OQGA 5H8FA 1NV4A 3Q25A 3IOTA 2OWTA 5I58B 5BUUA 1QJMA 1NI9A 4NF4B 4G4PA 4GX6A 1VFDA 1B3FA 1XT8A 3FV1A 4RNSA 3TTRA 3Q29A 3GBBA 4THIA 3SEVA 2I4CA 4QHQA 3OMBA 3OXNA 4GWZA 4XKPA 2QS1A 2WKYA 4OWDA 4RK2A 1LFIA 2ONRA 5I2KB 4IR8A 2HHMA 2PT1A 4ELPA 3QAXA 1Y1MA 1FTAA 4PBHA 3BFTA 3CG3A 2V93A 2XD3A 4OVJA 3KGCA 4FEBA 4BDOA 3TTMA 3FUZA 3F11A 4I3YA 3KC1A 2ANJA 1MQHA 4OEUA 4MCOA 4YB6A 4NF5B 5CMMA 3K1NA 1H45A 4LATA 4PETA 3TQLA 4TLLB 3C33A 4N13A 4G68A 3CRBA 5IZ3A 3TAJA 4JB7A 3FV2A 1MPDA 2OJTA 4QFPA 1PBPA 4G68C 2WBDA 1B2HA 1Q9DA 5EYHA 4P11A 4QFLA 3BBRA 2H98A 1FTKA 1LBXA 2FIEA 3RTWB 4N4UA 1FBPA 2ABHA 5HPQA 4POWA 2Q2AA 1R6ZA 3A09A 1O7TA 3GXAA 5DTBA 4HCWA 4ZDMA 5CM6A 4IO3A 3G3GA 1A40A 1B05A 4EUOA 4PF8A 5F1QA 3P7IA 3QXMA 1SD3A 1SW4A 4OA4A 3T9XB 3O6IA 4YKKA 4N6PA 4KHZE 2O51A 1LGBC 5TP9B 2CZLA 2NOOA 3KBZA 3IORA 4ZS9A 3BKIB 5I7IA 3JYRA 4QFNA 4OTEA 1LBBA 1A55A 1SVXB 2H99A 4U23A 3EHTA 1YCJA 4I62A 4ESWA 4NX1A 1PDAA 4R2BA 1Y3NA 3TUSA 4U4XA 3T66A 5DVIA 3CHGA 2BJIA 2XXXA 4HE0A 2Q88A 1B5IA 3EHSA 2CZHA 2F5XA 1GR2A 1P99A 1Y20A 4JWXA 4H45A 4JVDA 3T93B 4LA9A 1O64A 4P0IA 3N6TA 2F6PA 5DW8A 5EYGA 2CZIA 3RYDA 1MXWA 1GV8A 4ZEIA 1RYXA 4IO4A 3TELA 1SDXA 4F29A 2AIXA 4ZE9A 3RQTA 4F2QA 4ONYA 2GFEA 2O1MA 5H8HB 5KCJB 1US4A 1SI1A 4OMBA 4X48A 4H65A 1AL3A 3W9VA 5H8NB 1MH4A 4O7MA 2UVHA 2I0BA 2NWJA 3TMGA 4Q0CA 2REJA 4EQ9A 4OANA 1B3GA 3TZAA 3V89B 1FBDA 1FPGA 1FQAA 1YPNA 2O7UA 2ZZXA 1FQFA 1IUDA 3KOTA 3TTLA 5J16A 1QGXA 4DLDA 4TQUQ 1B7HA 3ISPA 5BWJA 1DMBA 4I1DA 2QS4A 2CEYA 1NV2A 3H6UA 5AA2A 4H1XA 5HBCA 4OVPA 3ZKLA 4KFQA 1A8FA 3D4GA 4ISUA 2O1LA 5I57B 2D3IA 1FPDA 2I58A 1B3HA 3H3GA 1SYIA 3QIMA 3PV0E 4H6DA 4R74A 4HE1A 2VOZA 1JP4A 1MM7A 4ZEDA 1SYHA 3MQ9A 1SQYA 4NAPA 1XC1A 5ELVA 2ZNSA 3HHGA 2BJJX 2AL4A 1B5HA 4RPNA 1FQCA 1TWYA 2DDKA 1HSLA 4F1VA 3LSWA 5KZTA 3G3FA 1FTLA 3O9PA 3Q26A 4LUBA 1SBPA 1MXUA 2Y84A 1MQJA 4GXAA 4U1OA 3LSFB 3RN8A 1B1XA 2DWJA 4M1VA 2VPNA 4NF6B 1DBZA 2ZZWA 5CC2A 2YLNA 5HM4B 3K6WA 2RKMA 3EN3A 3H06B 2FBPA 4GOTA 2XXHA 1EU8A 4HTGA 1NNPA 5A5LA 5AA4B 2FVZA 1OMPA 2F3BA 3G3JA 2F8DA 2O69A 4NWDA 3ILUB 3DP6A 2GRVA 2OZZA 4GWYA 1Q1KA 1DTGA 1OLAA 3HV1A 3USDA 3C31A 2CZKA 4F19A 1MDQA 3IX1A 4EF2A 4ELRA 4R2FA 4PFYA 4BDLA 3U94A 3JV9A 2XWKA 3W15C 1IXCA 3DELB 1A8EA 4PFBA 5H8FB 3ONMA 4O3AA 1FSAA 3IO6A 5A5XA 4PFIA 3RT8A 5DVFA 1M5DA 1URDA 2YPNA 4H5GA 4MIJA 2I49A 2NUVA 4JVCA 2F78A 2WEFA 1Y3QA 1XVXA 5CBSA 3H6VA 4GQOA 5B70A 1NNTA 2F6GA 5EQ7A 2OCUA 2DP8A 5TU0A 3PPPA 1PC3A 5ITPA 4DZ1A 4EXLA 3ECRA 4GWOA 1QULA 1Y4TA 4PFTA 3SEYA 3IOUA 1FRPA 1IXIA 3U92A 3AXFA 2ZYMA 3B6WA 4GVOA 3EQ1A 1MY1A 3R7XA 3KZGA 5I2NB 2AL5A 2ZXTA 1MXYA 3FXQA 4AQ4A 3TCGA 3OEMA 4YAHX 4Z7EA 1TXFA 4GIZA 5LTCA 1FQBA 1XOCA 4IGTA 4JBZA 4RY1A 4X1DA 3PD9A 4LP2B 1LBYA 3VE1B 3VVEA 1HSJA 4PAFA 4YKJA 3QUJA 1MPCA 4AB6A 3A3CA 3K0VA 2X7QA 4ZZAA 4LZ8A 2HFBA 3VXCA 3FXUA 4MHFA 1XHYA 3THIA 5H8QA 3MZ9A 4OVQA 4F39A 2XXVA 1US5A 2CMOA 3IR1A 1EYKA 4QF9A 3FD3A 5CRYA 4MLVA 5I59A 4JWOA 5CBRA 3QUFA 4MLQA 4HE2A 2QFLA 2DVZA 3E79A 1BIYA 3FXBA 4KYEA 1B3EA 2ZZVA 3MBPA 3VDFA 3U8QA 4XKNA 4L17A 2ZNTA 4OFOA 5K2XA 4WEPA 5CMKA 2XHDA 5I56A 4GBVA 3HPIA 5KDTA 3GYYA 4N81A 2Y5KA 1DPPA 2E0SA 2QVUA 2REGA 4GWWA 1A99A 2DQVA 4OVRA 2UYFA 3U65A 4OEVA 3EHUA 4FE8A 1CB6A 1VFEA 1FBGA 1FPJA 4YB7A 3OO9A 4U1ZA 1FJ6A 3FIRA 4NN3A 3O28A 2B3BA 2O6AA 3ROJA 3HCQA 4OQOA 4KPTA 4OFJA 3FATA 4RK9A 1KA1A 5JTYB 4EF1A 2HZLA 2PVUA 3L6HA 3MWBA 3IFCA 2V3UA 3SKPA 2RC8A 3U93A 3T0JA 1XI6A 3T22A 1MQIA 2KQZA 2ALUA 4AB5A 2Z8DA 2G29A 4NF8A 1ZIUA 3FGSA 5K2YA 1FBFA 4DDDA 3RTFB 5ISUA 3PPQA 4XKQA 2WBBA 1IEJA 3G7WA 5IM2A 4TLMB 4Z0IA 3IB0A 1IXHA 4E0WA 1N3XA 3G3HA 1QUIA 3E9XA 2A5TB 2Z23A 2XXUA 3OSQA 4G8MA 2PFZA 1N04A 1G0IA 4POXA 2F7AA 5ICQA 5IZZA 1FPLA 3HO7A 1NV6A 5FHNA 5JEIA 3OEKA 3MVYA 3HN0A 3MYUA 5AA3A 1EZPA 1OLCA 1O63A 2ESNA 4R75A 1H76A 2R9JA 4N8YA 3I5OA 5IKBA 3BFUA 4KD5A 1B6HA 1VR5A 1SI0A 3GLBA 4KQPA 3OSRA 1OVBA 1K9ZA 1WDNA 1IXGA 3VFJA 4R6YA 3E78A 4IY5A 5AE4A 2DOJA 1H44A 1S7YA 1NFTA 2Q8JA 3K6VA 4P1EA 1GGGA 1ZKBA 1MPBA 2XXIA 5L9MA 4KCDA 2THIA 2RCAA 4IO7A 3PUVE 3OD7A 5ET5A 4OHNA 3BIHA 2QVRA 3M3LA 3K6XA 4FECA 2ZYKA 5EYFA 5ET6A 2G93A 3FXRA 3HHFA 4LZ5A 2Q2CA 3UK4A 2OBGA 3FVOA 3SETA 3PPOA 2GQ1A 4DCYA 1MG1A 4LQ5A 1QUJA 4OESA 1UTHA 2VT5A 4IO5A 3TTNA 2R8TA 1LBVA 4HCYA 4XTCQ 4JWYA 1AIVA 1LAHE 4OZ9A 4GL0A 1TFAA 4OFLA 1NV3A 3UN6A 3IJXB 4MFIA 1FBHA 4ZZEA 1PB8A 4I9DA 4X9TA 3LC8A 5JK4A 5ICTA 4XF5A 3RT6B 3RNNA 3DP8A 2Q89A 1P1NA 5DYHA 4PGPA 1YTVA 1GVCA 5I58A 3LR1A 4YMAA 4KI0E 4ECFA 4NF4A 4DI3D 2V84A 1UQWA 4JSDA 3OELA 3UA8A 1MM6A 1IMCA 4DI4B 1LBWA 1BTJA 1SW2A 4NEDA 3PMVA 2XWVA 4N17A 5AA1A 5ESYA 4AS5A 2HPGA 1FCKA 2FA7A 3UGWA 1LAXA 2Z8EA 5I2KA 4PGNA 3T1BA 2RINA 4F18A 4P9KA 2D21A 4DXUA 2ZYOA 3O66A 3KOSA 3KC0A 1AOVA 1UTBB 2F35A 3PUYE 1NNFA 3TKDA 1LAFE 2F7BA 5DEXA 1P1WA 2QVVA 3H6WA 3O6GA 4NF5A 5EHMA 4PC9A 3FBPA 3SZPA 1B4HA 3PPNA 3CFZA 4R6HA 4I8CA 4NF0A 1URSA 1A7LA 2VGQA 4QSDA 2P3VA 3K1MA 1LCTA 3B8BA 3VXBA 4QXDA 1HSEA 4EDPA 4N15A 2RF1A 3MZ1A 1M5BA 3RUMA 1IZ1A 1GTKA 1NMUA 1RDXA 5TPAA 4DIGA 4G8HA 1FPIA 1MH3A 3CFXA 2NXOA 1MY0A 4F31B 2Y7KA 1B5JA 1LLSA 1FBEA 3K4UA 4OYVA 5H8QB 1KZ8A 2F34A 4PP0A 3VLVA 4P3LA 4R9GA 4PDDA 2D5WA 3K2DA 4H8JA 3TCHA 3ZSFA 4EQ7A 1N84A 3IB1A 4BDNA 4K3FA 2GHBA 2F97A 4P8BA 3IJOB 1FTOA 2I3WA 4N8GA 5CMBA 1FPBA 2QL3A 3T9VA 5IZ1A 1MQDA 4IB2A 2XXKA 1B58A 5T3JA 5TP9A 4ELQA 1NUWA 2Y7IA 4FORA 1LFHA 4C1TA 2ONSA 3OOAA 5LOMA 3C34A 3S2VA 3MVXA 1QKBA 4ZEBA 4M4GA 3S4UA 3ILTB 4X1BA 4GBWA 3TDJA 2HAVA 3D4CA 1CNQA 1I6QA 1JETA 4NWCA 4XIGQ 1EZOA 2I6EA 4F3SA 1DCUA 1M5EA 3MUQA 1KA0A 2B65A 1IMAA 4NMYA 2Y7RA 1ZLQA 1J1NA 1S50A 2E1SA 4GWUA 4O3BA 3C35A 3CVGA 3OO8A 3UP9A 3T96B 4DXCA 3MZBA 5IAIA 1FPKA 5EQAA 1MY2A 1TT1A 4OXVA 4XXUA 1D4NA 1K9YA 3E4RA 3KJTA 2O68A 1Y3PA 2FNCA 2X7PA 4Q8RA 1P1UA 1B40A 1ZJLA 5ITOA 3KEIA 4DE8A 4FIMA 1PB9A 4RPOA 1LBZA 2I48A 3G3IA 4PAKA 3PTYA 3RPLA 5H8HA 3MPKA 5KCJA 5L8DA 2W7YA 2XD2A 4PBQA 2XWOA 3M3FA 1D3KA 4ZEKA 2QMWA 3KN8A 1DSNA 3CSGA 5FHOA 1LB9A 5H8NA 3KG2A 1DK4A 4F3PA 3QK6A 5CMCA 3S9NC 2DS9A 1OQHA 3IO4A 3PD8A 1XVYA 1LFGA 3LV0A 4OVTA 4O3CA 1D9QA 4HS7A 5F24A 3C9HA 4N07A 2ONKE 4H0WA 1B7ZA 1G0HA 3TTKA 2MKZA 4QSCA 3MPLA 4G68B 4P0GA 2Z22A 4LVQA 4MH5A 5IZ3B 4G2ZA 4PDHA 5L9OA 3HSTA 2HZKA 2HXRA 1A54A 3TPAA 3TODA 4IO6A 4GL8A 4EXKA 4LQ2A 3UIFA 3S9MC 2Q9TA 3TCFA 1N0TA 4YKIA 4OENA 4C1UA 3Q28A 4PE3A 4UABA 1ZU0A 5B7DA 3K01A 4OERA 3KN7A 4UA8A 1QKAA 2DE4A 3C4MA 2XXPA 2XXTA 1JQFA 4GXSB 2P3NA 4N91A 3V5AA 1IMFA 5H8SA 1JW4A 1XS5A 2OWSA 3TYHA 1B9JA 1IMEA 2H9BA 1JNFA 2DVCA 4PCDA 1LEVA 4ESXA 4MX6A 3A3UA 2F7CA 2XXQA 1UTHB 1LSTA 3KSJA 4PE5B 3K00A 1H43A 1N7WA 2QS2A 2XA5A 4PFRA 4QFOA 1FTMA 3O97A 2PMSA 2DWAA 1NUYA 3FJGA 2VP1A 3LUZA 4X04A 3UORA 4GX3A 2V4CA 1NL5A 1MDP1 2HEUA 3U72A 4GF8A 3SERA 2B4LA 1Z7ME 2HAUA 2H4IA 3ZS6A 3EKIA 3OO6A 4I3EA 1BLFA 1AH5A 2ZYNA 1SW1A 3LSXA 3K1PA 3N26A 1EH3A 4NTLA 2NVUB 3O6HA 4O7IA 2F36A 2OWZA 1N76A 3BIGA 1I69A 3G3KA 3S9LC 5M2VA 4MAGA 1PEBA 2QS3A 5FHMA 2FYIA 3I3VA 2V3QA 1BP5A 1R9LA 1LB8A 1DOTA 1JW1A 3CSBA 3R6UA 2GH9A 3IL1B 3U1OA 5I2NA 3CFLA 4R72A 1IIWA 2DSFA 1UIVA 2DYXA 1NKXA 2XX8A 5AA2B 3PMXA 2HXWA 1MXVA 2IEEA 3CR9A 4LONB 5DEXB 2A5SA 3RPWA 1QUKA 4P1LA 4F3GA 2DWHA 2AYSA 4FEDA 4U21A 3B6TA 3FJ7A 3PMWA 4MNIA 2PYYA 1Y4CA 5DT6A 3IOWA 3W9WA 2V3TA 4PTKA 1INPA 1OIBA 3HFUA 2H5YA 2QSXA 1NUZA 3C32A 1MY4A 2RCBA 1USYH 1EYJA
chains in the Genus database with same CATH topology
1FSAA 4O94A 4PFIA 4KXPA 2WYKA 4MIJA 2QVVA 4G61A 1BK4A 4PC9A 4JVCA 3FBPA 1YXIA 3SZPA 2WEFA 5EQ8A 1NV5A 4NF0A 5EQ7A 4N6KA 2P3VA 1YYZA 1AWBA 3B8BA 3B50A 4QXDA 1EYIA 2DE3A 4JVIA 4YICA 4N15A 1FRPA 5I5PA 1RDYA 1NV4A 2Q8MA 1RDXA 1FPIA 5ET8A 1NI9A 4H46A 4GX6A 1FBEA 1KZ8A 5EQ9A 4P3LA 4PDDA 2F3DA 5LTCA 1IMDA 4P8BA 4GWZA 4N8GA 1FPBA 2L5VA 2Y5LA 4XEQA 5IZ1A 1LBYA 4PAFA 2XXKA 4IR8A 2HHMA 5T3JA 1FTAA 1FBCA 4PBHA 1NUWA 4MHFA 4OVQA 4I3YA 3KC1A 4GBWA 1EYKA 4MCOA 1VDWA 4YZZA 4PETA 4FBPA 1CNQA 4HE2A 2QFLA 2DVZA 2KR0A 3E79A 3FXBA 5LDZA 3RPLB 5IZ3A 1DCUA 2JJKA 2ZZVA 1KA0A 1IMAA 1NUXA 2WBDA 5IGAA 1NV7A 1Q9DA 4GWUA 5EYHA 2OX3A 1FPKA 1LBXA 5EQAA 4MNPA 4GBVA 2FIEA 4N4UA 3GYYA 4N81A 1FBPA 1K9YA 2Y5KA 2QVUA 5FBPA 4GWWA 4OVRA 3U65A 4HCWA 5CM6A 4PAIA 1FBGA 1LBZA 1FPJA 4PAKA 1FJ6A 4XFEA 3PTYA 3RPLA 3A29A 4NN3A 4PF8A 4PBQA 2XWOA 3ROJA 4LN5A 4OA4A 1DK4A 1KA1A 2HZLA 2WX9A 3IFCA 3KBZA 5I7IA 3T0JA 1XI6A 4P47A 2KQZA 4I40A 3LV0A 1YZ0A 4OVTA 1D9QA 2FIXA 5F24A 4NX1A 4NG7A 3MSTA 1G0HA 1FBFA 2MKZA 3CHGA 2BJIA 2WBBA 5IM2A 4HE0A 4O8MA 5IZ3B 4PDHA 2VPOA 2CZHA 2HZKA 2F5XA 2HXRA 2CEXA 4H45A 4JVDA 1NV1A 2PFZA 1G0IA 5DW8A 5EYGA 2Q9TA 2CZIA 5IZZA 1FPLA 1NV6A 3RYDA 4PE3A 4UABA 3MYUA 2PFYA 2DE4A 4GWXA 2P3NA 4N8YA 3NOHA 4N91A 1FPEA 3W9VA 4O7MA 1IMFA 2XWIA 1K9ZA 4GWSA 3E78A 3D1RA 4OANA 1IMEA 2B4MA 4NHBA 5ET7A 1SPIA 1FBDA 1FPGA 4PCDA 2DE2A 4NGUA 2ZZXA 1LEVA 4AS4A 4P1EA 4MX6A 5J16A 1QGXA 1IMBA 3ISPA 2XA5A 2CEYA 1NV2A 4PFRA 5ET5A 3BIHA 2QVRA 4OVPA 4X8RA 1NUYA 5ET6A 1NV0A 2QPQA 4QBAA 3LUZA 1FPDA 4X04A 4GX3A 2V4CA 4N6DA 4OVSA 4NQ8A 2B4LA 4PF6A 4P56A 2PCRA 4MMPA 4HE1A 3EKIA 2GQ1A 4I3EA 1JP4A 2VT5A 4MNCA 5J1DA 2R8TA 1LBVA 4HCYA 4NAPA 2WYPA 4MEVA 2DDKA 1NV3A 4F1UA 4F1VA 4O7IA 4HXVA 2OWZA 1FBHA 3BIGA 4M1VA 4MAGA 2VPNA 1DBZA 2ZZWA 4X9TA 5JK4A 4XF5A 2FBPA 2V3QA 2FHYA 5A5LA 4PGPA 2FVZA 2F3BA 4DI3D 3IFAA 1FJ9A 1IMCA 4GWYA 4DI4B 1FPFA 4GX4A 1LBWA 3QMFA 4MJOA 2XWVA 4N17A 4P1LA 5ESYA 4AS5A 5I3SA 2HPGA 2CZKA 4F19A 4MNIA 4PGNA 3T1BA 2XWKA 3W9WA 4F18A 4P9KA 4PTKA 1INPA 3HFUA 2Q74A 1RDZA 1NUZA 4PFBA 1EYJA 3KC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDH A;  4YZZ A;  2VPO A;  4PET A;  4MMP A;  2HZK A;  4O94 A;  4PFI A;  2WYK A;  2CEX A;  4MIJ A;  3FXB A;  4PC9 A;  2ZZV A;  4MNC A;  2PFZ A;  4NAP A;  4NF0 A;  5IGA A;  2WYP A;  5IZZ A;  4N6K A;  4PE3 A;  4MEV A;  3B50 A;  4MNP A;  4UAB A;  2PFY A;  4N4U A;  3GYY A;  4YIC A;  4N15 A;  5I5P A;  4OVR A;  4MAG A;  3U65 A;  2VPN A;  5CM6 A;  2ZZW A;  4N8Y A;  4PAI A;  4N91 A;  4XF5 A;  4PAK A;  4XFE A;  4O7M A;  4NN3 A;  4PGP A;  2XWI A;  4P3L A;  4PF8 A;  4PBQ A;  2XWO A;  4PDD A;  5LTC A;  4DI3 D;  4OAN A;  4P8B A;  4LN5 A;  4OA4 A;  4NHB A;  4N8G A;  4PCD A;  4NGU A;  2ZZX A;  4DI4 B;  2HZL A;  4P1E A;  4MX6 A;  2WX9 A;  4XEQ A;  2XWV A;  4PAF A;  4N17 A;  5I7I A;  4P1L A;  2XXK A;  2XA5 A;  4P47 A;  2HPG A;  2CEY A;  4PFR A;  4OVP A;  4OVT A;  4PBH A;  4MNI A;  4X8R A;  4MHF A;  4PGN A;  2XWK A;  4NX1 A;  4P9K A;  4OVQ A;  4X04 A;  4NG7 A;  2V4C A;  4N6D A;  4OVS A;  4NQ8 A;  4MCO A;  5IM2 A;  4PFB A;  4O8M A;  4PF6 A;  4P56 A; 
#chains in the Genus database with same CATH topology
 2R71 A;  4F3B A;  2OLB A;  5TPA B;  3GZG A;  2O7I A;  1JW5 A;  4KXP A;  1B0L A;  1CE2 A;  3LUY A;  3Q27 A;  3V83 A;  1N3W A;  1BK4 A;  5EQ8 A;  1AMF A;  1FQE A;  1NV5 A;  1B3L A;  4IGR A;  3E13 X;  1M5C A;  4PQJ A;  4N6K A;  1PB7 A;  2YJP A;  2VD2 A;  2M8C A;  1AWB A;  3B50 A;  1EYI A;  3MP6 A;  2DE3 A;  4HW8 A;  4GLI A;  4YIC A;  1VE4 A;  1DPE A;  3SDF A;  2XX7 A;  2Q8M A;  3M8U A;  3H4Z A;  5ET8 A;  2R6G E;  2P2A A;  1P1Q A;  1KWH A;  1F9B A;  1PBQ A;  4H46 A;  3R26 A;  4RJZ A;  5EQ9 A;  1D9Y A;  1FW0 A;  4MBP A;  1NH7 A;  2F3D A;  3KBR A;  1IMD A;  3PUW E;  2DXY A;  1LCF A;  4DCX A;  2XXR A;  2L5V A;  3T9H B;  4KCC A;  1NNK A;  1MS7 A;  1B1H A;  2Y5L A;  4XEQ A;  4IO2 A;  1JVX A;  4H5F A;  4C0R A;  5JTY A;  3O2A A;  3MVZ A;  1FBC A;  4PFU A;  1MQG A;  3KSX A;  4JSO A;  3N6U A;  4LZ7 A;  2P0S A;  3FJM A;  3FVG A;  4BLA A;  5A5X B;  4JXI A;  3MVW A;  2LAO A;  1H3D A;  3JZJ A;  1UIU A;  1I6A A;  1VDW A;  3EF7 A;  5AA2 D;  4YZZ A;  4FBP A;  3B6Q A;  2KR0 A;  1Q35 A;  3IK6 B;  4KYD A;  4YKP A;  5LDZ A;  3TQW A;  3RPL B;  1POY 1;  2JJK A;  3GBA A;  2QMX A;  1NUX A;  1MRP A;  3MP1 A;  2A5T A;  5IGA A;  1NV7 A;  3CI8 A;  3TEP A;  5FTI A;  2OX3 A;  2VD3 A;  4FAJ A;  4MNP A;  2HQ0 A;  2ZMB A;  4E0X A;  5F7V A;  1Z7N E;  5FBP A;  3LBS A;  3O29 A;  4BDM A;  4GRK A;  3K02 A;  4PAI A;  2O84 X;  1DTZ A;  4GD5 A;  3S9E A;  4XFE A;  3M3K A;  3N5L A;  2RC7 A;  3A29 A;  1OVT A;  4ZE8 A;  3E3K A;  2UVJ A;  3IAZ A;  1MY3 A;  3SEU A;  3IB2 A;  4LN5 A;  3T9U A;  3SEW A;  2GHA A;  4KYS A;  3VVF A;  1JVY A;  4WXJ A;  1IIT A;  2IA4 A;  1Y1Z A;  2WX9 A;  1B7U A;  1ZBM A;  4P47 A;  1B32 A;  4I40 A;  1LBC A;  1MXX A;  1YZ0 A;  4ELO A;  2RC9 A;  1FTJ A;  2FIX A;  1LAG E;  1RYO A;  4QRZ A;  3WAF A;  4U2R A;  5I59 B;  4UAC A;  3DP4 A;  3VLW A;  4F2O A;  3KN3 A;  4NG7 A;  4TOZ A;  3MST A;  2I3V A;  4FAT A;  4BDQ A;  1B52 A;  4G77 A;  2ZNU A;  4O8M A;  4EQB A;  4F22 A;  1I6B A;  1M5F A;  2VPO A;  2CEX A;  3LSL A;  3VVD A;  1NV1 A;  3PUZ E;  3RY3 A;  5I56 B;  2PBW A;  3VLU A;  4R6K A;  2Y7W A;  4RA1 A;  1FQD A;  1WVJ A;  3MAM A;  5KDT B;  1S9T A;  2P1S A;  2I4B A;  3FVK A;  3DLN A;  2UXA A;  2PFY A;  3MC2 A;  1JEV A;  4U4S A;  3TFL A;  2XXW A;  3L6G A;  2OK2 A;  4GWX A;  4MF3 A;  3NOH A;  4ZEF A;  2DWI A;  1B0H A;  4IY6 A;  1FPE A;  3KJ7 A;  3ODB A;  2Y7P A;  3H6T A;  2XWI A;  2QJE A;  4GWS A;  4RYA A;  2UYE A;  3D1R A;  3PUX E;  2B4M A;  4DXB A;  1VSO A;  4NHB A;  5ET7 A;  1SPI A;  1ZMG A;  2UVG A;  3H03 A;  2DE2 A;  1MXZ A;  4NGU A;  2VHA A;  4H67 A;  4AS4 A;  1ANF A;  4NF8 B;  1IMB A;  3CG1 A;  5FTH A;  3QYT A;  4JDF A;  4NE4 A;  4X8R A;  3PGF A;  1ZTY A;  4YMB A;  5CI5 A;  3MP8 A;  1RKM A;  2KLF A;  1NV0 A;  2QPQ A;  4QBA A;  3KFM A;  4KR5 A;  4F1Y A;  4N6D A;  1SW5 A;  4OVS A;  4NQ8 A;  2PX1 A;  4PF6 A;  4P56 A;  1Y9U A;  2PCR A;  2DXR A;  4MMP A;  1B46 A;  4H8I A;  4WKM A;  3V8X B;  1USY E;  1UTB A;  1YAE A;  3ZKK A;  4MNC A;  5J1D A;  4ZEC A;  2PT2 A;  5I84 A;  3FAS A;  2WYP A;  3QSL A;  1NH8 A;  5L9S A;  3FZV A;  4MEV A;  2B3F A;  5I57 A;  4F1U A;  2XX9 A;  4HXV A;  1BKA A;  4WED A;  4BDR A;  5DVJ A;  4QSE A;  1TFD A;  2HCA A;  1B51 A;  1B4Z A;  4OET A;  3H7M A;  3DM0 A;  4R9F A;  2FHY A;  3VV5 A;  2Z8F A;  4G8N A;  4FJP A;  2UVI A;  3OO7 A;  3PU5 A;  3B7D A;  4ND9 A;  1QW0 A;  2QRY A;  3IFA A;  1FJ9 A;  1FPF A;  4GX4 A;  1N7X A;  3FVN A;  4R73 A;  3QMF A;  4MJO A;  3I6V A;  3N94 A;  5I3S A;  4NF6 A;  1L5T A;  3RGY A;  5EHS A;  3EPE A;  3MW0 A;  4GFR A;  5AA4 A;  3C36 A;  3IOV A;  1ATG A;  3PPR A;  4RXL A;  1POT A;  1II5 A;  2X26 A;  3K6U A;  2Q74 A;  3WAE A;  4YU0 A;  1RDZ A;  1R9Q A;  1D9V A;  4YB5 A;  1JEU A;  4Q5T A;  2V25 A;  1R1N A;  4O94 A;  3RLF E;  1T0K A;  2WYK A;  1P1O A;  4U22 A;  2I0C A;  4G61 A;  2H25 A;  1IQ7 A;  4XKR A;  1ELJ A;  1QVS A;  1YXI A;  4QFK A;  3MJN A;  3SEX A;  1URG A;  3CIJ A;  2XXY A;  4PFW A;  1WOD A;  3SES A;  1YYZ A;  4Q30 B;  3OEN A;  1EZ9 A;  4JVI A;  5I5P A;  1RDY A;  1OQG A;  5H8F A;  1NV4 A;  3Q25 A;  3IOT A;  2OWT A;  5I58 B;  5BUU A;  1QJM A;  1NI9 A;  4NF4 B;  4G4P A;  4GX6 A;  1VFD A;  1B3F A;  1XT8 A;  3FV1 A;  4RNS A;  3TTR A;  3Q29 A;  3GBB A;  4THI A;  3SEV A;  2I4C A;  4QHQ A;  3OMB A;  3OXN A;  4GWZ A;  4XKP A;  2QS1 A;  2WKY A;  4OWD A;  4RK2 A;  1LFI A;  2ONR A;  5I2K B;  4IR8 A;  2HHM A;  2PT1 A;  4ELP A;  3QAX A;  1Y1M A;  1FTA A;  4PBH A;  3BFT A;  3CG3 A;  2V93 A;  2XD3 A;  4OVJ A;  3KGC A;  4FEB A;  4BDO A;  3TTM A;  3FUZ A;  3F11 A;  4I3Y A;  3KC1 A;  2ANJ A;  1MQH A;  4OEU A;  4MCO A;  4YB6 A;  4NF5 B;  5CMM A;  3K1N A;  1H45 A;  4LAT A;  4PET A;  3TQL A;  4TLL B;  3C33 A;  4N13 A;  4G68 A;  3CRB A;  5IZ3 A;  3TAJ A;  4JB7 A;  3FV2 A;  1MPD A;  2OJT A;  4QFP A;  1PBP A;  4G68 C;  2WBD A;  1B2H A;  1Q9D A;  5EYH A;  4P11 A;  4QFL A;  3BBR A;  2H98 A;  1FTK A;  1LBX A;  2FIE A;  3RTW B;  4N4U A;  1FBP A;  2ABH A;  5HPQ A;  4POW A;  2Q2A A;  1R6Z A;  3A09 A;  1O7T A;  3GXA A;  5DTB A;  4HCW A;  4ZDM A;  5CM6 A;  4IO3 A;  3G3G A;  1A40 A;  1B05 A;  4EUO A;  4PF8 A;  5F1Q A;  3P7I A;  3QXM A;  1SD3 A;  1SW4 A;  4OA4 A;  3T9X B;  3O6I A;  4YKK A;  4N6P A;  4KHZ E;  2O51 A;  1LGB C;  5TP9 B;  2CZL A;  2NOO A;  3KBZ A;  3IOR A;  4ZS9 A;  3BKI B;  5I7I A;  3JYR A;  4QFN A;  4OTE A;  1LBB A;  1A55 A;  1SVX B;  2H99 A;  4U23 A;  3EHT A;  1YCJ A;  4I62 A;  4ESW A;  4NX1 A;  1PDA A;  4R2B A;  1Y3N A;  3TUS A;  4U4X A;  3T66 A;  5DVI A;  3CHG A;  2BJI A;  2XXX A;  4HE0 A;  2Q88 A;  1B5I A;  3EHS A;  2CZH A;  2F5X A;  1GR2 A;  1P99 A;  1Y20 A;  4JWX A;  4H45 A;  4JVD A;  3T93 B;  4LA9 A;  1O64 A;  4P0I A;  3N6T A;  2F6P A;  5DW8 A;  5EYG A;  2CZI A;  3RYD A;  1MXW A;  1GV8 A;  4ZEI A;  1RYX A;  4IO4 A;  3TEL A;  1SDX A;  4F29 A;  2AIX A;  4ZE9 A;  3RQT A;  4F2Q A;  4ONY A;  2GFE A;  2O1M A;  5H8H B;  5KCJ B;  1US4 A;  1SI1 A;  4OMB A;  4X48 A;  4H65 A;  1AL3 A;  3W9V A;  5H8N B;  1MH4 A;  4O7M A;  2UVH A;  2I0B A;  2NWJ A;  3TMG A;  4Q0C A;  2REJ A;  4EQ9 A;  4OAN A;  1B3G A;  3TZA A;  3V89 B;  1FBD A;  1FPG A;  1FQA A;  1YPN A;  2O7U A;  2ZZX A;  1FQF A;  1IUD A;  3KOT A;  3TTL A;  5J16 A;  1QGX A;  4DLD A;  4TQU Q;  1B7H A;  3ISP A;  5BWJ A;  1DMB A;  4I1D A;  2QS4 A;  2CEY A;  1NV2 A;  3H6U A;  5AA2 A;  4H1X A;  5HBC A;  4OVP A;  3ZKL A;  4KFQ A;  1A8F A;  3D4G A;  4ISU A;  2O1L A;  5I57 B;  2D3I A;  1FPD A;  2I58 A;  1B3H A;  3H3G A;  1SYI A;  3QIM A;  3PV0 E;  4H6D A;  4R74 A;  4HE1 A;  2VOZ A;  1JP4 A;  1MM7 A;  4ZED A;  1SYH A;  3MQ9 A;  1SQY A;  4NAP A;  1XC1 A;  5ELV A;  2ZNS A;  3HHG A;  2BJJ X;  2AL4 A;  1B5H A;  4RPN A;  1FQC A;  1TWY A;  2DDK A;  1HSL A;  4F1V A;  3LSW A;  5KZT A;  3G3F A;  1FTL A;  3O9P A;  3Q26 A;  4LUB A;  1SBP A;  1MXU A;  2Y84 A;  1MQJ A;  4GXA A;  4U1O A;  3LSF B;  3RN8 A;  1B1X A;  2DWJ A;  4M1V A;  2VPN A;  4NF6 B;  1DBZ A;  2ZZW A;  5CC2 A;  2YLN A;  5HM4 B;  3K6W A;  2RKM A;  3EN3 A;  3H06 B;  2FBP A;  4GOT A;  2XXH A;  1EU8 A;  4HTG A;  1NNP A;  5A5L A;  5AA4 B;  2FVZ A;  1OMP A;  2F3B A;  3G3J A;  2F8D A;  2O69 A;  4NWD A;  3ILU B;  3DP6 A;  2GRV A;  2OZZ A;  4GWY A;  1Q1K A;  1DTG A;  1OLA A;  3HV1 A;  3USD A;  3C31 A;  2CZK A;  4F19 A;  1MDQ A;  3IX1 A;  4EF2 A;  4ELR A;  4R2F A;  4PFY A;  4BDL A;  3U94 A;  3JV9 A;  2XWK A;  3W15 C;  1IXC A;  3DEL B;  1A8E A;  4PFB A;  5H8F B;  3ONM A;  4O3A A;  1FSA A;  3IO6 A;  5A5X A;  4PFI A;  3RT8 A;  5DVF A;  1M5D A;  1URD A;  2YPN A;  4H5G A;  4MIJ A;  2I49 A;  2NUV A;  4JVC A;  2F78 A;  2WEF A;  1Y3Q A;  1XVX A;  5CBS A;  3H6V A;  4GQO A;  5B70 A;  1NNT A;  2F6G A;  5EQ7 A;  2OCU A;  2DP8 A;  5TU0 A;  3PPP A;  1PC3 A;  5ITP A;  4DZ1 A;  4EXL A;  3ECR A;  4GWO A;  1QUL A;  1Y4T A;  4PFT A;  3SEY A;  3IOU A;  1FRP A;  1IXI A;  3U92 A;  3AXF A;  2ZYM A;  3B6W A;  4GVO A;  3EQ1 A;  1MY1 A;  3R7X A;  3KZG A;  5I2N B;  2AL5 A;  2ZXT A;  1MXY A;  3FXQ A;  4AQ4 A;  3TCG A;  3OEM A;  4YAH X;  4Z7E A;  1TXF A;  4GIZ A;  5LTC A;  1FQB A;  1XOC A;  4IGT A;  4JBZ A;  4RY1 A;  4X1D A;  3PD9 A;  4LP2 B;  1LBY A;  3VE1 B;  3VVE A;  1HSJ A;  4PAF A;  4YKJ A;  3QUJ A;  1MPC A;  4AB6 A;  3A3C A;  3K0V A;  2X7Q A;  4ZZA A;  4LZ8 A;  2HFB A;  3VXC A;  3FXU A;  4MHF A;  1XHY A;  3THI A;  5H8Q A;  3MZ9 A;  4OVQ A;  4F39 A;  2XXV A;  1US5 A;  2CMO A;  3IR1 A;  1EYK A;  4QF9 A;  3FD3 A;  5CRY A;  4MLV A;  5I59 A;  4JWO A;  5CBR A;  3QUF A;  4MLQ A;  4HE2 A;  2QFL A;  2DVZ A;  3E79 A;  1BIY A;  3FXB A;  4KYE A;  1B3E A;  2ZZV A;  3MBP A;  3VDF A;  3U8Q A;  4XKN A;  4L17 A;  2ZNT A;  4OFO A;  5K2X A;  4WEP A;  5CMK A;  2XHD A;  5I56 A;  4GBV A;  3HPI A;  5KDT A;  3GYY A;  4N81 A;  2Y5K A;  1DPP A;  2E0S A;  2QVU A;  2REG A;  4GWW A;  1A99 A;  2DQV A;  4OVR A;  2UYF A;  3U65 A;  4OEV A;  3EHU A;  4FE8 A;  1CB6 A;  1VFE A;  1FBG A;  1FPJ A;  4YB7 A;  3OO9 A;  4U1Z A;  1FJ6 A;  3FIR A;  4NN3 A;  3O28 A;  2B3B A;  2O6A A;  3ROJ A;  3HCQ A;  4OQO A;  4KPT A;  4OFJ A;  3FAT A;  4RK9 A;  1KA1 A;  5JTY B;  4EF1 A;  2HZL A;  2PVU A;  3L6H A;  3MWB A;  3IFC A;  2V3U A;  3SKP A;  2RC8 A;  3U93 A;  3T0J A;  1XI6 A;  3T22 A;  1MQI A;  2KQZ A;  2ALU A;  4AB5 A;  2Z8D A;  2G29 A;  4NF8 A;  1ZIU A;  3FGS A;  5K2Y A;  1FBF A;  4DDD A;  3RTF B;  5ISU A;  3PPQ A;  4XKQ A;  2WBB A;  1IEJ A;  3G7W A;  5IM2 A;  4TLM B;  4Z0I A;  3IB0 A;  1IXH A;  4E0W A;  1N3X A;  3G3H A;  1QUI A;  3E9X A;  2A5T B;  2Z23 A;  2XXU A;  3OSQ A;  4G8M A;  2PFZ A;  1N04 A;  1G0I A;  4POX A;  2F7A A;  5ICQ A;  5IZZ A;  1FPL A;  3HO7 A;  1NV6 A;  5FHN A;  5JEI A;  3OEK A;  3MVY A;  3HN0 A;  3MYU A;  5AA3 A;  1EZP A;  1OLC A;  1O63 A;  2ESN A;  4R75 A;  1H76 A;  2R9J A;  4N8Y A;  3I5O A;  5IKB A;  3BFU A;  4KD5 A;  1B6H A;  1VR5 A;  1SI0 A;  3GLB A;  4KQP A;  3OSR A;  1OVB A;  1K9Z A;  1WDN A;  1IXG A;  3VFJ A;  4R6Y A;  3E78 A;  4IY5 A;  5AE4 A;  2DOJ A;  1H44 A;  1S7Y A;  1NFT A;  2Q8J A;  3K6V A;  4P1E A;  1GGG A;  1ZKB A;  1MPB A;  2XXI A;  5L9M A;  4KCD A;  2THI A;  2RCA A;  4IO7 A;  3PUV E;  3OD7 A;  5ET5 A;  4OHN A;  3BIH A;  2QVR A;  3M3L A;  3K6X A;  4FEC A;  2ZYK A;  5EYF A;  5ET6 A;  2G93 A;  3FXR A;  3HHF A;  4LZ5 A;  2Q2C A;  3UK4 A;  2OBG A;  3FVO A;  3SET A;  3PPO A;  2GQ1 A;  4DCY A;  1MG1 A;  4LQ5 A;  1QUJ A;  4OES A;  1UTH A;  2VT5 A;  4IO5 A;  3TTN A;  2R8T A;  1LBV A;  4HCY A;  4XTC Q;  4JWY A;  1AIV A;  1LAH E;  4OZ9 A;  4GL0 A;  1TFA A;  4OFL A;  1NV3 A;  3UN6 A;  3IJX B;  4MFI A;  1FBH A;  4ZZE A;  1PB8 A;  4I9D A;  4X9T A;  3LC8 A;  5JK4 A;  5ICT A;  4XF5 A;  3RT6 B;  3RNN A;  3DP8 A;  2Q89 A;  1P1N A;  5DYH A;  4PGP A;  1YTV A;  1GVC A;  5I58 A;  3LR1 A;  4YMA A;  4KI0 E;  4ECF A;  4NF4 A;  4DI3 D;  2V84 A;  1UQW A;  4JSD A;  3OEL A;  3UA8 A;  1MM6 A;  1IMC A;  4DI4 B;  1LBW A;  1BTJ A;  1SW2 A;  4NED A;  3PMV A;  2XWV A;  4N17 A;  5AA1 A;  5ESY A;  4AS5 A;  2HPG A;  1FCK A;  2FA7 A;  3UGW A;  1LAX A;  2Z8E A;  5I2K A;  4PGN A;  3T1B A;  2RIN A;  4F18 A;  4P9K A;  2D21 A;  4DXU A;  2ZYO A;  3O66 A;  3KOS A;  3KC0 A;  1AOV A;  1UTB B;  2F35 A;  3PUY E;  1NNF A;  3TKD A;  1LAF E;  2F7B A;  5DEX A;  1P1W A;  2QVV A;  3H6W A;  3O6G A;  4NF5 A;  5EHM A;  4PC9 A;  3FBP A;  3SZP A;  1B4H A;  3PPN A;  3CFZ A;  4R6H A;  4I8C A;  4NF0 A;  1URS A;  1A7L A;  2VGQ A;  4QSD A;  2P3V A;  3K1M A;  1LCT A;  3B8B A;  3VXB A;  4QXD A;  1HSE A;  4EDP A;  4N15 A;  2RF1 A;  3MZ1 A;  1M5B A;  3RUM A;  1IZ1 A;  1GTK A;  1NMU A;  1RDX A;  5TPA A;  4DIG A;  4G8H A;  1FPI A;  1MH3 A;  3CFX A;  2NXO A;  1MY0 A;  4F31 B;  2Y7K A;  1B5J A;  1LLS A;  1FBE A;  3K4U A;  4OYV A;  5H8Q B;  1KZ8 A;  2F34 A;  4PP0 A;  3VLV A;  4P3L A;  4R9G A;  4PDD A;  2D5W A;  3K2D A;  4H8J A;  3TCH A;  3ZSF A;  4EQ7 A;  1N84 A;  3IB1 A;  4BDN A;  4K3F A;  2GHB A;  2F97 A;  4P8B A;  3IJO B;  1FTO A;  2I3W A;  4N8G A;  5CMB A;  1FPB A;  2QL3 A;  3T9V A;  5IZ1 A;  1MQD A;  4IB2 A;  2XXK A;  1B58 A;  5T3J A;  5TP9 A;  4ELQ A;  1NUW A;  2Y7I A;  4FOR A;  1LFH A;  4C1T A;  2ONS A;  3OOA A;  5LOM A;  3C34 A;  3S2V A;  3MVX A;  1QKB A;  4ZEB A;  4M4G A;  3S4U A;  3ILT B;  4X1B A;  4GBW A;  3TDJ A;  2HAV A;  3D4C A;  1CNQ A;  1I6Q A;  1JET A;  4NWC A;  4XIG Q;  1EZO A;  2I6E A;  4F3S A;  1DCU A;  1M5E A;  3MUQ A;  1KA0 A;  2B65 A;  1IMA A;  4NMY A;  2Y7R A;  1ZLQ A;  1J1N A;  1S50 A;  2E1S A;  4GWU A;  4O3B A;  3C35 A;  3CVG A;  3OO8 A;  3UP9 A;  3T96 B;  4DXC A;  3MZB A;  5IAI A;  1FPK A;  5EQA A;  1MY2 A;  1TT1 A;  4OXV A;  4XXU A;  1D4N A;  1K9Y A;  3E4R A;  3KJT A;  2O68 A;  1Y3P A;  2FNC A;  2X7P A;  4Q8R A;  1P1U A;  1B40 A;  1ZJL A;  5ITO A;  3KEI A;  4DE8 A;  4FIM A;  1PB9 A;  4RPO A;  1LBZ A;  2I48 A;  3G3I A;  4PAK A;  3PTY A;  3RPL A;  5H8H A;  3MPK A;  5KCJ A;  5L8D A;  2W7Y A;  2XD2 A;  4PBQ A;  2XWO A;  3M3F A;  1D3K A;  4ZEK A;  2QMW A;  3KN8 A;  1DSN A;  3CSG A;  5FHO A;  1LB9 A;  5H8N A;  3KG2 A;  1DK4 A;  4F3P A;  3QK6 A;  5CMC A;  3S9N C;  2DS9 A;  1OQH A;  3IO4 A;  3PD8 A;  1XVY A;  1LFG A;  3LV0 A;  4OVT A;  4O3C A;  1D9Q A;  4HS7 A;  5F24 A;  3C9H A;  4N07 A;  2ONK E;  4H0W A;  1B7Z A;  1G0H A;  3TTK A;  2MKZ A;  4QSC A;  3MPL A;  4G68 B;  4P0G A;  2Z22 A;  4LVQ A;  4MH5 A;  5IZ3 B;  4G2Z A;  4PDH A;  5L9O A;  3HST A;  2HZK A;  2HXR A;  1A54 A;  3TPA A;  3TOD A;  4IO6 A;  4GL8 A;  4EXK A;  4LQ2 A;  3UIF A;  3S9M C;  2Q9T A;  3TCF A;  1N0T A;  4YKI A;  4OEN A;  4C1U A;  3Q28 A;  4PE3 A;  4UAB A;  1ZU0 A;  5B7D A;  3K01 A;  4OER A;  3KN7 A;  4UA8 A;  1QKA A;  2DE4 A;  3C4M A;  2XXP A;  2XXT A;  1JQF A;  4GXS B;  2P3N A;  4N91 A;  3V5A A;  1IMF A;  5H8S A;  1JW4 A;  1XS5 A;  2OWS A;  3TYH A;  1B9J A;  1IME A;  2H9B A;  1JNF A;  2DVC A;  4PCD A;  1LEV A;  4ESX A;  4MX6 A;  3A3U A;  2F7C A;  2XXQ A;  1UTH B;  1LST A;  3KSJ A;  4PE5 B;  3K00 A;  1H43 A;  1N7W A;  2QS2 A;  2XA5 A;  4PFR A;  4QFO A;  1FTM A;  3O97 A;  2PMS A;  2DWA A;  1NUY A;  3FJG A;  2VP1 A;  3LUZ A;  4X04 A;  3UOR A;  4GX3 A;  2V4C A;  1NL5 A;  1MDP 1;  2HEU A;  3U72 A;  4GF8 A;  3SER A;  2B4L A;  1Z7M E;  2HAU A;  2H4I A;  3ZS6 A;  3EKI A;  3OO6 A;  4I3E A;  1BLF A;  1AH5 A;  2ZYN A;  1SW1 A;  3LSX A;  3K1P A;  3N26 A;  1EH3 A;  4NTL A;  2NVU B;  3O6H A;  4O7I A;  2F36 A;  2OWZ A;  1N76 A;  3BIG A;  1I69 A;  3G3K A;  3S9L C;  5M2V A;  4MAG A;  1PEB A;  2QS3 A;  5FHM A;  2FYI A;  3I3V A;  2V3Q A;  1BP5 A;  1R9L A;  1LB8 A;  1DOT A;  1JW1 A;  3CSB A;  3R6U A;  2GH9 A;  3IL1 B;  3U1O A;  5I2N A;  3CFL A;  4R72 A;  1IIW A;  2DSF A;  1UIV A;  2DYX A;  1NKX A;  2XX8 A;  5AA2 B;  3PMX A;  2HXW A;  1MXV A;  2IEE A;  3CR9 A;  4LON B;  5DEX B;  2A5S A;  3RPW A;  1QUK A;  4P1L A;  4F3G A;  2DWH A;  2AYS A;  4FED A;  4U21 A;  3B6T A;  3FJ7 A;  3PMW A;  4MNI A;  2PYY A;  1Y4C A;  5DT6 A;  3IOW A;  3W9W A;  2V3T A;  4PTK A;  1INP A;  1OIB A;  3HFU A;  2H5Y A;  2QSX A;  1NUZ A;  3C32 A;  1MY4 A;  2RCB A;  1USY H;  1EYJ A; 
#chains in the Genus database with same CATH homology
 1FSA A;  4O94 A;  4PFI A;  4KXP A;  2WYK A;  4MIJ A;  2QVV A;  4G61 A;  1BK4 A;  4PC9 A;  4JVC A;  3FBP A;  1YXI A;  3SZP A;  2WEF A;  5EQ8 A;  1NV5 A;  4NF0 A;  5EQ7 A;  4N6K A;  2P3V A;  1YYZ A;  1AWB A;  3B8B A;  3B50 A;  4QXD A;  1EYI A;  2DE3 A;  4JVI A;  4YIC A;  4N15 A;  1FRP A;  5I5P A;  1RDY A;  1NV4 A;  2Q8M A;  1RDX A;  1FPI A;  5ET8 A;  1NI9 A;  4H46 A;  4GX6 A;  1FBE A;  1KZ8 A;  5EQ9 A;  4P3L A;  4PDD A;  2F3D A;  5LTC A;  1IMD A;  4P8B A;  4GWZ A;  4N8G A;  1FPB A;  2L5V A;  2Y5L A;  4XEQ A;  5IZ1 A;  1LBY A;  4PAF A;  2XXK A;  4IR8 A;  2HHM A;  5T3J A;  1FTA A;  1FBC A;  4PBH A;  1NUW A;  4MHF A;  4OVQ A;  4I3Y A;  3KC1 A;  4GBW A;  1EYK A;  4MCO A;  1VDW A;  4YZZ A;  4PET A;  4FBP A;  1CNQ A;  4HE2 A;  2QFL A;  2DVZ A;  2KR0 A;  3E79 A;  3FXB A;  5LDZ A;  3RPL B;  5IZ3 A;  1DCU A;  2JJK A;  2ZZV A;  1KA0 A;  1IMA A;  1NUX A;  2WBD A;  5IGA A;  1NV7 A;  1Q9D A;  4GWU A;  5EYH A;  2OX3 A;  1FPK A;  1LBX A;  5EQA A;  4MNP A;  4GBV A;  2FIE A;  4N4U A;  3GYY A;  4N81 A;  1FBP A;  1K9Y A;  2Y5K A;  2QVU A;  5FBP A;  4GWW A;  4OVR A;  3U65 A;  4HCW A;  5CM6 A;  4PAI A;  1FBG A;  1LBZ A;  1FPJ A;  4PAK A;  1FJ6 A;  4XFE A;  3PTY A;  3RPL A;  3A29 A;  4NN3 A;  4PF8 A;  4PBQ A;  2XWO A;  3ROJ A;  4LN5 A;  4OA4 A;  1DK4 A;  1KA1 A;  2HZL A;  2WX9 A;  3IFC A;  3KBZ A;  5I7I A;  3T0J A;  1XI6 A;  4P47 A;  2KQZ A;  4I40 A;  3LV0 A;  1YZ0 A;  4OVT A;  1D9Q A;  2FIX A;  5F24 A;  4NX1 A;  4NG7 A;  3MST A;  1G0H A;  1FBF A;  2MKZ A;  3CHG A;  2BJI A;  2WBB A;  5IM2 A;  4HE0 A;  4O8M A;  5IZ3 B;  4PDH A;  2VPO A;  2CZH A;  2HZK A;  2F5X A;  2HXR A;  2CEX A;  4H45 A;  4JVD A;  1NV1 A;  2PFZ A;  1G0I A;  5DW8 A;  5EYG A;  2Q9T A;  2CZI A;  5IZZ A;  1FPL A;  1NV6 A;  3RYD A;  4PE3 A;  4UAB A;  3MYU A;  2PFY A;  2DE4 A;  4GWX A;  2P3N A;  4N8Y A;  3NOH A;  4N91 A;  1FPE A;  3W9V A;  4O7M A;  1IMF A;  2XWI A;  1K9Z A;  4GWS A;  3E78 A;  3D1R A;  4OAN A;  1IME A;  2B4M A;  4NHB A;  5ET7 A;  1SPI A;  1FBD A;  1FPG A;  4PCD A;  2DE2 A;  4NGU A;  2ZZX A;  1LEV A;  4AS4 A;  4P1E A;  4MX6 A;  5J16 A;  1QGX A;  1IMB A;  3ISP A;  2XA5 A;  2CEY A;  1NV2 A;  4PFR A;  5ET5 A;  3BIH A;  2QVR A;  4OVP A;  4X8R A;  1NUY A;  5ET6 A;  1NV0 A;  2QPQ A;  4QBA A;  3LUZ A;  1FPD A;  4X04 A;  4GX3 A;  2V4C A;  4N6D A;  4OVS A;  4NQ8 A;  2B4L A;  4PF6 A;  4P56 A;  2PCR A;  4MMP A;  4HE1 A;  3EKI A;  2GQ1 A;  4I3E A;  1JP4 A;  2VT5 A;  4MNC A;  5J1D A;  2R8T A;  1LBV A;  4HCY A;  4NAP A;  2WYP A;  4MEV A;  2DDK A;  1NV3 A;  4F1U A;  4F1V A;  4O7I A;  4HXV A;  2OWZ A;  1FBH A;  3BIG A;  4M1V A;  4MAG A;  2VPN A;  1DBZ A;  2ZZW A;  4X9T A;  5JK4 A;  4XF5 A;  2FBP A;  2V3Q A;  2FHY A;  5A5L A;  4PGP A;  2FVZ A;  2F3B A;  4DI3 D;  3IFA A;  1FJ9 A;  1IMC A;  4GWY A;  4DI4 B;  1FPF A;  4GX4 A;  1LBW A;  3QMF A;  4MJO A;  2XWV A;  4N17 A;  4P1L A;  5ESY A;  4AS5 A;  5I3S A;  2HPG A;  2CZK A;  4F19 A;  4MNI A;  4PGN A;  3T1B A;  2XWK A;  3W9W A;  4F18 A;  4P9K A;  4PTK A;  1INP A;  3HFU A;  2Q74 A;  1RDZ A;  1NUZ A;  4PFB A;  1EYJ A;  3KC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...