1I69A

Crystal structure of the reduced form of oxyr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
206
Chain Sequence
b'ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHSLRDQAMGFCFDTHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR
publication title Structural basis of the redox switch in the OxyR transcription factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 45
structure length 206
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i69A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i69A02
2OWSA 1EZPA 1JQFA 4RPNA 4IB2A 3TDJA 4NTLA 5A5XB 4YB6A 4R6KA 3TTLA 4ELRA 4RPOA 2ZNUA 4RNSA 1JW1A 3G3HA 2QJEA 1DPEA 3D4GA 2XXPA 1TFAA 3MAMA 2V3UA 4YB5A 4AQ4A 2RKMA 3T22A 4OFOA 1ZLQA 1A40A 1JVYA 1D4NA 3R7XA 3Q29A 4YKIA 3FJGA 4WEPA 4R2BA 3K4UA 3MVZA 2HXWA 3O6IA 1ZTYA 2O51A 1Z7ME 4UA8A 4KD5A 4LZ5A 1PB7A 2QSXA 2GRVA 4KI0E 4NWCA 3K6XA 3K6VA 1BLFA 1HSJA 1D9VA 1EZ9A 2YPNA 3GXAA 5FHMA 2XD3A 2REGA 3GBBA 4X1DA 4QSDA 5TP9B 2CZLA 3PMVA 4FEBA 4QFLA 4OXVA 3HV1A 3BBRA 4BDNA 3UGWA 3VVDA 4E0XA 3VLVA 5TPAB 2HEUA 1MQIA 4EUOA 4BDRA 1OIBA 2ZMBA 3S9MC 5H8HA 4F2OA 3FUZA 3DLNA 4MLVA 3EHTA 3N5LA 4H6DA 4GOTA 1QW0A 3MP1A 2PBWA 3VVFA 3VFJA 4GXAA 2I58A 4GF8A 1VE4A 3LSXA 1OQGA 2E0SA 2F7CA 1A55A 2DP8A 1MXVA 4C1TA 1B0LA 3HHGA 4F1YA 3OSRA 4JDFA 5F7VA 1PC3A 1MG1A 3T9VA 1XC1A 5CMKA 2O6AA 3PMXA 2YLNA 3U8QA 4GXSB 4F19A 2UYFA 1MXYA 3N6TA 5I58B 2RCAA 1TFDA 1SW4A 1VFDA 4AB6A 5L9MA 4C1UA 1LBBA 5JTYA 4H67A 2G29A 4OESA 2QS3A 1O7TA 4DDDA 2OJTA 5ITOA 4F3PA 1XVXA 3G3JA 5B7DA 1B58A 3FXUA 1II5A 4C0RA 2QL3A 4PFYA 1YCJA 4YICA 1MDP1 2P2AA 3KBRA 3GZGA 3S2VA 2RF1A 1DSNA 1CB6A 4QRZA 3IO6A 4RK2A 3TZAA 2DVZA 2XXWA 5I2KB 3QUFA 1LLSA 1I6BA 1UIUA 3K00A 4YKKA 1J1NA 1QVSA 4OHNA 4R9GA 4QHQA 3C36A 5EHMA 3KOSA 4ZEKA 1DMBA 3KZGA 3MJNA 4GIZA 4KYDA 4N07A 1N7WA 2F97A 1CE2A 5I59B 3RT6B 3K1NA 4M4GA 1VR5A 3LC8A 4OFLA 2B3BA 4R75A 3KG2A 3TMGA 3TQLA 4R73A 1JETA 3ECRA 4MLQA 2VD2A 4LZ7A 3RTWB 1QULA 2XD2A 1B1XA 1DTZA 3IOTA 1B3LA 3RQTA 1Y1MA 3S9NC 3CRBA 1IQ7A 4PETA 2Q8JA 3WAFA 3HPIA 5K2XA 1VFEA 3KEIA 3FD3A 4YB7A 3FV1A 3TYHA 4F3GA 3H3GA 4EXKA 3PD9A 2D21A 3QK6A 3LSWA 2IA4A 1IITA 2P1SA 1B7HA 1YAEA 1US4A 2F34A 4DCXA 3RT8A 3A09A 3TUSA 4RJZA 4LA9A 2BJJX 1MQJA 3T96B 4OQOA 2NOOA 4ELOA 1KWHA 5DEXB 3QIMA 1IXCA 1MH4A 1R9LA 3FV2A 4NE4A 3CIJA 4U1ZA 1FQEA 2QS2A 2FYIA 2NVUB 3RNNA 4LATA 4WKMA 3RTFB 5I57A 2NUVA 3VDFA 5H8HB 1BP5A 5BUUA 1LSTA 2DWHA 2V3QA 2VHAA 3VLUA 4BDQA 1SD3A 3PPOA 4X48A 1LFGA 3PMWA 2Y7RA 5CBRA 2ZNTA 3MC2A 4NF4A 2DQVA 4R72A 1XT8A 5AA2B 3UA8A 1NFTA 3SEUA 1LAFE 2RC8A 4MF3A 3IO4A 4O3CA 5KZTA 4DE8A 1NH7A 3E13X 4X1BA 3O2AA 4LP2B 2VD3A 2E1SA 3OENA 3GBAA 1S7YA 4GRKA 2VGQA 4F1UA 2PMSA 3U1OA 4E0WA 4F3BA 3U93A 1RKMA 5CC2A 4U22A 3DP6A 2A5TA 3UIFA 5AA1A 3V89B 4EQBA 5CI5A 4QFKA 3KN8A 1M5EA 1POY1 3DELB 4THIA 3KN7A 5K2YA 2F8DA 3I6VA 3TAJA 2HFBA 3O66A 1SDXA 3TELA 4OVJA 4ZS9A 4NEDA 1FTLA 4OYVA 5JTYB 3TQWA 1URGA 3FVGA 4OMBA 1ZU0A 4I1DA 1FQBA 3N94A 1Y4CA 1M5DA 1OLAA 1SW5A 1SYIA 1MY3A 1IIWA 4OENA 3S9EA 1B6HA 4QSCA 4IO5A 4HCWA 1AH5A 5I2NA 5FTIA 2DE2A 2V3TA 1FQAA 3VLWA 3PD8A 5KDTB 4PFTA 4RXLA 4YMAA 4P0GA 1A99A 3G3IA 4DXCA 1WVJA 2ZNSA 5L8DA 5H8QA 3W15C 3C4MA 2Y7WA 3IX1A 4F39A 5FHNA 1FQDA 2ABHA 3W9VA 3E3KA 3T9UA 1MH3A 1R9QA 4PE5B 1AIVA 4AB5A 1XS5A 1Q1KA 1RYXA 5IKBA 4R2FA 4I62A 1I69A 5ICQA 3FATA 3EQ1A 1B1HA 2GFEA 3MVYA 1MY2A 1UTBA 4K3FA 3M8UA 4QFPA 2UVJA 3K01A 2HCAA 1SI0A 3GLBA 3ZS6A 2XX9A 3IAZA 3E4RA 4H0WA 1FTJA 5FHOA 3JZJA 3C34A 3L6GA 3KN3A 2H99A 4OERA 5DTBA 3IOWA 3RGYA 3IB0A 4P0IA 3SESA 3TPAA 3OMBA 1B3HA 4U1OA 1QJMA 3M3KA 3IJXB 2F7BA 5IAIA 1B32A 4GLIA 3EN3A 4G8MA 4R6YA 4LQ5A 1IUDA 4ESWA 1B46A 4M1VA 4F1VA 5CBSA 4KCCA 4XKPA 1B7UA 3N26A 1USYH 2QMXA 3IOVA 1M5CA 3K6UA 4QSEA 3FZVA 4H1XA 4GQOA 3V83A 3BFTA 2ZYKA 1NL5A 3OO8A 4EQ7A 4IO6A 3VVEA 3H6TA 1US5A 2H98A 4FAJA 3OELA 4LZ8A 4JSDA 3UORA 1LBCA 1FW0A 3U92A 3BKIB 3TCHA 3P7IA 4OEVA 1NMUA 3B6QA 2F7AA 2YJPA 1JW5A 2XXVA 2F6PA 1D9YA 3SEWA 4ZEDA 1N3XA 3PPQA 1B5IA 4DZ1A 4DXUA 4KR5A 1HSEA 3G3GA 4Z0IA 3CI8A 1IXGA 3CSGA 2UYEA 1A8EA 3HN0A 1ANFA 3K0VA 4NF5B 2M8CA 4NF6A 1GVCA 2QS1A 3I3VA 1PB9A 1FTKA 4F2QA 4XKQA 3PUXE 1PBPA 2AIXA 3CR9A 1T0KA 4IO3A 1R1NA 3H6WA 2ONRA 5DYHA 2XXHA 1AL3A 4IO4A 2VOZA 2QS4A 2G93A 1B3EA 5ITPA 1SVXB 4YU0A 3LSLA 2DWAA 4ZEIA 5JK4A 2OBGA 2RCBA 3VXCA 2VP1A 4O3AA 5I2NB 2I3VA 2O68A 1ZJLA 4JB7A 2DE3A 3OSQA 4F22A 3R6UA 4FATA 1B52A 3IB2A 2Z8EA 2D3IA 4I8CA 3G3KA 1B5JA 3MP8A 2AL5A 3B7DA 2Q89A 3V5AA 5BWJA 5I56A 3RN8A 1NNTA 4R74A 3FVKA 4Q30B 4G68A 3OO9A 2B65A 1D3KA 2F78A 4YMBA 5A5XA 3HHFA 5DT6A 1ATGA 1MM6A 3G3FA 4KHZE 2OCUA 1XVYA 4EXLA 1UTBB 1PB8A 1P1QA 1H43A 4JWYA 4GFRA 3QSLA 2QPQA 2X26A 1YTVA 1DOTA 2I6EA 4KYEA 3OEKA 3ILUB 3MWBA 3U72A 4QFOA 3QAXA 5LOMA 1QUKA 2DE4A 1RYOA 2F5XA 4POXA 1P1UA 4IGRA 3USDA 1MDQA 1TT1A 2UXAA 3K2DA 4ZEBA 1HSLA 4FIMA 2I48A 5TP9A 2Y7PA 5J1DA 3RPWA 3M3FA 1EU8A 1DTGA 1MY1A 1P99A 3THIA 5KCJA 3IJOB 4O3BA 1OLCA 1LAXA 3FXRA 1MPDA 3VV5A 3PUZE 3CFXA 3O9PA 2HAUA 3K1PA 3O6GA 4N6PA 3IR1A 4FE8A 3TEPA 1IZ1A 3TTMA 3PPNA 3E9XA 4PFWA 3C32A 3HO7A 3Q28A 4KCDA 2PT2A 2PT1A 1O64A 1TWYA 3IB1A 1Y1ZA 5DVIA 3N6UA 1JEVA 4ZZAA 4ECFA 3Q25A 2O84X 3MZ1A 1GR2A 3FJ7A 1ELJA 3DP4A 4IO2A 1S50A 2H9BA 1DPPA 1MY4A 4XIGQ 1UIVA 4ND9A 4OZ9A 1PBQA 4U23A 1N84A 1POTA 1O63A 3VE1B 2O1MA 3KJ7A 2ZYOA 2DYXA 2O1LA 4HW8A 4XKNA 3O97A 2IEEA 2Z8DA 1AMFA 3H06B 4Z7EA 2XXIA 4F3SA 3PU5A 2AL4A 5I84A 1P1WA 5I58A 1LFIA 4MH5A 4OEUA 5TU0A 3FJMA 4H5FA 2Z22A 1N0TA 3MPLA 4BDMA 1LB9A 2AYSA 4NF8A 4DXBA 1P1NA 1URDA 3LR1A 3MW0A 4TQUQ 1JNFA 4EDPA 2Y84A 1N04A 1MM7A 3O6HA 3EHSA 1OMPA 1QUJA 1XOCA 4F18A 3OXNA 3H6UA 4JXIA 3WAEA 3OO7A 3Q27A 2O69A 4GD5A 3QUJA 4NMYA 3MVXA 2THIA 2RINA 5I2KA 4QFNA 5L9SA 4ZE8A 4ELPA 4LQ2A 2Y7KA 5H8SA 4ESXA 1USYE 2Q9TA 4KYSA 2D5WA 2ALUA 1UQWA 4GWOA 1MY0A 1IXIA 5JEIA 1SI1A 4YKPA 3U94A 3UP9A 4U4XA 5I59A 4F29A 3C9HA 4IGTA 1IEJA 2H5YA 2ZXTA 2I4BA 1N3WA 5ICTA 5B70A 1H76A 4X9TA 3BFUA 4FORA 1GGGA 3KSXA 5H8NA 4OTEA 2PYYA 5L9OA 3FIRA 3OEMA 2ONSA 3UN6A 3D4CA 2F6GA 4H8JA 1JEUA 4G68B 4RA1A 1MPBA 3PPPA 2I49A 3PUVE 1PEBA 1WDNA 1AOVA 4U21A 4U2RA 1XHYA 3R26A 3TTNA 4BLAA 1BTJA 2XX8A 1ZMGA 2OWTA 1JVXA 3IORA 3LUYA 1FCKA 1B2HA 4BDLA 3PV0E 2O7IA 1URSA 4MFIA 2RC9A 2FNCA 4ONYA 1MPCA 2X7QA 3ZKLA 4PP0A 3TTRA 3S4UA 2I3WA 1EZOA 1BIYA 4YAHX 1B3FA 3T93B 5AA3A 4P11A 3FVNA 3ODBA 5FTHA 5DEXA 5HM4B 3EPEA 1MQHA 4JWOA 3DP8A 3MZ9A 2QMWA 2HZKA 1QUIA 4XTCQ 1FTOA 4TLLB 2F36A 3A3UA 3EHUA 3TFLA 5KCJB 2V93A 2B3FA 1QKAA 2F35A 3RY3A 1I6AA 2ANJA 4HTGA 2I0CA 1SQYA 2XXXA 2XXYA 1WODA 3OOAA 1UTHA 5I57B 2V25A 1ZIUA 3MBPA 2XXRA 2DWIA 3DM0A 4JSOA 1QKBA 5AA2A 2DXRA 2GHBA 4DCYA 1Y3PA 5F1QA 2Z23A 3T66A 4XXUA 4NF4B 3TODA 2HQ0A 2Q88A 2Z8FA 1ZKBA 4RY1A 3K6WA 4GL0A 4H65A 2GH9A 3ILTB 4R6HA 4JWXA 3SETA 1MXZA 3FVOA 2W7YA 3SKPA 3CFZA 1GTKA 4G68C 2QRYA 5AE4A 2HAVA 1M5FA 2X7PA 1PDAA 2A5TB 4TLMB 3CG1A 3CSBA 2OLBA 5CRYA 2NXOA 2FA7A 3ZKKA 3MZBA 3RLFE 4WEDA 3F11A 4NF8B 4YKJA 3TKDA 2P0SA 3TCGA 4HCYA 4ISUA 3SEXA 5H8FA 2R9JA 3B6TA 2Y7IA 4OFJA 1YPNA 5AA4A 4UACA 1VSOA 4FECA 5KDTA 2GHAA 3VXBA 4JBZA 4KFQA 3OO6A 3LBSA 4IY6A 1N7XA 1B05A 5CM6A 5H8QB 3Q26A 1MXWA 1FQCA 4GL8A 1LAGE 3CG3A 4F31B 4ZDMA 4ZE9A 2XXTA 3SEVA 1EH3A 3QXMA 4G77A 4Q0CA 1LFHA 4KPTA 1ZBMA 1A7LA 2HZLA 4WXJA 3V8XB 4U4SA 3HSTA 4PFUA 4ZEFA 1B7ZA 1NNKA 3RUMA 4KQPA 1MQGA 1B4ZA 5H8NB 3CVGA 2I4CA 3PPRA 1H45A 1Y3QA 1MRPA 2XXUA 2ZYNA 3JYRA 5CMMA 2LAOA 1NNFA 1S9TA 3TTKA 1Q35A 4POWA 4IY5A 1R6ZA 4IO7A 2XHDA 1H44A 2OK2A 4H5GA 3ZSFA 3CFLA 1M5BA 3C33A 1TXFA 5DVFA 1NKXA 4EQ9A 3O28A 4G8NA 3IOUA 1FTMA 4Q8RA 1A8FA 1P1OA 2PVUA 3PUYE 2PX1A 5CMBA 1MQDA 3H4ZA 3MVWA 3K1MA 2CMOA 4QF9A 1SBPA 2DOJA 2R6GE 2DVCA 4PQJA 3MPKA 2WKYA 5CMCA 3MQ9A 3FXQA 4DIGA 3KSJA 5TPAA 3C31A 1H3DA 2RC7A 4OETA 4ZECA 1LCTA 1IXHA 1B5HA 4L17A 2ONKE 2REJA 3KJTA 3A3CA 1B51A 2UVHA 2V84A 4ZZEA 4N13A 4LONB 1B3GA 1JW4A 3G7WA 4YZZA 3IK6B 1OQHA 3M3LA 3ONMA 3UK4A 3S9LC 4I9DA 2H4IA 4LUBA 4H8IA 4RYAA 2UVIA 2OZZA 1NNPA 3OD7A 3K02A 1B9JA 1UTHB 1B0HA 1GV8A 4R9FA 1Y3NA 2Q2CA 3JV9A 4LVQA 2R71A 1SW2A 1N76A 3KFMA 1F9BA 3KOTA 1NH8A 1LCFA 4G4PA 3H03A 2DSFA 5M2VA 2H25A 3EF7A 2NWJA 4GVOA 4XKRA 4G8HA 3TCFA 5ELVA 4FEDA 3FASA 3PUWE 3LSFB 4G2ZA 4BDOA 4NF5A 1MS7A 3MP6A 2DWJA 3IL1B 2XXQA 1SYHA 4OWDA 5HPQA 1Z7NE 1L5TA 1FQFA 1MXXA 3PGFA 1OVTA 1A54A 5AA2D 4NWDA 4NF6B 4HS7A 3HCQA 5HBCA 4EF2A 1Y9UA 3C35A 3KGCA 2ZYMA 2DS9A 3W9WA 2Q2AA 2O7UA 1B40A 4EF1A 2A5SA 4RK9A 3T9XB 5EHSA 3FGSA 4ELQA 3T9HB 1LB8A 5H8FB 3SDFA 4TOZA 4FJPA 5AA4B 3H7MA 1OVBA 3QYTA 3AXFA 5ISUA 1Y4TA 1MXUA 2DXYA 3L6HA 2UVGA 2XX7A 3H6VA 4Q5TA 5EYFA 2ESNA 1I6QA 3MUQA 1SW1A 1Y20A 2I0BA 3SEYA 4MBPA 4DLDA 1LAHE 5DVJA 3B6WA 1BKAA 3O29A 5I56B 1B4HA 1LGBC 3I5OA 2KLFA 3SERA
chains in the Genus database with same CATH superfamily
1NV1A 2OWSA 1EZPA 1JQFA 4RPNA 4IB2A 3TDJA 4NTLA 1DCUA 5A5XB 4YB6A 4R6KA 3TTLA 4ELRA 4RPOA 2ZNUA 4RNSA 5DW8A 1JW1A 3G3HA 2QJEA 4LN5A 1DPEA 3D4GA 1IMBA 2XXPA 1TFAA 3MAMA 2V3UA 4YB5A 4AQ4A 2RKMA 3A29A 1FPJA 5ET8A 3T22A 4OFOA 3RPLB 1ZLQA 1A40A 3IFAA 1JVYA 1D4NA 3R7XA 3Q29A 4YKIA 3FJGA 4WEPA 4JVCA 4R2BA 3K4UA 3MVZA 1SPIA 1VDWA 2HXWA 3O6IA 1ZTYA 2O51A 1Z7ME 4UA8A 4KD5A 4LZ5A 1PB7A 2QSXA 4IR8A 2GRVA 4KI0E 4NWCA 3K6XA 3K6VA 1BLFA 3RYDA 1HSJA 1D9VA 1EZ9A 2YPNA 3GXAA 1FRPA 5FHMA 2XD3A 2REGA 4PGNA 3GBBA 4X1DA 4QSDA 5TP9B 2CZLA 3B50A 3PMVA 4FEBA 4QFLA 4OXVA 3HV1A 3BBRA 1FBGA 4BDNA 3UGWA 3VVDA 4E0XA 5EYHA 3VLVA 5TPAB 2HEUA 1MQIA 4EUOA 4BDRA 1OIBA 2ZMBA 3S9MC 5H8HA 4F2OA 3E78A 3FUZA 3DLNA 4MLVA 2FIEA 3EHTA 3N5LA 4H6DA 4GOTA 1QW0A 3MP1A 2PBWA 3VVFA 4MJOA 4I3EA 3VFJA 4GXAA 2I58A 4GF8A 1VE4A 3LSXA 1OQGA 2E0SA 4PTKA 2F7CA 1A55A 2DP8A 1MXVA 4C1TA 4AS5A 1B0LA 3HHGA 4F1YA 3OSRA 4OVRA 4JDFA 4PDHA 5F7VA 3GYYA 1PC3A 1YXIA 3KC1A 1MG1A 3T9VA 2CEYA 2HXRA 1XC1A 5CMKA 1NV6A 2O6AA 3PMXA 4NAPA 4PGPA 2YLNA 3U8QA 4GXSB 4F19A 2UYFA 1MXYA 3N6TA 5I58B 2RCAA 5I7IA 1TFDA 1SW4A 1VFDA 4AB6A 5L9MA 4C1UA 1LBBA 5JTYA 1FPIA 4H67A 2G29A 4OESA 2QS3A 1O7TA 4DDDA 5A5LA 2OJTA 5ITOA 4F3PA 1XVXA 3G3JA 5B7DA 1B58A 3FXUA 1II5A 4C0RA 2QL3A 4PFYA 3FXBA 4PF6A 5ESYA 1YCJA 4YICA 1NV0A 1KZ8A 1MDP1 4H45A 4DI4B 5EQ9A 1NUZA 2P2AA 3KBRA 3GZGA 3S2VA 2RF1A 4XEQA 1DSNA 5EYGA 1CB6A 4QRZA 3IO6A 4RK2A 3TZAA 2DVZA 2XXWA 5I2KB 3QUFA 1LLSA 4GWWA 1I6BA 1UIUA 3K00A 4YKKA 1J1NA 1QVSA 4OHNA 4R9GA 4QHQA 3C36A 5EHMA 3KOSA 4ZEKA 1DMBA 4PAIA 3KZGA 3SZPA 3MJNA 4GIZA 4KYDA 4N07A 1N7WA 2QVVA 1FBHA 2F97A 1CE2A 1RDZA 5I59B 3RT6B 3K1NA 4M4GA 1VR5A 1G0HA 3LC8A 4OFLA 2B3BA 4R75A 3KG2A 3TMGA 3TQLA 4R73A 1JETA 3ECRA 4HE1A 4MLQA 2VD2A 4PBHA 4LZ7A 3RTWB 1QULA 4PAFA 2XD2A 1B1XA 1DTZA 3IOTA 1B3LA 3RQTA 1Y1MA 4PE3A 3S9NC 4GWUA 3CRBA 1IQ7A 4PETA 2Q8JA 5FBPA 1YYZA 3WAFA 3HPIA 5K2XA 1VFEA 3KEIA 3FD3A 4YB7A 3FV1A 4P9KA 3TYHA 4F3GA 4JVIA 3H3GA 4EXKA 3PD9A 2D21A 4KXPA 3QK6A 3LSWA 2IA4A 2L5VA 1NI9A 1IITA 2P1SA 1B7HA 1YAEA 1US4A 2F34A 4DCXA 3RT8A 3A09A 3TUSA 4RJZA 4LA9A 2BJJX 1MQJA 3T96B 4OQOA 2NOOA 4ELOA 1KWHA 5DEXB 3QIMA 1IXCA 1MH4A 4OVSA 1R9LA 3FV2A 4NE4A 1NUWA 1FBCA 3CIJA 4U1ZA 1FQEA 2QS2A 2FYIA 2NVUB 3RNNA 4GX3A 4LATA 4WKMA 3RTFB 5I57A 2NUVA 5IGAA 3VDFA 5H8HB 1BP5A 5BUUA 1LSTA 2DWHA 2V3QA 2VHAA 3VLUA 4BDQA 1SD3A 3PPOA 4X48A 1LFGA 3PMWA 2Y7RA 5CBRA 2ZNTA 3MC2A 4NF4A 2DQVA 4R72A 1FTAA 1XT8A 5AA2B 3UA8A 1NFTA 3SEUA 1LAFE 2RC8A 4MF3A 3IO4A 4O3CA 5KZTA 4DE8A 1NH7A 3E13X 4X1BA 3O2AA 4LP2B 2VD3A 2E1SA 3OENA 3GBAA 1S7YA 4GRKA 2VGQA 4O8MA 2PMSA 4F1UA 3U1OA 4E0WA 4F3BA 3U93A 1RKMA 5CC2A 4U22A 5ET6A 3DP6A 2A5TA 3UIFA 5AA1A 3V89B 4MNIA 4EQBA 5CI5A 4QFKA 3KN8A 3QMFA 1M5EA 1POY1 3DELB 4THIA 3KN7A 5K2YA 3I6VA 2F8DA 1FBDA 3TAJA 1EYIA 2HFBA 3O66A 1SDXA 3TELA 4NG7A 4OVJA 4ZS9A 4NEDA 1FTLA 5LDZA 5IM2A 4GWYA 4OYVA 5JTYB 3TQWA 1URGA 3FVGA 4OMBA 1ZU0A 1LBWA 4I1DA 1FQBA 3N94A 1Y4CA 1M5DA 1OLAA 1SW5A 2FIXA 1SYIA 2OX3A 1MY3A 1IIWA 4OENA 4NX1A 3S9EA 1B6HA 4QSCA 4IO5A 4O7MA 4HCWA 1AH5A 4P3LA 5I2NA 5FTIA 2DE2A 2V3TA 1IMFA 1FQAA 3VLWA 3PD8A 5KDTB 4PFTA 4RXLA 4YMAA 4P0GA 1A99A 2R8TA 3G3IA 4DXCA 1WVJA 2ZNSA 5L8DA 5H8QA 1FPDA 3W15C 4MNCA 3C4MA 2Y7WA 3IX1A 4F39A 5FHNA 1FQDA 2ABHA 3W9VA 3E3KA 3T9UA 1MH3A 1R9QA 4PE5B 1AIVA 4AB5A 1XS5A 1Q1KA 1RYXA 1XI6A 5IKBA 4R2FA 4I62A 1I69A 4OVTA 5ICQA 3FATA 3EQ1A 4NF0A 1B1HA 2GFEA 3MVYA 1MY2A 1UTBA 4K3FA 3M8UA 4QFPA 2UVJA 3K01A 2HCAA 1SI0A 3GLBA 3ZS6A 2XX9A 1EYKA 3IAZA 1FPBA 3E4RA 4GWSA 4H0WA 1FTJA 5FHOA 3JZJA 3C34A 3L6GA 3KN3A 2H99A 4OERA 1FSAA 4PFBA 5DTBA 3IOWA 3RGYA 3IB0A 4P0IA 3SESA 3TPAA 3OMBA 1B3HA 4U1OA 1QJMA 3M3KA 3IJXB 2F7BA 5IAIA 1B32A 4GLIA 3EN3A 4G8MA 5EQ7A 4R6YA 4LQ5A 1IUDA 4ESWA 1B46A 4M1VA 4F1VA 5CBSA 4KCCA 4XKPA 1B7UA 4GX6A 3N26A 1USYH 4FBPA 2QMXA 3IOVA 1M5CA 4P8BA 2F3DA 3K6UA 4QSEA 3FZVA 4H1XA 4GQOA 2FVZA 3V83A 3BFTA 2ZYKA 1EYJA 1NL5A 1FBPA 2F3BA 4O94A 3OO8A 1IMDA 4EQ7A 4IO6A 3VVEA 3H6TA 1US5A 2H98A 4FAJA 3OELA 4LZ8A 4JSDA 3UORA 1LBCA 1FW0A 3U92A 3BKIB 5ET5A 3TCHA 4HXVA 1FPKA 3P7IA 4OEVA 1NMUA 1FPEA 3B6QA 2F7AA 2YJPA 1JW5A 2XXVA 2F6PA 1D9YA 3SEWA 4PAKA 4PF8A 4ZEDA 1N3XA 3PPQA 1B5IA 4DZ1A 4DXUA 1DBZA 4KR5A 1HSEA 3G3GA 1IMCA 4Z0IA 3CI8A 4MX6A 1IXGA 3BIGA 3CSGA 2WYPA 1G0IA 2B4LA 1K9YA 2UYEA 2PFZA 2XWKA 1A8EA 3HN0A 1ANFA 3K0VA 1RDYA 4NF5B 4PFRA 2M8CA 4NF6A 1GVCA 2QS1A 3I3VA 1PB9A 1FTKA 4XKQA 4N15A 4F2QA 2OWZA 4OA4A 3PUXE 1PBPA 2AIXA 3CR9A 2VPOA 4O7IA 4PFIA 1T0KA 4IO3A 1R1NA 3H6WA 2ONRA 5DYHA 2QVUA 2XXHA 1AL3A 1FJ6A 4IO4A 2VOZA 2WYKA 1JP4A 2QS4A 2G93A 1B3EA 5ITPA 1SVXB 4YU0A 5IZ3B 4OANA 3LSLA 2DWAA 4ZEIA 5JK4A 2OBGA 2RCBA 3VXCA 4P56A 2VP1A 4O3AA 5I2NB 2I3VA 2O68A 1ZJLA 4JB7A 2DE3A 3OSQA 4F22A 3R6UA 4FATA 1B52A 3IB2A 2Z8EA 2D3IA 4I8CA 3G3KA 2MKZA 1B5JA 3MP8A 4XFEA 2AL5A 3B7DA 2Q89A 3V5AA 5BWJA 1D9QA 5I56A 3RN8A 4G61A 1NNTA 4R74A 3FVKA 4Q30B 3HFUA 4G68A 3OO9A 2XXKA 2B65A 1D3KA 2F78A 4YMBA 5A5XA 3HHFA 5DT6A 1ATGA 1MM6A 3G3FA 4KHZE 2OCUA 1XVYA 4EXLA 4P1EA 1UTBB 5LTCA 1PB8A 1P1QA 1H43A 4JWYA 2VPNA 4GFRA 3QSLA 2QPQA 2X26A 3RPLA 2HHMA 1LBZA 1YTVA 1DOTA 2I6EA 4KYEA 3OEKA 3ILUB 3MWBA 3U72A 4QFOA 4MCOA 5ET7A 3QAXA 5LOMA 1QUKA 1LBXA 2DE4A 1RYOA 2F5XA 4POXA 1P1UA 4IGRA 1NV7A 4N81A 3USDA 1MDQA 1TT1A 2UXAA 3K2DA 4HE2A 4ZEBA 1HSLA 4FIMA 4OVQA 2I48A 5TP9A 2Y7PA 2P3VA 5J1DA 1IMEA 3RPWA 1FPGA 3M3FA 1EU8A 3FBPA 1DK4A 1DTGA 1MY1A 1P99A 3THIA 5KCJA 3IJOB 4O3BA 1OLCA 1LAXA 3FXRA 5F24A 3EKIA 1MPDA 2WBBA 3VV5A 3PUZE 3CFXA 1YZ0A 3O9PA 4N91A 2HAUA 2FHYA 3K1PA 3O6GA 4N6PA 3IR1A 4FE8A 3TEPA 1IZ1A 3TTMA 3PPNA 3E9XA 1RDXA 4PFWA 3C32A 3HO7A 3Q28A 4KCDA 4NN3A 2PT2A 2PT1A 1O64A 1TWYA 3IB1A 1Y1ZA 5T3JA 5DVIA 3N6UA 1JEVA 4ZZAA 4ECFA 3Q25A 2O84X 3MZ1A 1GR2A 3FJ7A 1ELJA 3DP4A 4IO2A 1S50A 2H9BA 1DPPA 1MY4A 4XIGQ 1UIVA 4ND9A 4OZ9A 4PCDA 1PBQA 5J16A 4U23A 1N84A 1POTA 1O63A 3VE1B 4OVPA 2O1MA 3KJ7A 2CZHA 2ZYOA 2XWIA 2DYXA 2O1LA 4HW8A 4XKNA 3O97A 2IEEA 2Z8DA 1AMFA 3H06B 4Z7EA 2XXIA 4F3SA 3PU5A 2AL4A 5I84A 1P1WA 4GWZA 5I58A 1LFIA 4MH5A 4OEUA 5TU0A 3FJMA 1NV5A 4H5FA 2Z22A 1N0TA 3MPLA 4BDMA 1LB9A 2AYSA 4NF8A 4DXBA 1P1NA 1URDA 3LR1A 3MW0A 4TQUQ 1JNFA 2DDKA 4EDPA 2B4MA 2Y84A 1N04A 1MM7A 3O6HA 3EHSA 1OMPA 1QUJA 1XOCA 4F18A 3OXNA 3H6UA 2WX9A 5EQ8A 4JXIA 3WAEA 3OO7A 3Q27A 2O69A 1IMAA 4GD5A 3QUJA 4NMYA 3MVXA 2THIA 2RINA 5I2KA 4QFNA 5L9SA 4ZE8A 4ELPA 4LQ2A 2Y7KA 5H8SA 4ESXA 1USYE 2Q9TA 2ZZWA 4KYSA 3CHGA 2D5WA 2ALUA 2ZZXA 1UQWA 4GWOA 5IZZA 1MY0A 1IXIA 5JEIA 5IZ1A 1SI1A 4YKPA 3U94A 3UP9A 4U4XA 5I59A 4F29A 3C9HA 4IGTA 1LBVA 1IEJA 2H5YA 2ZXTA 2I4BA 1N3WA 5ICTA 5B70A 1H76A 3T0JA 4X9TA 3ROJA 3BFUA 1CNQA 4FORA 1GGGA 3KSXA 5H8NA 4OTEA 2PYYA 5L9OA 3FIRA 2CZKA 1FPFA 3OEMA 2ONSA 4GX4A 3UN6A 3D4CA 2F6GA 4H8JA 1JEUA 4G68B 4RA1A 1MPBA 5I5PA 3PPPA 2I49A 3PUVE 1PEBA 1WDNA 1AOVA 4U21A 4MAGA 4U2RA 3KC0A 4MIJA 2FBPA 1XHYA 3R26A 3TTNA 3NOHA 2WBDA 4BLAA 1BTJA 2XX8A 1ZMGA 2OWTA 1JVXA 3IORA 3LUYA 1FCKA 1B2HA 4BDLA 3PV0E 2O7IA 4GBWA 1URSA 4MFIA 1NUXA 2RC9A 2FNCA 1KA1A 2CEXA 4ONYA 1MPCA 2X7QA 3ZKLA 4PP0A 3TTRA 3S4UA 2I3WA 2Q8MA 1EZOA 1BIYA 4YAHX 1B3FA 2PCRA 3T93B 5AA3A 4P11A 3FVNA 3ODBA 5FTHA 5DEXA 5HM4B 4DI3D 2KQZA 3EPEA 1FJ9A 2Y5KA 1MQHA 4JWOA 3DP8A 3MZ9A 2QMWA 2HZKA 1QUIA 4XTCQ 1FTOA 4TLLB 2F36A 2QFLA 4JVDA 3A3UA 3EHUA 3TFLA 5KCJB 2V93A 2B3FA 1QKAA 2F35A 3RY3A 1I6AA 2ANJA 4HTGA 2I0CA 3KBZA 1SQYA 2XXXA 2XXYA 4N6DA 1WODA 3OOAA 1UTHA 5I57B 1NV2A 2V25A 1ZIUA 3MBPA 1AWBA 2XXRA 3D1RA 2DWIA 3DM0A 4JSOA 1QKBA 5AA2A 2DXRA 2GHBA 4DCYA 1Y3PA 1KA0A 5F1QA 1K9ZA 2Z23A 3T66A 4XXUA 4NF4B 1FBEA 3TODA 2HQ0A 2Q88A 2Z8FA 1ZKBA 4RY1A 3K6WA 3E79A 4I40A 1QGXA 4GL0A 4H65A 2GH9A 3ILTB 4X04A 1NUYA 4R6HA 4JWXA 2VT5A 3SETA 1MXZA 3FVOA 2W7YA 3SKPA 3CFZA 1GTKA 4G68C 2QRYA 5AE4A 2HAVA 1M5FA 3B8BA 2XWVA 2X7PA 1PDAA 2A5TB 4TLMB 3CG1A 3CSBA 2OLBA 5CRYA 2NXOA 4N8GA 2FA7A 1LBYA 3ZKKA 3MZBA 3RLFE 3MSTA 4WEDA 4MHFA 3F11A 4NF8B 4YKJA 4P1LA 3TKDA 2P0SA 4PDDA 3TCGA 4HCYA 4H46A 4ISUA 3SEXA 5H8FA 2R9JA 3B6TA 2Y7IA 4OFJA 1YPNA 5AA4A 4UACA 1VSOA 4FECA 5KDTA 2GHAA 4GBVA 3VXBA 4JBZA 4KFQA 3OO6A 2JJKA 3LBSA 4N4UA 2P3NA 4IY6A 1N7XA 1B05A 5CM6A 4HE0A 5H8QB 3Q26A 5I3SA 1MXWA 1FQCA 4GL8A 1LAGE 3CG3A 4F31B 4ZDMA 4ZE9A 2XXTA 3SEVA 1EH3A 3QXMA 4G77A 4Q0CA 1LFHA 4KPTA 1ZBMA 1A7LA 2HZLA 4N8YA 4WXJA 3V8XB 4U4SA 3HSTA 4PFUA 4ZEFA 1B7ZA 1NNKA 3RUMA 4KQPA 1MQGA 1B4ZA 4MEVA 5H8NB 3CVGA 2I4CA 3PPRA 1H45A 1Y3QA 1MRPA 2XXUA 2ZYNA 3JYRA 5CMMA 2LAOA 1NNFA 1S9TA 3TTKA 1Q35A 4POWA 1BK4A 1R6ZA 4IY5A 4IO7A 2XHDA 3PTYA 4XF5A 1H44A 2OK2A 4H5GA 3ZSFA 3CFLA 1M5BA 3C33A 4NGUA 1TXFA 5DVFA 1NKXA 4EQ9A 3O28A 1NV4A 4G8NA 3IOUA 2V4CA 3BIHA 3U65A 1FTMA 4Q8RA 3ISPA 1A8FA 1P1OA 2PVUA 3PUYE 2PX1A 5CMBA 1MQDA 3H4ZA 3MVWA 3K1MA 2CMOA 4QF9A 2BJIA 1SBPA 2DOJA 2R6GE 4NQ8A 2DVCA 4PQJA 3MPKA 2WKYA 2KR0A 3MYUA 5CMCA 3MQ9A 3FXQA 4DIGA 3KSJA 5TPAA 3C31A 1H3DA 2RC7A 4OETA 4ZECA 1LCTA 1IXHA 4QXDA 1B5HA 4L17A 2ONKE 2REJA 3KJTA 3A3CA 1B51A 2UVHA 2V84A 4ZZEA 4N13A 4LONB 4N17A 1B3GA 4MMPA 1JW4A 3G7WA 4YZZA 3IK6B 1OQHA 3M3LA 2Q74A 3ONMA 3UK4A 3S9LC 4I9DA 2H4IA 4LUBA 4H8IA 2GQ1A 4MNPA 4RYAA 2XWOA 2UVIA 2OZZA 1NNPA 3OD7A 3K02A 1B9JA 1UTHB 1B0HA 1GV8A 4R9FA 1Y3NA 4AS4A 2Q2CA 3LUZA 3JV9A 4LVQA 1INPA 1LEVA 1FBFA 2R71A 1SW2A 2HPGA 4X8RA 1N76A 3KFMA 4NHBA 4PBQA 1F9BA 3KOTA 1NH8A 1LCFA 4G4PA 3H03A 2DSFA 5M2VA 2H25A 3EF7A 2NWJA 4GVOA 4XKRA 4G8HA 3TCFA 5ELVA 2CZIA 4FEDA 3FASA 3PUWE 3LSFB 4G2ZA 4BDOA 2XA5A 4NF5A 1MS7A 2QVRA 3MP6A 2DWJA 3IL1B 2XXQA 1SYHA 4OWDA 5HPQA 1Z7NE 4GWXA 1L5TA 1FQFA 1MXXA 3PGFA 4QBAA 1OVTA 1A54A 5AA2D 4NWDA 4NF6B 2WEFA 4HS7A 3HCQA 4I3YA 5HBCA 4N6KA 4UABA 4EF2A 1Y9UA 3LV0A 3T1BA 2PFYA 3C35A 3KGCA 2ZYMA 2Y5LA 2DS9A 3W9WA 2Q2AA 2O7UA 1B40A 4EF1A 2A5SA 4RK9A 3T9XB 5EHSA 3FGSA 4ELQA 3T9HB 1LB8A 5IZ3A 5H8FB 2ZZVA 3SDFA 4TOZA 4FJPA 5AA4B 3H7MA 1OVBA 4PC9A 3QYTA 3AXFA 5ISUA 1Y4TA 1MXUA 2DXYA 3L6HA 2UVGA 5EQAA 2XX7A 3H6VA 4Q5TA 5EYFA 2ESNA 1I6QA 3MUQA 1SW1A 1Y20A 2I0BA 3SEYA 4MBPA 4DLDA 4P47A 1NV3A 1LAHE 5DVJA 3B6WA 1BKAA 3O29A 5I56B 1B4HA 1FPLA 1LGBC 1Q9DA 3I5OA 2KLFA 3IFCA 3SERA
chains in the Genus database with same CATH topology
2OWSA 1EZPA 1JQFA 4RPNA 4IB2A 3TDJA 4NTLA 5A5XB 4YB6A 4R6KA 3TTLA 4ELRA 4RPOA 2ZNUA 4RNSA 1JW1A 3G3HA 2QJEA 1DPEA 3D4GA 2XXPA 1TFAA 3MAMA 2V3UA 4YB5A 4AQ4A 2RKMA 3T22A 4OFOA 1ZLQA 1A40A 1JVYA 1D4NA 3R7XA 3Q29A 4YKIA 3FJGA 4WEPA 4R2BA 3K4UA 3MVZA 2HXWA 3O6IA 1ZTYA 2O51A 1Z7ME 4UA8A 4KD5A 4LZ5A 1PB7A 2QSXA 2GRVA 4KI0E 4NWCA 3K6XA 3K6VA 1BLFA 1HSJA 1D9VA 1EZ9A 2YPNA 3GXAA 5FHMA 2XD3A 2REGA 3GBBA 4X1DA 4QSDA 5TP9B 2CZLA 3PMVA 4FEBA 4QFLA 4OXVA 3HV1A 3BBRA 4BDNA 3UGWA 3VVDA 4E0XA 3VLVA 5TPAB 2HEUA 1MQIA 4EUOA 4BDRA 1OIBA 2ZMBA 3S9MC 5H8HA 4F2OA 3FUZA 3DLNA 4MLVA 3EHTA 3N5LA 4H6DA 4GOTA 1QW0A 3MP1A 2PBWA 3VVFA 3VFJA 4GXAA 2I58A 4GF8A 1VE4A 3LSXA 1OQGA 2E0SA 2F7CA 1A55A 2DP8A 1MXVA 4C1TA 1B0LA 3HHGA 4F1YA 3OSRA 4JDFA 5F7VA 1PC3A 1MG1A 3T9VA 1XC1A 5CMKA 2O6AA 3PMXA 2YLNA 3U8QA 4GXSB 4F19A 2UYFA 1MXYA 3N6TA 5I58B 2RCAA 1TFDA 1SW4A 1VFDA 4AB6A 5L9MA 4C1UA 1LBBA 5JTYA 4H67A 2G29A 4OESA 2QS3A 1O7TA 4DDDA 2OJTA 5ITOA 4F3PA 1XVXA 3G3JA 5B7DA 1B58A 3FXUA 1II5A 4C0RA 2QL3A 4PFYA 1YCJA 4YICA 1MDP1 2P2AA 3KBRA 3GZGA 3S2VA 2RF1A 1DSNA 1CB6A 4QRZA 3IO6A 4RK2A 3TZAA 2DVZA 2XXWA 5I2KB 3QUFA 1LLSA 1I6BA 1UIUA 3K00A 4YKKA 1J1NA 1QVSA 4OHNA 4R9GA 4QHQA 3C36A 5EHMA 3KOSA 4ZEKA 1DMBA 3KZGA 3MJNA 4GIZA 4KYDA 4N07A 1N7WA 2F97A 1CE2A 5I59B 3RT6B 3K1NA 4M4GA 1VR5A 3LC8A 4OFLA 2B3BA 4R75A 3KG2A 3TMGA 3TQLA 4R73A 1JETA 3ECRA 4MLQA 2VD2A 4LZ7A 3RTWB 1QULA 2XD2A 1B1XA 1DTZA 3IOTA 1B3LA 3RQTA 1Y1MA 3S9NC 3CRBA 1IQ7A 4PETA 2Q8JA 3WAFA 3HPIA 5K2XA 1VFEA 3KEIA 3FD3A 4YB7A 3FV1A 3TYHA 4F3GA 3H3GA 4EXKA 3PD9A 2D21A 3QK6A 3LSWA 2IA4A 1IITA 2P1SA 1B7HA 1YAEA 1US4A 2F34A 4DCXA 3RT8A 3A09A 3TUSA 4RJZA 4LA9A 2BJJX 1MQJA 3T96B 4OQOA 2NOOA 4ELOA 1KWHA 5DEXB 3QIMA 1IXCA 1MH4A 1R9LA 3FV2A 4NE4A 3CIJA 4U1ZA 1FQEA 2QS2A 2FYIA 2NVUB 3RNNA 4LATA 4WKMA 3RTFB 5I57A 2NUVA 3VDFA 5H8HB 1BP5A 5BUUA 1LSTA 2DWHA 2V3QA 2VHAA 3VLUA 4BDQA 1SD3A 3PPOA 4X48A 1LFGA 3PMWA 2Y7RA 5CBRA 2ZNTA 3MC2A 4NF4A 2DQVA 4R72A 1XT8A 5AA2B 3UA8A 1NFTA 3SEUA 1LAFE 2RC8A 4MF3A 3IO4A 4O3CA 5KZTA 4DE8A 1NH7A 3E13X 4X1BA 3O2AA 4LP2B 2VD3A 2E1SA 3OENA 3GBAA 1S7YA 4GRKA 2VGQA 4F1UA 2PMSA 3U1OA 4E0WA 4F3BA 3U93A 1RKMA 5CC2A 4U22A 3DP6A 2A5TA 3UIFA 5AA1A 3V89B 4EQBA 5CI5A 4QFKA 3KN8A 1M5EA 1POY1 3DELB 4THIA 3KN7A 5K2YA 2F8DA 3I6VA 3TAJA 2HFBA 3O66A 1SDXA 3TELA 4OVJA 4ZS9A 4NEDA 1FTLA 4OYVA 5JTYB 3TQWA 1URGA 3FVGA 4OMBA 1ZU0A 4I1DA 1FQBA 3N94A 1Y4CA 1M5DA 1OLAA 1SW5A 1SYIA 1MY3A 1IIWA 4OENA 3S9EA 1B6HA 4QSCA 4IO5A 4HCWA 1AH5A 5I2NA 5FTIA 2DE2A 2V3TA 1FQAA 3VLWA 3PD8A 5KDTB 4PFTA 4RXLA 4YMAA 4P0GA 1A99A 3G3IA 4DXCA 1WVJA 2ZNSA 5L8DA 5H8QA 3W15C 3C4MA 2Y7WA 3IX1A 4F39A 5FHNA 1FQDA 2ABHA 3W9VA 3E3KA 3T9UA 1MH3A 1R9QA 4PE5B 1AIVA 4AB5A 1XS5A 1Q1KA 1RYXA 5IKBA 4R2FA 4I62A 1I69A 5ICQA 3FATA 3EQ1A 1B1HA 2GFEA 3MVYA 1MY2A 1UTBA 4K3FA 3M8UA 4QFPA 2UVJA 3K01A 2HCAA 1SI0A 3GLBA 3ZS6A 2XX9A 3IAZA 3E4RA 4H0WA 1FTJA 5FHOA 3JZJA 3C34A 3L6GA 3KN3A 2H99A 4OERA 5DTBA 3IOWA 3RGYA 3IB0A 4P0IA 3SESA 3TPAA 3OMBA 1B3HA 4U1OA 1QJMA 3M3KA 3IJXB 2F7BA 5IAIA 1B32A 4GLIA 3EN3A 4G8MA 4R6YA 4LQ5A 1IUDA 4ESWA 1B46A 4M1VA 4F1VA 5CBSA 4KCCA 4XKPA 1B7UA 3N26A 1USYH 2QMXA 3IOVA 1M5CA 3K6UA 4QSEA 3FZVA 4H1XA 4GQOA 3V83A 3BFTA 2ZYKA 1NL5A 3OO8A 4EQ7A 4IO6A 3VVEA 3H6TA 1US5A 2H98A 4FAJA 3OELA 4LZ8A 4JSDA 3UORA 1LBCA 1FW0A 3U92A 3BKIB 3TCHA 3P7IA 4OEVA 1NMUA 3B6QA 2F7AA 2YJPA 1JW5A 2XXVA 2F6PA 1D9YA 3SEWA 4ZEDA 1N3XA 3PPQA 1B5IA 4DZ1A 4DXUA 4KR5A 1HSEA 3G3GA 4Z0IA 3CI8A 1IXGA 3CSGA 2UYEA 1A8EA 3HN0A 1ANFA 3K0VA 4NF5B 2M8CA 4NF6A 1GVCA 2QS1A 3I3VA 1PB9A 1FTKA 4F2QA 4XKQA 3PUXE 1PBPA 2AIXA 3CR9A 1T0KA 4IO3A 1R1NA 3H6WA 2ONRA 5DYHA 2XXHA 1AL3A 4IO4A 2VOZA 2QS4A 2G93A 1B3EA 5ITPA 1SVXB 4YU0A 3LSLA 2DWAA 4ZEIA 5JK4A 2OBGA 2RCBA 3VXCA 2VP1A 4O3AA 5I2NB 2I3VA 2O68A 1ZJLA 4JB7A 2DE3A 3OSQA 4F22A 3R6UA 4FATA 1B52A 3IB2A 2Z8EA 2D3IA 4I8CA 3G3KA 1B5JA 3MP8A 2AL5A 3B7DA 2Q89A 3V5AA 5BWJA 5I56A 3RN8A 1NNTA 4R74A 3FVKA 4Q30B 4G68A 3OO9A 2B65A 1D3KA 2F78A 4YMBA 5A5XA 3HHFA 5DT6A 1ATGA 1MM6A 3G3FA 4KHZE 2OCUA 1XVYA 4EXLA 1UTBB 1PB8A 1P1QA 1H43A 4JWYA 4GFRA 3QSLA 2QPQA 2X26A 1YTVA 1DOTA 2I6EA 4KYEA 3OEKA 3ILUB 3MWBA 3U72A 4QFOA 3QAXA 5LOMA 1QUKA 2DE4A 1RYOA 2F5XA 4POXA 1P1UA 4IGRA 3USDA 1MDQA 1TT1A 2UXAA 3K2DA 4ZEBA 1HSLA 4FIMA 2I48A 5TP9A 2Y7PA 5J1DA 3RPWA 3M3FA 1EU8A 1DTGA 1MY1A 1P99A 3THIA 5KCJA 3IJOB 4O3BA 1OLCA 1LAXA 3FXRA 1MPDA 3VV5A 3PUZE 3CFXA 3O9PA 2HAUA 3K1PA 3O6GA 4N6PA 3IR1A 4FE8A 3TEPA 1IZ1A 3TTMA 3PPNA 3E9XA 4PFWA 3C32A 3HO7A 3Q28A 4KCDA 2PT2A 2PT1A 1O64A 1TWYA 3IB1A 1Y1ZA 5DVIA 3N6UA 1JEVA 4ZZAA 4ECFA 3Q25A 2O84X 3MZ1A 1GR2A 3FJ7A 1ELJA 3DP4A 4IO2A 1S50A 2H9BA 1DPPA 1MY4A 4XIGQ 1UIVA 4ND9A 4OZ9A 1PBQA 4U23A 1N84A 1POTA 1O63A 3VE1B 2O1MA 3KJ7A 2ZYOA 2DYXA 2O1LA 4HW8A 4XKNA 3O97A 2IEEA 2Z8DA 1AMFA 3H06B 4Z7EA 2XXIA 4F3SA 3PU5A 2AL4A 5I84A 1P1WA 5I58A 1LFIA 4MH5A 4OEUA 5TU0A 3FJMA 4H5FA 2Z22A 1N0TA 3MPLA 4BDMA 1LB9A 2AYSA 4NF8A 4DXBA 1P1NA 1URDA 3LR1A 3MW0A 4TQUQ 1JNFA 4EDPA 2Y84A 1N04A 1MM7A 3O6HA 3EHSA 1OMPA 1QUJA 1XOCA 4F18A 3OXNA 3H6UA 4JXIA 3WAEA 3OO7A 3Q27A 2O69A 4GD5A 3QUJA 4NMYA 3MVXA 2THIA 2RINA 5I2KA 4QFNA 5L9SA 4ZE8A 4ELPA 4LQ2A 2Y7KA 5H8SA 4ESXA 1USYE 2Q9TA 4KYSA 2D5WA 2ALUA 1UQWA 4GWOA 1MY0A 1IXIA 5JEIA 1SI1A 4YKPA 3U94A 3UP9A 4U4XA 5I59A 4F29A 3C9HA 4IGTA 1IEJA 2H5YA 2ZXTA 2I4BA 1N3WA 5ICTA 5B70A 1H76A 4X9TA 3BFUA 4FORA 1GGGA 3KSXA 5H8NA 4OTEA 2PYYA 5L9OA 3FIRA 3OEMA 2ONSA 3UN6A 3D4CA 2F6GA 4H8JA 1JEUA 4G68B 4RA1A 1MPBA 3PPPA 2I49A 3PUVE 1PEBA 1WDNA 1AOVA 4U21A 4U2RA 1XHYA 3R26A 3TTNA 4BLAA 1BTJA 2XX8A 1ZMGA 2OWTA 1JVXA 3IORA 3LUYA 1FCKA 1B2HA 4BDLA 3PV0E 2O7IA 1URSA 4MFIA 2RC9A 2FNCA 4ONYA 1MPCA 2X7QA 3ZKLA 4PP0A 3TTRA 3S4UA 2I3WA 1EZOA 1BIYA 4YAHX 1B3FA 3T93B 5AA3A 4P11A 3FVNA 3ODBA 5FTHA 5DEXA 5HM4B 3EPEA 1MQHA 4JWOA 3DP8A 3MZ9A 2QMWA 2HZKA 1QUIA 4XTCQ 1FTOA 4TLLB 2F36A 3A3UA 3EHUA 3TFLA 5KCJB 2V93A 2B3FA 1QKAA 2F35A 3RY3A 1I6AA 2ANJA 4HTGA 2I0CA 1SQYA 2XXXA 2XXYA 1WODA 3OOAA 1UTHA 5I57B 2V25A 1ZIUA 3MBPA 2XXRA 2DWIA 3DM0A 4JSOA 1QKBA 5AA2A 2DXRA 2GHBA 4DCYA 1Y3PA 5F1QA 2Z23A 3T66A 4XXUA 4NF4B 3TODA 2HQ0A 2Q88A 2Z8FA 1ZKBA 4RY1A 3K6WA 4GL0A 4H65A 2GH9A 3ILTB 4R6HA 4JWXA 3SETA 1MXZA 3FVOA 2W7YA 3SKPA 3CFZA 1GTKA 4G68C 2QRYA 5AE4A 2HAVA 1M5FA 2X7PA 1PDAA 2A5TB 4TLMB 3CG1A 3CSBA 2OLBA 5CRYA 2NXOA 2FA7A 3ZKKA 3MZBA 3RLFE 4WEDA 3F11A 4NF8B 4YKJA 3TKDA 2P0SA 3TCGA 4HCYA 4ISUA 3SEXA 5H8FA 2R9JA 3B6TA 2Y7IA 4OFJA 1YPNA 5AA4A 4UACA 1VSOA 4FECA 5KDTA 2GHAA 3VXBA 4JBZA 4KFQA 3OO6A 3LBSA 4IY6A 1N7XA 1B05A 5CM6A 5H8QB 3Q26A 1MXWA 1FQCA 4GL8A 1LAGE 3CG3A 4F31B 4ZDMA 4ZE9A 2XXTA 3SEVA 1EH3A 3QXMA 4G77A 4Q0CA 1LFHA 4KPTA 1ZBMA 1A7LA 2HZLA 4WXJA 3V8XB 4U4SA 3HSTA 4PFUA 4ZEFA 1B7ZA 1NNKA 3RUMA 4KQPA 1MQGA 1B4ZA 5H8NB 3CVGA 2I4CA 3PPRA 1H45A 1Y3QA 1MRPA 2XXUA 2ZYNA 3JYRA 5CMMA 2LAOA 1NNFA 1S9TA 3TTKA 1Q35A 4POWA 4IY5A 1R6ZA 4IO7A 2XHDA 1H44A 2OK2A 4H5GA 3ZSFA 3CFLA 1M5BA 3C33A 1TXFA 5DVFA 1NKXA 4EQ9A 3O28A 4G8NA 3IOUA 1FTMA 4Q8RA 1A8FA 1P1OA 2PVUA 3PUYE 2PX1A 5CMBA 1MQDA 3H4ZA 3MVWA 3K1MA 2CMOA 4QF9A 1SBPA 2DOJA 2R6GE 2DVCA 4PQJA 3MPKA 2WKYA 5CMCA 3MQ9A 3FXQA 4DIGA 3KSJA 5TPAA 3C31A 1H3DA 2RC7A 4OETA 4ZECA 1LCTA 1IXHA 1B5HA 4L17A 2ONKE 2REJA 3KJTA 3A3CA 1B51A 2UVHA 2V84A 4ZZEA 4N13A 4LONB 1B3GA 1JW4A 3G7WA 4YZZA 3IK6B 1OQHA 3M3LA 3ONMA 3UK4A 3S9LC 4I9DA 2H4IA 4LUBA 4H8IA 4RYAA 2UVIA 2OZZA 1NNPA 3OD7A 3K02A 1B9JA 1UTHB 1B0HA 1GV8A 4R9FA 1Y3NA 2Q2CA 3JV9A 4LVQA 2R71A 1SW2A 1N76A 3KFMA 1F9BA 3KOTA 1NH8A 1LCFA 4G4PA 3H03A 2DSFA 5M2VA 2H25A 3EF7A 2NWJA 4GVOA 4XKRA 4G8HA 3TCFA 5ELVA 4FEDA 3FASA 3PUWE 3LSFB 4G2ZA 4BDOA 4NF5A 1MS7A 3MP6A 2DWJA 3IL1B 2XXQA 1SYHA 4OWDA 5HPQA 1Z7NE 1L5TA 1FQFA 1MXXA 3PGFA 1OVTA 1A54A 5AA2D 4NWDA 4NF6B 4HS7A 3HCQA 5HBCA 4EF2A 1Y9UA 3C35A 3KGCA 2ZYMA 2DS9A 3W9WA 2Q2AA 2O7UA 1B40A 4EF1A 2A5SA 4RK9A 3T9XB 5EHSA 3FGSA 4ELQA 3T9HB 1LB8A 5H8FB 3SDFA 4TOZA 4FJPA 5AA4B 3H7MA 1OVBA 3QYTA 3AXFA 5ISUA 1Y4TA 1MXUA 2DXYA 3L6HA 2UVGA 2XX7A 3H6VA 4Q5TA 5EYFA 2ESNA 1I6QA 3MUQA 1SW1A 1Y20A 2I0BA 3SEYA 4MBPA 4DLDA 1LAHE 5DVJA 3B6WA 1BKAA 3O29A 5I56B 1B4HA 1LGBC 3I5OA 2KLFA 3SERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWS A;  1EZP A;  1JQF A;  4RPN A;  4IB2 A;  3TDJ A;  4NTL A;  5A5X B;  4YB6 A;  4R6K A;  3TTL A;  4ELR A;  4RPO A;  2ZNU A;  4RNS A;  1JW1 A;  3G3H A;  2QJE A;  1DPE A;  3D4G A;  2XXP A;  1TFA A;  3MAM A;  2V3U A;  4YB5 A;  4AQ4 A;  2RKM A;  3T22 A;  4OFO A;  1ZLQ A;  1A40 A;  1JVY A;  1D4N A;  3R7X A;  3Q29 A;  4YKI A;  3FJG A;  4WEP A;  4R2B A;  3K4U A;  3MVZ A;  2HXW A;  3O6I A;  1ZTY A;  2O51 A;  1Z7M E;  4UA8 A;  4KD5 A;  4LZ5 A;  1PB7 A;  2QSX A;  2GRV A;  4KI0 E;  4NWC A;  3K6X A;  3K6V A;  1BLF A;  1HSJ A;  1D9V A;  1EZ9 A;  2YPN A;  3GXA A;  5FHM A;  2XD3 A;  2REG A;  3GBB A;  4X1D A;  4QSD A;  5TP9 B;  2CZL A;  3PMV A;  4FEB A;  4QFL A;  4OXV A;  3HV1 A;  3BBR A;  4BDN A;  3UGW A;  3VVD A;  4E0X A;  3VLV A;  5TPA B;  2HEU A;  1MQI A;  4EUO A;  4BDR A;  1OIB A;  2ZMB A;  3S9M C;  5H8H A;  4F2O A;  3FUZ A;  3DLN A;  4MLV A;  3EHT A;  3N5L A;  4H6D A;  4GOT A;  1QW0 A;  3MP1 A;  2PBW A;  3VVF A;  3VFJ A;  4GXA A;  2I58 A;  4GF8 A;  1VE4 A;  3LSX A;  1OQG A;  2E0S A;  2F7C A;  1A55 A;  2DP8 A;  1MXV A;  4C1T A;  1B0L A;  3HHG A;  4F1Y A;  3OSR A;  4JDF A;  5F7V A;  1PC3 A;  1MG1 A;  3T9V A;  1XC1 A;  5CMK A;  2O6A A;  3PMX A;  2YLN A;  3U8Q A;  4GXS B;  4F19 A;  2UYF A;  1MXY A;  3N6T A;  5I58 B;  2RCA A;  1TFD A;  1SW4 A;  1VFD A;  4AB6 A;  5L9M A;  4C1U A;  1LBB A;  5JTY A;  4H67 A;  2G29 A;  4OES A;  2QS3 A;  1O7T A;  4DDD A;  2OJT A;  5ITO A;  4F3P A;  1XVX A;  3G3J A;  5B7D A;  1B58 A;  3FXU A;  1II5 A;  4C0R A;  2QL3 A;  4PFY A;  1YCJ A;  4YIC A;  1MDP 1;  2P2A A;  3KBR A;  3GZG A;  3S2V A;  2RF1 A;  1DSN A;  1CB6 A;  4QRZ A;  3IO6 A;  4RK2 A;  3TZA A;  2DVZ A;  2XXW A;  5I2K B;  3QUF A;  1LLS A;  1I6B A;  1UIU A;  3K00 A;  4YKK A;  1J1N A;  1QVS A;  4OHN A;  4R9G A;  4QHQ A;  3C36 A;  5EHM A;  3KOS A;  4ZEK A;  1DMB A;  3KZG A;  3MJN A;  4GIZ A;  4KYD A;  4N07 A;  1N7W A;  2F97 A;  1CE2 A;  5I59 B;  3RT6 B;  3K1N A;  4M4G A;  1VR5 A;  3LC8 A;  4OFL A;  2B3B A;  4R75 A;  3KG2 A;  3TMG A;  3TQL A;  4R73 A;  1JET A;  3ECR A;  4MLQ A;  2VD2 A;  4LZ7 A;  3RTW B;  1QUL A;  2XD2 A;  1B1X A;  1DTZ A;  3IOT A;  1B3L A;  3RQT A;  1Y1M A;  3S9N C;  3CRB A;  1IQ7 A;  4PET A;  2Q8J A;  3WAF A;  3HPI A;  5K2X A;  1VFE A;  3KEI A;  3FD3 A;  4YB7 A;  3FV1 A;  3TYH A;  4F3G A;  3H3G A;  4EXK A;  3PD9 A;  2D21 A;  3QK6 A;  3LSW A;  2IA4 A;  1IIT A;  2P1S A;  1B7H A;  1YAE A;  1US4 A;  2F34 A;  4DCX A;  3RT8 A;  3A09 A;  3TUS A;  4RJZ A;  4LA9 A;  2BJJ X;  1MQJ A;  3T96 B;  4OQO A;  2NOO A;  4ELO A;  1KWH A;  5DEX B;  3QIM A;  1IXC A;  1MH4 A;  1R9L A;  3FV2 A;  4NE4 A;  3CIJ A;  4U1Z A;  1FQE A;  2QS2 A;  2FYI A;  2NVU B;  3RNN A;  4LAT A;  4WKM A;  3RTF B;  5I57 A;  2NUV A;  3VDF A;  5H8H B;  1BP5 A;  5BUU A;  1LST A;  2DWH A;  2V3Q A;  2VHA A;  3VLU A;  4BDQ A;  1SD3 A;  3PPO A;  4X48 A;  1LFG A;  3PMW A;  2Y7R A;  5CBR A;  2ZNT A;  3MC2 A;  4NF4 A;  2DQV A;  4R72 A;  1XT8 A;  5AA2 B;  3UA8 A;  1NFT A;  3SEU A;  1LAF E;  2RC8 A;  4MF3 A;  3IO4 A;  4O3C A;  5KZT A;  4DE8 A;  1NH7 A;  3E13 X;  4X1B A;  3O2A A;  4LP2 B;  2VD3 A;  2E1S A;  3OEN A;  3GBA A;  1S7Y A;  4GRK A;  2VGQ A;  4F1U A;  2PMS A;  3U1O A;  4E0W A;  4F3B A;  3U93 A;  1RKM A;  5CC2 A;  4U22 A;  3DP6 A;  2A5T A;  3UIF A;  5AA1 A;  3V89 B;  4EQB A;  5CI5 A;  4QFK A;  3KN8 A;  1M5E A;  1POY 1;  3DEL B;  4THI A;  3KN7 A;  5K2Y A;  2F8D A;  3I6V A;  3TAJ A;  2HFB A;  3O66 A;  1SDX A;  3TEL A;  4OVJ A;  4ZS9 A;  4NED A;  1FTL A;  4OYV A;  5JTY B;  3TQW A;  1URG A;  3FVG A;  4OMB A;  1ZU0 A;  4I1D A;  1FQB A;  3N94 A;  1Y4C A;  1M5D A;  1OLA A;  1SW5 A;  1SYI A;  1MY3 A;  1IIW A;  4OEN A;  3S9E A;  1B6H A;  4QSC A;  4IO5 A;  4HCW A;  1AH5 A;  5I2N A;  5FTI A;  2DE2 A;  2V3T A;  1FQA A;  3VLW A;  3PD8 A;  5KDT B;  4PFT A;  4RXL A;  4YMA A;  4P0G A;  1A99 A;  3G3I A;  4DXC A;  1WVJ A;  2ZNS A;  5L8D A;  5H8Q A;  3W15 C;  3C4M A;  2Y7W A;  3IX1 A;  4F39 A;  5FHN A;  1FQD A;  2ABH A;  3W9V A;  3E3K A;  3T9U A;  1MH3 A;  1R9Q A;  4PE5 B;  1AIV A;  4AB5 A;  1XS5 A;  1Q1K A;  1RYX A;  5IKB A;  4R2F A;  4I62 A;  1I69 A;  5ICQ A;  3FAT A;  3EQ1 A;  1B1H A;  2GFE A;  3MVY A;  1MY2 A;  1UTB A;  4K3F A;  3M8U A;  4QFP A;  2UVJ A;  3K01 A;  2HCA A;  1SI0 A;  3GLB A;  3ZS6 A;  2XX9 A;  3IAZ A;  3E4R A;  4H0W A;  1FTJ A;  5FHO A;  3JZJ A;  3C34 A;  3L6G A;  3KN3 A;  2H99 A;  4OER A;  5DTB A;  3IOW A;  3RGY A;  3IB0 A;  4P0I A;  3SES A;  3TPA A;  3OMB A;  1B3H A;  4U1O A;  1QJM A;  3M3K A;  3IJX B;  2F7B A;  5IAI A;  1B32 A;  4GLI A;  3EN3 A;  4G8M A;  4R6Y A;  4LQ5 A;  1IUD A;  4ESW A;  1B46 A;  4M1V A;  4F1V A;  5CBS A;  4KCC A;  4XKP A;  1B7U A;  3N26 A;  1USY H;  2QMX A;  3IOV A;  1M5C A;  3K6U A;  4QSE A;  3FZV A;  4H1X A;  4GQO A;  3V83 A;  3BFT A;  2ZYK A;  1NL5 A;  3OO8 A;  4EQ7 A;  4IO6 A;  3VVE A;  3H6T A;  1US5 A;  2H98 A;  4FAJ A;  3OEL A;  4LZ8 A;  4JSD A;  3UOR A;  1LBC A;  1FW0 A;  3U92 A;  3BKI B;  3TCH A;  3P7I A;  4OEV A;  1NMU A;  3B6Q A;  2F7A A;  2YJP A;  1JW5 A;  2XXV A;  2F6P A;  1D9Y A;  3SEW A;  4ZED A;  1N3X A;  3PPQ A;  1B5I A;  4DZ1 A;  4DXU A;  4KR5 A;  1HSE A;  3G3G A;  4Z0I A;  3CI8 A;  1IXG A;  3CSG A;  2UYE A;  1A8E A;  3HN0 A;  1ANF A;  3K0V A;  4NF5 B;  2M8C A;  4NF6 A;  1GVC A;  2QS1 A;  3I3V A;  1PB9 A;  1FTK A;  4F2Q A;  4XKQ A;  3PUX E;  1PBP A;  2AIX A;  3CR9 A;  1T0K A;  4IO3 A;  1R1N A;  3H6W A;  2ONR A;  5DYH A;  2XXH A;  1AL3 A;  4IO4 A;  2VOZ A;  2QS4 A;  2G93 A;  1B3E A;  5ITP A;  1SVX B;  4YU0 A;  3LSL A;  2DWA A;  4ZEI A;  5JK4 A;  2OBG A;  2RCB A;  3VXC A;  2VP1 A;  4O3A A;  5I2N B;  2I3V A;  2O68 A;  1ZJL A;  4JB7 A;  2DE3 A;  3OSQ A;  4F22 A;  3R6U A;  4FAT A;  1B52 A;  3IB2 A;  2Z8E A;  2D3I A;  4I8C A;  3G3K A;  1B5J A;  3MP8 A;  2AL5 A;  3B7D A;  2Q89 A;  3V5A A;  5BWJ A;  5I56 A;  3RN8 A;  1NNT A;  4R74 A;  3FVK A;  4Q30 B;  4G68 A;  3OO9 A;  2B65 A;  1D3K A;  2F78 A;  4YMB A;  5A5X A;  3HHF A;  5DT6 A;  1ATG A;  1MM6 A;  3G3F A;  4KHZ E;  2OCU A;  1XVY A;  4EXL A;  1UTB B;  1PB8 A;  1P1Q A;  1H43 A;  4JWY A;  4GFR A;  3QSL A;  2QPQ A;  2X26 A;  1YTV A;  1DOT A;  2I6E A;  4KYE A;  3OEK A;  3ILU B;  3MWB A;  3U72 A;  4QFO A;  3QAX A;  5LOM A;  1QUK A;  2DE4 A;  1RYO A;  2F5X A;  4POX A;  1P1U A;  4IGR A;  3USD A;  1MDQ A;  1TT1 A;  2UXA A;  3K2D A;  4ZEB A;  1HSL A;  4FIM A;  2I48 A;  5TP9 A;  2Y7P A;  5J1D A;  3RPW A;  3M3F A;  1EU8 A;  1DTG A;  1MY1 A;  1P99 A;  3THI A;  5KCJ A;  3IJO B;  4O3B A;  1OLC A;  1LAX A;  3FXR A;  1MPD A;  3VV5 A;  3PUZ E;  3CFX A;  3O9P A;  2HAU A;  3K1P A;  3O6G A;  4N6P A;  3IR1 A;  4FE8 A;  3TEP A;  1IZ1 A;  3TTM A;  3PPN A;  3E9X A;  4PFW A;  3C32 A;  3HO7 A;  3Q28 A;  4KCD A;  2PT2 A;  2PT1 A;  1O64 A;  1TWY A;  3IB1 A;  1Y1Z A;  5DVI A;  3N6U A;  1JEV A;  4ZZA A;  4ECF A;  3Q25 A;  2O84 X;  3MZ1 A;  1GR2 A;  3FJ7 A;  1ELJ A;  3DP4 A;  4IO2 A;  1S50 A;  2H9B A;  1DPP A;  1MY4 A;  4XIG Q;  1UIV A;  4ND9 A;  4OZ9 A;  1PBQ A;  4U23 A;  1N84 A;  1POT A;  1O63 A;  3VE1 B;  2O1M A;  3KJ7 A;  2ZYO A;  2DYX A;  2O1L A;  4HW8 A;  4XKN A;  3O97 A;  2IEE A;  2Z8D A;  1AMF A;  3H06 B;  4Z7E A;  2XXI A;  4F3S A;  3PU5 A;  2AL4 A;  5I84 A;  1P1W A;  5I58 A;  1LFI A;  4MH5 A;  4OEU A;  5TU0 A;  3FJM A;  4H5F A;  2Z22 A;  1N0T A;  3MPL A;  4BDM A;  1LB9 A;  2AYS A;  4NF8 A;  4DXB A;  1P1N A;  1URD A;  3LR1 A;  3MW0 A;  4TQU Q;  1JNF A;  4EDP A;  2Y84 A;  1N04 A;  1MM7 A;  3O6H A;  3EHS A;  1OMP A;  1QUJ A;  1XOC A;  4F18 A;  3OXN A;  3H6U A;  4JXI A;  3WAE A;  3OO7 A;  3Q27 A;  2O69 A;  4GD5 A;  3QUJ A;  4NMY A;  3MVX A;  2THI A;  2RIN A;  5I2K A;  4QFN A;  5L9S A;  4ZE8 A;  4ELP A;  4LQ2 A;  2Y7K A;  5H8S A;  4ESX A;  1USY E;  2Q9T A;  4KYS A;  2D5W A;  2ALU A;  1UQW A;  4GWO A;  1MY0 A;  1IXI A;  5JEI A;  1SI1 A;  4YKP A;  3U94 A;  3UP9 A;  4U4X A;  5I59 A;  4F29 A;  3C9H A;  4IGT A;  1IEJ A;  2H5Y A;  2ZXT A;  2I4B A;  1N3W A;  5ICT A;  5B70 A;  1H76 A;  4X9T A;  3BFU A;  4FOR A;  1GGG A;  3KSX A;  5H8N A;  4OTE A;  2PYY A;  5L9O A;  3FIR A;  3OEM A;  2ONS A;  3UN6 A;  3D4C A;  2F6G A;  4H8J A;  1JEU A;  4G68 B;  4RA1 A;  1MPB A;  3PPP A;  2I49 A;  3PUV E;  1PEB A;  1WDN A;  1AOV A;  4U21 A;  4U2R A;  1XHY A;  3R26 A;  3TTN A;  4BLA A;  1BTJ A;  2XX8 A;  1ZMG A;  2OWT A;  1JVX A;  3IOR A;  3LUY A;  1FCK A;  1B2H A;  4BDL A;  3PV0 E;  2O7I A;  1URS A;  4MFI A;  2RC9 A;  2FNC A;  4ONY A;  1MPC A;  2X7Q A;  3ZKL A;  4PP0 A;  3TTR A;  3S4U A;  2I3W A;  1EZO A;  1BIY A;  4YAH X;  1B3F A;  3T93 B;  5AA3 A;  4P11 A;  3FVN A;  3ODB A;  5FTH A;  5DEX A;  5HM4 B;  3EPE A;  1MQH A;  4JWO A;  3DP8 A;  3MZ9 A;  2QMW A;  2HZK A;  1QUI A;  4XTC Q;  1FTO A;  4TLL B;  2F36 A;  3A3U A;  3EHU A;  3TFL A;  5KCJ B;  2V93 A;  2B3F A;  1QKA A;  2F35 A;  3RY3 A;  1I6A A;  2ANJ A;  4HTG A;  2I0C A;  1SQY A;  2XXX A;  2XXY A;  1WOD A;  3OOA A;  1UTH A;  5I57 B;  2V25 A;  1ZIU A;  3MBP A;  2XXR A;  2DWI A;  3DM0 A;  4JSO A;  1QKB A;  5AA2 A;  2DXR A;  2GHB A;  4DCY A;  1Y3P A;  5F1Q A;  2Z23 A;  3T66 A;  4XXU A;  4NF4 B;  3TOD A;  2HQ0 A;  2Q88 A;  2Z8F A;  1ZKB A;  4RY1 A;  3K6W A;  4GL0 A;  4H65 A;  2GH9 A;  3ILT B;  4R6H A;  4JWX A;  3SET A;  1MXZ A;  3FVO A;  2W7Y A;  3SKP A;  3CFZ A;  1GTK A;  4G68 C;  2QRY A;  5AE4 A;  2HAV A;  1M5F A;  2X7P A;  1PDA A;  2A5T B;  4TLM B;  3CG1 A;  3CSB A;  2OLB A;  5CRY A;  2NXO A;  2FA7 A;  3ZKK A;  3MZB A;  3RLF E;  4WED A;  3F11 A;  4NF8 B;  4YKJ A;  3TKD A;  2P0S A;  3TCG A;  4HCY A;  4ISU A;  3SEX A;  5H8F A;  2R9J A;  3B6T A;  2Y7I A;  4OFJ A;  1YPN A;  5AA4 A;  4UAC A;  1VSO A;  4FEC A;  5KDT A;  2GHA A;  3VXB A;  4JBZ A;  4KFQ A;  3OO6 A;  3LBS A;  4IY6 A;  1N7X A;  1B05 A;  5CM6 A;  5H8Q B;  3Q26 A;  1MXW A;  1FQC A;  4GL8 A;  1LAG E;  3CG3 A;  4F31 B;  4ZDM A;  4ZE9 A;  2XXT A;  3SEV A;  1EH3 A;  3QXM A;  4G77 A;  4Q0C A;  1LFH A;  4KPT A;  1ZBM A;  1A7L A;  2HZL A;  4WXJ A;  3V8X B;  4U4S A;  3HST A;  4PFU A;  4ZEF A;  1B7Z A;  1NNK A;  3RUM A;  4KQP A;  1MQG A;  1B4Z A;  5H8N B;  3CVG A;  2I4C A;  3PPR A;  1H45 A;  1Y3Q A;  1MRP A;  2XXU A;  2ZYN A;  3JYR A;  5CMM A;  2LAO A;  1NNF A;  1S9T A;  3TTK A;  1Q35 A;  4POW A;  4IY5 A;  1R6Z A;  4IO7 A;  2XHD A;  1H44 A;  2OK2 A;  4H5G A;  3ZSF A;  3CFL A;  1M5B A;  3C33 A;  1TXF A;  5DVF A;  1NKX A;  4EQ9 A;  3O28 A;  4G8N A;  3IOU A;  1FTM A;  4Q8R A;  1A8F A;  1P1O A;  2PVU A;  3PUY E;  2PX1 A;  5CMB A;  1MQD A;  3H4Z A;  3MVW A;  3K1M A;  2CMO A;  4QF9 A;  1SBP A;  2DOJ A;  2R6G E;  2DVC A;  4PQJ A;  3MPK A;  2WKY A;  5CMC A;  3MQ9 A;  3FXQ A;  4DIG A;  3KSJ A;  5TPA A;  3C31 A;  1H3D A;  2RC7 A;  4OET A;  4ZEC A;  1LCT A;  1IXH A;  1B5H A;  4L17 A;  2ONK E;  2REJ A;  3KJT A;  3A3C A;  1B51 A;  2UVH A;  2V84 A;  4ZZE A;  4N13 A;  4LON B;  1B3G A;  1JW4 A;  3G7W A;  4YZZ A;  3IK6 B;  1OQH A;  3M3L A;  3ONM A;  3UK4 A;  3S9L C;  4I9D A;  2H4I A;  4LUB A;  4H8I A;  4RYA A;  2UVI A;  2OZZ A;  1NNP A;  3OD7 A;  3K02 A;  1B9J A;  1UTH B;  1B0H A;  1GV8 A;  4R9F A;  1Y3N A;  2Q2C A;  3JV9 A;  4LVQ A;  2R71 A;  1SW2 A;  1N76 A;  3KFM A;  1F9B A;  3KOT A;  1NH8 A;  1LCF A;  4G4P A;  3H03 A;  2DSF A;  5M2V A;  2H25 A;  3EF7 A;  2NWJ A;  4GVO A;  4XKR A;  4G8H A;  3TCF A;  5ELV A;  4FED A;  3FAS A;  3PUW E;  3LSF B;  4G2Z A;  4BDO A;  4NF5 A;  1MS7 A;  3MP6 A;  2DWJ A;  3IL1 B;  2XXQ A;  1SYH A;  4OWD A;  5HPQ A;  1Z7N E;  1L5T A;  1FQF A;  1MXX A;  3PGF A;  1OVT A;  1A54 A;  5AA2 D;  4NWD A;  4NF6 B;  4HS7 A;  3HCQ A;  5HBC A;  4EF2 A;  1Y9U A;  3C35 A;  3KGC A;  2ZYM A;  2DS9 A;  3W9W A;  2Q2A A;  2O7U A;  1B40 A;  4EF1 A;  2A5S A;  4RK9 A;  3T9X B;  5EHS A;  3FGS A;  4ELQ A;  3T9H B;  1LB8 A;  5H8F B;  3SDF A;  4TOZ A;  4FJP A;  5AA4 B;  3H7M A;  1OVB A;  3QYT A;  3AXF A;  5ISU A;  1Y4T A;  1MXU A;  2DXY A;  3L6H A;  2UVG A;  2XX7 A;  3H6V A;  4Q5T A;  5EYF A;  2ESN A;  1I6Q A;  3MUQ A;  1SW1 A;  1Y20 A;  2I0B A;  3SEY A;  4MBP A;  4DLD A;  1LAH E;  5DVJ A;  3B6W A;  1BKA A;  3O29 A;  5I56 B;  1B4H A;  1LGB C;  3I5O A;  2KLF A;  3SER A; 
#chains in the Genus database with same CATH topology
 1NV1 A;  2OWS A;  1EZP A;  1JQF A;  4RPN A;  4IB2 A;  3TDJ A;  4NTL A;  1DCU A;  5A5X B;  4YB6 A;  4R6K A;  3TTL A;  4ELR A;  4RPO A;  2ZNU A;  4RNS A;  5DW8 A;  1JW1 A;  3G3H A;  2QJE A;  4LN5 A;  1DPE A;  3D4G A;  1IMB A;  2XXP A;  1TFA A;  3MAM A;  2V3U A;  4YB5 A;  4AQ4 A;  2RKM A;  3A29 A;  1FPJ A;  5ET8 A;  3T22 A;  4OFO A;  3RPL B;  1ZLQ A;  1A40 A;  3IFA A;  1JVY A;  1D4N A;  3R7X A;  3Q29 A;  4YKI A;  3FJG A;  4WEP A;  4JVC A;  4R2B A;  3K4U A;  3MVZ A;  1SPI A;  1VDW A;  2HXW A;  3O6I A;  1ZTY A;  2O51 A;  1Z7M E;  4UA8 A;  4KD5 A;  4LZ5 A;  1PB7 A;  2QSX A;  4IR8 A;  2GRV A;  4KI0 E;  4NWC A;  3K6X A;  3K6V A;  1BLF A;  3RYD A;  1HSJ A;  1D9V A;  1EZ9 A;  2YPN A;  3GXA A;  1FRP A;  5FHM A;  2XD3 A;  2REG A;  4PGN A;  3GBB A;  4X1D A;  4QSD A;  5TP9 B;  2CZL A;  3B50 A;  3PMV A;  4FEB A;  4QFL A;  4OXV A;  3HV1 A;  3BBR A;  1FBG A;  4BDN A;  3UGW A;  3VVD A;  4E0X A;  5EYH A;  3VLV A;  5TPA B;  2HEU A;  1MQI A;  4EUO A;  4BDR A;  1OIB A;  2ZMB A;  3S9M C;  5H8H A;  4F2O A;  3E78 A;  3FUZ A;  3DLN A;  4MLV A;  2FIE A;  3EHT A;  3N5L A;  4H6D A;  4GOT A;  1QW0 A;  3MP1 A;  2PBW A;  3VVF A;  4MJO A;  4I3E A;  3VFJ A;  4GXA A;  2I58 A;  4GF8 A;  1VE4 A;  3LSX A;  1OQG A;  2E0S A;  4PTK A;  2F7C A;  1A55 A;  2DP8 A;  1MXV A;  4C1T A;  4AS5 A;  1B0L A;  3HHG A;  4F1Y A;  3OSR A;  4OVR A;  4JDF A;  4PDH A;  5F7V A;  3GYY A;  1PC3 A;  1YXI A;  3KC1 A;  1MG1 A;  3T9V A;  2CEY A;  2HXR A;  1XC1 A;  5CMK A;  1NV6 A;  2O6A A;  3PMX A;  4NAP A;  4PGP A;  2YLN A;  3U8Q A;  4GXS B;  4F19 A;  2UYF A;  1MXY A;  3N6T A;  5I58 B;  2RCA A;  5I7I A;  1TFD A;  1SW4 A;  1VFD A;  4AB6 A;  5L9M A;  4C1U A;  1LBB A;  5JTY A;  1FPI A;  4H67 A;  2G29 A;  4OES A;  2QS3 A;  1O7T A;  4DDD A;  5A5L A;  2OJT A;  5ITO A;  4F3P A;  1XVX A;  3G3J A;  5B7D A;  1B58 A;  3FXU A;  1II5 A;  4C0R A;  2QL3 A;  4PFY A;  3FXB A;  4PF6 A;  5ESY A;  1YCJ A;  4YIC A;  1NV0 A;  1KZ8 A;  1MDP 1;  4H45 A;  4DI4 B;  5EQ9 A;  1NUZ A;  2P2A A;  3KBR A;  3GZG A;  3S2V A;  2RF1 A;  4XEQ A;  1DSN A;  5EYG A;  1CB6 A;  4QRZ A;  3IO6 A;  4RK2 A;  3TZA A;  2DVZ A;  2XXW A;  5I2K B;  3QUF A;  1LLS A;  4GWW A;  1I6B A;  1UIU A;  3K00 A;  4YKK A;  1J1N A;  1QVS A;  4OHN A;  4R9G A;  4QHQ A;  3C36 A;  5EHM A;  3KOS A;  4ZEK A;  1DMB A;  4PAI A;  3KZG A;  3SZP A;  3MJN A;  4GIZ A;  4KYD A;  4N07 A;  1N7W A;  2QVV A;  1FBH A;  2F97 A;  1CE2 A;  1RDZ A;  5I59 B;  3RT6 B;  3K1N A;  4M4G A;  1VR5 A;  1G0H A;  3LC8 A;  4OFL A;  2B3B A;  4R75 A;  3KG2 A;  3TMG A;  3TQL A;  4R73 A;  1JET A;  3ECR A;  4HE1 A;  4MLQ A;  2VD2 A;  4PBH A;  4LZ7 A;  3RTW B;  1QUL A;  4PAF A;  2XD2 A;  1B1X A;  1DTZ A;  3IOT A;  1B3L A;  3RQT A;  1Y1M A;  4PE3 A;  3S9N C;  4GWU A;  3CRB A;  1IQ7 A;  4PET A;  2Q8J A;  5FBP A;  1YYZ A;  3WAF A;  3HPI A;  5K2X A;  1VFE A;  3KEI A;  3FD3 A;  4YB7 A;  3FV1 A;  4P9K A;  3TYH A;  4F3G A;  4JVI A;  3H3G A;  4EXK A;  3PD9 A;  2D21 A;  4KXP A;  3QK6 A;  3LSW A;  2IA4 A;  2L5V A;  1NI9 A;  1IIT A;  2P1S A;  1B7H A;  1YAE A;  1US4 A;  2F34 A;  4DCX A;  3RT8 A;  3A09 A;  3TUS A;  4RJZ A;  4LA9 A;  2BJJ X;  1MQJ A;  3T96 B;  4OQO A;  2NOO A;  4ELO A;  1KWH A;  5DEX B;  3QIM A;  1IXC A;  1MH4 A;  4OVS A;  1R9L A;  3FV2 A;  4NE4 A;  1NUW A;  1FBC A;  3CIJ A;  4U1Z A;  1FQE A;  2QS2 A;  2FYI A;  2NVU B;  3RNN A;  4GX3 A;  4LAT A;  4WKM A;  3RTF B;  5I57 A;  2NUV A;  5IGA A;  3VDF A;  5H8H B;  1BP5 A;  5BUU A;  1LST A;  2DWH A;  2V3Q A;  2VHA A;  3VLU A;  4BDQ A;  1SD3 A;  3PPO A;  4X48 A;  1LFG A;  3PMW A;  2Y7R A;  5CBR A;  2ZNT A;  3MC2 A;  4NF4 A;  2DQV A;  4R72 A;  1FTA A;  1XT8 A;  5AA2 B;  3UA8 A;  1NFT A;  3SEU A;  1LAF E;  2RC8 A;  4MF3 A;  3IO4 A;  4O3C A;  5KZT A;  4DE8 A;  1NH7 A;  3E13 X;  4X1B A;  3O2A A;  4LP2 B;  2VD3 A;  2E1S A;  3OEN A;  3GBA A;  1S7Y A;  4GRK A;  2VGQ A;  4O8M A;  2PMS A;  4F1U A;  3U1O A;  4E0W A;  4F3B A;  3U93 A;  1RKM A;  5CC2 A;  4U22 A;  5ET6 A;  3DP6 A;  2A5T A;  3UIF A;  5AA1 A;  3V89 B;  4MNI A;  4EQB A;  5CI5 A;  4QFK A;  3KN8 A;  3QMF A;  1M5E A;  1POY 1;  3DEL B;  4THI A;  3KN7 A;  5K2Y A;  3I6V A;  2F8D A;  1FBD A;  3TAJ A;  1EYI A;  2HFB A;  3O66 A;  1SDX A;  3TEL A;  4NG7 A;  4OVJ A;  4ZS9 A;  4NED A;  1FTL A;  5LDZ A;  5IM2 A;  4GWY A;  4OYV A;  5JTY B;  3TQW A;  1URG A;  3FVG A;  4OMB A;  1ZU0 A;  1LBW A;  4I1D A;  1FQB A;  3N94 A;  1Y4C A;  1M5D A;  1OLA A;  1SW5 A;  2FIX A;  1SYI A;  2OX3 A;  1MY3 A;  1IIW A;  4OEN A;  4NX1 A;  3S9E A;  1B6H A;  4QSC A;  4IO5 A;  4O7M A;  4HCW A;  1AH5 A;  4P3L A;  5I2N A;  5FTI A;  2DE2 A;  2V3T A;  1IMF A;  1FQA A;  3VLW A;  3PD8 A;  5KDT B;  4PFT A;  4RXL A;  4YMA A;  4P0G A;  1A99 A;  2R8T A;  3G3I A;  4DXC A;  1WVJ A;  2ZNS A;  5L8D A;  5H8Q A;  1FPD A;  3W15 C;  4MNC A;  3C4M A;  2Y7W A;  3IX1 A;  4F39 A;  5FHN A;  1FQD A;  2ABH A;  3W9V A;  3E3K A;  3T9U A;  1MH3 A;  1R9Q A;  4PE5 B;  1AIV A;  4AB5 A;  1XS5 A;  1Q1K A;  1RYX A;  1XI6 A;  5IKB A;  4R2F A;  4I62 A;  1I69 A;  4OVT A;  5ICQ A;  3FAT A;  3EQ1 A;  4NF0 A;  1B1H A;  2GFE A;  3MVY A;  1MY2 A;  1UTB A;  4K3F A;  3M8U A;  4QFP A;  2UVJ A;  3K01 A;  2HCA A;  1SI0 A;  3GLB A;  3ZS6 A;  2XX9 A;  1EYK A;  3IAZ A;  1FPB A;  3E4R A;  4GWS A;  4H0W A;  1FTJ A;  5FHO A;  3JZJ A;  3C34 A;  3L6G A;  3KN3 A;  2H99 A;  4OER A;  1FSA A;  4PFB A;  5DTB A;  3IOW A;  3RGY A;  3IB0 A;  4P0I A;  3SES A;  3TPA A;  3OMB A;  1B3H A;  4U1O A;  1QJM A;  3M3K A;  3IJX B;  2F7B A;  5IAI A;  1B32 A;  4GLI A;  3EN3 A;  4G8M A;  5EQ7 A;  4R6Y A;  4LQ5 A;  1IUD A;  4ESW A;  1B46 A;  4M1V A;  4F1V A;  5CBS A;  4KCC A;  4XKP A;  1B7U A;  4GX6 A;  3N26 A;  1USY H;  4FBP A;  2QMX A;  3IOV A;  1M5C A;  4P8B A;  2F3D A;  3K6U A;  4QSE A;  3FZV A;  4H1X A;  4GQO A;  2FVZ A;  3V83 A;  3BFT A;  2ZYK A;  1EYJ A;  1NL5 A;  1FBP A;  2F3B A;  4O94 A;  3OO8 A;  1IMD A;  4EQ7 A;  4IO6 A;  3VVE A;  3H6T A;  1US5 A;  2H98 A;  4FAJ A;  3OEL A;  4LZ8 A;  4JSD A;  3UOR A;  1LBC A;  1FW0 A;  3U92 A;  3BKI B;  5ET5 A;  3TCH A;  4HXV A;  1FPK A;  3P7I A;  4OEV A;  1NMU A;  1FPE A;  3B6Q A;  2F7A A;  2YJP A;  1JW5 A;  2XXV A;  2F6P A;  1D9Y A;  3SEW A;  4PAK A;  4PF8 A;  4ZED A;  1N3X A;  3PPQ A;  1B5I A;  4DZ1 A;  4DXU A;  1DBZ A;  4KR5 A;  1HSE A;  3G3G A;  1IMC A;  4Z0I A;  3CI8 A;  4MX6 A;  1IXG A;  3BIG A;  3CSG A;  2WYP A;  1G0I A;  2B4L A;  1K9Y A;  2UYE A;  2PFZ A;  2XWK A;  1A8E A;  3HN0 A;  1ANF A;  3K0V A;  1RDY A;  4NF5 B;  4PFR A;  2M8C A;  4NF6 A;  1GVC A;  2QS1 A;  3I3V A;  1PB9 A;  1FTK A;  4XKQ A;  4N15 A;  4F2Q A;  2OWZ A;  4OA4 A;  3PUX E;  1PBP A;  2AIX A;  3CR9 A;  2VPO A;  4O7I A;  4PFI A;  1T0K A;  4IO3 A;  1R1N A;  3H6W A;  2ONR A;  5DYH A;  2QVU A;  2XXH A;  1AL3 A;  1FJ6 A;  4IO4 A;  2VOZ A;  2WYK A;  1JP4 A;  2QS4 A;  2G93 A;  1B3E A;  5ITP A;  1SVX B;  4YU0 A;  5IZ3 B;  4OAN A;  3LSL A;  2DWA A;  4ZEI A;  5JK4 A;  2OBG A;  2RCB A;  3VXC A;  4P56 A;  2VP1 A;  4O3A A;  5I2N B;  2I3V A;  2O68 A;  1ZJL A;  4JB7 A;  2DE3 A;  3OSQ A;  4F22 A;  3R6U A;  4FAT A;  1B52 A;  3IB2 A;  2Z8E A;  2D3I A;  4I8C A;  3G3K A;  2MKZ A;  1B5J A;  3MP8 A;  4XFE A;  2AL5 A;  3B7D A;  2Q89 A;  3V5A A;  5BWJ A;  1D9Q A;  5I56 A;  3RN8 A;  4G61 A;  1NNT A;  4R74 A;  3FVK A;  4Q30 B;  3HFU A;  4G68 A;  3OO9 A;  2XXK A;  2B65 A;  1D3K A;  2F78 A;  4YMB A;  5A5X A;  3HHF A;  5DT6 A;  1ATG A;  1MM6 A;  3G3F A;  4KHZ E;  2OCU A;  1XVY A;  4EXL A;  4P1E A;  1UTB B;  5LTC A;  1PB8 A;  1P1Q A;  1H43 A;  4JWY A;  2VPN A;  4GFR A;  3QSL A;  2QPQ A;  2X26 A;  3RPL A;  2HHM A;  1LBZ A;  1YTV A;  1DOT A;  2I6E A;  4KYE A;  3OEK A;  3ILU B;  3MWB A;  3U72 A;  4QFO A;  4MCO A;  5ET7 A;  3QAX A;  5LOM A;  1QUK A;  1LBX A;  2DE4 A;  1RYO A;  2F5X A;  4POX A;  1P1U A;  4IGR A;  1NV7 A;  4N81 A;  3USD A;  1MDQ A;  1TT1 A;  2UXA A;  3K2D A;  4HE2 A;  4ZEB A;  1HSL A;  4FIM A;  4OVQ A;  2I48 A;  5TP9 A;  2Y7P A;  2P3V A;  5J1D A;  1IME A;  3RPW A;  1FPG A;  3M3F A;  1EU8 A;  3FBP A;  1DK4 A;  1DTG A;  1MY1 A;  1P99 A;  3THI A;  5KCJ A;  3IJO B;  4O3B A;  1OLC A;  1LAX A;  3FXR A;  5F24 A;  3EKI A;  1MPD A;  2WBB A;  3VV5 A;  3PUZ E;  3CFX A;  1YZ0 A;  3O9P A;  4N91 A;  2HAU A;  2FHY A;  3K1P A;  3O6G A;  4N6P A;  3IR1 A;  4FE8 A;  3TEP A;  1IZ1 A;  3TTM A;  3PPN A;  3E9X A;  1RDX A;  4PFW A;  3C32 A;  3HO7 A;  3Q28 A;  4KCD A;  4NN3 A;  2PT2 A;  2PT1 A;  1O64 A;  1TWY A;  3IB1 A;  1Y1Z A;  5T3J A;  5DVI A;  3N6U A;  1JEV A;  4ZZA A;  4ECF A;  3Q25 A;  2O84 X;  3MZ1 A;  1GR2 A;  3FJ7 A;  1ELJ A;  3DP4 A;  4IO2 A;  1S50 A;  2H9B A;  1DPP A;  1MY4 A;  4XIG Q;  1UIV A;  4ND9 A;  4OZ9 A;  4PCD A;  1PBQ A;  5J16 A;  4U23 A;  1N84 A;  1POT A;  1O63 A;  3VE1 B;  4OVP A;  2O1M A;  3KJ7 A;  2CZH A;  2ZYO A;  2XWI A;  2DYX A;  2O1L A;  4HW8 A;  4XKN A;  3O97 A;  2IEE A;  2Z8D A;  1AMF A;  3H06 B;  4Z7E A;  2XXI A;  4F3S A;  3PU5 A;  2AL4 A;  5I84 A;  1P1W A;  4GWZ A;  5I58 A;  1LFI A;  4MH5 A;  4OEU A;  5TU0 A;  3FJM A;  1NV5 A;  4H5F A;  2Z22 A;  1N0T A;  3MPL A;  4BDM A;  1LB9 A;  2AYS A;  4NF8 A;  4DXB A;  1P1N A;  1URD A;  3LR1 A;  3MW0 A;  4TQU Q;  1JNF A;  2DDK A;  4EDP A;  2B4M A;  2Y84 A;  1N04 A;  1MM7 A;  3O6H A;  3EHS A;  1OMP A;  1QUJ A;  1XOC A;  4F18 A;  3OXN A;  3H6U A;  2WX9 A;  5EQ8 A;  4JXI A;  3WAE A;  3OO7 A;  3Q27 A;  2O69 A;  1IMA A;  4GD5 A;  3QUJ A;  4NMY A;  3MVX A;  2THI A;  2RIN A;  5I2K A;  4QFN A;  5L9S A;  4ZE8 A;  4ELP A;  4LQ2 A;  2Y7K A;  5H8S A;  4ESX A;  1USY E;  2Q9T A;  2ZZW A;  4KYS A;  3CHG A;  2D5W A;  2ALU A;  2ZZX A;  1UQW A;  4GWO A;  5IZZ A;  1MY0 A;  1IXI A;  5JEI A;  5IZ1 A;  1SI1 A;  4YKP A;  3U94 A;  3UP9 A;  4U4X A;  5I59 A;  4F29 A;  3C9H A;  4IGT A;  1LBV A;  1IEJ A;  2H5Y A;  2ZXT A;  2I4B A;  1N3W A;  5ICT A;  5B70 A;  1H76 A;  3T0J A;  4X9T A;  3ROJ A;  3BFU A;  1CNQ A;  4FOR A;  1GGG A;  3KSX A;  5H8N A;  4OTE A;  2PYY A;  5L9O A;  3FIR A;  2CZK A;  1FPF A;  3OEM A;  2ONS A;  4GX4 A;  3UN6 A;  3D4C A;  2F6G A;  4H8J A;  1JEU A;  4G68 B;  4RA1 A;  1MPB A;  5I5P A;  3PPP A;  2I49 A;  3PUV E;  1PEB A;  1WDN A;  1AOV A;  4U21 A;  4MAG A;  4U2R A;  3KC0 A;  4MIJ A;  2FBP A;  1XHY A;  3R26 A;  3TTN A;  3NOH A;  2WBD A;  4BLA A;  1BTJ A;  2XX8 A;  1ZMG A;  2OWT A;  1JVX A;  3IOR A;  3LUY A;  1FCK A;  1B2H A;  4BDL A;  3PV0 E;  2O7I A;  4GBW A;  1URS A;  4MFI A;  1NUX A;  2RC9 A;  2FNC A;  1KA1 A;  2CEX A;  4ONY A;  1MPC A;  2X7Q A;  3ZKL A;  4PP0 A;  3TTR A;  3S4U A;  2I3W A;  2Q8M A;  1EZO A;  1BIY A;  4YAH X;  1B3F A;  2PCR A;  3T93 B;  5AA3 A;  4P11 A;  3FVN A;  3ODB A;  5FTH A;  5DEX A;  5HM4 B;  4DI3 D;  2KQZ A;  3EPE A;  1FJ9 A;  2Y5K A;  1MQH A;  4JWO A;  3DP8 A;  3MZ9 A;  2QMW A;  2HZK A;  1QUI A;  4XTC Q;  1FTO A;  4TLL B;  2F36 A;  2QFL A;  4JVD A;  3A3U A;  3EHU A;  3TFL A;  5KCJ B;  2V93 A;  2B3F A;  1QKA A;  2F35 A;  3RY3 A;  1I6A A;  2ANJ A;  4HTG A;  2I0C A;  3KBZ A;  1SQY A;  2XXX A;  2XXY A;  4N6D A;  1WOD A;  3OOA A;  1UTH A;  5I57 B;  1NV2 A;  2V25 A;  1ZIU A;  3MBP A;  1AWB A;  2XXR A;  3D1R A;  2DWI A;  3DM0 A;  4JSO A;  1QKB A;  5AA2 A;  2DXR A;  2GHB A;  4DCY A;  1Y3P A;  1KA0 A;  5F1Q A;  1K9Z A;  2Z23 A;  3T66 A;  4XXU A;  4NF4 B;  1FBE A;  3TOD A;  2HQ0 A;  2Q88 A;  2Z8F A;  1ZKB A;  4RY1 A;  3K6W A;  3E79 A;  4I40 A;  1QGX A;  4GL0 A;  4H65 A;  2GH9 A;  3ILT B;  4X04 A;  1NUY A;  4R6H A;  4JWX A;  2VT5 A;  3SET A;  1MXZ A;  3FVO A;  2W7Y A;  3SKP A;  3CFZ A;  1GTK A;  4G68 C;  2QRY A;  5AE4 A;  2HAV A;  1M5F A;  3B8B A;  2XWV A;  2X7P A;  1PDA A;  2A5T B;  4TLM B;  3CG1 A;  3CSB A;  2OLB A;  5CRY A;  2NXO A;  4N8G A;  2FA7 A;  1LBY A;  3ZKK A;  3MZB A;  3RLF E;  3MST A;  4WED A;  4MHF A;  3F11 A;  4NF8 B;  4YKJ A;  4P1L A;  3TKD A;  2P0S A;  4PDD A;  3TCG A;  4HCY A;  4H46 A;  4ISU A;  3SEX A;  5H8F A;  2R9J A;  3B6T A;  2Y7I A;  4OFJ A;  1YPN A;  5AA4 A;  4UAC A;  1VSO A;  4FEC A;  5KDT A;  2GHA A;  4GBV A;  3VXB A;  4JBZ A;  4KFQ A;  3OO6 A;  2JJK A;  3LBS A;  4N4U A;  2P3N A;  4IY6 A;  1N7X A;  1B05 A;  5CM6 A;  4HE0 A;  5H8Q B;  3Q26 A;  5I3S A;  1MXW A;  1FQC A;  4GL8 A;  1LAG E;  3CG3 A;  4F31 B;  4ZDM A;  4ZE9 A;  2XXT A;  3SEV A;  1EH3 A;  3QXM A;  4G77 A;  4Q0C A;  1LFH A;  4KPT A;  1ZBM A;  1A7L A;  2HZL A;  4N8Y A;  4WXJ A;  3V8X B;  4U4S A;  3HST A;  4PFU A;  4ZEF A;  1B7Z A;  1NNK A;  3RUM A;  4KQP A;  1MQG A;  1B4Z A;  4MEV A;  5H8N B;  3CVG A;  2I4C A;  3PPR A;  1H45 A;  1Y3Q A;  1MRP A;  2XXU A;  2ZYN A;  3JYR A;  5CMM A;  2LAO A;  1NNF A;  1S9T A;  3TTK A;  1Q35 A;  4POW A;  1BK4 A;  1R6Z A;  4IY5 A;  4IO7 A;  2XHD A;  3PTY A;  4XF5 A;  1H44 A;  2OK2 A;  4H5G A;  3ZSF A;  3CFL A;  1M5B A;  3C33 A;  4NGU A;  1TXF A;  5DVF A;  1NKX A;  4EQ9 A;  3O28 A;  1NV4 A;  4G8N A;  3IOU A;  2V4C A;  3BIH A;  3U65 A;  1FTM A;  4Q8R A;  3ISP A;  1A8F A;  1P1O A;  2PVU A;  3PUY E;  2PX1 A;  5CMB A;  1MQD A;  3H4Z A;  3MVW A;  3K1M A;  2CMO A;  4QF9 A;  2BJI A;  1SBP A;  2DOJ A;  2R6G E;  4NQ8 A;  2DVC A;  4PQJ A;  3MPK A;  2WKY A;  2KR0 A;  3MYU A;  5CMC A;  3MQ9 A;  3FXQ A;  4DIG A;  3KSJ A;  5TPA A;  3C31 A;  1H3D A;  2RC7 A;  4OET A;  4ZEC A;  1LCT A;  1IXH A;  4QXD A;  1B5H A;  4L17 A;  2ONK E;  2REJ A;  3KJT A;  3A3C A;  1B51 A;  2UVH A;  2V84 A;  4ZZE A;  4N13 A;  4LON B;  4N17 A;  1B3G A;  4MMP A;  1JW4 A;  3G7W A;  4YZZ A;  3IK6 B;  1OQH A;  3M3L A;  2Q74 A;  3ONM A;  3UK4 A;  3S9L C;  4I9D A;  2H4I A;  4LUB A;  4H8I A;  2GQ1 A;  4MNP A;  4RYA A;  2XWO A;  2UVI A;  2OZZ A;  1NNP A;  3OD7 A;  3K02 A;  1B9J A;  1UTH B;  1B0H A;  1GV8 A;  4R9F A;  1Y3N A;  4AS4 A;  2Q2C A;  3LUZ A;  3JV9 A;  4LVQ A;  1INP A;  1LEV A;  1FBF A;  2R71 A;  1SW2 A;  2HPG A;  4X8R A;  1N76 A;  3KFM A;  4NHB A;  4PBQ A;  1F9B A;  3KOT A;  1NH8 A;  1LCF A;  4G4P A;  3H03 A;  2DSF A;  5M2V A;  2H25 A;  3EF7 A;  2NWJ A;  4GVO A;  4XKR A;  4G8H A;  3TCF A;  5ELV A;  2CZI A;  4FED A;  3FAS A;  3PUW E;  3LSF B;  4G2Z A;  4BDO A;  2XA5 A;  4NF5 A;  1MS7 A;  2QVR A;  3MP6 A;  2DWJ A;  3IL1 B;  2XXQ A;  1SYH A;  4OWD A;  5HPQ A;  1Z7N E;  4GWX A;  1L5T A;  1FQF A;  1MXX A;  3PGF A;  4QBA A;  1OVT A;  1A54 A;  5AA2 D;  4NWD A;  4NF6 B;  2WEF A;  4HS7 A;  3HCQ A;  4I3Y A;  5HBC A;  4N6K A;  4UAB A;  4EF2 A;  1Y9U A;  3LV0 A;  3T1B A;  2PFY A;  3C35 A;  3KGC A;  2ZYM A;  2Y5L A;  2DS9 A;  3W9W A;  2Q2A A;  2O7U A;  1B40 A;  4EF1 A;  2A5S A;  4RK9 A;  3T9X B;  5EHS A;  3FGS A;  4ELQ A;  3T9H B;  1LB8 A;  5IZ3 A;  5H8F B;  2ZZV A;  3SDF A;  4TOZ A;  4FJP A;  5AA4 B;  3H7M A;  1OVB A;  4PC9 A;  3QYT A;  3AXF A;  5ISU A;  1Y4T A;  1MXU A;  2DXY A;  3L6H A;  2UVG A;  5EQA A;  2XX7 A;  3H6V A;  4Q5T A;  5EYF A;  2ESN A;  1I6Q A;  3MUQ A;  1SW1 A;  1Y20 A;  2I0B A;  3SEY A;  4MBP A;  4DLD A;  4P47 A;  1NV3 A;  1LAH E;  5DVJ A;  3B6W A;  1BKA A;  3O29 A;  5I56 B;  1B4H A;  1FPL A;  1LGB C;  1Q9D A;  3I5O A;  2KLF A;  3IFC A;  3SER A; 
#chains in the Genus database with same CATH homology
 2OWS A;  1EZP A;  1JQF A;  4RPN A;  4IB2 A;  3TDJ A;  4NTL A;  5A5X B;  4YB6 A;  4R6K A;  3TTL A;  4ELR A;  4RPO A;  2ZNU A;  4RNS A;  1JW1 A;  3G3H A;  2QJE A;  1DPE A;  3D4G A;  2XXP A;  1TFA A;  3MAM A;  2V3U A;  4YB5 A;  4AQ4 A;  2RKM A;  3T22 A;  4OFO A;  1ZLQ A;  1A40 A;  1JVY A;  1D4N A;  3R7X A;  3Q29 A;  4YKI A;  3FJG A;  4WEP A;  4R2B A;  3K4U A;  3MVZ A;  2HXW A;  3O6I A;  1ZTY A;  2O51 A;  1Z7M E;  4UA8 A;  4KD5 A;  4LZ5 A;  1PB7 A;  2QSX A;  2GRV A;  4KI0 E;  4NWC A;  3K6X A;  3K6V A;  1BLF A;  1HSJ A;  1D9V A;  1EZ9 A;  2YPN A;  3GXA A;  5FHM A;  2XD3 A;  2REG A;  3GBB A;  4X1D A;  4QSD A;  5TP9 B;  2CZL A;  3PMV A;  4FEB A;  4QFL A;  4OXV A;  3HV1 A;  3BBR A;  4BDN A;  3UGW A;  3VVD A;  4E0X A;  3VLV A;  5TPA B;  2HEU A;  1MQI A;  4EUO A;  4BDR A;  1OIB A;  2ZMB A;  3S9M C;  5H8H A;  4F2O A;  3FUZ A;  3DLN A;  4MLV A;  3EHT A;  3N5L A;  4H6D A;  4GOT A;  1QW0 A;  3MP1 A;  2PBW A;  3VVF A;  3VFJ A;  4GXA A;  2I58 A;  4GF8 A;  1VE4 A;  3LSX A;  1OQG A;  2E0S A;  2F7C A;  1A55 A;  2DP8 A;  1MXV A;  4C1T A;  1B0L A;  3HHG A;  4F1Y A;  3OSR A;  4JDF A;  5F7V A;  1PC3 A;  1MG1 A;  3T9V A;  1XC1 A;  5CMK A;  2O6A A;  3PMX A;  2YLN A;  3U8Q A;  4GXS B;  4F19 A;  2UYF A;  1MXY A;  3N6T A;  5I58 B;  2RCA A;  1TFD A;  1SW4 A;  1VFD A;  4AB6 A;  5L9M A;  4C1U A;  1LBB A;  5JTY A;  4H67 A;  2G29 A;  4OES A;  2QS3 A;  1O7T A;  4DDD A;  2OJT A;  5ITO A;  4F3P A;  1XVX A;  3G3J A;  5B7D A;  1B58 A;  3FXU A;  1II5 A;  4C0R A;  2QL3 A;  4PFY A;  1YCJ A;  4YIC A;  1MDP 1;  2P2A A;  3KBR A;  3GZG A;  3S2V A;  2RF1 A;  1DSN A;  1CB6 A;  4QRZ A;  3IO6 A;  4RK2 A;  3TZA A;  2DVZ A;  2XXW A;  5I2K B;  3QUF A;  1LLS A;  1I6B A;  1UIU A;  3K00 A;  4YKK A;  1J1N A;  1QVS A;  4OHN A;  4R9G A;  4QHQ A;  3C36 A;  5EHM A;  3KOS A;  4ZEK A;  1DMB A;  3KZG A;  3MJN A;  4GIZ A;  4KYD A;  4N07 A;  1N7W A;  2F97 A;  1CE2 A;  5I59 B;  3RT6 B;  3K1N A;  4M4G A;  1VR5 A;  3LC8 A;  4OFL A;  2B3B A;  4R75 A;  3KG2 A;  3TMG A;  3TQL A;  4R73 A;  1JET A;  3ECR A;  4MLQ A;  2VD2 A;  4LZ7 A;  3RTW B;  1QUL A;  2XD2 A;  1B1X A;  1DTZ A;  3IOT A;  1B3L A;  3RQT A;  1Y1M A;  3S9N C;  3CRB A;  1IQ7 A;  4PET A;  2Q8J A;  3WAF A;  3HPI A;  5K2X A;  1VFE A;  3KEI A;  3FD3 A;  4YB7 A;  3FV1 A;  3TYH A;  4F3G A;  3H3G A;  4EXK A;  3PD9 A;  2D21 A;  3QK6 A;  3LSW A;  2IA4 A;  1IIT A;  2P1S A;  1B7H A;  1YAE A;  1US4 A;  2F34 A;  4DCX A;  3RT8 A;  3A09 A;  3TUS A;  4RJZ A;  4LA9 A;  2BJJ X;  1MQJ A;  3T96 B;  4OQO A;  2NOO A;  4ELO A;  1KWH A;  5DEX B;  3QIM A;  1IXC A;  1MH4 A;  1R9L A;  3FV2 A;  4NE4 A;  3CIJ A;  4U1Z A;  1FQE A;  2QS2 A;  2FYI A;  2NVU B;  3RNN A;  4LAT A;  4WKM A;  3RTF B;  5I57 A;  2NUV A;  3VDF A;  5H8H B;  1BP5 A;  5BUU A;  1LST A;  2DWH A;  2V3Q A;  2VHA A;  3VLU A;  4BDQ A;  1SD3 A;  3PPO A;  4X48 A;  1LFG A;  3PMW A;  2Y7R A;  5CBR A;  2ZNT A;  3MC2 A;  4NF4 A;  2DQV A;  4R72 A;  1XT8 A;  5AA2 B;  3UA8 A;  1NFT A;  3SEU A;  1LAF E;  2RC8 A;  4MF3 A;  3IO4 A;  4O3C A;  5KZT A;  4DE8 A;  1NH7 A;  3E13 X;  4X1B A;  3O2A A;  4LP2 B;  2VD3 A;  2E1S A;  3OEN A;  3GBA A;  1S7Y A;  4GRK A;  2VGQ A;  4F1U A;  2PMS A;  3U1O A;  4E0W A;  4F3B A;  3U93 A;  1RKM A;  5CC2 A;  4U22 A;  3DP6 A;  2A5T A;  3UIF A;  5AA1 A;  3V89 B;  4EQB A;  5CI5 A;  4QFK A;  3KN8 A;  1M5E A;  1POY 1;  3DEL B;  4THI A;  3KN7 A;  5K2Y A;  2F8D A;  3I6V A;  3TAJ A;  2HFB A;  3O66 A;  1SDX A;  3TEL A;  4OVJ A;  4ZS9 A;  4NED A;  1FTL A;  4OYV A;  5JTY B;  3TQW A;  1URG A;  3FVG A;  4OMB A;  1ZU0 A;  4I1D A;  1FQB A;  3N94 A;  1Y4C A;  1M5D A;  1OLA A;  1SW5 A;  1SYI A;  1MY3 A;  1IIW A;  4OEN A;  3S9E A;  1B6H A;  4QSC A;  4IO5 A;  4HCW A;  1AH5 A;  5I2N A;  5FTI A;  2DE2 A;  2V3T A;  1FQA A;  3VLW A;  3PD8 A;  5KDT B;  4PFT A;  4RXL A;  4YMA A;  4P0G A;  1A99 A;  3G3I A;  4DXC A;  1WVJ A;  2ZNS A;  5L8D A;  5H8Q A;  3W15 C;  3C4M A;  2Y7W A;  3IX1 A;  4F39 A;  5FHN A;  1FQD A;  2ABH A;  3W9V A;  3E3K A;  3T9U A;  1MH3 A;  1R9Q A;  4PE5 B;  1AIV A;  4AB5 A;  1XS5 A;  1Q1K A;  1RYX A;  5IKB A;  4R2F A;  4I62 A;  1I69 A;  5ICQ A;  3FAT A;  3EQ1 A;  1B1H A;  2GFE A;  3MVY A;  1MY2 A;  1UTB A;  4K3F A;  3M8U A;  4QFP A;  2UVJ A;  3K01 A;  2HCA A;  1SI0 A;  3GLB A;  3ZS6 A;  2XX9 A;  3IAZ A;  3E4R A;  4H0W A;  1FTJ A;  5FHO A;  3JZJ A;  3C34 A;  3L6G A;  3KN3 A;  2H99 A;  4OER A;  5DTB A;  3IOW A;  3RGY A;  3IB0 A;  4P0I A;  3SES A;  3TPA A;  3OMB A;  1B3H A;  4U1O A;  1QJM A;  3M3K A;  3IJX B;  2F7B A;  5IAI A;  1B32 A;  4GLI A;  3EN3 A;  4G8M A;  4R6Y A;  4LQ5 A;  1IUD A;  4ESW A;  1B46 A;  4M1V A;  4F1V A;  5CBS A;  4KCC A;  4XKP A;  1B7U A;  3N26 A;  1USY H;  2QMX A;  3IOV A;  1M5C A;  3K6U A;  4QSE A;  3FZV A;  4H1X A;  4GQO A;  3V83 A;  3BFT A;  2ZYK A;  1NL5 A;  3OO8 A;  4EQ7 A;  4IO6 A;  3VVE A;  3H6T A;  1US5 A;  2H98 A;  4FAJ A;  3OEL A;  4LZ8 A;  4JSD A;  3UOR A;  1LBC A;  1FW0 A;  3U92 A;  3BKI B;  3TCH A;  3P7I A;  4OEV A;  1NMU A;  3B6Q A;  2F7A A;  2YJP A;  1JW5 A;  2XXV A;  2F6P A;  1D9Y A;  3SEW A;  4ZED A;  1N3X A;  3PPQ A;  1B5I A;  4DZ1 A;  4DXU A;  4KR5 A;  1HSE A;  3G3G A;  4Z0I A;  3CI8 A;  1IXG A;  3CSG A;  2UYE A;  1A8E A;  3HN0 A;  1ANF A;  3K0V A;  4NF5 B;  2M8C A;  4NF6 A;  1GVC A;  2QS1 A;  3I3V A;  1PB9 A;  1FTK A;  4F2Q A;  4XKQ A;  3PUX E;  1PBP A;  2AIX A;  3CR9 A;  1T0K A;  4IO3 A;  1R1N A;  3H6W A;  2ONR A;  5DYH A;  2XXH A;  1AL3 A;  4IO4 A;  2VOZ A;  2QS4 A;  2G93 A;  1B3E A;  5ITP A;  1SVX B;  4YU0 A;  3LSL A;  2DWA A;  4ZEI A;  5JK4 A;  2OBG A;  2RCB A;  3VXC A;  2VP1 A;  4O3A A;  5I2N B;  2I3V A;  2O68 A;  1ZJL A;  4JB7 A;  2DE3 A;  3OSQ A;  4F22 A;  3R6U A;  4FAT A;  1B52 A;  3IB2 A;  2Z8E A;  2D3I A;  4I8C A;  3G3K A;  1B5J A;  3MP8 A;  2AL5 A;  3B7D A;  2Q89 A;  3V5A A;  5BWJ A;  5I56 A;  3RN8 A;  1NNT A;  4R74 A;  3FVK A;  4Q30 B;  4G68 A;  3OO9 A;  2B65 A;  1D3K A;  2F78 A;  4YMB A;  5A5X A;  3HHF A;  5DT6 A;  1ATG A;  1MM6 A;  3G3F A;  4KHZ E;  2OCU A;  1XVY A;  4EXL A;  1UTB B;  1PB8 A;  1P1Q A;  1H43 A;  4JWY A;  4GFR A;  3QSL A;  2QPQ A;  2X26 A;  1YTV A;  1DOT A;  2I6E A;  4KYE A;  3OEK A;  3ILU B;  3MWB A;  3U72 A;  4QFO A;  3QAX A;  5LOM A;  1QUK A;  2DE4 A;  1RYO A;  2F5X A;  4POX A;  1P1U A;  4IGR A;  3USD A;  1MDQ A;  1TT1 A;  2UXA A;  3K2D A;  4ZEB A;  1HSL A;  4FIM A;  2I48 A;  5TP9 A;  2Y7P A;  5J1D A;  3RPW A;  3M3F A;  1EU8 A;  1DTG A;  1MY1 A;  1P99 A;  3THI A;  5KCJ A;  3IJO B;  4O3B A;  1OLC A;  1LAX A;  3FXR A;  1MPD A;  3VV5 A;  3PUZ E;  3CFX A;  3O9P A;  2HAU A;  3K1P A;  3O6G A;  4N6P A;  3IR1 A;  4FE8 A;  3TEP A;  1IZ1 A;  3TTM A;  3PPN A;  3E9X A;  4PFW A;  3C32 A;  3HO7 A;  3Q28 A;  4KCD A;  2PT2 A;  2PT1 A;  1O64 A;  1TWY A;  3IB1 A;  1Y1Z A;  5DVI A;  3N6U A;  1JEV A;  4ZZA A;  4ECF A;  3Q25 A;  2O84 X;  3MZ1 A;  1GR2 A;  3FJ7 A;  1ELJ A;  3DP4 A;  4IO2 A;  1S50 A;  2H9B A;  1DPP A;  1MY4 A;  4XIG Q;  1UIV A;  4ND9 A;  4OZ9 A;  1PBQ A;  4U23 A;  1N84 A;  1POT A;  1O63 A;  3VE1 B;  2O1M A;  3KJ7 A;  2ZYO A;  2DYX A;  2O1L A;  4HW8 A;  4XKN A;  3O97 A;  2IEE A;  2Z8D A;  1AMF A;  3H06 B;  4Z7E A;  2XXI A;  4F3S A;  3PU5 A;  2AL4 A;  5I84 A;  1P1W A;  5I58 A;  1LFI A;  4MH5 A;  4OEU A;  5TU0 A;  3FJM A;  4H5F A;  2Z22 A;  1N0T A;  3MPL A;  4BDM A;  1LB9 A;  2AYS A;  4NF8 A;  4DXB A;  1P1N A;  1URD A;  3LR1 A;  3MW0 A;  4TQU Q;  1JNF A;  4EDP A;  2Y84 A;  1N04 A;  1MM7 A;  3O6H A;  3EHS A;  1OMP A;  1QUJ A;  1XOC A;  4F18 A;  3OXN A;  3H6U A;  4JXI A;  3WAE A;  3OO7 A;  3Q27 A;  2O69 A;  4GD5 A;  3QUJ A;  4NMY A;  3MVX A;  2THI A;  2RIN A;  5I2K A;  4QFN A;  5L9S A;  4ZE8 A;  4ELP A;  4LQ2 A;  2Y7K A;  5H8S A;  4ESX A;  1USY E;  2Q9T A;  4KYS A;  2D5W A;  2ALU A;  1UQW A;  4GWO A;  1MY0 A;  1IXI A;  5JEI A;  1SI1 A;  4YKP A;  3U94 A;  3UP9 A;  4U4X A;  5I59 A;  4F29 A;  3C9H A;  4IGT A;  1IEJ A;  2H5Y A;  2ZXT A;  2I4B A;  1N3W A;  5ICT A;  5B70 A;  1H76 A;  4X9T A;  3BFU A;  4FOR A;  1GGG A;  3KSX A;  5H8N A;  4OTE A;  2PYY A;  5L9O A;  3FIR A;  3OEM A;  2ONS A;  3UN6 A;  3D4C A;  2F6G A;  4H8J A;  1JEU A;  4G68 B;  4RA1 A;  1MPB A;  3PPP A;  2I49 A;  3PUV E;  1PEB A;  1WDN A;  1AOV A;  4U21 A;  4U2R A;  1XHY A;  3R26 A;  3TTN A;  4BLA A;  1BTJ A;  2XX8 A;  1ZMG A;  2OWT A;  1JVX A;  3IOR A;  3LUY A;  1FCK A;  1B2H A;  4BDL A;  3PV0 E;  2O7I A;  1URS A;  4MFI A;  2RC9 A;  2FNC A;  4ONY A;  1MPC A;  2X7Q A;  3ZKL A;  4PP0 A;  3TTR A;  3S4U A;  2I3W A;  1EZO A;  1BIY A;  4YAH X;  1B3F A;  3T93 B;  5AA3 A;  4P11 A;  3FVN A;  3ODB A;  5FTH A;  5DEX A;  5HM4 B;  3EPE A;  1MQH A;  4JWO A;  3DP8 A;  3MZ9 A;  2QMW A;  2HZK A;  1QUI A;  4XTC Q;  1FTO A;  4TLL B;  2F36 A;  3A3U A;  3EHU A;  3TFL A;  5KCJ B;  2V93 A;  2B3F A;  1QKA A;  2F35 A;  3RY3 A;  1I6A A;  2ANJ A;  4HTG A;  2I0C A;  1SQY A;  2XXX A;  2XXY A;  1WOD A;  3OOA A;  1UTH A;  5I57 B;  2V25 A;  1ZIU A;  3MBP A;  2XXR A;  2DWI A;  3DM0 A;  4JSO A;  1QKB A;  5AA2 A;  2DXR A;  2GHB A;  4DCY A;  1Y3P A;  5F1Q A;  2Z23 A;  3T66 A;  4XXU A;  4NF4 B;  3TOD A;  2HQ0 A;  2Q88 A;  2Z8F A;  1ZKB A;  4RY1 A;  3K6W A;  4GL0 A;  4H65 A;  2GH9 A;  3ILT B;  4R6H A;  4JWX A;  3SET A;  1MXZ A;  3FVO A;  2W7Y A;  3SKP A;  3CFZ A;  1GTK A;  4G68 C;  2QRY A;  5AE4 A;  2HAV A;  1M5F A;  2X7P A;  1PDA A;  2A5T B;  4TLM B;  3CG1 A;  3CSB A;  2OLB A;  5CRY A;  2NXO A;  2FA7 A;  3ZKK A;  3MZB A;  3RLF E;  4WED A;  3F11 A;  4NF8 B;  4YKJ A;  3TKD A;  2P0S A;  3TCG A;  4HCY A;  4ISU A;  3SEX A;  5H8F A;  2R9J A;  3B6T A;  2Y7I A;  4OFJ A;  1YPN A;  5AA4 A;  4UAC A;  1VSO A;  4FEC A;  5KDT A;  2GHA A;  3VXB A;  4JBZ A;  4KFQ A;  3OO6 A;  3LBS A;  4IY6 A;  1N7X A;  1B05 A;  5CM6 A;  5H8Q B;  3Q26 A;  1MXW A;  1FQC A;  4GL8 A;  1LAG E;  3CG3 A;  4F31 B;  4ZDM A;  4ZE9 A;  2XXT A;  3SEV A;  1EH3 A;  3QXM A;  4G77 A;  4Q0C A;  1LFH A;  4KPT A;  1ZBM A;  1A7L A;  2HZL A;  4WXJ A;  3V8X B;  4U4S A;  3HST A;  4PFU A;  4ZEF A;  1B7Z A;  1NNK A;  3RUM A;  4KQP A;  1MQG A;  1B4Z A;  5H8N B;  3CVG A;  2I4C A;  3PPR A;  1H45 A;  1Y3Q A;  1MRP A;  2XXU A;  2ZYN A;  3JYR A;  5CMM A;  2LAO A;  1NNF A;  1S9T A;  3TTK A;  1Q35 A;  4POW A;  4IY5 A;  1R6Z A;  4IO7 A;  2XHD A;  1H44 A;  2OK2 A;  4H5G A;  3ZSF A;  3CFL A;  1M5B A;  3C33 A;  1TXF A;  5DVF A;  1NKX A;  4EQ9 A;  3O28 A;  4G8N A;  3IOU A;  1FTM A;  4Q8R A;  1A8F A;  1P1O A;  2PVU A;  3PUY E;  2PX1 A;  5CMB A;  1MQD A;  3H4Z A;  3MVW A;  3K1M A;  2CMO A;  4QF9 A;  1SBP A;  2DOJ A;  2R6G E;  2DVC A;  4PQJ A;  3MPK A;  2WKY A;  5CMC A;  3MQ9 A;  3FXQ A;  4DIG A;  3KSJ A;  5TPA A;  3C31 A;  1H3D A;  2RC7 A;  4OET A;  4ZEC A;  1LCT A;  1IXH A;  1B5H A;  4L17 A;  2ONK E;  2REJ A;  3KJT A;  3A3C A;  1B51 A;  2UVH A;  2V84 A;  4ZZE A;  4N13 A;  4LON B;  1B3G A;  1JW4 A;  3G7W A;  4YZZ A;  3IK6 B;  1OQH A;  3M3L A;  3ONM A;  3UK4 A;  3S9L C;  4I9D A;  2H4I A;  4LUB A;  4H8I A;  4RYA A;  2UVI A;  2OZZ A;  1NNP A;  3OD7 A;  3K02 A;  1B9J A;  1UTH B;  1B0H A;  1GV8 A;  4R9F A;  1Y3N A;  2Q2C A;  3JV9 A;  4LVQ A;  2R71 A;  1SW2 A;  1N76 A;  3KFM A;  1F9B A;  3KOT A;  1NH8 A;  1LCF A;  4G4P A;  3H03 A;  2DSF A;  5M2V A;  2H25 A;  3EF7 A;  2NWJ A;  4GVO A;  4XKR A;  4G8H A;  3TCF A;  5ELV A;  4FED A;  3FAS A;  3PUW E;  3LSF B;  4G2Z A;  4BDO A;  4NF5 A;  1MS7 A;  3MP6 A;  2DWJ A;  3IL1 B;  2XXQ A;  1SYH A;  4OWD A;  5HPQ A;  1Z7N E;  1L5T A;  1FQF A;  1MXX A;  3PGF A;  1OVT A;  1A54 A;  5AA2 D;  4NWD A;  4NF6 B;  4HS7 A;  3HCQ A;  5HBC A;  4EF2 A;  1Y9U A;  3C35 A;  3KGC A;  2ZYM A;  2DS9 A;  3W9W A;  2Q2A A;  2O7U A;  1B40 A;  4EF1 A;  2A5S A;  4RK9 A;  3T9X B;  5EHS A;  3FGS A;  4ELQ A;  3T9H B;  1LB8 A;  5H8F B;  3SDF A;  4TOZ A;  4FJP A;  5AA4 B;  3H7M A;  1OVB A;  3QYT A;  3AXF A;  5ISU A;  1Y4T A;  1MXU A;  2DXY A;  3L6H A;  2UVG A;  2XX7 A;  3H6V A;  4Q5T A;  5EYF A;  2ESN A;  1I6Q A;  3MUQ A;  1SW1 A;  1Y20 A;  2I0B A;  3SEY A;  4MBP A;  4DLD A;  1LAH E;  5DVJ A;  3B6W A;  1BKA A;  3O29 A;  5I56 B;  1B4H A;  1LGB C;  3I5O A;  2KLF A;  3SER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...