1I69A

Crystal structure of the reduced form of oxyr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
206
Chain Sequence
ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHSLRDQAMGFCFDTHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR
publication title Structural basis of the redox switch in the OxyR transcription factor.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 206
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i69A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i69A02
2I0BA 3FVGA 2YPNA 1QKAA 2AYSA 5AA3A 1ZBMA 4YKKA 1LSTA 3JV9A 4UACA 4KYEA 5DVIA 1P1OA 4LZ5A 4U22A 3G3FA 1OIBA 1URDA 2BJJX 4YMBA 2XD3A 1IQ7A 4G68A 1N0TA 2A5TA 2DWIA 1S9TA 3MWBA 1M5DA 1O7TA 2P1SA 1LFIA 3H7MA 4R6HA 4ZZAA 2XXTA 4Z7EA 3K01A 3PPNA 3MP8A 5A5XA 1NNFA 1XC1A 3C31A 1FTJA 1SVXB 3V5AA 3OD7A 4F39A 3RN8A 1PBQA 3RLFE 2HFBA 2AL5A 2Z22A 3HV1A 4RY1A 3FJMA 3IOUA 1YPNA 2VHAA 4KD5A 3MZ1A 4F3GA 2V25A 4BDRA 1Y9UA 3QUFA 4BDOA 4F31B 4JWXA 2DXRA 3IOVA 1B5JA 2XXVA 2XXUA 2ZYNA 1IXIA 2HEUA 2OWSA 4P0IA 4OFOA 1OVTA 4RNSA 1HSJA 5ITOA 4XKNA 4L17A 2VGQA 1DPPA 2Z8DA 1YAEA 2DE4A 1ANFA 4ISUA 3G3IA 3RT6B 1POY1 3GBAA 2DP8A 5K2YA 5DTBA 1M5FA 1H44A 4K3FA 2DWHA 2H99A 1P1NA 4LATA 3TZAA 3RPWA 1OLCA 4TOZA 3IJXB 2UVIA 3T96B 3N5LA 3O9PA 1JW1A 1WDNA 1ZTYA 1FQAA 4F3SA 3IOWA 1IZ1A 2OJTA 1B52A 1D9YA 5HPQA 2QL3A 3FVNA 1FQCA 4XXUA 3UORA 3CFZA 2Y7KA 1OQGA 4F1YA 1UTHB 2FA7A 5KCJB 3KZGA 2G29A 5H8SA 2ZYOA 2QMXA 1URSA 3WAFA 3V83A 1H45A 3MVXA 5I56B 4P0GA 4ZEIA 3LSLA 4QFLA 3LSWA 1I69A 4G2ZA 3G3KA 5L8DA 1BKAA 1Y1ZA 3TUSA 3K4UA 1FTLA 1RYOA 4KYDA 3MZ9A 1B5IA 1VE4A 4ZDMA 4EQBA 3KGCA 1LB8A 1VFEA 2O6AA 2NVUB 2PX1A 4F3BA 1MQJA 1TT1A 2FNCA 3T9UA 2XXRA 4WXJA 5H8FB 1MPDA 4G8MA 1FQEA 3CG1A 4LQ2A 2QS4A 3KSJA 2DE3A 3LUYA 1NH8A 1US4A 1SI0A 2REJA 5J1DA 1GVCA 3TTRA 3SEXA 1Z7NE 3Q29A 5CI5A 4WKMA 3ZS6A 4ELQA 5CMKA 3IO4A 5DT6A 1B2HA 1CB6A 4QSEA 2XXXA 3CFLA 4H5FA 1N84A 1QUKA 5CMCA 4ELRA 4OEVA 3HHFA 2GRVA 4ESXA 3PPQA 3OO6A 1N3WA 4ESWA 4NF5A 2Q2CA 4U23A 2F7BA 4NTLA 3IORA 1IXHA 3KJ7A 3TELA 1MXVA 4BDQA 1I6AA 1MQDA 4ECFA 1VR5A 3GZGA 4NF6A 4C0RA 3A3UA 4OEUA 4C1UA 1LB9A 3D4GA 3QUJA 4AQ4A 4RYAA 1HSEA 2XXPA 4NF8A 2QRYA 2D21A 5I59A 2Y7PA 4E0XA 5FHOA 3Q27A 1AL3A 3SDFA 5I2KB 3PMWA 3TQLA 4KQPA 4O3CA 4JWOA 3VFJA 3OOAA 2F8DA 3QYTA 3T93B 1MQIA 2RF1A 5M2VA 1DMBA 3LSXA 3LC8A 5B7DA 4U21A 1ZIUA 1SW5A 5F1QA 3PPPA 3MVYA 3K00A 3Q25A 1EZ9A 3M3FA 5TP9B 1UIVA 2ALUA 3U92A 2H4IA 4YU0A 4U2RA 1NMUA 1MXXA 5L9SA 1FQDA 4PQJA 4ZEKA 1MG1A 3FZVA 4WEDA 3TMGA 1MXWA 2V3UA 3KSXA 4F2OA 4LONB 5JK4A 1US5A 3S9NC 1MQHA 1M5BA 4FIMA 4ZECA 3FJ7A 4IY5A 4GIZA 1FQFA 1P1QA 5LOMA 4X1DA 1Y20A 1LFHA 4OETA 4LZ7A 1SQYA 2I49A 4WEPA 3W9WA 1QW0A 3ONMA 2V3TA 2QS1A 4G8HA 2DVZA 2OWTA 2DXYA 4ZEDA 3KOTA 4EF1A 2PT1A 1UIUA 1B7UA 3C34A 2QS3A 3CR9A 5CBRA 4RPNA 1MY3A 1QULA 1LCFA 4GD5A 4DE8A 3S2VA 1WODA 1B3LA 3IK6B 2H5YA 3PUWE 4G4PA 1LAXA 4GF8A 3ILUB 3VE1B 3TTKA 1Y3PA 3TQWA 4R75A 5I57A 3KN8A 2UXAA 3GXAA 4FORA 4QFNA 1SW1A 1B40A 3TCHA 2AIXA 3GBBA 1UTHA 5KCJA 1P99A 3EF7A 4R2BA 5I56A 2GHAA 4EDPA 2V84A 2UYEA 5ICQA 1TFAA 1MM7A 1BLFA 3L6GA 4KPTA 4HTGA 4NE4A 4Q0CA 3PUZE 1PB9A 1QVSA 5ITPA 3W9VA 2DWAA 4NF4A 4H67A 3M3LA 3H3GA 1IEJA 2B65A 4ELOA 5H8FA 4OFJA 1FTMA 2Y7RA 1A99A 3UA8A 1PBPA 2HZKA 4G77A 1FW0A 1B7ZA 3N6UA 3RGYA 1B5HA 4LUBA 3S9LC 1DPEA 3PPRA 1JETA 1ATGA 5FHNA 5KDTB 4RA1A 3K1MA 4OQOA 5BWJA 1ZJLA 3HPIA 1AMFA 3OSQA 2UVHA 3DP4A 3V8XB 3PD9A 2ONRA 1B3FA 4XTCQ 1MS7A 3U93A 4OTEA 5AA4B 3MUQA 4OWDA 4TQUQ 3K1PA 4DCYA 3D4CA 4H6DA 4GLIA 1MRPA 5H8NB 3DM0A 4ZE8A 4IO5A 2HXWA 2ANJA 5BUUA 3PUXE 1O63A 2XXWA 1AIVA 4R6YA 2YLNA 2ZYKA 1Y4TA 4Q8RA 1MXZA 3U94A 4OERA 1PEBA 1ZMGA 3I6VA 1MY2A 3PMXA 2DOJA 3MPLA 2XX7A 5HM4B 2G93A 4QFKA 2NWJA 1RKMA 2HQ0A 2FYIA 5I2KA 4QSDA 3GLBA 4F3PA 3CSBA 3C35A 4R6KA 1XVXA 2ZNSA 3G3GA 3G3JA 4F29A 1MH4A 3R6UA 4GXSB 3O6HA 2R71A 1FTKA 4QHQA 3EPEA 2PBWA 5DVFA 1H3DA 3V89B 1NFTA 3IX1A 4H8IA 2I48A 4IGRA 5TP9A 4R72A 3RNNA 2OBGA 2F7CA 4X48A 4PP0A 2X7QA 4KYSA 3O66A 3ILTB 3OO9A 4O3BA 2UYFA 3IR1A 3IB2A 4TLLB 5IAIA 1MDQA 3T9VA 3PMVA 4NWCA 2I3WA 3MW0A 4PFYA 2LAOA 3U1OA 2HAVA 3H6UA 3IOTA 3MAMA 4PFTA 4X1BA 3ZKLA 3ECRA 4XKQA 4OXVA 3RTFB 3VXCA 3MQ9A 2Z8EA 3E4RA 1ZKBA 3WAEA 3B6QA 1N3XA 4BDMA 4F2QA 5EYFA 2E0SA 4F1VA 3PUYE 4JWYA 4G68B 4N13A 2CMOA 3TTMA 5DVJA 1MPBA 4ZEFA 2XXQA 2RKMA 1QJMA 4IY6A 2M8CA 4ELPA 4QF9A 3RQTA 2F7AA 5A5XB 2XD2A 3OXNA 1PB7A 4I8CA 1A55A 5JTYB 4DZ1A 3H6VA 3L6HA 1XHYA 3K6UA 1Q35A 3T66A 3P7IA 4LP2B 3VVFA 2IA4A 5FHMA 4OYVA 2Q89A 1KWHA 2O7IA 1S7YA 4DXBA 2NUVA 4YKJA 1Y1MA 2F6PA 1H76A 3SERA 2O51A 4NWDA 1N76A 2RCAA 1QUJA 1FCKA 1LAGE 5EHMA 4H1XA 4EUOA 2PYYA 4GRKA 1TFDA 2P0SA 3PU5A 2B3BA 5AA2B 1N7XA 4F22A 1LFGA 3K6WA 5FTIA 3FVOA 4BDLA 3CFXA 3FASA 2PVUA 3K6XA 4OZ9A 4N07A 3FJGA 2R6GE 3K0VA 1EZPA 2VP1A 3EHSA 3H06B 3BFUA 2F97A 3O28A 3MBPA 3OENA 3FVKA 1SYIA 1PB8A 2HCAA 3B6WA 5H8HB 3KFMA 2ZXTA 4M1VA 5KDTA 4I62A 3UK4A 2ZNTA 2ONKE 1LLSA 3CVGA 1MY1A 1OLAA 1P1UA 1JW4A 4EXKA 1JVYA 3I5OA 3FIRA 4YMAA 1MQGA 1L5TA 3FXRA 4G8NA 1YTVA 1B4HA 2DWJA 3U72A 1NNTA 1B3EA 3LSFB 4I9DA 1IUDA 5H8QB 4QFOA 5AA4A 4IGTA 5AE4A 3T9HB 1F9BA 5H8NA 4THIA 4KR5A 2X7PA 3IJOB 2O1LA 4OESA 4HW8A 1I6BA 1O64A 1TWYA 1B32A 3OEKA 4MFIA 5CRYA 4PFUA 3PPOA 1B05A 5K2XA 4JB7A 3IB0A 1GR2A 4LQ5A 1EZOA 1N04A 1USYH 4C1TA 4JSDA 2Q9TA 1MPCA 1LAHE 2XXHA 4M4GA 2O1MA 2ABHA 1IIWA 1II5A 4EF2A 1A8EA 4PFWA 4IO6A 3M3KA 1OQHA 3TEPA 5IKBA 1IXGA 4YICA 1FTOA 3KJTA 4RXLA 2F78A 3MC2A 4E0WA 1UTBB 2KLFA 4YZZA 3ZKKA 3PV0E 2X26A 1B3HA 3O29A 5HBCA 3CSGA 5I58B 3SEVA 1T0KA 3QSLA 3S9EA 1CE2A 5DEXB 3TPAA 4DLDA 1NL5A 1SW4A 4R9FA 1NH7A 1ZU0A 2B3FA 3K1NA 2GHBA 4UA8A 3FGSA 1BIYA 3PGFA 2H25A 3FUZA 3EQ1A 1GTKA 2YJPA 3TODA 1D9VA 3B6TA 4YB5A 2NOOA 2OZZA 4POXA 4NF6B 3A3CA 1WVJA 2O69A 3QXMA 1BTJA 3RUMA 3MZBA 1M5EA 2UVGA 4ZZEA 1B1HA 1M5CA 2ZNUA 2DVCA 1MH3A 1B3GA 1OMPA 2F5XA 5I59B 3K02A 4PE5B 4XIGQ 2QJEA 3TDJA 4U4XA 1XS5A 3FXUA 3RT8A 4NEDA 2OLBA 1B46A 3DP6A 2A5SA 4YKPA 4U1ZA 4F1UA 2DE2A 1LBBA 4MF3A 2DS9A 2QS2A 4R73A 1N7WA 1MXYA 3MPKA 1A7LA 1GV8A 2XHDA 5CMBA 2AL4A 4OMBA 3C4MA 4H65A 5CM6A 4Q30B 2REGA 3KG2A 4FECA 3FATA 3R26A 1SI1A 3TTNA 4QSCA 4GL8A 1URGA 4MLQA 1RYXA 1I6QA 4R74A 3O6GA 1NNKA 5JTYA 3BKIB 3FXQA 3MVZA 1Y4CA 1PDAA 2NXOA 1LAFE 2I4CA 3OO7A 2F34A 2XX8A 1JNFA 2HZLA 3CI8A 3VXBA 1EH3A 4ZS9A 1IITA 1SW2A 1POTA 4DDDA 1A54A 1UQWA 2F36A 5ISUA 3BBRA 1XT8A 4BLAA 2UVJA 2RC7A 1DSNA 4LVQA 3VLWA 1H43A 3EHUA 4JBZA 3UGWA 4RJZA 1NKXA 2RC9A 2H9BA 3S9MC 5AA2A 1DOTA 3OSRA 3E9XA 4BDNA 3K6VA 4H0WA 2QSXA 3U8QA 1MY4A 2OCUA 3Q28A 3UN6A 4IO2A 1OVBA 4GOTA 3IAZA 5I2NB 4DIGA 1MM6A 3PD8A 4FATA 5TPAB 1B9JA 3OEMA 5H8HA 3CG3A 4MBPA 3VVDA 3EHTA 4EQ7A 1JVXA 2ONSA 3USDA 3T22A 4EXLA 3FD3A 3IB1A 4JSOA 4DXUA 1IXCA 3SEUA 4MLVA 1B1XA 4KFQA 4Z0IA 3S4UA 2D3IA 4KHZE 1JQFA 5I57B 5H8QA 4GVOA 1QKBA 3FV1A 2ZMBA 4GL0A 4FAJA 1R1NA 1JEVA 1R6ZA 3H6WA 4HCYA 4DXCA 4G68C 3QAXA 3N94A 1B4ZA 3SKPA 2PT2A 2Y84A 1SYHA 2I0CA 3SETA 1YCJA 4JDFA 1AOVA 4POWA 3I3VA 1MDP1 4YKIA 1JW5A 1XVYA 4OENA 3KN7A 3JYRA 3R7XA 3LR1A 4NF4B 5L9OA 3TFLA 1LGBC 3F11A 4O3AA 2RINA 1Q1KA 5ELVA 2F6GA 1B51A 3N6TA 4F18A 4DCXA 4RPOA 3N26A 2GFEA 2HAUA 3KBRA 1SD3A 2XXYA 1GGGA 2QPQA 5I84A 2VOZA 1A8FA 1DTGA 1HSLA 3G3HA 2A5TB 4FJPA 2Q2AA 4XKRA 3CRBA 3TCFA 1PC3A 3ZSFA 1SBPA 4I1DA 3FV2A 4KCCA 1UTBA 3E3KA 3TTLA 5TU0A 1QUIA 5ICTA 3TYHA 5I58A 1VSOA 3TAJA 5CC2A 3E13X 3QK6A 2H98A 3Q26A 3O97A 5AA2D 4EQ9A 4KI0E 5FTHA 3H6TA 5DEXA 4P11A 3TCGA 2O84X 2DQVA 2Z23A 1R9QA 3C36A 1Y3NA 3C32A 5DYHA 3PUVE 4N6PA 2DSFA 4H5GA 2Q88A 3ODBA 2O7UA 2Q8JA 4FEDA 4F19A 4KCDA 4NMYA 2VD3A 4GXAA 1J1NA 4AB6A 3KOSA 3JZJA 2RCBA 3EN3A 3OELA 1ELJA 2ESNA 3KEIA 3MP1A 2E1SA 3C9HA 2THIA 3T9XB 4HS7A 3BFTA 1P1WA 3W15C 4AB5A 1ZLQA 3G7WA 3H4ZA 4GQOA 2Z8FA 4TLMB 2D5WA 2I58A 1EU8A 5JEIA 3HO7A 4RK2A 4IO3A 4ONYA 4U4SA 3VV5A 1D4NA 3DLNA 5EHSA 4RK9A 2Y7WA 3A09A 4FEBA 3O6IA 1DTZA 3B7DA 3HHGA 1R9LA 1Z7ME 3OMBA 3IO6A 4IO4A 4IB2A 1B0HA 4GFRA 5B70A 4OFLA 4JXIA 1B58A 2PMSA 4HCWA 1LBCA 3C33A 1S50A 3VVEA 3UP9A 4GWOA 2XX9A 3RTWB 3M8UA 4Q5TA 4H8JA 2ZYMA 4QFPA 4ZE9A 3RY3A 1JEUA 2CZLA 2OK2A 2WKYA 3SEWA 1Y3QA 3AXFA 3SESA 2Y7IA 1AH5A 3DP8A 4ZEBA 3QIMA 1B0LA 5CMMA 1USYE 2V3QA 3IL1B 1MY0A 5I2NA 3MVWA 4YB7A 2QMWA 4YB6A 1MXUA 3CIJA 2O68A 3SEYA 5TPAA 2I4BA 4R2FA 1D3KA 1LCTA 3H03A 3VDFA 3OO8A 4LA9A 2F35A 4U1OA 1VFDA 1SDXA 5KZTA 5L9MA 3MP6A 4MH5A 2V93A 2IEEA 4ND9A 3HCQA 3MJNA 4R9GA 4NF5B 4XKPA 5CBSA 3KN3A 2RC8A 4FE8A 4PETA 3VLUA 1A40A 4IO7A 1TXFA 2GH9A 2VD2A 5F7VA 1FQBA 4LZ8A 3TKDA 4YAHX 4QRZA 1NNPA 1XOCA 3O2AA 3THIA 3HSTA 1BP5A 2DYXA 2I6EA 4OVJA 3DELB 2R9JA 5AA1A 2I3VA 2XXIA 4X9TA 1B6HA 3VLVA 3HN0A 3LBSA 3UIFA 2P2AA 1B7HA 3K2DA 4NF8B 2W7YA 4OHNA
chains in the Genus database with same CATH superfamily
2I0BA 3FVGA 2YPNA 1QKAA 2AYSA 5AA3A 1ZBMA 4P56A 4QBAA 4YKKA 1LSTA 3JV9A 4UACA 4KYEA 5DVIA 1P1OA 4LZ5A 4U22A 3G3FA 1OIBA 1URDA 2BJJX 4YMBA 2XD3A 1IQ7A 4PF6A 4G68A 1N0TA 2A5TA 2DWIA 1S9TA 3MWBA 2VPOA 1M5DA 1O7TA 2P1SA 1LFIA 3H7MA 1LEVA 4R6HA 2PFZA 4ZZAA 2XXTA 4Z7EA 3K01A 3PPNA 3MP8A 5A5XA 4I40A 1NNFA 1XC1A 3C31A 2R8TA 1FTJA 1SVXB 3V5AA 3OD7A 4F39A 5EQ7A 3RN8A 4MEVA 1IMDA 1PBQA 3ROJA 3RLFE 2HFBA 2AL5A 5A5LA 5F24A 3HFUA 2Z22A 3HV1A 4RY1A 4GX6A 3FJMA 3IOUA 1YPNA 2VHAA 3RPLB 4KD5A 2MKZA 3MZ1A 4F3GA 2V25A 4BDRA 1Y9UA 3QUFA 4BDOA 4F31B 4JWXA 2DXRA 3IOVA 4MX6A 1B5JA 2XXVA 2XXUA 2ZYNA 1YXIA 1IXIA 2HEUA 2OWSA 4P0IA 4OFOA 4GX3A 1OVTA 4RNSA 1HSJA 5ITOA 4XKNA 2ZZXA 4L17A 2VGQA 1DPPA 2Z8DA 1YAEA 2DE4A 4HE1A 1ANFA 3B8BA 1FPIA 4ISUA 3G3IA 3RT6B 1POY1 4P9KA 3GBAA 2DP8A 5K2YA 5DTBA 1M5FA 1H44A 1KA1A 4K3FA 4OVRA 4DI4B 2DWHA 2H99A 4MJOA 1P1NA 4LATA 3TZAA 3RPWA 1OLCA 4TOZA 3IJXB 3EKIA 2UVIA 3T96B 3N5LA 3O9PA 1JW1A 1NV4A 1WDNA 4X8RA 1ZTYA 1FQAA 4F3SA 4XF5A 3IOWA 4HXVA 1IZ1A 2OJTA 1B52A 1D9YA 5HPQA 2QL3A 3FVNA 1FQCA 4XXUA 3UORA 3CFZA 2Y7KA 1OQGA 5IZ1A 4F1YA 1UTHB 2FA7A 5KCJB 3KZGA 2G29A 5H8SA 2ZYOA 2QMXA 1URSA 3WAFA 3V83A 1H45A 3MVXA 5I56B 4P0GA 4ZEIA 3LSLA 4QFLA 3LSWA 1I69A 4G2ZA 4NN3A 3G3KA 5L8DA 1BKAA 1Y1ZA 3TUSA 3K4UA 1FTLA 3FXBA 1RYOA 3T0JA 4KYDA 3MZ9A 1B5IA 1VE4A 4ZDMA 4EQBA 4GWUA 3KGCA 2OX3A 1LB8A 1VFEA 2O6AA 2NVUB 2PX1A 4F3BA 1MQJA 1TT1A 2FNCA 3T9UA 2XXRA 4WXJA 4I3EA 5H8FB 5ET7A 1MPDA 4G8MA 1FQEA 3CG1A 4LQ2A 2QS4A 3KSJA 2DE3A 3LUYA 1NH8A 1US4A 1SI0A 2REJA 5J1DA 1GVCA 4PGNA 3TTRA 3SEXA 1Z7NE 3Q29A 5CI5A 4WKMA 3ZS6A 4ELQA 2B4LA 5CMKA 3IO4A 5DT6A 1B2HA 1CB6A 4QSEA 2XXXA 3CFLA 4H5FA 1N84A 2F3BA 1QUKA 4N4UA 5CMCA 4OEVA 4ELRA 5IGAA 3HHFA 2GRVA 1NV3A 4ESXA 3PPQA 3OO6A 4GWYA 3A29A 1N3WA 4ESWA 4NF5A 2Q2CA 4QXDA 4U23A 2F7BA 4NTLA 3IORA 1IXHA 3KJ7A 3TELA 1MXVA 4BDQA 1I6AA 1MQDA 4ECFA 1VR5A 3GZGA 4MNCA 4NF6A 4C0RA 3A3UA 2P3VA 4OEUA 4C1UA 1LB9A 3D4GA 3QUJA 4AQ4A 4RYAA 1HSEA 1NUYA 2XXPA 4NF8A 2QRYA 4N6DA 2D21A 2Y5KA 5I59A 2Y7PA 2FIEA 4E0XA 5FHOA 3Q27A 1AL3A 3SDFA 5I2KB 3PMWA 3TQLA 4KQPA 4JVDA 4O3CA 4JWOA 3VFJA 3OOAA 2F8DA 3QYTA 3T93B 1MQIA 2RF1A 5M2VA 1DMBA 3LSXA 3LC8A 5B7DA 2GQ1A 4U21A 1ZIUA 1SW5A 5F1QA 3PPPA 1FPJA 3MVYA 3K00A 3Q25A 1EZ9A 4NG7A 2QVRA 3M3FA 5TP9B 4XFEA 1UIVA 2ALUA 3U92A 2H4IA 4YU0A 4U2RA 1NMUA 1MXXA 5L9SA 1FQDA 4PQJA 4ZEKA 1MG1A 3FZVA 4WEDA 3TMGA 1MXWA 2V3UA 4PDHA 4GWXA 3KSXA 4F2OA 3IFAA 3RPLA 4LONB 5JK4A 1US5A 3S9NC 1MQHA 1Q9DA 1NUWA 1FPLA 1M5BA 4FIMA 4ZECA 3FJ7A 4IY5A 2XWVA 4GIZA 1FQFA 1P1QA 5LOMA 4X1DA 5ET8A 4N8YA 3QMFA 3LUZA 1Y20A 1LFHA 4OETA 4LZ7A 1SQYA 2I49A 4WEPA 3W9WA 1QW0A 3ONMA 2V3TA 2QS1A 4G8HA 4PGPA 2DVZA 5J16A 2OWTA 2DXYA 4ZEDA 3KOTA 4EF1A 2PT1A 1UIUA 1B7UA 3C34A 2QS3A 3CR9A 2QVVA 1IMBA 5CBRA 4RPNA 1MY3A 1QULA 1FBPA 1LCFA 4GD5A 4DE8A 1LBVA 3S2VA 1YYZA 1WODA 1B3LA 3IK6B 2BJIA 2H5YA 3PUWE 4G4PA 1LAXA 4GF8A 3ILUB 3VE1B 3TTKA 1INPA 1Y3PA 3TQWA 4R75A 2KR0A 5I57A 3KN8A 2UXAA 4H45A 3GXAA 4FORA 4QFNA 1SW1A 1B40A 3TCHA 2AIXA 3GBBA 1UTHA 5KCJA 1P99A 2B4MA 3EF7A 4R2BA 5I56A 2GHAA 4EDPA 2V84A 2UYEA 1K9YA 5ICQA 1TFAA 1MM7A 1BLFA 3L6GA 3T1BA 4KPTA 3FBPA 4HTGA 4NE4A 4Q0CA 3PUZE 1PB9A 5EQ8A 1QVSA 5ITPA 2HPGA 3W9VA 2DWAA 4NF4A 4PF8A 4H67A 3M3LA 3H3GA 2Q74A 4MNPA 1IEJA 2B65A 4MNIA 1DCUA 4ELOA 4PC9A 5H8FA 3NOHA 4OFJA 1FTMA 2PFYA 2Y7RA 4N81A 4PDDA 1A99A 3UA8A 1PBPA 2HZKA 4G77A 1FW0A 1B7ZA 3N6UA 3RGYA 1B5HA 1G0IA 1FBFA 4LUBA 3S9LC 1DPEA 3PPRA 1JETA 1ATGA 5FHNA 5KDTB 4RA1A 3K1MA 4OQOA 5BWJA 1ZJLA 3HPIA 1AMFA 4OVSA 1NUZA 3OSQA 2UVHA 3DP4A 3V8XB 3PD9A 2ONRA 4I3YA 1B3FA 4XTCQ 4PTKA 1MS7A 3U93A 1NV2A 4OTEA 5AA4B 3MUQA 4OWDA 4TQUQ 3K1PA 3D4CA 4DCYA 4H6DA 4GLIA 1MRPA 5H8NB 2XWIA 3DM0A 1RDYA 4ZE8A 2QVUA 4IO5A 2HXWA 2ANJA 5BUUA 3PUXE 1O63A 2XXWA 1FPFA 1AIVA 4R6YA 2YLNA 2ZYKA 1Y4TA 4P8BA 4JVIA 4Q8RA 2F3DA 1MXZA 3U94A 4OERA 1PEBA 1ZMGA 3I6VA 1MY2A 3PMXA 2DOJA 3MPLA 2WEFA 2XX7A 5HM4B 2G93A 4QFKA 2NWJA 1RKMA 2HQ0A 2FYIA 5I2KA 4QSDA 2Q8MA 4OVQA 3GLBA 4F3PA 3GYYA 3CSBA 3C35A 4R6KA 5I7IA 1XVXA 4O7IA 2ZNSA 3G3GA 3G3JA 4F29A 4XEQA 1MH4A 3R6UA 4GXSB 3O6HA 2R71A 1FTKA 4PFIA 4QHQA 3EPEA 1FJ6A 2PBWA 5DVFA 1H3DA 4OVTA 1NFTA 3IX1A 3V89B 1NV0A 4H8IA 2I48A 4IGRA 5TP9A 4R72A 3RNNA 2OBGA 4KXPA 2F7CA 4X48A 4PP0A 2X7QA 4KYSA 2CZIA 4PBQA 3O66A 3ILTB 3OO9A 4O3BA 1FBEA 2UYFA 3IR1A 3IB2A 4TLLB 5IAIA 1MDQA 3IFCA 4PFRA 3T9VA 3PMVA 4NWCA 2I3WA 3MW0A 4PFYA 2LAOA 3U1OA 2HAVA 3H6UA 3IOTA 3MAMA 4PFTA 4X1BA 3ZKLA 3ECRA 4PAKA 4HE0A 4XKQA 4P1LA 4OXVA 3RTFB 3VXCA 3MQ9A 2P3NA 2Z8EA 3E4RA 1ZKBA 3WAEA 3B6QA 1N3XA 4BDMA 4F2QA 5EYFA 2E0SA 4F1VA 3PUYE 4JWYA 4JVCA 1JP4A 4G68B 4N13A 1QGXA 2CMOA 3TTMA 1DK4A 5DVJA 1MPBA 4ZEFA 2XXQA 2RKMA 1FJ9A 3MYUA 1FPEA 1QJMA 4IY6A 2M8CA 4ELPA 4QF9A 4MMPA 3RQTA 2F7AA 5A5XB 2XD2A 3OXNA 1PB7A 4I8CA 1A55A 5JTYB 4DZ1A 3H6VA 3L6HA 1XHYA 3K6UA 4NX1A 1Q35A 3T66A 3P7IA 4LP2B 3VVFA 2IA4A 1FBCA 5FHMA 4OYVA 2Q89A 1KWHA 2O7IA 1S7YA 4DXBA 2NUVA 4YKJA 1Y1MA 4O8MA 2F6PA 1H76A 5T3JA 1G0HA 3SERA 2O51A 4NWDA 5FBPA 1N76A 2RCAA 1QUJA 1FCKA 4P3LA 1LAGE 5EHMA 4H1XA 1RDXA 2PYYA 4EUOA 4GRKA 1TFDA 2P0SA 3PU5A 5EQ9A 2B3BA 5AA2B 1N7XA 4F22A 1LFGA 3K6WA 5FTIA 3FVOA 4BDLA 3CFXA 3FASA 2PVUA 3K6XA 4OZ9A 1NUXA 4N07A 3FJGA 2R6GE 3K0VA 1EZPA 2VP1A 3EHSA 3H06B 3BFUA 2F97A 3O28A 3MBPA 3OENA 3FVKA 1SYIA 1PB8A 2HCAA 3B6WA 1YZ0A 5H8HB 3KFMA 2ZXTA 4M1VA 1BK4A 5KDTA 4I62A 3UK4A 1FPKA 2ZNTA 2ONKE 1LLSA 3CVGA 1MY1A 5IZ3B 1P1UA 1OLAA 1JW4A 4EXKA 1JVYA 3I5OA 5I5PA 3FIRA 4YMAA 1MQGA 1L5TA 3FXRA 4G8NA 1YTVA 1B4HA 2DWJA 3U72A 1NNTA 1B3EA 3LSFB 4I9DA 1NI9A 1IUDA 5H8QB 4QFOA 5AA4A 4IGTA 5AE4A 3T9HB 1F9BA 5H8NA 4THIA 4AS4A 1FPGA 4KR5A 2X7PA 3IJOB 2O1LA 4OESA 4HW8A 1I6BA 1O64A 1TWYA 1B32A 3OEKA 4MFIA 5CRYA 2CEXA 4PFUA 3PPOA 1B05A 5K2XA 4JB7A 5LDZA 3CHGA 3IB0A 1GR2A 4LQ5A 1EZOA 4NGUA 2HXRA 1N04A 1USYH 4C1TA 4JSDA 2Q9TA 1MPCA 1LAHE 2XXHA 4M4GA 2O1MA 2ABHA 1IIWA 3KBZA 1II5A 2FIXA 4EF2A 4N91A 1A8EA 2QFLA 4PFWA 4IO6A 2WYPA 3M3KA 1OQHA 1EYIA 1AWBA 3TEPA 4FBPA 5IKBA 1IXGA 4YICA 2V4CA 1FTOA 3KJTA 1XI6A 4RXLA 1SPIA 1FTAA 2F78A 3MC2A 1UTBB 2KLFA 4E0WA 4YZZA 3ZKKA 3PV0E 2KQZA 2X26A 1B3HA 3O29A 5HBCA 3E79A 3CSGA 5EQAA 1NV6A 5I58B 3SEVA 1T0KA 4PFBA 3QSLA 3S9EA 2L5VA 1CE2A 5DEXB 5EYHA 3TPAA 4DLDA 1NL5A 1SW4A 4R9FA 1NH7A 1ZU0A 2B3FA 3K1NA 2GHBA 4UA8A 3FGSA 1FBDA 4PCDA 1BIYA 3PGFA 2H25A 1K9ZA 2ZZWA 3FUZA 3EQ1A 1GTKA 2YJPA 3TODA 1D9VA 3B6TA 4YB5A 2NOOA 2OZZA 2CZHA 4POXA 4NF6B 3A3CA 1WVJA 2O69A 4AS5A 3QXMA 1BTJA 3RUMA 3MZBA 1M5EA 2UVGA 4ZZEA 1B1HA 1M5CA 2ZNUA 2DVCA 1MH3A 1B3GA 1OMPA 2F5XA 5I59B 3K02A 4PE5B 4XIGQ 4N17A 2QJEA 3TDJA 1LBWA 4U4XA 1XS5A 3FXUA 3RT8A 4NEDA 2OLBA 1B46A 3DP6A 2A5SA 4YKPA 4U1ZA 4F1UA 2DE2A 3E78A 1LBBA 4MF3A 2DS9A 2QS2A 4G61A 4MHFA 4R73A 1N7WA 1MXYA 1RDZA 3MPKA 1A7LA 1GV8A 4OA4A 2XHDA 2FBPA 5CMBA 2AL4A 4OMBA 3C4MA 4H65A 5CM6A 4Q30B 2REGA 3KG2A 4FECA 3FATA 5ET6A 3R26A 1SI1A 2HHMA 3TTNA 4N15A 4QSCA 4GL8A 1URGA 4MLQA 1RYXA 1I6QA 4R74A 3O6GA 1NNKA 5JTYA 3BKIB 3FXQA 3MVZA 1Y4CA 1PDAA 2NXOA 1LAFE 2I4CA 3OO7A 2F34A 2XX8A 4PBHA 1JNFA 2HZLA 2FHYA 3CI8A 3VXBA 1EH3A 3ISPA 4ZS9A 4MCOA 5I3SA 1IITA 1SW2A 1POTA 4DDDA 1A54A 1UQWA 2F36A 5ISUA 3BBRA 1XT8A 4BLAA 2UVJA 2RC7A 1VDWA 1NV1A 1DSNA 4LVQA 4PAIA 3VLWA 1H43A 3EHUA 4JBZA 2WX9A 3UGWA 4RJZA 1NKXA 2RC9A 2H9BA 3S9MC 5AA2A 1DOTA 3OSRA 3E9XA 4H0WA 3K6VA 4BDNA 2QSXA 1FBHA 3U8QA 1MY4A 2OCUA 4GWZA 4DI3D 3Q28A 2VPNA 4GBWA 4IO2A 3UN6A 2JJKA 1OVBA 4GOTA 3IAZA 1CNQA 5I2NB 4DIGA 1MM6A 5LTCA 3PD8A 4FATA 5TPAB 1B9JA 3OEMA 1FPBA 4IR8A 5H8HA 3CG3A 4MBPA 3VVDA 3EHTA 4HE2A 4EQ7A 1JVXA 2ONSA 5IZ3A 4GBVA 3USDA 3T22A 3LV0A 4EXLA 3FD3A 3IB1A 4JSOA 4DXUA 1IXCA 3SEUA 4MLVA 4LN5A 1B1XA 4KFQA 4Z0IA 3S4UA 5ESYA 2D3IA 4KHZE 1JQFA 5I57B 4NAPA 5H8QA 4GVOA 1QKBA 3FV1A 2ZMBA 5DW8A 4GL0A 4FAJA 1R1NA 4OVPA 1JEVA 1R6ZA 3H6WA 1KZ8A 4HCYA 4DXCA 4G68C 3QAXA 1NV7A 3N94A 1B4ZA 3SKPA 2PT2A 2Y84A 3B50A 1SYHA 2I0CA 3KC1A 3SETA 1YCJA 4MIJA 4JDFA 1AOVA 4POWA 3I3VA 1MDP1 4YKIA 1FRPA 1JW5A 1XVYA 4OENA 2XWOA 3KN7A 3JYRA 3R7XA 3LR1A 4NF4B 5L9OA 3TFLA 1LGBC 3F11A 4O3AA 2ZZVA 2RINA 1Q1KA 5ELVA 2F6GA 1B51A 3N6TA 4F18A 4DCXA 4RPOA 2WYKA 2GFEA 3N26A 2HAUA 3KBRA 1SD3A 2XXYA 1GGGA 2QPQA 5I84A 2VOZA 1A8FA 1DTGA 1HSLA 3G3HA 1FBGA 2A5TB 4FJPA 4GWWA 2Q2AA 4XKRA 3CRBA 3TCFA 1PC3A 1IMCA 3ZSFA 1SBPA 4I1DA 3FV2A 4KCCA 1UTBA 1IMEA 3E3KA 3KC0A 3TTLA 5TU0A 1QUIA 5ICTA 3TYHA 5I58A 1VSOA 3TAJA 5CC2A 4N8GA 3E13X 3QK6A 2H98A 3Q26A 3O97A 5AA2D 4EQ9A 4KI0E 5FTHA 3H6TA 5DEXA 4P11A 3TCGA 5EYGA 3SZPA 5IM2A 5IZZA 2O84X 2DQVA 2Z23A 1R9QA 3C36A 3RYDA 1Y3NA 3C32A 5DYHA 4N6KA 3PUVE 4N6PA 2DSFA 4H5GA 1IMFA 2Q88A 5ET5A 1LBZA 3ODBA 2O7UA 1EYKA 2Q8JA 1FPDA 4FEDA 4F19A 4KCDA 4NMYA 2VD3A 4GXAA 2FVZA 1J1NA 4AB6A 3KOSA 3JZJA 2RCBA 3EN3A 3OELA 1ELJA 2ESNA 3KEIA 3MP1A 2E1SA 3C9HA 1DBZA 2THIA 3D1RA 3T9XB 1IMAA 4HS7A 3BFTA 4P1EA 1P1WA 3W15C 4AB5A 2XA5A 1ZLQA 3G7WA 3H4ZA 4GQOA 2XXKA 2Z8FA 4TLMB 2D5WA 2I58A 1EU8A 5JEIA 3HO7A 4RK2A 4IO3A 4X04A 4ONYA 4O94A 4U4SA 3VV5A 1D4NA 4NHBA 4P47A 3DLNA 5EHSA 4RK9A 2Y7WA 3A09A 4FEBA 3O6IA 4OANA 1DTZA 3B7DA 3HHGA 1R9LA 1Z7ME 3OMBA 3IO6A 4IO4A 4IB2A 4PE3A 1B0HA 4GFRA 2XWKA 5B70A 4OFLA 4JXIA 2WBBA 2VT5A 1B58A 2PMSA 4UABA 2PCRA 4HCWA 4MAGA 1LBCA 3C33A 1S50A 3VVEA 3UP9A 4GWOA 2XX9A 3RTWB 3M8UA 4Q5TA 1KA0A 2CEYA 4H8JA 2ZYMA 4PAFA 1EYJA 4QFPA 4ZE9A 3RY3A 1JEUA 4GWSA 2CZLA 1D9QA 2OK2A 1LBXA 2WKYA 3SEWA 1Y3QA 3AXFA 4GX4A 3PTYA 3SESA 2Y7IA 4H46A 1AH5A 1LBYA 3DP8A 4ZEBA 3QIMA 1B0LA 5CMMA 1USYE 2V3QA 4NF0A 3IL1B 1MY0A 5I2NA 3MVWA 2CZKA 4YB7A 1FSAA 2QMWA 2DDKA 4YB6A 1MXUA 3CIJA 2O68A 3SEYA 5TPAA 2I4BA 4R2FA 1D3KA 1LCTA 3H03A 3VDFA 3OO8A 4LA9A 2F35A 4U1OA 1VFDA 1SDXA 2Y5LA 5KZTA 5L9MA 3MP6A 4O7MA 4MH5A 2V93A 2IEEA 3BIGA 4ND9A 3HCQA 1NV5A 3MJNA 4R9GA 4NF5B 4XKPA 5CBSA 3KN3A 2RC8A 4FE8A 4PETA 3VLUA 1A40A 3BIHA 4IO7A 1TXFA 2GH9A 2VD2A 5F7VA 1FQBA 4LZ8A 3TKDA 4YAHX 4QRZA 1NNPA 1XOCA 3O2AA 3THIA 3HSTA 1BP5A 3U65A 2DYXA 2I6EA 4OVJA 3MSTA 3DELB 2R9JA 5AA1A 2I3VA 2XXIA 4X9TA 1B6HA 3VLVA 3HN0A 3LBSA 2WBDA 3UIFA 2P2AA 1B7HA 3K2DA 4NQ8A 2OWZA 4NF8B 2W7YA 4OHNA
chains in the Genus database with same CATH topology
2I0BA 3FVGA 2YPNA 1QKAA 2AYSA 5AA3A 1ZBMA 4YKKA 1LSTA 3JV9A 4UACA 4KYEA 5DVIA 1P1OA 4LZ5A 4U22A 3G3FA 1OIBA 1URDA 2BJJX 4YMBA 2XD3A 1IQ7A 4G68A 1N0TA 2A5TA 2DWIA 1S9TA 3MWBA 1M5DA 1O7TA 2P1SA 1LFIA 3H7MA 4R6HA 4ZZAA 2XXTA 4Z7EA 3K01A 3PPNA 3MP8A 5A5XA 1NNFA 1XC1A 3C31A 1FTJA 1SVXB 3V5AA 3OD7A 4F39A 3RN8A 1PBQA 3RLFE 2HFBA 2AL5A 2Z22A 3HV1A 4RY1A 3FJMA 3IOUA 1YPNA 2VHAA 4KD5A 3MZ1A 4F3GA 2V25A 4BDRA 1Y9UA 3QUFA 4BDOA 4F31B 4JWXA 2DXRA 3IOVA 1B5JA 2XXVA 2XXUA 2ZYNA 1IXIA 2HEUA 2OWSA 4P0IA 4OFOA 1OVTA 4RNSA 1HSJA 5ITOA 4XKNA 4L17A 2VGQA 1DPPA 2Z8DA 1YAEA 2DE4A 1ANFA 4ISUA 3G3IA 3RT6B 1POY1 3GBAA 2DP8A 5K2YA 5DTBA 1M5FA 1H44A 4K3FA 2DWHA 2H99A 1P1NA 4LATA 3TZAA 3RPWA 1OLCA 4TOZA 3IJXB 2UVIA 3T96B 3N5LA 3O9PA 1JW1A 1WDNA 1ZTYA 1FQAA 4F3SA 3IOWA 1IZ1A 2OJTA 1B52A 1D9YA 5HPQA 2QL3A 3FVNA 1FQCA 4XXUA 3UORA 3CFZA 2Y7KA 1OQGA 4F1YA 1UTHB 2FA7A 5KCJB 3KZGA 2G29A 5H8SA 2ZYOA 2QMXA 1URSA 3WAFA 3V83A 1H45A 3MVXA 5I56B 4P0GA 4ZEIA 3LSLA 4QFLA 3LSWA 1I69A 4G2ZA 3G3KA 5L8DA 1BKAA 1Y1ZA 3TUSA 3K4UA 1FTLA 1RYOA 4KYDA 3MZ9A 1B5IA 1VE4A 4ZDMA 4EQBA 3KGCA 1LB8A 1VFEA 2O6AA 2NVUB 2PX1A 4F3BA 1MQJA 1TT1A 2FNCA 3T9UA 2XXRA 4WXJA 5H8FB 1MPDA 4G8MA 1FQEA 3CG1A 4LQ2A 2QS4A 3KSJA 2DE3A 3LUYA 1NH8A 1US4A 1SI0A 2REJA 5J1DA 1GVCA 3TTRA 3SEXA 1Z7NE 3Q29A 5CI5A 4WKMA 3ZS6A 4ELQA 5CMKA 3IO4A 5DT6A 1B2HA 1CB6A 4QSEA 2XXXA 3CFLA 4H5FA 1N84A 1QUKA 5CMCA 4ELRA 4OEVA 3HHFA 2GRVA 4ESXA 3PPQA 3OO6A 1N3WA 4ESWA 4NF5A 2Q2CA 4U23A 2F7BA 4NTLA 3IORA 1IXHA 3KJ7A 3TELA 1MXVA 4BDQA 1I6AA 1MQDA 4ECFA 1VR5A 3GZGA 4NF6A 4C0RA 3A3UA 4OEUA 4C1UA 1LB9A 3D4GA 3QUJA 4AQ4A 4RYAA 1HSEA 2XXPA 4NF8A 2QRYA 2D21A 5I59A 2Y7PA 4E0XA 5FHOA 3Q27A 1AL3A 3SDFA 5I2KB 3PMWA 3TQLA 4KQPA 4O3CA 4JWOA 3VFJA 3OOAA 2F8DA 3QYTA 3T93B 1MQIA 2RF1A 5M2VA 1DMBA 3LSXA 3LC8A 5B7DA 4U21A 1ZIUA 1SW5A 5F1QA 3PPPA 3MVYA 3K00A 3Q25A 1EZ9A 3M3FA 5TP9B 1UIVA 2ALUA 3U92A 2H4IA 4YU0A 4U2RA 1NMUA 1MXXA 5L9SA 1FQDA 4PQJA 4ZEKA 1MG1A 3FZVA 4WEDA 3TMGA 1MXWA 2V3UA 3KSXA 4F2OA 4LONB 5JK4A 1US5A 3S9NC 1MQHA 1M5BA 4FIMA 4ZECA 3FJ7A 4IY5A 4GIZA 1FQFA 1P1QA 5LOMA 4X1DA 1Y20A 1LFHA 4OETA 4LZ7A 1SQYA 2I49A 4WEPA 3W9WA 1QW0A 3ONMA 2V3TA 2QS1A 4G8HA 2DVZA 2OWTA 2DXYA 4ZEDA 3KOTA 4EF1A 2PT1A 1UIUA 1B7UA 3C34A 2QS3A 3CR9A 5CBRA 4RPNA 1MY3A 1QULA 1LCFA 4GD5A 4DE8A 3S2VA 1WODA 1B3LA 3IK6B 2H5YA 3PUWE 4G4PA 1LAXA 4GF8A 3ILUB 3VE1B 3TTKA 1Y3PA 3TQWA 4R75A 5I57A 3KN8A 2UXAA 3GXAA 4FORA 4QFNA 1SW1A 1B40A 3TCHA 2AIXA 3GBBA 1UTHA 5KCJA 1P99A 3EF7A 4R2BA 5I56A 2GHAA 4EDPA 2V84A 2UYEA 5ICQA 1TFAA 1MM7A 1BLFA 3L6GA 4KPTA 4HTGA 4NE4A 4Q0CA 3PUZE 1PB9A 1QVSA 5ITPA 3W9VA 2DWAA 4NF4A 4H67A 3M3LA 3H3GA 1IEJA 2B65A 4ELOA 5H8FA 4OFJA 1FTMA 2Y7RA 1A99A 3UA8A 1PBPA 2HZKA 4G77A 1FW0A 1B7ZA 3N6UA 3RGYA 1B5HA 4LUBA 3S9LC 1DPEA 3PPRA 1JETA 1ATGA 5FHNA 5KDTB 4RA1A 3K1MA 4OQOA 5BWJA 1ZJLA 3HPIA 1AMFA 3OSQA 2UVHA 3DP4A 3V8XB 3PD9A 2ONRA 1B3FA 4XTCQ 1MS7A 3U93A 4OTEA 5AA4B 3MUQA 4OWDA 4TQUQ 3K1PA 4DCYA 3D4CA 4H6DA 4GLIA 1MRPA 5H8NB 3DM0A 4ZE8A 4IO5A 2HXWA 2ANJA 5BUUA 3PUXE 1O63A 2XXWA 1AIVA 4R6YA 2YLNA 2ZYKA 1Y4TA 4Q8RA 1MXZA 3U94A 4OERA 1PEBA 1ZMGA 3I6VA 1MY2A 3PMXA 2DOJA 3MPLA 2XX7A 5HM4B 2G93A 4QFKA 2NWJA 1RKMA 2HQ0A 2FYIA 5I2KA 4QSDA 3GLBA 4F3PA 3CSBA 3C35A 4R6KA 1XVXA 2ZNSA 3G3GA 3G3JA 4F29A 1MH4A 3R6UA 4GXSB 3O6HA 2R71A 1FTKA 4QHQA 3EPEA 2PBWA 5DVFA 1H3DA 3V89B 1NFTA 3IX1A 4H8IA 2I48A 4IGRA 5TP9A 4R72A 3RNNA 2OBGA 2F7CA 4X48A 4PP0A 2X7QA 4KYSA 3O66A 3ILTB 3OO9A 4O3BA 2UYFA 3IR1A 3IB2A 4TLLB 5IAIA 1MDQA 3T9VA 3PMVA 4NWCA 2I3WA 3MW0A 4PFYA 2LAOA 3U1OA 2HAVA 3H6UA 3IOTA 3MAMA 4PFTA 4X1BA 3ZKLA 3ECRA 4XKQA 4OXVA 3RTFB 3VXCA 3MQ9A 2Z8EA 3E4RA 1ZKBA 3WAEA 3B6QA 1N3XA 4BDMA 4F2QA 5EYFA 2E0SA 4F1VA 3PUYE 4JWYA 4G68B 4N13A 2CMOA 3TTMA 5DVJA 1MPBA 4ZEFA 2XXQA 2RKMA 1QJMA 4IY6A 2M8CA 4ELPA 4QF9A 3RQTA 2F7AA 5A5XB 2XD2A 3OXNA 1PB7A 4I8CA 1A55A 5JTYB 4DZ1A 3H6VA 3L6HA 1XHYA 3K6UA 1Q35A 3T66A 3P7IA 4LP2B 3VVFA 2IA4A 5FHMA 4OYVA 2Q89A 1KWHA 2O7IA 1S7YA 4DXBA 2NUVA 4YKJA 1Y1MA 2F6PA 1H76A 3SERA 2O51A 4NWDA 1N76A 2RCAA 1QUJA 1FCKA 1LAGE 5EHMA 4H1XA 4EUOA 2PYYA 4GRKA 1TFDA 2P0SA 3PU5A 2B3BA 5AA2B 1N7XA 4F22A 1LFGA 3K6WA 5FTIA 3FVOA 4BDLA 3CFXA 3FASA 2PVUA 3K6XA 4OZ9A 4N07A 3FJGA 2R6GE 3K0VA 1EZPA 2VP1A 3EHSA 3H06B 3BFUA 2F97A 3O28A 3MBPA 3OENA 3FVKA 1SYIA 1PB8A 2HCAA 3B6WA 5H8HB 3KFMA 2ZXTA 4M1VA 5KDTA 4I62A 3UK4A 2ZNTA 2ONKE 1LLSA 3CVGA 1MY1A 1OLAA 1P1UA 1JW4A 4EXKA 1JVYA 3I5OA 3FIRA 4YMAA 1MQGA 1L5TA 3FXRA 4G8NA 1YTVA 1B4HA 2DWJA 3U72A 1NNTA 1B3EA 3LSFB 4I9DA 1IUDA 5H8QB 4QFOA 5AA4A 4IGTA 5AE4A 3T9HB 1F9BA 5H8NA 4THIA 4KR5A 2X7PA 3IJOB 2O1LA 4OESA 4HW8A 1I6BA 1O64A 1TWYA 1B32A 3OEKA 4MFIA 5CRYA 4PFUA 3PPOA 1B05A 5K2XA 4JB7A 3IB0A 1GR2A 4LQ5A 1EZOA 1N04A 1USYH 4C1TA 4JSDA 2Q9TA 1MPCA 1LAHE 2XXHA 4M4GA 2O1MA 2ABHA 1IIWA 1II5A 4EF2A 1A8EA 4PFWA 4IO6A 3M3KA 1OQHA 3TEPA 5IKBA 1IXGA 4YICA 1FTOA 3KJTA 4RXLA 2F78A 3MC2A 4E0WA 1UTBB 2KLFA 4YZZA 3ZKKA 3PV0E 2X26A 1B3HA 3O29A 5HBCA 3CSGA 5I58B 3SEVA 1T0KA 3QSLA 3S9EA 1CE2A 5DEXB 3TPAA 4DLDA 1NL5A 1SW4A 4R9FA 1NH7A 1ZU0A 2B3FA 3K1NA 2GHBA 4UA8A 3FGSA 1BIYA 3PGFA 2H25A 3FUZA 3EQ1A 1GTKA 2YJPA 3TODA 1D9VA 3B6TA 4YB5A 2NOOA 2OZZA 4POXA 4NF6B 3A3CA 1WVJA 2O69A 3QXMA 1BTJA 3RUMA 3MZBA 1M5EA 2UVGA 4ZZEA 1B1HA 1M5CA 2ZNUA 2DVCA 1MH3A 1B3GA 1OMPA 2F5XA 5I59B 3K02A 4PE5B 4XIGQ 2QJEA 3TDJA 4U4XA 1XS5A 3FXUA 3RT8A 4NEDA 2OLBA 1B46A 3DP6A 2A5SA 4YKPA 4U1ZA 4F1UA 2DE2A 1LBBA 4MF3A 2DS9A 2QS2A 4R73A 1N7WA 1MXYA 3MPKA 1A7LA 1GV8A 2XHDA 5CMBA 2AL4A 4OMBA 3C4MA 4H65A 5CM6A 4Q30B 2REGA 3KG2A 4FECA 3FATA 3R26A 1SI1A 3TTNA 4QSCA 4GL8A 1URGA 4MLQA 1RYXA 1I6QA 4R74A 3O6GA 1NNKA 5JTYA 3BKIB 3FXQA 3MVZA 1Y4CA 1PDAA 2NXOA 1LAFE 2I4CA 3OO7A 2F34A 2XX8A 1JNFA 2HZLA 3CI8A 3VXBA 1EH3A 4ZS9A 1IITA 1SW2A 1POTA 4DDDA 1A54A 1UQWA 2F36A 5ISUA 3BBRA 1XT8A 4BLAA 2UVJA 2RC7A 1DSNA 4LVQA 3VLWA 1H43A 3EHUA 4JBZA 3UGWA 4RJZA 1NKXA 2RC9A 2H9BA 3S9MC 5AA2A 1DOTA 3OSRA 3E9XA 4BDNA 3K6VA 4H0WA 2QSXA 3U8QA 1MY4A 2OCUA 3Q28A 3UN6A 4IO2A 1OVBA 4GOTA 3IAZA 5I2NB 4DIGA 1MM6A 3PD8A 4FATA 5TPAB 1B9JA 3OEMA 5H8HA 3CG3A 4MBPA 3VVDA 3EHTA 4EQ7A 1JVXA 2ONSA 3USDA 3T22A 4EXLA 3FD3A 3IB1A 4JSOA 4DXUA 1IXCA 3SEUA 4MLVA 1B1XA 4KFQA 4Z0IA 3S4UA 2D3IA 4KHZE 1JQFA 5I57B 5H8QA 4GVOA 1QKBA 3FV1A 2ZMBA 4GL0A 4FAJA 1R1NA 1JEVA 1R6ZA 3H6WA 4HCYA 4DXCA 4G68C 3QAXA 3N94A 1B4ZA 3SKPA 2PT2A 2Y84A 1SYHA 2I0CA 3SETA 1YCJA 4JDFA 1AOVA 4POWA 3I3VA 1MDP1 4YKIA 1JW5A 1XVYA 4OENA 3KN7A 3JYRA 3R7XA 3LR1A 4NF4B 5L9OA 3TFLA 1LGBC 3F11A 4O3AA 2RINA 1Q1KA 5ELVA 2F6GA 1B51A 3N6TA 4F18A 4DCXA 4RPOA 3N26A 2GFEA 2HAUA 3KBRA 1SD3A 2XXYA 1GGGA 2QPQA 5I84A 2VOZA 1A8FA 1DTGA 1HSLA 3G3HA 2A5TB 4FJPA 2Q2AA 4XKRA 3CRBA 3TCFA 1PC3A 3ZSFA 1SBPA 4I1DA 3FV2A 4KCCA 1UTBA 3E3KA 3TTLA 5TU0A 1QUIA 5ICTA 3TYHA 5I58A 1VSOA 3TAJA 5CC2A 3E13X 3QK6A 2H98A 3Q26A 3O97A 5AA2D 4EQ9A 4KI0E 5FTHA 3H6TA 5DEXA 4P11A 3TCGA 2O84X 2DQVA 2Z23A 1R9QA 3C36A 1Y3NA 3C32A 5DYHA 3PUVE 4N6PA 2DSFA 4H5GA 2Q88A 3ODBA 2O7UA 2Q8JA 4FEDA 4F19A 4KCDA 4NMYA 2VD3A 4GXAA 1J1NA 4AB6A 3KOSA 3JZJA 2RCBA 3EN3A 3OELA 1ELJA 2ESNA 3KEIA 3MP1A 2E1SA 3C9HA 2THIA 3T9XB 4HS7A 3BFTA 1P1WA 3W15C 4AB5A 1ZLQA 3G7WA 3H4ZA 4GQOA 2Z8FA 4TLMB 2D5WA 2I58A 1EU8A 5JEIA 3HO7A 4RK2A 4IO3A 4ONYA 4U4SA 3VV5A 1D4NA 3DLNA 5EHSA 4RK9A 2Y7WA 3A09A 4FEBA 3O6IA 1DTZA 3B7DA 3HHGA 1R9LA 1Z7ME 3OMBA 3IO6A 4IO4A 4IB2A 1B0HA 4GFRA 5B70A 4OFLA 4JXIA 1B58A 2PMSA 4HCWA 1LBCA 3C33A 1S50A 3VVEA 3UP9A 4GWOA 2XX9A 3RTWB 3M8UA 4Q5TA 4H8JA 2ZYMA 4QFPA 4ZE9A 3RY3A 1JEUA 2CZLA 2OK2A 2WKYA 3SEWA 1Y3QA 3AXFA 3SESA 2Y7IA 1AH5A 3DP8A 4ZEBA 3QIMA 1B0LA 5CMMA 1USYE 2V3QA 3IL1B 1MY0A 5I2NA 3MVWA 4YB7A 2QMWA 4YB6A 1MXUA 3CIJA 2O68A 3SEYA 5TPAA 2I4BA 4R2FA 1D3KA 1LCTA 3H03A 3VDFA 3OO8A 4LA9A 2F35A 4U1OA 1VFDA 1SDXA 5KZTA 5L9MA 3MP6A 4MH5A 2V93A 2IEEA 4ND9A 3HCQA 3MJNA 4R9GA 4NF5B 4XKPA 5CBSA 3KN3A 2RC8A 4FE8A 4PETA 3VLUA 1A40A 4IO7A 1TXFA 2GH9A 2VD2A 5F7VA 1FQBA 4LZ8A 3TKDA 4YAHX 4QRZA 1NNPA 1XOCA 3O2AA 3THIA 3HSTA 1BP5A 2DYXA 2I6EA 4OVJA 3DELB 2R9JA 5AA1A 2I3VA 2XXIA 4X9TA 1B6HA 3VLVA 3HN0A 3LBSA 3UIFA 2P2AA 1B7HA 3K2DA 4NF8B 2W7YA 4OHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0B A;  3FVG A;  2YPN A;  1QKA A;  2AYS A;  5AA3 A;  1ZBM A;  4YKK A;  1LST A;  3JV9 A;  4UAC A;  4KYE A;  5DVI A;  1P1O A;  4LZ5 A;  4U22 A;  3G3F A;  1OIB A;  1URD A;  2BJJ X;  4YMB A;  2XD3 A;  1IQ7 A;  4G68 A;  1N0T A;  2A5T A;  2DWI A;  1S9T A;  3MWB A;  1M5D A;  1O7T A;  2P1S A;  1LFI A;  3H7M A;  4R6H A;  4ZZA A;  2XXT A;  4Z7E A;  3K01 A;  3PPN A;  3MP8 A;  5A5X A;  1NNF A;  1XC1 A;  3C31 A;  1FTJ A;  1SVX B;  3V5A A;  3OD7 A;  4F39 A;  3RN8 A;  1PBQ A;  3RLF E;  2HFB A;  2AL5 A;  2Z22 A;  3HV1 A;  4RY1 A;  3FJM A;  3IOU A;  1YPN A;  2VHA A;  4KD5 A;  3MZ1 A;  4F3G A;  2V25 A;  4BDR A;  1Y9U A;  3QUF A;  4BDO A;  4F31 B;  4JWX A;  2DXR A;  3IOV A;  1B5J A;  2XXV A;  2XXU A;  2ZYN A;  1IXI A;  2HEU A;  2OWS A;  4P0I A;  4OFO A;  1OVT A;  4RNS A;  1HSJ A;  5ITO A;  4XKN A;  4L17 A;  2VGQ A;  1DPP A;  2Z8D A;  1YAE A;  2DE4 A;  1ANF A;  4ISU A;  3G3I A;  3RT6 B;  1POY 1;  3GBA A;  2DP8 A;  5K2Y A;  5DTB A;  1M5F A;  1H44 A;  4K3F A;  2DWH A;  2H99 A;  1P1N A;  4LAT A;  3TZA A;  3RPW A;  1OLC A;  4TOZ A;  3IJX B;  2UVI A;  3T96 B;  3N5L A;  3O9P A;  1JW1 A;  1WDN A;  1ZTY A;  1FQA A;  4F3S A;  3IOW A;  1IZ1 A;  2OJT A;  1B52 A;  1D9Y A;  5HPQ A;  2QL3 A;  3FVN A;  1FQC A;  4XXU A;  3UOR A;  3CFZ A;  2Y7K A;  1OQG A;  4F1Y A;  1UTH B;  2FA7 A;  5KCJ B;  3KZG A;  2G29 A;  5H8S A;  2ZYO A;  2QMX A;  1URS A;  3WAF A;  3V83 A;  1H45 A;  3MVX A;  5I56 B;  4P0G A;  4ZEI A;  3LSL A;  4QFL A;  3LSW A;  1I69 A;  4G2Z A;  3G3K A;  5L8D A;  1BKA A;  1Y1Z A;  3TUS A;  3K4U A;  1FTL A;  1RYO A;  4KYD A;  3MZ9 A;  1B5I A;  1VE4 A;  4ZDM A;  4EQB A;  3KGC A;  1LB8 A;  1VFE A;  2O6A A;  2NVU B;  2PX1 A;  4F3B A;  1MQJ A;  1TT1 A;  2FNC A;  3T9U A;  2XXR A;  4WXJ A;  5H8F B;  1MPD A;  4G8M A;  1FQE A;  3CG1 A;  4LQ2 A;  2QS4 A;  3KSJ A;  2DE3 A;  3LUY A;  1NH8 A;  1US4 A;  1SI0 A;  2REJ A;  5J1D A;  1GVC A;  3TTR A;  3SEX A;  1Z7N E;  3Q29 A;  5CI5 A;  4WKM A;  3ZS6 A;  4ELQ A;  5CMK A;  3IO4 A;  5DT6 A;  1B2H A;  1CB6 A;  4QSE A;  2XXX A;  3CFL A;  4H5F A;  1N84 A;  1QUK A;  5CMC A;  4ELR A;  4OEV A;  3HHF A;  2GRV A;  4ESX A;  3PPQ A;  3OO6 A;  1N3W A;  4ESW A;  4NF5 A;  2Q2C A;  4U23 A;  2F7B A;  4NTL A;  3IOR A;  1IXH A;  3KJ7 A;  3TEL A;  1MXV A;  4BDQ A;  1I6A A;  1MQD A;  4ECF A;  1VR5 A;  3GZG A;  4NF6 A;  4C0R A;  3A3U A;  4OEU A;  4C1U A;  1LB9 A;  3D4G A;  3QUJ A;  4AQ4 A;  4RYA A;  1HSE A;  2XXP A;  4NF8 A;  2QRY A;  2D21 A;  5I59 A;  2Y7P A;  4E0X A;  5FHO A;  3Q27 A;  1AL3 A;  3SDF A;  5I2K B;  3PMW A;  3TQL A;  4KQP A;  4O3C A;  4JWO A;  3VFJ A;  3OOA A;  2F8D A;  3QYT A;  3T93 B;  1MQI A;  2RF1 A;  5M2V A;  1DMB A;  3LSX A;  3LC8 A;  5B7D A;  4U21 A;  1ZIU A;  1SW5 A;  5F1Q A;  3PPP A;  3MVY A;  3K00 A;  3Q25 A;  1EZ9 A;  3M3F A;  5TP9 B;  1UIV A;  2ALU A;  3U92 A;  2H4I A;  4YU0 A;  4U2R A;  1NMU A;  1MXX A;  5L9S A;  1FQD A;  4PQJ A;  4ZEK A;  1MG1 A;  3FZV A;  4WED A;  3TMG A;  1MXW A;  2V3U A;  3KSX A;  4F2O A;  4LON B;  5JK4 A;  1US5 A;  3S9N C;  1MQH A;  1M5B A;  4FIM A;  4ZEC A;  3FJ7 A;  4IY5 A;  4GIZ A;  1FQF A;  1P1Q A;  5LOM A;  4X1D A;  1Y20 A;  1LFH A;  4OET A;  4LZ7 A;  1SQY A;  2I49 A;  4WEP A;  3W9W A;  1QW0 A;  3ONM A;  2V3T A;  2QS1 A;  4G8H A;  2DVZ A;  2OWT A;  2DXY A;  4ZED A;  3KOT A;  4EF1 A;  2PT1 A;  1UIU A;  1B7U A;  3C34 A;  2QS3 A;  3CR9 A;  5CBR A;  4RPN A;  1MY3 A;  1QUL A;  1LCF A;  4GD5 A;  4DE8 A;  3S2V A;  1WOD A;  1B3L A;  3IK6 B;  2H5Y A;  3PUW E;  4G4P A;  1LAX A;  4GF8 A;  3ILU B;  3VE1 B;  3TTK A;  1Y3P A;  3TQW A;  4R75 A;  5I57 A;  3KN8 A;  2UXA A;  3GXA A;  4FOR A;  4QFN A;  1SW1 A;  1B40 A;  3TCH A;  2AIX A;  3GBB A;  1UTH A;  5KCJ A;  1P99 A;  3EF7 A;  4R2B A;  5I56 A;  2GHA A;  4EDP A;  2V84 A;  2UYE A;  5ICQ A;  1TFA A;  1MM7 A;  1BLF A;  3L6G A;  4KPT A;  4HTG A;  4NE4 A;  4Q0C A;  3PUZ E;  1PB9 A;  1QVS A;  5ITP A;  3W9V A;  2DWA A;  4NF4 A;  4H67 A;  3M3L A;  3H3G A;  1IEJ A;  2B65 A;  4ELO A;  5H8F A;  4OFJ A;  1FTM A;  2Y7R A;  1A99 A;  3UA8 A;  1PBP A;  2HZK A;  4G77 A;  1FW0 A;  1B7Z A;  3N6U A;  3RGY A;  1B5H A;  4LUB A;  3S9L C;  1DPE A;  3PPR A;  1JET A;  1ATG A;  5FHN A;  5KDT B;  4RA1 A;  3K1M A;  4OQO A;  5BWJ A;  1ZJL A;  3HPI A;  1AMF A;  3OSQ A;  2UVH A;  3DP4 A;  3V8X B;  3PD9 A;  2ONR A;  1B3F A;  4XTC Q;  1MS7 A;  3U93 A;  4OTE A;  5AA4 B;  3MUQ A;  4OWD A;  4TQU Q;  3K1P A;  4DCY A;  3D4C A;  4H6D A;  4GLI A;  1MRP A;  5H8N B;  3DM0 A;  4ZE8 A;  4IO5 A;  2HXW A;  2ANJ A;  5BUU A;  3PUX E;  1O63 A;  2XXW A;  1AIV A;  4R6Y A;  2YLN A;  2ZYK A;  1Y4T A;  4Q8R A;  1MXZ A;  3U94 A;  4OER A;  1PEB A;  1ZMG A;  3I6V A;  1MY2 A;  3PMX A;  2DOJ A;  3MPL A;  2XX7 A;  5HM4 B;  2G93 A;  4QFK A;  2NWJ A;  1RKM A;  2HQ0 A;  2FYI A;  5I2K A;  4QSD A;  3GLB A;  4F3P A;  3CSB A;  3C35 A;  4R6K A;  1XVX A;  2ZNS A;  3G3G A;  3G3J A;  4F29 A;  1MH4 A;  3R6U A;  4GXS B;  3O6H A;  2R71 A;  1FTK A;  4QHQ A;  3EPE A;  2PBW A;  5DVF A;  1H3D A;  3V89 B;  1NFT A;  3IX1 A;  4H8I A;  2I48 A;  4IGR A;  5TP9 A;  4R72 A;  3RNN A;  2OBG A;  2F7C A;  4X48 A;  4PP0 A;  2X7Q A;  4KYS A;  3O66 A;  3ILT B;  3OO9 A;  4O3B A;  2UYF A;  3IR1 A;  3IB2 A;  4TLL B;  5IAI A;  1MDQ A;  3T9V A;  3PMV A;  4NWC A;  2I3W A;  3MW0 A;  4PFY A;  2LAO A;  3U1O A;  2HAV A;  3H6U A;  3IOT A;  3MAM A;  4PFT A;  4X1B A;  3ZKL A;  3ECR A;  4XKQ A;  4OXV A;  3RTF B;  3VXC A;  3MQ9 A;  2Z8E A;  3E4R A;  1ZKB A;  3WAE A;  3B6Q A;  1N3X A;  4BDM A;  4F2Q A;  5EYF A;  2E0S A;  4F1V A;  3PUY E;  4JWY A;  4G68 B;  4N13 A;  2CMO A;  3TTM A;  5DVJ A;  1MPB A;  4ZEF A;  2XXQ A;  2RKM A;  1QJM A;  4IY6 A;  2M8C A;  4ELP A;  4QF9 A;  3RQT A;  2F7A A;  5A5X B;  2XD2 A;  3OXN A;  1PB7 A;  4I8C A;  1A55 A;  5JTY B;  4DZ1 A;  3H6V A;  3L6H A;  1XHY A;  3K6U A;  1Q35 A;  3T66 A;  3P7I A;  4LP2 B;  3VVF A;  2IA4 A;  5FHM A;  4OYV A;  2Q89 A;  1KWH A;  2O7I A;  1S7Y A;  4DXB A;  2NUV A;  4YKJ A;  1Y1M A;  2F6P A;  1H76 A;  3SER A;  2O51 A;  4NWD A;  1N76 A;  2RCA A;  1QUJ A;  1FCK A;  1LAG E;  5EHM A;  4H1X A;  4EUO A;  2PYY A;  4GRK A;  1TFD A;  2P0S A;  3PU5 A;  2B3B A;  5AA2 B;  1N7X A;  4F22 A;  1LFG A;  3K6W A;  5FTI A;  3FVO A;  4BDL A;  3CFX A;  3FAS A;  2PVU A;  3K6X A;  4OZ9 A;  4N07 A;  3FJG A;  2R6G E;  3K0V A;  1EZP A;  2VP1 A;  3EHS A;  3H06 B;  3BFU A;  2F97 A;  3O28 A;  3MBP A;  3OEN A;  3FVK A;  1SYI A;  1PB8 A;  2HCA A;  3B6W A;  5H8H B;  3KFM A;  2ZXT A;  4M1V A;  5KDT A;  4I62 A;  3UK4 A;  2ZNT A;  2ONK E;  1LLS A;  3CVG A;  1MY1 A;  1OLA A;  1P1U A;  1JW4 A;  4EXK A;  1JVY A;  3I5O A;  3FIR A;  4YMA A;  1MQG A;  1L5T A;  3FXR A;  4G8N A;  1YTV A;  1B4H A;  2DWJ A;  3U72 A;  1NNT A;  1B3E A;  3LSF B;  4I9D A;  1IUD A;  5H8Q B;  4QFO A;  5AA4 A;  4IGT A;  5AE4 A;  3T9H B;  1F9B A;  5H8N A;  4THI A;  4KR5 A;  2X7P A;  3IJO B;  2O1L A;  4OES A;  4HW8 A;  1I6B A;  1O64 A;  1TWY A;  1B32 A;  3OEK A;  4MFI A;  5CRY A;  4PFU A;  3PPO A;  1B05 A;  5K2X A;  4JB7 A;  3IB0 A;  1GR2 A;  4LQ5 A;  1EZO A;  1N04 A;  1USY H;  4C1T A;  4JSD A;  2Q9T A;  1MPC A;  1LAH E;  2XXH A;  4M4G A;  2O1M A;  2ABH A;  1IIW A;  1II5 A;  4EF2 A;  1A8E A;  4PFW A;  4IO6 A;  3M3K A;  1OQH A;  3TEP A;  5IKB A;  1IXG A;  4YIC A;  1FTO A;  3KJT A;  4RXL A;  2F78 A;  3MC2 A;  4E0W A;  1UTB B;  2KLF A;  4YZZ A;  3ZKK A;  3PV0 E;  2X26 A;  1B3H A;  3O29 A;  5HBC A;  3CSG A;  5I58 B;  3SEV A;  1T0K A;  3QSL A;  3S9E A;  1CE2 A;  5DEX B;  3TPA A;  4DLD A;  1NL5 A;  1SW4 A;  4R9F A;  1NH7 A;  1ZU0 A;  2B3F A;  3K1N A;  2GHB A;  4UA8 A;  3FGS A;  1BIY A;  3PGF A;  2H25 A;  3FUZ A;  3EQ1 A;  1GTK A;  2YJP A;  3TOD A;  1D9V A;  3B6T A;  4YB5 A;  2NOO A;  2OZZ A;  4POX A;  4NF6 B;  3A3C A;  1WVJ A;  2O69 A;  3QXM A;  1BTJ A;  3RUM A;  3MZB A;  1M5E A;  2UVG A;  4ZZE A;  1B1H A;  1M5C A;  2ZNU A;  2DVC A;  1MH3 A;  1B3G A;  1OMP A;  2F5X A;  5I59 B;  3K02 A;  4PE5 B;  4XIG Q;  2QJE A;  3TDJ A;  4U4X A;  1XS5 A;  3FXU A;  3RT8 A;  4NED A;  2OLB A;  1B46 A;  3DP6 A;  2A5S A;  4YKP A;  4U1Z A;  4F1U A;  2DE2 A;  1LBB A;  4MF3 A;  2DS9 A;  2QS2 A;  4R73 A;  1N7W A;  1MXY A;  3MPK A;  1A7L A;  1GV8 A;  2XHD A;  5CMB A;  2AL4 A;  4OMB A;  3C4M A;  4H65 A;  5CM6 A;  4Q30 B;  2REG A;  3KG2 A;  4FEC A;  3FAT A;  3R26 A;  1SI1 A;  3TTN A;  4QSC A;  4GL8 A;  1URG A;  4MLQ A;  1RYX A;  1I6Q A;  4R74 A;  3O6G A;  1NNK A;  5JTY A;  3BKI B;  3FXQ A;  3MVZ A;  1Y4C A;  1PDA A;  2NXO A;  1LAF E;  2I4C A;  3OO7 A;  2F34 A;  2XX8 A;  1JNF A;  2HZL A;  3CI8 A;  3VXB A;  1EH3 A;  4ZS9 A;  1IIT A;  1SW2 A;  1POT A;  4DDD A;  1A54 A;  1UQW A;  2F36 A;  5ISU A;  3BBR A;  1XT8 A;  4BLA A;  2UVJ A;  2RC7 A;  1DSN A;  4LVQ A;  3VLW A;  1H43 A;  3EHU A;  4JBZ A;  3UGW A;  4RJZ A;  1NKX A;  2RC9 A;  2H9B A;  3S9M C;  5AA2 A;  1DOT A;  3OSR A;  3E9X A;  4BDN A;  3K6V A;  4H0W A;  2QSX A;  3U8Q A;  1MY4 A;  2OCU A;  3Q28 A;  3UN6 A;  4IO2 A;  1OVB A;  4GOT A;  3IAZ A;  5I2N B;  4DIG A;  1MM6 A;  3PD8 A;  4FAT A;  5TPA B;  1B9J A;  3OEM A;  5H8H A;  3CG3 A;  4MBP A;  3VVD A;  3EHT A;  4EQ7 A;  1JVX A;  2ONS A;  3USD A;  3T22 A;  4EXL A;  3FD3 A;  3IB1 A;  4JSO A;  4DXU A;  1IXC A;  3SEU A;  4MLV A;  1B1X A;  4KFQ A;  4Z0I A;  3S4U A;  2D3I A;  4KHZ E;  1JQF A;  5I57 B;  5H8Q A;  4GVO A;  1QKB A;  3FV1 A;  2ZMB A;  4GL0 A;  4FAJ A;  1R1N A;  1JEV A;  1R6Z A;  3H6W A;  4HCY A;  4DXC A;  4G68 C;  3QAX A;  3N94 A;  1B4Z A;  3SKP A;  2PT2 A;  2Y84 A;  1SYH A;  2I0C A;  3SET A;  1YCJ A;  4JDF A;  1AOV A;  4POW A;  3I3V A;  1MDP 1;  4YKI A;  1JW5 A;  1XVY A;  4OEN A;  3KN7 A;  3JYR A;  3R7X A;  3LR1 A;  4NF4 B;  5L9O A;  3TFL A;  1LGB C;  3F11 A;  4O3A A;  2RIN A;  1Q1K A;  5ELV A;  2F6G A;  1B51 A;  3N6T A;  4F18 A;  4DCX A;  4RPO A;  3N26 A;  2GFE A;  2HAU A;  3KBR A;  1SD3 A;  2XXY A;  1GGG A;  2QPQ A;  5I84 A;  2VOZ A;  1A8F A;  1DTG A;  1HSL A;  3G3H A;  2A5T B;  4FJP A;  2Q2A A;  4XKR A;  3CRB A;  3TCF A;  1PC3 A;  3ZSF A;  1SBP A;  4I1D A;  3FV2 A;  4KCC A;  1UTB A;  3E3K A;  3TTL A;  5TU0 A;  1QUI A;  5ICT A;  3TYH A;  5I58 A;  1VSO A;  3TAJ A;  5CC2 A;  3E13 X;  3QK6 A;  2H98 A;  3Q26 A;  3O97 A;  5AA2 D;  4EQ9 A;  4KI0 E;  5FTH A;  3H6T A;  5DEX A;  4P11 A;  3TCG A;  2O84 X;  2DQV A;  2Z23 A;  1R9Q A;  3C36 A;  1Y3N A;  3C32 A;  5DYH A;  3PUV E;  4N6P A;  2DSF A;  4H5G A;  2Q88 A;  3ODB A;  2O7U A;  2Q8J A;  4FED A;  4F19 A;  4KCD A;  4NMY A;  2VD3 A;  4GXA A;  1J1N A;  4AB6 A;  3KOS A;  3JZJ A;  2RCB A;  3EN3 A;  3OEL A;  1ELJ A;  2ESN A;  3KEI A;  3MP1 A;  2E1S A;  3C9H A;  2THI A;  3T9X B;  4HS7 A;  3BFT A;  1P1W A;  3W15 C;  4AB5 A;  1ZLQ A;  3G7W A;  3H4Z A;  4GQO A;  2Z8F A;  4TLM B;  2D5W A;  2I58 A;  1EU8 A;  5JEI A;  3HO7 A;  4RK2 A;  4IO3 A;  4ONY A;  4U4S A;  3VV5 A;  1D4N A;  3DLN A;  5EHS A;  4RK9 A;  2Y7W A;  3A09 A;  4FEB A;  3O6I A;  1DTZ A;  3B7D A;  3HHG A;  1R9L A;  1Z7M E;  3OMB A;  3IO6 A;  4IO4 A;  4IB2 A;  1B0H A;  4GFR A;  5B70 A;  4OFL A;  4JXI A;  1B58 A;  2PMS A;  4HCW A;  1LBC A;  3C33 A;  1S50 A;  3VVE A;  3UP9 A;  4GWO A;  2XX9 A;  3RTW B;  3M8U A;  4Q5T A;  4H8J A;  2ZYM A;  4QFP A;  4ZE9 A;  3RY3 A;  1JEU A;  2CZL A;  2OK2 A;  2WKY A;  3SEW A;  1Y3Q A;  3AXF A;  3SES A;  2Y7I A;  1AH5 A;  3DP8 A;  4ZEB A;  3QIM A;  1B0L A;  5CMM A;  1USY E;  2V3Q A;  3IL1 B;  1MY0 A;  5I2N A;  3MVW A;  4YB7 A;  2QMW A;  4YB6 A;  1MXU A;  3CIJ A;  2O68 A;  3SEY A;  5TPA A;  2I4B A;  4R2F A;  1D3K A;  1LCT A;  3H03 A;  3VDF A;  3OO8 A;  4LA9 A;  2F35 A;  4U1O A;  1VFD A;  1SDX A;  5KZT A;  5L9M A;  3MP6 A;  4MH5 A;  2V93 A;  2IEE A;  4ND9 A;  3HCQ A;  3MJN A;  4R9G A;  4NF5 B;  4XKP A;  5CBS A;  3KN3 A;  2RC8 A;  4FE8 A;  4PET A;  3VLU A;  1A40 A;  4IO7 A;  1TXF A;  2GH9 A;  2VD2 A;  5F7V A;  1FQB A;  4LZ8 A;  3TKD A;  4YAH X;  4QRZ A;  1NNP A;  1XOC A;  3O2A A;  3THI A;  3HST A;  1BP5 A;  2DYX A;  2I6E A;  4OVJ A;  3DEL B;  2R9J A;  5AA1 A;  2I3V A;  2XXI A;  4X9T A;  1B6H A;  3VLV A;  3HN0 A;  3LBS A;  3UIF A;  2P2A A;  1B7H A;  3K2D A;  4NF8 B;  2W7Y A;  4OHN A; 
#chains in the Genus database with same CATH topology
 2I0B A;  3FVG A;  2YPN A;  1QKA A;  2AYS A;  5AA3 A;  1ZBM A;  4P56 A;  4QBA A;  4YKK A;  1LST A;  3JV9 A;  4UAC A;  4KYE A;  5DVI A;  1P1O A;  4LZ5 A;  4U22 A;  3G3F A;  1OIB A;  1URD A;  2BJJ X;  4YMB A;  2XD3 A;  1IQ7 A;  4PF6 A;  4G68 A;  1N0T A;  2A5T A;  2DWI A;  1S9T A;  3MWB A;  2VPO A;  1M5D A;  1O7T A;  2P1S A;  1LFI A;  3H7M A;  1LEV A;  4R6H A;  2PFZ A;  4ZZA A;  2XXT A;  4Z7E A;  3K01 A;  3PPN A;  3MP8 A;  5A5X A;  4I40 A;  1NNF A;  1XC1 A;  3C31 A;  2R8T A;  1FTJ A;  1SVX B;  3V5A A;  3OD7 A;  4F39 A;  5EQ7 A;  3RN8 A;  4MEV A;  1IMD A;  1PBQ A;  3ROJ A;  3RLF E;  2HFB A;  2AL5 A;  5A5L A;  5F24 A;  3HFU A;  2Z22 A;  3HV1 A;  4RY1 A;  4GX6 A;  3FJM A;  3IOU A;  1YPN A;  2VHA A;  3RPL B;  4KD5 A;  2MKZ A;  3MZ1 A;  4F3G A;  2V25 A;  4BDR A;  1Y9U A;  3QUF A;  4BDO A;  4F31 B;  4JWX A;  2DXR A;  3IOV A;  4MX6 A;  1B5J A;  2XXV A;  2XXU A;  2ZYN A;  1YXI A;  1IXI A;  2HEU A;  2OWS A;  4P0I A;  4OFO A;  4GX3 A;  1OVT A;  4RNS A;  1HSJ A;  5ITO A;  4XKN A;  2ZZX A;  4L17 A;  2VGQ A;  1DPP A;  2Z8D A;  1YAE A;  2DE4 A;  4HE1 A;  1ANF A;  3B8B A;  1FPI A;  4ISU A;  3G3I A;  3RT6 B;  1POY 1;  4P9K A;  3GBA A;  2DP8 A;  5K2Y A;  5DTB A;  1M5F A;  1H44 A;  1KA1 A;  4K3F A;  4OVR A;  4DI4 B;  2DWH A;  2H99 A;  4MJO A;  1P1N A;  4LAT A;  3TZA A;  3RPW A;  1OLC A;  4TOZ A;  3IJX B;  3EKI A;  2UVI A;  3T96 B;  3N5L A;  3O9P A;  1JW1 A;  1NV4 A;  1WDN A;  4X8R A;  1ZTY A;  1FQA A;  4F3S A;  4XF5 A;  3IOW A;  4HXV A;  1IZ1 A;  2OJT A;  1B52 A;  1D9Y A;  5HPQ A;  2QL3 A;  3FVN A;  1FQC A;  4XXU A;  3UOR A;  3CFZ A;  2Y7K A;  1OQG A;  5IZ1 A;  4F1Y A;  1UTH B;  2FA7 A;  5KCJ B;  3KZG A;  2G29 A;  5H8S A;  2ZYO A;  2QMX A;  1URS A;  3WAF A;  3V83 A;  1H45 A;  3MVX A;  5I56 B;  4P0G A;  4ZEI A;  3LSL A;  4QFL A;  3LSW A;  1I69 A;  4G2Z A;  4NN3 A;  3G3K A;  5L8D A;  1BKA A;  1Y1Z A;  3TUS A;  3K4U A;  1FTL A;  3FXB A;  1RYO A;  3T0J A;  4KYD A;  3MZ9 A;  1B5I A;  1VE4 A;  4ZDM A;  4EQB A;  4GWU A;  3KGC A;  2OX3 A;  1LB8 A;  1VFE A;  2O6A A;  2NVU B;  2PX1 A;  4F3B A;  1MQJ A;  1TT1 A;  2FNC A;  3T9U A;  2XXR A;  4WXJ A;  4I3E A;  5H8F B;  5ET7 A;  1MPD A;  4G8M A;  1FQE A;  3CG1 A;  4LQ2 A;  2QS4 A;  3KSJ A;  2DE3 A;  3LUY A;  1NH8 A;  1US4 A;  1SI0 A;  2REJ A;  5J1D A;  1GVC A;  4PGN A;  3TTR A;  3SEX A;  1Z7N E;  3Q29 A;  5CI5 A;  4WKM A;  3ZS6 A;  4ELQ A;  2B4L A;  5CMK A;  3IO4 A;  5DT6 A;  1B2H A;  1CB6 A;  4QSE A;  2XXX A;  3CFL A;  4H5F A;  1N84 A;  2F3B A;  1QUK A;  4N4U A;  5CMC A;  4OEV A;  4ELR A;  5IGA A;  3HHF A;  2GRV A;  1NV3 A;  4ESX A;  3PPQ A;  3OO6 A;  4GWY A;  3A29 A;  1N3W A;  4ESW A;  4NF5 A;  2Q2C A;  4QXD A;  4U23 A;  2F7B A;  4NTL A;  3IOR A;  1IXH A;  3KJ7 A;  3TEL A;  1MXV A;  4BDQ A;  1I6A A;  1MQD A;  4ECF A;  1VR5 A;  3GZG A;  4MNC A;  4NF6 A;  4C0R A;  3A3U A;  2P3V A;  4OEU A;  4C1U A;  1LB9 A;  3D4G A;  3QUJ A;  4AQ4 A;  4RYA A;  1HSE A;  1NUY A;  2XXP A;  4NF8 A;  2QRY A;  4N6D A;  2D21 A;  2Y5K A;  5I59 A;  2Y7P A;  2FIE A;  4E0X A;  5FHO A;  3Q27 A;  1AL3 A;  3SDF A;  5I2K B;  3PMW A;  3TQL A;  4KQP A;  4JVD A;  4O3C A;  4JWO A;  3VFJ A;  3OOA A;  2F8D A;  3QYT A;  3T93 B;  1MQI A;  2RF1 A;  5M2V A;  1DMB A;  3LSX A;  3LC8 A;  5B7D A;  2GQ1 A;  4U21 A;  1ZIU A;  1SW5 A;  5F1Q A;  3PPP A;  1FPJ A;  3MVY A;  3K00 A;  3Q25 A;  1EZ9 A;  4NG7 A;  2QVR A;  3M3F A;  5TP9 B;  4XFE A;  1UIV A;  2ALU A;  3U92 A;  2H4I A;  4YU0 A;  4U2R A;  1NMU A;  1MXX A;  5L9S A;  1FQD A;  4PQJ A;  4ZEK A;  1MG1 A;  3FZV A;  4WED A;  3TMG A;  1MXW A;  2V3U A;  4PDH A;  4GWX A;  3KSX A;  4F2O A;  3IFA A;  3RPL A;  4LON B;  5JK4 A;  1US5 A;  3S9N C;  1MQH A;  1Q9D A;  1NUW A;  1FPL A;  1M5B A;  4FIM A;  4ZEC A;  3FJ7 A;  4IY5 A;  2XWV A;  4GIZ A;  1FQF A;  1P1Q A;  5LOM A;  4X1D A;  5ET8 A;  4N8Y A;  3QMF A;  3LUZ A;  1Y20 A;  1LFH A;  4OET A;  4LZ7 A;  1SQY A;  2I49 A;  4WEP A;  3W9W A;  1QW0 A;  3ONM A;  2V3T A;  2QS1 A;  4G8H A;  4PGP A;  2DVZ A;  5J16 A;  2OWT A;  2DXY A;  4ZED A;  3KOT A;  4EF1 A;  2PT1 A;  1UIU A;  1B7U A;  3C34 A;  2QS3 A;  3CR9 A;  2QVV A;  1IMB A;  5CBR A;  4RPN A;  1MY3 A;  1QUL A;  1FBP A;  1LCF A;  4GD5 A;  4DE8 A;  1LBV A;  3S2V A;  1YYZ A;  1WOD A;  1B3L A;  3IK6 B;  2BJI A;  2H5Y A;  3PUW E;  4G4P A;  1LAX A;  4GF8 A;  3ILU B;  3VE1 B;  3TTK A;  1INP A;  1Y3P A;  3TQW A;  4R75 A;  2KR0 A;  5I57 A;  3KN8 A;  2UXA A;  4H45 A;  3GXA A;  4FOR A;  4QFN A;  1SW1 A;  1B40 A;  3TCH A;  2AIX A;  3GBB A;  1UTH A;  5KCJ A;  1P99 A;  2B4M A;  3EF7 A;  4R2B A;  5I56 A;  2GHA A;  4EDP A;  2V84 A;  2UYE A;  1K9Y A;  5ICQ A;  1TFA A;  1MM7 A;  1BLF A;  3L6G A;  3T1B A;  4KPT A;  3FBP A;  4HTG A;  4NE4 A;  4Q0C A;  3PUZ E;  1PB9 A;  5EQ8 A;  1QVS A;  5ITP A;  2HPG A;  3W9V A;  2DWA A;  4NF4 A;  4PF8 A;  4H67 A;  3M3L A;  3H3G A;  2Q74 A;  4MNP A;  1IEJ A;  2B65 A;  4MNI A;  1DCU A;  4ELO A;  4PC9 A;  5H8F A;  3NOH A;  4OFJ A;  1FTM A;  2PFY A;  2Y7R A;  4N81 A;  4PDD A;  1A99 A;  3UA8 A;  1PBP A;  2HZK A;  4G77 A;  1FW0 A;  1B7Z A;  3N6U A;  3RGY A;  1B5H A;  1G0I A;  1FBF A;  4LUB A;  3S9L C;  1DPE A;  3PPR A;  1JET A;  1ATG A;  5FHN A;  5KDT B;  4RA1 A;  3K1M A;  4OQO A;  5BWJ A;  1ZJL A;  3HPI A;  1AMF A;  4OVS A;  1NUZ A;  3OSQ A;  2UVH A;  3DP4 A;  3V8X B;  3PD9 A;  2ONR A;  4I3Y A;  1B3F A;  4XTC Q;  4PTK A;  1MS7 A;  3U93 A;  1NV2 A;  4OTE A;  5AA4 B;  3MUQ A;  4OWD A;  4TQU Q;  3K1P A;  3D4C A;  4DCY A;  4H6D A;  4GLI A;  1MRP A;  5H8N B;  2XWI A;  3DM0 A;  1RDY A;  4ZE8 A;  2QVU A;  4IO5 A;  2HXW A;  2ANJ A;  5BUU A;  3PUX E;  1O63 A;  2XXW A;  1FPF A;  1AIV A;  4R6Y A;  2YLN A;  2ZYK A;  1Y4T A;  4P8B A;  4JVI A;  4Q8R A;  2F3D A;  1MXZ A;  3U94 A;  4OER A;  1PEB A;  1ZMG A;  3I6V A;  1MY2 A;  3PMX A;  2DOJ A;  3MPL A;  2WEF A;  2XX7 A;  5HM4 B;  2G93 A;  4QFK A;  2NWJ A;  1RKM A;  2HQ0 A;  2FYI A;  5I2K A;  4QSD A;  2Q8M A;  4OVQ A;  3GLB A;  4F3P A;  3GYY A;  3CSB A;  3C35 A;  4R6K A;  5I7I A;  1XVX A;  4O7I A;  2ZNS A;  3G3G A;  3G3J A;  4F29 A;  4XEQ A;  1MH4 A;  3R6U A;  4GXS B;  3O6H A;  2R71 A;  1FTK A;  4PFI A;  4QHQ A;  3EPE A;  1FJ6 A;  2PBW A;  5DVF A;  1H3D A;  4OVT A;  1NFT A;  3IX1 A;  3V89 B;  1NV0 A;  4H8I A;  2I48 A;  4IGR A;  5TP9 A;  4R72 A;  3RNN A;  2OBG A;  4KXP A;  2F7C A;  4X48 A;  4PP0 A;  2X7Q A;  4KYS A;  2CZI A;  4PBQ A;  3O66 A;  3ILT B;  3OO9 A;  4O3B A;  1FBE A;  2UYF A;  3IR1 A;  3IB2 A;  4TLL B;  5IAI A;  1MDQ A;  3IFC A;  4PFR A;  3T9V A;  3PMV A;  4NWC A;  2I3W A;  3MW0 A;  4PFY A;  2LAO A;  3U1O A;  2HAV A;  3H6U A;  3IOT A;  3MAM A;  4PFT A;  4X1B A;  3ZKL A;  3ECR A;  4PAK A;  4HE0 A;  4XKQ A;  4P1L A;  4OXV A;  3RTF B;  3VXC A;  3MQ9 A;  2P3N A;  2Z8E A;  3E4R A;  1ZKB A;  3WAE A;  3B6Q A;  1N3X A;  4BDM A;  4F2Q A;  5EYF A;  2E0S A;  4F1V A;  3PUY E;  4JWY A;  4JVC A;  1JP4 A;  4G68 B;  4N13 A;  1QGX A;  2CMO A;  3TTM A;  1DK4 A;  5DVJ A;  1MPB A;  4ZEF A;  2XXQ A;  2RKM A;  1FJ9 A;  3MYU A;  1FPE A;  1QJM A;  4IY6 A;  2M8C A;  4ELP A;  4QF9 A;  4MMP A;  3RQT A;  2F7A A;  5A5X B;  2XD2 A;  3OXN A;  1PB7 A;  4I8C A;  1A55 A;  5JTY B;  4DZ1 A;  3H6V A;  3L6H A;  1XHY A;  3K6U A;  4NX1 A;  1Q35 A;  3T66 A;  3P7I A;  4LP2 B;  3VVF A;  2IA4 A;  1FBC A;  5FHM A;  4OYV A;  2Q89 A;  1KWH A;  2O7I A;  1S7Y A;  4DXB A;  2NUV A;  4YKJ A;  1Y1M A;  4O8M A;  2F6P A;  1H76 A;  5T3J A;  1G0H A;  3SER A;  2O51 A;  4NWD A;  5FBP A;  1N76 A;  2RCA A;  1QUJ A;  1FCK A;  4P3L A;  1LAG E;  5EHM A;  4H1X A;  1RDX A;  2PYY A;  4EUO A;  4GRK A;  1TFD A;  2P0S A;  3PU5 A;  5EQ9 A;  2B3B A;  5AA2 B;  1N7X A;  4F22 A;  1LFG A;  3K6W A;  5FTI A;  3FVO A;  4BDL A;  3CFX A;  3FAS A;  2PVU A;  3K6X A;  4OZ9 A;  1NUX A;  4N07 A;  3FJG A;  2R6G E;  3K0V A;  1EZP A;  2VP1 A;  3EHS A;  3H06 B;  3BFU A;  2F97 A;  3O28 A;  3MBP A;  3OEN A;  3FVK A;  1SYI A;  1PB8 A;  2HCA A;  3B6W A;  1YZ0 A;  5H8H B;  3KFM A;  2ZXT A;  4M1V A;  1BK4 A;  5KDT A;  4I62 A;  3UK4 A;  1FPK A;  2ZNT A;  2ONK E;  1LLS A;  3CVG A;  1MY1 A;  5IZ3 B;  1P1U A;  1OLA A;  1JW4 A;  4EXK A;  1JVY A;  3I5O A;  5I5P A;  3FIR A;  4YMA A;  1MQG A;  1L5T A;  3FXR A;  4G8N A;  1YTV A;  1B4H A;  2DWJ A;  3U72 A;  1NNT A;  1B3E A;  3LSF B;  4I9D A;  1NI9 A;  1IUD A;  5H8Q B;  4QFO A;  5AA4 A;  4IGT A;  5AE4 A;  3T9H B;  1F9B A;  5H8N A;  4THI A;  4AS4 A;  1FPG A;  4KR5 A;  2X7P A;  3IJO B;  2O1L A;  4OES A;  4HW8 A;  1I6B A;  1O64 A;  1TWY A;  1B32 A;  3OEK A;  4MFI A;  5CRY A;  2CEX A;  4PFU A;  3PPO A;  1B05 A;  5K2X A;  4JB7 A;  5LDZ A;  3CHG A;  3IB0 A;  1GR2 A;  4LQ5 A;  1EZO A;  4NGU A;  2HXR A;  1N04 A;  1USY H;  4C1T A;  4JSD A;  2Q9T A;  1MPC A;  1LAH E;  2XXH A;  4M4G A;  2O1M A;  2ABH A;  1IIW A;  3KBZ A;  1II5 A;  2FIX A;  4EF2 A;  4N91 A;  1A8E A;  2QFL A;  4PFW A;  4IO6 A;  2WYP A;  3M3K A;  1OQH A;  1EYI A;  1AWB A;  3TEP A;  4FBP A;  5IKB A;  1IXG A;  4YIC A;  2V4C A;  1FTO A;  3KJT A;  1XI6 A;  4RXL A;  1SPI A;  1FTA A;  2F78 A;  3MC2 A;  1UTB B;  2KLF A;  4E0W A;  4YZZ A;  3ZKK A;  3PV0 E;  2KQZ A;  2X26 A;  1B3H A;  3O29 A;  5HBC A;  3E79 A;  3CSG A;  5EQA A;  1NV6 A;  5I58 B;  3SEV A;  1T0K A;  4PFB A;  3QSL A;  3S9E A;  2L5V A;  1CE2 A;  5DEX B;  5EYH A;  3TPA A;  4DLD A;  1NL5 A;  1SW4 A;  4R9F A;  1NH7 A;  1ZU0 A;  2B3F A;  3K1N A;  2GHB A;  4UA8 A;  3FGS A;  1FBD A;  4PCD A;  1BIY A;  3PGF A;  2H25 A;  1K9Z A;  2ZZW A;  3FUZ A;  3EQ1 A;  1GTK A;  2YJP A;  3TOD A;  1D9V A;  3B6T A;  4YB5 A;  2NOO A;  2OZZ A;  2CZH A;  4POX A;  4NF6 B;  3A3C A;  1WVJ A;  2O69 A;  4AS5 A;  3QXM A;  1BTJ A;  3RUM A;  3MZB A;  1M5E A;  2UVG A;  4ZZE A;  1B1H A;  1M5C A;  2ZNU A;  2DVC A;  1MH3 A;  1B3G A;  1OMP A;  2F5X A;  5I59 B;  3K02 A;  4PE5 B;  4XIG Q;  4N17 A;  2QJE A;  3TDJ A;  1LBW A;  4U4X A;  1XS5 A;  3FXU A;  3RT8 A;  4NED A;  2OLB A;  1B46 A;  3DP6 A;  2A5S A;  4YKP A;  4U1Z A;  4F1U A;  2DE2 A;  3E78 A;  1LBB A;  4MF3 A;  2DS9 A;  2QS2 A;  4G61 A;  4MHF A;  4R73 A;  1N7W A;  1MXY A;  1RDZ A;  3MPK A;  1A7L A;  1GV8 A;  4OA4 A;  2XHD A;  2FBP A;  5CMB A;  2AL4 A;  4OMB A;  3C4M A;  4H65 A;  5CM6 A;  4Q30 B;  2REG A;  3KG2 A;  4FEC A;  3FAT A;  5ET6 A;  3R26 A;  1SI1 A;  2HHM A;  3TTN A;  4N15 A;  4QSC A;  4GL8 A;  1URG A;  4MLQ A;  1RYX A;  1I6Q A;  4R74 A;  3O6G A;  1NNK A;  5JTY A;  3BKI B;  3FXQ A;  3MVZ A;  1Y4C A;  1PDA A;  2NXO A;  1LAF E;  2I4C A;  3OO7 A;  2F34 A;  2XX8 A;  4PBH A;  1JNF A;  2HZL A;  2FHY A;  3CI8 A;  3VXB A;  1EH3 A;  3ISP A;  4ZS9 A;  4MCO A;  5I3S A;  1IIT A;  1SW2 A;  1POT A;  4DDD A;  1A54 A;  1UQW A;  2F36 A;  5ISU A;  3BBR A;  1XT8 A;  4BLA A;  2UVJ A;  2RC7 A;  1VDW A;  1NV1 A;  1DSN A;  4LVQ A;  4PAI A;  3VLW A;  1H43 A;  3EHU A;  4JBZ A;  2WX9 A;  3UGW A;  4RJZ A;  1NKX A;  2RC9 A;  2H9B A;  3S9M C;  5AA2 A;  1DOT A;  3OSR A;  3E9X A;  4H0W A;  3K6V A;  4BDN A;  2QSX A;  1FBH A;  3U8Q A;  1MY4 A;  2OCU A;  4GWZ A;  4DI3 D;  3Q28 A;  2VPN A;  4GBW A;  4IO2 A;  3UN6 A;  2JJK A;  1OVB A;  4GOT A;  3IAZ A;  1CNQ A;  5I2N B;  4DIG A;  1MM6 A;  5LTC A;  3PD8 A;  4FAT A;  5TPA B;  1B9J A;  3OEM A;  1FPB A;  4IR8 A;  5H8H A;  3CG3 A;  4MBP A;  3VVD A;  3EHT A;  4HE2 A;  4EQ7 A;  1JVX A;  2ONS A;  5IZ3 A;  4GBV A;  3USD A;  3T22 A;  3LV0 A;  4EXL A;  3FD3 A;  3IB1 A;  4JSO A;  4DXU A;  1IXC A;  3SEU A;  4MLV A;  4LN5 A;  1B1X A;  4KFQ A;  4Z0I A;  3S4U A;  5ESY A;  2D3I A;  4KHZ E;  1JQF A;  5I57 B;  4NAP A;  5H8Q A;  4GVO A;  1QKB A;  3FV1 A;  2ZMB A;  5DW8 A;  4GL0 A;  4FAJ A;  1R1N A;  4OVP A;  1JEV A;  1R6Z A;  3H6W A;  1KZ8 A;  4HCY A;  4DXC A;  4G68 C;  3QAX A;  1NV7 A;  3N94 A;  1B4Z A;  3SKP A;  2PT2 A;  2Y84 A;  3B50 A;  1SYH A;  2I0C A;  3KC1 A;  3SET A;  1YCJ A;  4MIJ A;  4JDF A;  1AOV A;  4POW A;  3I3V A;  1MDP 1;  4YKI A;  1FRP A;  1JW5 A;  1XVY A;  4OEN A;  2XWO A;  3KN7 A;  3JYR A;  3R7X A;  3LR1 A;  4NF4 B;  5L9O A;  3TFL A;  1LGB C;  3F11 A;  4O3A A;  2ZZV A;  2RIN A;  1Q1K A;  5ELV A;  2F6G A;  1B51 A;  3N6T A;  4F18 A;  4DCX A;  4RPO A;  2WYK A;  2GFE A;  3N26 A;  2HAU A;  3KBR A;  1SD3 A;  2XXY A;  1GGG A;  2QPQ A;  5I84 A;  2VOZ A;  1A8F A;  1DTG A;  1HSL A;  3G3H A;  1FBG A;  2A5T B;  4FJP A;  4GWW A;  2Q2A A;  4XKR A;  3CRB A;  3TCF A;  1PC3 A;  1IMC A;  3ZSF A;  1SBP A;  4I1D A;  3FV2 A;  4KCC A;  1UTB A;  1IME A;  3E3K A;  3KC0 A;  3TTL A;  5TU0 A;  1QUI A;  5ICT A;  3TYH A;  5I58 A;  1VSO A;  3TAJ A;  5CC2 A;  4N8G A;  3E13 X;  3QK6 A;  2H98 A;  3Q26 A;  3O97 A;  5AA2 D;  4EQ9 A;  4KI0 E;  5FTH A;  3H6T A;  5DEX A;  4P11 A;  3TCG A;  5EYG A;  3SZP A;  5IM2 A;  5IZZ A;  2O84 X;  2DQV A;  2Z23 A;  1R9Q A;  3C36 A;  3RYD A;  1Y3N A;  3C32 A;  5DYH A;  4N6K A;  3PUV E;  4N6P A;  2DSF A;  4H5G A;  1IMF A;  2Q88 A;  5ET5 A;  1LBZ A;  3ODB A;  2O7U A;  1EYK A;  2Q8J A;  1FPD A;  4FED A;  4F19 A;  4KCD A;  4NMY A;  2VD3 A;  4GXA A;  2FVZ A;  1J1N A;  4AB6 A;  3KOS A;  3JZJ A;  2RCB A;  3EN3 A;  3OEL A;  1ELJ A;  2ESN A;  3KEI A;  3MP1 A;  2E1S A;  3C9H A;  1DBZ A;  2THI A;  3D1R A;  3T9X B;  1IMA A;  4HS7 A;  3BFT A;  4P1E A;  1P1W A;  3W15 C;  4AB5 A;  2XA5 A;  1ZLQ A;  3G7W A;  3H4Z A;  4GQO A;  2XXK A;  2Z8F A;  4TLM B;  2D5W A;  2I58 A;  1EU8 A;  5JEI A;  3HO7 A;  4RK2 A;  4IO3 A;  4X04 A;  4ONY A;  4O94 A;  4U4S A;  3VV5 A;  1D4N A;  4NHB A;  4P47 A;  3DLN A;  5EHS A;  4RK9 A;  2Y7W A;  3A09 A;  4FEB A;  3O6I A;  4OAN A;  1DTZ A;  3B7D A;  3HHG A;  1R9L A;  1Z7M E;  3OMB A;  3IO6 A;  4IO4 A;  4IB2 A;  4PE3 A;  1B0H A;  4GFR A;  2XWK A;  5B70 A;  4OFL A;  4JXI A;  2WBB A;  2VT5 A;  1B58 A;  2PMS A;  4UAB A;  2PCR A;  4HCW A;  4MAG A;  1LBC A;  3C33 A;  1S50 A;  3VVE A;  3UP9 A;  4GWO A;  2XX9 A;  3RTW B;  3M8U A;  4Q5T A;  1KA0 A;  2CEY A;  4H8J A;  2ZYM A;  4PAF A;  1EYJ A;  4QFP A;  4ZE9 A;  3RY3 A;  1JEU A;  4GWS A;  2CZL A;  1D9Q A;  2OK2 A;  1LBX A;  2WKY A;  3SEW A;  1Y3Q A;  3AXF A;  4GX4 A;  3PTY A;  3SES A;  2Y7I A;  4H46 A;  1AH5 A;  1LBY A;  3DP8 A;  4ZEB A;  3QIM A;  1B0L A;  5CMM A;  1USY E;  2V3Q A;  4NF0 A;  3IL1 B;  1MY0 A;  5I2N A;  3MVW A;  2CZK A;  4YB7 A;  1FSA A;  2QMW A;  2DDK A;  4YB6 A;  1MXU A;  3CIJ A;  2O68 A;  3SEY A;  5TPA A;  2I4B A;  4R2F A;  1D3K A;  1LCT A;  3H03 A;  3VDF A;  3OO8 A;  4LA9 A;  2F35 A;  4U1O A;  1VFD A;  1SDX A;  2Y5L A;  5KZT A;  5L9M A;  3MP6 A;  4O7M A;  4MH5 A;  2V93 A;  2IEE A;  3BIG A;  4ND9 A;  3HCQ A;  1NV5 A;  3MJN A;  4R9G A;  4NF5 B;  4XKP A;  5CBS A;  3KN3 A;  2RC8 A;  4FE8 A;  4PET A;  3VLU A;  1A40 A;  3BIH A;  4IO7 A;  1TXF A;  2GH9 A;  2VD2 A;  5F7V A;  1FQB A;  4LZ8 A;  3TKD A;  4YAH X;  4QRZ A;  1NNP A;  1XOC A;  3O2A A;  3THI A;  3HST A;  1BP5 A;  3U65 A;  2DYX A;  2I6E A;  4OVJ A;  3MST A;  3DEL B;  2R9J A;  5AA1 A;  2I3V A;  2XXI A;  4X9T A;  1B6H A;  3VLV A;  3HN0 A;  3LBS A;  2WBD A;  3UIF A;  2P2A A;  1B7H A;  3K2D A;  4NQ8 A;  2OWZ A;  4NF8 B;  2W7Y A;  4OHN A; 
#chains in the Genus database with same CATH homology
 2I0B A;  3FVG A;  2YPN A;  1QKA A;  2AYS A;  5AA3 A;  1ZBM A;  4YKK A;  1LST A;  3JV9 A;  4UAC A;  4KYE A;  5DVI A;  1P1O A;  4LZ5 A;  4U22 A;  3G3F A;  1OIB A;  1URD A;  2BJJ X;  4YMB A;  2XD3 A;  1IQ7 A;  4G68 A;  1N0T A;  2A5T A;  2DWI A;  1S9T A;  3MWB A;  1M5D A;  1O7T A;  2P1S A;  1LFI A;  3H7M A;  4R6H A;  4ZZA A;  2XXT A;  4Z7E A;  3K01 A;  3PPN A;  3MP8 A;  5A5X A;  1NNF A;  1XC1 A;  3C31 A;  1FTJ A;  1SVX B;  3V5A A;  3OD7 A;  4F39 A;  3RN8 A;  1PBQ A;  3RLF E;  2HFB A;  2AL5 A;  2Z22 A;  3HV1 A;  4RY1 A;  3FJM A;  3IOU A;  1YPN A;  2VHA A;  4KD5 A;  3MZ1 A;  4F3G A;  2V25 A;  4BDR A;  1Y9U A;  3QUF A;  4BDO A;  4F31 B;  4JWX A;  2DXR A;  3IOV A;  1B5J A;  2XXV A;  2XXU A;  2ZYN A;  1IXI A;  2HEU A;  2OWS A;  4P0I A;  4OFO A;  1OVT A;  4RNS A;  1HSJ A;  5ITO A;  4XKN A;  4L17 A;  2VGQ A;  1DPP A;  2Z8D A;  1YAE A;  2DE4 A;  1ANF A;  4ISU A;  3G3I A;  3RT6 B;  1POY 1;  3GBA A;  2DP8 A;  5K2Y A;  5DTB A;  1M5F A;  1H44 A;  4K3F A;  2DWH A;  2H99 A;  1P1N A;  4LAT A;  3TZA A;  3RPW A;  1OLC A;  4TOZ A;  3IJX B;  2UVI A;  3T96 B;  3N5L A;  3O9P A;  1JW1 A;  1WDN A;  1ZTY A;  1FQA A;  4F3S A;  3IOW A;  1IZ1 A;  2OJT A;  1B52 A;  1D9Y A;  5HPQ A;  2QL3 A;  3FVN A;  1FQC A;  4XXU A;  3UOR A;  3CFZ A;  2Y7K A;  1OQG A;  4F1Y A;  1UTH B;  2FA7 A;  5KCJ B;  3KZG A;  2G29 A;  5H8S A;  2ZYO A;  2QMX A;  1URS A;  3WAF A;  3V83 A;  1H45 A;  3MVX A;  5I56 B;  4P0G A;  4ZEI A;  3LSL A;  4QFL A;  3LSW A;  1I69 A;  4G2Z A;  3G3K A;  5L8D A;  1BKA A;  1Y1Z A;  3TUS A;  3K4U A;  1FTL A;  1RYO A;  4KYD A;  3MZ9 A;  1B5I A;  1VE4 A;  4ZDM A;  4EQB A;  3KGC A;  1LB8 A;  1VFE A;  2O6A A;  2NVU B;  2PX1 A;  4F3B A;  1MQJ A;  1TT1 A;  2FNC A;  3T9U A;  2XXR A;  4WXJ A;  5H8F B;  1MPD A;  4G8M A;  1FQE A;  3CG1 A;  4LQ2 A;  2QS4 A;  3KSJ A;  2DE3 A;  3LUY A;  1NH8 A;  1US4 A;  1SI0 A;  2REJ A;  5J1D A;  1GVC A;  3TTR A;  3SEX A;  1Z7N E;  3Q29 A;  5CI5 A;  4WKM A;  3ZS6 A;  4ELQ A;  5CMK A;  3IO4 A;  5DT6 A;  1B2H A;  1CB6 A;  4QSE A;  2XXX A;  3CFL A;  4H5F A;  1N84 A;  1QUK A;  5CMC A;  4ELR A;  4OEV A;  3HHF A;  2GRV A;  4ESX A;  3PPQ A;  3OO6 A;  1N3W A;  4ESW A;  4NF5 A;  2Q2C A;  4U23 A;  2F7B A;  4NTL A;  3IOR A;  1IXH A;  3KJ7 A;  3TEL A;  1MXV A;  4BDQ A;  1I6A A;  1MQD A;  4ECF A;  1VR5 A;  3GZG A;  4NF6 A;  4C0R A;  3A3U A;  4OEU A;  4C1U A;  1LB9 A;  3D4G A;  3QUJ A;  4AQ4 A;  4RYA A;  1HSE A;  2XXP A;  4NF8 A;  2QRY A;  2D21 A;  5I59 A;  2Y7P A;  4E0X A;  5FHO A;  3Q27 A;  1AL3 A;  3SDF A;  5I2K B;  3PMW A;  3TQL A;  4KQP A;  4O3C A;  4JWO A;  3VFJ A;  3OOA A;  2F8D A;  3QYT A;  3T93 B;  1MQI A;  2RF1 A;  5M2V A;  1DMB A;  3LSX A;  3LC8 A;  5B7D A;  4U21 A;  1ZIU A;  1SW5 A;  5F1Q A;  3PPP A;  3MVY A;  3K00 A;  3Q25 A;  1EZ9 A;  3M3F A;  5TP9 B;  1UIV A;  2ALU A;  3U92 A;  2H4I A;  4YU0 A;  4U2R A;  1NMU A;  1MXX A;  5L9S A;  1FQD A;  4PQJ A;  4ZEK A;  1MG1 A;  3FZV A;  4WED A;  3TMG A;  1MXW A;  2V3U A;  3KSX A;  4F2O A;  4LON B;  5JK4 A;  1US5 A;  3S9N C;  1MQH A;  1M5B A;  4FIM A;  4ZEC A;  3FJ7 A;  4IY5 A;  4GIZ A;  1FQF A;  1P1Q A;  5LOM A;  4X1D A;  1Y20 A;  1LFH A;  4OET A;  4LZ7 A;  1SQY A;  2I49 A;  4WEP A;  3W9W A;  1QW0 A;  3ONM A;  2V3T A;  2QS1 A;  4G8H A;  2DVZ A;  2OWT A;  2DXY A;  4ZED A;  3KOT A;  4EF1 A;  2PT1 A;  1UIU A;  1B7U A;  3C34 A;  2QS3 A;  3CR9 A;  5CBR A;  4RPN A;  1MY3 A;  1QUL A;  1LCF A;  4GD5 A;  4DE8 A;  3S2V A;  1WOD A;  1B3L A;  3IK6 B;  2H5Y A;  3PUW E;  4G4P A;  1LAX A;  4GF8 A;  3ILU B;  3VE1 B;  3TTK A;  1Y3P A;  3TQW A;  4R75 A;  5I57 A;  3KN8 A;  2UXA A;  3GXA A;  4FOR A;  4QFN A;  1SW1 A;  1B40 A;  3TCH A;  2AIX A;  3GBB A;  1UTH A;  5KCJ A;  1P99 A;  3EF7 A;  4R2B A;  5I56 A;  2GHA A;  4EDP A;  2V84 A;  2UYE A;  5ICQ A;  1TFA A;  1MM7 A;  1BLF A;  3L6G A;  4KPT A;  4HTG A;  4NE4 A;  4Q0C A;  3PUZ E;  1PB9 A;  1QVS A;  5ITP A;  3W9V A;  2DWA A;  4NF4 A;  4H67 A;  3M3L A;  3H3G A;  1IEJ A;  2B65 A;  4ELO A;  5H8F A;  4OFJ A;  1FTM A;  2Y7R A;  1A99 A;  3UA8 A;  1PBP A;  2HZK A;  4G77 A;  1FW0 A;  1B7Z A;  3N6U A;  3RGY A;  1B5H A;  4LUB A;  3S9L C;  1DPE A;  3PPR A;  1JET A;  1ATG A;  5FHN A;  5KDT B;  4RA1 A;  3K1M A;  4OQO A;  5BWJ A;  1ZJL A;  3HPI A;  1AMF A;  3OSQ A;  2UVH A;  3DP4 A;  3V8X B;  3PD9 A;  2ONR A;  1B3F A;  4XTC Q;  1MS7 A;  3U93 A;  4OTE A;  5AA4 B;  3MUQ A;  4OWD A;  4TQU Q;  3K1P A;  4DCY A;  3D4C A;  4H6D A;  4GLI A;  1MRP A;  5H8N B;  3DM0 A;  4ZE8 A;  4IO5 A;  2HXW A;  2ANJ A;  5BUU A;  3PUX E;  1O63 A;  2XXW A;  1AIV A;  4R6Y A;  2YLN A;  2ZYK A;  1Y4T A;  4Q8R A;  1MXZ A;  3U94 A;  4OER A;  1PEB A;  1ZMG A;  3I6V A;  1MY2 A;  3PMX A;  2DOJ A;  3MPL A;  2XX7 A;  5HM4 B;  2G93 A;  4QFK A;  2NWJ A;  1RKM A;  2HQ0 A;  2FYI A;  5I2K A;  4QSD A;  3GLB A;  4F3P A;  3CSB A;  3C35 A;  4R6K A;  1XVX A;  2ZNS A;  3G3G A;  3G3J A;  4F29 A;  1MH4 A;  3R6U A;  4GXS B;  3O6H A;  2R71 A;  1FTK A;  4QHQ A;  3EPE A;  2PBW A;  5DVF A;  1H3D A;  3V89 B;  1NFT A;  3IX1 A;  4H8I A;  2I48 A;  4IGR A;  5TP9 A;  4R72 A;  3RNN A;  2OBG A;  2F7C A;  4X48 A;  4PP0 A;  2X7Q A;  4KYS A;  3O66 A;  3ILT B;  3OO9 A;  4O3B A;  2UYF A;  3IR1 A;  3IB2 A;  4TLL B;  5IAI A;  1MDQ A;  3T9V A;  3PMV A;  4NWC A;  2I3W A;  3MW0 A;  4PFY A;  2LAO A;  3U1O A;  2HAV A;  3H6U A;  3IOT A;  3MAM A;  4PFT A;  4X1B A;  3ZKL A;  3ECR A;  4XKQ A;  4OXV A;  3RTF B;  3VXC A;  3MQ9 A;  2Z8E A;  3E4R A;  1ZKB A;  3WAE A;  3B6Q A;  1N3X A;  4BDM A;  4F2Q A;  5EYF A;  2E0S A;  4F1V A;  3PUY E;  4JWY A;  4G68 B;  4N13 A;  2CMO A;  3TTM A;  5DVJ A;  1MPB A;  4ZEF A;  2XXQ A;  2RKM A;  1QJM A;  4IY6 A;  2M8C A;  4ELP A;  4QF9 A;  3RQT A;  2F7A A;  5A5X B;  2XD2 A;  3OXN A;  1PB7 A;  4I8C A;  1A55 A;  5JTY B;  4DZ1 A;  3H6V A;  3L6H A;  1XHY A;  3K6U A;  1Q35 A;  3T66 A;  3P7I A;  4LP2 B;  3VVF A;  2IA4 A;  5FHM A;  4OYV A;  2Q89 A;  1KWH A;  2O7I A;  1S7Y A;  4DXB A;  2NUV A;  4YKJ A;  1Y1M A;  2F6P A;  1H76 A;  3SER A;  2O51 A;  4NWD A;  1N76 A;  2RCA A;  1QUJ A;  1FCK A;  1LAG E;  5EHM A;  4H1X A;  4EUO A;  2PYY A;  4GRK A;  1TFD A;  2P0S A;  3PU5 A;  2B3B A;  5AA2 B;  1N7X A;  4F22 A;  1LFG A;  3K6W A;  5FTI A;  3FVO A;  4BDL A;  3CFX A;  3FAS A;  2PVU A;  3K6X A;  4OZ9 A;  4N07 A;  3FJG A;  2R6G E;  3K0V A;  1EZP A;  2VP1 A;  3EHS A;  3H06 B;  3BFU A;  2F97 A;  3O28 A;  3MBP A;  3OEN A;  3FVK A;  1SYI A;  1PB8 A;  2HCA A;  3B6W A;  5H8H B;  3KFM A;  2ZXT A;  4M1V A;  5KDT A;  4I62 A;  3UK4 A;  2ZNT A;  2ONK E;  1LLS A;  3CVG A;  1MY1 A;  1OLA A;  1P1U A;  1JW4 A;  4EXK A;  1JVY A;  3I5O A;  3FIR A;  4YMA A;  1MQG A;  1L5T A;  3FXR A;  4G8N A;  1YTV A;  1B4H A;  2DWJ A;  3U72 A;  1NNT A;  1B3E A;  3LSF B;  4I9D A;  1IUD A;  5H8Q B;  4QFO A;  5AA4 A;  4IGT A;  5AE4 A;  3T9H B;  1F9B A;  5H8N A;  4THI A;  4KR5 A;  2X7P A;  3IJO B;  2O1L A;  4OES A;  4HW8 A;  1I6B A;  1O64 A;  1TWY A;  1B32 A;  3OEK A;  4MFI A;  5CRY A;  4PFU A;  3PPO A;  1B05 A;  5K2X A;  4JB7 A;  3IB0 A;  1GR2 A;  4LQ5 A;  1EZO A;  1N04 A;  1USY H;  4C1T A;  4JSD A;  2Q9T A;  1MPC A;  1LAH E;  2XXH A;  4M4G A;  2O1M A;  2ABH A;  1IIW A;  1II5 A;  4EF2 A;  1A8E A;  4PFW A;  4IO6 A;  3M3K A;  1OQH A;  3TEP A;  5IKB A;  1IXG A;  4YIC A;  1FTO A;  3KJT A;  4RXL A;  2F78 A;  3MC2 A;  4E0W A;  1UTB B;  2KLF A;  4YZZ A;  3ZKK A;  3PV0 E;  2X26 A;  1B3H A;  3O29 A;  5HBC A;  3CSG A;  5I58 B;  3SEV A;  1T0K A;  3QSL A;  3S9E A;  1CE2 A;  5DEX B;  3TPA A;  4DLD A;  1NL5 A;  1SW4 A;  4R9F A;  1NH7 A;  1ZU0 A;  2B3F A;  3K1N A;  2GHB A;  4UA8 A;  3FGS A;  1BIY A;  3PGF A;  2H25 A;  3FUZ A;  3EQ1 A;  1GTK A;  2YJP A;  3TOD A;  1D9V A;  3B6T A;  4YB5 A;  2NOO A;  2OZZ A;  4POX A;  4NF6 B;  3A3C A;  1WVJ A;  2O69 A;  3QXM A;  1BTJ A;  3RUM A;  3MZB A;  1M5E A;  2UVG A;  4ZZE A;  1B1H A;  1M5C A;  2ZNU A;  2DVC A;  1MH3 A;  1B3G A;  1OMP A;  2F5X A;  5I59 B;  3K02 A;  4PE5 B;  4XIG Q;  2QJE A;  3TDJ A;  4U4X A;  1XS5 A;  3FXU A;  3RT8 A;  4NED A;  2OLB A;  1B46 A;  3DP6 A;  2A5S A;  4YKP A;  4U1Z A;  4F1U A;  2DE2 A;  1LBB A;  4MF3 A;  2DS9 A;  2QS2 A;  4R73 A;  1N7W A;  1MXY A;  3MPK A;  1A7L A;  1GV8 A;  2XHD A;  5CMB A;  2AL4 A;  4OMB A;  3C4M A;  4H65 A;  5CM6 A;  4Q30 B;  2REG A;  3KG2 A;  4FEC A;  3FAT A;  3R26 A;  1SI1 A;  3TTN A;  4QSC A;  4GL8 A;  1URG A;  4MLQ A;  1RYX A;  1I6Q A;  4R74 A;  3O6G A;  1NNK A;  5JTY A;  3BKI B;  3FXQ A;  3MVZ A;  1Y4C A;  1PDA A;  2NXO A;  1LAF E;  2I4C A;  3OO7 A;  2F34 A;  2XX8 A;  1JNF A;  2HZL A;  3CI8 A;  3VXB A;  1EH3 A;  4ZS9 A;  1IIT A;  1SW2 A;  1POT A;  4DDD A;  1A54 A;  1UQW A;  2F36 A;  5ISU A;  3BBR A;  1XT8 A;  4BLA A;  2UVJ A;  2RC7 A;  1DSN A;  4LVQ A;  3VLW A;  1H43 A;  3EHU A;  4JBZ A;  3UGW A;  4RJZ A;  1NKX A;  2RC9 A;  2H9B A;  3S9M C;  5AA2 A;  1DOT A;  3OSR A;  3E9X A;  4BDN A;  3K6V A;  4H0W A;  2QSX A;  3U8Q A;  1MY4 A;  2OCU A;  3Q28 A;  3UN6 A;  4IO2 A;  1OVB A;  4GOT A;  3IAZ A;  5I2N B;  4DIG A;  1MM6 A;  3PD8 A;  4FAT A;  5TPA B;  1B9J A;  3OEM A;  5H8H A;  3CG3 A;  4MBP A;  3VVD A;  3EHT A;  4EQ7 A;  1JVX A;  2ONS A;  3USD A;  3T22 A;  4EXL A;  3FD3 A;  3IB1 A;  4JSO A;  4DXU A;  1IXC A;  3SEU A;  4MLV A;  1B1X A;  4KFQ A;  4Z0I A;  3S4U A;  2D3I A;  4KHZ E;  1JQF A;  5I57 B;  5H8Q A;  4GVO A;  1QKB A;  3FV1 A;  2ZMB A;  4GL0 A;  4FAJ A;  1R1N A;  1JEV A;  1R6Z A;  3H6W A;  4HCY A;  4DXC A;  4G68 C;  3QAX A;  3N94 A;  1B4Z A;  3SKP A;  2PT2 A;  2Y84 A;  1SYH A;  2I0C A;  3SET A;  1YCJ A;  4JDF A;  1AOV A;  4POW A;  3I3V A;  1MDP 1;  4YKI A;  1JW5 A;  1XVY A;  4OEN A;  3KN7 A;  3JYR A;  3R7X A;  3LR1 A;  4NF4 B;  5L9O A;  3TFL A;  1LGB C;  3F11 A;  4O3A A;  2RIN A;  1Q1K A;  5ELV A;  2F6G A;  1B51 A;  3N6T A;  4F18 A;  4DCX A;  4RPO A;  3N26 A;  2GFE A;  2HAU A;  3KBR A;  1SD3 A;  2XXY A;  1GGG A;  2QPQ A;  5I84 A;  2VOZ A;  1A8F A;  1DTG A;  1HSL A;  3G3H A;  2A5T B;  4FJP A;  2Q2A A;  4XKR A;  3CRB A;  3TCF A;  1PC3 A;  3ZSF A;  1SBP A;  4I1D A;  3FV2 A;  4KCC A;  1UTB A;  3E3K A;  3TTL A;  5TU0 A;  1QUI A;  5ICT A;  3TYH A;  5I58 A;  1VSO A;  3TAJ A;  5CC2 A;  3E13 X;  3QK6 A;  2H98 A;  3Q26 A;  3O97 A;  5AA2 D;  4EQ9 A;  4KI0 E;  5FTH A;  3H6T A;  5DEX A;  4P11 A;  3TCG A;  2O84 X;  2DQV A;  2Z23 A;  1R9Q A;  3C36 A;  1Y3N A;  3C32 A;  5DYH A;  3PUV E;  4N6P A;  2DSF A;  4H5G A;  2Q88 A;  3ODB A;  2O7U A;  2Q8J A;  4FED A;  4F19 A;  4KCD A;  4NMY A;  2VD3 A;  4GXA A;  1J1N A;  4AB6 A;  3KOS A;  3JZJ A;  2RCB A;  3EN3 A;  3OEL A;  1ELJ A;  2ESN A;  3KEI A;  3MP1 A;  2E1S A;  3C9H A;  2THI A;  3T9X B;  4HS7 A;  3BFT A;  1P1W A;  3W15 C;  4AB5 A;  1ZLQ A;  3G7W A;  3H4Z A;  4GQO A;  2Z8F A;  4TLM B;  2D5W A;  2I58 A;  1EU8 A;  5JEI A;  3HO7 A;  4RK2 A;  4IO3 A;  4ONY A;  4U4S A;  3VV5 A;  1D4N A;  3DLN A;  5EHS A;  4RK9 A;  2Y7W A;  3A09 A;  4FEB A;  3O6I A;  1DTZ A;  3B7D A;  3HHG A;  1R9L A;  1Z7M E;  3OMB A;  3IO6 A;  4IO4 A;  4IB2 A;  1B0H A;  4GFR A;  5B70 A;  4OFL A;  4JXI A;  1B58 A;  2PMS A;  4HCW A;  1LBC A;  3C33 A;  1S50 A;  3VVE A;  3UP9 A;  4GWO A;  2XX9 A;  3RTW B;  3M8U A;  4Q5T A;  4H8J A;  2ZYM A;  4QFP A;  4ZE9 A;  3RY3 A;  1JEU A;  2CZL A;  2OK2 A;  2WKY A;  3SEW A;  1Y3Q A;  3AXF A;  3SES A;  2Y7I A;  1AH5 A;  3DP8 A;  4ZEB A;  3QIM A;  1B0L A;  5CMM A;  1USY E;  2V3Q A;  3IL1 B;  1MY0 A;  5I2N A;  3MVW A;  4YB7 A;  2QMW A;  4YB6 A;  1MXU A;  3CIJ A;  2O68 A;  3SEY A;  5TPA A;  2I4B A;  4R2F A;  1D3K A;  1LCT A;  3H03 A;  3VDF A;  3OO8 A;  4LA9 A;  2F35 A;  4U1O A;  1VFD A;  1SDX A;  5KZT A;  5L9M A;  3MP6 A;  4MH5 A;  2V93 A;  2IEE A;  4ND9 A;  3HCQ A;  3MJN A;  4R9G A;  4NF5 B;  4XKP A;  5CBS A;  3KN3 A;  2RC8 A;  4FE8 A;  4PET A;  3VLU A;  1A40 A;  4IO7 A;  1TXF A;  2GH9 A;  2VD2 A;  5F7V A;  1FQB A;  4LZ8 A;  3TKD A;  4YAH X;  4QRZ A;  1NNP A;  1XOC A;  3O2A A;  3THI A;  3HST A;  1BP5 A;  2DYX A;  2I6E A;  4OVJ A;  3DEL B;  2R9J A;  5AA1 A;  2I3V A;  2XXI A;  4X9T A;  1B6H A;  3VLV A;  3HN0 A;  3LBS A;  3UIF A;  2P2A A;  1B7H A;  3K2D A;  4NF8 B;  2W7Y A;  4OHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...