1I69A

Crystal structure of the reduced form of oxyr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
206
Chain Sequence
ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHSLRDQAMGFCFDTHFRATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR
publication title Structural basis of the redox switch in the OxyR transcription factor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 45
structure length 206
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i69A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1i69A02
1TFDA 4TLLB 4QF9A 3IO4A 1M5DA 3IB0A 3L6HA 3FASA 1H45A 3T96B 4JWOA 3TQLA 1R9QA 4LZ5A 2DE2A 4PFUA 2NWJA 3I6VA 2I4CA 1A8EA 4E0XA 3A3UA 3KSJA 5BWJA 3KJTA 3M8UA 2H98A 1DTZA 2Z8EA 3O2AA 3OOAA 3OD7A 1D9VA 3BBRA 4Q30B 2ONRA 1GGGA 2Z8FA 5DYHA 4ZE8A 4ISUA 4EQ7A 2XXUA 3OEKA 4OYVA 5F7VA 4BLAA 3FJMA 3CSBA 5DVJA 2I3VA 3MBPA 5CRYA 2DXRA 4G8HA 2X26A 3U72A 3MW0A 2NXOA 4YMAA 1N3WA 4IY5A 4WEDA 4POWA 3GLBA 3S9NC 3T9UA 2DS9A 1NH7A 3D4CA 1Y3PA 3QSLA 3K6WA 2H5YA 4ESXA 2RCAA 3E13X 5M2VA 2XD2A 1MXZA 1B40A 1RYOA 2H25A 1LB8A 1F9BA 2UYFA 2HAUA 1MXYA 1NNPA 3Q29A 2DWIA 4LVQA 1TT1A 5KDTA 1NL5A 3KSXA 2O84X 3RLFE 4KHZE 1FTJA 1IXIA 1MQJA 1AL3A 4IB2A 3MJNA 1AIVA 3PUWE 2ZXTA 3HSTA 1B4HA 2WKYA 4OFLA 1N84A 3FXQA 1B5HA 1YAEA 4ZEDA 1O63A 4GQOA 2YLNA 3JYRA 5I59B 4DZ1A 1SW2A 2QPQA 2D5WA 2F78A 3HHGA 1FQFA 1Q1KA 3U1OA 4ZEIA 3MP8A 3C4MA 1MXWA 5H8FB 3VV5A 1EH3A 1ZBMA 4MLQA 5B70A 4NEDA 4NF5B 4KR5A 4KQPA 1YPNA 1LAXA 2F7AA 3TTLA 2M8CA 4IO5A 3VDFA 2Y84A 1B5JA 5ITPA 1P99A 3M3KA 3FVGA 3PMWA 3FV2A 4KYEA 1SI0A 2FYIA 2F7BA 3OSRA 2F8DA 1PB7A 3KZGA 3V5AA 3PPRA 1MM7A 2O7UA 3SEYA 3TCGA 2XXVA 3M3FA 3USDA 4QFKA 5JEIA 1FQCA 2PMSA 4NF6A 3MQ9A 1M5CA 2V3QA 3EHTA 1BIYA 4XIGQ 4BDRA 1QUJA 2DYXA 1A54A 4G77A 2REJA 1B5IA 3MUQA 1XT8A 3RPWA 4OERA 4GWOA 3DP8A 3PD9A 3PU5A 1ATGA 4ZZEA 3S9EA 1N7XA 5F1QA 1LFGA 3K1NA 4WXJA 1N76A 3EHSA 1IUDA 1M5EA 3UGWA 1EU8A 4H8JA 1LFHA 2Q9TA 3K4UA 1IIWA 4R6YA 2GHAA 1JQFA 1Y20A 2QS3A 5CBSA 3F11A 3IJXB 4EF1A 4GLIA 1URSA 3IAZA 1UIVA 1YTVA 1N7WA 3RT6B 5AA2D 2XXIA 2F34A 4EDPA 4ZZAA 4OENA 1QJMA 3RTWB 3FUZA 4G8MA 1M5FA 2QS2A 4H8IA 2XXPA 3PD8A 4GRKA 1MY3A 3O6HA 3EPEA 3PPPA 2UYEA 2QS1A 4ESWA 2I0BA 4RK2A 2Z8DA 1UTHA 4IO4A 3TQWA 4F1VA 3KBRA 1LAHE 4R6KA 4FEDA 1HSJA 3OO7A 1ANFA 4OVJA 1JNFA 4UA8A 1DPEA 1B6HA 3HCQA 5DEXA 4YKJA 3UN6A 4JB7A 2V3TA 3H6WA 3THIA 3B6TA 1B7HA 1CB6A 1IXHA 2RKMA 2ALUA 1Z7NE 4OXVA 3WAEA 5A5XA 5HBCA 4YAHX 2R9JA 5AA2A 3CSGA 2VD2A 4R75A 5FHMA 5LOMA 5L8DA 3LSXA 4JDFA 5AA4B 3MVZA 3SKPA 4F3BA 5I2KA 4R2FA 3K6UA 4GF8A 1ZJLA 2XXHA 1FTMA 4GD5A 3N6UA 2UVGA 4ZEKA 2OCUA 4C0RA 3R26A 1O64A 1FQDA 1NH8A 3PPOA 1MPCA 3S4UA 3S9LC 1B4ZA 3N26A 1JVYA 2IA4A 3E4RA 2PT1A 3MZ1A 1XOCA 2O1MA 4F39A 2Y7KA 3R6UA 3ECRA 4IY6A 3AXFA 5TPAA 1OLCA 3DM0A 3H3GA 5FTHA 3KG2A 4U22A 1ZIUA 2I48A 2F35A 1PBQA 2ZYMA 1JEVA 2NOOA 3IR1A 5H8SA 1J1NA 3SESA 5K2XA 1Z7ME 4QSDA 2DE4A 1A7LA 1B05A 3OO8A 4R9FA 1ZMGA 1A55A 4I8CA 4IO2A 1BP5A 2Y7RA 2Z22A 3IOTA 3DLNA 3MWBA 4X48A 1SYHA 3W9VA 3DP4A 5J1DA 1XHYA 3SEXA 4AQ4A 2I4BA 4XTCQ 1MY4A 2REGA 3R7XA 2UVJA 2R6GE 4WKMA 4XXUA 4QHQA 2R71A 3BFUA 4Q0CA 2P2AA 2UVHA 1B52A 2E1SA 1EZ9A 3MVXA 4XKPA 5I58B 2O7IA 1B46A 2YPNA 3BKIB 2A5TA 3EF7A 4N6PA 2ZNSA 2DWAA 4C1TA 4RPOA 1LGBC 5IAIA 4F31B 2QJEA 4I9DA 3FZVA 3I3VA 3HPIA 3CFLA 4BDOA 2NVUB 4ZEBA 2G93A 2VHAA 4IO3A 1QKBA 4IGRA 1CE2A 3PUZE 2HZLA 1Y1MA 3W9WA 4JBZA 4NF4A 5FHOA 4QFNA 1SD3A 1DPPA 4M1VA 4F19A 4EQBA 2ZYOA 4JWXA 1OMPA 3O6GA 3MP1A 1MY1A 5EYFA 4JXIA 4E0WA 1XS5A 1B9JA 4IO7A 3CFXA 3G3FA 3VXCA 4ELRA 5CMMA 1LBCA 4PP0A 4RXLA 1B32A 4O3BA 5H8HA 4QSCA 2DOJA 3K02A 3MPKA 4PFYA 1PB8A 3IB1A 4OETA 4F22A 3N5LA 2H4IA 3TTRA 4PQJA 3QXMA 4AB6A 3MPLA 3FJGA 3H6VA 5KDTB 4YKPA 1OQHA 2PYYA 1GVCA 1MH3A 2I49A 4F2OA 4WEPA 1FQAA 4UACA 4KYSA 3UORA 1I69A 3IOVA 3T9XB 3DELB 3UA8A 3TUSA 4RNSA 4YKKA 5I57A 2DWJA 1US4A 4I62A 3RN8A 4TQUQ 1DMBA 2ABHA 1MPDA 2DP8A 2ZNUA 4N13A 3A3CA 1SQYA 2Y7WA 4XKNA 1I6QA 2QMXA 5BUUA 1MPBA 3IORA 4R2BA 1LCFA 4H5GA 1EZPA 3U8QA 1QULA 5H8QA 3H4ZA 1B7UA 4ND9A 5AA1A 3U94A 2THIA 4GL8A 2QRYA 1Y3QA 2XXWA 1M5BA 4HTGA 2HAVA 1FQEA 2DE3A 1N0TA 3IL1B 3LC8A 2FA7A 5TP9A 2Z23A 3IOWA 1B2HA 1H44A 3KJ7A 2VOZA 3M3LA 1B3EA 4O3AA 4OESA 2H99A 1T0KA 3B7DA 1SVXB 4Z0IA 3IB2A 2V93A 1JVXA 5H8FA 3EHUA 3RT8A 2AIXA 3D4GA 4NF6B 4OMBA 4QFPA 4G68C 1WDNA 2ONSA 3IJOB 5ELVA 3PUXE 3UK4A 4GOTA 4PE5B 3CR9A 4RPNA 3EN3A 3PGFA 3ZSFA 1PC3A 1IXGA 3VFJA 1A99A 4XKQA 1NFTA 3TDJA 3JZJA 5I56A 3FJ7A 1SYIA 3T22A 1Y3NA 1Y4CA 4THIA 4JSOA 2XXQA 3SEWA 3FVKA 5KCJA 3QAXA 3HO7A 3PMXA 4F3PA 2V25A 1BTJA 3TZAA 4OQOA 4JSDA 4F29A 3UIFA 4R74A 3G3KA 4ZEFA 1DTGA 3TAJA 3FIRA 3TELA 4H6DA 3FXRA 4RJZA 3Q26A 3TKDA 3B6QA 4PFTA 5L9SA 1I6AA 1UTHB 2ANJA 1SW1A 1POTA 2ZYKA 2D21A 1Y9UA 1R1NA 5ICQA 2HZKA 1QW0A 3WAFA 4H5FA 3V8XB 5I2NA 5DEXB 1B3FA 2F6GA 2V84A 3T66A 1IZ1A 4DE8A 4P0IA 4F3GA 1XVYA 3KOTA 2E0SA 5IKBA 1R9LA 3H7MA 1TXFA 3O97A 3PMVA 1AOVA 4ELPA 5A5XB 4OEUA 3C35A 4MLVA 4OFOA 4ELQA 3O29A 4TLMB 2VP1A 3C34A 4GFRA 2W7YA 5AA2B 2Q2CA 1MQGA 3QUJA 3C32A 1Y1ZA 3OELA 4YICA 3RNNA 5I2KB 3TEPA 3MVWA 3K00A 1B1HA 3VXBA 4NF8B 4BDLA 1BLFA 3TTKA 3TODA 3G3HA 2Q89A 1OVBA 3TFLA 4QSEA 3LSFB 3QK6A 2RC9A 3O66A 3SETA 4YKIA 2YJPA 3K2DA 2XHDA 1VFDA 3K0VA 2VD3A 1LBBA 4JWYA 1N3XA 3C31A 1FTKA 1MH4A 5DT6A 1FTOA 5TPAB 5DVIA 3OENA 2ONKE 3LSWA 5L9MA 4DXUA 2QS4A 4LUBA 1MY2A 1NKXA 2RF1A 2QMWA 4DLDA 4HW8A 2ZNTA 2O1LA 1JW1A 5JTYA 3E3KA 3VLUA 3OO6A 3ZS6A 1B51A 1N04A 1UTBA 1Q35A 2DQVA 4LONB 2I3WA 1FQBA 4P0GA 2X7PA 2PVUA 1MQIA 1FCKA 3QYTA 4DCXA 1DSNA 4U2RA 4NMYA 4YU0A 3RQTA 1VFEA 3TTMA 3PUVE 2HXWA 3G7WA 1VSOA 1MDQA 5JK4A 4RA1A 3FVNA 2XXRA 1B3HA 2RCBA 3TCFA 2VGQA 1P1NA 1MDP1 2PX1A 3DP6A 1NNFA 1MQHA 1ZKBA 4ZDMA 3UP9A 3FD3A 1XVXA 4KCDA 3VE1B 2A5TB 3K6XA 1DOTA 4G2ZA 3RUMA 5H8NA 1IITA 4X1BA 5CM6A 4FIMA 2IEEA 1WVJA 4I1DA 1B7ZA 4G4PA 1B0HA 1B58A 4H65A 3U92A 2P0SA 2GRVA 4HCYA 4Z7EA 4LZ7A 1R6ZA 1LFIA 1QUIA 2DVZA 5EHSA 1GR2A 4F3SA 1UQWA 4NF4B 3GZGA 1P1QA 1JEUA 3MC2A 4QRZA 3V89B 4G68A 2O6AA 3T93B 2HCAA 1RKMA 3LBSA 5HM4B 1LSTA 5I58A 3P7IA 1JW4A 1US5A 4DXCA 4OFJA 5AA3A 3GBBA 2DXYA 5L9OA 1HSEA 5ISUA 4LATA 3KFMA 3K1PA 2DWHA 3PV0E 4EXKA 3H06B 4EXLA 2XXYA 1HSLA 4MBPA 2F7CA 4P11A 4GVOA 3IX1A 3PPQA 4RY1A 1EZOA 2OK2A 4LQ2A 3SEUA 3W15C 3MZ9A 1BKAA 4KD5A 4FAJA 4O3CA 4ZE9A 3TCHA 4LZ8A 1ELJA 1OIBA 1PEBA 5H8HB 1QKAA 3G3IA 3SERA 4K3FA 3G3GA 3TTNA 3C9HA 3CI8A 3I5OA 3ILTB 4GIZA 4F1YA 4YB7A 1SW4A 4FORA 1USYH 2O69A 4GXAA 4KCCA 1GV8A 3QUFA 4FEBA 3LUYA 4IO6A 4POXA 2PT2A 3LR1A 1LLSA 4HCWA 4BDMA 2BJJX 2AL5A 5AE4A 3ONMA 1S7YA 4FJPA 3ILUB 3FV1A 2NUVA 4EUOA 1B3LA 1KWHA 2GH9A 3MP6A 3K01A 1GTKA 2UVIA 1TWYA 4KFQA 4MFIA 4YZZA 4L17A 1URGA 5I57B 1IQ7A 1QVSA 3HV1A 1O7TA 3N6TA 1JW5A 5ITOA 4X1DA 3RGYA 1PB9A 3PPNA 3ZKKA 3FXUA 3N94A 4U21A 1ZTYA 1L5TA 4U4XA 5FHNA 1WODA 5H8QB 3S2VA 1YCJA 4MF3A 1RYXA 1VE4A 3KN7A 2CMOA 2AL4A 2HEUA 2QSXA 4OZ9A 3TYHA 2ESNA 4Q5TA 2X7QA 1SDXA 3GBAA 2CZLA 2H9BA 1S50A 1LAGE 3TMGA 4NTLA 2F6PA 3VVFA 5B7DA 5TP9B 1VR5A 3KEIA 2Y7PA 4G8NA 1MY0A 3A09A 3B6WA 3CVGA 4NWDA 1NNTA 3G3JA 2DVCA 4LP2B 2HQ0A 4H0WA 3OSQA 1OLAA 4HS7A 4RK9A 5I59A 4U4SA 3E9XA 1A40A 5CMCA 1ZLQA 1B3GA 2FNCA 1MG1A 5EHMA 4OTEA 3ZKLA 4KI0E 2DSFA 4QFLA 2B3BA 2HFBA 3CRBA 3T9HB 4FATA 1LAFE 3CG1A 3KN8A 5CBRA 4OEVA 1USYE 3T9VA 4LA9A 4NF5A 1SBPA 2XX9A 4BDNA 4DDDA 4ECFA 2Q2AA 4PFWA 3Q25A 3HHFA 2O68A 5CMBA 2XX7A 5I56B 1QUKA 1D3KA 4DXBA 2PBWA 2KLFA 1XC1A 1JETA 3VVDA 3PUYE 1PDAA 4ELOA 1II5A 3OO9A 2OJTA 5DTBA 3CIJA 5KCJB 2QL3A 2OWSA 1P1UA 3EQ1A 2XXTA 1FTLA 2I0CA 3ODBA 1Y4TA 4ZECA 3Q27A 1D9YA 2F5XA 1URDA 2XXXA 1TFAA 3JV9A 4AB5A 3VLWA 3HN0A 1MXUA 3RTFB 2A5SA 5I2NB 3O28A 1IXCA 1OQGA 3FVOA 1I6BA 1NMUA 4GL0A 2LAOA 5CMKA 3MZBA 4N07A 2I6EA 4PETA 4X9TA 4R73A 4R6HA 2OLBA 4YB6A 3BFTA 3VLVA 4U23A 3SEVA 4F2QA 1D4NA 3FATA 5CC2A 2OBGA 4F1UA 3CFZA 1A8FA 5ICTA 2Q88A 3K1MA 4TOZA 2RINA 2B3FA 5KZTA 2F97A 4QFOA 4EQ9A 2I58A 2G29A 3IK6B 3KOSA 3O9PA 3VVEA 1IEJA 5CI5A 1B1XA 2ZYNA 1MXVA 2GFEA 3V83A 4KPTA 4XKRA 4C1UA 2V3UA 2Y7IA 4NE4A 1AH5A 3KN3A 2RC8A 3MAMA 5K2YA 4YB5A 5JTYB 3IO6A 3K6VA 4H67A 4NF8A 3C33A 1H43A 4KYDA 1UTBB 2XD3A 3GXAA 1SW5A 1PBPA 4DCYA 5AA4A 2RC7A 3L6GA 5HPQA 1MS7A 4Q8RA 1ZU0A 4ONYA 3QIMA 1MRPA 4FECA 3TPAA 4M4GA 4OHNA 4YMBA 1S9TA 4FE8A 5I84A 3SDFA 4LQ5A 1AMFA 4OWDA 4U1ZA 3H03A 1FW0A 1OVTA 3H6UA 1SI1A 2Q8JA 1NNKA 2OWTA 2P1SA 1UIUA 1H76A 1H3DA 3FGSA 3RY3A 3S9MC 4DIGA 4R9GA 2OZZA 4H1XA 2GHBA 5H8NB 3OMBA 5DVFA 3OEMA 2D3IA 1P1WA 3H6TA 2B65A 3KGCA 4ZS9A 1POY1 4RYAA 4GXSB 3U93A 3O6IA 3C36A 4R72A 5FTIA 3LSLA 1MQDA 4BDQA 4NWCA 4U1OA 1P1OA 4G68B 1LCTA 2ZMBA 2AYSA 1B0LA 4F18A 2O51A 2XX8A 3IOUA 5TU0A 4EF2A 3MVYA 1MXXA 2UXAA 1MM6A 1LB9A 4MH5A 2F36A 3Q28A 3OXNA 4IGTA 3CG3A
chains in the Genus database with same CATH superfamily
5EQAA 1TFDA 4TLLB 4QF9A 3IO4A 4FBPA 2XWOA 1M5DA 3IB0A 3L6HA 3FASA 1H45A 4PAKA 3T96B 1IMAA 2CZHA 4JWOA 3TQLA 1R9QA 4LZ5A 2DE2A 4PFUA 2XXKA 2NWJA 3I6VA 2I4CA 1A8EA 2WX9A 4E0XA 3A3UA 3KSJA 5BWJA 3KJTA 3M8UA 2H98A 1DTZA 2Z8EA 2WEFA 3O2AA 3OOAA 3OD7A 1D9VA 2HPGA 3BBRA 4Q30B 2ONRA 1GGGA 2Z8FA 4KXPA 5DYHA 4IR8A 4ZE8A 4ISUA 2ZZVA 4EQ7A 2XXUA 3OEKA 4OYVA 5F7VA 4BLAA 1VDWA 3FJMA 3CSBA 2V4CA 5IM2A 5DVJA 2I3VA 4PTKA 3MBPA 5CRYA 2DXRA 1FSAA 4G8HA 2X26A 3U72A 3MW0A 2NXOA 4YMAA 1N3WA 4IY5A 4WEDA 2Y5LA 4POWA 2R8TA 3GLBA 3S9NC 3T9UA 1FPKA 2DS9A 1NH7A 3D4CA 1Y3PA 3QSLA 3K6WA 2H5YA 5LTCA 4ESXA 2RCAA 3E13X 5M2VA 2XD2A 1MXZA 1B40A 1RYOA 4OVPA 2H25A 2WBDA 1LB8A 4NF0A 1F9BA 2UYFA 2HAUA 2P3NA 1MXYA 1NNPA 3Q29A 1IMBA 2F3BA 2DWIA 4LVQA 1TT1A 5KDTA 2VPNA 1NL5A 3KSXA 1EYJA 2O84X 4GBWA 3RLFE 4KHZE 1FTJA 1IXIA 1MQJA 1AL3A 4IB2A 3MJNA 1AIVA 3PUWE 2ZXTA 3HSTA 1B4HA 2WKYA 4OFLA 1N84A 4JVDA 4N8YA 3FXQA 1B5HA 1YAEA 4ZEDA 1O63A 4GQOA 2YLNA 3JYRA 5I59B 4DZ1A 2FIXA 4P1EA 1SW2A 2QPQA 1BK4A 2D5WA 2F78A 3HHGA 4HE2A 2XWIA 1FQFA 1Q1KA 3U1OA 4ZEIA 3MP8A 2MKZA 1MXWA 3C4MA 5H8FB 3VV5A 1EH3A 1ZBMA 4MLQA 5B70A 4NEDA 4NF5B 4KR5A 4KQPA 1YPNA 1LAXA 3KBZA 2F7AA 1NV2A 3TTLA 2M8CA 5ET6A 4IO5A 3VDFA 5I7IA 2Y84A 1B5JA 5ITPA 1P99A 3M3KA 3FVGA 3PMWA 3FV2A 4KYEA 1SI0A 2FYIA 2F7BA 4PGNA 3OSRA 2F8DA 1PB7A 3KZGA 3V5AA 4P1LA 3PPRA 1MM7A 3LV0A 2O7UA 3SEYA 3TCGA 2XXVA 3M3FA 3USDA 4QFKA 5JEIA 1FQCA 2PMSA 4NF6A 3MQ9A 1M5CA 2V3QA 3EHTA 1BIYA 4XIGQ 4AS4A 4BDRA 4NX1A 1QUJA 2DYXA 1A54A 3NOHA 2REJA 4G77A 1B5IA 3MUQA 1XT8A 3RPWA 4OERA 4GWOA 3DP8A 3PD9A 3PU5A 1NV7A 1ATGA 4ZZEA 3S9EA 1N7XA 5IZZA 3MYUA 5F1QA 1LFGA 3K1NA 4WXJA 1N76A 3EHSA 1IUDA 1M5EA 1QGXA 1EU8A 3UGWA 4H8JA 1LFHA 2Q9TA 3K4UA 1IIWA 4R6YA 2Q74A 2GHAA 1JQFA 5ET5A 1Y20A 2QS3A 5CBSA 3F11A 3IJXB 4EF1A 1SPIA 4GLIA 1URSA 3IAZA 4PBQA 1UIVA 1YTVA 1N7WA 3RT6B 5AA2D 2XXIA 2F34A 1LBZA 4PCDA 4EDPA 4ZZAA 4GX4A 4OENA 1QJMA 3RTWB 3FUZA 4G8MA 1M5FA 2QS2A 4H8IA 2XXPA 3PD8A 4GRKA 1MY3A 3O6HA 3GYYA 3EPEA 3PPPA 2UYEA 2QS1A 4ESWA 2I0BA 4RK2A 3BIGA 2Z8DA 1UTHA 4IO4A 3TQWA 2B4LA 4F1VA 3KBRA 1LAHE 4R6KA 4FEDA 1HSJA 3OO7A 1ANFA 3IFAA 1JNFA 4OVJA 4UA8A 1DPEA 1B6HA 3HCQA 5DEXA 4DI3D 4YKJA 3UN6A 1FBEA 4JB7A 1YXIA 2V3TA 3H6WA 3THIA 1Q9DA 3B6TA 1B7HA 3KC0A 3RPLA 1CB6A 1IXHA 2RKMA 4OVSA 2ALUA 1Z7NE 4OXVA 3WAEA 4MNPA 5A5XA 5HBCA 4PAFA 4YAHX 2FIEA 1JP4A 5I3SA 2R9JA 5AA2A 3CSGA 2VD2A 4R75A 5FHMA 5LOMA 5L8DA 3LSXA 4JDFA 5AA4B 3MVZA 3SKPA 4F3BA 5I2KA 4R2FA 3K6UA 4PF6A 1YZ0A 4GF8A 1ZJLA 2XXHA 1FTMA 4GD5A 3N6UA 2UVGA 4X8RA 5J16A 4ZEKA 2OCUA 4C0RA 3R26A 1O64A 1NI9A 1FQDA 1NH8A 3PPOA 1MPCA 3S4UA 3S9LC 1B4ZA 3N26A 1JVYA 2IA4A 3E4RA 2PT1A 2CEXA 1EYKA 3MZ1A 1XOCA 2O1MA 4F39A 2Y7KA 3R6UA 5EYGA 3ECRA 4IY6A 3AXFA 5TPAA 1OLCA 3DM0A 3H3GA 5FTHA 3KG2A 4U22A 1ZIUA 2I48A 2F35A 1PBQA 2ZYMA 1JEVA 2NOOA 3IR1A 5H8SA 1DCUA 1J1NA 3SESA 5K2XA 4MX6A 1Z7ME 4QSDA 1FPJA 1YYZA 2DE4A 2XWVA 3IFCA 1A7LA 1B05A 3OO8A 4R9FA 1ZMGA 1A55A 4I8CA 4IO2A 1BP5A 2Y7RA 2Z22A 4LN5A 3IOTA 3DLNA 3MWBA 4X48A 1SYHA 3W9VA 3DP4A 5J1DA 1XHYA 3SEXA 4AQ4A 2I4BA 4XTCQ 1MY4A 4PC9A 4H45A 2REGA 3R7XA 2UVJA 2R6GE 4WKMA 4XXUA 4QHQA 2R71A 3BFUA 4Q0CA 2P2AA 2UVHA 1B52A 2E1SA 4QBAA 1EZ9A 3MVXA 3HFUA 4XKPA 5I58B 2O7IA 1B46A 2YPNA 3BKIB 2A5TA 3EF7A 4N6PA 2ZNSA 2DWAA 4C1TA 4RPOA 1LGBC 5IAIA 4F31B 2QJEA 1LBYA 4I9DA 3FZVA 4XEQA 2ZZXA 3I3VA 3HPIA 3CFLA 4PAIA 4BDOA 2VT5A 2NVUB 4ZEBA 4PFRA 2G93A 2VHAA 4IO3A 1QKBA 4IGRA 4MHFA 1CE2A 3PUZE 4NGUA 2HZLA 1Y1MA 3W9WA 4JBZA 4NF4A 5FHOA 4QFNA 3ISPA 1FBPA 3E79A 1SD3A 1NV3A 1DPPA 4M1VA 4F19A 1KA0A 4EQBA 2ZYOA 4JWXA 4N8GA 1OMPA 3O6GA 3MP1A 1MY1A 5EYFA 4JXIA 4E0WA 1XS5A 1B9JA 3LUZA 4IO7A 3CFXA 5F24A 3G3FA 1RDYA 3VXCA 4ELRA 5CMMA 1LBCA 4PP0A 4RXLA 1B32A 4O3BA 5H8HA 4QSCA 2DOJA 3K02A 3MPKA 4N6DA 4PFYA 1PB8A 3BIHA 5LDZA 3IB1A 4OETA 4F22A 3N5LA 2H4IA 3TTRA 5DW8A 4PQJA 3QXMA 4AB6A 3MPLA 3FJGA 3H6VA 5KDTB 4YKPA 1OQHA 2PYYA 1GVCA 1MH3A 2I49A 4F2OA 4WEPA 1FQAA 4UACA 4KYSA 3UORA 1I69A 3IOVA 3T9XB 4GWZA 3DELB 3UA8A 3TUSA 1FBCA 4RNSA 4YKKA 5I57A 2DWJA 1US4A 4I62A 3RN8A 4TQUQ 1DMBA 4PGPA 2ABHA 1MPDA 2PCRA 2DP8A 2ZNUA 4N13A 2VPOA 3A3CA 1SQYA 4MIJA 2Y7WA 4XKNA 1I6QA 2QMXA 5BUUA 2FVZA 1MPBA 3IORA 4R2BA 1LCFA 4H5GA 1EZPA 3U8QA 1QULA 5H8QA 3H4ZA 2XWKA 4MNCA 1B7UA 4ND9A 5AA1A 3U94A 2THIA 4GL8A 2QRYA 4G61A 1Y3QA 2XXWA 1M5BA 4HTGA 2HAVA 1FQEA 2GQ1A 2DE3A 1N0TA 1EYIA 3IL1B 3LC8A 2CZIA 2FA7A 5TP9A 2Z23A 3IOWA 1B2HA 1H44A 3FXBA 2VOZA 3KJ7A 3M3LA 4MJOA 1B3EA 4O3AA 4OESA 2H99A 2KQZA 1T0KA 3B7DA 1SVXB 4Z0IA 3IB2A 2V93A 1DBZA 1JVXA 5H8FA 3EHUA 3RT8A 2AIXA 2Q8MA 3D4GA 4NF6B 4OVTA 4OMBA 4QFPA 4MEVA 4G68C 5ET8A 1WDNA 2ONSA 3IJOB 5ELVA 3PUXE 3UK4A 4GOTA 4PE5B 3CR9A 4RPNA 3EN3A 3PGFA 3ZSFA 1PC3A 1IXGA 3VFJA 1A99A 2WYKA 4XKQA 4PFBA 1NFTA 4PDHA 3TDJA 3JZJA 4OA4A 5I56A 3FJ7A 1SYIA 3T22A 1Y3NA 1Y4CA 4MAGA 4THIA 4JSOA 2XXQA 3SEWA 3FVKA 5KCJA 3QAXA 3HO7A 3PMXA 4F3PA 2V25A 1BTJA 3TZAA 4OQOA 1K9ZA 4JSDA 4F29A 3UIFA 1FPIA 4R74A 3G3KA 4ZEFA 1DTGA 3TAJA 3FIRA 3TELA 4H6DA 3FXRA 4RJZA 3Q26A 3TKDA 3B6QA 4PFTA 4PDDA 5L9SA 1I6AA 1UTHB 2ANJA 1SW1A 1POTA 2ZYKA 3A29A 2D21A 2KR0A 1Y9UA 1R1NA 5ICQA 3ROJA 2HZKA 1QW0A 3WAFA 4H5FA 3V8XB 5I2NA 5DEXB 1B3FA 2F6GA 2V84A 5EQ7A 3T66A 1IZ1A 4DE8A 4P0IA 4F3GA 1XVYA 3KOTA 1NUZA 2E0SA 5IKBA 1R9LA 3H7MA 1TXFA 3O97A 3PMVA 1AOVA 4ELPA 5A5XB 4OEUA 3C35A 4MLVA 4N81A 4OFOA 4ELQA 3O29A 4TLMB 2VP1A 3C34A 4GFRA 2W7YA 5AA2B 2Q2CA 1MQGA 3QUJA 3C32A 1Y1ZA 4JVIA 3OELA 1IMDA 4YICA 3RNNA 5I2KB 3TEPA 1DK4A 3MVWA 5IGAA 3K00A 1B1HA 3VXBA 4NF8B 4BDLA 1BLFA 3TTKA 3TODA 5ET7A 3G3HA 2Q89A 1OVBA 1LBVA 3TFLA 4QSEA 3LSFB 3QK6A 3SZPA 2RC9A 3O66A 4N6KA 3E78A 4YKIA 3SETA 1LBWA 2YJPA 3K2DA 2XHDA 1VFDA 2P3VA 3K0VA 2VD3A 1LBBA 1K9YA 4JWYA 1FPGA 1N3XA 3C31A 1FTKA 1MH4A 4PF8A 5DT6A 4GWUA 4PE3A 1FTOA 5TPAB 5DVIA 3RYDA 3OENA 2ONKE 3LSWA 1NV4A 5L9MA 4DXUA 2QS4A 4LUBA 1MY2A 1NKXA 2RF1A 2QFLA 2QMWA 4DLDA 4HW8A 2ZNTA 5EQ9A 2O1LA 1JW1A 5JTYA 3E3KA 3VLUA 4P56A 1FJ6A 3OO6A 1NV6A 3ZS6A 1B51A 1N04A 1UTBA 1Q35A 2DQVA 4LONB 2I3WA 1FQBA 4P0GA 2X7PA 2PVUA 1MQIA 4NG7A 1FCKA 3QYTA 4DCXA 5FBPA 1DSNA 5IZ3A 4U2RA 1KZ8A 1FPEA 4NMYA 4YU0A 3RQTA 1VFEA 3TTMA 3PUVE 2HXWA 3G7WA 1VSOA 1MDQA 5JK4A 4RA1A 3FVNA 2XXRA 1B3HA 2RCBA 3TCFA 2VGQA 1P1NA 1MDP1 2PX1A 1IMCA 3DP6A 1NNFA 1MQHA 1ZKBA 4ZDMA 3UP9A 3FD3A 1XVXA 4KCDA 3VE1B 2A5TB 3CHGA 3K6XA 1DOTA 4GBVA 5T3JA 4G2ZA 4OANA 3RUMA 5H8NA 1IITA 4X1BA 2HXRA 5CM6A 2PFZA 4FIMA 2IEEA 1WVJA 4I1DA 1B7ZA 4G4PA 1IMEA 1B0HA 1B58A 4H65A 3U92A 4GWYA 2P0SA 2GRVA 4HCYA 4Z7EA 3T1BA 4LZ7A 1R6ZA 1LFIA 1QUIA 5I5PA 2DVZA 4O7MA 1GR2A 5EHSA 1UQWA 4F3SA 4NF4B 3GZGA 4XFEA 1P1QA 1JEUA 3MC2A 4QRZA 2CEYA 3V89B 4G68A 2O6AA 3T93B 2HCAA 1RKMA 3LBSA 5HM4B 1LSTA 5I58A 3P7IA 2PFYA 1JW4A 1US5A 4DXCA 4OFJA 5AA3A 3GBBA 2DXYA 5L9OA 1HSEA 5ISUA 4LATA 3KFMA 1KA1A 3K1PA 3B8BA 2DWHA 3PV0E 4EXKA 1FPBA 1FRPA 3H06B 4EXLA 2XXYA 1HSLA 4MBPA 2F7CA 4P11A 4GVOA 3IX1A 3PPQA 4RY1A 1EZOA 2OK2A 4LQ2A 3SEUA 3W15C 3MZ9A 1BKAA 4KD5A 2FBPA 4FAJA 4O3CA 4ZE9A 3TCHA 4LZ8A 1ELJA 1OIBA 4I40A 1PEBA 2XA5A 5H8HB 4OVQA 1QKAA 4NN3A 4P9KA 3G3IA 3SERA 4K3FA 3G3GA 3D1RA 3TTNA 3C9HA 3EKIA 2QVUA 3CI8A 3I5OA 4AS5A 3ILTB 4GIZA 4F1YA 3PTYA 4YB7A 1SW4A 4FORA 1USYH 2O69A 4GXAA 3MSTA 1D9QA 4KCCA 1GV8A 3QUFA 4FEBA 3LUYA 4IO6A 4POXA 2PT2A 1NUXA 3LR1A 1LLSA 2F3DA 1LBXA 1NV1A 2B4MA 4HCWA 4BDMA 2BJJX 2AL5A 5AE4A 4MNIA 3ONMA 4N17A 1S7YA 1FBHA 4FJPA 3ILUB 3FV1A 2NUVA 4EUOA 1B3LA 1KWHA 2GH9A 4P47A 4PBHA 3MP6A 3K01A 1GTKA 2UVIA 1TWYA 4KFQA 4MFIA 4YZZA 4L17A 1URGA 5I57B 1IQ7A 1QVSA 3HV1A 1O7TA 4I3YA 1NUYA 3N6TA 1JW5A 5ITOA 4HE0A 4X1DA 3RGYA 1PB9A 3PPNA 3ZKKA 3FXUA 3N94A 4U21A 1ZTYA 1L5TA 4U4XA 5FHNA 1AWBA 1WODA 3KC1A 5H8QB 3S2VA 1YCJA 4MF3A 4GWWA 1RYXA 1VE4A 3KN7A 2CMOA 2AL4A 2HEUA 2QSXA 4OZ9A 3TYHA 2ESNA 4Q5TA 2X7QA 1SDXA 3GBAA 2CZLA 4MCOA 2H9BA 1S50A 1LAGE 3TMGA 2JJKA 4NTLA 2F6PA 3VVFA 5B7DA 5TP9B 1VR5A 3KEIA 2Y7PA 4G8NA 1MY0A 1FJ9A 3A09A 3B6WA 3CVGA 4NWDA 1NNTA 4XF5A 3G3JA 2DVCA 4LP2B 2HQ0A 4H0WA 4N4UA 4GWSA 3OSQA 1OLAA 4HS7A 4RK9A 2QVVA 5I59A 5IZ1A 4H46A 4U4SA 3E9XA 1A40A 4O94A 5CMCA 1ZLQA 1B3GA 3U65A 2FNCA 1MG1A 5EHMA 4OTEA 3ZKLA 4KI0E 2DSFA 4QFLA 2B3BA 2HFBA 4O7IA 3CRBA 3T9HB 4FATA 1LAFE 3CG1A 3KN8A 5CBRA 4OEVA 1USYE 3T9VA 4LA9A 4NF5A 1SBPA 2XX9A 2CZKA 2L5VA 1FPLA 4BDNA 4DDDA 4ECFA 1G0IA 2Q2AA 4PFWA 3Q25A 4MMPA 3HHFA 2O68A 5CMBA 4JVCA 2XX7A 5I56B 1QUKA 1D3KA 4DXBA 2OX3A 2PBWA 2KLFA 1XC1A 1FBFA 1JETA 3VVDA 3PUYE 1PDAA 4ELOA 1II5A 3OO9A 2OJTA 5DTBA 1NV0A 3CIJA 1NUWA 5EQ8A 5KCJB 2QL3A 2OWSA 4DI4B 1P1UA 3EQ1A 4OVRA 2XXTA 1FTLA 2I0CA 3ODBA 1Y4TA 4ZECA 3Q27A 1D9YA 1IMFA 2F5XA 4P8BA 1URDA 2DDKA 2XXXA 1TFAA 3JV9A 4AB5A 3VLWA 3HN0A 1MXUA 3RTFB 3QMFA 2A5SA 5I2NB 3O28A 1IXCA 1OQGA 3FVOA 1I6BA 4HE1A 4O8MA 1NMUA 4GL0A 2LAOA 4HXVA 5CMKA 3MZBA 2OWZA 4N07A 1NV5A 2I6EA 4PETA 4X9TA 4R73A 4R6HA 2OLBA 4YB6A 3BFTA 3VLVA 3RPLB 4U23A 5A5LA 3SEVA 4F2QA 1D4NA 3FATA 5CC2A 2OBGA 4F1UA 1FTAA 3CFZA 1A8FA 5ICTA 2Q88A 4UABA 3K1MA 3B50A 4TOZA 2RINA 2B3FA 5KZTA 2F97A 4QFOA 4EQ9A 2QVRA 2I58A 4NQ8A 1LEVA 2G29A 3IK6B 4N15A 3KOSA 3O9PA 3VVEA 1IEJA 5CI5A 1B1XA 4GX3A 2ZYNA 1MXVA 2GFEA 3V83A 4KPTA 4XKRA 1CNQA 2FHYA 4NAPA 4C1UA 2V3UA 1FPDA 2Y7IA 4NE4A 1AH5A 3KN3A 2RC8A 3MAMA 2WBBA 5K2YA 4YB5A 5JTYB 3IO6A 4N91A 3K6VA 4P3LA 4H67A 4NF8A 3C33A 1H43A 4KYDA 1UTBB 2XD3A 3GXAA 1SW5A 1PBPA 4DCYA 5AA4A 2RC7A 4I3EA 3L6GA 4NHBA 5HPQA 1MS7A 5IZ3B 4Q8RA 1ZU0A 4ONYA 1INPA 3QIMA 1FBDA 1XI6A 1MRPA 4FECA 3TPAA 4M4GA 4OHNA 4YMBA 1S9TA 4FE8A 5I84A 3SDFA 4LQ5A 1AMFA 4OWDA 1FBGA 4U1ZA 2BJIA 3H03A 1FW0A 1OVTA 3H6UA 1SI1A 2Q8JA 1NNKA 2OWTA 5EYHA 1FPFA 2P1SA 1UIUA 1H76A 3FBPA 1H3DA 3FGSA 3RY3A 3S9MC 4DIGA 1RDXA 4R9GA 2OZZA 4H1XA 2GHBA 5H8NB 1RDZA 3OMBA 5DVFA 3OEMA 2D3IA 1P1WA 3H6TA 5ESYA 2ZZWA 2B65A 2Y5KA 3KGCA 1G0HA 4ZS9A 4QXDA 1POY1 4RYAA 4GXSB 3U93A 3O6IA 3C36A 4R72A 5FTIA 3LSLA 1MQDA 4BDQA 4PFIA 4NWCA 4X04A 4U1OA 1P1OA 4G68B 1LCTA 2ZMBA 2AYSA 1B0LA 4GX6A 4F18A 4GWXA 2O51A 2XX8A 3IOUA 3T0JA 5TU0A 4EF2A 2HHMA 3MVYA 1MXXA 2UXAA 1MM6A 1LB9A 4MH5A 2F36A 3Q28A 3OXNA 4IGTA 2WYPA 3CG3A
chains in the Genus database with same CATH topology
1TFDA 4TLLB 4QF9A 3IO4A 1M5DA 3IB0A 3L6HA 3FASA 1H45A 3T96B 4JWOA 3TQLA 1R9QA 4LZ5A 2DE2A 4PFUA 2NWJA 3I6VA 2I4CA 1A8EA 4E0XA 3A3UA 3KSJA 5BWJA 3KJTA 3M8UA 2H98A 1DTZA 2Z8EA 3O2AA 3OOAA 3OD7A 1D9VA 3BBRA 4Q30B 2ONRA 1GGGA 2Z8FA 5DYHA 4ZE8A 4ISUA 4EQ7A 2XXUA 3OEKA 4OYVA 5F7VA 4BLAA 3FJMA 3CSBA 5DVJA 2I3VA 3MBPA 5CRYA 2DXRA 4G8HA 2X26A 3U72A 3MW0A 2NXOA 4YMAA 1N3WA 4IY5A 4WEDA 4POWA 3GLBA 3S9NC 3T9UA 2DS9A 1NH7A 3D4CA 1Y3PA 3QSLA 3K6WA 2H5YA 4ESXA 2RCAA 3E13X 5M2VA 2XD2A 1MXZA 1B40A 1RYOA 2H25A 1LB8A 1F9BA 2UYFA 2HAUA 1MXYA 1NNPA 3Q29A 2DWIA 4LVQA 1TT1A 5KDTA 1NL5A 3KSXA 2O84X 3RLFE 4KHZE 1FTJA 1IXIA 1MQJA 1AL3A 4IB2A 3MJNA 1AIVA 3PUWE 2ZXTA 3HSTA 1B4HA 2WKYA 4OFLA 1N84A 3FXQA 1B5HA 1YAEA 4ZEDA 1O63A 4GQOA 2YLNA 3JYRA 5I59B 4DZ1A 1SW2A 2QPQA 2D5WA 2F78A 3HHGA 1FQFA 1Q1KA 3U1OA 4ZEIA 3MP8A 3C4MA 1MXWA 5H8FB 3VV5A 1EH3A 1ZBMA 4MLQA 5B70A 4NEDA 4NF5B 4KR5A 4KQPA 1YPNA 1LAXA 2F7AA 3TTLA 2M8CA 4IO5A 3VDFA 2Y84A 1B5JA 5ITPA 1P99A 3M3KA 3FVGA 3PMWA 3FV2A 4KYEA 1SI0A 2FYIA 2F7BA 3OSRA 2F8DA 1PB7A 3KZGA 3V5AA 3PPRA 1MM7A 2O7UA 3SEYA 3TCGA 2XXVA 3M3FA 3USDA 4QFKA 5JEIA 1FQCA 2PMSA 4NF6A 3MQ9A 1M5CA 2V3QA 3EHTA 1BIYA 4XIGQ 4BDRA 1QUJA 2DYXA 1A54A 4G77A 2REJA 1B5IA 3MUQA 1XT8A 3RPWA 4OERA 4GWOA 3DP8A 3PD9A 3PU5A 1ATGA 4ZZEA 3S9EA 1N7XA 5F1QA 1LFGA 3K1NA 4WXJA 1N76A 3EHSA 1IUDA 1M5EA 3UGWA 1EU8A 4H8JA 1LFHA 2Q9TA 3K4UA 1IIWA 4R6YA 2GHAA 1JQFA 1Y20A 2QS3A 5CBSA 3F11A 3IJXB 4EF1A 4GLIA 1URSA 3IAZA 1UIVA 1YTVA 1N7WA 3RT6B 5AA2D 2XXIA 2F34A 4EDPA 4ZZAA 4OENA 1QJMA 3RTWB 3FUZA 4G8MA 1M5FA 2QS2A 4H8IA 2XXPA 3PD8A 4GRKA 1MY3A 3O6HA 3EPEA 3PPPA 2UYEA 2QS1A 4ESWA 2I0BA 4RK2A 2Z8DA 1UTHA 4IO4A 3TQWA 4F1VA 3KBRA 1LAHE 4R6KA 4FEDA 1HSJA 3OO7A 1ANFA 4OVJA 1JNFA 4UA8A 1DPEA 1B6HA 3HCQA 5DEXA 4YKJA 3UN6A 4JB7A 2V3TA 3H6WA 3THIA 3B6TA 1B7HA 1CB6A 1IXHA 2RKMA 2ALUA 1Z7NE 4OXVA 3WAEA 5A5XA 5HBCA 4YAHX 2R9JA 5AA2A 3CSGA 2VD2A 4R75A 5FHMA 5LOMA 5L8DA 3LSXA 4JDFA 5AA4B 3MVZA 3SKPA 4F3BA 5I2KA 4R2FA 3K6UA 4GF8A 1ZJLA 2XXHA 1FTMA 4GD5A 3N6UA 2UVGA 4ZEKA 2OCUA 4C0RA 3R26A 1O64A 1FQDA 1NH8A 3PPOA 1MPCA 3S4UA 3S9LC 1B4ZA 3N26A 1JVYA 2IA4A 3E4RA 2PT1A 3MZ1A 1XOCA 2O1MA 4F39A 2Y7KA 3R6UA 3ECRA 4IY6A 3AXFA 5TPAA 1OLCA 3DM0A 3H3GA 5FTHA 3KG2A 4U22A 1ZIUA 2I48A 2F35A 1PBQA 2ZYMA 1JEVA 2NOOA 3IR1A 5H8SA 1J1NA 3SESA 5K2XA 1Z7ME 4QSDA 2DE4A 1A7LA 1B05A 3OO8A 4R9FA 1ZMGA 1A55A 4I8CA 4IO2A 1BP5A 2Y7RA 2Z22A 3IOTA 3DLNA 3MWBA 4X48A 1SYHA 3W9VA 3DP4A 5J1DA 1XHYA 3SEXA 4AQ4A 2I4BA 4XTCQ 1MY4A 2REGA 3R7XA 2UVJA 2R6GE 4WKMA 4XXUA 4QHQA 2R71A 3BFUA 4Q0CA 2P2AA 2UVHA 1B52A 2E1SA 1EZ9A 3MVXA 4XKPA 5I58B 2O7IA 1B46A 2YPNA 3BKIB 2A5TA 3EF7A 4N6PA 2ZNSA 2DWAA 4C1TA 4RPOA 1LGBC 5IAIA 4F31B 2QJEA 4I9DA 3FZVA 3I3VA 3HPIA 3CFLA 4BDOA 2NVUB 4ZEBA 2G93A 2VHAA 4IO3A 1QKBA 4IGRA 1CE2A 3PUZE 2HZLA 1Y1MA 3W9WA 4JBZA 4NF4A 5FHOA 4QFNA 1SD3A 1DPPA 4M1VA 4F19A 4EQBA 2ZYOA 4JWXA 1OMPA 3O6GA 3MP1A 1MY1A 5EYFA 4JXIA 4E0WA 1XS5A 1B9JA 4IO7A 3CFXA 3G3FA 3VXCA 4ELRA 5CMMA 1LBCA 4PP0A 4RXLA 1B32A 4O3BA 5H8HA 4QSCA 2DOJA 3K02A 3MPKA 4PFYA 1PB8A 3IB1A 4OETA 4F22A 3N5LA 2H4IA 3TTRA 4PQJA 3QXMA 4AB6A 3MPLA 3FJGA 3H6VA 5KDTB 4YKPA 1OQHA 2PYYA 1GVCA 1MH3A 2I49A 4F2OA 4WEPA 1FQAA 4UACA 4KYSA 3UORA 1I69A 3IOVA 3T9XB 3DELB 3UA8A 3TUSA 4RNSA 4YKKA 5I57A 2DWJA 1US4A 4I62A 3RN8A 4TQUQ 1DMBA 2ABHA 1MPDA 2DP8A 2ZNUA 4N13A 3A3CA 1SQYA 2Y7WA 4XKNA 1I6QA 2QMXA 5BUUA 1MPBA 3IORA 4R2BA 1LCFA 4H5GA 1EZPA 3U8QA 1QULA 5H8QA 3H4ZA 1B7UA 4ND9A 5AA1A 3U94A 2THIA 4GL8A 2QRYA 1Y3QA 2XXWA 1M5BA 4HTGA 2HAVA 1FQEA 2DE3A 1N0TA 3IL1B 3LC8A 2FA7A 5TP9A 2Z23A 3IOWA 1B2HA 1H44A 3KJ7A 2VOZA 3M3LA 1B3EA 4O3AA 4OESA 2H99A 1T0KA 3B7DA 1SVXB 4Z0IA 3IB2A 2V93A 1JVXA 5H8FA 3EHUA 3RT8A 2AIXA 3D4GA 4NF6B 4OMBA 4QFPA 4G68C 1WDNA 2ONSA 3IJOB 5ELVA 3PUXE 3UK4A 4GOTA 4PE5B 3CR9A 4RPNA 3EN3A 3PGFA 3ZSFA 1PC3A 1IXGA 3VFJA 1A99A 4XKQA 1NFTA 3TDJA 3JZJA 5I56A 3FJ7A 1SYIA 3T22A 1Y3NA 1Y4CA 4THIA 4JSOA 2XXQA 3SEWA 3FVKA 5KCJA 3QAXA 3HO7A 3PMXA 4F3PA 2V25A 1BTJA 3TZAA 4OQOA 4JSDA 4F29A 3UIFA 4R74A 3G3KA 4ZEFA 1DTGA 3TAJA 3FIRA 3TELA 4H6DA 3FXRA 4RJZA 3Q26A 3TKDA 3B6QA 4PFTA 5L9SA 1I6AA 1UTHB 2ANJA 1SW1A 1POTA 2ZYKA 2D21A 1Y9UA 1R1NA 5ICQA 2HZKA 1QW0A 3WAFA 4H5FA 3V8XB 5I2NA 5DEXB 1B3FA 2F6GA 2V84A 3T66A 1IZ1A 4DE8A 4P0IA 4F3GA 1XVYA 3KOTA 2E0SA 5IKBA 1R9LA 3H7MA 1TXFA 3O97A 3PMVA 1AOVA 4ELPA 5A5XB 4OEUA 3C35A 4MLVA 4OFOA 4ELQA 3O29A 4TLMB 2VP1A 3C34A 4GFRA 2W7YA 5AA2B 2Q2CA 1MQGA 3QUJA 3C32A 1Y1ZA 3OELA 4YICA 3RNNA 5I2KB 3TEPA 3MVWA 3K00A 1B1HA 3VXBA 4NF8B 4BDLA 1BLFA 3TTKA 3TODA 3G3HA 2Q89A 1OVBA 3TFLA 4QSEA 3LSFB 3QK6A 2RC9A 3O66A 3SETA 4YKIA 2YJPA 3K2DA 2XHDA 1VFDA 3K0VA 2VD3A 1LBBA 4JWYA 1N3XA 3C31A 1FTKA 1MH4A 5DT6A 1FTOA 5TPAB 5DVIA 3OENA 2ONKE 3LSWA 5L9MA 4DXUA 2QS4A 4LUBA 1MY2A 1NKXA 2RF1A 2QMWA 4DLDA 4HW8A 2ZNTA 2O1LA 1JW1A 5JTYA 3E3KA 3VLUA 3OO6A 3ZS6A 1B51A 1N04A 1UTBA 1Q35A 2DQVA 4LONB 2I3WA 1FQBA 4P0GA 2X7PA 2PVUA 1MQIA 1FCKA 3QYTA 4DCXA 1DSNA 4U2RA 4NMYA 4YU0A 3RQTA 1VFEA 3TTMA 3PUVE 2HXWA 3G7WA 1VSOA 1MDQA 5JK4A 4RA1A 3FVNA 2XXRA 1B3HA 2RCBA 3TCFA 2VGQA 1P1NA 1MDP1 2PX1A 3DP6A 1NNFA 1MQHA 1ZKBA 4ZDMA 3UP9A 3FD3A 1XVXA 4KCDA 3VE1B 2A5TB 3K6XA 1DOTA 4G2ZA 3RUMA 5H8NA 1IITA 4X1BA 5CM6A 4FIMA 2IEEA 1WVJA 4I1DA 1B7ZA 4G4PA 1B0HA 1B58A 4H65A 3U92A 2P0SA 2GRVA 4HCYA 4Z7EA 4LZ7A 1R6ZA 1LFIA 1QUIA 2DVZA 5EHSA 1GR2A 4F3SA 1UQWA 4NF4B 3GZGA 1P1QA 1JEUA 3MC2A 4QRZA 3V89B 4G68A 2O6AA 3T93B 2HCAA 1RKMA 3LBSA 5HM4B 1LSTA 5I58A 3P7IA 1JW4A 1US5A 4DXCA 4OFJA 5AA3A 3GBBA 2DXYA 5L9OA 1HSEA 5ISUA 4LATA 3KFMA 3K1PA 2DWHA 3PV0E 4EXKA 3H06B 4EXLA 2XXYA 1HSLA 4MBPA 2F7CA 4P11A 4GVOA 3IX1A 3PPQA 4RY1A 1EZOA 2OK2A 4LQ2A 3SEUA 3W15C 3MZ9A 1BKAA 4KD5A 4FAJA 4O3CA 4ZE9A 3TCHA 4LZ8A 1ELJA 1OIBA 1PEBA 5H8HB 1QKAA 3G3IA 3SERA 4K3FA 3G3GA 3TTNA 3C9HA 3CI8A 3I5OA 3ILTB 4GIZA 4F1YA 4YB7A 1SW4A 4FORA 1USYH 2O69A 4GXAA 4KCCA 1GV8A 3QUFA 4FEBA 3LUYA 4IO6A 4POXA 2PT2A 3LR1A 1LLSA 4HCWA 4BDMA 2BJJX 2AL5A 5AE4A 3ONMA 1S7YA 4FJPA 3ILUB 3FV1A 2NUVA 4EUOA 1B3LA 1KWHA 2GH9A 3MP6A 3K01A 1GTKA 2UVIA 1TWYA 4KFQA 4MFIA 4YZZA 4L17A 1URGA 5I57B 1IQ7A 1QVSA 3HV1A 1O7TA 3N6TA 1JW5A 5ITOA 4X1DA 3RGYA 1PB9A 3PPNA 3ZKKA 3FXUA 3N94A 4U21A 1ZTYA 1L5TA 4U4XA 5FHNA 1WODA 5H8QB 3S2VA 1YCJA 4MF3A 1RYXA 1VE4A 3KN7A 2CMOA 2AL4A 2HEUA 2QSXA 4OZ9A 3TYHA 2ESNA 4Q5TA 2X7QA 1SDXA 3GBAA 2CZLA 2H9BA 1S50A 1LAGE 3TMGA 4NTLA 2F6PA 3VVFA 5B7DA 5TP9B 1VR5A 3KEIA 2Y7PA 4G8NA 1MY0A 3A09A 3B6WA 3CVGA 4NWDA 1NNTA 3G3JA 2DVCA 4LP2B 2HQ0A 4H0WA 3OSQA 1OLAA 4HS7A 4RK9A 5I59A 4U4SA 3E9XA 1A40A 5CMCA 1ZLQA 1B3GA 2FNCA 1MG1A 5EHMA 4OTEA 3ZKLA 4KI0E 2DSFA 4QFLA 2B3BA 2HFBA 3CRBA 3T9HB 4FATA 1LAFE 3CG1A 3KN8A 5CBRA 4OEVA 1USYE 3T9VA 4LA9A 4NF5A 1SBPA 2XX9A 4BDNA 4DDDA 4ECFA 2Q2AA 4PFWA 3Q25A 3HHFA 2O68A 5CMBA 2XX7A 5I56B 1QUKA 1D3KA 4DXBA 2PBWA 2KLFA 1XC1A 1JETA 3VVDA 3PUYE 1PDAA 4ELOA 1II5A 3OO9A 2OJTA 5DTBA 3CIJA 5KCJB 2QL3A 2OWSA 1P1UA 3EQ1A 2XXTA 1FTLA 2I0CA 3ODBA 1Y4TA 4ZECA 3Q27A 1D9YA 2F5XA 1URDA 2XXXA 1TFAA 3JV9A 4AB5A 3VLWA 3HN0A 1MXUA 3RTFB 2A5SA 5I2NB 3O28A 1IXCA 1OQGA 3FVOA 1I6BA 1NMUA 4GL0A 2LAOA 5CMKA 3MZBA 4N07A 2I6EA 4PETA 4X9TA 4R73A 4R6HA 2OLBA 4YB6A 3BFTA 3VLVA 4U23A 3SEVA 4F2QA 1D4NA 3FATA 5CC2A 2OBGA 4F1UA 3CFZA 1A8FA 5ICTA 2Q88A 3K1MA 4TOZA 2RINA 2B3FA 5KZTA 2F97A 4QFOA 4EQ9A 2I58A 2G29A 3IK6B 3KOSA 3O9PA 3VVEA 1IEJA 5CI5A 1B1XA 2ZYNA 1MXVA 2GFEA 3V83A 4KPTA 4XKRA 4C1UA 2V3UA 2Y7IA 4NE4A 1AH5A 3KN3A 2RC8A 3MAMA 5K2YA 4YB5A 5JTYB 3IO6A 3K6VA 4H67A 4NF8A 3C33A 1H43A 4KYDA 1UTBB 2XD3A 3GXAA 1SW5A 1PBPA 4DCYA 5AA4A 2RC7A 3L6GA 5HPQA 1MS7A 4Q8RA 1ZU0A 4ONYA 3QIMA 1MRPA 4FECA 3TPAA 4M4GA 4OHNA 4YMBA 1S9TA 4FE8A 5I84A 3SDFA 4LQ5A 1AMFA 4OWDA 4U1ZA 3H03A 1FW0A 1OVTA 3H6UA 1SI1A 2Q8JA 1NNKA 2OWTA 2P1SA 1UIUA 1H76A 1H3DA 3FGSA 3RY3A 3S9MC 4DIGA 4R9GA 2OZZA 4H1XA 2GHBA 5H8NB 3OMBA 5DVFA 3OEMA 2D3IA 1P1WA 3H6TA 2B65A 3KGCA 4ZS9A 1POY1 4RYAA 4GXSB 3U93A 3O6IA 3C36A 4R72A 5FTIA 3LSLA 1MQDA 4BDQA 4NWCA 4U1OA 1P1OA 4G68B 1LCTA 2ZMBA 2AYSA 1B0LA 4F18A 2O51A 2XX8A 3IOUA 5TU0A 4EF2A 3MVYA 1MXXA 2UXAA 1MM6A 1LB9A 4MH5A 2F36A 3Q28A 3OXNA 4IGTA 3CG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFD A;  4TLL B;  4QF9 A;  3IO4 A;  1M5D A;  3IB0 A;  3L6H A;  3FAS A;  1H45 A;  3T96 B;  4JWO A;  3TQL A;  1R9Q A;  4LZ5 A;  2DE2 A;  4PFU A;  2NWJ A;  3I6V A;  2I4C A;  1A8E A;  4E0X A;  3A3U A;  3KSJ A;  5BWJ A;  3KJT A;  3M8U A;  2H98 A;  1DTZ A;  2Z8E A;  3O2A A;  3OOA A;  3OD7 A;  1D9V A;  3BBR A;  4Q30 B;  2ONR A;  1GGG A;  2Z8F A;  5DYH A;  4ZE8 A;  4ISU A;  4EQ7 A;  2XXU A;  3OEK A;  4OYV A;  5F7V A;  4BLA A;  3FJM A;  3CSB A;  5DVJ A;  2I3V A;  3MBP A;  5CRY A;  2DXR A;  4G8H A;  2X26 A;  3U72 A;  3MW0 A;  2NXO A;  4YMA A;  1N3W A;  4IY5 A;  4WED A;  4POW A;  3GLB A;  3S9N C;  3T9U A;  2DS9 A;  1NH7 A;  3D4C A;  1Y3P A;  3QSL A;  3K6W A;  2H5Y A;  4ESX A;  2RCA A;  3E13 X;  5M2V A;  2XD2 A;  1MXZ A;  1B40 A;  1RYO A;  2H25 A;  1LB8 A;  1F9B A;  2UYF A;  2HAU A;  1MXY A;  1NNP A;  3Q29 A;  2DWI A;  4LVQ A;  1TT1 A;  5KDT A;  1NL5 A;  3KSX A;  2O84 X;  3RLF E;  4KHZ E;  1FTJ A;  1IXI A;  1MQJ A;  1AL3 A;  4IB2 A;  3MJN A;  1AIV A;  3PUW E;  2ZXT A;  3HST A;  1B4H A;  2WKY A;  4OFL A;  1N84 A;  3FXQ A;  1B5H A;  1YAE A;  4ZED A;  1O63 A;  4GQO A;  2YLN A;  3JYR A;  5I59 B;  4DZ1 A;  1SW2 A;  2QPQ A;  2D5W A;  2F78 A;  3HHG A;  1FQF A;  1Q1K A;  3U1O A;  4ZEI A;  3MP8 A;  3C4M A;  1MXW A;  5H8F B;  3VV5 A;  1EH3 A;  1ZBM A;  4MLQ A;  5B70 A;  4NED A;  4NF5 B;  4KR5 A;  4KQP A;  1YPN A;  1LAX A;  2F7A A;  3TTL A;  2M8C A;  4IO5 A;  3VDF A;  2Y84 A;  1B5J A;  5ITP A;  1P99 A;  3M3K A;  3FVG A;  3PMW A;  3FV2 A;  4KYE A;  1SI0 A;  2FYI A;  2F7B A;  3OSR A;  2F8D A;  1PB7 A;  3KZG A;  3V5A A;  3PPR A;  1MM7 A;  2O7U A;  3SEY A;  3TCG A;  2XXV A;  3M3F A;  3USD A;  4QFK A;  5JEI A;  1FQC A;  2PMS A;  4NF6 A;  3MQ9 A;  1M5C A;  2V3Q A;  3EHT A;  1BIY A;  4XIG Q;  4BDR A;  1QUJ A;  2DYX A;  1A54 A;  4G77 A;  2REJ A;  1B5I A;  3MUQ A;  1XT8 A;  3RPW A;  4OER A;  4GWO A;  3DP8 A;  3PD9 A;  3PU5 A;  1ATG A;  4ZZE A;  3S9E A;  1N7X A;  5F1Q A;  1LFG A;  3K1N A;  4WXJ A;  1N76 A;  3EHS A;  1IUD A;  1M5E A;  3UGW A;  1EU8 A;  4H8J A;  1LFH A;  2Q9T A;  3K4U A;  1IIW A;  4R6Y A;  2GHA A;  1JQF A;  1Y20 A;  2QS3 A;  5CBS A;  3F11 A;  3IJX B;  4EF1 A;  4GLI A;  1URS A;  3IAZ A;  1UIV A;  1YTV A;  1N7W A;  3RT6 B;  5AA2 D;  2XXI A;  2F34 A;  4EDP A;  4ZZA A;  4OEN A;  1QJM A;  3RTW B;  3FUZ A;  4G8M A;  1M5F A;  2QS2 A;  4H8I A;  2XXP A;  3PD8 A;  4GRK A;  1MY3 A;  3O6H A;  3EPE A;  3PPP A;  2UYE A;  2QS1 A;  4ESW A;  2I0B A;  4RK2 A;  2Z8D A;  1UTH A;  4IO4 A;  3TQW A;  4F1V A;  3KBR A;  1LAH E;  4R6K A;  4FED A;  1HSJ A;  3OO7 A;  1ANF A;  4OVJ A;  1JNF A;  4UA8 A;  1DPE A;  1B6H A;  3HCQ A;  5DEX A;  4YKJ A;  3UN6 A;  4JB7 A;  2V3T A;  3H6W A;  3THI A;  3B6T A;  1B7H A;  1CB6 A;  1IXH A;  2RKM A;  2ALU A;  1Z7N E;  4OXV A;  3WAE A;  5A5X A;  5HBC A;  4YAH X;  2R9J A;  5AA2 A;  3CSG A;  2VD2 A;  4R75 A;  5FHM A;  5LOM A;  5L8D A;  3LSX A;  4JDF A;  5AA4 B;  3MVZ A;  3SKP A;  4F3B A;  5I2K A;  4R2F A;  3K6U A;  4GF8 A;  1ZJL A;  2XXH A;  1FTM A;  4GD5 A;  3N6U A;  2UVG A;  4ZEK A;  2OCU A;  4C0R A;  3R26 A;  1O64 A;  1FQD A;  1NH8 A;  3PPO A;  1MPC A;  3S4U A;  3S9L C;  1B4Z A;  3N26 A;  1JVY A;  2IA4 A;  3E4R A;  2PT1 A;  3MZ1 A;  1XOC A;  2O1M A;  4F39 A;  2Y7K A;  3R6U A;  3ECR A;  4IY6 A;  3AXF A;  5TPA A;  1OLC A;  3DM0 A;  3H3G A;  5FTH A;  3KG2 A;  4U22 A;  1ZIU A;  2I48 A;  2F35 A;  1PBQ A;  2ZYM A;  1JEV A;  2NOO A;  3IR1 A;  5H8S A;  1J1N A;  3SES A;  5K2X A;  1Z7M E;  4QSD A;  2DE4 A;  1A7L A;  1B05 A;  3OO8 A;  4R9F A;  1ZMG A;  1A55 A;  4I8C A;  4IO2 A;  1BP5 A;  2Y7R A;  2Z22 A;  3IOT A;  3DLN A;  3MWB A;  4X48 A;  1SYH A;  3W9V A;  3DP4 A;  5J1D A;  1XHY A;  3SEX A;  4AQ4 A;  2I4B A;  4XTC Q;  1MY4 A;  2REG A;  3R7X A;  2UVJ A;  2R6G E;  4WKM A;  4XXU A;  4QHQ A;  2R71 A;  3BFU A;  4Q0C A;  2P2A A;  2UVH A;  1B52 A;  2E1S A;  1EZ9 A;  3MVX A;  4XKP A;  5I58 B;  2O7I A;  1B46 A;  2YPN A;  3BKI B;  2A5T A;  3EF7 A;  4N6P A;  2ZNS A;  2DWA A;  4C1T A;  4RPO A;  1LGB C;  5IAI A;  4F31 B;  2QJE A;  4I9D A;  3FZV A;  3I3V A;  3HPI A;  3CFL A;  4BDO A;  2NVU B;  4ZEB A;  2G93 A;  2VHA A;  4IO3 A;  1QKB A;  4IGR A;  1CE2 A;  3PUZ E;  2HZL A;  1Y1M A;  3W9W A;  4JBZ A;  4NF4 A;  5FHO A;  4QFN A;  1SD3 A;  1DPP A;  4M1V A;  4F19 A;  4EQB A;  2ZYO A;  4JWX A;  1OMP A;  3O6G A;  3MP1 A;  1MY1 A;  5EYF A;  4JXI A;  4E0W A;  1XS5 A;  1B9J A;  4IO7 A;  3CFX A;  3G3F A;  3VXC A;  4ELR A;  5CMM A;  1LBC A;  4PP0 A;  4RXL A;  1B32 A;  4O3B A;  5H8H A;  4QSC A;  2DOJ A;  3K02 A;  3MPK A;  4PFY A;  1PB8 A;  3IB1 A;  4OET A;  4F22 A;  3N5L A;  2H4I A;  3TTR A;  4PQJ A;  3QXM A;  4AB6 A;  3MPL A;  3FJG A;  3H6V A;  5KDT B;  4YKP A;  1OQH A;  2PYY A;  1GVC A;  1MH3 A;  2I49 A;  4F2O A;  4WEP A;  1FQA A;  4UAC A;  4KYS A;  3UOR A;  1I69 A;  3IOV A;  3T9X B;  3DEL B;  3UA8 A;  3TUS A;  4RNS A;  4YKK A;  5I57 A;  2DWJ A;  1US4 A;  4I62 A;  3RN8 A;  4TQU Q;  1DMB A;  2ABH A;  1MPD A;  2DP8 A;  2ZNU A;  4N13 A;  3A3C A;  1SQY A;  2Y7W A;  4XKN A;  1I6Q A;  2QMX A;  5BUU A;  1MPB A;  3IOR A;  4R2B A;  1LCF A;  4H5G A;  1EZP A;  3U8Q A;  1QUL A;  5H8Q A;  3H4Z A;  1B7U A;  4ND9 A;  5AA1 A;  3U94 A;  2THI A;  4GL8 A;  2QRY A;  1Y3Q A;  2XXW A;  1M5B A;  4HTG A;  2HAV A;  1FQE A;  2DE3 A;  1N0T A;  3IL1 B;  3LC8 A;  2FA7 A;  5TP9 A;  2Z23 A;  3IOW A;  1B2H A;  1H44 A;  3KJ7 A;  2VOZ A;  3M3L A;  1B3E A;  4O3A A;  4OES A;  2H99 A;  1T0K A;  3B7D A;  1SVX B;  4Z0I A;  3IB2 A;  2V93 A;  1JVX A;  5H8F A;  3EHU A;  3RT8 A;  2AIX A;  3D4G A;  4NF6 B;  4OMB A;  4QFP A;  4G68 C;  1WDN A;  2ONS A;  3IJO B;  5ELV A;  3PUX E;  3UK4 A;  4GOT A;  4PE5 B;  3CR9 A;  4RPN A;  3EN3 A;  3PGF A;  3ZSF A;  1PC3 A;  1IXG A;  3VFJ A;  1A99 A;  4XKQ A;  1NFT A;  3TDJ A;  3JZJ A;  5I56 A;  3FJ7 A;  1SYI A;  3T22 A;  1Y3N A;  1Y4C A;  4THI A;  4JSO A;  2XXQ A;  3SEW A;  3FVK A;  5KCJ A;  3QAX A;  3HO7 A;  3PMX A;  4F3P A;  2V25 A;  1BTJ A;  3TZA A;  4OQO A;  4JSD A;  4F29 A;  3UIF A;  4R74 A;  3G3K A;  4ZEF A;  1DTG A;  3TAJ A;  3FIR A;  3TEL A;  4H6D A;  3FXR A;  4RJZ A;  3Q26 A;  3TKD A;  3B6Q A;  4PFT A;  5L9S A;  1I6A A;  1UTH B;  2ANJ A;  1SW1 A;  1POT A;  2ZYK A;  2D21 A;  1Y9U A;  1R1N A;  5ICQ A;  2HZK A;  1QW0 A;  3WAF A;  4H5F A;  3V8X B;  5I2N A;  5DEX B;  1B3F A;  2F6G A;  2V84 A;  3T66 A;  1IZ1 A;  4DE8 A;  4P0I A;  4F3G A;  1XVY A;  3KOT A;  2E0S A;  5IKB A;  1R9L A;  3H7M A;  1TXF A;  3O97 A;  3PMV A;  1AOV A;  4ELP A;  5A5X B;  4OEU A;  3C35 A;  4MLV A;  4OFO A;  4ELQ A;  3O29 A;  4TLM B;  2VP1 A;  3C34 A;  4GFR A;  2W7Y A;  5AA2 B;  2Q2C A;  1MQG A;  3QUJ A;  3C32 A;  1Y1Z A;  3OEL A;  4YIC A;  3RNN A;  5I2K B;  3TEP A;  3MVW A;  3K00 A;  1B1H A;  3VXB A;  4NF8 B;  4BDL A;  1BLF A;  3TTK A;  3TOD A;  3G3H A;  2Q89 A;  1OVB A;  3TFL A;  4QSE A;  3LSF B;  3QK6 A;  2RC9 A;  3O66 A;  3SET A;  4YKI A;  2YJP A;  3K2D A;  2XHD A;  1VFD A;  3K0V A;  2VD3 A;  1LBB A;  4JWY A;  1N3X A;  3C31 A;  1FTK A;  1MH4 A;  5DT6 A;  1FTO A;  5TPA B;  5DVI A;  3OEN A;  2ONK E;  3LSW A;  5L9M A;  4DXU A;  2QS4 A;  4LUB A;  1MY2 A;  1NKX A;  2RF1 A;  2QMW A;  4DLD A;  4HW8 A;  2ZNT A;  2O1L A;  1JW1 A;  5JTY A;  3E3K A;  3VLU A;  3OO6 A;  3ZS6 A;  1B51 A;  1N04 A;  1UTB A;  1Q35 A;  2DQV A;  4LON B;  2I3W A;  1FQB A;  4P0G A;  2X7P A;  2PVU A;  1MQI A;  1FCK A;  3QYT A;  4DCX A;  1DSN A;  4U2R A;  4NMY A;  4YU0 A;  3RQT A;  1VFE A;  3TTM A;  3PUV E;  2HXW A;  3G7W A;  1VSO A;  1MDQ A;  5JK4 A;  4RA1 A;  3FVN A;  2XXR A;  1B3H A;  2RCB A;  3TCF A;  2VGQ A;  1P1N A;  1MDP 1;  2PX1 A;  3DP6 A;  1NNF A;  1MQH A;  1ZKB A;  4ZDM A;  3UP9 A;  3FD3 A;  1XVX A;  4KCD A;  3VE1 B;  2A5T B;  3K6X A;  1DOT A;  4G2Z A;  3RUM A;  5H8N A;  1IIT A;  4X1B A;  5CM6 A;  4FIM A;  2IEE A;  1WVJ A;  4I1D A;  1B7Z A;  4G4P A;  1B0H A;  1B58 A;  4H65 A;  3U92 A;  2P0S A;  2GRV A;  4HCY A;  4Z7E A;  4LZ7 A;  1R6Z A;  1LFI A;  1QUI A;  2DVZ A;  5EHS A;  1GR2 A;  4F3S A;  1UQW A;  4NF4 B;  3GZG A;  1P1Q A;  1JEU A;  3MC2 A;  4QRZ A;  3V89 B;  4G68 A;  2O6A A;  3T93 B;  2HCA A;  1RKM A;  3LBS A;  5HM4 B;  1LST A;  5I58 A;  3P7I A;  1JW4 A;  1US5 A;  4DXC A;  4OFJ A;  5AA3 A;  3GBB A;  2DXY A;  5L9O A;  1HSE A;  5ISU A;  4LAT A;  3KFM A;  3K1P A;  2DWH A;  3PV0 E;  4EXK A;  3H06 B;  4EXL A;  2XXY A;  1HSL A;  4MBP A;  2F7C A;  4P11 A;  4GVO A;  3IX1 A;  3PPQ A;  4RY1 A;  1EZO A;  2OK2 A;  4LQ2 A;  3SEU A;  3W15 C;  3MZ9 A;  1BKA A;  4KD5 A;  4FAJ A;  4O3C A;  4ZE9 A;  3TCH A;  4LZ8 A;  1ELJ A;  1OIB A;  1PEB A;  5H8H B;  1QKA A;  3G3I A;  3SER A;  4K3F A;  3G3G A;  3TTN A;  3C9H A;  3CI8 A;  3I5O A;  3ILT B;  4GIZ A;  4F1Y A;  4YB7 A;  1SW4 A;  4FOR A;  1USY H;  2O69 A;  4GXA A;  4KCC A;  1GV8 A;  3QUF A;  4FEB A;  3LUY A;  4IO6 A;  4POX A;  2PT2 A;  3LR1 A;  1LLS A;  4HCW A;  4BDM A;  2BJJ X;  2AL5 A;  5AE4 A;  3ONM A;  1S7Y A;  4FJP A;  3ILU B;  3FV1 A;  2NUV A;  4EUO A;  1B3L A;  1KWH A;  2GH9 A;  3MP6 A;  3K01 A;  1GTK A;  2UVI A;  1TWY A;  4KFQ A;  4MFI A;  4YZZ A;  4L17 A;  1URG A;  5I57 B;  1IQ7 A;  1QVS A;  3HV1 A;  1O7T A;  3N6T A;  1JW5 A;  5ITO A;  4X1D A;  3RGY A;  1PB9 A;  3PPN A;  3ZKK A;  3FXU A;  3N94 A;  4U21 A;  1ZTY A;  1L5T A;  4U4X A;  5FHN A;  1WOD A;  5H8Q B;  3S2V A;  1YCJ A;  4MF3 A;  1RYX A;  1VE4 A;  3KN7 A;  2CMO A;  2AL4 A;  2HEU A;  2QSX A;  4OZ9 A;  3TYH A;  2ESN A;  4Q5T A;  2X7Q A;  1SDX A;  3GBA A;  2CZL A;  2H9B A;  1S50 A;  1LAG E;  3TMG A;  4NTL A;  2F6P A;  3VVF A;  5B7D A;  5TP9 B;  1VR5 A;  3KEI A;  2Y7P A;  4G8N A;  1MY0 A;  3A09 A;  3B6W A;  3CVG A;  4NWD A;  1NNT A;  3G3J A;  2DVC A;  4LP2 B;  2HQ0 A;  4H0W A;  3OSQ A;  1OLA A;  4HS7 A;  4RK9 A;  5I59 A;  4U4S A;  3E9X A;  1A40 A;  5CMC A;  1ZLQ A;  1B3G A;  2FNC A;  1MG1 A;  5EHM A;  4OTE A;  3ZKL A;  4KI0 E;  2DSF A;  4QFL A;  2B3B A;  2HFB A;  3CRB A;  3T9H B;  4FAT A;  1LAF E;  3CG1 A;  3KN8 A;  5CBR A;  4OEV A;  1USY E;  3T9V A;  4LA9 A;  4NF5 A;  1SBP A;  2XX9 A;  4BDN A;  4DDD A;  4ECF A;  2Q2A A;  4PFW A;  3Q25 A;  3HHF A;  2O68 A;  5CMB A;  2XX7 A;  5I56 B;  1QUK A;  1D3K A;  4DXB A;  2PBW A;  2KLF A;  1XC1 A;  1JET A;  3VVD A;  3PUY E;  1PDA A;  4ELO A;  1II5 A;  3OO9 A;  2OJT A;  5DTB A;  3CIJ A;  5KCJ B;  2QL3 A;  2OWS A;  1P1U A;  3EQ1 A;  2XXT A;  1FTL A;  2I0C A;  3ODB A;  1Y4T A;  4ZEC A;  3Q27 A;  1D9Y A;  2F5X A;  1URD A;  2XXX A;  1TFA A;  3JV9 A;  4AB5 A;  3VLW A;  3HN0 A;  1MXU A;  3RTF B;  2A5S A;  5I2N B;  3O28 A;  1IXC A;  1OQG A;  3FVO A;  1I6B A;  1NMU A;  4GL0 A;  2LAO A;  5CMK A;  3MZB A;  4N07 A;  2I6E A;  4PET A;  4X9T A;  4R73 A;  4R6H A;  2OLB A;  4YB6 A;  3BFT A;  3VLV A;  4U23 A;  3SEV A;  4F2Q A;  1D4N A;  3FAT A;  5CC2 A;  2OBG A;  4F1U A;  3CFZ A;  1A8F A;  5ICT A;  2Q88 A;  3K1M A;  4TOZ A;  2RIN A;  2B3F A;  5KZT A;  2F97 A;  4QFO A;  4EQ9 A;  2I58 A;  2G29 A;  3IK6 B;  3KOS A;  3O9P A;  3VVE A;  1IEJ A;  5CI5 A;  1B1X A;  2ZYN A;  1MXV A;  2GFE A;  3V83 A;  4KPT A;  4XKR A;  4C1U A;  2V3U A;  2Y7I A;  4NE4 A;  1AH5 A;  3KN3 A;  2RC8 A;  3MAM A;  5K2Y A;  4YB5 A;  5JTY B;  3IO6 A;  3K6V A;  4H67 A;  4NF8 A;  3C33 A;  1H43 A;  4KYD A;  1UTB B;  2XD3 A;  3GXA A;  1SW5 A;  1PBP A;  4DCY A;  5AA4 A;  2RC7 A;  3L6G A;  5HPQ A;  1MS7 A;  4Q8R A;  1ZU0 A;  4ONY A;  3QIM A;  1MRP A;  4FEC A;  3TPA A;  4M4G A;  4OHN A;  4YMB A;  1S9T A;  4FE8 A;  5I84 A;  3SDF A;  4LQ5 A;  1AMF A;  4OWD A;  4U1Z A;  3H03 A;  1FW0 A;  1OVT A;  3H6U A;  1SI1 A;  2Q8J A;  1NNK A;  2OWT A;  2P1S A;  1UIU A;  1H76 A;  1H3D A;  3FGS A;  3RY3 A;  3S9M C;  4DIG A;  4R9G A;  2OZZ A;  4H1X A;  2GHB A;  5H8N B;  3OMB A;  5DVF A;  3OEM A;  2D3I A;  1P1W A;  3H6T A;  2B65 A;  3KGC A;  4ZS9 A;  1POY 1;  4RYA A;  4GXS B;  3U93 A;  3O6I A;  3C36 A;  4R72 A;  5FTI A;  3LSL A;  1MQD A;  4BDQ A;  4NWC A;  4U1O A;  1P1O A;  4G68 B;  1LCT A;  2ZMB A;  2AYS A;  1B0L A;  4F18 A;  2O51 A;  2XX8 A;  3IOU A;  5TU0 A;  4EF2 A;  3MVY A;  1MXX A;  2UXA A;  1MM6 A;  1LB9 A;  4MH5 A;  2F36 A;  3Q28 A;  3OXN A;  4IGT A;  3CG3 A; 
#chains in the Genus database with same CATH topology
 5EQA A;  1TFD A;  4TLL B;  4QF9 A;  3IO4 A;  4FBP A;  2XWO A;  1M5D A;  3IB0 A;  3L6H A;  3FAS A;  1H45 A;  4PAK A;  3T96 B;  1IMA A;  2CZH A;  4JWO A;  3TQL A;  1R9Q A;  4LZ5 A;  2DE2 A;  4PFU A;  2XXK A;  2NWJ A;  3I6V A;  2I4C A;  1A8E A;  2WX9 A;  4E0X A;  3A3U A;  3KSJ A;  5BWJ A;  3KJT A;  3M8U A;  2H98 A;  1DTZ A;  2Z8E A;  2WEF A;  3O2A A;  3OOA A;  3OD7 A;  1D9V A;  2HPG A;  3BBR A;  4Q30 B;  2ONR A;  1GGG A;  2Z8F A;  4KXP A;  5DYH A;  4IR8 A;  4ZE8 A;  4ISU A;  2ZZV A;  4EQ7 A;  2XXU A;  3OEK A;  4OYV A;  5F7V A;  4BLA A;  1VDW A;  3FJM A;  3CSB A;  2V4C A;  5IM2 A;  5DVJ A;  2I3V A;  4PTK A;  3MBP A;  5CRY A;  2DXR A;  1FSA A;  4G8H A;  2X26 A;  3U72 A;  3MW0 A;  2NXO A;  4YMA A;  1N3W A;  4IY5 A;  4WED A;  2Y5L A;  4POW A;  2R8T A;  3GLB A;  3S9N C;  3T9U A;  1FPK A;  2DS9 A;  1NH7 A;  3D4C A;  1Y3P A;  3QSL A;  3K6W A;  2H5Y A;  5LTC A;  4ESX A;  2RCA A;  3E13 X;  5M2V A;  2XD2 A;  1MXZ A;  1B40 A;  1RYO A;  4OVP A;  2H25 A;  2WBD A;  1LB8 A;  4NF0 A;  1F9B A;  2UYF A;  2HAU A;  2P3N A;  1MXY A;  1NNP A;  3Q29 A;  1IMB A;  2F3B A;  2DWI A;  4LVQ A;  1TT1 A;  5KDT A;  2VPN A;  1NL5 A;  3KSX A;  1EYJ A;  2O84 X;  4GBW A;  3RLF E;  4KHZ E;  1FTJ A;  1IXI A;  1MQJ A;  1AL3 A;  4IB2 A;  3MJN A;  1AIV A;  3PUW E;  2ZXT A;  3HST A;  1B4H A;  2WKY A;  4OFL A;  1N84 A;  4JVD A;  4N8Y A;  3FXQ A;  1B5H A;  1YAE A;  4ZED A;  1O63 A;  4GQO A;  2YLN A;  3JYR A;  5I59 B;  4DZ1 A;  2FIX A;  4P1E A;  1SW2 A;  2QPQ A;  1BK4 A;  2D5W A;  2F78 A;  3HHG A;  4HE2 A;  2XWI A;  1FQF A;  1Q1K A;  3U1O A;  4ZEI A;  3MP8 A;  2MKZ A;  1MXW A;  3C4M A;  5H8F B;  3VV5 A;  1EH3 A;  1ZBM A;  4MLQ A;  5B70 A;  4NED A;  4NF5 B;  4KR5 A;  4KQP A;  1YPN A;  1LAX A;  3KBZ A;  2F7A A;  1NV2 A;  3TTL A;  2M8C A;  5ET6 A;  4IO5 A;  3VDF A;  5I7I A;  2Y84 A;  1B5J A;  5ITP A;  1P99 A;  3M3K A;  3FVG A;  3PMW A;  3FV2 A;  4KYE A;  1SI0 A;  2FYI A;  2F7B A;  4PGN A;  3OSR A;  2F8D A;  1PB7 A;  3KZG A;  3V5A A;  4P1L A;  3PPR A;  1MM7 A;  3LV0 A;  2O7U A;  3SEY A;  3TCG A;  2XXV A;  3M3F A;  3USD A;  4QFK A;  5JEI A;  1FQC A;  2PMS A;  4NF6 A;  3MQ9 A;  1M5C A;  2V3Q A;  3EHT A;  1BIY A;  4XIG Q;  4AS4 A;  4BDR A;  4NX1 A;  1QUJ A;  2DYX A;  1A54 A;  3NOH A;  2REJ A;  4G77 A;  1B5I A;  3MUQ A;  1XT8 A;  3RPW A;  4OER A;  4GWO A;  3DP8 A;  3PD9 A;  3PU5 A;  1NV7 A;  1ATG A;  4ZZE A;  3S9E A;  1N7X A;  5IZZ A;  3MYU A;  5F1Q A;  1LFG A;  3K1N A;  4WXJ A;  1N76 A;  3EHS A;  1IUD A;  1M5E A;  1QGX A;  1EU8 A;  3UGW A;  4H8J A;  1LFH A;  2Q9T A;  3K4U A;  1IIW A;  4R6Y A;  2Q74 A;  2GHA A;  1JQF A;  5ET5 A;  1Y20 A;  2QS3 A;  5CBS A;  3F11 A;  3IJX B;  4EF1 A;  1SPI A;  4GLI A;  1URS A;  3IAZ A;  4PBQ A;  1UIV A;  1YTV A;  1N7W A;  3RT6 B;  5AA2 D;  2XXI A;  2F34 A;  1LBZ A;  4PCD A;  4EDP A;  4ZZA A;  4GX4 A;  4OEN A;  1QJM A;  3RTW B;  3FUZ A;  4G8M A;  1M5F A;  2QS2 A;  4H8I A;  2XXP A;  3PD8 A;  4GRK A;  1MY3 A;  3O6H A;  3GYY A;  3EPE A;  3PPP A;  2UYE A;  2QS1 A;  4ESW A;  2I0B A;  4RK2 A;  3BIG A;  2Z8D A;  1UTH A;  4IO4 A;  3TQW A;  2B4L A;  4F1V A;  3KBR A;  1LAH E;  4R6K A;  4FED A;  1HSJ A;  3OO7 A;  1ANF A;  3IFA A;  1JNF A;  4OVJ A;  4UA8 A;  1DPE A;  1B6H A;  3HCQ A;  5DEX A;  4DI3 D;  4YKJ A;  3UN6 A;  1FBE A;  4JB7 A;  1YXI A;  2V3T A;  3H6W A;  3THI A;  1Q9D A;  3B6T A;  1B7H A;  3KC0 A;  3RPL A;  1CB6 A;  1IXH A;  2RKM A;  4OVS A;  2ALU A;  1Z7N E;  4OXV A;  3WAE A;  4MNP A;  5A5X A;  5HBC A;  4PAF A;  4YAH X;  2FIE A;  1JP4 A;  5I3S A;  2R9J A;  5AA2 A;  3CSG A;  2VD2 A;  4R75 A;  5FHM A;  5LOM A;  5L8D A;  3LSX A;  4JDF A;  5AA4 B;  3MVZ A;  3SKP A;  4F3B A;  5I2K A;  4R2F A;  3K6U A;  4PF6 A;  1YZ0 A;  4GF8 A;  1ZJL A;  2XXH A;  1FTM A;  4GD5 A;  3N6U A;  2UVG A;  4X8R A;  5J16 A;  4ZEK A;  2OCU A;  4C0R A;  3R26 A;  1O64 A;  1NI9 A;  1FQD A;  1NH8 A;  3PPO A;  1MPC A;  3S4U A;  3S9L C;  1B4Z A;  3N26 A;  1JVY A;  2IA4 A;  3E4R A;  2PT1 A;  2CEX A;  1EYK A;  3MZ1 A;  1XOC A;  2O1M A;  4F39 A;  2Y7K A;  3R6U A;  5EYG A;  3ECR A;  4IY6 A;  3AXF A;  5TPA A;  1OLC A;  3DM0 A;  3H3G A;  5FTH A;  3KG2 A;  4U22 A;  1ZIU A;  2I48 A;  2F35 A;  1PBQ A;  2ZYM A;  1JEV A;  2NOO A;  3IR1 A;  5H8S A;  1DCU A;  1J1N A;  3SES A;  5K2X A;  4MX6 A;  1Z7M E;  4QSD A;  1FPJ A;  1YYZ A;  2DE4 A;  2XWV A;  3IFC A;  1A7L A;  1B05 A;  3OO8 A;  4R9F A;  1ZMG A;  1A55 A;  4I8C A;  4IO2 A;  1BP5 A;  2Y7R A;  2Z22 A;  4LN5 A;  3IOT A;  3DLN A;  3MWB A;  4X48 A;  1SYH A;  3W9V A;  3DP4 A;  5J1D A;  1XHY A;  3SEX A;  4AQ4 A;  2I4B A;  4XTC Q;  1MY4 A;  4PC9 A;  4H45 A;  2REG A;  3R7X A;  2UVJ A;  2R6G E;  4WKM A;  4XXU A;  4QHQ A;  2R71 A;  3BFU A;  4Q0C A;  2P2A A;  2UVH A;  1B52 A;  2E1S A;  4QBA A;  1EZ9 A;  3MVX A;  3HFU A;  4XKP A;  5I58 B;  2O7I A;  1B46 A;  2YPN A;  3BKI B;  2A5T A;  3EF7 A;  4N6P A;  2ZNS A;  2DWA A;  4C1T A;  4RPO A;  1LGB C;  5IAI A;  4F31 B;  2QJE A;  1LBY A;  4I9D A;  3FZV A;  4XEQ A;  2ZZX A;  3I3V A;  3HPI A;  3CFL A;  4PAI A;  4BDO A;  2VT5 A;  2NVU B;  4ZEB A;  4PFR A;  2G93 A;  2VHA A;  4IO3 A;  1QKB A;  4IGR A;  4MHF A;  1CE2 A;  3PUZ E;  4NGU A;  2HZL A;  1Y1M A;  3W9W A;  4JBZ A;  4NF4 A;  5FHO A;  4QFN A;  3ISP A;  1FBP A;  3E79 A;  1SD3 A;  1NV3 A;  1DPP A;  4M1V A;  4F19 A;  1KA0 A;  4EQB A;  2ZYO A;  4JWX A;  4N8G A;  1OMP A;  3O6G A;  3MP1 A;  1MY1 A;  5EYF A;  4JXI A;  4E0W A;  1XS5 A;  1B9J A;  3LUZ A;  4IO7 A;  3CFX A;  5F24 A;  3G3F A;  1RDY A;  3VXC A;  4ELR A;  5CMM A;  1LBC A;  4PP0 A;  4RXL A;  1B32 A;  4O3B A;  5H8H A;  4QSC A;  2DOJ A;  3K02 A;  3MPK A;  4N6D A;  4PFY A;  1PB8 A;  3BIH A;  5LDZ A;  3IB1 A;  4OET A;  4F22 A;  3N5L A;  2H4I A;  3TTR A;  5DW8 A;  4PQJ A;  3QXM A;  4AB6 A;  3MPL A;  3FJG A;  3H6V A;  5KDT B;  4YKP A;  1OQH A;  2PYY A;  1GVC A;  1MH3 A;  2I49 A;  4F2O A;  4WEP A;  1FQA A;  4UAC A;  4KYS A;  3UOR A;  1I69 A;  3IOV A;  3T9X B;  4GWZ A;  3DEL B;  3UA8 A;  3TUS A;  1FBC A;  4RNS A;  4YKK A;  5I57 A;  2DWJ A;  1US4 A;  4I62 A;  3RN8 A;  4TQU Q;  1DMB A;  4PGP A;  2ABH A;  1MPD A;  2PCR A;  2DP8 A;  2ZNU A;  4N13 A;  2VPO A;  3A3C A;  1SQY A;  4MIJ A;  2Y7W A;  4XKN A;  1I6Q A;  2QMX A;  5BUU A;  2FVZ A;  1MPB A;  3IOR A;  4R2B A;  1LCF A;  4H5G A;  1EZP A;  3U8Q A;  1QUL A;  5H8Q A;  3H4Z A;  2XWK A;  4MNC A;  1B7U A;  4ND9 A;  5AA1 A;  3U94 A;  2THI A;  4GL8 A;  2QRY A;  4G61 A;  1Y3Q A;  2XXW A;  1M5B A;  4HTG A;  2HAV A;  1FQE A;  2GQ1 A;  2DE3 A;  1N0T A;  1EYI A;  3IL1 B;  3LC8 A;  2CZI A;  2FA7 A;  5TP9 A;  2Z23 A;  3IOW A;  1B2H A;  1H44 A;  3FXB A;  2VOZ A;  3KJ7 A;  3M3L A;  4MJO A;  1B3E A;  4O3A A;  4OES A;  2H99 A;  2KQZ A;  1T0K A;  3B7D A;  1SVX B;  4Z0I A;  3IB2 A;  2V93 A;  1DBZ A;  1JVX A;  5H8F A;  3EHU A;  3RT8 A;  2AIX A;  2Q8M A;  3D4G A;  4NF6 B;  4OVT A;  4OMB A;  4QFP A;  4MEV A;  4G68 C;  5ET8 A;  1WDN A;  2ONS A;  3IJO B;  5ELV A;  3PUX E;  3UK4 A;  4GOT A;  4PE5 B;  3CR9 A;  4RPN A;  3EN3 A;  3PGF A;  3ZSF A;  1PC3 A;  1IXG A;  3VFJ A;  1A99 A;  2WYK A;  4XKQ A;  4PFB A;  1NFT A;  4PDH A;  3TDJ A;  3JZJ A;  4OA4 A;  5I56 A;  3FJ7 A;  1SYI A;  3T22 A;  1Y3N A;  1Y4C A;  4MAG A;  4THI A;  4JSO A;  2XXQ A;  3SEW A;  3FVK A;  5KCJ A;  3QAX A;  3HO7 A;  3PMX A;  4F3P A;  2V25 A;  1BTJ A;  3TZA A;  4OQO A;  1K9Z A;  4JSD A;  4F29 A;  3UIF A;  1FPI A;  4R74 A;  3G3K A;  4ZEF A;  1DTG A;  3TAJ A;  3FIR A;  3TEL A;  4H6D A;  3FXR A;  4RJZ A;  3Q26 A;  3TKD A;  3B6Q A;  4PFT A;  4PDD A;  5L9S A;  1I6A A;  1UTH B;  2ANJ A;  1SW1 A;  1POT A;  2ZYK A;  3A29 A;  2D21 A;  2KR0 A;  1Y9U A;  1R1N A;  5ICQ A;  3ROJ A;  2HZK A;  1QW0 A;  3WAF A;  4H5F A;  3V8X B;  5I2N A;  5DEX B;  1B3F A;  2F6G A;  2V84 A;  5EQ7 A;  3T66 A;  1IZ1 A;  4DE8 A;  4P0I A;  4F3G A;  1XVY A;  3KOT A;  1NUZ A;  2E0S A;  5IKB A;  1R9L A;  3H7M A;  1TXF A;  3O97 A;  3PMV A;  1AOV A;  4ELP A;  5A5X B;  4OEU A;  3C35 A;  4MLV A;  4N81 A;  4OFO A;  4ELQ A;  3O29 A;  4TLM B;  2VP1 A;  3C34 A;  4GFR A;  2W7Y A;  5AA2 B;  2Q2C A;  1MQG A;  3QUJ A;  3C32 A;  1Y1Z A;  4JVI A;  3OEL A;  1IMD A;  4YIC A;  3RNN A;  5I2K B;  3TEP A;  1DK4 A;  3MVW A;  5IGA A;  3K00 A;  1B1H A;  3VXB A;  4NF8 B;  4BDL A;  1BLF A;  3TTK A;  3TOD A;  5ET7 A;  3G3H A;  2Q89 A;  1OVB A;  1LBV A;  3TFL A;  4QSE A;  3LSF B;  3QK6 A;  3SZP A;  2RC9 A;  3O66 A;  4N6K A;  3E78 A;  4YKI A;  3SET A;  1LBW A;  2YJP A;  3K2D A;  2XHD A;  1VFD A;  2P3V A;  3K0V A;  2VD3 A;  1LBB A;  1K9Y A;  4JWY A;  1FPG A;  1N3X A;  3C31 A;  1FTK A;  1MH4 A;  4PF8 A;  5DT6 A;  4GWU A;  4PE3 A;  1FTO A;  5TPA B;  5DVI A;  3RYD A;  3OEN A;  2ONK E;  3LSW A;  1NV4 A;  5L9M A;  4DXU A;  2QS4 A;  4LUB A;  1MY2 A;  1NKX A;  2RF1 A;  2QFL A;  2QMW A;  4DLD A;  4HW8 A;  2ZNT A;  5EQ9 A;  2O1L A;  1JW1 A;  5JTY A;  3E3K A;  3VLU A;  4P56 A;  1FJ6 A;  3OO6 A;  1NV6 A;  3ZS6 A;  1B51 A;  1N04 A;  1UTB A;  1Q35 A;  2DQV A;  4LON B;  2I3W A;  1FQB A;  4P0G A;  2X7P A;  2PVU A;  1MQI A;  4NG7 A;  1FCK A;  3QYT A;  4DCX A;  5FBP A;  1DSN A;  5IZ3 A;  4U2R A;  1KZ8 A;  1FPE A;  4NMY A;  4YU0 A;  3RQT A;  1VFE A;  3TTM A;  3PUV E;  2HXW A;  3G7W A;  1VSO A;  1MDQ A;  5JK4 A;  4RA1 A;  3FVN A;  2XXR A;  1B3H A;  2RCB A;  3TCF A;  2VGQ A;  1P1N A;  1MDP 1;  2PX1 A;  1IMC A;  3DP6 A;  1NNF A;  1MQH A;  1ZKB A;  4ZDM A;  3UP9 A;  3FD3 A;  1XVX A;  4KCD A;  3VE1 B;  2A5T B;  3CHG A;  3K6X A;  1DOT A;  4GBV A;  5T3J A;  4G2Z A;  4OAN A;  3RUM A;  5H8N A;  1IIT A;  4X1B A;  2HXR A;  5CM6 A;  2PFZ A;  4FIM A;  2IEE A;  1WVJ A;  4I1D A;  1B7Z A;  4G4P A;  1IME A;  1B0H A;  1B58 A;  4H65 A;  3U92 A;  4GWY A;  2P0S A;  2GRV A;  4HCY A;  4Z7E A;  3T1B A;  4LZ7 A;  1R6Z A;  1LFI A;  1QUI A;  5I5P A;  2DVZ A;  4O7M A;  1GR2 A;  5EHS A;  1UQW A;  4F3S A;  4NF4 B;  3GZG A;  4XFE A;  1P1Q A;  1JEU A;  3MC2 A;  4QRZ A;  2CEY A;  3V89 B;  4G68 A;  2O6A A;  3T93 B;  2HCA A;  1RKM A;  3LBS A;  5HM4 B;  1LST A;  5I58 A;  3P7I A;  2PFY A;  1JW4 A;  1US5 A;  4DXC A;  4OFJ A;  5AA3 A;  3GBB A;  2DXY A;  5L9O A;  1HSE A;  5ISU A;  4LAT A;  3KFM A;  1KA1 A;  3K1P A;  3B8B A;  2DWH A;  3PV0 E;  4EXK A;  1FPB A;  1FRP A;  3H06 B;  4EXL A;  2XXY A;  1HSL A;  4MBP A;  2F7C A;  4P11 A;  4GVO A;  3IX1 A;  3PPQ A;  4RY1 A;  1EZO A;  2OK2 A;  4LQ2 A;  3SEU A;  3W15 C;  3MZ9 A;  1BKA A;  4KD5 A;  2FBP A;  4FAJ A;  4O3C A;  4ZE9 A;  3TCH A;  4LZ8 A;  1ELJ A;  1OIB A;  4I40 A;  1PEB A;  2XA5 A;  5H8H B;  4OVQ A;  1QKA A;  4NN3 A;  4P9K A;  3G3I A;  3SER A;  4K3F A;  3G3G A;  3D1R A;  3TTN A;  3C9H A;  3EKI A;  2QVU A;  3CI8 A;  3I5O A;  4AS5 A;  3ILT B;  4GIZ A;  4F1Y A;  3PTY A;  4YB7 A;  1SW4 A;  4FOR A;  1USY H;  2O69 A;  4GXA A;  3MST A;  1D9Q A;  4KCC A;  1GV8 A;  3QUF A;  4FEB A;  3LUY A;  4IO6 A;  4POX A;  2PT2 A;  1NUX A;  3LR1 A;  1LLS A;  2F3D A;  1LBX A;  1NV1 A;  2B4M A;  4HCW A;  4BDM A;  2BJJ X;  2AL5 A;  5AE4 A;  4MNI A;  3ONM A;  4N17 A;  1S7Y A;  1FBH A;  4FJP A;  3ILU B;  3FV1 A;  2NUV A;  4EUO A;  1B3L A;  1KWH A;  2GH9 A;  4P47 A;  4PBH A;  3MP6 A;  3K01 A;  1GTK A;  2UVI A;  1TWY A;  4KFQ A;  4MFI A;  4YZZ A;  4L17 A;  1URG A;  5I57 B;  1IQ7 A;  1QVS A;  3HV1 A;  1O7T A;  4I3Y A;  1NUY A;  3N6T A;  1JW5 A;  5ITO A;  4HE0 A;  4X1D A;  3RGY A;  1PB9 A;  3PPN A;  3ZKK A;  3FXU A;  3N94 A;  4U21 A;  1ZTY A;  1L5T A;  4U4X A;  5FHN A;  1AWB A;  1WOD A;  3KC1 A;  5H8Q B;  3S2V A;  1YCJ A;  4MF3 A;  4GWW A;  1RYX A;  1VE4 A;  3KN7 A;  2CMO A;  2AL4 A;  2HEU A;  2QSX A;  4OZ9 A;  3TYH A;  2ESN A;  4Q5T A;  2X7Q A;  1SDX A;  3GBA A;  2CZL A;  4MCO A;  2H9B A;  1S50 A;  1LAG E;  3TMG A;  2JJK A;  4NTL A;  2F6P A;  3VVF A;  5B7D A;  5TP9 B;  1VR5 A;  3KEI A;  2Y7P A;  4G8N A;  1MY0 A;  1FJ9 A;  3A09 A;  3B6W A;  3CVG A;  4NWD A;  1NNT A;  4XF5 A;  3G3J A;  2DVC A;  4LP2 B;  2HQ0 A;  4H0W A;  4N4U A;  4GWS A;  3OSQ A;  1OLA A;  4HS7 A;  4RK9 A;  2QVV A;  5I59 A;  5IZ1 A;  4H46 A;  4U4S A;  3E9X A;  1A40 A;  4O94 A;  5CMC A;  1ZLQ A;  1B3G A;  3U65 A;  2FNC A;  1MG1 A;  5EHM A;  4OTE A;  3ZKL A;  4KI0 E;  2DSF A;  4QFL A;  2B3B A;  2HFB A;  4O7I A;  3CRB A;  3T9H B;  4FAT A;  1LAF E;  3CG1 A;  3KN8 A;  5CBR A;  4OEV A;  1USY E;  3T9V A;  4LA9 A;  4NF5 A;  1SBP A;  2XX9 A;  2CZK A;  2L5V A;  1FPL A;  4BDN A;  4DDD A;  4ECF A;  1G0I A;  2Q2A A;  4PFW A;  3Q25 A;  4MMP A;  3HHF A;  2O68 A;  5CMB A;  4JVC A;  2XX7 A;  5I56 B;  1QUK A;  1D3K A;  4DXB A;  2OX3 A;  2PBW A;  2KLF A;  1XC1 A;  1FBF A;  1JET A;  3VVD A;  3PUY E;  1PDA A;  4ELO A;  1II5 A;  3OO9 A;  2OJT A;  5DTB A;  1NV0 A;  3CIJ A;  1NUW A;  5EQ8 A;  5KCJ B;  2QL3 A;  2OWS A;  4DI4 B;  1P1U A;  3EQ1 A;  4OVR A;  2XXT A;  1FTL A;  2I0C A;  3ODB A;  1Y4T A;  4ZEC A;  3Q27 A;  1D9Y A;  1IMF A;  2F5X A;  4P8B A;  1URD A;  2DDK A;  2XXX A;  1TFA A;  3JV9 A;  4AB5 A;  3VLW A;  3HN0 A;  1MXU A;  3RTF B;  3QMF A;  2A5S A;  5I2N B;  3O28 A;  1IXC A;  1OQG A;  3FVO A;  1I6B A;  4HE1 A;  4O8M A;  1NMU A;  4GL0 A;  2LAO A;  4HXV A;  5CMK A;  3MZB A;  2OWZ A;  4N07 A;  1NV5 A;  2I6E A;  4PET A;  4X9T A;  4R73 A;  4R6H A;  2OLB A;  4YB6 A;  3BFT A;  3VLV A;  3RPL B;  4U23 A;  5A5L A;  3SEV A;  4F2Q A;  1D4N A;  3FAT A;  5CC2 A;  2OBG A;  4F1U A;  1FTA A;  3CFZ A;  1A8F A;  5ICT A;  2Q88 A;  4UAB A;  3K1M A;  3B50 A;  4TOZ A;  2RIN A;  2B3F A;  5KZT A;  2F97 A;  4QFO A;  4EQ9 A;  2QVR A;  2I58 A;  4NQ8 A;  1LEV A;  2G29 A;  3IK6 B;  4N15 A;  3KOS A;  3O9P A;  3VVE A;  1IEJ A;  5CI5 A;  1B1X A;  4GX3 A;  2ZYN A;  1MXV A;  2GFE A;  3V83 A;  4KPT A;  4XKR A;  1CNQ A;  2FHY A;  4NAP A;  4C1U A;  2V3U A;  1FPD A;  2Y7I A;  4NE4 A;  1AH5 A;  3KN3 A;  2RC8 A;  3MAM A;  2WBB A;  5K2Y A;  4YB5 A;  5JTY B;  3IO6 A;  4N91 A;  3K6V A;  4P3L A;  4H67 A;  4NF8 A;  3C33 A;  1H43 A;  4KYD A;  1UTB B;  2XD3 A;  3GXA A;  1SW5 A;  1PBP A;  4DCY A;  5AA4 A;  2RC7 A;  4I3E A;  3L6G A;  4NHB A;  5HPQ A;  1MS7 A;  5IZ3 B;  4Q8R A;  1ZU0 A;  4ONY A;  1INP A;  3QIM A;  1FBD A;  1XI6 A;  1MRP A;  4FEC A;  3TPA A;  4M4G A;  4OHN A;  4YMB A;  1S9T A;  4FE8 A;  5I84 A;  3SDF A;  4LQ5 A;  1AMF A;  4OWD A;  1FBG A;  4U1Z A;  2BJI A;  3H03 A;  1FW0 A;  1OVT A;  3H6U A;  1SI1 A;  2Q8J A;  1NNK A;  2OWT A;  5EYH A;  1FPF A;  2P1S A;  1UIU A;  1H76 A;  3FBP A;  1H3D A;  3FGS A;  3RY3 A;  3S9M C;  4DIG A;  1RDX A;  4R9G A;  2OZZ A;  4H1X A;  2GHB A;  5H8N B;  1RDZ A;  3OMB A;  5DVF A;  3OEM A;  2D3I A;  1P1W A;  3H6T A;  5ESY A;  2ZZW A;  2B65 A;  2Y5K A;  3KGC A;  1G0H A;  4ZS9 A;  4QXD A;  1POY 1;  4RYA A;  4GXS B;  3U93 A;  3O6I A;  3C36 A;  4R72 A;  5FTI A;  3LSL A;  1MQD A;  4BDQ A;  4PFI A;  4NWC A;  4X04 A;  4U1O A;  1P1O A;  4G68 B;  1LCT A;  2ZMB A;  2AYS A;  1B0L A;  4GX6 A;  4F18 A;  4GWX A;  2O51 A;  2XX8 A;  3IOU A;  3T0J A;  5TU0 A;  4EF2 A;  2HHM A;  3MVY A;  1MXX A;  2UXA A;  1MM6 A;  1LB9 A;  4MH5 A;  2F36 A;  3Q28 A;  3OXN A;  4IGT A;  2WYP A;  3CG3 A; 
#chains in the Genus database with same CATH homology
 1TFD A;  4TLL B;  4QF9 A;  3IO4 A;  1M5D A;  3IB0 A;  3L6H A;  3FAS A;  1H45 A;  3T96 B;  4JWO A;  3TQL A;  1R9Q A;  4LZ5 A;  2DE2 A;  4PFU A;  2NWJ A;  3I6V A;  2I4C A;  1A8E A;  4E0X A;  3A3U A;  3KSJ A;  5BWJ A;  3KJT A;  3M8U A;  2H98 A;  1DTZ A;  2Z8E A;  3O2A A;  3OOA A;  3OD7 A;  1D9V A;  3BBR A;  4Q30 B;  2ONR A;  1GGG A;  2Z8F A;  5DYH A;  4ZE8 A;  4ISU A;  4EQ7 A;  2XXU A;  3OEK A;  4OYV A;  5F7V A;  4BLA A;  3FJM A;  3CSB A;  5DVJ A;  2I3V A;  3MBP A;  5CRY A;  2DXR A;  4G8H A;  2X26 A;  3U72 A;  3MW0 A;  2NXO A;  4YMA A;  1N3W A;  4IY5 A;  4WED A;  4POW A;  3GLB A;  3S9N C;  3T9U A;  2DS9 A;  1NH7 A;  3D4C A;  1Y3P A;  3QSL A;  3K6W A;  2H5Y A;  4ESX A;  2RCA A;  3E13 X;  5M2V A;  2XD2 A;  1MXZ A;  1B40 A;  1RYO A;  2H25 A;  1LB8 A;  1F9B A;  2UYF A;  2HAU A;  1MXY A;  1NNP A;  3Q29 A;  2DWI A;  4LVQ A;  1TT1 A;  5KDT A;  1NL5 A;  3KSX A;  2O84 X;  3RLF E;  4KHZ E;  1FTJ A;  1IXI A;  1MQJ A;  1AL3 A;  4IB2 A;  3MJN A;  1AIV A;  3PUW E;  2ZXT A;  3HST A;  1B4H A;  2WKY A;  4OFL A;  1N84 A;  3FXQ A;  1B5H A;  1YAE A;  4ZED A;  1O63 A;  4GQO A;  2YLN A;  3JYR A;  5I59 B;  4DZ1 A;  1SW2 A;  2QPQ A;  2D5W A;  2F78 A;  3HHG A;  1FQF A;  1Q1K A;  3U1O A;  4ZEI A;  3MP8 A;  3C4M A;  1MXW A;  5H8F B;  3VV5 A;  1EH3 A;  1ZBM A;  4MLQ A;  5B70 A;  4NED A;  4NF5 B;  4KR5 A;  4KQP A;  1YPN A;  1LAX A;  2F7A A;  3TTL A;  2M8C A;  4IO5 A;  3VDF A;  2Y84 A;  1B5J A;  5ITP A;  1P99 A;  3M3K A;  3FVG A;  3PMW A;  3FV2 A;  4KYE A;  1SI0 A;  2FYI A;  2F7B A;  3OSR A;  2F8D A;  1PB7 A;  3KZG A;  3V5A A;  3PPR A;  1MM7 A;  2O7U A;  3SEY A;  3TCG A;  2XXV A;  3M3F A;  3USD A;  4QFK A;  5JEI A;  1FQC A;  2PMS A;  4NF6 A;  3MQ9 A;  1M5C A;  2V3Q A;  3EHT A;  1BIY A;  4XIG Q;  4BDR A;  1QUJ A;  2DYX A;  1A54 A;  4G77 A;  2REJ A;  1B5I A;  3MUQ A;  1XT8 A;  3RPW A;  4OER A;  4GWO A;  3DP8 A;  3PD9 A;  3PU5 A;  1ATG A;  4ZZE A;  3S9E A;  1N7X A;  5F1Q A;  1LFG A;  3K1N A;  4WXJ A;  1N76 A;  3EHS A;  1IUD A;  1M5E A;  3UGW A;  1EU8 A;  4H8J A;  1LFH A;  2Q9T A;  3K4U A;  1IIW A;  4R6Y A;  2GHA A;  1JQF A;  1Y20 A;  2QS3 A;  5CBS A;  3F11 A;  3IJX B;  4EF1 A;  4GLI A;  1URS A;  3IAZ A;  1UIV A;  1YTV A;  1N7W A;  3RT6 B;  5AA2 D;  2XXI A;  2F34 A;  4EDP A;  4ZZA A;  4OEN A;  1QJM A;  3RTW B;  3FUZ A;  4G8M A;  1M5F A;  2QS2 A;  4H8I A;  2XXP A;  3PD8 A;  4GRK A;  1MY3 A;  3O6H A;  3EPE A;  3PPP A;  2UYE A;  2QS1 A;  4ESW A;  2I0B A;  4RK2 A;  2Z8D A;  1UTH A;  4IO4 A;  3TQW A;  4F1V A;  3KBR A;  1LAH E;  4R6K A;  4FED A;  1HSJ A;  3OO7 A;  1ANF A;  4OVJ A;  1JNF A;  4UA8 A;  1DPE A;  1B6H A;  3HCQ A;  5DEX A;  4YKJ A;  3UN6 A;  4JB7 A;  2V3T A;  3H6W A;  3THI A;  3B6T A;  1B7H A;  1CB6 A;  1IXH A;  2RKM A;  2ALU A;  1Z7N E;  4OXV A;  3WAE A;  5A5X A;  5HBC A;  4YAH X;  2R9J A;  5AA2 A;  3CSG A;  2VD2 A;  4R75 A;  5FHM A;  5LOM A;  5L8D A;  3LSX A;  4JDF A;  5AA4 B;  3MVZ A;  3SKP A;  4F3B A;  5I2K A;  4R2F A;  3K6U A;  4GF8 A;  1ZJL A;  2XXH A;  1FTM A;  4GD5 A;  3N6U A;  2UVG A;  4ZEK A;  2OCU A;  4C0R A;  3R26 A;  1O64 A;  1FQD A;  1NH8 A;  3PPO A;  1MPC A;  3S4U A;  3S9L C;  1B4Z A;  3N26 A;  1JVY A;  2IA4 A;  3E4R A;  2PT1 A;  3MZ1 A;  1XOC A;  2O1M A;  4F39 A;  2Y7K A;  3R6U A;  3ECR A;  4IY6 A;  3AXF A;  5TPA A;  1OLC A;  3DM0 A;  3H3G A;  5FTH A;  3KG2 A;  4U22 A;  1ZIU A;  2I48 A;  2F35 A;  1PBQ A;  2ZYM A;  1JEV A;  2NOO A;  3IR1 A;  5H8S A;  1J1N A;  3SES A;  5K2X A;  1Z7M E;  4QSD A;  2DE4 A;  1A7L A;  1B05 A;  3OO8 A;  4R9F A;  1ZMG A;  1A55 A;  4I8C A;  4IO2 A;  1BP5 A;  2Y7R A;  2Z22 A;  3IOT A;  3DLN A;  3MWB A;  4X48 A;  1SYH A;  3W9V A;  3DP4 A;  5J1D A;  1XHY A;  3SEX A;  4AQ4 A;  2I4B A;  4XTC Q;  1MY4 A;  2REG A;  3R7X A;  2UVJ A;  2R6G E;  4WKM A;  4XXU A;  4QHQ A;  2R71 A;  3BFU A;  4Q0C A;  2P2A A;  2UVH A;  1B52 A;  2E1S A;  1EZ9 A;  3MVX A;  4XKP A;  5I58 B;  2O7I A;  1B46 A;  2YPN A;  3BKI B;  2A5T A;  3EF7 A;  4N6P A;  2ZNS A;  2DWA A;  4C1T A;  4RPO A;  1LGB C;  5IAI A;  4F31 B;  2QJE A;  4I9D A;  3FZV A;  3I3V A;  3HPI A;  3CFL A;  4BDO A;  2NVU B;  4ZEB A;  2G93 A;  2VHA A;  4IO3 A;  1QKB A;  4IGR A;  1CE2 A;  3PUZ E;  2HZL A;  1Y1M A;  3W9W A;  4JBZ A;  4NF4 A;  5FHO A;  4QFN A;  1SD3 A;  1DPP A;  4M1V A;  4F19 A;  4EQB A;  2ZYO A;  4JWX A;  1OMP A;  3O6G A;  3MP1 A;  1MY1 A;  5EYF A;  4JXI A;  4E0W A;  1XS5 A;  1B9J A;  4IO7 A;  3CFX A;  3G3F A;  3VXC A;  4ELR A;  5CMM A;  1LBC A;  4PP0 A;  4RXL A;  1B32 A;  4O3B A;  5H8H A;  4QSC A;  2DOJ A;  3K02 A;  3MPK A;  4PFY A;  1PB8 A;  3IB1 A;  4OET A;  4F22 A;  3N5L A;  2H4I A;  3TTR A;  4PQJ A;  3QXM A;  4AB6 A;  3MPL A;  3FJG A;  3H6V A;  5KDT B;  4YKP A;  1OQH A;  2PYY A;  1GVC A;  1MH3 A;  2I49 A;  4F2O A;  4WEP A;  1FQA A;  4UAC A;  4KYS A;  3UOR A;  1I69 A;  3IOV A;  3T9X B;  3DEL B;  3UA8 A;  3TUS A;  4RNS A;  4YKK A;  5I57 A;  2DWJ A;  1US4 A;  4I62 A;  3RN8 A;  4TQU Q;  1DMB A;  2ABH A;  1MPD A;  2DP8 A;  2ZNU A;  4N13 A;  3A3C A;  1SQY A;  2Y7W A;  4XKN A;  1I6Q A;  2QMX A;  5BUU A;  1MPB A;  3IOR A;  4R2B A;  1LCF A;  4H5G A;  1EZP A;  3U8Q A;  1QUL A;  5H8Q A;  3H4Z A;  1B7U A;  4ND9 A;  5AA1 A;  3U94 A;  2THI A;  4GL8 A;  2QRY A;  1Y3Q A;  2XXW A;  1M5B A;  4HTG A;  2HAV A;  1FQE A;  2DE3 A;  1N0T A;  3IL1 B;  3LC8 A;  2FA7 A;  5TP9 A;  2Z23 A;  3IOW A;  1B2H A;  1H44 A;  3KJ7 A;  2VOZ A;  3M3L A;  1B3E A;  4O3A A;  4OES A;  2H99 A;  1T0K A;  3B7D A;  1SVX B;  4Z0I A;  3IB2 A;  2V93 A;  1JVX A;  5H8F A;  3EHU A;  3RT8 A;  2AIX A;  3D4G A;  4NF6 B;  4OMB A;  4QFP A;  4G68 C;  1WDN A;  2ONS A;  3IJO B;  5ELV A;  3PUX E;  3UK4 A;  4GOT A;  4PE5 B;  3CR9 A;  4RPN A;  3EN3 A;  3PGF A;  3ZSF A;  1PC3 A;  1IXG A;  3VFJ A;  1A99 A;  4XKQ A;  1NFT A;  3TDJ A;  3JZJ A;  5I56 A;  3FJ7 A;  1SYI A;  3T22 A;  1Y3N A;  1Y4C A;  4THI A;  4JSO A;  2XXQ A;  3SEW A;  3FVK A;  5KCJ A;  3QAX A;  3HO7 A;  3PMX A;  4F3P A;  2V25 A;  1BTJ A;  3TZA A;  4OQO A;  4JSD A;  4F29 A;  3UIF A;  4R74 A;  3G3K A;  4ZEF A;  1DTG A;  3TAJ A;  3FIR A;  3TEL A;  4H6D A;  3FXR A;  4RJZ A;  3Q26 A;  3TKD A;  3B6Q A;  4PFT A;  5L9S A;  1I6A A;  1UTH B;  2ANJ A;  1SW1 A;  1POT A;  2ZYK A;  2D21 A;  1Y9U A;  1R1N A;  5ICQ A;  2HZK A;  1QW0 A;  3WAF A;  4H5F A;  3V8X B;  5I2N A;  5DEX B;  1B3F A;  2F6G A;  2V84 A;  3T66 A;  1IZ1 A;  4DE8 A;  4P0I A;  4F3G A;  1XVY A;  3KOT A;  2E0S A;  5IKB A;  1R9L A;  3H7M A;  1TXF A;  3O97 A;  3PMV A;  1AOV A;  4ELP A;  5A5X B;  4OEU A;  3C35 A;  4MLV A;  4OFO A;  4ELQ A;  3O29 A;  4TLM B;  2VP1 A;  3C34 A;  4GFR A;  2W7Y A;  5AA2 B;  2Q2C A;  1MQG A;  3QUJ A;  3C32 A;  1Y1Z A;  3OEL A;  4YIC A;  3RNN A;  5I2K B;  3TEP A;  3MVW A;  3K00 A;  1B1H A;  3VXB A;  4NF8 B;  4BDL A;  1BLF A;  3TTK A;  3TOD A;  3G3H A;  2Q89 A;  1OVB A;  3TFL A;  4QSE A;  3LSF B;  3QK6 A;  2RC9 A;  3O66 A;  3SET A;  4YKI A;  2YJP A;  3K2D A;  2XHD A;  1VFD A;  3K0V A;  2VD3 A;  1LBB A;  4JWY A;  1N3X A;  3C31 A;  1FTK A;  1MH4 A;  5DT6 A;  1FTO A;  5TPA B;  5DVI A;  3OEN A;  2ONK E;  3LSW A;  5L9M A;  4DXU A;  2QS4 A;  4LUB A;  1MY2 A;  1NKX A;  2RF1 A;  2QMW A;  4DLD A;  4HW8 A;  2ZNT A;  2O1L A;  1JW1 A;  5JTY A;  3E3K A;  3VLU A;  3OO6 A;  3ZS6 A;  1B51 A;  1N04 A;  1UTB A;  1Q35 A;  2DQV A;  4LON B;  2I3W A;  1FQB A;  4P0G A;  2X7P A;  2PVU A;  1MQI A;  1FCK A;  3QYT A;  4DCX A;  1DSN A;  4U2R A;  4NMY A;  4YU0 A;  3RQT A;  1VFE A;  3TTM A;  3PUV E;  2HXW A;  3G7W A;  1VSO A;  1MDQ A;  5JK4 A;  4RA1 A;  3FVN A;  2XXR A;  1B3H A;  2RCB A;  3TCF A;  2VGQ A;  1P1N A;  1MDP 1;  2PX1 A;  3DP6 A;  1NNF A;  1MQH A;  1ZKB A;  4ZDM A;  3UP9 A;  3FD3 A;  1XVX A;  4KCD A;  3VE1 B;  2A5T B;  3K6X A;  1DOT A;  4G2Z A;  3RUM A;  5H8N A;  1IIT A;  4X1B A;  5CM6 A;  4FIM A;  2IEE A;  1WVJ A;  4I1D A;  1B7Z A;  4G4P A;  1B0H A;  1B58 A;  4H65 A;  3U92 A;  2P0S A;  2GRV A;  4HCY A;  4Z7E A;  4LZ7 A;  1R6Z A;  1LFI A;  1QUI A;  2DVZ A;  5EHS A;  1GR2 A;  4F3S A;  1UQW A;  4NF4 B;  3GZG A;  1P1Q A;  1JEU A;  3MC2 A;  4QRZ A;  3V89 B;  4G68 A;  2O6A A;  3T93 B;  2HCA A;  1RKM A;  3LBS A;  5HM4 B;  1LST A;  5I58 A;  3P7I A;  1JW4 A;  1US5 A;  4DXC A;  4OFJ A;  5AA3 A;  3GBB A;  2DXY A;  5L9O A;  1HSE A;  5ISU A;  4LAT A;  3KFM A;  3K1P A;  2DWH A;  3PV0 E;  4EXK A;  3H06 B;  4EXL A;  2XXY A;  1HSL A;  4MBP A;  2F7C A;  4P11 A;  4GVO A;  3IX1 A;  3PPQ A;  4RY1 A;  1EZO A;  2OK2 A;  4LQ2 A;  3SEU A;  3W15 C;  3MZ9 A;  1BKA A;  4KD5 A;  4FAJ A;  4O3C A;  4ZE9 A;  3TCH A;  4LZ8 A;  1ELJ A;  1OIB A;  1PEB A;  5H8H B;  1QKA A;  3G3I A;  3SER A;  4K3F A;  3G3G A;  3TTN A;  3C9H A;  3CI8 A;  3I5O A;  3ILT B;  4GIZ A;  4F1Y A;  4YB7 A;  1SW4 A;  4FOR A;  1USY H;  2O69 A;  4GXA A;  4KCC A;  1GV8 A;  3QUF A;  4FEB A;  3LUY A;  4IO6 A;  4POX A;  2PT2 A;  3LR1 A;  1LLS A;  4HCW A;  4BDM A;  2BJJ X;  2AL5 A;  5AE4 A;  3ONM A;  1S7Y A;  4FJP A;  3ILU B;  3FV1 A;  2NUV A;  4EUO A;  1B3L A;  1KWH A;  2GH9 A;  3MP6 A;  3K01 A;  1GTK A;  2UVI A;  1TWY A;  4KFQ A;  4MFI A;  4YZZ A;  4L17 A;  1URG A;  5I57 B;  1IQ7 A;  1QVS A;  3HV1 A;  1O7T A;  3N6T A;  1JW5 A;  5ITO A;  4X1D A;  3RGY A;  1PB9 A;  3PPN A;  3ZKK A;  3FXU A;  3N94 A;  4U21 A;  1ZTY A;  1L5T A;  4U4X A;  5FHN A;  1WOD A;  5H8Q B;  3S2V A;  1YCJ A;  4MF3 A;  1RYX A;  1VE4 A;  3KN7 A;  2CMO A;  2AL4 A;  2HEU A;  2QSX A;  4OZ9 A;  3TYH A;  2ESN A;  4Q5T A;  2X7Q A;  1SDX A;  3GBA A;  2CZL A;  2H9B A;  1S50 A;  1LAG E;  3TMG A;  4NTL A;  2F6P A;  3VVF A;  5B7D A;  5TP9 B;  1VR5 A;  3KEI A;  2Y7P A;  4G8N A;  1MY0 A;  3A09 A;  3B6W A;  3CVG A;  4NWD A;  1NNT A;  3G3J A;  2DVC A;  4LP2 B;  2HQ0 A;  4H0W A;  3OSQ A;  1OLA A;  4HS7 A;  4RK9 A;  5I59 A;  4U4S A;  3E9X A;  1A40 A;  5CMC A;  1ZLQ A;  1B3G A;  2FNC A;  1MG1 A;  5EHM A;  4OTE A;  3ZKL A;  4KI0 E;  2DSF A;  4QFL A;  2B3B A;  2HFB A;  3CRB A;  3T9H B;  4FAT A;  1LAF E;  3CG1 A;  3KN8 A;  5CBR A;  4OEV A;  1USY E;  3T9V A;  4LA9 A;  4NF5 A;  1SBP A;  2XX9 A;  4BDN A;  4DDD A;  4ECF A;  2Q2A A;  4PFW A;  3Q25 A;  3HHF A;  2O68 A;  5CMB A;  2XX7 A;  5I56 B;  1QUK A;  1D3K A;  4DXB A;  2PBW A;  2KLF A;  1XC1 A;  1JET A;  3VVD A;  3PUY E;  1PDA A;  4ELO A;  1II5 A;  3OO9 A;  2OJT A;  5DTB A;  3CIJ A;  5KCJ B;  2QL3 A;  2OWS A;  1P1U A;  3EQ1 A;  2XXT A;  1FTL A;  2I0C A;  3ODB A;  1Y4T A;  4ZEC A;  3Q27 A;  1D9Y A;  2F5X A;  1URD A;  2XXX A;  1TFA A;  3JV9 A;  4AB5 A;  3VLW A;  3HN0 A;  1MXU A;  3RTF B;  2A5S A;  5I2N B;  3O28 A;  1IXC A;  1OQG A;  3FVO A;  1I6B A;  1NMU A;  4GL0 A;  2LAO A;  5CMK A;  3MZB A;  4N07 A;  2I6E A;  4PET A;  4X9T A;  4R73 A;  4R6H A;  2OLB A;  4YB6 A;  3BFT A;  3VLV A;  4U23 A;  3SEV A;  4F2Q A;  1D4N A;  3FAT A;  5CC2 A;  2OBG A;  4F1U A;  3CFZ A;  1A8F A;  5ICT A;  2Q88 A;  3K1M A;  4TOZ A;  2RIN A;  2B3F A;  5KZT A;  2F97 A;  4QFO A;  4EQ9 A;  2I58 A;  2G29 A;  3IK6 B;  3KOS A;  3O9P A;  3VVE A;  1IEJ A;  5CI5 A;  1B1X A;  2ZYN A;  1MXV A;  2GFE A;  3V83 A;  4KPT A;  4XKR A;  4C1U A;  2V3U A;  2Y7I A;  4NE4 A;  1AH5 A;  3KN3 A;  2RC8 A;  3MAM A;  5K2Y A;  4YB5 A;  5JTY B;  3IO6 A;  3K6V A;  4H67 A;  4NF8 A;  3C33 A;  1H43 A;  4KYD A;  1UTB B;  2XD3 A;  3GXA A;  1SW5 A;  1PBP A;  4DCY A;  5AA4 A;  2RC7 A;  3L6G A;  5HPQ A;  1MS7 A;  4Q8R A;  1ZU0 A;  4ONY A;  3QIM A;  1MRP A;  4FEC A;  3TPA A;  4M4G A;  4OHN A;  4YMB A;  1S9T A;  4FE8 A;  5I84 A;  3SDF A;  4LQ5 A;  1AMF A;  4OWD A;  4U1Z A;  3H03 A;  1FW0 A;  1OVT A;  3H6U A;  1SI1 A;  2Q8J A;  1NNK A;  2OWT A;  2P1S A;  1UIU A;  1H76 A;  1H3D A;  3FGS A;  3RY3 A;  3S9M C;  4DIG A;  4R9G A;  2OZZ A;  4H1X A;  2GHB A;  5H8N B;  3OMB A;  5DVF A;  3OEM A;  2D3I A;  1P1W A;  3H6T A;  2B65 A;  3KGC A;  4ZS9 A;  1POY 1;  4RYA A;  4GXS B;  3U93 A;  3O6I A;  3C36 A;  4R72 A;  5FTI A;  3LSL A;  1MQD A;  4BDQ A;  4NWC A;  4U1O A;  1P1O A;  4G68 B;  1LCT A;  2ZMB A;  2AYS A;  1B0L A;  4F18 A;  2O51 A;  2XX8 A;  3IOU A;  5TU0 A;  4EF2 A;  3MVY A;  1MXX A;  2UXA A;  1MM6 A;  1LB9 A;  4MH5 A;  2F36 A;  3Q28 A;  3OXN A;  4IGT A;  3CG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...