1Y1MA

Crystal structure of the nr1 ligand binding core in complex with cycloleucine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
281
structure length
271
Chain Sequence
RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords Glutamate [NMDA] receptor subunit zeta 1
publication title Mechanism of Partial Agonist Action at the NR1 Subunit of NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 80
structure length 271
sequence length 281
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y1mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y1mA02
3V8XB 2V84A 1DPEA 1YTVA 3QYTA 3RT6B 1NH8A 3QAXA 3CVGA 5L9MA 3PMWA 3S2VA 1QW0A 3KJ7A 3LUYA 1B5JA 3DM0A 3UIFA 5AA4A 3P7IA 1FQDA 3KN3A 3DP6A 4LUBA 4O3BA 5HBCA 1M5BA 3CFXA 2UVHA 1MXUA 2O84X 1MPCA 4BDNA 2DQVA 1B51A 2XX7A 4Q30B 2IEEA 3TTMA 2OWTA 1RYOA 1M5EA 4RYAA 4TOZA 4TLMB 1FQBA 4JWYA 3TPAA 1TT1A 1LAGE 2NXOA 2O6AA 2REGA 1ZU0A 2FNCA 4DXUA 2DVCA 5AA2B 1MM6A 1ZTYA 1MY2A 4QFNA 4YB6A 1EZOA 2REJA 3K1PA 3UK4A 1QUIA 1UTHB 4ZS9A 2Z22A 4NF6B 3ODBA 4MFIA 3O2AA 2Y7KA 4KPTA 1SYIA 3O9PA 5AA3A 1LFGA 1EZ9A 3H7MA 2Q2CA 2I6EA 1MY0A 2XX9A 1SW2A 3TCHA 1IXIA 3IK6B 1Y1ZA 4ZZEA 1IZ1A 4GFRA 3HCQA 3Q26A 3T93B 4EQBA 3T66A 3V89B 2XD2A 1L5TA 1T0KA 1S50A 1A55A 4ELOA 4I9DA 4OETA 3PUXE 3TTNA 1H3DA 2Q2AA 3IX1A 1B5HA 4OFOA 1OMPA 1RYXA 3KN8A 1B46A 3H6TA 2XHDA 3FJGA 2ONKE 4LP2B 3IB0A 4L17A 4YKPA 4JWXA 1AMFA 1OVTA 4U1ZA 1DTZA 2P1SA 3MVZA 5L9SA 3I6VA 5DVFA 4GD5A 3F11A 1H44A 5H8SA 4NF8B 4KD5A 3SEVA 3PPQA 5BUUA 3T9XB 1B7HA 2OJTA 2Q9TA 5FHMA 2F6GA 3QSLA 2DE3A 3I5OA 3HHFA 4MH5A 3TCGA 1DMBA 3VE1B 4ZEFA 4ZEKA 3G3KA 1ZKBA 1JW5A 3G3JA 5ITOA 2BJJX 4NWCA 4RY1A 5CM6A 2UYFA 1USYE 4IO4A 4PETA 5H8FA 5I56A 3KG2A 2D5WA 3GBBA 2YPNA 4U22A 3IB1A 1BLFA 1D9VA 1JW4A 4LVQA 2Z8DA 4QHQA 3TAJA 4GQOA 3UN6A 4POXA 3O29A 4QF9A 3U8QA 2Y7WA 4ND9A 4YAHX 3W9WA 3GZGA 3MZBA 1O63A 2ONSA 3W9VA 3IOTA 4OFJA 2O68A 4RPNA 5I2KB 2ZYOA 5EHSA 3CFLA 1ZLQA 2Q89A 2I4BA 3U94A 3FZVA 2HZKA 1QKBA 3EHUA 5LOMA 4WEPA 4NF5B 1VSOA 3K6XA 1HSJA 3W15C 3G3HA 3KGCA 4DDDA 4THIA 2XXIA 4H5FA 2HXWA 2VD2A 2UXAA 2UYEA 1Q35A 1XOCA 2V93A 4KR5A 1LAHE 3FJ7A 1JEVA 1TXFA 2XXTA 1PC3A 4G77A 2B65A 2F6PA 1LBBA 2FYIA 3G3IA 1UTBB 1MDQA 2ANJA 3IO4A 1N7XA 2F36A 4RA1A 4P11A 4C1UA 1Y4TA 3KBRA 1IQ7A 3HPIA 3U72A 3B6TA 1MQIA 2XXYA 2XXVA 2VOZA 5ICQA 1ZJLA 3FD3A 1FTJA 1MQHA 4QFLA 4OENA 3QIMA 3M8UA 3M3KA 3LSXA 1NNTA 4XKRA 4FJPA 4KCCA 4KQPA 5H8QA 4WXJA 2V3QA 3PPPA 5L8DA 4JDFA 2RCBA 4K3FA 1MS7A 1D3KA 3OD7A 3BFTA 3OOAA 1H43A 2THIA 4F31B 1IEJA 1PB8A 1ZMGA 3T22A 3H6WA 5JTYA 1A99A 3OEKA 1IXHA 2OZZA 4OQOA 3LR1A 1MQJA 3Q25A 4H8JA 2RC9A 3O6IA 4PFUA 5KCJA 3OENA 2D21A 3MVWA 1R1NA 1N84A 1A54A 1LSTA 5K2XA 3EPEA 1VR5A 4FIMA 4ZEIA 3TDJA 3O6GA 3O66A 5TU0A 5H8HB 4Q0CA 5TPAA 5CMKA 1EU8A 4H67A 5TP9A 2H98A 4UACA 3C36A 2DE4A 3OEMA 4U21A 2DP8A 3SESA 3G3GA 5I58A 4IO2A 5I84A 1Y4CA 4YICA 4NF8A 4OFLA 3FV1A 3UP9A 1SW4A 1SW1A 2QS4A 1M5CA 3LSWA 4I1DA 3DELB 2ESNA 1MXYA 1S9TA 4ZE9A 4F19A 1OIBA 3TCFA 3PD8A 1FTOA 3QXMA 2O1LA 4F3SA 1M5FA 4PFTA 2GHAA 1B7UA 3CG1A 5CRYA 3OO8A 4YMBA 1B58A 1R6ZA 4EQ7A 2XXHA 1ZIUA 4Z7EA 3C35A 4YB5A 4OXVA 1AOVA 1B0LA 4KYSA 3CSBA 4O3CA 5H8NB 3PPOA 5DVJA 5M2VA 2P0SA 4HW8A 4N13A 5DT6A 3M3LA 4RK9A 4H65A 1LGBC 5DEXB 5KDTA 3KEIA 4YKJA 2I3VA 4ELPA 4FAJA 2XXRA 2M8CA 4PP0A 5CC2A 4OYVA 4NF5A 3S9LC 3BBRA 3FIRA 2Z8FA 3PGFA 3MJNA 3K1MA 3S4UA 3S9MC 1NKXA 1MXXA 3MAMA 3N6TA 4MLVA 2E1SA 3MC2A 3OSRA 4Q5TA 5I57B 2HEUA 4R9FA 1AL3A 2R6GE 4GOTA 3DP4A 4XIGQ 2YJPA 5AA1A 1FQEA 2HFBA 1AH5A 2CMOA 3EF7A 4G8NA 1LFHA 5CMBA 5AE4A 1TFAA 3TYHA 1Z7ME 3AXFA 3IJOB 1SD3A 4NF4A 5FTIA 2A5SA 3TMGA 1LBCA 4OZ9A 3MW0A 3K4UA 3BFUA 2QS3A 4DCYA 2RC8A 1B1HA 1FW0A 1N3XA 2AIXA 3FASA 4QSEA 2NWJA 4E0WA 1TFDA 1B0HA 3SDFA 4BDQA 3EN3A 3TUSA 1LAXA 4GL0A 2DVZA 3JZJA 2DXRA 3CFZA 1FCKA 3ILTB 3H3GA 2PBWA 2Q8JA 2DWHA 2QMXA 4ZZAA 5ELVA 4U2RA 1LB8A 1MH3A 4IY6A 2DXYA 3A3CA 3C33A 2X26A 2P2AA 1MDP1 2F7CA 4R9GA 2RKMA 1H45A 4NMYA 5I59A 2GRVA 2NVUB 1MPDA 1IUDA 3MP8A 1B3GA 5I2NA 1VFEA 3HO7A 4R75A 1MH4A 1H76A 1P99A 3Q29A 4ZEDA 2I49A 1Y9UA 3FXQA 4F2OA 3IR1A 4R6YA 1QKAA 3GXAA 3T9VA 4AB5A 3FATA 3L6HA 3K6UA 5DTBA 3FJMA 4GVOA 1QVSA 2HZLA 3K2DA 1B4HA 3B7DA 4RXLA 3T9UA 1MPBA 2O69A 2QS2A 2ALUA 3IOVA 5B7DA 3SKPA 4LA9A 4E0XA 3IO6A 5BWJA 2ZNSA 3FVGA 4AQ4A 1XT8A 4OERA 3K6VA 2H4IA 3MP1A 5K2YA 4R2FA 2VP1A 3D4GA 4Q8RA 2A5TB 1LLSA 4DIGA 1Y20A 1FTKA 3RN8A 2R9JA 3SEYA 3E13X 1M5DA 2KLFA 4HCWA 2GHBA 2HCAA 4MBPA 2IA4A 1GTKA 1N76A 3N26A 4EUOA 3TQWA 4AB6A 3ONMA 4QSCA 2PT1A 3IOUA 5ITPA 1I6QA 4C0RA 1HSEA 1YAEA 3U92A 4G68A 1SDXA 3KOSA 1PDAA 4DLDA 1IITA 1QULA 1I6BA 3VVFA 2H5YA 2OLBA 2PT2A 2XXUA 4UA8A 3CR9A 3OMBA 5I57A 4EQ9A 1TWYA 2QS1A 2F35A 1B2HA 4H0WA 1MXVA 3LSFB 3VLUA 3RGYA 4IO3A 5A5XB 5HM4B 5AA4B 2I0BA 2RF1A 3UGWA 1SI1A 4HCYA 4JWOA 1XC1A 2ZMBA 3CIJA 2I58A 3JV9A 1SBPA 4ZEBA 3TTLA 4X1BA 3KFMA 4RK2A 5AA2A 5FHOA 2RINA 4G8MA 3MZ9A 3R6UA 3FXRA 1B3HA 1UTHA 3M3FA 3WAFA 1ANFA 2HAUA 4NF6A 3VFJA 3TEPA 5F7VA 4QSDA 4H6DA 3T96B 5CMMA 2DE2A 1MG1A 3TFLA 2VD3A 1Y3QA 2PYYA 1USYH 3TQLA 1MQDA 3QK6A 3K01A 5JK4A 2VGQA 3PPRA 1O64A 1N3WA 3VDFA 4F18A 3Q28A 1UIVA 3TODA 1WDNA 4FECA 2RC7A 1A8FA 1YPNA 2Y84A 1JNFA 3PUYE 3PUZE 1XHYA 1POY1 4OWDA 3QUFA 1WODA 1R9QA 1ZBMA 3HN0A 4IGTA 3PU5A 3H6UA 3FGSA 3MUQA 1I6AA 3C4MA 3PV0E 3FVNA 2D3IA 5F1QA 1PB9A 5CBSA 3K0VA 1MRPA 3IL1B 3O6HA 1Q1KA 3OELA 2QJEA 1MXWA 1DTGA 4BDRA 5EYFA 4GRKA 2X7QA 4F1VA 1RKMA 1P1QA 2XXQA 2OBGA 3A3UA 1B9JA 3PD9A 3UORA 1URSA 4FE8A 4HTGA 1B52A 1IXGA 1MM7A 3MVXA 1PB7A 1JQFA 1S7YA 5HPQA 3FV2A 4F3BA 5H8FB 5I56B 4IO7A 2V3UA 2QMWA 3IORA 1BKAA 2LAOA 3VLWA 4YKIA 1AIVA 2DWAA 4G68C 2PMSA 1DPPA 2F78A 4YKKA 3A09A 4U4XA 1POTA 1N7WA 2ZNTA 2ZNUA 3CI8A 3EQ1A 2I48A 1SW5A 2PX1A 1URDA 1A8EA 5CMCA 1BP5A 5I2KA 3IJXB 3RT8A 1B5IA 2Z8EA 4U23A 1BTJA 4H1XA 3USDA 1FQFA 2H9BA 3H06B 4R72A 1II5A 4EDPA 3D4CA 1GR2A 1MXZA 4OTEA 4RNSA 3TTRA 3U93A 3N5LA 4Z0IA 1PEBA 4DXBA 4XXUA 3N94A 4RPOA 1MQGA 1OQHA 3Q27A 3HSTA 2XXXA 4JXIA 3KSJA 1UTBA 4BLAA 1B3FA 2ONRA 3VV5A 1XS5A 2VHAA 1OQGA 2UVGA 2XD3A 3MZ1A 4ESWA 1US5A 5A5XA 5ISUA 4IO5A 2NUVA 3VVEA 4X1DA 1GGGA 1B6HA 4MLQA 1NL5A 3SEWA 2X7PA 4ELQA 3MVYA 2CZLA 3C32A 1SI0A 4JSDA 4ELRA 4OVJA 4LZ8A 2AL4A 1MY1A 1KWHA 3RLFE 2OK2A 2H99A 1LFIA 3SEXA 4BDOA 4LQ2A 5H8QB 4ESXA 3VXCA 3RUMA 1JW1A 3L6GA 3QUJA 2QL3A 2R71A 3B6QA 2W7YA 4O3AA 3KZGA 4H5GA 1LCTA 2HQ0A 5CBRA 1PBPA 1NNPA 4WEDA 4GXSB 4NTLA 3OO6A 5JTYB 3H6VA 1I69A 3K00A 3O28A 3KSXA 1NNKA 3C9HA 4G2ZA 1R9LA 1QUJA 4PFYA 4JB7A 3ZS6A 5KCJB 4NWDA 3EHTA 1IXCA 1A7LA 3RNNA 2I3WA 5B70A 4EF2A 3R7XA 2WKYA 4MF3A 3DP8A 5H8HA 2Y7IA 1B3EA 4YB7A 1PBQA 4XTCQ 1DSNA 4XKNA 4ZDMA 1B40A 4GXAA 5TPAB 5EHMA 4KYEA 4XKQA 4P0IA 2B3FA 5TP9B 4F29A 3O97A 1US4A 3K6WA 3MPKA 4FORA 5FHNA 4ZECA 4WKMA 4OEUA 3OSQA 4TLLB 4PE5B 4LATA 1LCFA 1GVCA 2I4CA 4TQUQ 5I58B 3KN7A 5DYHA 3THIA 3CRBA 1P1UA 2AL5A 4EF1A 4EXLA 2YLNA 3PPNA 4RJZA 4FEDA 4LONB 3BKIB 2Z23A 1NFTA 3I3VA 5ICTA 4ONYA 4F3GA 2GH9A 3ILUB 2OWSA 4KHZE 3RTFB 3TZAA 4DCXA 1D4NA 3PUVE 3H03A 1JVYA 3LC8A 4OMBA 3V5AA 3E4RA 1JEUA 3WAEA 3S9EA 3LSLA 2QSXA 3ZKKA 3V83A 1URGA 2F8DA 3B6WA 4R74A 2XXWA 1WVJA 3DLNA 3MWBA 4IY5A 4LZ7A 5H8NA 4NE4A 4X48A 1OLAA 1EH3A 5J1DA 4M4GA 1A40A 3RPWA 1Y3PA 1SYHA 3E3KA 5DEXA 4R6KA 1XVXA 1HSLA 4GF8A 4FATA 4GLIA 5KDTB 3OO9A 4PFWA 5IAIA 1B1XA 3KJTA 4POWA 3SETA 1Y3NA 1B7ZA 1F9BA 4I62A 4GL8A 4BDMA 4LQ5A 1UIUA 3ZSFA 3RTWB 4F22A 3HHGA 1JETA 1N0TA 2G29A 2PVUA 4R2BA 2RCAA 4IB2A 2DS9A 3IOWA 3MBPA 4H8IA 3MP6A 3R26A 4F39A 3IAZA 3MQ9A 1P1OA 3OO7A 3H4ZA 3PMXA 1CE2A 3SERA 1VFDA 1GV8A 3IB2A 3SEUA 2F97A 4M1VA 1FQCA 2XX8A 3CG3A 1QUKA 1XVYA 1P1WA 3T9HB 4NF4B 2DWJA 1YCJA 2V3TA 1LAFE 2F7AA 4FEBA 2ZYNA 3N6UA 4U1OA 4HS7A 2UVIA 4XKPA 3TTKA 3E9XA 3PMVA 4G8HA 1IIWA 2XXPA 4ZE8A 2O7IA 1NMUA 2ZXTA 3ECRA 2O51A 1LB9A 4JBZA 2ZYMA 4ECFA 1SVXB 3TELA 3C31A 2B3BA 5AA2D 4KCDA 4F1UA 1Y1MA 2ABHA 4PQJA 1CB6A 3U1OA 1O7TA 4KYDA 2QPQA 5KZTA 3HV1A 2G93A 2QRYA 4F2QA 5JEIA 4I8CA 4GWOA 4P0GA 3GLBA 3K02A 1ATGA 2V25A 2ZYKA 5I59B 3CSGA 1JVXA 1DOTA 5FTHA 1ELJA 2HAVA 5I2NB 4QFKA 3C34A 3VXBA 3TKDA 1MY4A 1SQYA 4ISUA 1FQAA 2NOOA 3FVKA 3RQTA 1N04A 2DOJA 4BDLA 2AYSA 3KOTA 1MY3A 2F7BA 3PUWE 4R73A 3G7WA 2O7UA 4F1YA 4OHNA 4YU0A 4IGRA 3OXNA 2Y7RA 1EZPA 1J1NA 4N07A 1UQWA 1B05A 2H25A 3G3FA 4KI0E 4DZ1A 4EXKA 3VVDA 3MPLA 1NH7A 3VLVA 4NEDA 3JYRA 1OVBA 1B3LA 2I0CA 3FUZA 2Q88A 1NNFA 3FXUA 2DWIA 3S9NC 1BIYA 3FVOA 4QRZA 4LZ5A 1B32A 4QFOA 5DVIA 2A5TA 2Y7PA 4IO6A 4KFQA 2DYXA 3UA8A 4X9TA 1VE4A 2FA7A 1D9YA 4C1TA 1Z7NE 2UVJA 2OCUA 1P1NA 4F3PA 3K1NA 4OEVA 3RY3A 5IKBA 3EHSA 3GBAA 2F34A 2O1MA 1FTMA 3LBSA 4YZZA 2GFEA 4DE8A 2F5XA 4R6HA 2DSFA 4QFPA 5CI5A 4DXCA 1B4ZA 4JSOA 4U4SA 2E0SA 3ZKLA 4GIZA 4G4PA 1FTLA 1QJMA 4YMAA 5L9OA 4N6PA 4OESA 4G68B 1OLCA
chains in the Genus database with same CATH superfamily
3V8XB 4MHFA 2V84A 4GWSA 1DPEA 1FPJA 1YTVA 3QYTA 5IZZA 3RT6B 1NH8A 3QAXA 3CVGA 5L9MA 3PMWA 3S2VA 1QW0A 3KJ7A 3LUYA 1B5JA 3DM0A 3UIFA 5AA4A 4P9KA 1FPGA 3P7IA 2XWVA 1FQDA 3KN3A 3DP6A 4LUBA 4O3BA 5HBCA 1M5BA 3CFXA 4MNIA 4PCDA 2UVHA 1MXUA 2O84X 1MPCA 4BDNA 2XWIA 2DQVA 1B51A 2XX7A 4Q30B 2IEEA 3TTMA 2OWTA 1RYOA 1M5EA 4RYAA 4TOZA 4TLMB 1IMDA 4G61A 1FQBA 4JWYA 3TPAA 1TT1A 1LAGE 2NXOA 2O6AA 2REGA 1ZU0A 2FNCA 4DXUA 2DVCA 5AA2B 1MM6A 4P8BA 3HFUA 1ZTYA 1MY2A 4QFNA 4YB6A 1EZOA 2REJA 3K1PA 3UK4A 1BK4A 1QUIA 1UTHB 4ZS9A 2Z22A 4NF6B 3ODBA 4MFIA 3O2AA 2Y7KA 4KPTA 1SYIA 3O9PA 4N8YA 5AA3A 1LFGA 1EZ9A 3H7MA 2Q2CA 2I6EA 1MY0A 2XX9A 1SW2A 3NOHA 3TCHA 1IXIA 3IK6B 4IR8A 4OVQA 1Y1ZA 4ZZEA 1IZ1A 4GFRA 3HCQA 4MCOA 3Q26A 3T93B 4EQBA 3T66A 3V89B 1LBWA 2XD2A 1L5TA 1T0KA 1S50A 1A55A 4ELOA 4I9DA 4OETA 3PUXE 1LBVA 3TTNA 1H3DA 2Q2AA 3IX1A 1B5HA 4OFOA 5EQ7A 1OMPA 4H46A 1RYXA 3KN8A 2MKZA 1DK4A 1B46A 3H6TA 4PE3A 2XHDA 3FJGA 2ONKE 4LP2B 3IB0A 4L17A 4YKPA 1KA1A 4JWXA 1AMFA 1OVTA 4U1ZA 1DTZA 2P1SA 3MVZA 4NAPA 5L9SA 3I6VA 3U65A 5DVFA 1RDYA 5IZ3B 4GD5A 3F11A 1H44A 2XXKA 5H8SA 4NF8B 4KD5A 1FJ6A 3SEVA 3PPQA 5BUUA 3T9XB 1B7HA 2OJTA 2Q9TA 5FHMA 2F6GA 3QSLA 2DE3A 3D1RA 5IGAA 4OVTA 3I5OA 3HHFA 4MH5A 3TCGA 1DMBA 3VE1B 4ZEFA 4ZEKA 3G3KA 1ZKBA 1JW5A 3IFCA 3G3JA 2WEFA 1YXIA 5ITOA 1EYKA 2BJJX 4NWCA 4RY1A 5CM6A 2UYFA 1USYE 1VDWA 4IO4A 4PETA 1NV5A 5H8FA 5I56A 3KG2A 2D5WA 3GBBA 2YPNA 4U22A 4PBQA 3IB1A 5ET7A 1BLFA 1D9VA 4PC9A 1JW4A 4LVQA 2Z8DA 4QHQA 3TAJA 4GQOA 3UN6A 4POXA 3O29A 4QF9A 3U8QA 2Y7WA 4ND9A 4YAHX 3W9WA 1YYZA 3GZGA 3MZBA 1O63A 2ONSA 3W9VA 3IOTA 4OFJA 2O68A 4RPNA 4OVSA 5I2KB 4NN3A 1LEVA 2ZYOA 5EHSA 3CFLA 1ZLQA 2Q89A 2I4BA 3U94A 4PDDA 3FZVA 1IMCA 2HZKA 4N8GA 1QKBA 3EHUA 5LOMA 4WEPA 4NF5B 1VSOA 3K6XA 1HSJA 3W15C 3G3HA 3KGCA 4PDHA 4DDDA 4THIA 2XXIA 4H5FA 2HXWA 2VD2A 2UXAA 2UYEA 5LTCA 1Q35A 1XOCA 2V93A 4KR5A 2WX9A 1LAHE 3FJ7A 1JEVA 1TXFA 2VPOA 2XXTA 1PC3A 4G77A 2B65A 2F6PA 1LBBA 2FYIA 3G3IA 1UTBB 1MDQA 2ANJA 3IO4A 1N7XA 2F36A 4RA1A 4P11A 4C1UA 1Y4TA 3KBRA 1IQ7A 3HPIA 5EYGA 3U72A 3B6TA 1MQIA 2XXYA 2XXVA 2VOZA 4PFRA 5ICQA 1ZJLA 3FD3A 1FTJA 1MQHA 4QFLA 4OENA 3QIMA 3M8UA 3M3KA 3LSXA 1YZ0A 1NNTA 4XKRA 4FJPA 4KCCA 4KQPA 5H8QA 4WXJA 2V3QA 1FBFA 3PPPA 5L8DA 2GQ1A 4JDFA 2RCBA 4K3FA 1MS7A 1D3KA 3OD7A 3BFTA 3OOAA 1H43A 4HE0A 2THIA 5DW8A 4F31B 1IEJA 3B8BA 1PB8A 1ZMGA 3T22A 3H6WA 5JTYA 1A99A 1FPBA 3OEKA 1IXHA 2OZZA 4OQOA 3LR1A 1MQJA 3Q25A 4H8JA 2RC9A 3O6IA 4PFUA 1NV1A 5KCJA 3OENA 2D21A 3MVWA 1R1NA 1N84A 1A54A 1LSTA 5K2XA 3EPEA 1VR5A 4FIMA 1Q9DA 4ZEIA 3TDJA 3O6GA 3O66A 5TU0A 5H8HB 2Y5KA 4Q0CA 4PFBA 5TPAA 5CMKA 1EU8A 4H67A 5TP9A 2H98A 4UACA 3C36A 2DE4A 1FBHA 1K9ZA 3OEMA 4H45A 4U21A 2DP8A 3QMFA 3SESA 3G3GA 1NV0A 5I58A 4IO2A 5I84A 1Y4CA 4N15A 4YICA 1FSAA 5ESYA 2HHMA 4NF8A 4OFLA 3FV1A 3UP9A 1SW4A 1SW1A 2QS4A 1M5CA 3LSWA 4I1DA 3DELB 2ESNA 1MXYA 3CHGA 1INPA 1S9TA 2R8TA 1NV3A 4P47A 4ZE9A 4F19A 1OIBA 3TCFA 1NV4A 3PD8A 1FTOA 3QXMA 2O1LA 2V4CA 5FBPA 2F3DA 4F3SA 1M5FA 4PFTA 2GHAA 1B7UA 1NUYA 3CG1A 2WYKA 5CRYA 3OO8A 3KBZA 4N91A 1B58A 4YMBA 1R6ZA 4EQ7A 2B4MA 2XXHA 1ZIUA 4Z7EA 2PFZA 3C35A 4YB5A 4OXVA 1AOVA 4P56A 1B0LA 5EQAA 4KYSA 1FPDA 3CSBA 4O3CA 5H8NB 3PPOA 5DVJA 5M2VA 2P0SA 4HW8A 4N13A 4MNCA 5DT6A 3M3LA 4RK9A 4H65A 2QVUA 1LGBC 5DEXB 5KDTA 3KEIA 4YKJA 2I3VA 3RPLB 1EYJA 4PF8A 3KC1A 4ELPA 4AS4A 4FAJA 2XXRA 4X8RA 2M8CA 1NV6A 4PP0A 5CC2A 4OYVA 4NF5A 3S9LC 3BBRA 4PGNA 3FIRA 1IMEA 2Z8FA 3PGFA 3MJNA 3K1MA 3S4UA 3S9MC 1NKXA 1MXXA 3MAMA 3N6TA 1IMAA 4MLVA 1FTAA 2E1SA 3MC2A 3OSRA 4Q5TA 5I57B 2HEUA 4R9FA 1AL3A 4X04A 3KC0A 2R6GE 4GOTA 3DP4A 4XIGQ 2YJPA 5AA1A 1FQEA 3FBPA 4JVIA 2HFBA 1AH5A 2CMOA 4XFEA 3EF7A 4G8NA 3SZPA 1LFHA 5CMBA 4MMPA 5AE4A 1TFAA 3BIGA 3TYHA 1Z7ME 3AXFA 3IJOB 1SD3A 4NF4A 4PAIA 4JVCA 5FTIA 2A5SA 3TMGA 1LBCA 4KXPA 4XF5A 2WBDA 4OZ9A 3MW0A 3K4UA 2FIXA 3BFUA 2QS3A 4DCYA 2RC8A 1B1HA 1FW0A 1N3XA 2AIXA 3FASA 4QSEA 2NWJA 4E0WA 1TFDA 1B0HA 3SDFA 4BDQA 1NV7A 3EN3A 2CZIA 3TUSA 1LAXA 2CEYA 4GL0A 4AS5A 4N6KA 2DVZA 3JZJA 2DXRA 3CFZA 1FCKA 4XEQA 2FIEA 3MSTA 3A29A 3ILTB 3H3GA 2PBWA 2Q8JA 2DWHA 2QMXA 4ZZAA 5ELVA 4U2RA 1LB8A 1MH3A 4IY6A 2DXYA 3A3CA 3C33A 2X26A 2P2AA 1MDP1 2F7CA 4R9GA 2RKMA 1H45A 4NMYA 1FBDA 5I59A 2GRVA 2NVUB 1MPDA 1IUDA 3MP8A 1B3GA 5I2NA 1K9YA 1VFEA 4N6DA 3HO7A 4R75A 1MH4A 1H76A 1P99A 3Q29A 4ZEDA 2I49A 2KR0A 1Y9UA 3FXQA 2JJKA 5EYHA 4F2OA 3IR1A 2Q74A 4R6YA 1QKAA 3GXAA 3T9VA 4AB5A 3FATA 3L6HA 3K6UA 5DTBA 3FJMA 4GVOA 1QVSA 2HZLA 3FXBA 3K2DA 1B4HA 2HXRA 3B7DA 4RXLA 3T9UA 1MPBA 2O69A 2QS2A 2ALUA 3IOVA 5B7DA 1NUXA 3SKPA 4LA9A 4E0XA 3IO6A 1FPIA 5BWJA 2P3VA 2ZNSA 5I7IA 3FVGA 4AQ4A 1NUZA 1XT8A 4OERA 3K6VA 5J16A 2H4IA 3MP1A 5K2YA 2ZZVA 3EKIA 4R2FA 2Q8MA 2VP1A 4I40A 3D4GA 4HE1A 4Q8RA 4I3YA 2A5TB 1LLSA 4DIGA 1Y20A 1FTKA 3RN8A 2R9JA 3SEYA 3E13X 1FRPA 1M5DA 2KLFA 4HCWA 2GHBA 2B4LA 2HCAA 1FPFA 4MBPA 5A5LA 2IA4A 4MIJA 1GTKA 2FVZA 1N76A 4OVRA 3N26A 4EUOA 3TQWA 4AB6A 3ONMA 4QSCA 2PT1A 5T3JA 3IOUA 5ITPA 1I6QA 4C0RA 1HSEA 5ET6A 1YAEA 3U92A 4G68A 1SDXA 3KOSA 1PDAA 4DLDA 1IITA 1QULA 4GBWA 1I6BA 3VVFA 2H5YA 2OLBA 2PT2A 2XXUA 4UA8A 2PCRA 3CR9A 3OMBA 1LBYA 5LDZA 1AWBA 5I57A 1NI9A 4EQ9A 1TWYA 1KA0A 2QS1A 2F35A 4NGUA 1B2HA 4H0WA 5EQ8A 1FBCA 1MXVA 3LSFB 3VLUA 3RGYA 4IO3A 5A5XB 5HM4B 5AA4B 3GYYA 2I0BA 4QXDA 2RF1A 3UGWA 1SI1A 4HCYA 4O8MA 4JWOA 1XC1A 2ZMBA 3CIJA 4PFIA 2I58A 3JV9A 1SBPA 4ZEBA 4NX1A 3TTLA 4X1BA 3KFMA 4RK2A 5AA2A 5FHOA 2RINA 4G8MA 3MZ9A 3R6UA 3FXRA 1B3HA 1UTHA 3M3FA 3WAFA 1ANFA 2HAUA 4NF6A 3VFJA 3TEPA 5F7VA 4QSDA 4H6DA 3T96B 5CMMA 2DE2A 1MG1A 3TFLA 4QBAA 2CZHA 2VD3A 1Y3QA 2PYYA 1USYH 3TQLA 4GWXA 1MQDA 3QK6A 3K01A 5JK4A 2VGQA 3PPRA 1O64A 1N3WA 3VDFA 4F18A 3Q28A 4MNPA 1UIVA 3TODA 1WDNA 4FECA 2RC7A 1A8FA 1YPNA 2Y84A 1JNFA 3PUYE 3PUZE 2DDKA 1XHYA 1POY1 4OWDA 3QUFA 1WODA 1R9QA 4PBHA 1DBZA 1ZBMA 3HN0A 4IGTA 3PU5A 4MAGA 3H6UA 3FGSA 3MUQA 1I6AA 3C4MA 3PV0E 3FVNA 2D3IA 5F1QA 1PB9A 5IZ3A 1IMBA 5CBSA 3K0VA 1MRPA 3IL1B 3O6HA 1Q1KA 3OELA 2QJEA 1MXWA 1DTGA 4BDRA 4NHBA 5EYFA 4GRKA 2X7QA 4GWZA 4F1VA 1RKMA 1LBZA 1P1QA 2XXQA 2OBGA 3A3UA 1B9JA 3PD9A 3UORA 1URSA 4FE8A 4HTGA 1B52A 5ET8A 2BJIA 2VPNA 1IXGA 1MM7A 2CEXA 3MVXA 1PB7A 1JQFA 1S7YA 5HPQA 3FV2A 4F3BA 2P3NA 5H8FB 4NG7A 5I56B 4IO7A 2V3UA 2QMWA 3IORA 1BKAA 2LAOA 3VLWA 4YKIA 4OVPA 2OX3A 1AIVA 2DWAA 4G68C 4O94A 3IFAA 2PMSA 4N17A 1DPPA 2F78A 4YKKA 3A09A 4U4XA 1POTA 4NF0A 1N7WA 2ZNTA 2ZNUA 3CI8A 3EQ1A 2I48A 5I3SA 1SW5A 2PX1A 1URDA 1A8EA 5CMCA 2CZKA 1BP5A 5I2KA 3IJXB 1G0IA 3RT8A 1B5IA 2Z8EA 4U23A 1BTJA 4GWYA 4H1XA 1KZ8A 3USDA 1FQFA 2H9BA 3E79A 3H06B 4R72A 1II5A 4EDPA 3D4CA 1GR2A 1NUWA 1MXZA 4OTEA 4RNSA 3TTRA 3U93A 3N5LA 1FPKA 4Z0IA 1PEBA 4DXBA 4XXUA 1QGXA 1FPEA 3N94A 4RPOA 1MQGA 1OQHA 3Q27A 3HSTA 1G0HA 2XXXA 4JXIA 3KSJA 1UTBA 4BLAA 1B3FA 2ONRA 3VV5A 1XS5A 2VHAA 1OQGA 2UVGA 2XD3A 3MZ1A 4ESWA 1US5A 5A5XA 5ISUA 2XWKA 4IO5A 2NUVA 3VVEA 4GWWA 4X1DA 1GGGA 1B6HA 4MLQA 2WBBA 1NL5A 3SEWA 2X7PA 1FJ9A 4N81A 4ELQA 3MVYA 2CZLA 3C32A 1SI0A 4JSDA 4ELRA 4OVJA 4LZ8A 1MY1A 2AL4A 4O7IA 1KWHA 3RLFE 2OK2A 1FPLA 2H99A 1LFIA 3SEXA 4BDOA 3PTYA 4LQ2A 5H8QB 4ESXA 3VXCA 3RUMA 1JW1A 3L6GA 3QUJA 2QL3A 2R71A 3B6QA 2W7YA 4O3AA 3KZGA 4H5GA 4P1LA 1LCTA 2HQ0A 5CBRA 1PBPA 1NNPA 4WEDA 4GXSB 4NTLA 4PAKA 3OO6A 5JTYB 2HPGA 3H6VA 1I69A 3K00A 3O28A 3KSXA 1NNKA 3C9HA 4G2ZA 4GX6A 1R9LA 1QUJA 4PFYA 4P3LA 4JB7A 3ZS6A 5KCJB 4NWDA 3EHTA 1IXCA 4HXVA 4DI3D 1A7LA 3RNNA 2I3WA 5B70A 4EF2A 3R7XA 2WKYA 4MF3A 3DP8A 5H8HA 2Y7IA 1B3EA 4YB7A 1PBQA 4XTCQ 1DSNA 4XKNA 4ZDMA 1B40A 4GXAA 5TPAB 5EHMA 4KYEA 4XKQA 4P0IA 2B3FA 5TP9B 4F29A 3O97A 1US4A 3K6WA 2ZZWA 3MPKA 4FORA 5FHNA 4ZECA 4WKMA 3LV0A 4OEUA 3OSQA 4TLLB 4PE5B 5I5PA 4LATA 1LCFA 1GVCA 2I4CA 4TQUQ 5IM2A 5I58B 3KN7A 5DYHA 3THIA 3CRBA 1P1UA 2AL5A 4EF1A 1FBGA 4EXLA 4N4UA 2YLNA 3PPNA 4RJZA 4FEDA 4LONB 3BKIB 2Z23A 4MX6A 1NFTA 3I3VA 5ICTA 4LN5A 4ONYA 4F3GA 4GWUA 2GH9A 3ILUB 2F3BA 2OWSA 2QVVA 4KHZE 3RTFB 4MEVA 3TZAA 4DCXA 1D4NA 3PUVE 3H03A 1JVYA 3LC8A 4OMBA 2OWZA 4GBVA 3V5AA 3E4RA 1JEUA 3WAEA 3S9EA 3LSLA 2QSXA 3ZKKA 3V83A 1URGA 2F8DA 3B6WA 4R74A 2XXWA 1WVJA 3DLNA 5IZ1A 5EQ9A 4PF6A 3MWBA 2FBPA 4IY5A 4LZ7A 5H8NA 1JP4A 4NE4A 4X48A 1OLAA 1EH3A 5J1DA 4M4GA 3E78A 1DCUA 1A40A 3RPWA 4OANA 1Y3PA 1SYHA 3E3KA 5DEXA 4R6KA 2L5VA 3RPLA 1XVXA 1HSLA 4GF8A 4FATA 4GLIA 5KDTB 3OO9A 4PFWA 5IAIA 2FHYA 1B1XA 3KJTA 4POWA 3SETA 1Y3NA 1B7ZA 1F9BA 4I62A 4GL8A 4BDMA 4LQ5A 1UIUA 3ZSFA 3RTWB 3MYUA 4F22A 3HHGA 1JETA 1N0TA 2G29A 2PVUA 4R2BA 2RCAA 4IB2A 2DS9A 3IOWA 3MBPA 4UABA 4H8IA 3MP6A 3R26A 4F39A 3IAZA 3MQ9A 1P1OA 3ISPA 5F24A 3OO7A 3H4ZA 4GX3A 3PMXA 1CE2A 3SERA 1VFDA 1GV8A 3IB2A 3SEUA 2F97A 1LBXA 4M1VA 1FQCA 2XX8A 3CG3A 1QUKA 1XVYA 1P1WA 3T9HB 4NF4B 2DWJA 1YCJA 2V3TA 1LAFE 2F7AA 4FEBA 2ZYNA 3N6UA 4U1OA 4HS7A 2UVIA 1IMFA 2Y5LA 4XKPA 3TTKA 3E9XA 3PMVA 4JVDA 4G8HA 1IIWA 2XXPA 4ZE8A 2QFLA 2O7IA 1NMUA 3B50A 2ZXTA 2QVRA 3ECRA 2O51A 1LB9A 4JBZA 1SPIA 2ZYMA 4ECFA 1SVXB 3TELA 3C31A 2B3BA 5AA2D 4KCDA 3LUZA 4F1UA 1Y1MA 1EYIA 2ABHA 4PQJA 2VT5A 3ROJA 1D9QA 1CB6A 3U1OA 1RDZA 2KQZA 1O7TA 4PAFA 4KYDA 2QPQA 5KZTA 3HV1A 2G93A 4PGPA 2QRYA 5ET5A 4F2QA 5JEIA 4I8CA 4GWOA 4P0GA 3GLBA 3K02A 1ATGA 2V25A 2ZYKA 1FBPA 4NQ8A 5I59B 3CSGA 1JVXA 1DOTA 4O7MA 2ZZXA 1ELJA 5FTHA 2HAVA 5I2NB 4QFKA 3C34A 4I3EA 3VXBA 2PFYA 3TKDA 1MY4A 1SQYA 4ISUA 1FQAA 2NOOA 3FVKA 3RQTA 1N04A 2DOJA 4BDLA 4HE2A 2AYSA 3KOTA 1MY3A 2F7BA 3PUWE 4R73A 3G7WA 2O7UA 4F1YA 4OHNA 4YU0A 4IGRA 3OXNA 2Y7RA 1EZPA 1J1NA 4N07A 1UQWA 1B05A 2H25A 3G3FA 4KI0E 4DZ1A 4EXKA 3VVDA 1NV2A 3MPLA 1NH7A 3VLVA 4NEDA 3JYRA 1OVBA 1B3LA 2I0CA 2WYPA 3FUZA 2Q88A 3T0JA 4FBPA 1NNFA 4GX4A 3FXUA 2DWIA 2XA5A 3S9NC 1BIYA 1FBEA 4DI4B 3FVOA 4QRZA 3RYDA 1RDXA 3T1BA 4LZ5A 1B32A 1CNQA 4QFOA 5DVIA 2XWOA 2A5TA 2Y7PA 4OA4A 1XI6A 4IO6A 4KFQA 2DYXA 4MJOA 3UA8A 4X9TA 1VE4A 2FA7A 1D9YA 4C1TA 4PTKA 1Z7NE 2UVJA 2OCUA 3BIHA 1P1NA 4F3PA 3K1NA 4OEVA 3RY3A 5IKBA 3EHSA 3GBAA 2F34A 2O1MA 1FTMA 3LBSA 4YZZA 2GFEA 4DE8A 2F5XA 4R6HA 2DSFA 4QFPA 5CI5A 4DXCA 1B4ZA 4JSOA 4U4SA 2E0SA 3ZKLA 4GIZA 4P1EA 4G4PA 1FTLA 1QJMA 4YMAA 5L9OA 4N6PA 4OESA 4G68B 1OLCA
chains in the Genus database with same CATH topology
3V8XB 2V84A 1DPEA 1YTVA 3QYTA 3RT6B 1NH8A 3QAXA 3CVGA 5L9MA 3PMWA 3S2VA 1QW0A 3KJ7A 3LUYA 1B5JA 3DM0A 3UIFA 5AA4A 3P7IA 1FQDA 3KN3A 3DP6A 4LUBA 4O3BA 5HBCA 1M5BA 3CFXA 2UVHA 1MXUA 2O84X 1MPCA 4BDNA 2DQVA 1B51A 2XX7A 4Q30B 2IEEA 3TTMA 2OWTA 1RYOA 1M5EA 4RYAA 4TOZA 4TLMB 1FQBA 4JWYA 3TPAA 1TT1A 1LAGE 2NXOA 2O6AA 2REGA 1ZU0A 2FNCA 4DXUA 2DVCA 5AA2B 1MM6A 1ZTYA 1MY2A 4QFNA 4YB6A 1EZOA 2REJA 3K1PA 3UK4A 1QUIA 1UTHB 4ZS9A 2Z22A 4NF6B 3ODBA 4MFIA 3O2AA 2Y7KA 4KPTA 1SYIA 3O9PA 5AA3A 1LFGA 1EZ9A 3H7MA 2Q2CA 2I6EA 1MY0A 2XX9A 1SW2A 3TCHA 1IXIA 3IK6B 1Y1ZA 4ZZEA 1IZ1A 4GFRA 3HCQA 3Q26A 3T93B 4EQBA 3T66A 3V89B 2XD2A 1L5TA 1T0KA 1S50A 1A55A 4ELOA 4I9DA 4OETA 3PUXE 3TTNA 1H3DA 2Q2AA 3IX1A 1B5HA 4OFOA 1OMPA 1RYXA 3KN8A 1B46A 3H6TA 2XHDA 3FJGA 2ONKE 4LP2B 3IB0A 4L17A 4YKPA 4JWXA 1AMFA 1OVTA 4U1ZA 1DTZA 2P1SA 3MVZA 5L9SA 3I6VA 5DVFA 4GD5A 3F11A 1H44A 5H8SA 4NF8B 4KD5A 3SEVA 3PPQA 5BUUA 3T9XB 1B7HA 2OJTA 2Q9TA 5FHMA 2F6GA 3QSLA 2DE3A 3I5OA 3HHFA 4MH5A 3TCGA 1DMBA 3VE1B 4ZEFA 4ZEKA 3G3KA 1ZKBA 1JW5A 3G3JA 5ITOA 2BJJX 4NWCA 4RY1A 5CM6A 2UYFA 1USYE 4IO4A 4PETA 5H8FA 5I56A 3KG2A 2D5WA 3GBBA 2YPNA 4U22A 3IB1A 1BLFA 1D9VA 1JW4A 4LVQA 2Z8DA 4QHQA 3TAJA 4GQOA 3UN6A 4POXA 3O29A 4QF9A 3U8QA 2Y7WA 4ND9A 4YAHX 3W9WA 3GZGA 3MZBA 1O63A 2ONSA 3W9VA 3IOTA 4OFJA 2O68A 4RPNA 5I2KB 2ZYOA 5EHSA 3CFLA 1ZLQA 2Q89A 2I4BA 3U94A 3FZVA 2HZKA 1QKBA 3EHUA 5LOMA 4WEPA 4NF5B 1VSOA 3K6XA 1HSJA 3W15C 3G3HA 3KGCA 4DDDA 4THIA 2XXIA 4H5FA 2HXWA 2VD2A 2UXAA 2UYEA 1Q35A 1XOCA 2V93A 4KR5A 1LAHE 3FJ7A 1JEVA 1TXFA 2XXTA 1PC3A 4G77A 2B65A 2F6PA 1LBBA 2FYIA 3G3IA 1UTBB 1MDQA 2ANJA 3IO4A 1N7XA 2F36A 4RA1A 4P11A 4C1UA 1Y4TA 3KBRA 1IQ7A 3HPIA 3U72A 3B6TA 1MQIA 2XXYA 2XXVA 2VOZA 5ICQA 1ZJLA 3FD3A 1FTJA 1MQHA 4QFLA 4OENA 3QIMA 3M8UA 3M3KA 3LSXA 1NNTA 4XKRA 4FJPA 4KCCA 4KQPA 5H8QA 4WXJA 2V3QA 3PPPA 5L8DA 4JDFA 2RCBA 4K3FA 1MS7A 1D3KA 3OD7A 3BFTA 3OOAA 1H43A 2THIA 4F31B 1IEJA 1PB8A 1ZMGA 3T22A 3H6WA 5JTYA 1A99A 3OEKA 1IXHA 2OZZA 4OQOA 3LR1A 1MQJA 3Q25A 4H8JA 2RC9A 3O6IA 4PFUA 5KCJA 3OENA 2D21A 3MVWA 1R1NA 1N84A 1A54A 1LSTA 5K2XA 3EPEA 1VR5A 4FIMA 4ZEIA 3TDJA 3O6GA 3O66A 5TU0A 5H8HB 4Q0CA 5TPAA 5CMKA 1EU8A 4H67A 5TP9A 2H98A 4UACA 3C36A 2DE4A 3OEMA 4U21A 2DP8A 3SESA 3G3GA 5I58A 4IO2A 5I84A 1Y4CA 4YICA 4NF8A 4OFLA 3FV1A 3UP9A 1SW4A 1SW1A 2QS4A 1M5CA 3LSWA 4I1DA 3DELB 2ESNA 1MXYA 1S9TA 4ZE9A 4F19A 1OIBA 3TCFA 3PD8A 1FTOA 3QXMA 2O1LA 4F3SA 1M5FA 4PFTA 2GHAA 1B7UA 3CG1A 5CRYA 3OO8A 4YMBA 1B58A 1R6ZA 4EQ7A 2XXHA 1ZIUA 4Z7EA 3C35A 4YB5A 4OXVA 1AOVA 1B0LA 4KYSA 3CSBA 4O3CA 5H8NB 3PPOA 5DVJA 5M2VA 2P0SA 4HW8A 4N13A 5DT6A 3M3LA 4RK9A 4H65A 1LGBC 5DEXB 5KDTA 3KEIA 4YKJA 2I3VA 4ELPA 4FAJA 2XXRA 2M8CA 4PP0A 5CC2A 4OYVA 4NF5A 3S9LC 3BBRA 3FIRA 2Z8FA 3PGFA 3MJNA 3K1MA 3S4UA 3S9MC 1NKXA 1MXXA 3MAMA 3N6TA 4MLVA 2E1SA 3MC2A 3OSRA 4Q5TA 5I57B 2HEUA 4R9FA 1AL3A 2R6GE 4GOTA 3DP4A 4XIGQ 2YJPA 5AA1A 1FQEA 2HFBA 1AH5A 2CMOA 3EF7A 4G8NA 1LFHA 5CMBA 5AE4A 1TFAA 3TYHA 1Z7ME 3AXFA 3IJOB 1SD3A 4NF4A 5FTIA 2A5SA 3TMGA 1LBCA 4OZ9A 3MW0A 3K4UA 3BFUA 2QS3A 4DCYA 2RC8A 1B1HA 1FW0A 1N3XA 2AIXA 3FASA 4QSEA 2NWJA 4E0WA 1TFDA 1B0HA 3SDFA 4BDQA 3EN3A 3TUSA 1LAXA 4GL0A 2DVZA 3JZJA 2DXRA 3CFZA 1FCKA 3ILTB 3H3GA 2PBWA 2Q8JA 2DWHA 2QMXA 4ZZAA 5ELVA 4U2RA 1LB8A 1MH3A 4IY6A 2DXYA 3A3CA 3C33A 2X26A 2P2AA 1MDP1 2F7CA 4R9GA 2RKMA 1H45A 4NMYA 5I59A 2GRVA 2NVUB 1MPDA 1IUDA 3MP8A 1B3GA 5I2NA 1VFEA 3HO7A 4R75A 1MH4A 1H76A 1P99A 3Q29A 4ZEDA 2I49A 1Y9UA 3FXQA 4F2OA 3IR1A 4R6YA 1QKAA 3GXAA 3T9VA 4AB5A 3FATA 3L6HA 3K6UA 5DTBA 3FJMA 4GVOA 1QVSA 2HZLA 3K2DA 1B4HA 3B7DA 4RXLA 3T9UA 1MPBA 2O69A 2QS2A 2ALUA 3IOVA 5B7DA 3SKPA 4LA9A 4E0XA 3IO6A 5BWJA 2ZNSA 3FVGA 4AQ4A 1XT8A 4OERA 3K6VA 2H4IA 3MP1A 5K2YA 4R2FA 2VP1A 3D4GA 4Q8RA 2A5TB 1LLSA 4DIGA 1Y20A 1FTKA 3RN8A 2R9JA 3SEYA 3E13X 1M5DA 2KLFA 4HCWA 2GHBA 2HCAA 4MBPA 2IA4A 1GTKA 1N76A 3N26A 4EUOA 3TQWA 4AB6A 3ONMA 4QSCA 2PT1A 3IOUA 5ITPA 1I6QA 4C0RA 1HSEA 1YAEA 3U92A 4G68A 1SDXA 3KOSA 1PDAA 4DLDA 1IITA 1QULA 1I6BA 3VVFA 2H5YA 2OLBA 2PT2A 2XXUA 4UA8A 3CR9A 3OMBA 5I57A 4EQ9A 1TWYA 2QS1A 2F35A 1B2HA 4H0WA 1MXVA 3LSFB 3VLUA 3RGYA 4IO3A 5A5XB 5HM4B 5AA4B 2I0BA 2RF1A 3UGWA 1SI1A 4HCYA 4JWOA 1XC1A 2ZMBA 3CIJA 2I58A 3JV9A 1SBPA 4ZEBA 3TTLA 4X1BA 3KFMA 4RK2A 5AA2A 5FHOA 2RINA 4G8MA 3MZ9A 3R6UA 3FXRA 1B3HA 1UTHA 3M3FA 3WAFA 1ANFA 2HAUA 4NF6A 3VFJA 3TEPA 5F7VA 4QSDA 4H6DA 3T96B 5CMMA 2DE2A 1MG1A 3TFLA 2VD3A 1Y3QA 2PYYA 1USYH 3TQLA 1MQDA 3QK6A 3K01A 5JK4A 2VGQA 3PPRA 1O64A 1N3WA 3VDFA 4F18A 3Q28A 1UIVA 3TODA 1WDNA 4FECA 2RC7A 1A8FA 1YPNA 2Y84A 1JNFA 3PUYE 3PUZE 1XHYA 1POY1 4OWDA 3QUFA 1WODA 1R9QA 1ZBMA 3HN0A 4IGTA 3PU5A 3H6UA 3FGSA 3MUQA 1I6AA 3C4MA 3PV0E 3FVNA 2D3IA 5F1QA 1PB9A 5CBSA 3K0VA 1MRPA 3IL1B 3O6HA 1Q1KA 3OELA 2QJEA 1MXWA 1DTGA 4BDRA 5EYFA 4GRKA 2X7QA 4F1VA 1RKMA 1P1QA 2XXQA 2OBGA 3A3UA 1B9JA 3PD9A 3UORA 1URSA 4FE8A 4HTGA 1B52A 1IXGA 1MM7A 3MVXA 1PB7A 1JQFA 1S7YA 5HPQA 3FV2A 4F3BA 5H8FB 5I56B 4IO7A 2V3UA 2QMWA 3IORA 1BKAA 2LAOA 3VLWA 4YKIA 1AIVA 2DWAA 4G68C 2PMSA 1DPPA 2F78A 4YKKA 3A09A 4U4XA 1POTA 1N7WA 2ZNTA 2ZNUA 3CI8A 3EQ1A 2I48A 1SW5A 2PX1A 1URDA 1A8EA 5CMCA 1BP5A 5I2KA 3IJXB 3RT8A 1B5IA 2Z8EA 4U23A 1BTJA 4H1XA 3USDA 1FQFA 2H9BA 3H06B 4R72A 1II5A 4EDPA 3D4CA 1GR2A 1MXZA 4OTEA 4RNSA 3TTRA 3U93A 3N5LA 4Z0IA 1PEBA 4DXBA 4XXUA 3N94A 4RPOA 1MQGA 1OQHA 3Q27A 3HSTA 2XXXA 4JXIA 3KSJA 1UTBA 4BLAA 1B3FA 2ONRA 3VV5A 1XS5A 2VHAA 1OQGA 2UVGA 2XD3A 3MZ1A 4ESWA 1US5A 5A5XA 5ISUA 4IO5A 2NUVA 3VVEA 4X1DA 1GGGA 1B6HA 4MLQA 1NL5A 3SEWA 2X7PA 4ELQA 3MVYA 2CZLA 3C32A 1SI0A 4JSDA 4ELRA 4OVJA 4LZ8A 2AL4A 1MY1A 1KWHA 3RLFE 2OK2A 2H99A 1LFIA 3SEXA 4BDOA 4LQ2A 5H8QB 4ESXA 3VXCA 3RUMA 1JW1A 3L6GA 3QUJA 2QL3A 2R71A 3B6QA 2W7YA 4O3AA 3KZGA 4H5GA 1LCTA 2HQ0A 5CBRA 1PBPA 1NNPA 4WEDA 4GXSB 4NTLA 3OO6A 5JTYB 3H6VA 1I69A 3K00A 3O28A 3KSXA 1NNKA 3C9HA 4G2ZA 1R9LA 1QUJA 4PFYA 4JB7A 3ZS6A 5KCJB 4NWDA 3EHTA 1IXCA 1A7LA 3RNNA 2I3WA 5B70A 4EF2A 3R7XA 2WKYA 4MF3A 3DP8A 5H8HA 2Y7IA 1B3EA 4YB7A 1PBQA 4XTCQ 1DSNA 4XKNA 4ZDMA 1B40A 4GXAA 5TPAB 5EHMA 4KYEA 4XKQA 4P0IA 2B3FA 5TP9B 4F29A 3O97A 1US4A 3K6WA 3MPKA 4FORA 5FHNA 4ZECA 4WKMA 4OEUA 3OSQA 4TLLB 4PE5B 4LATA 1LCFA 1GVCA 2I4CA 4TQUQ 5I58B 3KN7A 5DYHA 3THIA 3CRBA 1P1UA 2AL5A 4EF1A 4EXLA 2YLNA 3PPNA 4RJZA 4FEDA 4LONB 3BKIB 2Z23A 1NFTA 3I3VA 5ICTA 4ONYA 4F3GA 2GH9A 3ILUB 2OWSA 4KHZE 3RTFB 3TZAA 4DCXA 1D4NA 3PUVE 3H03A 1JVYA 3LC8A 4OMBA 3V5AA 3E4RA 1JEUA 3WAEA 3S9EA 3LSLA 2QSXA 3ZKKA 3V83A 1URGA 2F8DA 3B6WA 4R74A 2XXWA 1WVJA 3DLNA 3MWBA 4IY5A 4LZ7A 5H8NA 4NE4A 4X48A 1OLAA 1EH3A 5J1DA 4M4GA 1A40A 3RPWA 1Y3PA 1SYHA 3E3KA 5DEXA 4R6KA 1XVXA 1HSLA 4GF8A 4FATA 4GLIA 5KDTB 3OO9A 4PFWA 5IAIA 1B1XA 3KJTA 4POWA 3SETA 1Y3NA 1B7ZA 1F9BA 4I62A 4GL8A 4BDMA 4LQ5A 1UIUA 3ZSFA 3RTWB 4F22A 3HHGA 1JETA 1N0TA 2G29A 2PVUA 4R2BA 2RCAA 4IB2A 2DS9A 3IOWA 3MBPA 4H8IA 3MP6A 3R26A 4F39A 3IAZA 3MQ9A 1P1OA 3OO7A 3H4ZA 3PMXA 1CE2A 3SERA 1VFDA 1GV8A 3IB2A 3SEUA 2F97A 4M1VA 1FQCA 2XX8A 3CG3A 1QUKA 1XVYA 1P1WA 3T9HB 4NF4B 2DWJA 1YCJA 2V3TA 1LAFE 2F7AA 4FEBA 2ZYNA 3N6UA 4U1OA 4HS7A 2UVIA 4XKPA 3TTKA 3E9XA 3PMVA 4G8HA 1IIWA 2XXPA 4ZE8A 2O7IA 1NMUA 2ZXTA 3ECRA 2O51A 1LB9A 4JBZA 2ZYMA 4ECFA 1SVXB 3TELA 3C31A 2B3BA 5AA2D 4KCDA 4F1UA 1Y1MA 2ABHA 4PQJA 1CB6A 3U1OA 1O7TA 4KYDA 2QPQA 5KZTA 3HV1A 2G93A 2QRYA 4F2QA 5JEIA 4I8CA 4GWOA 4P0GA 3GLBA 3K02A 1ATGA 2V25A 2ZYKA 5I59B 3CSGA 1JVXA 1DOTA 5FTHA 1ELJA 2HAVA 5I2NB 4QFKA 3C34A 3VXBA 3TKDA 1MY4A 1SQYA 4ISUA 1FQAA 2NOOA 3FVKA 3RQTA 1N04A 2DOJA 4BDLA 2AYSA 3KOTA 1MY3A 2F7BA 3PUWE 4R73A 3G7WA 2O7UA 4F1YA 4OHNA 4YU0A 4IGRA 3OXNA 2Y7RA 1EZPA 1J1NA 4N07A 1UQWA 1B05A 2H25A 3G3FA 4KI0E 4DZ1A 4EXKA 3VVDA 3MPLA 1NH7A 3VLVA 4NEDA 3JYRA 1OVBA 1B3LA 2I0CA 3FUZA 2Q88A 1NNFA 3FXUA 2DWIA 3S9NC 1BIYA 3FVOA 4QRZA 4LZ5A 1B32A 4QFOA 5DVIA 2A5TA 2Y7PA 4IO6A 4KFQA 2DYXA 3UA8A 4X9TA 1VE4A 2FA7A 1D9YA 4C1TA 1Z7NE 2UVJA 2OCUA 1P1NA 4F3PA 3K1NA 4OEVA 3RY3A 5IKBA 3EHSA 3GBAA 2F34A 2O1MA 1FTMA 3LBSA 4YZZA 2GFEA 4DE8A 2F5XA 4R6HA 2DSFA 4QFPA 5CI5A 4DXCA 1B4ZA 4JSOA 4U4SA 2E0SA 3ZKLA 4GIZA 4G4PA 1FTLA 1QJMA 4YMAA 5L9OA 4N6PA 4OESA 4G68B 1OLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8X B;  2V84 A;  1DPE A;  1YTV A;  3QYT A;  3RT6 B;  1NH8 A;  3QAX A;  3CVG A;  5L9M A;  3PMW A;  3S2V A;  1QW0 A;  3KJ7 A;  3LUY A;  1B5J A;  3DM0 A;  3UIF A;  5AA4 A;  3P7I A;  1FQD A;  3KN3 A;  3DP6 A;  4LUB A;  4O3B A;  5HBC A;  1M5B A;  3CFX A;  2UVH A;  1MXU A;  2O84 X;  1MPC A;  4BDN A;  2DQV A;  1B51 A;  2XX7 A;  4Q30 B;  2IEE A;  3TTM A;  2OWT A;  1RYO A;  1M5E A;  4RYA A;  4TOZ A;  4TLM B;  1FQB A;  4JWY A;  3TPA A;  1TT1 A;  1LAG E;  2NXO A;  2O6A A;  2REG A;  1ZU0 A;  2FNC A;  4DXU A;  2DVC A;  5AA2 B;  1MM6 A;  1ZTY A;  1MY2 A;  4QFN A;  4YB6 A;  1EZO A;  2REJ A;  3K1P A;  3UK4 A;  1QUI A;  1UTH B;  4ZS9 A;  2Z22 A;  4NF6 B;  3ODB A;  4MFI A;  3O2A A;  2Y7K A;  4KPT A;  1SYI A;  3O9P A;  5AA3 A;  1LFG A;  1EZ9 A;  3H7M A;  2Q2C A;  2I6E A;  1MY0 A;  2XX9 A;  1SW2 A;  3TCH A;  1IXI A;  3IK6 B;  1Y1Z A;  4ZZE A;  1IZ1 A;  4GFR A;  3HCQ A;  3Q26 A;  3T93 B;  4EQB A;  3T66 A;  3V89 B;  2XD2 A;  1L5T A;  1T0K A;  1S50 A;  1A55 A;  4ELO A;  4I9D A;  4OET A;  3PUX E;  3TTN A;  1H3D A;  2Q2A A;  3IX1 A;  1B5H A;  4OFO A;  1OMP A;  1RYX A;  3KN8 A;  1B46 A;  3H6T A;  2XHD A;  3FJG A;  2ONK E;  4LP2 B;  3IB0 A;  4L17 A;  4YKP A;  4JWX A;  1AMF A;  1OVT A;  4U1Z A;  1DTZ A;  2P1S A;  3MVZ A;  5L9S A;  3I6V A;  5DVF A;  4GD5 A;  3F11 A;  1H44 A;  5H8S A;  4NF8 B;  4KD5 A;  3SEV A;  3PPQ A;  5BUU A;  3T9X B;  1B7H A;  2OJT A;  2Q9T A;  5FHM A;  2F6G A;  3QSL A;  2DE3 A;  3I5O A;  3HHF A;  4MH5 A;  3TCG A;  1DMB A;  3VE1 B;  4ZEF A;  4ZEK A;  3G3K A;  1ZKB A;  1JW5 A;  3G3J A;  5ITO A;  2BJJ X;  4NWC A;  4RY1 A;  5CM6 A;  2UYF A;  1USY E;  4IO4 A;  4PET A;  5H8F A;  5I56 A;  3KG2 A;  2D5W A;  3GBB A;  2YPN A;  4U22 A;  3IB1 A;  1BLF A;  1D9V A;  1JW4 A;  4LVQ A;  2Z8D A;  4QHQ A;  3TAJ A;  4GQO A;  3UN6 A;  4POX A;  3O29 A;  4QF9 A;  3U8Q A;  2Y7W A;  4ND9 A;  4YAH X;  3W9W A;  3GZG A;  3MZB A;  1O63 A;  2ONS A;  3W9V A;  3IOT A;  4OFJ A;  2O68 A;  4RPN A;  5I2K B;  2ZYO A;  5EHS A;  3CFL A;  1ZLQ A;  2Q89 A;  2I4B A;  3U94 A;  3FZV A;  2HZK A;  1QKB A;  3EHU A;  5LOM A;  4WEP A;  4NF5 B;  1VSO A;  3K6X A;  1HSJ A;  3W15 C;  3G3H A;  3KGC A;  4DDD A;  4THI A;  2XXI A;  4H5F A;  2HXW A;  2VD2 A;  2UXA A;  2UYE A;  1Q35 A;  1XOC A;  2V93 A;  4KR5 A;  1LAH E;  3FJ7 A;  1JEV A;  1TXF A;  2XXT A;  1PC3 A;  4G77 A;  2B65 A;  2F6P A;  1LBB A;  2FYI A;  3G3I A;  1UTB B;  1MDQ A;  2ANJ A;  3IO4 A;  1N7X A;  2F36 A;  4RA1 A;  4P11 A;  4C1U A;  1Y4T A;  3KBR A;  1IQ7 A;  3HPI A;  3U72 A;  3B6T A;  1MQI A;  2XXY A;  2XXV A;  2VOZ A;  5ICQ A;  1ZJL A;  3FD3 A;  1FTJ A;  1MQH A;  4QFL A;  4OEN A;  3QIM A;  3M8U A;  3M3K A;  3LSX A;  1NNT A;  4XKR A;  4FJP A;  4KCC A;  4KQP A;  5H8Q A;  4WXJ A;  2V3Q A;  3PPP A;  5L8D A;  4JDF A;  2RCB A;  4K3F A;  1MS7 A;  1D3K A;  3OD7 A;  3BFT A;  3OOA A;  1H43 A;  2THI A;  4F31 B;  1IEJ A;  1PB8 A;  1ZMG A;  3T22 A;  3H6W A;  5JTY A;  1A99 A;  3OEK A;  1IXH A;  2OZZ A;  4OQO A;  3LR1 A;  1MQJ A;  3Q25 A;  4H8J A;  2RC9 A;  3O6I A;  4PFU A;  5KCJ A;  3OEN A;  2D21 A;  3MVW A;  1R1N A;  1N84 A;  1A54 A;  1LST A;  5K2X A;  3EPE A;  1VR5 A;  4FIM A;  4ZEI A;  3TDJ A;  3O6G A;  3O66 A;  5TU0 A;  5H8H B;  4Q0C A;  5TPA A;  5CMK A;  1EU8 A;  4H67 A;  5TP9 A;  2H98 A;  4UAC A;  3C36 A;  2DE4 A;  3OEM A;  4U21 A;  2DP8 A;  3SES A;  3G3G A;  5I58 A;  4IO2 A;  5I84 A;  1Y4C A;  4YIC A;  4NF8 A;  4OFL A;  3FV1 A;  3UP9 A;  1SW4 A;  1SW1 A;  2QS4 A;  1M5C A;  3LSW A;  4I1D A;  3DEL B;  2ESN A;  1MXY A;  1S9T A;  4ZE9 A;  4F19 A;  1OIB A;  3TCF A;  3PD8 A;  1FTO A;  3QXM A;  2O1L A;  4F3S A;  1M5F A;  4PFT A;  2GHA A;  1B7U A;  3CG1 A;  5CRY A;  3OO8 A;  4YMB A;  1B58 A;  1R6Z A;  4EQ7 A;  2XXH A;  1ZIU A;  4Z7E A;  3C35 A;  4YB5 A;  4OXV A;  1AOV A;  1B0L A;  4KYS A;  3CSB A;  4O3C A;  5H8N B;  3PPO A;  5DVJ A;  5M2V A;  2P0S A;  4HW8 A;  4N13 A;  5DT6 A;  3M3L A;  4RK9 A;  4H65 A;  1LGB C;  5DEX B;  5KDT A;  3KEI A;  4YKJ A;  2I3V A;  4ELP A;  4FAJ A;  2XXR A;  2M8C A;  4PP0 A;  5CC2 A;  4OYV A;  4NF5 A;  3S9L C;  3BBR A;  3FIR A;  2Z8F A;  3PGF A;  3MJN A;  3K1M A;  3S4U A;  3S9M C;  1NKX A;  1MXX A;  3MAM A;  3N6T A;  4MLV A;  2E1S A;  3MC2 A;  3OSR A;  4Q5T A;  5I57 B;  2HEU A;  4R9F A;  1AL3 A;  2R6G E;  4GOT A;  3DP4 A;  4XIG Q;  2YJP A;  5AA1 A;  1FQE A;  2HFB A;  1AH5 A;  2CMO A;  3EF7 A;  4G8N A;  1LFH A;  5CMB A;  5AE4 A;  1TFA A;  3TYH A;  1Z7M E;  3AXF A;  3IJO B;  1SD3 A;  4NF4 A;  5FTI A;  2A5S A;  3TMG A;  1LBC A;  4OZ9 A;  3MW0 A;  3K4U A;  3BFU A;  2QS3 A;  4DCY A;  2RC8 A;  1B1H A;  1FW0 A;  1N3X A;  2AIX A;  3FAS A;  4QSE A;  2NWJ A;  4E0W A;  1TFD A;  1B0H A;  3SDF A;  4BDQ A;  3EN3 A;  3TUS A;  1LAX A;  4GL0 A;  2DVZ A;  3JZJ A;  2DXR A;  3CFZ A;  1FCK A;  3ILT B;  3H3G A;  2PBW A;  2Q8J A;  2DWH A;  2QMX A;  4ZZA A;  5ELV A;  4U2R A;  1LB8 A;  1MH3 A;  4IY6 A;  2DXY A;  3A3C A;  3C33 A;  2X26 A;  2P2A A;  1MDP 1;  2F7C A;  4R9G A;  2RKM A;  1H45 A;  4NMY A;  5I59 A;  2GRV A;  2NVU B;  1MPD A;  1IUD A;  3MP8 A;  1B3G A;  5I2N A;  1VFE A;  3HO7 A;  4R75 A;  1MH4 A;  1H76 A;  1P99 A;  3Q29 A;  4ZED A;  2I49 A;  1Y9U A;  3FXQ A;  4F2O A;  3IR1 A;  4R6Y A;  1QKA A;  3GXA A;  3T9V A;  4AB5 A;  3FAT A;  3L6H A;  3K6U A;  5DTB A;  3FJM A;  4GVO A;  1QVS A;  2HZL A;  3K2D A;  1B4H A;  3B7D A;  4RXL A;  3T9U A;  1MPB A;  2O69 A;  2QS2 A;  2ALU A;  3IOV A;  5B7D A;  3SKP A;  4LA9 A;  4E0X A;  3IO6 A;  5BWJ A;  2ZNS A;  3FVG A;  4AQ4 A;  1XT8 A;  4OER A;  3K6V A;  2H4I A;  3MP1 A;  5K2Y A;  4R2F A;  2VP1 A;  3D4G A;  4Q8R A;  2A5T B;  1LLS A;  4DIG A;  1Y20 A;  1FTK A;  3RN8 A;  2R9J A;  3SEY A;  3E13 X;  1M5D A;  2KLF A;  4HCW A;  2GHB A;  2HCA A;  4MBP A;  2IA4 A;  1GTK A;  1N76 A;  3N26 A;  4EUO A;  3TQW A;  4AB6 A;  3ONM A;  4QSC A;  2PT1 A;  3IOU A;  5ITP A;  1I6Q A;  4C0R A;  1HSE A;  1YAE A;  3U92 A;  4G68 A;  1SDX A;  3KOS A;  1PDA A;  4DLD A;  1IIT A;  1QUL A;  1I6B A;  3VVF A;  2H5Y A;  2OLB A;  2PT2 A;  2XXU A;  4UA8 A;  3CR9 A;  3OMB A;  5I57 A;  4EQ9 A;  1TWY A;  2QS1 A;  2F35 A;  1B2H A;  4H0W A;  1MXV A;  3LSF B;  3VLU A;  3RGY A;  4IO3 A;  5A5X B;  5HM4 B;  5AA4 B;  2I0B A;  2RF1 A;  3UGW A;  1SI1 A;  4HCY A;  4JWO A;  1XC1 A;  2ZMB A;  3CIJ A;  2I58 A;  3JV9 A;  1SBP A;  4ZEB A;  3TTL A;  4X1B A;  3KFM A;  4RK2 A;  5AA2 A;  5FHO A;  2RIN A;  4G8M A;  3MZ9 A;  3R6U A;  3FXR A;  1B3H A;  1UTH A;  3M3F A;  3WAF A;  1ANF A;  2HAU A;  4NF6 A;  3VFJ A;  3TEP A;  5F7V A;  4QSD A;  4H6D A;  3T96 B;  5CMM A;  2DE2 A;  1MG1 A;  3TFL A;  2VD3 A;  1Y3Q A;  2PYY A;  1USY H;  3TQL A;  1MQD A;  3QK6 A;  3K01 A;  5JK4 A;  2VGQ A;  3PPR A;  1O64 A;  1N3W A;  3VDF A;  4F18 A;  3Q28 A;  1UIV A;  3TOD A;  1WDN A;  4FEC A;  2RC7 A;  1A8F A;  1YPN A;  2Y84 A;  1JNF A;  3PUY E;  3PUZ E;  1XHY A;  1POY 1;  4OWD A;  3QUF A;  1WOD A;  1R9Q A;  1ZBM A;  3HN0 A;  4IGT A;  3PU5 A;  3H6U A;  3FGS A;  3MUQ A;  1I6A A;  3C4M A;  3PV0 E;  3FVN A;  2D3I A;  5F1Q A;  1PB9 A;  5CBS A;  3K0V A;  1MRP A;  3IL1 B;  3O6H A;  1Q1K A;  3OEL A;  2QJE A;  1MXW A;  1DTG A;  4BDR A;  5EYF A;  4GRK A;  2X7Q A;  4F1V A;  1RKM A;  1P1Q A;  2XXQ A;  2OBG A;  3A3U A;  1B9J A;  3PD9 A;  3UOR A;  1URS A;  4FE8 A;  4HTG A;  1B52 A;  1IXG A;  1MM7 A;  3MVX A;  1PB7 A;  1JQF A;  1S7Y A;  5HPQ A;  3FV2 A;  4F3B A;  5H8F B;  5I56 B;  4IO7 A;  2V3U A;  2QMW A;  3IOR A;  1BKA A;  2LAO A;  3VLW A;  4YKI A;  1AIV A;  2DWA A;  4G68 C;  2PMS A;  1DPP A;  2F78 A;  4YKK A;  3A09 A;  4U4X A;  1POT A;  1N7W A;  2ZNT A;  2ZNU A;  3CI8 A;  3EQ1 A;  2I48 A;  1SW5 A;  2PX1 A;  1URD A;  1A8E A;  5CMC A;  1BP5 A;  5I2K A;  3IJX B;  3RT8 A;  1B5I A;  2Z8E A;  4U23 A;  1BTJ A;  4H1X A;  3USD A;  1FQF A;  2H9B A;  3H06 B;  4R72 A;  1II5 A;  4EDP A;  3D4C A;  1GR2 A;  1MXZ A;  4OTE A;  4RNS A;  3TTR A;  3U93 A;  3N5L A;  4Z0I A;  1PEB A;  4DXB A;  4XXU A;  3N94 A;  4RPO A;  1MQG A;  1OQH A;  3Q27 A;  3HST A;  2XXX A;  4JXI A;  3KSJ A;  1UTB A;  4BLA A;  1B3F A;  2ONR A;  3VV5 A;  1XS5 A;  2VHA A;  1OQG A;  2UVG A;  2XD3 A;  3MZ1 A;  4ESW A;  1US5 A;  5A5X A;  5ISU A;  4IO5 A;  2NUV A;  3VVE A;  4X1D A;  1GGG A;  1B6H A;  4MLQ A;  1NL5 A;  3SEW A;  2X7P A;  4ELQ A;  3MVY A;  2CZL A;  3C32 A;  1SI0 A;  4JSD A;  4ELR A;  4OVJ A;  4LZ8 A;  2AL4 A;  1MY1 A;  1KWH A;  3RLF E;  2OK2 A;  2H99 A;  1LFI A;  3SEX A;  4BDO A;  4LQ2 A;  5H8Q B;  4ESX A;  3VXC A;  3RUM A;  1JW1 A;  3L6G A;  3QUJ A;  2QL3 A;  2R71 A;  3B6Q A;  2W7Y A;  4O3A A;  3KZG A;  4H5G A;  1LCT A;  2HQ0 A;  5CBR A;  1PBP A;  1NNP A;  4WED A;  4GXS B;  4NTL A;  3OO6 A;  5JTY B;  3H6V A;  1I69 A;  3K00 A;  3O28 A;  3KSX A;  1NNK A;  3C9H A;  4G2Z A;  1R9L A;  1QUJ A;  4PFY A;  4JB7 A;  3ZS6 A;  5KCJ B;  4NWD A;  3EHT A;  1IXC A;  1A7L A;  3RNN A;  2I3W A;  5B70 A;  4EF2 A;  3R7X A;  2WKY A;  4MF3 A;  3DP8 A;  5H8H A;  2Y7I A;  1B3E A;  4YB7 A;  1PBQ A;  4XTC Q;  1DSN A;  4XKN A;  4ZDM A;  1B40 A;  4GXA A;  5TPA B;  5EHM A;  4KYE A;  4XKQ A;  4P0I A;  2B3F A;  5TP9 B;  4F29 A;  3O97 A;  1US4 A;  3K6W A;  3MPK A;  4FOR A;  5FHN A;  4ZEC A;  4WKM A;  4OEU A;  3OSQ A;  4TLL B;  4PE5 B;  4LAT A;  1LCF A;  1GVC A;  2I4C A;  4TQU Q;  5I58 B;  3KN7 A;  5DYH A;  3THI A;  3CRB A;  1P1U A;  2AL5 A;  4EF1 A;  4EXL A;  2YLN A;  3PPN A;  4RJZ A;  4FED A;  4LON B;  3BKI B;  2Z23 A;  1NFT A;  3I3V A;  5ICT A;  4ONY A;  4F3G A;  2GH9 A;  3ILU B;  2OWS A;  4KHZ E;  3RTF B;  3TZA A;  4DCX A;  1D4N A;  3PUV E;  3H03 A;  1JVY A;  3LC8 A;  4OMB A;  3V5A A;  3E4R A;  1JEU A;  3WAE A;  3S9E A;  3LSL A;  2QSX A;  3ZKK A;  3V83 A;  1URG A;  2F8D A;  3B6W A;  4R74 A;  2XXW A;  1WVJ A;  3DLN A;  3MWB A;  4IY5 A;  4LZ7 A;  5H8N A;  4NE4 A;  4X48 A;  1OLA A;  1EH3 A;  5J1D A;  4M4G A;  1A40 A;  3RPW A;  1Y3P A;  1SYH A;  3E3K A;  5DEX A;  4R6K A;  1XVX A;  1HSL A;  4GF8 A;  4FAT A;  4GLI A;  5KDT B;  3OO9 A;  4PFW A;  5IAI A;  1B1X A;  3KJT A;  4POW A;  3SET A;  1Y3N A;  1B7Z A;  1F9B A;  4I62 A;  4GL8 A;  4BDM A;  4LQ5 A;  1UIU A;  3ZSF A;  3RTW B;  4F22 A;  3HHG A;  1JET A;  1N0T A;  2G29 A;  2PVU A;  4R2B A;  2RCA A;  4IB2 A;  2DS9 A;  3IOW A;  3MBP A;  4H8I A;  3MP6 A;  3R26 A;  4F39 A;  3IAZ A;  3MQ9 A;  1P1O A;  3OO7 A;  3H4Z A;  3PMX A;  1CE2 A;  3SER A;  1VFD A;  1GV8 A;  3IB2 A;  3SEU A;  2F97 A;  4M1V A;  1FQC A;  2XX8 A;  3CG3 A;  1QUK A;  1XVY A;  1P1W A;  3T9H B;  4NF4 B;  2DWJ A;  1YCJ A;  2V3T A;  1LAF E;  2F7A A;  4FEB A;  2ZYN A;  3N6U A;  4U1O A;  4HS7 A;  2UVI A;  4XKP A;  3TTK A;  3E9X A;  3PMV A;  4G8H A;  1IIW A;  2XXP A;  4ZE8 A;  2O7I A;  1NMU A;  2ZXT A;  3ECR A;  2O51 A;  1LB9 A;  4JBZ A;  2ZYM A;  4ECF A;  1SVX B;  3TEL A;  3C31 A;  2B3B A;  5AA2 D;  4KCD A;  4F1U A;  1Y1M A;  2ABH A;  4PQJ A;  1CB6 A;  3U1O A;  1O7T A;  4KYD A;  2QPQ A;  5KZT A;  3HV1 A;  2G93 A;  2QRY A;  4F2Q A;  5JEI A;  4I8C A;  4GWO A;  4P0G A;  3GLB A;  3K02 A;  1ATG A;  2V25 A;  2ZYK A;  5I59 B;  3CSG A;  1JVX A;  1DOT A;  5FTH A;  1ELJ A;  2HAV A;  5I2N B;  4QFK A;  3C34 A;  3VXB A;  3TKD A;  1MY4 A;  1SQY A;  4ISU A;  1FQA A;  2NOO A;  3FVK A;  3RQT A;  1N04 A;  2DOJ A;  4BDL A;  2AYS A;  3KOT A;  1MY3 A;  2F7B A;  3PUW E;  4R73 A;  3G7W A;  2O7U A;  4F1Y A;  4OHN A;  4YU0 A;  4IGR A;  3OXN A;  2Y7R A;  1EZP A;  1J1N A;  4N07 A;  1UQW A;  1B05 A;  2H25 A;  3G3F A;  4KI0 E;  4DZ1 A;  4EXK A;  3VVD A;  3MPL A;  1NH7 A;  3VLV A;  4NED A;  3JYR A;  1OVB A;  1B3L A;  2I0C A;  3FUZ A;  2Q88 A;  1NNF A;  3FXU A;  2DWI A;  3S9N C;  1BIY A;  3FVO A;  4QRZ A;  4LZ5 A;  1B32 A;  4QFO A;  5DVI A;  2A5T A;  2Y7P A;  4IO6 A;  4KFQ A;  2DYX A;  3UA8 A;  4X9T A;  1VE4 A;  2FA7 A;  1D9Y A;  4C1T A;  1Z7N E;  2UVJ A;  2OCU A;  1P1N A;  4F3P A;  3K1N A;  4OEV A;  3RY3 A;  5IKB A;  3EHS A;  3GBA A;  2F34 A;  2O1M A;  1FTM A;  3LBS A;  4YZZ A;  2GFE A;  4DE8 A;  2F5X A;  4R6H A;  2DSF A;  4QFP A;  5CI5 A;  4DXC A;  1B4Z A;  4JSO A;  4U4S A;  2E0S A;  3ZKL A;  4GIZ A;  4G4P A;  1FTL A;  1QJM A;  4YMA A;  5L9O A;  4N6P A;  4OES A;  4G68 B;  1OLC A; 
#chains in the Genus database with same CATH topology
 3V8X B;  4MHF A;  2V84 A;  4GWS A;  1DPE A;  1FPJ A;  1YTV A;  3QYT A;  5IZZ A;  3RT6 B;  1NH8 A;  3QAX A;  3CVG A;  5L9M A;  3PMW A;  3S2V A;  1QW0 A;  3KJ7 A;  3LUY A;  1B5J A;  3DM0 A;  3UIF A;  5AA4 A;  4P9K A;  1FPG A;  3P7I A;  2XWV A;  1FQD A;  3KN3 A;  3DP6 A;  4LUB A;  4O3B A;  5HBC A;  1M5B A;  3CFX A;  4MNI A;  4PCD A;  2UVH A;  1MXU A;  2O84 X;  1MPC A;  4BDN A;  2XWI A;  2DQV A;  1B51 A;  2XX7 A;  4Q30 B;  2IEE A;  3TTM A;  2OWT A;  1RYO A;  1M5E A;  4RYA A;  4TOZ A;  4TLM B;  1IMD A;  4G61 A;  1FQB A;  4JWY A;  3TPA A;  1TT1 A;  1LAG E;  2NXO A;  2O6A A;  2REG A;  1ZU0 A;  2FNC A;  4DXU A;  2DVC A;  5AA2 B;  1MM6 A;  4P8B A;  3HFU A;  1ZTY A;  1MY2 A;  4QFN A;  4YB6 A;  1EZO A;  2REJ A;  3K1P A;  3UK4 A;  1BK4 A;  1QUI A;  1UTH B;  4ZS9 A;  2Z22 A;  4NF6 B;  3ODB A;  4MFI A;  3O2A A;  2Y7K A;  4KPT A;  1SYI A;  3O9P A;  4N8Y A;  5AA3 A;  1LFG A;  1EZ9 A;  3H7M A;  2Q2C A;  2I6E A;  1MY0 A;  2XX9 A;  1SW2 A;  3NOH A;  3TCH A;  1IXI A;  3IK6 B;  4IR8 A;  4OVQ A;  1Y1Z A;  4ZZE A;  1IZ1 A;  4GFR A;  3HCQ A;  4MCO A;  3Q26 A;  3T93 B;  4EQB A;  3T66 A;  3V89 B;  1LBW A;  2XD2 A;  1L5T A;  1T0K A;  1S50 A;  1A55 A;  4ELO A;  4I9D A;  4OET A;  3PUX E;  1LBV A;  3TTN A;  1H3D A;  2Q2A A;  3IX1 A;  1B5H A;  4OFO A;  5EQ7 A;  1OMP A;  4H46 A;  1RYX A;  3KN8 A;  2MKZ A;  1DK4 A;  1B46 A;  3H6T A;  4PE3 A;  2XHD A;  3FJG A;  2ONK E;  4LP2 B;  3IB0 A;  4L17 A;  4YKP A;  1KA1 A;  4JWX A;  1AMF A;  1OVT A;  4U1Z A;  1DTZ A;  2P1S A;  3MVZ A;  4NAP A;  5L9S A;  3I6V A;  3U65 A;  5DVF A;  1RDY A;  5IZ3 B;  4GD5 A;  3F11 A;  1H44 A;  2XXK A;  5H8S A;  4NF8 B;  4KD5 A;  1FJ6 A;  3SEV A;  3PPQ A;  5BUU A;  3T9X B;  1B7H A;  2OJT A;  2Q9T A;  5FHM A;  2F6G A;  3QSL A;  2DE3 A;  3D1R A;  5IGA A;  4OVT A;  3I5O A;  3HHF A;  4MH5 A;  3TCG A;  1DMB A;  3VE1 B;  4ZEF A;  4ZEK A;  3G3K A;  1ZKB A;  1JW5 A;  3IFC A;  3G3J A;  2WEF A;  1YXI A;  5ITO A;  1EYK A;  2BJJ X;  4NWC A;  4RY1 A;  5CM6 A;  2UYF A;  1USY E;  1VDW A;  4IO4 A;  4PET A;  1NV5 A;  5H8F A;  5I56 A;  3KG2 A;  2D5W A;  3GBB A;  2YPN A;  4U22 A;  4PBQ A;  3IB1 A;  5ET7 A;  1BLF A;  1D9V A;  4PC9 A;  1JW4 A;  4LVQ A;  2Z8D A;  4QHQ A;  3TAJ A;  4GQO A;  3UN6 A;  4POX A;  3O29 A;  4QF9 A;  3U8Q A;  2Y7W A;  4ND9 A;  4YAH X;  3W9W A;  1YYZ A;  3GZG A;  3MZB A;  1O63 A;  2ONS A;  3W9V A;  3IOT A;  4OFJ A;  2O68 A;  4RPN A;  4OVS A;  5I2K B;  4NN3 A;  1LEV A;  2ZYO A;  5EHS A;  3CFL A;  1ZLQ A;  2Q89 A;  2I4B A;  3U94 A;  4PDD A;  3FZV A;  1IMC A;  2HZK A;  4N8G A;  1QKB A;  3EHU A;  5LOM A;  4WEP A;  4NF5 B;  1VSO A;  3K6X A;  1HSJ A;  3W15 C;  3G3H A;  3KGC A;  4PDH A;  4DDD A;  4THI A;  2XXI A;  4H5F A;  2HXW A;  2VD2 A;  2UXA A;  2UYE A;  5LTC A;  1Q35 A;  1XOC A;  2V93 A;  4KR5 A;  2WX9 A;  1LAH E;  3FJ7 A;  1JEV A;  1TXF A;  2VPO A;  2XXT A;  1PC3 A;  4G77 A;  2B65 A;  2F6P A;  1LBB A;  2FYI A;  3G3I A;  1UTB B;  1MDQ A;  2ANJ A;  3IO4 A;  1N7X A;  2F36 A;  4RA1 A;  4P11 A;  4C1U A;  1Y4T A;  3KBR A;  1IQ7 A;  3HPI A;  5EYG A;  3U72 A;  3B6T A;  1MQI A;  2XXY A;  2XXV A;  2VOZ A;  4PFR A;  5ICQ A;  1ZJL A;  3FD3 A;  1FTJ A;  1MQH A;  4QFL A;  4OEN A;  3QIM A;  3M8U A;  3M3K A;  3LSX A;  1YZ0 A;  1NNT A;  4XKR A;  4FJP A;  4KCC A;  4KQP A;  5H8Q A;  4WXJ A;  2V3Q A;  1FBF A;  3PPP A;  5L8D A;  2GQ1 A;  4JDF A;  2RCB A;  4K3F A;  1MS7 A;  1D3K A;  3OD7 A;  3BFT A;  3OOA A;  1H43 A;  4HE0 A;  2THI A;  5DW8 A;  4F31 B;  1IEJ A;  3B8B A;  1PB8 A;  1ZMG A;  3T22 A;  3H6W A;  5JTY A;  1A99 A;  1FPB A;  3OEK A;  1IXH A;  2OZZ A;  4OQO A;  3LR1 A;  1MQJ A;  3Q25 A;  4H8J A;  2RC9 A;  3O6I A;  4PFU A;  1NV1 A;  5KCJ A;  3OEN A;  2D21 A;  3MVW A;  1R1N A;  1N84 A;  1A54 A;  1LST A;  5K2X A;  3EPE A;  1VR5 A;  4FIM A;  1Q9D A;  4ZEI A;  3TDJ A;  3O6G A;  3O66 A;  5TU0 A;  5H8H B;  2Y5K A;  4Q0C A;  4PFB A;  5TPA A;  5CMK A;  1EU8 A;  4H67 A;  5TP9 A;  2H98 A;  4UAC A;  3C36 A;  2DE4 A;  1FBH A;  1K9Z A;  3OEM A;  4H45 A;  4U21 A;  2DP8 A;  3QMF A;  3SES A;  3G3G A;  1NV0 A;  5I58 A;  4IO2 A;  5I84 A;  1Y4C A;  4N15 A;  4YIC A;  1FSA A;  5ESY A;  2HHM A;  4NF8 A;  4OFL A;  3FV1 A;  3UP9 A;  1SW4 A;  1SW1 A;  2QS4 A;  1M5C A;  3LSW A;  4I1D A;  3DEL B;  2ESN A;  1MXY A;  3CHG A;  1INP A;  1S9T A;  2R8T A;  1NV3 A;  4P47 A;  4ZE9 A;  4F19 A;  1OIB A;  3TCF A;  1NV4 A;  3PD8 A;  1FTO A;  3QXM A;  2O1L A;  2V4C A;  5FBP A;  2F3D A;  4F3S A;  1M5F A;  4PFT A;  2GHA A;  1B7U A;  1NUY A;  3CG1 A;  2WYK A;  5CRY A;  3OO8 A;  3KBZ A;  4N91 A;  1B58 A;  4YMB A;  1R6Z A;  4EQ7 A;  2B4M A;  2XXH A;  1ZIU A;  4Z7E A;  2PFZ A;  3C35 A;  4YB5 A;  4OXV A;  1AOV A;  4P56 A;  1B0L A;  5EQA A;  4KYS A;  1FPD A;  3CSB A;  4O3C A;  5H8N B;  3PPO A;  5DVJ A;  5M2V A;  2P0S A;  4HW8 A;  4N13 A;  4MNC A;  5DT6 A;  3M3L A;  4RK9 A;  4H65 A;  2QVU A;  1LGB C;  5DEX B;  5KDT A;  3KEI A;  4YKJ A;  2I3V A;  3RPL B;  1EYJ A;  4PF8 A;  3KC1 A;  4ELP A;  4AS4 A;  4FAJ A;  2XXR A;  4X8R A;  2M8C A;  1NV6 A;  4PP0 A;  5CC2 A;  4OYV A;  4NF5 A;  3S9L C;  3BBR A;  4PGN A;  3FIR A;  1IME A;  2Z8F A;  3PGF A;  3MJN A;  3K1M A;  3S4U A;  3S9M C;  1NKX A;  1MXX A;  3MAM A;  3N6T A;  1IMA A;  4MLV A;  1FTA A;  2E1S A;  3MC2 A;  3OSR A;  4Q5T A;  5I57 B;  2HEU A;  4R9F A;  1AL3 A;  4X04 A;  3KC0 A;  2R6G E;  4GOT A;  3DP4 A;  4XIG Q;  2YJP A;  5AA1 A;  1FQE A;  3FBP A;  4JVI A;  2HFB A;  1AH5 A;  2CMO A;  4XFE A;  3EF7 A;  4G8N A;  3SZP A;  1LFH A;  5CMB A;  4MMP A;  5AE4 A;  1TFA A;  3BIG A;  3TYH A;  1Z7M E;  3AXF A;  3IJO B;  1SD3 A;  4NF4 A;  4PAI A;  4JVC A;  5FTI A;  2A5S A;  3TMG A;  1LBC A;  4KXP A;  4XF5 A;  2WBD A;  4OZ9 A;  3MW0 A;  3K4U A;  2FIX A;  3BFU A;  2QS3 A;  4DCY A;  2RC8 A;  1B1H A;  1FW0 A;  1N3X A;  2AIX A;  3FAS A;  4QSE A;  2NWJ A;  4E0W A;  1TFD A;  1B0H A;  3SDF A;  4BDQ A;  1NV7 A;  3EN3 A;  2CZI A;  3TUS A;  1LAX A;  2CEY A;  4GL0 A;  4AS5 A;  4N6K A;  2DVZ A;  3JZJ A;  2DXR A;  3CFZ A;  1FCK A;  4XEQ A;  2FIE A;  3MST A;  3A29 A;  3ILT B;  3H3G A;  2PBW A;  2Q8J A;  2DWH A;  2QMX A;  4ZZA A;  5ELV A;  4U2R A;  1LB8 A;  1MH3 A;  4IY6 A;  2DXY A;  3A3C A;  3C33 A;  2X26 A;  2P2A A;  1MDP 1;  2F7C A;  4R9G A;  2RKM A;  1H45 A;  4NMY A;  1FBD A;  5I59 A;  2GRV A;  2NVU B;  1MPD A;  1IUD A;  3MP8 A;  1B3G A;  5I2N A;  1K9Y A;  1VFE A;  4N6D A;  3HO7 A;  4R75 A;  1MH4 A;  1H76 A;  1P99 A;  3Q29 A;  4ZED A;  2I49 A;  2KR0 A;  1Y9U A;  3FXQ A;  2JJK A;  5EYH A;  4F2O A;  3IR1 A;  2Q74 A;  4R6Y A;  1QKA A;  3GXA A;  3T9V A;  4AB5 A;  3FAT A;  3L6H A;  3K6U A;  5DTB A;  3FJM A;  4GVO A;  1QVS A;  2HZL A;  3FXB A;  3K2D A;  1B4H A;  2HXR A;  3B7D A;  4RXL A;  3T9U A;  1MPB A;  2O69 A;  2QS2 A;  2ALU A;  3IOV A;  5B7D A;  1NUX A;  3SKP A;  4LA9 A;  4E0X A;  3IO6 A;  1FPI A;  5BWJ A;  2P3V A;  2ZNS A;  5I7I A;  3FVG A;  4AQ4 A;  1NUZ A;  1XT8 A;  4OER A;  3K6V A;  5J16 A;  2H4I A;  3MP1 A;  5K2Y A;  2ZZV A;  3EKI A;  4R2F A;  2Q8M A;  2VP1 A;  4I40 A;  3D4G A;  4HE1 A;  4Q8R A;  4I3Y A;  2A5T B;  1LLS A;  4DIG A;  1Y20 A;  1FTK A;  3RN8 A;  2R9J A;  3SEY A;  3E13 X;  1FRP A;  1M5D A;  2KLF A;  4HCW A;  2GHB A;  2B4L A;  2HCA A;  1FPF A;  4MBP A;  5A5L A;  2IA4 A;  4MIJ A;  1GTK A;  2FVZ A;  1N76 A;  4OVR A;  3N26 A;  4EUO A;  3TQW A;  4AB6 A;  3ONM A;  4QSC A;  2PT1 A;  5T3J A;  3IOU A;  5ITP A;  1I6Q A;  4C0R A;  1HSE A;  5ET6 A;  1YAE A;  3U92 A;  4G68 A;  1SDX A;  3KOS A;  1PDA A;  4DLD A;  1IIT A;  1QUL A;  4GBW A;  1I6B A;  3VVF A;  2H5Y A;  2OLB A;  2PT2 A;  2XXU A;  4UA8 A;  2PCR A;  3CR9 A;  3OMB A;  1LBY A;  5LDZ A;  1AWB A;  5I57 A;  1NI9 A;  4EQ9 A;  1TWY A;  1KA0 A;  2QS1 A;  2F35 A;  4NGU A;  1B2H A;  4H0W A;  5EQ8 A;  1FBC A;  1MXV A;  3LSF B;  3VLU A;  3RGY A;  4IO3 A;  5A5X B;  5HM4 B;  5AA4 B;  3GYY A;  2I0B A;  4QXD A;  2RF1 A;  3UGW A;  1SI1 A;  4HCY A;  4O8M A;  4JWO A;  1XC1 A;  2ZMB A;  3CIJ A;  4PFI A;  2I58 A;  3JV9 A;  1SBP A;  4ZEB A;  4NX1 A;  3TTL A;  4X1B A;  3KFM A;  4RK2 A;  5AA2 A;  5FHO A;  2RIN A;  4G8M A;  3MZ9 A;  3R6U A;  3FXR A;  1B3H A;  1UTH A;  3M3F A;  3WAF A;  1ANF A;  2HAU A;  4NF6 A;  3VFJ A;  3TEP A;  5F7V A;  4QSD A;  4H6D A;  3T96 B;  5CMM A;  2DE2 A;  1MG1 A;  3TFL A;  4QBA A;  2CZH A;  2VD3 A;  1Y3Q A;  2PYY A;  1USY H;  3TQL A;  4GWX A;  1MQD A;  3QK6 A;  3K01 A;  5JK4 A;  2VGQ A;  3PPR A;  1O64 A;  1N3W A;  3VDF A;  4F18 A;  3Q28 A;  4MNP A;  1UIV A;  3TOD A;  1WDN A;  4FEC A;  2RC7 A;  1A8F A;  1YPN A;  2Y84 A;  1JNF A;  3PUY E;  3PUZ E;  2DDK A;  1XHY A;  1POY 1;  4OWD A;  3QUF A;  1WOD A;  1R9Q A;  4PBH A;  1DBZ A;  1ZBM A;  3HN0 A;  4IGT A;  3PU5 A;  4MAG A;  3H6U A;  3FGS A;  3MUQ A;  1I6A A;  3C4M A;  3PV0 E;  3FVN A;  2D3I A;  5F1Q A;  1PB9 A;  5IZ3 A;  1IMB A;  5CBS A;  3K0V A;  1MRP A;  3IL1 B;  3O6H A;  1Q1K A;  3OEL A;  2QJE A;  1MXW A;  1DTG A;  4BDR A;  4NHB A;  5EYF A;  4GRK A;  2X7Q A;  4GWZ A;  4F1V A;  1RKM A;  1LBZ A;  1P1Q A;  2XXQ A;  2OBG A;  3A3U A;  1B9J A;  3PD9 A;  3UOR A;  1URS A;  4FE8 A;  4HTG A;  1B52 A;  5ET8 A;  2BJI A;  2VPN A;  1IXG A;  1MM7 A;  2CEX A;  3MVX A;  1PB7 A;  1JQF A;  1S7Y A;  5HPQ A;  3FV2 A;  4F3B A;  2P3N A;  5H8F B;  4NG7 A;  5I56 B;  4IO7 A;  2V3U A;  2QMW A;  3IOR A;  1BKA A;  2LAO A;  3VLW A;  4YKI A;  4OVP A;  2OX3 A;  1AIV A;  2DWA A;  4G68 C;  4O94 A;  3IFA A;  2PMS A;  4N17 A;  1DPP A;  2F78 A;  4YKK A;  3A09 A;  4U4X A;  1POT A;  4NF0 A;  1N7W A;  2ZNT A;  2ZNU A;  3CI8 A;  3EQ1 A;  2I48 A;  5I3S A;  1SW5 A;  2PX1 A;  1URD A;  1A8E A;  5CMC A;  2CZK A;  1BP5 A;  5I2K A;  3IJX B;  1G0I A;  3RT8 A;  1B5I A;  2Z8E A;  4U23 A;  1BTJ A;  4GWY A;  4H1X A;  1KZ8 A;  3USD A;  1FQF A;  2H9B A;  3E79 A;  3H06 B;  4R72 A;  1II5 A;  4EDP A;  3D4C A;  1GR2 A;  1NUW A;  1MXZ A;  4OTE A;  4RNS A;  3TTR A;  3U93 A;  3N5L A;  1FPK A;  4Z0I A;  1PEB A;  4DXB A;  4XXU A;  1QGX A;  1FPE A;  3N94 A;  4RPO A;  1MQG A;  1OQH A;  3Q27 A;  3HST A;  1G0H A;  2XXX A;  4JXI A;  3KSJ A;  1UTB A;  4BLA A;  1B3F A;  2ONR A;  3VV5 A;  1XS5 A;  2VHA A;  1OQG A;  2UVG A;  2XD3 A;  3MZ1 A;  4ESW A;  1US5 A;  5A5X A;  5ISU A;  2XWK A;  4IO5 A;  2NUV A;  3VVE A;  4GWW A;  4X1D A;  1GGG A;  1B6H A;  4MLQ A;  2WBB A;  1NL5 A;  3SEW A;  2X7P A;  1FJ9 A;  4N81 A;  4ELQ A;  3MVY A;  2CZL A;  3C32 A;  1SI0 A;  4JSD A;  4ELR A;  4OVJ A;  4LZ8 A;  1MY1 A;  2AL4 A;  4O7I A;  1KWH A;  3RLF E;  2OK2 A;  1FPL A;  2H99 A;  1LFI A;  3SEX A;  4BDO A;  3PTY A;  4LQ2 A;  5H8Q B;  4ESX A;  3VXC A;  3RUM A;  1JW1 A;  3L6G A;  3QUJ A;  2QL3 A;  2R71 A;  3B6Q A;  2W7Y A;  4O3A A;  3KZG A;  4H5G A;  4P1L A;  1LCT A;  2HQ0 A;  5CBR A;  1PBP A;  1NNP A;  4WED A;  4GXS B;  4NTL A;  4PAK A;  3OO6 A;  5JTY B;  2HPG A;  3H6V A;  1I69 A;  3K00 A;  3O28 A;  3KSX A;  1NNK A;  3C9H A;  4G2Z A;  4GX6 A;  1R9L A;  1QUJ A;  4PFY A;  4P3L A;  4JB7 A;  3ZS6 A;  5KCJ B;  4NWD A;  3EHT A;  1IXC A;  4HXV A;  4DI3 D;  1A7L A;  3RNN A;  2I3W A;  5B70 A;  4EF2 A;  3R7X A;  2WKY A;  4MF3 A;  3DP8 A;  5H8H A;  2Y7I A;  1B3E A;  4YB7 A;  1PBQ A;  4XTC Q;  1DSN A;  4XKN A;  4ZDM A;  1B40 A;  4GXA A;  5TPA B;  5EHM A;  4KYE A;  4XKQ A;  4P0I A;  2B3F A;  5TP9 B;  4F29 A;  3O97 A;  1US4 A;  3K6W A;  2ZZW A;  3MPK A;  4FOR A;  5FHN A;  4ZEC A;  4WKM A;  3LV0 A;  4OEU A;  3OSQ A;  4TLL B;  4PE5 B;  5I5P A;  4LAT A;  1LCF A;  1GVC A;  2I4C A;  4TQU Q;  5IM2 A;  5I58 B;  3KN7 A;  5DYH A;  3THI A;  3CRB A;  1P1U A;  2AL5 A;  4EF1 A;  1FBG A;  4EXL A;  4N4U A;  2YLN A;  3PPN A;  4RJZ A;  4FED A;  4LON B;  3BKI B;  2Z23 A;  4MX6 A;  1NFT A;  3I3V A;  5ICT A;  4LN5 A;  4ONY A;  4F3G A;  4GWU A;  2GH9 A;  3ILU B;  2F3B A;  2OWS A;  2QVV A;  4KHZ E;  3RTF B;  4MEV A;  3TZA A;  4DCX A;  1D4N A;  3PUV E;  3H03 A;  1JVY A;  3LC8 A;  4OMB A;  2OWZ A;  4GBV A;  3V5A A;  3E4R A;  1JEU A;  3WAE A;  3S9E A;  3LSL A;  2QSX A;  3ZKK A;  3V83 A;  1URG A;  2F8D A;  3B6W A;  4R74 A;  2XXW A;  1WVJ A;  3DLN A;  5IZ1 A;  5EQ9 A;  4PF6 A;  3MWB A;  2FBP A;  4IY5 A;  4LZ7 A;  5H8N A;  1JP4 A;  4NE4 A;  4X48 A;  1OLA A;  1EH3 A;  5J1D A;  4M4G A;  3E78 A;  1DCU A;  1A40 A;  3RPW A;  4OAN A;  1Y3P A;  1SYH A;  3E3K A;  5DEX A;  4R6K A;  2L5V A;  3RPL A;  1XVX A;  1HSL A;  4GF8 A;  4FAT A;  4GLI A;  5KDT B;  3OO9 A;  4PFW A;  5IAI A;  2FHY A;  1B1X A;  3KJT A;  4POW A;  3SET A;  1Y3N A;  1B7Z A;  1F9B A;  4I62 A;  4GL8 A;  4BDM A;  4LQ5 A;  1UIU A;  3ZSF A;  3RTW B;  3MYU A;  4F22 A;  3HHG A;  1JET A;  1N0T A;  2G29 A;  2PVU A;  4R2B A;  2RCA A;  4IB2 A;  2DS9 A;  3IOW A;  3MBP A;  4UAB A;  4H8I A;  3MP6 A;  3R26 A;  4F39 A;  3IAZ A;  3MQ9 A;  1P1O A;  3ISP A;  5F24 A;  3OO7 A;  3H4Z A;  4GX3 A;  3PMX A;  1CE2 A;  3SER A;  1VFD A;  1GV8 A;  3IB2 A;  3SEU A;  2F97 A;  1LBX A;  4M1V A;  1FQC A;  2XX8 A;  3CG3 A;  1QUK A;  1XVY A;  1P1W A;  3T9H B;  4NF4 B;  2DWJ A;  1YCJ A;  2V3T A;  1LAF E;  2F7A A;  4FEB A;  2ZYN A;  3N6U A;  4U1O A;  4HS7 A;  2UVI A;  1IMF A;  2Y5L A;  4XKP A;  3TTK A;  3E9X A;  3PMV A;  4JVD A;  4G8H A;  1IIW A;  2XXP A;  4ZE8 A;  2QFL A;  2O7I A;  1NMU A;  3B50 A;  2ZXT A;  2QVR A;  3ECR A;  2O51 A;  1LB9 A;  4JBZ A;  1SPI A;  2ZYM A;  4ECF A;  1SVX B;  3TEL A;  3C31 A;  2B3B A;  5AA2 D;  4KCD A;  3LUZ A;  4F1U A;  1Y1M A;  1EYI A;  2ABH A;  4PQJ A;  2VT5 A;  3ROJ A;  1D9Q A;  1CB6 A;  3U1O A;  1RDZ A;  2KQZ A;  1O7T A;  4PAF A;  4KYD A;  2QPQ A;  5KZT A;  3HV1 A;  2G93 A;  4PGP A;  2QRY A;  5ET5 A;  4F2Q A;  5JEI A;  4I8C A;  4GWO A;  4P0G A;  3GLB A;  3K02 A;  1ATG A;  2V25 A;  2ZYK A;  1FBP A;  4NQ8 A;  5I59 B;  3CSG A;  1JVX A;  1DOT A;  4O7M A;  2ZZX A;  1ELJ A;  5FTH A;  2HAV A;  5I2N B;  4QFK A;  3C34 A;  4I3E A;  3VXB A;  2PFY A;  3TKD A;  1MY4 A;  1SQY A;  4ISU A;  1FQA A;  2NOO A;  3FVK A;  3RQT A;  1N04 A;  2DOJ A;  4BDL A;  4HE2 A;  2AYS A;  3KOT A;  1MY3 A;  2F7B A;  3PUW E;  4R73 A;  3G7W A;  2O7U A;  4F1Y A;  4OHN A;  4YU0 A;  4IGR A;  3OXN A;  2Y7R A;  1EZP A;  1J1N A;  4N07 A;  1UQW A;  1B05 A;  2H25 A;  3G3F A;  4KI0 E;  4DZ1 A;  4EXK A;  3VVD A;  1NV2 A;  3MPL A;  1NH7 A;  3VLV A;  4NED A;  3JYR A;  1OVB A;  1B3L A;  2I0C A;  2WYP A;  3FUZ A;  2Q88 A;  3T0J A;  4FBP A;  1NNF A;  4GX4 A;  3FXU A;  2DWI A;  2XA5 A;  3S9N C;  1BIY A;  1FBE A;  4DI4 B;  3FVO A;  4QRZ A;  3RYD A;  1RDX A;  3T1B A;  4LZ5 A;  1B32 A;  1CNQ A;  4QFO A;  5DVI A;  2XWO A;  2A5T A;  2Y7P A;  4OA4 A;  1XI6 A;  4IO6 A;  4KFQ A;  2DYX A;  4MJO A;  3UA8 A;  4X9T A;  1VE4 A;  2FA7 A;  1D9Y A;  4C1T A;  4PTK A;  1Z7N E;  2UVJ A;  2OCU A;  3BIH A;  1P1N A;  4F3P A;  3K1N A;  4OEV A;  3RY3 A;  5IKB A;  3EHS A;  3GBA A;  2F34 A;  2O1M A;  1FTM A;  3LBS A;  4YZZ A;  2GFE A;  4DE8 A;  2F5X A;  4R6H A;  2DSF A;  4QFP A;  5CI5 A;  4DXC A;  1B4Z A;  4JSO A;  4U4S A;  2E0S A;  3ZKL A;  4GIZ A;  4P1E A;  4G4P A;  1FTL A;  1QJM A;  4YMA A;  5L9O A;  4N6P A;  4OES A;  4G68 B;  1OLC A; 
#chains in the Genus database with same CATH homology
 3V8X B;  2V84 A;  1DPE A;  1YTV A;  3QYT A;  3RT6 B;  1NH8 A;  3QAX A;  3CVG A;  5L9M A;  3PMW A;  3S2V A;  1QW0 A;  3KJ7 A;  3LUY A;  1B5J A;  3DM0 A;  3UIF A;  5AA4 A;  3P7I A;  1FQD A;  3KN3 A;  3DP6 A;  4LUB A;  4O3B A;  5HBC A;  1M5B A;  3CFX A;  2UVH A;  1MXU A;  2O84 X;  1MPC A;  4BDN A;  2DQV A;  1B51 A;  2XX7 A;  4Q30 B;  2IEE A;  3TTM A;  2OWT A;  1RYO A;  1M5E A;  4RYA A;  4TOZ A;  4TLM B;  1FQB A;  4JWY A;  3TPA A;  1TT1 A;  1LAG E;  2NXO A;  2O6A A;  2REG A;  1ZU0 A;  2FNC A;  4DXU A;  2DVC A;  5AA2 B;  1MM6 A;  1ZTY A;  1MY2 A;  4QFN A;  4YB6 A;  1EZO A;  2REJ A;  3K1P A;  3UK4 A;  1QUI A;  1UTH B;  4ZS9 A;  2Z22 A;  4NF6 B;  3ODB A;  4MFI A;  3O2A A;  2Y7K A;  4KPT A;  1SYI A;  3O9P A;  5AA3 A;  1LFG A;  1EZ9 A;  3H7M A;  2Q2C A;  2I6E A;  1MY0 A;  2XX9 A;  1SW2 A;  3TCH A;  1IXI A;  3IK6 B;  1Y1Z A;  4ZZE A;  1IZ1 A;  4GFR A;  3HCQ A;  3Q26 A;  3T93 B;  4EQB A;  3T66 A;  3V89 B;  2XD2 A;  1L5T A;  1T0K A;  1S50 A;  1A55 A;  4ELO A;  4I9D A;  4OET A;  3PUX E;  3TTN A;  1H3D A;  2Q2A A;  3IX1 A;  1B5H A;  4OFO A;  1OMP A;  1RYX A;  3KN8 A;  1B46 A;  3H6T A;  2XHD A;  3FJG A;  2ONK E;  4LP2 B;  3IB0 A;  4L17 A;  4YKP A;  4JWX A;  1AMF A;  1OVT A;  4U1Z A;  1DTZ A;  2P1S A;  3MVZ A;  5L9S A;  3I6V A;  5DVF A;  4GD5 A;  3F11 A;  1H44 A;  5H8S A;  4NF8 B;  4KD5 A;  3SEV A;  3PPQ A;  5BUU A;  3T9X B;  1B7H A;  2OJT A;  2Q9T A;  5FHM A;  2F6G A;  3QSL A;  2DE3 A;  3I5O A;  3HHF A;  4MH5 A;  3TCG A;  1DMB A;  3VE1 B;  4ZEF A;  4ZEK A;  3G3K A;  1ZKB A;  1JW5 A;  3G3J A;  5ITO A;  2BJJ X;  4NWC A;  4RY1 A;  5CM6 A;  2UYF A;  1USY E;  4IO4 A;  4PET A;  5H8F A;  5I56 A;  3KG2 A;  2D5W A;  3GBB A;  2YPN A;  4U22 A;  3IB1 A;  1BLF A;  1D9V A;  1JW4 A;  4LVQ A;  2Z8D A;  4QHQ A;  3TAJ A;  4GQO A;  3UN6 A;  4POX A;  3O29 A;  4QF9 A;  3U8Q A;  2Y7W A;  4ND9 A;  4YAH X;  3W9W A;  3GZG A;  3MZB A;  1O63 A;  2ONS A;  3W9V A;  3IOT A;  4OFJ A;  2O68 A;  4RPN A;  5I2K B;  2ZYO A;  5EHS A;  3CFL A;  1ZLQ A;  2Q89 A;  2I4B A;  3U94 A;  3FZV A;  2HZK A;  1QKB A;  3EHU A;  5LOM A;  4WEP A;  4NF5 B;  1VSO A;  3K6X A;  1HSJ A;  3W15 C;  3G3H A;  3KGC A;  4DDD A;  4THI A;  2XXI A;  4H5F A;  2HXW A;  2VD2 A;  2UXA A;  2UYE A;  1Q35 A;  1XOC A;  2V93 A;  4KR5 A;  1LAH E;  3FJ7 A;  1JEV A;  1TXF A;  2XXT A;  1PC3 A;  4G77 A;  2B65 A;  2F6P A;  1LBB A;  2FYI A;  3G3I A;  1UTB B;  1MDQ A;  2ANJ A;  3IO4 A;  1N7X A;  2F36 A;  4RA1 A;  4P11 A;  4C1U A;  1Y4T A;  3KBR A;  1IQ7 A;  3HPI A;  3U72 A;  3B6T A;  1MQI A;  2XXY A;  2XXV A;  2VOZ A;  5ICQ A;  1ZJL A;  3FD3 A;  1FTJ A;  1MQH A;  4QFL A;  4OEN A;  3QIM A;  3M8U A;  3M3K A;  3LSX A;  1NNT A;  4XKR A;  4FJP A;  4KCC A;  4KQP A;  5H8Q A;  4WXJ A;  2V3Q A;  3PPP A;  5L8D A;  4JDF A;  2RCB A;  4K3F A;  1MS7 A;  1D3K A;  3OD7 A;  3BFT A;  3OOA A;  1H43 A;  2THI A;  4F31 B;  1IEJ A;  1PB8 A;  1ZMG A;  3T22 A;  3H6W A;  5JTY A;  1A99 A;  3OEK A;  1IXH A;  2OZZ A;  4OQO A;  3LR1 A;  1MQJ A;  3Q25 A;  4H8J A;  2RC9 A;  3O6I A;  4PFU A;  5KCJ A;  3OEN A;  2D21 A;  3MVW A;  1R1N A;  1N84 A;  1A54 A;  1LST A;  5K2X A;  3EPE A;  1VR5 A;  4FIM A;  4ZEI A;  3TDJ A;  3O6G A;  3O66 A;  5TU0 A;  5H8H B;  4Q0C A;  5TPA A;  5CMK A;  1EU8 A;  4H67 A;  5TP9 A;  2H98 A;  4UAC A;  3C36 A;  2DE4 A;  3OEM A;  4U21 A;  2DP8 A;  3SES A;  3G3G A;  5I58 A;  4IO2 A;  5I84 A;  1Y4C A;  4YIC A;  4NF8 A;  4OFL A;  3FV1 A;  3UP9 A;  1SW4 A;  1SW1 A;  2QS4 A;  1M5C A;  3LSW A;  4I1D A;  3DEL B;  2ESN A;  1MXY A;  1S9T A;  4ZE9 A;  4F19 A;  1OIB A;  3TCF A;  3PD8 A;  1FTO A;  3QXM A;  2O1L A;  4F3S A;  1M5F A;  4PFT A;  2GHA A;  1B7U A;  3CG1 A;  5CRY A;  3OO8 A;  4YMB A;  1B58 A;  1R6Z A;  4EQ7 A;  2XXH A;  1ZIU A;  4Z7E A;  3C35 A;  4YB5 A;  4OXV A;  1AOV A;  1B0L A;  4KYS A;  3CSB A;  4O3C A;  5H8N B;  3PPO A;  5DVJ A;  5M2V A;  2P0S A;  4HW8 A;  4N13 A;  5DT6 A;  3M3L A;  4RK9 A;  4H65 A;  1LGB C;  5DEX B;  5KDT A;  3KEI A;  4YKJ A;  2I3V A;  4ELP A;  4FAJ A;  2XXR A;  2M8C A;  4PP0 A;  5CC2 A;  4OYV A;  4NF5 A;  3S9L C;  3BBR A;  3FIR A;  2Z8F A;  3PGF A;  3MJN A;  3K1M A;  3S4U A;  3S9M C;  1NKX A;  1MXX A;  3MAM A;  3N6T A;  4MLV A;  2E1S A;  3MC2 A;  3OSR A;  4Q5T A;  5I57 B;  2HEU A;  4R9F A;  1AL3 A;  2R6G E;  4GOT A;  3DP4 A;  4XIG Q;  2YJP A;  5AA1 A;  1FQE A;  2HFB A;  1AH5 A;  2CMO A;  3EF7 A;  4G8N A;  1LFH A;  5CMB A;  5AE4 A;  1TFA A;  3TYH A;  1Z7M E;  3AXF A;  3IJO B;  1SD3 A;  4NF4 A;  5FTI A;  2A5S A;  3TMG A;  1LBC A;  4OZ9 A;  3MW0 A;  3K4U A;  3BFU A;  2QS3 A;  4DCY A;  2RC8 A;  1B1H A;  1FW0 A;  1N3X A;  2AIX A;  3FAS A;  4QSE A;  2NWJ A;  4E0W A;  1TFD A;  1B0H A;  3SDF A;  4BDQ A;  3EN3 A;  3TUS A;  1LAX A;  4GL0 A;  2DVZ A;  3JZJ A;  2DXR A;  3CFZ A;  1FCK A;  3ILT B;  3H3G A;  2PBW A;  2Q8J A;  2DWH A;  2QMX A;  4ZZA A;  5ELV A;  4U2R A;  1LB8 A;  1MH3 A;  4IY6 A;  2DXY A;  3A3C A;  3C33 A;  2X26 A;  2P2A A;  1MDP 1;  2F7C A;  4R9G A;  2RKM A;  1H45 A;  4NMY A;  5I59 A;  2GRV A;  2NVU B;  1MPD A;  1IUD A;  3MP8 A;  1B3G A;  5I2N A;  1VFE A;  3HO7 A;  4R75 A;  1MH4 A;  1H76 A;  1P99 A;  3Q29 A;  4ZED A;  2I49 A;  1Y9U A;  3FXQ A;  4F2O A;  3IR1 A;  4R6Y A;  1QKA A;  3GXA A;  3T9V A;  4AB5 A;  3FAT A;  3L6H A;  3K6U A;  5DTB A;  3FJM A;  4GVO A;  1QVS A;  2HZL A;  3K2D A;  1B4H A;  3B7D A;  4RXL A;  3T9U A;  1MPB A;  2O69 A;  2QS2 A;  2ALU A;  3IOV A;  5B7D A;  3SKP A;  4LA9 A;  4E0X A;  3IO6 A;  5BWJ A;  2ZNS A;  3FVG A;  4AQ4 A;  1XT8 A;  4OER A;  3K6V A;  2H4I A;  3MP1 A;  5K2Y A;  4R2F A;  2VP1 A;  3D4G A;  4Q8R A;  2A5T B;  1LLS A;  4DIG A;  1Y20 A;  1FTK A;  3RN8 A;  2R9J A;  3SEY A;  3E13 X;  1M5D A;  2KLF A;  4HCW A;  2GHB A;  2HCA A;  4MBP A;  2IA4 A;  1GTK A;  1N76 A;  3N26 A;  4EUO A;  3TQW A;  4AB6 A;  3ONM A;  4QSC A;  2PT1 A;  3IOU A;  5ITP A;  1I6Q A;  4C0R A;  1HSE A;  1YAE A;  3U92 A;  4G68 A;  1SDX A;  3KOS A;  1PDA A;  4DLD A;  1IIT A;  1QUL A;  1I6B A;  3VVF A;  2H5Y A;  2OLB A;  2PT2 A;  2XXU A;  4UA8 A;  3CR9 A;  3OMB A;  5I57 A;  4EQ9 A;  1TWY A;  2QS1 A;  2F35 A;  1B2H A;  4H0W A;  1MXV A;  3LSF B;  3VLU A;  3RGY A;  4IO3 A;  5A5X B;  5HM4 B;  5AA4 B;  2I0B A;  2RF1 A;  3UGW A;  1SI1 A;  4HCY A;  4JWO A;  1XC1 A;  2ZMB A;  3CIJ A;  2I58 A;  3JV9 A;  1SBP A;  4ZEB A;  3TTL A;  4X1B A;  3KFM A;  4RK2 A;  5AA2 A;  5FHO A;  2RIN A;  4G8M A;  3MZ9 A;  3R6U A;  3FXR A;  1B3H A;  1UTH A;  3M3F A;  3WAF A;  1ANF A;  2HAU A;  4NF6 A;  3VFJ A;  3TEP A;  5F7V A;  4QSD A;  4H6D A;  3T96 B;  5CMM A;  2DE2 A;  1MG1 A;  3TFL A;  2VD3 A;  1Y3Q A;  2PYY A;  1USY H;  3TQL A;  1MQD A;  3QK6 A;  3K01 A;  5JK4 A;  2VGQ A;  3PPR A;  1O64 A;  1N3W A;  3VDF A;  4F18 A;  3Q28 A;  1UIV A;  3TOD A;  1WDN A;  4FEC A;  2RC7 A;  1A8F A;  1YPN A;  2Y84 A;  1JNF A;  3PUY E;  3PUZ E;  1XHY A;  1POY 1;  4OWD A;  3QUF A;  1WOD A;  1R9Q A;  1ZBM A;  3HN0 A;  4IGT A;  3PU5 A;  3H6U A;  3FGS A;  3MUQ A;  1I6A A;  3C4M A;  3PV0 E;  3FVN A;  2D3I A;  5F1Q A;  1PB9 A;  5CBS A;  3K0V A;  1MRP A;  3IL1 B;  3O6H A;  1Q1K A;  3OEL A;  2QJE A;  1MXW A;  1DTG A;  4BDR A;  5EYF A;  4GRK A;  2X7Q A;  4F1V A;  1RKM A;  1P1Q A;  2XXQ A;  2OBG A;  3A3U A;  1B9J A;  3PD9 A;  3UOR A;  1URS A;  4FE8 A;  4HTG A;  1B52 A;  1IXG A;  1MM7 A;  3MVX A;  1PB7 A;  1JQF A;  1S7Y A;  5HPQ A;  3FV2 A;  4F3B A;  5H8F B;  5I56 B;  4IO7 A;  2V3U A;  2QMW A;  3IOR A;  1BKA A;  2LAO A;  3VLW A;  4YKI A;  1AIV A;  2DWA A;  4G68 C;  2PMS A;  1DPP A;  2F78 A;  4YKK A;  3A09 A;  4U4X A;  1POT A;  1N7W A;  2ZNT A;  2ZNU A;  3CI8 A;  3EQ1 A;  2I48 A;  1SW5 A;  2PX1 A;  1URD A;  1A8E A;  5CMC A;  1BP5 A;  5I2K A;  3IJX B;  3RT8 A;  1B5I A;  2Z8E A;  4U23 A;  1BTJ A;  4H1X A;  3USD A;  1FQF A;  2H9B A;  3H06 B;  4R72 A;  1II5 A;  4EDP A;  3D4C A;  1GR2 A;  1MXZ A;  4OTE A;  4RNS A;  3TTR A;  3U93 A;  3N5L A;  4Z0I A;  1PEB A;  4DXB A;  4XXU A;  3N94 A;  4RPO A;  1MQG A;  1OQH A;  3Q27 A;  3HST A;  2XXX A;  4JXI A;  3KSJ A;  1UTB A;  4BLA A;  1B3F A;  2ONR A;  3VV5 A;  1XS5 A;  2VHA A;  1OQG A;  2UVG A;  2XD3 A;  3MZ1 A;  4ESW A;  1US5 A;  5A5X A;  5ISU A;  4IO5 A;  2NUV A;  3VVE A;  4X1D A;  1GGG A;  1B6H A;  4MLQ A;  1NL5 A;  3SEW A;  2X7P A;  4ELQ A;  3MVY A;  2CZL A;  3C32 A;  1SI0 A;  4JSD A;  4ELR A;  4OVJ A;  4LZ8 A;  2AL4 A;  1MY1 A;  1KWH A;  3RLF E;  2OK2 A;  2H99 A;  1LFI A;  3SEX A;  4BDO A;  4LQ2 A;  5H8Q B;  4ESX A;  3VXC A;  3RUM A;  1JW1 A;  3L6G A;  3QUJ A;  2QL3 A;  2R71 A;  3B6Q A;  2W7Y A;  4O3A A;  3KZG A;  4H5G A;  1LCT A;  2HQ0 A;  5CBR A;  1PBP A;  1NNP A;  4WED A;  4GXS B;  4NTL A;  3OO6 A;  5JTY B;  3H6V A;  1I69 A;  3K00 A;  3O28 A;  3KSX A;  1NNK A;  3C9H A;  4G2Z A;  1R9L A;  1QUJ A;  4PFY A;  4JB7 A;  3ZS6 A;  5KCJ B;  4NWD A;  3EHT A;  1IXC A;  1A7L A;  3RNN A;  2I3W A;  5B70 A;  4EF2 A;  3R7X A;  2WKY A;  4MF3 A;  3DP8 A;  5H8H A;  2Y7I A;  1B3E A;  4YB7 A;  1PBQ A;  4XTC Q;  1DSN A;  4XKN A;  4ZDM A;  1B40 A;  4GXA A;  5TPA B;  5EHM A;  4KYE A;  4XKQ A;  4P0I A;  2B3F A;  5TP9 B;  4F29 A;  3O97 A;  1US4 A;  3K6W A;  3MPK A;  4FOR A;  5FHN A;  4ZEC A;  4WKM A;  4OEU A;  3OSQ A;  4TLL B;  4PE5 B;  4LAT A;  1LCF A;  1GVC A;  2I4C A;  4TQU Q;  5I58 B;  3KN7 A;  5DYH A;  3THI A;  3CRB A;  1P1U A;  2AL5 A;  4EF1 A;  4EXL A;  2YLN A;  3PPN A;  4RJZ A;  4FED A;  4LON B;  3BKI B;  2Z23 A;  1NFT A;  3I3V A;  5ICT A;  4ONY A;  4F3G A;  2GH9 A;  3ILU B;  2OWS A;  4KHZ E;  3RTF B;  3TZA A;  4DCX A;  1D4N A;  3PUV E;  3H03 A;  1JVY A;  3LC8 A;  4OMB A;  3V5A A;  3E4R A;  1JEU A;  3WAE A;  3S9E A;  3LSL A;  2QSX A;  3ZKK A;  3V83 A;  1URG A;  2F8D A;  3B6W A;  4R74 A;  2XXW A;  1WVJ A;  3DLN A;  3MWB A;  4IY5 A;  4LZ7 A;  5H8N A;  4NE4 A;  4X48 A;  1OLA A;  1EH3 A;  5J1D A;  4M4G A;  1A40 A;  3RPW A;  1Y3P A;  1SYH A;  3E3K A;  5DEX A;  4R6K A;  1XVX A;  1HSL A;  4GF8 A;  4FAT A;  4GLI A;  5KDT B;  3OO9 A;  4PFW A;  5IAI A;  1B1X A;  3KJT A;  4POW A;  3SET A;  1Y3N A;  1B7Z A;  1F9B A;  4I62 A;  4GL8 A;  4BDM A;  4LQ5 A;  1UIU A;  3ZSF A;  3RTW B;  4F22 A;  3HHG A;  1JET A;  1N0T A;  2G29 A;  2PVU A;  4R2B A;  2RCA A;  4IB2 A;  2DS9 A;  3IOW A;  3MBP A;  4H8I A;  3MP6 A;  3R26 A;  4F39 A;  3IAZ A;  3MQ9 A;  1P1O A;  3OO7 A;  3H4Z A;  3PMX A;  1CE2 A;  3SER A;  1VFD A;  1GV8 A;  3IB2 A;  3SEU A;  2F97 A;  4M1V A;  1FQC A;  2XX8 A;  3CG3 A;  1QUK A;  1XVY A;  1P1W A;  3T9H B;  4NF4 B;  2DWJ A;  1YCJ A;  2V3T A;  1LAF E;  2F7A A;  4FEB A;  2ZYN A;  3N6U A;  4U1O A;  4HS7 A;  2UVI A;  4XKP A;  3TTK A;  3E9X A;  3PMV A;  4G8H A;  1IIW A;  2XXP A;  4ZE8 A;  2O7I A;  1NMU A;  2ZXT A;  3ECR A;  2O51 A;  1LB9 A;  4JBZ A;  2ZYM A;  4ECF A;  1SVX B;  3TEL A;  3C31 A;  2B3B A;  5AA2 D;  4KCD A;  4F1U A;  1Y1M A;  2ABH A;  4PQJ A;  1CB6 A;  3U1O A;  1O7T A;  4KYD A;  2QPQ A;  5KZT A;  3HV1 A;  2G93 A;  2QRY A;  4F2Q A;  5JEI A;  4I8C A;  4GWO A;  4P0G A;  3GLB A;  3K02 A;  1ATG A;  2V25 A;  2ZYK A;  5I59 B;  3CSG A;  1JVX A;  1DOT A;  5FTH A;  1ELJ A;  2HAV A;  5I2N B;  4QFK A;  3C34 A;  3VXB A;  3TKD A;  1MY4 A;  1SQY A;  4ISU A;  1FQA A;  2NOO A;  3FVK A;  3RQT A;  1N04 A;  2DOJ A;  4BDL A;  2AYS A;  3KOT A;  1MY3 A;  2F7B A;  3PUW E;  4R73 A;  3G7W A;  2O7U A;  4F1Y A;  4OHN A;  4YU0 A;  4IGR A;  3OXN A;  2Y7R A;  1EZP A;  1J1N A;  4N07 A;  1UQW A;  1B05 A;  2H25 A;  3G3F A;  4KI0 E;  4DZ1 A;  4EXK A;  3VVD A;  3MPL A;  1NH7 A;  3VLV A;  4NED A;  3JYR A;  1OVB A;  1B3L A;  2I0C A;  3FUZ A;  2Q88 A;  1NNF A;  3FXU A;  2DWI A;  3S9N C;  1BIY A;  3FVO A;  4QRZ A;  4LZ5 A;  1B32 A;  4QFO A;  5DVI A;  2A5T A;  2Y7P A;  4IO6 A;  4KFQ A;  2DYX A;  3UA8 A;  4X9T A;  1VE4 A;  2FA7 A;  1D9Y A;  4C1T A;  1Z7N E;  2UVJ A;  2OCU A;  1P1N A;  4F3P A;  3K1N A;  4OEV A;  3RY3 A;  5IKB A;  3EHS A;  3GBA A;  2F34 A;  2O1M A;  1FTM A;  3LBS A;  4YZZ A;  2GFE A;  4DE8 A;  2F5X A;  4R6H A;  2DSF A;  4QFP A;  5CI5 A;  4DXC A;  1B4Z A;  4JSO A;  4U4S A;  2E0S A;  3ZKL A;  4GIZ A;  4G4P A;  1FTL A;  1QJM A;  4YMA A;  5L9O A;  4N6P A;  4OES A;  4G68 B;  1OLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...