1Y1MA

Crystal structure of the nr1 ligand binding core in complex with cycloleucine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
281
structure length
271
Chain Sequence
RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Partial Agonist Action at the NR1 Subunit of NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligand binding protein
molecule keywords Glutamate [NMDA] receptor subunit zeta 1
total genus 80
structure length 271
sequence length 281
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y1mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y1mA02
3C31A 4IO4A 4JSDA 1DOTA 1N3XA 4LQ2A 4YICA 2Z22A 2RCBA 1R9LA 1B3GA 2ZYNA 3O97A 4GLIA 4OTEA 3V8XB 3CI8A 3P7IA 2G93A 3EHTA 4R75A 3OO8A 3LSFB 3OELA 3OO9A 3SETA 1VFEA 4XKRA 1OVTA 2E1SA 5I84A 2ONRA 1MDQA 4GXSB 4KR5A 4UACA 4WEPA 4X1BA 4YKIA 4JWXA 4GL8A 1B5IA 1ELJA 3RN8A 4E0XA 4YMAA 3PUVE 4EF2A 5CC2A 3TDJA 3CFZA 1B1HA 4EXKA 5AA2D 1B7HA 1US5A 2DQVA 3EN3A 3K1PA 1NMUA 2HQ0A 2NUVA 3CG3A 3CRBA 4ISUA 4P0IA 4YZZA 1FW0A 1NKXA 2OWSA 1MXUA 1XC1A 4GWOA 4X48A 4KD5A 4Z0IA 5JK4A 1S7YA 3FV2A 1LGBC 1OIBA 1VE4A 3TTKA 4HS7A 3I3VA 2QS3A 1P1OA 4AQ4A 3CFXA 4IY6A 1EZ9A 1N76A 1IEJA 3O6IA 3TQWA 1ZMGA 3Q27A 3H6VA 1N0TA 3TELA 1JEUA 2GFEA 1H43A 2ZYMA 4R2BA 3RT8A 4FIMA 4OEUA 1MQGA 1FTLA 3VLWA 1A7LA 3A3CA 1NFTA 3EHUA 3QAXA 4OFOA 5A5XA 4ZE9A 1DPEA 1QW0A 5L9MA 4F3GA 1O64A 1FTMA 4KQPA 3OO6A 3KZGA 2XXQA 1ZBMA 3FIRA 3O29A 2DE3A 3K6XA 5DT6A 4DXBA 4ELPA 5L9OA 3HO7A 1ZU0A 4LP2B 4H8IA 2XXIA 3FXQA 2PYYA 2DWJA 1FQEA 2V93A 3V5AA 4F18A 1DTZA 4XIGQ 1ZTYA 4R9GA 4FECA 4QSDA 3IB2A 5CI5A 3LSLA 1DPPA 3GLBA 3OMBA 4OMBA 4AB6A 2G29A 2DWHA 4EDPA 1TT1A 3KJ7A 2H99A 3F11A 3O66A 3H4ZA 1KWHA 2H5YA 2DYXA 4GRKA 1URSA 3HHGA 1MY1A 1NNPA 3RTFB 1IXIA 3PU5A 4GIZA 3T22A 4BDRA 2R9JA 4U23A 2RC8A 4EQBA 2QMWA 3LBSA 1BIYA 5TU0A 4ZE8A 4YKKA 2HFBA 4RK9A 4U1ZA 4R74A 5I56B 2XXUA 4UA8A 4ONYA 1FQCA 5JTYB 4RA1A 3MAMA 4HTGA 2I0BA 3OSQA 5H8SA 3JV9A 1VFDA 4GXAA 5H8HB 3RY3A 4U2RA 2ZNSA 5I58A 3N6UA 3IL1B 2I4BA 1B4ZA 4WKMA 4WXJA 1PDAA 3VVEA 3ZKKA 3V83A 2B3FA 1SW2A 3PMVA 1Y3QA 4FATA 1D9YA 1QULA 3CR9A 5AA2B 3S9MC 2IEEA 2Q88A 4YKPA 3T9VA 4OWDA 4F39A 2I49A 1Y3PA 4TQUQ 5HBCA 5B7DA 2P1SA 3MVWA 1IZ1A 1D9VA 3MPKA 4OYVA 2Z8DA 3IAZA 1MQHA 1N7WA 5IKBA 1JETA 1P1WA 1B3LA 3SKPA 4O3AA 5I57B 2H9BA 4GQOA 1N04A 1B3FA 3KEIA 3RUMA 2UYFA 2AYSA 1FQBA 1MXZA 3KBRA 4QHQA 4R2FA 5CMCA 4K3FA 3SDFA 4OVJA 3ZKLA 1H44A 3FXRA 3QUFA 3R6UA 3T93B 1B52A 1TXFA 3TAJA 3D4GA 1I6AA 1JW5A 4H6DA 4HW8A 4YU0A 5KDTA 3PUXE 3MVZA 1BP5A 4I1DA 2B65A 3VLVA 1EZOA 4JB7A 1B40A 1XT8A 2O69A 2PX1A 3G3GA 3VDFA 3N6TA 3QYTA 5FHNA 2XX7A 1TFAA 3EQ1A 1FTKA 1H45A 3KSJA 4IO5A 3MZ1A 3FVOA 4XKNA 3U1OA 4C1UA 3FZVA 5I56A 4DXUA 4YMBA 2F78A 1JW4A 1NL5A 2RC9A 1B51A 2V25A 4G68A 4G8NA 4JDFA 5TPAA 2ESNA 3EHSA 2FA7A 3V89B 1LSTA 1ANFA 5K2XA 4Z7EA 5H8NB 3D4CA 5I58B 2M8CA 3T9HB 4F3PA 3PPOA 1SBPA 3UA8A 4YB5A 4LZ8A 1MG1A 2RKMA 5H8QB 4ZDMA 3TFLA 3AXFA 4DE8A 4MLQA 2O51A 3RT6B 4EQ7A 5FTIA 2PT1A 1Y20A 2XHDA 4NTLA 1POY1 1QUJA 2VHAA 2XX8A 3DP6A 4XKQA 2HAVA 2I48A 3Q25A 1IXGA 4NF8B 3U8QA 4EF1A 4KYEA 1MPDA 4QFLA 2XXXA 3TEPA 4JWYA 1QUIA 2HZKA 3HV1A 1F9BA 3H6TA 3KN7A 1UIUA 2THIA 4QFNA 4R72A 3HHFA 3TCGA 4R6KA 4ZEIA 2YPNA 2VOZA 4NF5B 2D5WA 2F34A 1SYHA 1MDP1 4RPOA 2OBGA 4RXLA 3VVFA 3RNNA 1B5HA 4XTCQ 5I2KB 1MH3A 4ZECA 4BDQA 3GZGA 2ZNUA 3MP6A 5KZTA 3W9WA 1WVJA 1AOVA 4RPNA 2QRYA 4G4PA 1NNTA 4OFLA 2P0SA 4ELOA 3FD3A 3PPQA 4P11A 4R73A 2ZMBA 3K6UA 2UVJA 5AA1A 3BFTA 3RLFE 4H5GA 4F3BA 5I59B 2H25A 3TZAA 5CMKA 3FVNA 2GH9A 3G7WA 3TUSA 5J1DA 4LZ5A 1OQHA 4LVQA 4OETA 2F8DA 2I3WA 1MY0A 3OOAA 1TFDA 2F5XA 3VXBA 1B7ZA 4C0RA 1T0KA 1VSOA 3MZ9A 4BDOA 2DS9A 2ALUA 2D3IA 2Z23A 1S9TA 1A8EA 4Q30B 3T66A 2VD3A 3OD7A 4L17A 1DMBA 5I57A 2Y7RA 4GL0A 1JEVA 1B3EA 4LA9A 4DLDA 3R7XA 2CMOA 1UTBB 2DVCA 1I69A 2PT2A 1BKAA 1Q1KA 3MC2A 1Q35A 5CMBA 4BDLA 1RYOA 1SYIA 2D21A 4F1UA 2DXYA 2HEUA 2XXTA 2DSFA 2F7BA 4OXVA 3Q26A 4POXA 3PPNA 3RPWA 3Q28A 3M3LA 1QKBA 3VVDA 1PEBA 4TOZA 2QS2A 4M4GA 4RK2A 1BLFA 2QSXA 1ZLQA 4DZ1A 1YAEA 1MQDA 1SDXA 4IO7A 4NF6B 5F1QA 4OZ9A 5I2KA 2R6GE 5FTHA 2XXYA 2QPQA 2F7AA 4ZZEA 4IGRA 1YPNA 1II5A 1LBBA 3FATA 3K00A 3MWBA 4AB5A 1J1NA 3M3KA 3IJXB 5H8NA 2Q8JA 3FJMA 2OJTA 2OWTA 2F6GA 2GHAA 5CRYA 3GBBA 3ODBA 3FVKA 3R26A 1SQYA 2I58A 4O3CA 5I59A 3MUQA 5B70A 3UP9A 4P0GA 1OQGA 4LATA 3H3GA 4H5FA 1UTHA 4H0WA 1NNKA 2RF1A 4M1VA 2H98A 3RTWB 1Y3NA 2I4CA 4F19A 1URGA 5TP9A 1WODA 3OEKA 4DCYA 3LSWA 1B0HA 2CZLA 1MM6A 3PMXA 3QXMA 4X1DA 1H3DA 2XD3A 4IB2A 3RQTA 3TCFA 4EXLA 3DP4A 2DE4A 2DOJA 3SEXA 4H1XA 4ND9A 4OERA 4KI0E 2I0CA 3O6GA 1A55A 2PVUA 5AA4A 3A3UA 4RJZA 4IO6A 1TWYA 2A5TA 3WAEA 4F22A 1H76A 3LUYA 4ESWA 4LQ5A 2XXRA 2F6PA 2YJPA 1USYH 4PE5B 4PP0A 4BDMA 5ISUA 4U1OA 1LB9A 4ECFA 1LCFA 5HPQA 1HSJA 1JW1A 3N26A 3TYHA 2A5SA 1NNFA 3EF7A 1R9QA 2QS1A 1VR5A 4YB7A 1PB8A 1D3KA 3FJGA 1IUDA 1A54A 1MPBA 1SI1A 2UXAA 2ZYKA 1FTJA 4R6HA 3UN6A 2NVUB 2AIXA 2YLNA 4RNSA 5EHSA 3TCHA 3WAFA 5BUUA 3ECRA 2X7PA 1M5FA 3B7DA 2HXWA 1IITA 1URDA 4YKJA 2DWIA 1MH4A 1N84A 1NH8A 1UTBA 2DWAA 5CMMA 5ICTA 1FQAA 3MQ9A 1IXHA 3DLNA 5ITPA 4PQJA 5TP9B 1M5CA 4GF8A 3KFMA 3K02A 4I9DA 3G3FA 3KSXA 5TPAB 1WDNA 1O63A 1GTKA 1M5EA 1OVBA 3G3IA 2QL3A 2PBWA 2UYEA 3HN0A 1BTJA 3IORA 3L6GA 1SVXB 3LR1A 3PPPA 1LFGA 4IO2A 4KYDA 4NF6A 1PBPA 3MBPA 3USDA 2I6EA 2IA4A 4H8JA 4X9TA 1FCKA 5KCJA 4TLLB 1AL3A 3DELB 4FE8A 1ZJLA 4OENA 2F7CA 3O6HA 3SEVA 3HCQA 1OMPA 4PFYA 1EH3A 1AH5A 3HSTA 4O3BA 4OHNA 4NF8A 3PUZE 4GVOA 3B6WA 4IGTA 4G8HA 1N7XA 1S50A 1B58A 1QKAA 3FVGA 4I62A 1OLCA 2GRVA 1IIWA 1GGGA 2O7UA 3FASA 1LAHE 3C33A 4FORA 4OFJA 5DVFA 3T96B 3O28A 2GHBA 4NF5A 2R71A 5K2YA 4Q5TA 3ZSFA 4Q8RA 5FHMA 1MXWA 1MS7A 5DVIA 1Y9UA 1QJMA 3G3JA 1B05A 2O6AA 3E13X 3E3KA 1LFHA 4LONB 1CE2A 1YTVA 4MLVA 1B32A 1MRPA 3E9XA 1POTA 3B6TA 4NF4B 3IOVA 3UIFA 3H6WA 2F97A 4C1TA 2O84X 3UORA 2QJEA 2A5TB 3PUWE 5AA2A 1IQ7A 4OQOA 3ZS6A 1JNFA 1XVXA 4NEDA 3A09A 1LB8A 2VGQA 3IR1A 1P1QA 4FEBA 1SW4A 4ZEFA 3PPRA 5ITOA 3BKIB 4MBPA 3IOUA 3TTMA 3RGYA 2OCUA 1QUKA 2UVGA 3K6VA 4JWOA 5KCJB 1AIVA 3TMGA 1AMFA 3O9PA 1DSNA 4FAJA 2QS4A 1OLAA 3TTLA 5CM6A 3FXUA 1IXCA 4GD5A 3MPLA 2KLFA 1B6HA 2BJJX 2V84A 1N3WA 1Y1MA 1LCTA 2ONKE 4RY1A 4U4SA 1GVCA 3PGFA 1M5BA 3U94A 3C4MA 4DIGA 1B9JA 2X7QA 4THIA 4XXUA 4DCXA 2DE2A 2PMSA 3SEUA 3BFUA 1LAXA 2UVIA 3G3KA 2Q9TA 4KCCA 3IK6B 4OEVA 4EQ9A 1EZPA 4G77A 4F29A 3C9HA 3LC8A 4OESA 3BBRA 3Q29A 4QFKA 1PC3A 3SEWA 3C36A 1MY3A 4DDDA 3M3FA 1ZIUA 3S9NC 2H4IA 1USYE 2X26A 2ANJA 2ZNTA 3I6VA 3N94A 3O2AA 5H8HA 4ZEBA 5LOMA 1LBCA 1SI0A 3TODA 1MXXA 3PUYE 3IB1A 3IO6A 1D4NA 4MH5A 4QSEA 3SERA 3M8UA 2REGA 4N6PA 3K1MA 3H06B 1L5TA 2Q2AA 1XS5A 4ZEKA 5L9SA 4XKPA 4R6YA 3PD9A 1MY2A 3VFJA 4BLAA 2XXVA 3FGSA 3QUJA 3FUZA 4R9FA 3DP8A 2HAUA 3TKDA 4G8MA 3W15C 1RYXA 1Z7ME 3PMWA 5DYHA 5H8FB 3KJTA 2O1LA 2ABHA 3S4UA 3KN8A 3EPEA 2F35A 3KG2A 3CFLA 3I5OA 4GFRA 4KCDA 5DEXA 3CG1A 4F3SA 4F31B 3MP1A 4PETA 5FHOA 3THIA 3SEYA 3TPAA 1MQJA 1PBQA 4FEDA 2UVHA 2FNCA 4E0WA 4PFWA 1B4HA 4POWA 1QVSA 3CVGA 4WEDA 2W7YA 1M5DA 3UK4A 2XXWA 1ATGA 1GR2A 3KN3A 4G2ZA 5I2NA 5JEIA 1SW1A 2LAOA 3GBAA 3K1NA 3T9UA 5A5XB 5CBRA 4ELQA 2HZLA 4DXCA 1B0LA 1JQFA 1ZKBA 2REJA 2V3TA 3E4RA 3K2DA 3KGCA 2V3UA 3CSGA 1B3HA 3G3HA 4QFPA 2DVZA 4H67A 2DP8A 4KYSA 4F2QA 3PV0E 1Y4TA 3S2VA 3KOSA 1R1NA 2P2AA 1A40A 4G68B 3TTNA 4F1VA 2Y7PA 3C34A 1NH7A 4NE4A 1CB6A 3C35A 3MJNA 2O1MA 3QSLA 4JSOA 1JVYA 2ONSA 3PD8A 4NMYA 4FJPA 4HCWA 1I6QA 2Y7IA 5H8QA 4MFIA 3K01A 3H6UA 1P1UA 5ELVA 4TLMB 1GV8A 5IAIA 4ELRA 2OZZA 2Z8FA 1SD3A 4ZS9A 4N13A 4F1YA 1LFIA 1DTGA 1XOCA 4JBZA 1MQIA 4QFOA 5DEXB 4KFQA 4PFTA 3QK6A 3W9VA 1B46A 1B2HA 1MM7A 3IJOB 2FYIA 3LSXA 4GOTA 4N07A 2F36A 4QSCA 3K6WA 3IOTA 3QIMA 4BDNA 5AA3A 2I3VA 5ICQA 3S9EA 1PB9A 2OLBA 4EUOA 4KPTA 1MXYA 3U93A 2HCAA 4Q0CA 2Q2CA 2NWJA 4NWCA 1LLSA 2QMXA 2E0SA 2O7IA 4QRZA 4YB6A 1B1XA 3MP8A 3OEMA 1I6BA 2AL5A 4ZEDA 5JTYA 2OK2A 3U92A 3C32A 1A8FA 1B5JA 2VD2A 4I8CA 4U4XA 5F7VA 2XD2A 3ILTB 5AE4A 5HM4B 2Y7WA 3FJ7A 3IX1A 4PFUA 3VXCA 1RKMA 3L6HA 1EU8A 4H65A 1MY4A 2DXRA 3OENA 2ZXTA 5CBSA 2XXHA 4ZZAA 1HSLA 4ESXA 1Y1ZA 3JYRA 5DTBA 1UTHB 2NXOA 4QF9A 2VP1A 2Y84A 5H8FA 3FV1A 3K4UA 4RYAA 3T9XB 1UIVA 2XX9A 2Z8EA 3ILUB 5EHMA 4NWDA 3MZBA 1MPCA 4U21A 4LUBA 3U72A 5BWJA 1P99A 2ZYOA 4YAHX 2V3QA 3CSBA 3VE1B 4MF3A 4F2OA 1XHYA 3MW0A 3MVXA 4NF4A 3SESA 2Q89A 3OXNA 1US4A 2RC7A 4LZ7A 5AA4B 1LAFE 3TTRA 2B3BA 5KDTB 3CIJA 3ONMA 3MVYA 1A99A 2RCAA 2O68A 5I2NB 3IB0A 4G68C 3VV5A 3N5LA 2RINA 1SW5A 4HCYA 1HSEA 3DM0A 3VLUA 2XXPA 2WKYA 1O7TA 3UGWA 1FQDA 2Y7KA 3JZJA 4JXIA 3H7MA 3K0VA 3OSRA 3S9LC 3IOWA 1YCJA 5EYFA 3HPIA 1Z7NE 3B6QA 1B7UA 3IO4A 4IY5A 3OO7A 5DVJA 1FTOA 2AL4A 4KHZE 3H03A 4IO3A 1R6ZA 1LAGE 5L8DA 5M2VA 1FQFA 1PB7A 1UQWA 1Y4CA 1XVYA 3GXAA 1MXVA 1P1NA 3KOTA 2NOOA 4U22A 3TQLA 1JVXA
chains in the Genus database with same CATH superfamily
4GWZA 4PGPA 4JSDA 4YICA 4GLIA 3ZS6A 1B3GA 1D9QA 2G93A 5I84A 2E1SA 3B8BA 4KR5A 4WEPA 1NV3A 4JWXA 4E0XA 5CC2A 3TDJA 1US5A 2DQVA 4DI3D 2HQ0A 4YZZA 4GWOA 3FV2A 1VE4A 4OA4A 3CFXA 1N76A 3TQWA 3Q27A 1N0TA 1JEUA 3RT8A 1MQGA 1FTLA 3VLWA 1DPEA 1QW0A 3KZGA 1ZBMA 2DE3A 4ELPA 4LP2B 2XXIA 2PYYA 2DWJA 2V93A 5IZZA 4X8RA 1Q9DA 2H99A 1MY1A 1NNPA 3T22A 4YKKA 4RK9A 4U1ZA 5JTYB 5H8SA 3RY3A 2ZNSA 2I4BA 4PFBA 3PMVA 2QFLA 2Q88A 3T9VA 4F39A 5B7DA 5ET5A 2P1SA 3MVWA 3MPKA 1N7WA 4O94A 2KR0A 3SKPA 2H9BA 4OVJA 3ZKLA 3R6UA 1TXFA 1I6AA 1JW5A 3MVZA 4I1DA 3VDFA 3G3GA 2XX7A 4IO5A 2XWIA 1RDXA 2V25A 5ICQA 5TPAA 1FBCA 2ESNA 5I58B 4Z7EA 3D4CA 3UA8A 4YB5A 2RKMA 2HXRA 1Y20A 2XHDA 1POY1 4NF8B 3Q25A 4EF1A 3HV1A 3H6TA 4QFNA 1UIUA 3TCGA 4R72A 3HHFA 2YPNA 3RNNA 3GZGA 2ZNUA 4RPNA 4R73A 3K6UA 3CHGA 4F3BA 3RLFE 5IGAA 2H25A 5CMKA 3FVNA 1K9YA 3G7WA 4LZ5A 4OETA 1T0KA 1B7ZA 2ALUA 3T66A 1A8EA 4L17A 2P3VA 1JEVA 3R7XA 2CMOA 2DVCA 1I69A 2PT2A 1Q35A 4BDLA 4F1UA 2XXTA 2DSFA 4POXA 3Q26A 3QMFA 1FBPA 1PEBA 4RK2A 1BLFA 1SDXA 4IO7A 5F1QA 5FTHA 4ZZEA 4MAGA 4UABA 5IZ1A 3FXBA 3ODBA 3R26A 1SQYA 2I58A 3MUQA 5B70A 4LATA 1UTHA 1NNKA 3RTWB 4F19A 4DXBA 1H3DA 4EXLA 4OERA 2A5TA 4F22A 5ISUA 1JW1A 1R9QA 1YYZA 2QS1A 2HHMA 1VR5A 1YXIA 3UN6A 4GWWA 3B7DA 4GBWA 2HXWA 4YKJA 1N84A 1UTBA 2DWAA 3MQ9A 1G0HA 1IXHA 5ITPA 5TP9B 4MHFA 1M5CA 3G3FA 4C0RA 3G3IA 2PBWA 3PPPA 3HN0A 4IO2A 1LFGA 1PBPA 3MBPA 3USDA 5KCJA 4FE8A 4OENA 3HSTA 4OHNA 3B6WA 5FBPA 4G8HA 1S50A 1DBZA 1CNQA 3FASA 4OFJA 3T96B 2GHBA 4PAIA 2Q8MA 1MXWA 5DVIA 1LFHA 1QJMA 3G3JA 2XWVA 1CE2A 1YTVA 4LONB 3H6WA 1IQ7A 1JNFA 1LB8A 1P1QA 4FEBA 4ZEFA 5ITOA 3BKIB 4MBPA 3RGYA 1FBGA 1QUKA 4JWOA 3TMGA 3O9PA 4MCOA 3RYDA 3MPLA 4MNPA 4RY1A 1GVCA 1LBVA 1M5BA 2PFZA 1B9JA 2X7QA 2Q9TA 3IK6B 4EQ9A 5LDZA 4G77A 3LC8A 3PTYA 4OESA 3BBRA 3C36A 2FIXA 3S9NC 1USYE 4XF5A 4ZEBA 1LBCA 1SI0A 1MXXA 1D4NA 4N6PA 1L5TA 3K1MA 2KQZA 4HE2A 4R6YA 4BLAA 2XXVA 3QUJA 3DP8A 4PFIA 5H8FB 3S4UA 3EPEA 3CG1A 3MP1A 1PBQA 4FBPA 4MX6A 1QVSA 3CVGA 1GR2A 2FVZA 5JEIA 5A5XB 2LAOA 3K1NA 1KA0A 2XXKA 2REJA 2DVZA 4F2QA 3GYYA 3S9LC 1Y4TA 3MJNA 4N8GA 2ONSA 1I6QA 4MFIA 5ELVA 2Z8FA 1LFIA 1MQIA 4QFOA 4FAJA 1B2HA 1NUZA 4QSCA 3K6WA 3IOTA 4BDNA 2P3NA 2OLBA 4EUOA 3U93A 1FPEA 1LLSA 2VD2A 2Y7WA 3IX1A 3L6HA 3OENA 3JYRA 2Y84A 4I3EA 3ILUB 5IZ3A 1MPCA 4PF8A 3CSBA 4F2OA 3MW0A 2RC7A 3MVYA 4PE3A 5I2NB 4G68C 1SW5A 3DM0A 3VLUA 4NX1A 4JXIA 4HE1A 3K0VA 3IOWA 5EYFA 1IMDA 4KHZE 1R6ZA 5L8DA 3U65A 3KOTA 1MXVA 4GX3A 3N26A 1N3XA 2RCBA 3V8XB 3CI8A 3P7IA 4R75A 1OVTA 4UACA 4GL8A 3RN8A 4EF2A 3CFZA 4NHBA 2NUVA 3CG3A 3A29A 2OWSA 4Z0IA 5JK4A 1S7YA 2VPNA 5ET8A 4AQ4A 1AWBA 3IFCA 1EZ9A 1ZMGA 3H6VA 2GFEA 1FBHA 1A7LA 3A3CA 3QAXA 5F24A 4ZE9A 4P47A 1FTMA 2FBPA 4KQPA 2XXQA 3O29A 4O8MA 1FQEA 1DTZA 4XIGQ 4FECA 3IB2A 2G29A 1NV1A 1TT1A 3F11A 3RTFB 4GIZA 4BDRA 2R9JA 4O7MA 1BIYA 4R74A 5I56B 4UA8A 1NV6A 2CEYA 3N6UA 3IL1B 3VVEA 1B4ZA 4WXJA 1PDAA 3V83A 1Y3QA 1QULA 2F3DA 4P1EA 2I49A 1Y3PA 4TQUQ 1D9VA 5I7IA 3IAZA 5IKBA 5I57B 4N6DA 1B3FA 2UYFA 2AYSA 1FQBA 3KBRA 4K3FA 3SDFA 4OVSA 1H44A 1NV0A 1B52A 4HW8A 5KDTA 1BP5A 3VLVA 4JB7A 1XT8A 3N6TA 3QYTA 4C1UA 1H45A 4NQ8A 4DXUA 5H8NB 2FA7A 1ANFA 2M8CA 3PPOA 3TFLA 4LZ8A 4ZDMA 2FIEA 4AS4A 4DE8A 2O51A 2VHAA 3TEPA 1EYJA 4JWYA 1QUIA 1BK4A 1INPA 4RXLA 3ROJA 1MH3A 4PDHA 1SPIA 3W9WA 2P0SA 3FD3A 3PPQA 5AA1A 2ZZVA 5J1DA 4LVQA 1OQHA 2F8DA 1VSOA 3MZ9A 2DS9A 2D3IA 1DMBA 4LA9A 1RYOA 1SYIA 2DXYA 2B4LA 3PPNA 3RPWA 3Q28A 1QKBA 3VVDA 2QS2A 4M4GA 1NUYA 5I2KA 2F7AA 4IGRA 1YPNA 3FATA 3MWBA 2F6GA 3GBBA 1NUWA 5I59A 2FHYA 3UP9A 4P0GA 1URGA 3RQTA 3PMXA 5IZ3B 4IB2A 4H1XA 3O6GA 5EQ8A 4RJZA 4IO6A 4HXVA 3LUYA 4LQ5A 2XXRA 2YJPA 4ECFA 1LB9A 5HPQA 2XA5A 3TYHA 2A5SA 5IM2A 4YB7A 1D3KA 2WYPA 2UXAA 4R6HA 2NVUB 5EHSA 3ECRA 1M5FA 2DWIA 5CMMA 5ICTA 1FQAA 4N8YA 4GF8A 3KSXA 5TPAB 1OVBA 1GTKA 1M5EA 2QL3A 3IORA 3LUZA 5T3JA 2IA4A 1FCKA 1AL3A 1ZJLA 3SEVA 4PFYA 4O3BA 4NF8A 4IGTA 3NOHA 2PFYA 2HPGA 1QKAA 2O7UA 1LAHE 5DVFA 4I40A 2R71A 3E78A 4Q5TA 4Q8RA 3E9XA 4NF4B 3UIFA 1JP4A 2O84X 2QJEA 2A5TB 3PUWE 4OQOA 1XVXA 1SW4A 3PPRA 4PAFA 2UVGA 1AIVA 1AMFA 1OLAA 5CM6A 4P9KA 1B6HA 2BJJX 4HE0A 1LCTA 4U4SA 4DCXA 2DE2A 1VDWA 2UVIA 2WX9A 1EZPA 4F29A 3C9HA 2V4CA 3SEWA 1MY3A 3M3FA 1ZIUA 2ZNTA 3I6VA 3O2AA 3IB1A 4QSEA 1EYIA 3M8UA 1XS5A 1FJ6A 4R9FA 1RYXA 4IR8A 3KJTA 2O1LA 5DEXA 3KG2A 2F35A 3CFLA 4F31B 3THIA 2UVHA 4WEDA 2W7YA 3UK4A 2XXWA 1ATGA 4N17A 5EQ9A 4G2ZA 3GBAA 4ELQA 1FBEA 1JQFA 3MP6A 3E4RA 3K2DA 3CSGA 3G3HA 4KYSA 4H67A 2QVRA 5HM4B 1A40A 4N4UA 4F1VA 1NH7A 4QBAA 2Y7IA 4TLMB 1GV8A 4ELRA 3MSTA 4PBHA 3W9VA 3QK6A 4MMPA 4N07A 5AA3A 3T1BA 1PB9A 2OWZA 4Q0CA 2Q2CA 2NWJA 2QMXA 2E0SA 1B1XA 2OX3A 3MP8A 2OK2A 4I8CA 5F7VA 3VXCA 1FRPA 1RKMA 2DXRA 1FPKA 1HSLA 5H8FA 1G0IA 2Y5LA 4RYAA 5EHMA 4LUBA 1EYKA 2V3QA 1XI6A 1XHYA 2ZZWA 2Q89A 4LZ7A 5AA4B 3ONMA 2O68A 3VV5A 2RINA 4P3LA 2WKYA 1O7TA 1FQDA 3H7MA 4MEVA 1YCJA 1B7UA 3IO4A 3TAJA 3H03A 1PB7A 1XVYA 2NOOA 4MIJA 4IO4A 1DOTA 2Z22A 3O97A 1R9LA 4OTEA 3LSFB 3OELA 3OO9A 1VFEA 4XKRA 2ONRA 1MDQA 4X1BA 1ELJA 4YMAA 3PUVE 2F3BA 1B7HA 4H46A 3K1PA 4ISUA 1FW0A 1NKXA 1MXUA 4KD5A 1LGBC 4JVIA 3TTKA 4HS7A 3I3VA 3RPLA 1P1OA 4P1LA 2MKZA 3KC0A 4XEQA 4PDDA 1IEJA 3O6IA 1LBYA 3TELA 2ZYMA 4R2BA 2B4MA 5A5XA 4F3GA 1FBDA 3FIRA 3ISPA 3K6XA 5DT6A 5LTCA 3HO7A 4H8IA 4F18A 1LBWA 5CI5A 4KXPA 3LSLA 3GLBA 3OMBA 4OMBA 4EDPA 2ZZXA 3KJ7A 3O66A 1KWHA 2DYXA 2XWOA 1URSA 3HHGA 1IMFA 4GX6A 4U23A 2RC8A 4EQBA 2XXUA 4ONYA 1FQCA 4RA1A 3JV9A 5H8HB 4U2RA 5I58A 4WKMA 2B3FA 1SW2A 4FATA 3CR9A 3S9MC 4YKPA 4OWDA 1JETA 1P1WA 1B3LA 4O3AA 4GQOA 3KEIA 3RUMA 4QHQA 4R2FA 5CMCA 3E79A 3QUFA 1DK4A 4H6DA 4YU0A 1EZOA 2B65A 2O69A 5FHNA 1TFAA 4P8BA 3MZ1A 1IMCA 2F78A 4G8NA 4JDFA 1B51A 4GWYA 3V89B 5K2XA 1SBPA 3AXFA 4MLQA 5FTIA 4NTLA 1QUJA 2XX8A 3DP6A 2HAVA 2I48A 4KYEA 2XXXA 2HZKA 2L5VA 1F9BA 3KN7A 4ZEIA 4NF5B 2F34A 1SYHA 2JJKA 1MDP1 4JVCA 4RPOA 2OBGA 1B5HA 1FTAA 4ZECA 5KZTA 1AOVA 1WVJA 1NNTA 4ELOA 4P11A 2ZMBA 2UVJA 3BFTA 4H5GA 2GH9A 3TUSA 3VXBA 3OOAA 1MY0A 1TFDA 2Z23A 1S9TA 5I57A 3OD7A 2Y7RA 4DLDA 1Q1KA 3MC2A 3FBPA 2D21A 2HEUA 2F7BA 3M3LA 4TOZA 2QSXA 4DZ1A 1YAEA 4NF6B 4OZ9A 2R6GE 1II5A 3K00A 1J1NA 3M3KA 5H8NA 2Q8JA 2VT5A 2OWTA 4OVPA 2GHAA 5CRYA 2CZKA 2WBBA 1FBFA 4O3CA 4M1VA 2H98A 1Y3NA 2I4CA 5TP9A 1FPLA 1WODA 2CZLA 4QXDA 1MM6A 3QXMA 3TCFA 2DOJA 4KI0E 2I0CA 2PVUA 5AA4A 1LBZA 1TWYA 1H76A 4BDMA 4I3YA 1HSJA 1KA1A 1NI9A 3EF7A 1MPBA 1SI1A 2ZYKA 2AIXA 2YLNA 3TCHA 2X7PA 1IITA 1MH4A 1NH8A 4PQJA 3K02A 4I9DA 1WDNA 1O63A 3L6GA 1BTJA 4KYDA 4X9TA 3DELB 2WBDA 1OMPA 1AH5A 3PUZE 4GVOA 5A5LA 4DI4B 4I62A 1KZ8A 4GBVA 3ZSFA 1MS7A 1Y9UA 2O6AA 3E3KA 4OVQA 4MLVA 1B32A 1MRPA 1POTA 4PBQA 3B6TA 2F97A 5AA2A 2QVUA 4NEDA 3A09A 2VGQA 3IR1A 1FSAA 4MJOA 2OCUA 3K6VA 5KCJB 1DSNA 2QS4A 3FXUA 1IXCA 5ET6A 2DDKA 1N3WA 2V84A 4MNCA 3U94A 4PTKA 4THIA 2PMSA 3BFUA 1LAXA 3G3KA 4KCCA 4OEVA 4QFKA 2ANJA 5H8HA 3N94A 3TODA 3IO6A 3SERA 4MH5A 2REGA 4ZEKA 5L9SA 3VFJA 3FGSA 3TKDA 4G8MA 1Z7ME 5DYHA 4OVRA 2ABHA 3KN8A 4GFRA 4XFEA 4PETA 3TPAA 1MQJA 4FEDA 2FNCA 4E0WA 1B4HA 4NN3A 5I3SA 3D1RA 1FPGA 1SW1A 3T9UA 1B0LA 1FPIA 2DP8A 3PV0E 3S2VA 3IFAA 1R1NA 2P2AA 4N81A 3TTNA 4NE4A 2O1MA 4MNIA 4JVDA 4NMYA 4FJPA 3K01A 3H6UA 2QVVA 2OZZA 1SD3A 4ZS9A 1DTGA 4JBZA 4NG7A 4PFTA 3IJOB 5EQ7A 3S9EA 2I3VA 5L9MA 2O7IA 5JTYA 1I6BA 2AL5A 3U92A 3C32A 1A8FA 5AE4A 4U4XA 4PFUA 1EU8A 4H65A 1MY4A 4P56A 2ZXTA 5CBSA 4ZZAA 1Y1ZA 5DTBA 2NXOA 4QF9A 2VP1A 3FV1A 3K4UA 3T9XB 2XWKA 4NWDA 4U21A 3U72A 2VPOA 2ZYOA 4YAHX 3VE1B 3MVXA 4NF4A 3SESA 1IMAA 4H45A 1LAFE 3CIJA 1A99A 3IB0A 3N5LA 4HCYA 1HSEA 2Y7KA 4IY5A 5DW8A 1FTOA 2AL4A 4IO3A 1LAGE 5M2VA 1Y4CA 3GXAA 4PC9A 1P1NA 4U22A 5J16A 3C31A 4LQ2A 2ZYNA 3EHTA 3OO8A 1FPJA 3SETA 4GXSB 4YKIA 3KC1A 1B5IA 1B1HA 4EXKA 5AA2D 3EN3A 1NMUA 3CRBA 4P0IA 3U1OA 4X48A 1XC1A 1OIBA 2QS3A 4IY6A 1H43A 4FIMA 4OEUA 1NFTA 3EHUA 4OFOA 1O64A 4LN5A 2R8TA 4NGUA 3OO6A 4PCDA 1NV2A 5L9OA 1ZU0A 3FXQA 3V5AA 1ZTYA 4R9GA 4NAPA 5EYHA 4QSDA 1DPPA 4AB6A 2DWHA 3H4ZA 2H5YA 4GRKA 1IXIA 3PU5A 1NUXA 2QMWA 3LBSA 5TU0A 4ZE8A 2HFBA 3MAMA 4HTGA 2I0BA 3OSQA 4GXAA 1VFDA 5ESYA 3ZKKA 1D9YA 5AA2B 2IEEA 4PFRA 5HBCA 1IZ1A 4OYVA 2Z8DA 1MQHA 1DCUA 1IMBA 1N04A 1MXZA 4G61A 3FXRA 3T93B 4GWUA 3D4GA 3PUXE 1B40A 2PX1A 4X04A 3EQ1A 3KSJA 1FTKA 5I56A 3FVOA 4XKNA 3FZVA 2WYKA 4YMBA 1JW4A 1NL5A 2RC9A 4G68A 1IMEA 3EHSA 1LSTA 2WEFA 4OANA 3T9HB 4F3PA 4N15A 1MG1A 5H8QB 1FPBA 3RT6B 4EQ7A 2PT1A 2CEXA 4XKQA 3U8QA 1IXGA 1MPDA 4OVTA 4QFLA 2THIA 4R6KA 2VOZA 2D5WA 3VVFA 4XTCQ 5I2KB 4GWXA 4BDQA 2QRYA 4G4PA 4OFLA 4N91A 5I59B 3TZAA 2GQ1A 3RPLB 2I3WA 2F5XA 4BDOA 4Q30B 2VD3A 4GL0A 1B3EA 1UTBB 1BKAA 5CMBA 4OXVA 3EKIA 1QGXA 1ZLQA 1MQDA 4PF6A 2XXYA 2QPQA 1LBBA 4AB5A 3IJXB 5EQAA 3FJMA 2OJTA 3FVKA 1OQGA 3H3GA 4H5FA 1FPFA 4H0WA 2RF1A 3T0JA 3OEKA 4DCYA 3LSWA 1B0HA 5ET7A 4X1DA 3MYUA 2XD3A 1NV4A 4GX4A 3DP4A 2DE4A 3SEXA 4ND9A 1A55A 3A3UA 3WAEA 2BJIA 4ESWA 1YZ0A 2F6PA 1USYH 4PE5B 4PP0A 4U1OA 1LCFA 1NNFA 1NV7A 1PB8A 3FJGA 1IUDA 1A54A 1FTJA 4RNSA 3WAFA 5BUUA 1URDA 3BIHA 3DLNA 3KFMA 2UYEA 3LR1A 1SVXB 4NF6A 5I5PA 2I6EA 4H8JA 4TLLB 2F7CA 3O6HA 3HCQA 1EH3A 1N7XA 1B58A 3FVGA 1OLCA 2GRVA 1IIWA 1GGGA 4FORA 3C33A 3O28A 4NF5A 5K2YA 5FHMA 1B05A 3E13X 3IOVA 4C1TA 3UORA 2Y5KA 3IOUA 3TTMA 4GWSA 3TTLA 2CZIA 3SZPA 4GD5A 4AS5A 2KLFA 1Y1MA 2ONKE 3PGFA 3C4MA 4DIGA 1RDYA 4XXUA 3SEUA 2CZHA 3Q29A 1PC3A 4DDDA 1RDZA 2H4IA 2X26A 1NV5A 5LOMA 3PUYE 3H06B 2Q2AA 4XKPA 3PD9A 1MY2A 3FUZA 2HAUA 4PAKA 3W15C 4O7IA 3PMWA 1FJ9A 3KBZA 4KCDA 3I5OA 4F3SA 5FHOA 3SEYA 3BIGA 4PGNA 4PFWA 4POWA 1M5DA 3KN3A 5I2NA 5CBRA 2HZLA 4DXCA 1ZKBA 2V3TA 4QFPA 2V3UA 3KGCA 1B3HA 2Q74A 3KOSA 4G68B 4N6KA 2Y7PA 3C34A 1CB6A 3C35A 3QSLA 4JSOA 1JVYA 3PD8A 4HCWA 5H8QA 1P1UA 5IAIA 1K9ZA 4N13A 4F1YA 1XOCA 3LV0A 5DEXB 4KFQA 1B46A 1MM7A 2PCRA 3LSXA 2FYIA 4GOTA 3B50A 2F36A 3QIMA 4KPTA 1MXYA 2HCAA 4NWCA 4QRZA 4YB6A 3OEMA 4ZEDA 1LBXA 1B5JA 2XD2A 3ILTB 3FJ7A 5EYGA 2XXHA 4ESXA 1FPDA 4NF0A 1UTHB 1UIVA 2XX9A 2Z8EA 3MZBA 5BWJA 1P99A 4MF3A 3OXNA 1US4A 3TTRA 2B3BA 5KDTB 3HFUA 2RCAA 1LEVA 2XXPA 3UGWA 3JZJA 3OSRA 3HPIA 1Z7NE 3B6QA 5DVJA 3OO7A 1FQFA 1UQWA 3TQLA 1JVXA
chains in the Genus database with same CATH topology
3C31A 4IO4A 4JSDA 1DOTA 1N3XA 4LQ2A 4YICA 2Z22A 2RCBA 1R9LA 1B3GA 2ZYNA 3O97A 4GLIA 4OTEA 3V8XB 3CI8A 3P7IA 2G93A 3EHTA 4R75A 3OO8A 3LSFB 3OELA 3OO9A 3SETA 1VFEA 4XKRA 1OVTA 2E1SA 5I84A 2ONRA 1MDQA 4GXSB 4KR5A 4UACA 4WEPA 4X1BA 4YKIA 4JWXA 4GL8A 1B5IA 1ELJA 3RN8A 4E0XA 4YMAA 3PUVE 4EF2A 5CC2A 3TDJA 3CFZA 1B1HA 4EXKA 5AA2D 1B7HA 1US5A 2DQVA 3EN3A 3K1PA 1NMUA 2HQ0A 2NUVA 3CG3A 3CRBA 4ISUA 4P0IA 4YZZA 1FW0A 1NKXA 2OWSA 1MXUA 1XC1A 4GWOA 4X48A 4KD5A 4Z0IA 5JK4A 1S7YA 3FV2A 1LGBC 1OIBA 1VE4A 3TTKA 4HS7A 3I3VA 2QS3A 1P1OA 4AQ4A 3CFXA 4IY6A 1EZ9A 1N76A 1IEJA 3O6IA 3TQWA 1ZMGA 3Q27A 3H6VA 1N0TA 3TELA 1JEUA 2GFEA 1H43A 2ZYMA 4R2BA 3RT8A 4FIMA 4OEUA 1MQGA 1FTLA 3VLWA 1A7LA 3A3CA 1NFTA 3EHUA 3QAXA 4OFOA 5A5XA 4ZE9A 1DPEA 1QW0A 5L9MA 4F3GA 1O64A 1FTMA 4KQPA 3OO6A 3KZGA 2XXQA 1ZBMA 3FIRA 3O29A 2DE3A 3K6XA 5DT6A 4DXBA 4ELPA 5L9OA 3HO7A 1ZU0A 4LP2B 4H8IA 2XXIA 3FXQA 2PYYA 2DWJA 1FQEA 2V93A 3V5AA 4F18A 1DTZA 4XIGQ 1ZTYA 4R9GA 4FECA 4QSDA 3IB2A 5CI5A 3LSLA 1DPPA 3GLBA 3OMBA 4OMBA 4AB6A 2G29A 2DWHA 4EDPA 1TT1A 3KJ7A 2H99A 3F11A 3O66A 3H4ZA 1KWHA 2H5YA 2DYXA 4GRKA 1URSA 3HHGA 1MY1A 1NNPA 3RTFB 1IXIA 3PU5A 4GIZA 3T22A 4BDRA 2R9JA 4U23A 2RC8A 4EQBA 2QMWA 3LBSA 1BIYA 5TU0A 4ZE8A 4YKKA 2HFBA 4RK9A 4U1ZA 4R74A 5I56B 2XXUA 4UA8A 4ONYA 1FQCA 5JTYB 4RA1A 3MAMA 4HTGA 2I0BA 3OSQA 5H8SA 3JV9A 1VFDA 4GXAA 5H8HB 3RY3A 4U2RA 2ZNSA 5I58A 3N6UA 3IL1B 2I4BA 1B4ZA 4WKMA 4WXJA 1PDAA 3VVEA 3ZKKA 3V83A 2B3FA 1SW2A 3PMVA 1Y3QA 4FATA 1D9YA 1QULA 3CR9A 5AA2B 3S9MC 2IEEA 2Q88A 4YKPA 3T9VA 4OWDA 4F39A 2I49A 1Y3PA 4TQUQ 5HBCA 5B7DA 2P1SA 3MVWA 1IZ1A 1D9VA 3MPKA 4OYVA 2Z8DA 3IAZA 1MQHA 1N7WA 5IKBA 1JETA 1P1WA 1B3LA 3SKPA 4O3AA 5I57B 2H9BA 4GQOA 1N04A 1B3FA 3KEIA 3RUMA 2UYFA 2AYSA 1FQBA 1MXZA 3KBRA 4QHQA 4R2FA 5CMCA 4K3FA 3SDFA 4OVJA 3ZKLA 1H44A 3FXRA 3QUFA 3R6UA 3T93B 1B52A 1TXFA 3TAJA 3D4GA 1I6AA 1JW5A 4H6DA 4HW8A 4YU0A 5KDTA 3PUXE 3MVZA 1BP5A 4I1DA 2B65A 3VLVA 1EZOA 4JB7A 1B40A 1XT8A 2O69A 2PX1A 3G3GA 3VDFA 3N6TA 3QYTA 5FHNA 2XX7A 1TFAA 3EQ1A 1FTKA 1H45A 3KSJA 4IO5A 3MZ1A 3FVOA 4XKNA 3U1OA 4C1UA 3FZVA 5I56A 4DXUA 4YMBA 2F78A 1JW4A 1NL5A 2RC9A 1B51A 2V25A 4G68A 4G8NA 4JDFA 5TPAA 2ESNA 3EHSA 2FA7A 3V89B 1LSTA 1ANFA 5K2XA 4Z7EA 5H8NB 3D4CA 5I58B 2M8CA 3T9HB 4F3PA 3PPOA 1SBPA 3UA8A 4YB5A 4LZ8A 1MG1A 2RKMA 5H8QB 4ZDMA 3TFLA 3AXFA 4DE8A 4MLQA 2O51A 3RT6B 4EQ7A 5FTIA 2PT1A 1Y20A 2XHDA 4NTLA 1POY1 1QUJA 2VHAA 2XX8A 3DP6A 4XKQA 2HAVA 2I48A 3Q25A 1IXGA 4NF8B 3U8QA 4EF1A 4KYEA 1MPDA 4QFLA 2XXXA 3TEPA 4JWYA 1QUIA 2HZKA 3HV1A 1F9BA 3H6TA 3KN7A 1UIUA 2THIA 4QFNA 4R72A 3HHFA 3TCGA 4R6KA 4ZEIA 2YPNA 2VOZA 4NF5B 2D5WA 2F34A 1SYHA 1MDP1 4RPOA 2OBGA 4RXLA 3VVFA 3RNNA 1B5HA 4XTCQ 5I2KB 1MH3A 4ZECA 4BDQA 3GZGA 2ZNUA 3MP6A 5KZTA 3W9WA 1WVJA 1AOVA 4RPNA 2QRYA 4G4PA 1NNTA 4OFLA 2P0SA 4ELOA 3FD3A 3PPQA 4P11A 4R73A 2ZMBA 3K6UA 2UVJA 5AA1A 3BFTA 3RLFE 4H5GA 4F3BA 5I59B 2H25A 3TZAA 5CMKA 3FVNA 2GH9A 3G7WA 3TUSA 5J1DA 4LZ5A 1OQHA 4LVQA 4OETA 2F8DA 2I3WA 1MY0A 3OOAA 1TFDA 2F5XA 3VXBA 1B7ZA 4C0RA 1T0KA 1VSOA 3MZ9A 4BDOA 2DS9A 2ALUA 2D3IA 2Z23A 1S9TA 1A8EA 4Q30B 3T66A 2VD3A 3OD7A 4L17A 1DMBA 5I57A 2Y7RA 4GL0A 1JEVA 1B3EA 4LA9A 4DLDA 3R7XA 2CMOA 1UTBB 2DVCA 1I69A 2PT2A 1BKAA 1Q1KA 3MC2A 1Q35A 5CMBA 4BDLA 1RYOA 1SYIA 2D21A 4F1UA 2DXYA 2HEUA 2XXTA 2DSFA 2F7BA 4OXVA 3Q26A 4POXA 3PPNA 3RPWA 3Q28A 3M3LA 1QKBA 3VVDA 1PEBA 4TOZA 2QS2A 4M4GA 4RK2A 1BLFA 2QSXA 1ZLQA 4DZ1A 1YAEA 1MQDA 1SDXA 4IO7A 4NF6B 5F1QA 4OZ9A 5I2KA 2R6GE 5FTHA 2XXYA 2QPQA 2F7AA 4ZZEA 4IGRA 1YPNA 1II5A 1LBBA 3FATA 3K00A 3MWBA 4AB5A 1J1NA 3M3KA 3IJXB 5H8NA 2Q8JA 3FJMA 2OJTA 2OWTA 2F6GA 2GHAA 5CRYA 3GBBA 3ODBA 3FVKA 3R26A 1SQYA 2I58A 4O3CA 5I59A 3MUQA 5B70A 3UP9A 4P0GA 1OQGA 4LATA 3H3GA 4H5FA 1UTHA 4H0WA 1NNKA 2RF1A 4M1VA 2H98A 3RTWB 1Y3NA 2I4CA 4F19A 1URGA 5TP9A 1WODA 3OEKA 4DCYA 3LSWA 1B0HA 2CZLA 1MM6A 3PMXA 3QXMA 4X1DA 1H3DA 2XD3A 4IB2A 3RQTA 3TCFA 4EXLA 3DP4A 2DE4A 2DOJA 3SEXA 4H1XA 4ND9A 4OERA 4KI0E 2I0CA 3O6GA 1A55A 2PVUA 5AA4A 3A3UA 4RJZA 4IO6A 1TWYA 2A5TA 3WAEA 4F22A 1H76A 3LUYA 4ESWA 4LQ5A 2XXRA 2F6PA 2YJPA 1USYH 4PE5B 4PP0A 4BDMA 5ISUA 4U1OA 1LB9A 4ECFA 1LCFA 5HPQA 1HSJA 1JW1A 3N26A 3TYHA 2A5SA 1NNFA 3EF7A 1R9QA 2QS1A 1VR5A 4YB7A 1PB8A 1D3KA 3FJGA 1IUDA 1A54A 1MPBA 1SI1A 2UXAA 2ZYKA 1FTJA 4R6HA 3UN6A 2NVUB 2AIXA 2YLNA 4RNSA 5EHSA 3TCHA 3WAFA 5BUUA 3ECRA 2X7PA 1M5FA 3B7DA 2HXWA 1IITA 1URDA 4YKJA 2DWIA 1MH4A 1N84A 1NH8A 1UTBA 2DWAA 5CMMA 5ICTA 1FQAA 3MQ9A 1IXHA 3DLNA 5ITPA 4PQJA 5TP9B 1M5CA 4GF8A 3KFMA 3K02A 4I9DA 3G3FA 3KSXA 5TPAB 1WDNA 1O63A 1GTKA 1M5EA 1OVBA 3G3IA 2QL3A 2PBWA 2UYEA 3HN0A 1BTJA 3IORA 3L6GA 1SVXB 3LR1A 3PPPA 1LFGA 4IO2A 4KYDA 4NF6A 1PBPA 3MBPA 3USDA 2I6EA 2IA4A 4H8JA 4X9TA 1FCKA 5KCJA 4TLLB 1AL3A 3DELB 4FE8A 1ZJLA 4OENA 2F7CA 3O6HA 3SEVA 3HCQA 1OMPA 4PFYA 1EH3A 1AH5A 3HSTA 4O3BA 4OHNA 4NF8A 3PUZE 4GVOA 3B6WA 4IGTA 4G8HA 1N7XA 1S50A 1B58A 1QKAA 3FVGA 4I62A 1OLCA 2GRVA 1IIWA 1GGGA 2O7UA 3FASA 1LAHE 3C33A 4FORA 4OFJA 5DVFA 3T96B 3O28A 2GHBA 4NF5A 2R71A 5K2YA 4Q5TA 3ZSFA 4Q8RA 5FHMA 1MXWA 1MS7A 5DVIA 1Y9UA 1QJMA 3G3JA 1B05A 2O6AA 3E13X 3E3KA 1LFHA 4LONB 1CE2A 1YTVA 4MLVA 1B32A 1MRPA 3E9XA 1POTA 3B6TA 4NF4B 3IOVA 3UIFA 3H6WA 2F97A 4C1TA 2O84X 3UORA 2QJEA 2A5TB 3PUWE 5AA2A 1IQ7A 4OQOA 3ZS6A 1JNFA 1XVXA 4NEDA 3A09A 1LB8A 2VGQA 3IR1A 1P1QA 4FEBA 1SW4A 4ZEFA 3PPRA 5ITOA 3BKIB 4MBPA 3IOUA 3TTMA 3RGYA 2OCUA 1QUKA 2UVGA 3K6VA 4JWOA 5KCJB 1AIVA 3TMGA 1AMFA 3O9PA 1DSNA 4FAJA 2QS4A 1OLAA 3TTLA 5CM6A 3FXUA 1IXCA 4GD5A 3MPLA 2KLFA 1B6HA 2BJJX 2V84A 1N3WA 1Y1MA 1LCTA 2ONKE 4RY1A 4U4SA 1GVCA 3PGFA 1M5BA 3U94A 3C4MA 4DIGA 1B9JA 2X7QA 4THIA 4XXUA 4DCXA 2DE2A 2PMSA 3SEUA 3BFUA 1LAXA 2UVIA 3G3KA 2Q9TA 4KCCA 3IK6B 4OEVA 4EQ9A 1EZPA 4G77A 4F29A 3C9HA 3LC8A 4OESA 3BBRA 3Q29A 4QFKA 1PC3A 3SEWA 3C36A 1MY3A 4DDDA 3M3FA 1ZIUA 3S9NC 2H4IA 1USYE 2X26A 2ANJA 2ZNTA 3I6VA 3N94A 3O2AA 5H8HA 4ZEBA 5LOMA 1LBCA 1SI0A 3TODA 1MXXA 3PUYE 3IB1A 3IO6A 1D4NA 4MH5A 4QSEA 3SERA 3M8UA 2REGA 4N6PA 3K1MA 3H06B 1L5TA 2Q2AA 1XS5A 4ZEKA 5L9SA 4XKPA 4R6YA 3PD9A 1MY2A 3VFJA 4BLAA 2XXVA 3FGSA 3QUJA 3FUZA 4R9FA 3DP8A 2HAUA 3TKDA 4G8MA 3W15C 1RYXA 1Z7ME 3PMWA 5DYHA 5H8FB 3KJTA 2O1LA 2ABHA 3S4UA 3KN8A 3EPEA 2F35A 3KG2A 3CFLA 3I5OA 4GFRA 4KCDA 5DEXA 3CG1A 4F3SA 4F31B 3MP1A 4PETA 5FHOA 3THIA 3SEYA 3TPAA 1MQJA 1PBQA 4FEDA 2UVHA 2FNCA 4E0WA 4PFWA 1B4HA 4POWA 1QVSA 3CVGA 4WEDA 2W7YA 1M5DA 3UK4A 2XXWA 1ATGA 1GR2A 3KN3A 4G2ZA 5I2NA 5JEIA 1SW1A 2LAOA 3GBAA 3K1NA 3T9UA 5A5XB 5CBRA 4ELQA 2HZLA 4DXCA 1B0LA 1JQFA 1ZKBA 2REJA 2V3TA 3E4RA 3K2DA 3KGCA 2V3UA 3CSGA 1B3HA 3G3HA 4QFPA 2DVZA 4H67A 2DP8A 4KYSA 4F2QA 3PV0E 1Y4TA 3S2VA 3KOSA 1R1NA 2P2AA 1A40A 4G68B 3TTNA 4F1VA 2Y7PA 3C34A 1NH7A 4NE4A 1CB6A 3C35A 3MJNA 2O1MA 3QSLA 4JSOA 1JVYA 2ONSA 3PD8A 4NMYA 4FJPA 4HCWA 1I6QA 2Y7IA 5H8QA 4MFIA 3K01A 3H6UA 1P1UA 5ELVA 4TLMB 1GV8A 5IAIA 4ELRA 2OZZA 2Z8FA 1SD3A 4ZS9A 4N13A 4F1YA 1LFIA 1DTGA 1XOCA 4JBZA 1MQIA 4QFOA 5DEXB 4KFQA 4PFTA 3QK6A 3W9VA 1B46A 1B2HA 1MM7A 3IJOB 2FYIA 3LSXA 4GOTA 4N07A 2F36A 4QSCA 3K6WA 3IOTA 3QIMA 4BDNA 5AA3A 2I3VA 5ICQA 3S9EA 1PB9A 2OLBA 4EUOA 4KPTA 1MXYA 3U93A 2HCAA 4Q0CA 2Q2CA 2NWJA 4NWCA 1LLSA 2QMXA 2E0SA 2O7IA 4QRZA 4YB6A 1B1XA 3MP8A 3OEMA 1I6BA 2AL5A 4ZEDA 5JTYA 2OK2A 3U92A 3C32A 1A8FA 1B5JA 2VD2A 4I8CA 4U4XA 5F7VA 2XD2A 3ILTB 5AE4A 5HM4B 2Y7WA 3FJ7A 3IX1A 4PFUA 3VXCA 1RKMA 3L6HA 1EU8A 4H65A 1MY4A 2DXRA 3OENA 2ZXTA 5CBSA 2XXHA 4ZZAA 1HSLA 4ESXA 1Y1ZA 3JYRA 5DTBA 1UTHB 2NXOA 4QF9A 2VP1A 2Y84A 5H8FA 3FV1A 3K4UA 4RYAA 3T9XB 1UIVA 2XX9A 2Z8EA 3ILUB 5EHMA 4NWDA 3MZBA 1MPCA 4U21A 4LUBA 3U72A 5BWJA 1P99A 2ZYOA 4YAHX 2V3QA 3CSBA 3VE1B 4MF3A 4F2OA 1XHYA 3MW0A 3MVXA 4NF4A 3SESA 2Q89A 3OXNA 1US4A 2RC7A 4LZ7A 5AA4B 1LAFE 3TTRA 2B3BA 5KDTB 3CIJA 3ONMA 3MVYA 1A99A 2RCAA 2O68A 5I2NB 3IB0A 4G68C 3VV5A 3N5LA 2RINA 1SW5A 4HCYA 1HSEA 3DM0A 3VLUA 2XXPA 2WKYA 1O7TA 3UGWA 1FQDA 2Y7KA 3JZJA 4JXIA 3H7MA 3K0VA 3OSRA 3S9LC 3IOWA 1YCJA 5EYFA 3HPIA 1Z7NE 3B6QA 1B7UA 3IO4A 4IY5A 3OO7A 5DVJA 1FTOA 2AL4A 4KHZE 3H03A 4IO3A 1R6ZA 1LAGE 5L8DA 5M2VA 1FQFA 1PB7A 1UQWA 1Y4CA 1XVYA 3GXAA 1MXVA 1P1NA 3KOTA 2NOOA 4U22A 3TQLA 1JVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C31 A;  4IO4 A;  4JSD A;  1DOT A;  1N3X A;  4LQ2 A;  4YIC A;  2Z22 A;  2RCB A;  1R9L A;  1B3G A;  2ZYN A;  3O97 A;  4GLI A;  4OTE A;  3V8X B;  3CI8 A;  3P7I A;  2G93 A;  3EHT A;  4R75 A;  3OO8 A;  3LSF B;  3OEL A;  3OO9 A;  3SET A;  1VFE A;  4XKR A;  1OVT A;  2E1S A;  5I84 A;  2ONR A;  1MDQ A;  4GXS B;  4KR5 A;  4UAC A;  4WEP A;  4X1B A;  4YKI A;  4JWX A;  4GL8 A;  1B5I A;  1ELJ A;  3RN8 A;  4E0X A;  4YMA A;  3PUV E;  4EF2 A;  5CC2 A;  3TDJ A;  3CFZ A;  1B1H A;  4EXK A;  5AA2 D;  1B7H A;  1US5 A;  2DQV A;  3EN3 A;  3K1P A;  1NMU A;  2HQ0 A;  2NUV A;  3CG3 A;  3CRB A;  4ISU A;  4P0I A;  4YZZ A;  1FW0 A;  1NKX A;  2OWS A;  1MXU A;  1XC1 A;  4GWO A;  4X48 A;  4KD5 A;  4Z0I A;  5JK4 A;  1S7Y A;  3FV2 A;  1LGB C;  1OIB A;  1VE4 A;  3TTK A;  4HS7 A;  3I3V A;  2QS3 A;  1P1O A;  4AQ4 A;  3CFX A;  4IY6 A;  1EZ9 A;  1N76 A;  1IEJ A;  3O6I A;  3TQW A;  1ZMG A;  3Q27 A;  3H6V A;  1N0T A;  3TEL A;  1JEU A;  2GFE A;  1H43 A;  2ZYM A;  4R2B A;  3RT8 A;  4FIM A;  4OEU A;  1MQG A;  1FTL A;  3VLW A;  1A7L A;  3A3C A;  1NFT A;  3EHU A;  3QAX A;  4OFO A;  5A5X A;  4ZE9 A;  1DPE A;  1QW0 A;  5L9M A;  4F3G A;  1O64 A;  1FTM A;  4KQP A;  3OO6 A;  3KZG A;  2XXQ A;  1ZBM A;  3FIR A;  3O29 A;  2DE3 A;  3K6X A;  5DT6 A;  4DXB A;  4ELP A;  5L9O A;  3HO7 A;  1ZU0 A;  4LP2 B;  4H8I A;  2XXI A;  3FXQ A;  2PYY A;  2DWJ A;  1FQE A;  2V93 A;  3V5A A;  4F18 A;  1DTZ A;  4XIG Q;  1ZTY A;  4R9G A;  4FEC A;  4QSD A;  3IB2 A;  5CI5 A;  3LSL A;  1DPP A;  3GLB A;  3OMB A;  4OMB A;  4AB6 A;  2G29 A;  2DWH A;  4EDP A;  1TT1 A;  3KJ7 A;  2H99 A;  3F11 A;  3O66 A;  3H4Z A;  1KWH A;  2H5Y A;  2DYX A;  4GRK A;  1URS A;  3HHG A;  1MY1 A;  1NNP A;  3RTF B;  1IXI A;  3PU5 A;  4GIZ A;  3T22 A;  4BDR A;  2R9J A;  4U23 A;  2RC8 A;  4EQB A;  2QMW A;  3LBS A;  1BIY A;  5TU0 A;  4ZE8 A;  4YKK A;  2HFB A;  4RK9 A;  4U1Z A;  4R74 A;  5I56 B;  2XXU A;  4UA8 A;  4ONY A;  1FQC A;  5JTY B;  4RA1 A;  3MAM A;  4HTG A;  2I0B A;  3OSQ A;  5H8S A;  3JV9 A;  1VFD A;  4GXA A;  5H8H B;  3RY3 A;  4U2R A;  2ZNS A;  5I58 A;  3N6U A;  3IL1 B;  2I4B A;  1B4Z A;  4WKM A;  4WXJ A;  1PDA A;  3VVE A;  3ZKK A;  3V83 A;  2B3F A;  1SW2 A;  3PMV A;  1Y3Q A;  4FAT A;  1D9Y A;  1QUL A;  3CR9 A;  5AA2 B;  3S9M C;  2IEE A;  2Q88 A;  4YKP A;  3T9V A;  4OWD A;  4F39 A;  2I49 A;  1Y3P A;  4TQU Q;  5HBC A;  5B7D A;  2P1S A;  3MVW A;  1IZ1 A;  1D9V A;  3MPK A;  4OYV A;  2Z8D A;  3IAZ A;  1MQH A;  1N7W A;  5IKB A;  1JET A;  1P1W A;  1B3L A;  3SKP A;  4O3A A;  5I57 B;  2H9B A;  4GQO A;  1N04 A;  1B3F A;  3KEI A;  3RUM A;  2UYF A;  2AYS A;  1FQB A;  1MXZ A;  3KBR A;  4QHQ A;  4R2F A;  5CMC A;  4K3F A;  3SDF A;  4OVJ A;  3ZKL A;  1H44 A;  3FXR A;  3QUF A;  3R6U A;  3T93 B;  1B52 A;  1TXF A;  3TAJ A;  3D4G A;  1I6A A;  1JW5 A;  4H6D A;  4HW8 A;  4YU0 A;  5KDT A;  3PUX E;  3MVZ A;  1BP5 A;  4I1D A;  2B65 A;  3VLV A;  1EZO A;  4JB7 A;  1B40 A;  1XT8 A;  2O69 A;  2PX1 A;  3G3G A;  3VDF A;  3N6T A;  3QYT A;  5FHN A;  2XX7 A;  1TFA A;  3EQ1 A;  1FTK A;  1H45 A;  3KSJ A;  4IO5 A;  3MZ1 A;  3FVO A;  4XKN A;  3U1O A;  4C1U A;  3FZV A;  5I56 A;  4DXU A;  4YMB A;  2F78 A;  1JW4 A;  1NL5 A;  2RC9 A;  1B51 A;  2V25 A;  4G68 A;  4G8N A;  4JDF A;  5TPA A;  2ESN A;  3EHS A;  2FA7 A;  3V89 B;  1LST A;  1ANF A;  5K2X A;  4Z7E A;  5H8N B;  3D4C A;  5I58 B;  2M8C A;  3T9H B;  4F3P A;  3PPO A;  1SBP A;  3UA8 A;  4YB5 A;  4LZ8 A;  1MG1 A;  2RKM A;  5H8Q B;  4ZDM A;  3TFL A;  3AXF A;  4DE8 A;  4MLQ A;  2O51 A;  3RT6 B;  4EQ7 A;  5FTI A;  2PT1 A;  1Y20 A;  2XHD A;  4NTL A;  1POY 1;  1QUJ A;  2VHA A;  2XX8 A;  3DP6 A;  4XKQ A;  2HAV A;  2I48 A;  3Q25 A;  1IXG A;  4NF8 B;  3U8Q A;  4EF1 A;  4KYE A;  1MPD A;  4QFL A;  2XXX A;  3TEP A;  4JWY A;  1QUI A;  2HZK A;  3HV1 A;  1F9B A;  3H6T A;  3KN7 A;  1UIU A;  2THI A;  4QFN A;  4R72 A;  3HHF A;  3TCG A;  4R6K A;  4ZEI A;  2YPN A;  2VOZ A;  4NF5 B;  2D5W A;  2F34 A;  1SYH A;  1MDP 1;  4RPO A;  2OBG A;  4RXL A;  3VVF A;  3RNN A;  1B5H A;  4XTC Q;  5I2K B;  1MH3 A;  4ZEC A;  4BDQ A;  3GZG A;  2ZNU A;  3MP6 A;  5KZT A;  3W9W A;  1WVJ A;  1AOV A;  4RPN A;  2QRY A;  4G4P A;  1NNT A;  4OFL A;  2P0S A;  4ELO A;  3FD3 A;  3PPQ A;  4P11 A;  4R73 A;  2ZMB A;  3K6U A;  2UVJ A;  5AA1 A;  3BFT A;  3RLF E;  4H5G A;  4F3B A;  5I59 B;  2H25 A;  3TZA A;  5CMK A;  3FVN A;  2GH9 A;  3G7W A;  3TUS A;  5J1D A;  4LZ5 A;  1OQH A;  4LVQ A;  4OET A;  2F8D A;  2I3W A;  1MY0 A;  3OOA A;  1TFD A;  2F5X A;  3VXB A;  1B7Z A;  4C0R A;  1T0K A;  1VSO A;  3MZ9 A;  4BDO A;  2DS9 A;  2ALU A;  2D3I A;  2Z23 A;  1S9T A;  1A8E A;  4Q30 B;  3T66 A;  2VD3 A;  3OD7 A;  4L17 A;  1DMB A;  5I57 A;  2Y7R A;  4GL0 A;  1JEV A;  1B3E A;  4LA9 A;  4DLD A;  3R7X A;  2CMO A;  1UTB B;  2DVC A;  1I69 A;  2PT2 A;  1BKA A;  1Q1K A;  3MC2 A;  1Q35 A;  5CMB A;  4BDL A;  1RYO A;  1SYI A;  2D21 A;  4F1U A;  2DXY A;  2HEU A;  2XXT A;  2DSF A;  2F7B A;  4OXV A;  3Q26 A;  4POX A;  3PPN A;  3RPW A;  3Q28 A;  3M3L A;  1QKB A;  3VVD A;  1PEB A;  4TOZ A;  2QS2 A;  4M4G A;  4RK2 A;  1BLF A;  2QSX A;  1ZLQ A;  4DZ1 A;  1YAE A;  1MQD A;  1SDX A;  4IO7 A;  4NF6 B;  5F1Q A;  4OZ9 A;  5I2K A;  2R6G E;  5FTH A;  2XXY A;  2QPQ A;  2F7A A;  4ZZE A;  4IGR A;  1YPN A;  1II5 A;  1LBB A;  3FAT A;  3K00 A;  3MWB A;  4AB5 A;  1J1N A;  3M3K A;  3IJX B;  5H8N A;  2Q8J A;  3FJM A;  2OJT A;  2OWT A;  2F6G A;  2GHA A;  5CRY A;  3GBB A;  3ODB A;  3FVK A;  3R26 A;  1SQY A;  2I58 A;  4O3C A;  5I59 A;  3MUQ A;  5B70 A;  3UP9 A;  4P0G A;  1OQG A;  4LAT A;  3H3G A;  4H5F A;  1UTH A;  4H0W A;  1NNK A;  2RF1 A;  4M1V A;  2H98 A;  3RTW B;  1Y3N A;  2I4C A;  4F19 A;  1URG A;  5TP9 A;  1WOD A;  3OEK A;  4DCY A;  3LSW A;  1B0H A;  2CZL A;  1MM6 A;  3PMX A;  3QXM A;  4X1D A;  1H3D A;  2XD3 A;  4IB2 A;  3RQT A;  3TCF A;  4EXL A;  3DP4 A;  2DE4 A;  2DOJ A;  3SEX A;  4H1X A;  4ND9 A;  4OER A;  4KI0 E;  2I0C A;  3O6G A;  1A55 A;  2PVU A;  5AA4 A;  3A3U A;  4RJZ A;  4IO6 A;  1TWY A;  2A5T A;  3WAE A;  4F22 A;  1H76 A;  3LUY A;  4ESW A;  4LQ5 A;  2XXR A;  2F6P A;  2YJP A;  1USY H;  4PE5 B;  4PP0 A;  4BDM A;  5ISU A;  4U1O A;  1LB9 A;  4ECF A;  1LCF A;  5HPQ A;  1HSJ A;  1JW1 A;  3N26 A;  3TYH A;  2A5S A;  1NNF A;  3EF7 A;  1R9Q A;  2QS1 A;  1VR5 A;  4YB7 A;  1PB8 A;  1D3K A;  3FJG A;  1IUD A;  1A54 A;  1MPB A;  1SI1 A;  2UXA A;  2ZYK A;  1FTJ A;  4R6H A;  3UN6 A;  2NVU B;  2AIX A;  2YLN A;  4RNS A;  5EHS A;  3TCH A;  3WAF A;  5BUU A;  3ECR A;  2X7P A;  1M5F A;  3B7D A;  2HXW A;  1IIT A;  1URD A;  4YKJ A;  2DWI A;  1MH4 A;  1N84 A;  1NH8 A;  1UTB A;  2DWA A;  5CMM A;  5ICT A;  1FQA A;  3MQ9 A;  1IXH A;  3DLN A;  5ITP A;  4PQJ A;  5TP9 B;  1M5C A;  4GF8 A;  3KFM A;  3K02 A;  4I9D A;  3G3F A;  3KSX A;  5TPA B;  1WDN A;  1O63 A;  1GTK A;  1M5E A;  1OVB A;  3G3I A;  2QL3 A;  2PBW A;  2UYE A;  3HN0 A;  1BTJ A;  3IOR A;  3L6G A;  1SVX B;  3LR1 A;  3PPP A;  1LFG A;  4IO2 A;  4KYD A;  4NF6 A;  1PBP A;  3MBP A;  3USD A;  2I6E A;  2IA4 A;  4H8J A;  4X9T A;  1FCK A;  5KCJ A;  4TLL B;  1AL3 A;  3DEL B;  4FE8 A;  1ZJL A;  4OEN A;  2F7C A;  3O6H A;  3SEV A;  3HCQ A;  1OMP A;  4PFY A;  1EH3 A;  1AH5 A;  3HST A;  4O3B A;  4OHN A;  4NF8 A;  3PUZ E;  4GVO A;  3B6W A;  4IGT A;  4G8H A;  1N7X A;  1S50 A;  1B58 A;  1QKA A;  3FVG A;  4I62 A;  1OLC A;  2GRV A;  1IIW A;  1GGG A;  2O7U A;  3FAS A;  1LAH E;  3C33 A;  4FOR A;  4OFJ A;  5DVF A;  3T96 B;  3O28 A;  2GHB A;  4NF5 A;  2R71 A;  5K2Y A;  4Q5T A;  3ZSF A;  4Q8R A;  5FHM A;  1MXW A;  1MS7 A;  5DVI A;  1Y9U A;  1QJM A;  3G3J A;  1B05 A;  2O6A A;  3E13 X;  3E3K A;  1LFH A;  4LON B;  1CE2 A;  1YTV A;  4MLV A;  1B32 A;  1MRP A;  3E9X A;  1POT A;  3B6T A;  4NF4 B;  3IOV A;  3UIF A;  3H6W A;  2F97 A;  4C1T A;  2O84 X;  3UOR A;  2QJE A;  2A5T B;  3PUW E;  5AA2 A;  1IQ7 A;  4OQO A;  3ZS6 A;  1JNF A;  1XVX A;  4NED A;  3A09 A;  1LB8 A;  2VGQ A;  3IR1 A;  1P1Q A;  4FEB A;  1SW4 A;  4ZEF A;  3PPR A;  5ITO A;  3BKI B;  4MBP A;  3IOU A;  3TTM A;  3RGY A;  2OCU A;  1QUK A;  2UVG A;  3K6V A;  4JWO A;  5KCJ B;  1AIV A;  3TMG A;  1AMF A;  3O9P A;  1DSN A;  4FAJ A;  2QS4 A;  1OLA A;  3TTL A;  5CM6 A;  3FXU A;  1IXC A;  4GD5 A;  3MPL A;  2KLF A;  1B6H A;  2BJJ X;  2V84 A;  1N3W A;  1Y1M A;  1LCT A;  2ONK E;  4RY1 A;  4U4S A;  1GVC A;  3PGF A;  1M5B A;  3U94 A;  3C4M A;  4DIG A;  1B9J A;  2X7Q A;  4THI A;  4XXU A;  4DCX A;  2DE2 A;  2PMS A;  3SEU A;  3BFU A;  1LAX A;  2UVI A;  3G3K A;  2Q9T A;  4KCC A;  3IK6 B;  4OEV A;  4EQ9 A;  1EZP A;  4G77 A;  4F29 A;  3C9H A;  3LC8 A;  4OES A;  3BBR A;  3Q29 A;  4QFK A;  1PC3 A;  3SEW A;  3C36 A;  1MY3 A;  4DDD A;  3M3F A;  1ZIU A;  3S9N C;  2H4I A;  1USY E;  2X26 A;  2ANJ A;  2ZNT A;  3I6V A;  3N94 A;  3O2A A;  5H8H A;  4ZEB A;  5LOM A;  1LBC A;  1SI0 A;  3TOD A;  1MXX A;  3PUY E;  3IB1 A;  3IO6 A;  1D4N A;  4MH5 A;  4QSE A;  3SER A;  3M8U A;  2REG A;  4N6P A;  3K1M A;  3H06 B;  1L5T A;  2Q2A A;  1XS5 A;  4ZEK A;  5L9S A;  4XKP A;  4R6Y A;  3PD9 A;  1MY2 A;  3VFJ A;  4BLA A;  2XXV A;  3FGS A;  3QUJ A;  3FUZ A;  4R9F A;  3DP8 A;  2HAU A;  3TKD A;  4G8M A;  3W15 C;  1RYX A;  1Z7M E;  3PMW A;  5DYH A;  5H8F B;  3KJT A;  2O1L A;  2ABH A;  3S4U A;  3KN8 A;  3EPE A;  2F35 A;  3KG2 A;  3CFL A;  3I5O A;  4GFR A;  4KCD A;  5DEX A;  3CG1 A;  4F3S A;  4F31 B;  3MP1 A;  4PET A;  5FHO A;  3THI A;  3SEY A;  3TPA A;  1MQJ A;  1PBQ A;  4FED A;  2UVH A;  2FNC A;  4E0W A;  4PFW A;  1B4H A;  4POW A;  1QVS A;  3CVG A;  4WED A;  2W7Y A;  1M5D A;  3UK4 A;  2XXW A;  1ATG A;  1GR2 A;  3KN3 A;  4G2Z A;  5I2N A;  5JEI A;  1SW1 A;  2LAO A;  3GBA A;  3K1N A;  3T9U A;  5A5X B;  5CBR A;  4ELQ A;  2HZL A;  4DXC A;  1B0L A;  1JQF A;  1ZKB A;  2REJ A;  2V3T A;  3E4R A;  3K2D A;  3KGC A;  2V3U A;  3CSG A;  1B3H A;  3G3H A;  4QFP A;  2DVZ A;  4H67 A;  2DP8 A;  4KYS A;  4F2Q A;  3PV0 E;  1Y4T A;  3S2V A;  3KOS A;  1R1N A;  2P2A A;  1A40 A;  4G68 B;  3TTN A;  4F1V A;  2Y7P A;  3C34 A;  1NH7 A;  4NE4 A;  1CB6 A;  3C35 A;  3MJN A;  2O1M A;  3QSL A;  4JSO A;  1JVY A;  2ONS A;  3PD8 A;  4NMY A;  4FJP A;  4HCW A;  1I6Q A;  2Y7I A;  5H8Q A;  4MFI A;  3K01 A;  3H6U A;  1P1U A;  5ELV A;  4TLM B;  1GV8 A;  5IAI A;  4ELR A;  2OZZ A;  2Z8F A;  1SD3 A;  4ZS9 A;  4N13 A;  4F1Y A;  1LFI A;  1DTG A;  1XOC A;  4JBZ A;  1MQI A;  4QFO A;  5DEX B;  4KFQ A;  4PFT A;  3QK6 A;  3W9V A;  1B46 A;  1B2H A;  1MM7 A;  3IJO B;  2FYI A;  3LSX A;  4GOT A;  4N07 A;  2F36 A;  4QSC A;  3K6W A;  3IOT A;  3QIM A;  4BDN A;  5AA3 A;  2I3V A;  5ICQ A;  3S9E A;  1PB9 A;  2OLB A;  4EUO A;  4KPT A;  1MXY A;  3U93 A;  2HCA A;  4Q0C A;  2Q2C A;  2NWJ A;  4NWC A;  1LLS A;  2QMX A;  2E0S A;  2O7I A;  4QRZ A;  4YB6 A;  1B1X A;  3MP8 A;  3OEM A;  1I6B A;  2AL5 A;  4ZED A;  5JTY A;  2OK2 A;  3U92 A;  3C32 A;  1A8F A;  1B5J A;  2VD2 A;  4I8C A;  4U4X A;  5F7V A;  2XD2 A;  3ILT B;  5AE4 A;  5HM4 B;  2Y7W A;  3FJ7 A;  3IX1 A;  4PFU A;  3VXC A;  1RKM A;  3L6H A;  1EU8 A;  4H65 A;  1MY4 A;  2DXR A;  3OEN A;  2ZXT A;  5CBS A;  2XXH A;  4ZZA A;  1HSL A;  4ESX A;  1Y1Z A;  3JYR A;  5DTB A;  1UTH B;  2NXO A;  4QF9 A;  2VP1 A;  2Y84 A;  5H8F A;  3FV1 A;  3K4U A;  4RYA A;  3T9X B;  1UIV A;  2XX9 A;  2Z8E A;  3ILU B;  5EHM A;  4NWD A;  3MZB A;  1MPC A;  4U21 A;  4LUB A;  3U72 A;  5BWJ A;  1P99 A;  2ZYO A;  4YAH X;  2V3Q A;  3CSB A;  3VE1 B;  4MF3 A;  4F2O A;  1XHY A;  3MW0 A;  3MVX A;  4NF4 A;  3SES A;  2Q89 A;  3OXN A;  1US4 A;  2RC7 A;  4LZ7 A;  5AA4 B;  1LAF E;  3TTR A;  2B3B A;  5KDT B;  3CIJ A;  3ONM A;  3MVY A;  1A99 A;  2RCA A;  2O68 A;  5I2N B;  3IB0 A;  4G68 C;  3VV5 A;  3N5L A;  2RIN A;  1SW5 A;  4HCY A;  1HSE A;  3DM0 A;  3VLU A;  2XXP A;  2WKY A;  1O7T A;  3UGW A;  1FQD A;  2Y7K A;  3JZJ A;  4JXI A;  3H7M A;  3K0V A;  3OSR A;  3S9L C;  3IOW A;  1YCJ A;  5EYF A;  3HPI A;  1Z7N E;  3B6Q A;  1B7U A;  3IO4 A;  4IY5 A;  3OO7 A;  5DVJ A;  1FTO A;  2AL4 A;  4KHZ E;  3H03 A;  4IO3 A;  1R6Z A;  1LAG E;  5L8D A;  5M2V A;  1FQF A;  1PB7 A;  1UQW A;  1Y4C A;  1XVY A;  3GXA A;  1MXV A;  1P1N A;  3KOT A;  2NOO A;  4U22 A;  3TQL A;  1JVX A; 
#chains in the Genus database with same CATH topology
 4GWZ A;  4PGP A;  4JSD A;  4YIC A;  4GLI A;  3ZS6 A;  1B3G A;  1D9Q A;  2G93 A;  5I84 A;  2E1S A;  3B8B A;  4KR5 A;  4WEP A;  1NV3 A;  4JWX A;  4E0X A;  5CC2 A;  3TDJ A;  1US5 A;  2DQV A;  4DI3 D;  2HQ0 A;  4YZZ A;  4GWO A;  3FV2 A;  1VE4 A;  4OA4 A;  3CFX A;  1N76 A;  3TQW A;  3Q27 A;  1N0T A;  1JEU A;  3RT8 A;  1MQG A;  1FTL A;  3VLW A;  1DPE A;  1QW0 A;  3KZG A;  1ZBM A;  2DE3 A;  4ELP A;  4LP2 B;  2XXI A;  2PYY A;  2DWJ A;  2V93 A;  5IZZ A;  4X8R A;  1Q9D A;  2H99 A;  1MY1 A;  1NNP A;  3T22 A;  4YKK A;  4RK9 A;  4U1Z A;  5JTY B;  5H8S A;  3RY3 A;  2ZNS A;  2I4B A;  4PFB A;  3PMV A;  2QFL A;  2Q88 A;  3T9V A;  4F39 A;  5B7D A;  5ET5 A;  2P1S A;  3MVW A;  3MPK A;  1N7W A;  4O94 A;  2KR0 A;  3SKP A;  2H9B A;  4OVJ A;  3ZKL A;  3R6U A;  1TXF A;  1I6A A;  1JW5 A;  3MVZ A;  4I1D A;  3VDF A;  3G3G A;  2XX7 A;  4IO5 A;  2XWI A;  1RDX A;  2V25 A;  5ICQ A;  5TPA A;  1FBC A;  2ESN A;  5I58 B;  4Z7E A;  3D4C A;  3UA8 A;  4YB5 A;  2RKM A;  2HXR A;  1Y20 A;  2XHD A;  1POY 1;  4NF8 B;  3Q25 A;  4EF1 A;  3HV1 A;  3H6T A;  4QFN A;  1UIU A;  3TCG A;  4R72 A;  3HHF A;  2YPN A;  3RNN A;  3GZG A;  2ZNU A;  4RPN A;  4R73 A;  3K6U A;  3CHG A;  4F3B A;  3RLF E;  5IGA A;  2H25 A;  5CMK A;  3FVN A;  1K9Y A;  3G7W A;  4LZ5 A;  4OET A;  1T0K A;  1B7Z A;  2ALU A;  3T66 A;  1A8E A;  4L17 A;  2P3V A;  1JEV A;  3R7X A;  2CMO A;  2DVC A;  1I69 A;  2PT2 A;  1Q35 A;  4BDL A;  4F1U A;  2XXT A;  2DSF A;  4POX A;  3Q26 A;  3QMF A;  1FBP A;  1PEB A;  4RK2 A;  1BLF A;  1SDX A;  4IO7 A;  5F1Q A;  5FTH A;  4ZZE A;  4MAG A;  4UAB A;  5IZ1 A;  3FXB A;  3ODB A;  3R26 A;  1SQY A;  2I58 A;  3MUQ A;  5B70 A;  4LAT A;  1UTH A;  1NNK A;  3RTW B;  4F19 A;  4DXB A;  1H3D A;  4EXL A;  4OER A;  2A5T A;  4F22 A;  5ISU A;  1JW1 A;  1R9Q A;  1YYZ A;  2QS1 A;  2HHM A;  1VR5 A;  1YXI A;  3UN6 A;  4GWW A;  3B7D A;  4GBW A;  2HXW A;  4YKJ A;  1N84 A;  1UTB A;  2DWA A;  3MQ9 A;  1G0H A;  1IXH A;  5ITP A;  5TP9 B;  4MHF A;  1M5C A;  3G3F A;  4C0R A;  3G3I A;  2PBW A;  3PPP A;  3HN0 A;  4IO2 A;  1LFG A;  1PBP A;  3MBP A;  3USD A;  5KCJ A;  4FE8 A;  4OEN A;  3HST A;  4OHN A;  3B6W A;  5FBP A;  4G8H A;  1S50 A;  1DBZ A;  1CNQ A;  3FAS A;  4OFJ A;  3T96 B;  2GHB A;  4PAI A;  2Q8M A;  1MXW A;  5DVI A;  1LFH A;  1QJM A;  3G3J A;  2XWV A;  1CE2 A;  1YTV A;  4LON B;  3H6W A;  1IQ7 A;  1JNF A;  1LB8 A;  1P1Q A;  4FEB A;  4ZEF A;  5ITO A;  3BKI B;  4MBP A;  3RGY A;  1FBG A;  1QUK A;  4JWO A;  3TMG A;  3O9P A;  4MCO A;  3RYD A;  3MPL A;  4MNP A;  4RY1 A;  1GVC A;  1LBV A;  1M5B A;  2PFZ A;  1B9J A;  2X7Q A;  2Q9T A;  3IK6 B;  4EQ9 A;  5LDZ A;  4G77 A;  3LC8 A;  3PTY A;  4OES A;  3BBR A;  3C36 A;  2FIX A;  3S9N C;  1USY E;  4XF5 A;  4ZEB A;  1LBC A;  1SI0 A;  1MXX A;  1D4N A;  4N6P A;  1L5T A;  3K1M A;  2KQZ A;  4HE2 A;  4R6Y A;  4BLA A;  2XXV A;  3QUJ A;  3DP8 A;  4PFI A;  5H8F B;  3S4U A;  3EPE A;  3CG1 A;  3MP1 A;  1PBQ A;  4FBP A;  4MX6 A;  1QVS A;  3CVG A;  1GR2 A;  2FVZ A;  5JEI A;  5A5X B;  2LAO A;  3K1N A;  1KA0 A;  2XXK A;  2REJ A;  2DVZ A;  4F2Q A;  3GYY A;  3S9L C;  1Y4T A;  3MJN A;  4N8G A;  2ONS A;  1I6Q A;  4MFI A;  5ELV A;  2Z8F A;  1LFI A;  1MQI A;  4QFO A;  4FAJ A;  1B2H A;  1NUZ A;  4QSC A;  3K6W A;  3IOT A;  4BDN A;  2P3N A;  2OLB A;  4EUO A;  3U93 A;  1FPE A;  1LLS A;  2VD2 A;  2Y7W A;  3IX1 A;  3L6H A;  3OEN A;  3JYR A;  2Y84 A;  4I3E A;  3ILU B;  5IZ3 A;  1MPC A;  4PF8 A;  3CSB A;  4F2O A;  3MW0 A;  2RC7 A;  3MVY A;  4PE3 A;  5I2N B;  4G68 C;  1SW5 A;  3DM0 A;  3VLU A;  4NX1 A;  4JXI A;  4HE1 A;  3K0V A;  3IOW A;  5EYF A;  1IMD A;  4KHZ E;  1R6Z A;  5L8D A;  3U65 A;  3KOT A;  1MXV A;  4GX3 A;  3N26 A;  1N3X A;  2RCB A;  3V8X B;  3CI8 A;  3P7I A;  4R75 A;  1OVT A;  4UAC A;  4GL8 A;  3RN8 A;  4EF2 A;  3CFZ A;  4NHB A;  2NUV A;  3CG3 A;  3A29 A;  2OWS A;  4Z0I A;  5JK4 A;  1S7Y A;  2VPN A;  5ET8 A;  4AQ4 A;  1AWB A;  3IFC A;  1EZ9 A;  1ZMG A;  3H6V A;  2GFE A;  1FBH A;  1A7L A;  3A3C A;  3QAX A;  5F24 A;  4ZE9 A;  4P47 A;  1FTM A;  2FBP A;  4KQP A;  2XXQ A;  3O29 A;  4O8M A;  1FQE A;  1DTZ A;  4XIG Q;  4FEC A;  3IB2 A;  2G29 A;  1NV1 A;  1TT1 A;  3F11 A;  3RTF B;  4GIZ A;  4BDR A;  2R9J A;  4O7M A;  1BIY A;  4R74 A;  5I56 B;  4UA8 A;  1NV6 A;  2CEY A;  3N6U A;  3IL1 B;  3VVE A;  1B4Z A;  4WXJ A;  1PDA A;  3V83 A;  1Y3Q A;  1QUL A;  2F3D A;  4P1E A;  2I49 A;  1Y3P A;  4TQU Q;  1D9V A;  5I7I A;  3IAZ A;  5IKB A;  5I57 B;  4N6D A;  1B3F A;  2UYF A;  2AYS A;  1FQB A;  3KBR A;  4K3F A;  3SDF A;  4OVS A;  1H44 A;  1NV0 A;  1B52 A;  4HW8 A;  5KDT A;  1BP5 A;  3VLV A;  4JB7 A;  1XT8 A;  3N6T A;  3QYT A;  4C1U A;  1H45 A;  4NQ8 A;  4DXU A;  5H8N B;  2FA7 A;  1ANF A;  2M8C A;  3PPO A;  3TFL A;  4LZ8 A;  4ZDM A;  2FIE A;  4AS4 A;  4DE8 A;  2O51 A;  2VHA A;  3TEP A;  1EYJ A;  4JWY A;  1QUI A;  1BK4 A;  1INP A;  4RXL A;  3ROJ A;  1MH3 A;  4PDH A;  1SPI A;  3W9W A;  2P0S A;  3FD3 A;  3PPQ A;  5AA1 A;  2ZZV A;  5J1D A;  4LVQ A;  1OQH A;  2F8D A;  1VSO A;  3MZ9 A;  2DS9 A;  2D3I A;  1DMB A;  4LA9 A;  1RYO A;  1SYI A;  2DXY A;  2B4L A;  3PPN A;  3RPW A;  3Q28 A;  1QKB A;  3VVD A;  2QS2 A;  4M4G A;  1NUY A;  5I2K A;  2F7A A;  4IGR A;  1YPN A;  3FAT A;  3MWB A;  2F6G A;  3GBB A;  1NUW A;  5I59 A;  2FHY A;  3UP9 A;  4P0G A;  1URG A;  3RQT A;  3PMX A;  5IZ3 B;  4IB2 A;  4H1X A;  3O6G A;  5EQ8 A;  4RJZ A;  4IO6 A;  4HXV A;  3LUY A;  4LQ5 A;  2XXR A;  2YJP A;  4ECF A;  1LB9 A;  5HPQ A;  2XA5 A;  3TYH A;  2A5S A;  5IM2 A;  4YB7 A;  1D3K A;  2WYP A;  2UXA A;  4R6H A;  2NVU B;  5EHS A;  3ECR A;  1M5F A;  2DWI A;  5CMM A;  5ICT A;  1FQA A;  4N8Y A;  4GF8 A;  3KSX A;  5TPA B;  1OVB A;  1GTK A;  1M5E A;  2QL3 A;  3IOR A;  3LUZ A;  5T3J A;  2IA4 A;  1FCK A;  1AL3 A;  1ZJL A;  3SEV A;  4PFY A;  4O3B A;  4NF8 A;  4IGT A;  3NOH A;  2PFY A;  2HPG A;  1QKA A;  2O7U A;  1LAH E;  5DVF A;  4I40 A;  2R71 A;  3E78 A;  4Q5T A;  4Q8R A;  3E9X A;  4NF4 B;  3UIF A;  1JP4 A;  2O84 X;  2QJE A;  2A5T B;  3PUW E;  4OQO A;  1XVX A;  1SW4 A;  3PPR A;  4PAF A;  2UVG A;  1AIV A;  1AMF A;  1OLA A;  5CM6 A;  4P9K A;  1B6H A;  2BJJ X;  4HE0 A;  1LCT A;  4U4S A;  4DCX A;  2DE2 A;  1VDW A;  2UVI A;  2WX9 A;  1EZP A;  4F29 A;  3C9H A;  2V4C A;  3SEW A;  1MY3 A;  3M3F A;  1ZIU A;  2ZNT A;  3I6V A;  3O2A A;  3IB1 A;  4QSE A;  1EYI A;  3M8U A;  1XS5 A;  1FJ6 A;  4R9F A;  1RYX A;  4IR8 A;  3KJT A;  2O1L A;  5DEX A;  3KG2 A;  2F35 A;  3CFL A;  4F31 B;  3THI A;  2UVH A;  4WED A;  2W7Y A;  3UK4 A;  2XXW A;  1ATG A;  4N17 A;  5EQ9 A;  4G2Z A;  3GBA A;  4ELQ A;  1FBE A;  1JQF A;  3MP6 A;  3E4R A;  3K2D A;  3CSG A;  3G3H A;  4KYS A;  4H67 A;  2QVR A;  5HM4 B;  1A40 A;  4N4U A;  4F1V A;  1NH7 A;  4QBA A;  2Y7I A;  4TLM B;  1GV8 A;  4ELR A;  3MST A;  4PBH A;  3W9V A;  3QK6 A;  4MMP A;  4N07 A;  5AA3 A;  3T1B A;  1PB9 A;  2OWZ A;  4Q0C A;  2Q2C A;  2NWJ A;  2QMX A;  2E0S A;  1B1X A;  2OX3 A;  3MP8 A;  2OK2 A;  4I8C A;  5F7V A;  3VXC A;  1FRP A;  1RKM A;  2DXR A;  1FPK A;  1HSL A;  5H8F A;  1G0I A;  2Y5L A;  4RYA A;  5EHM A;  4LUB A;  1EYK A;  2V3Q A;  1XI6 A;  1XHY A;  2ZZW A;  2Q89 A;  4LZ7 A;  5AA4 B;  3ONM A;  2O68 A;  3VV5 A;  2RIN A;  4P3L A;  2WKY A;  1O7T A;  1FQD A;  3H7M A;  4MEV A;  1YCJ A;  1B7U A;  3IO4 A;  3TAJ A;  3H03 A;  1PB7 A;  1XVY A;  2NOO A;  4MIJ A;  4IO4 A;  1DOT A;  2Z22 A;  3O97 A;  1R9L A;  4OTE A;  3LSF B;  3OEL A;  3OO9 A;  1VFE A;  4XKR A;  2ONR A;  1MDQ A;  4X1B A;  1ELJ A;  4YMA A;  3PUV E;  2F3B A;  1B7H A;  4H46 A;  3K1P A;  4ISU A;  1FW0 A;  1NKX A;  1MXU A;  4KD5 A;  1LGB C;  4JVI A;  3TTK A;  4HS7 A;  3I3V A;  3RPL A;  1P1O A;  4P1L A;  2MKZ A;  3KC0 A;  4XEQ A;  4PDD A;  1IEJ A;  3O6I A;  1LBY A;  3TEL A;  2ZYM A;  4R2B A;  2B4M A;  5A5X A;  4F3G A;  1FBD A;  3FIR A;  3ISP A;  3K6X A;  5DT6 A;  5LTC A;  3HO7 A;  4H8I A;  4F18 A;  1LBW A;  5CI5 A;  4KXP A;  3LSL A;  3GLB A;  3OMB A;  4OMB A;  4EDP A;  2ZZX A;  3KJ7 A;  3O66 A;  1KWH A;  2DYX A;  2XWO A;  1URS A;  3HHG A;  1IMF A;  4GX6 A;  4U23 A;  2RC8 A;  4EQB A;  2XXU A;  4ONY A;  1FQC A;  4RA1 A;  3JV9 A;  5H8H B;  4U2R A;  5I58 A;  4WKM A;  2B3F A;  1SW2 A;  4FAT A;  3CR9 A;  3S9M C;  4YKP A;  4OWD A;  1JET A;  1P1W A;  1B3L A;  4O3A A;  4GQO A;  3KEI A;  3RUM A;  4QHQ A;  4R2F A;  5CMC A;  3E79 A;  3QUF A;  1DK4 A;  4H6D A;  4YU0 A;  1EZO A;  2B65 A;  2O69 A;  5FHN A;  1TFA A;  4P8B A;  3MZ1 A;  1IMC A;  2F78 A;  4G8N A;  4JDF A;  1B51 A;  4GWY A;  3V89 B;  5K2X A;  1SBP A;  3AXF A;  4MLQ A;  5FTI A;  4NTL A;  1QUJ A;  2XX8 A;  3DP6 A;  2HAV A;  2I48 A;  4KYE A;  2XXX A;  2HZK A;  2L5V A;  1F9B A;  3KN7 A;  4ZEI A;  4NF5 B;  2F34 A;  1SYH A;  2JJK A;  1MDP 1;  4JVC A;  4RPO A;  2OBG A;  1B5H A;  1FTA A;  4ZEC A;  5KZT A;  1AOV A;  1WVJ A;  1NNT A;  4ELO A;  4P11 A;  2ZMB A;  2UVJ A;  3BFT A;  4H5G A;  2GH9 A;  3TUS A;  3VXB A;  3OOA A;  1MY0 A;  1TFD A;  2Z23 A;  1S9T A;  5I57 A;  3OD7 A;  2Y7R A;  4DLD A;  1Q1K A;  3MC2 A;  3FBP A;  2D21 A;  2HEU A;  2F7B A;  3M3L A;  4TOZ A;  2QSX A;  4DZ1 A;  1YAE A;  4NF6 B;  4OZ9 A;  2R6G E;  1II5 A;  3K00 A;  1J1N A;  3M3K A;  5H8N A;  2Q8J A;  2VT5 A;  2OWT A;  4OVP A;  2GHA A;  5CRY A;  2CZK A;  2WBB A;  1FBF A;  4O3C A;  4M1V A;  2H98 A;  1Y3N A;  2I4C A;  5TP9 A;  1FPL A;  1WOD A;  2CZL A;  4QXD A;  1MM6 A;  3QXM A;  3TCF A;  2DOJ A;  4KI0 E;  2I0C A;  2PVU A;  5AA4 A;  1LBZ A;  1TWY A;  1H76 A;  4BDM A;  4I3Y A;  1HSJ A;  1KA1 A;  1NI9 A;  3EF7 A;  1MPB A;  1SI1 A;  2ZYK A;  2AIX A;  2YLN A;  3TCH A;  2X7P A;  1IIT A;  1MH4 A;  1NH8 A;  4PQJ A;  3K02 A;  4I9D A;  1WDN A;  1O63 A;  3L6G A;  1BTJ A;  4KYD A;  4X9T A;  3DEL B;  2WBD A;  1OMP A;  1AH5 A;  3PUZ E;  4GVO A;  5A5L A;  4DI4 B;  4I62 A;  1KZ8 A;  4GBV A;  3ZSF A;  1MS7 A;  1Y9U A;  2O6A A;  3E3K A;  4OVQ A;  4MLV A;  1B32 A;  1MRP A;  1POT A;  4PBQ A;  3B6T A;  2F97 A;  5AA2 A;  2QVU A;  4NED A;  3A09 A;  2VGQ A;  3IR1 A;  1FSA A;  4MJO A;  2OCU A;  3K6V A;  5KCJ B;  1DSN A;  2QS4 A;  3FXU A;  1IXC A;  5ET6 A;  2DDK A;  1N3W A;  2V84 A;  4MNC A;  3U94 A;  4PTK A;  4THI A;  2PMS A;  3BFU A;  1LAX A;  3G3K A;  4KCC A;  4OEV A;  4QFK A;  2ANJ A;  5H8H A;  3N94 A;  3TOD A;  3IO6 A;  3SER A;  4MH5 A;  2REG A;  4ZEK A;  5L9S A;  3VFJ A;  3FGS A;  3TKD A;  4G8M A;  1Z7M E;  5DYH A;  4OVR A;  2ABH A;  3KN8 A;  4GFR A;  4XFE A;  4PET A;  3TPA A;  1MQJ A;  4FED A;  2FNC A;  4E0W A;  1B4H A;  4NN3 A;  5I3S A;  3D1R A;  1FPG A;  1SW1 A;  3T9U A;  1B0L A;  1FPI A;  2DP8 A;  3PV0 E;  3S2V A;  3IFA A;  1R1N A;  2P2A A;  4N81 A;  3TTN A;  4NE4 A;  2O1M A;  4MNI A;  4JVD A;  4NMY A;  4FJP A;  3K01 A;  3H6U A;  2QVV A;  2OZZ A;  1SD3 A;  4ZS9 A;  1DTG A;  4JBZ A;  4NG7 A;  4PFT A;  3IJO B;  5EQ7 A;  3S9E A;  2I3V A;  5L9M A;  2O7I A;  5JTY A;  1I6B A;  2AL5 A;  3U92 A;  3C32 A;  1A8F A;  5AE4 A;  4U4X A;  4PFU A;  1EU8 A;  4H65 A;  1MY4 A;  4P56 A;  2ZXT A;  5CBS A;  4ZZA A;  1Y1Z A;  5DTB A;  2NXO A;  4QF9 A;  2VP1 A;  3FV1 A;  3K4U A;  3T9X B;  2XWK A;  4NWD A;  4U21 A;  3U72 A;  2VPO A;  2ZYO A;  4YAH X;  3VE1 B;  3MVX A;  4NF4 A;  3SES A;  1IMA A;  4H45 A;  1LAF E;  3CIJ A;  1A99 A;  3IB0 A;  3N5L A;  4HCY A;  1HSE A;  2Y7K A;  4IY5 A;  5DW8 A;  1FTO A;  2AL4 A;  4IO3 A;  1LAG E;  5M2V A;  1Y4C A;  3GXA A;  4PC9 A;  1P1N A;  4U22 A;  5J16 A;  3C31 A;  4LQ2 A;  2ZYN A;  3EHT A;  3OO8 A;  1FPJ A;  3SET A;  4GXS B;  4YKI A;  3KC1 A;  1B5I A;  1B1H A;  4EXK A;  5AA2 D;  3EN3 A;  1NMU A;  3CRB A;  4P0I A;  3U1O A;  4X48 A;  1XC1 A;  1OIB A;  2QS3 A;  4IY6 A;  1H43 A;  4FIM A;  4OEU A;  1NFT A;  3EHU A;  4OFO A;  1O64 A;  4LN5 A;  2R8T A;  4NGU A;  3OO6 A;  4PCD A;  1NV2 A;  5L9O A;  1ZU0 A;  3FXQ A;  3V5A A;  1ZTY A;  4R9G A;  4NAP A;  5EYH A;  4QSD A;  1DPP A;  4AB6 A;  2DWH A;  3H4Z A;  2H5Y A;  4GRK A;  1IXI A;  3PU5 A;  1NUX A;  2QMW A;  3LBS A;  5TU0 A;  4ZE8 A;  2HFB A;  3MAM A;  4HTG A;  2I0B A;  3OSQ A;  4GXA A;  1VFD A;  5ESY A;  3ZKK A;  1D9Y A;  5AA2 B;  2IEE A;  4PFR A;  5HBC A;  1IZ1 A;  4OYV A;  2Z8D A;  1MQH A;  1DCU A;  1IMB A;  1N04 A;  1MXZ A;  4G61 A;  3FXR A;  3T93 B;  4GWU A;  3D4G A;  3PUX E;  1B40 A;  2PX1 A;  4X04 A;  3EQ1 A;  3KSJ A;  1FTK A;  5I56 A;  3FVO A;  4XKN A;  3FZV A;  2WYK A;  4YMB A;  1JW4 A;  1NL5 A;  2RC9 A;  4G68 A;  1IME A;  3EHS A;  1LST A;  2WEF A;  4OAN A;  3T9H B;  4F3P A;  4N15 A;  1MG1 A;  5H8Q B;  1FPB A;  3RT6 B;  4EQ7 A;  2PT1 A;  2CEX A;  4XKQ A;  3U8Q A;  1IXG A;  1MPD A;  4OVT A;  4QFL A;  2THI A;  4R6K A;  2VOZ A;  2D5W A;  3VVF A;  4XTC Q;  5I2K B;  4GWX A;  4BDQ A;  2QRY A;  4G4P A;  4OFL A;  4N91 A;  5I59 B;  3TZA A;  2GQ1 A;  3RPL B;  2I3W A;  2F5X A;  4BDO A;  4Q30 B;  2VD3 A;  4GL0 A;  1B3E A;  1UTB B;  1BKA A;  5CMB A;  4OXV A;  3EKI A;  1QGX A;  1ZLQ A;  1MQD A;  4PF6 A;  2XXY A;  2QPQ A;  1LBB A;  4AB5 A;  3IJX B;  5EQA A;  3FJM A;  2OJT A;  3FVK A;  1OQG A;  3H3G A;  4H5F A;  1FPF A;  4H0W A;  2RF1 A;  3T0J A;  3OEK A;  4DCY A;  3LSW A;  1B0H A;  5ET7 A;  4X1D A;  3MYU A;  2XD3 A;  1NV4 A;  4GX4 A;  3DP4 A;  2DE4 A;  3SEX A;  4ND9 A;  1A55 A;  3A3U A;  3WAE A;  2BJI A;  4ESW A;  1YZ0 A;  2F6P A;  1USY H;  4PE5 B;  4PP0 A;  4U1O A;  1LCF A;  1NNF A;  1NV7 A;  1PB8 A;  3FJG A;  1IUD A;  1A54 A;  1FTJ A;  4RNS A;  3WAF A;  5BUU A;  1URD A;  3BIH A;  3DLN A;  3KFM A;  2UYE A;  3LR1 A;  1SVX B;  4NF6 A;  5I5P A;  2I6E A;  4H8J A;  4TLL B;  2F7C A;  3O6H A;  3HCQ A;  1EH3 A;  1N7X A;  1B58 A;  3FVG A;  1OLC A;  2GRV A;  1IIW A;  1GGG A;  4FOR A;  3C33 A;  3O28 A;  4NF5 A;  5K2Y A;  5FHM A;  1B05 A;  3E13 X;  3IOV A;  4C1T A;  3UOR A;  2Y5K A;  3IOU A;  3TTM A;  4GWS A;  3TTL A;  2CZI A;  3SZP A;  4GD5 A;  4AS5 A;  2KLF A;  1Y1M A;  2ONK E;  3PGF A;  3C4M A;  4DIG A;  1RDY A;  4XXU A;  3SEU A;  2CZH A;  3Q29 A;  1PC3 A;  4DDD A;  1RDZ A;  2H4I A;  2X26 A;  1NV5 A;  5LOM A;  3PUY E;  3H06 B;  2Q2A A;  4XKP A;  3PD9 A;  1MY2 A;  3FUZ A;  2HAU A;  4PAK A;  3W15 C;  4O7I A;  3PMW A;  1FJ9 A;  3KBZ A;  4KCD A;  3I5O A;  4F3S A;  5FHO A;  3SEY A;  3BIG A;  4PGN A;  4PFW A;  4POW A;  1M5D A;  3KN3 A;  5I2N A;  5CBR A;  2HZL A;  4DXC A;  1ZKB A;  2V3T A;  4QFP A;  2V3U A;  3KGC A;  1B3H A;  2Q74 A;  3KOS A;  4G68 B;  4N6K A;  2Y7P A;  3C34 A;  1CB6 A;  3C35 A;  3QSL A;  4JSO A;  1JVY A;  3PD8 A;  4HCW A;  5H8Q A;  1P1U A;  5IAI A;  1K9Z A;  4N13 A;  4F1Y A;  1XOC A;  3LV0 A;  5DEX B;  4KFQ A;  1B46 A;  1MM7 A;  2PCR A;  3LSX A;  2FYI A;  4GOT A;  3B50 A;  2F36 A;  3QIM A;  4KPT A;  1MXY A;  2HCA A;  4NWC A;  4QRZ A;  4YB6 A;  3OEM A;  4ZED A;  1LBX A;  1B5J A;  2XD2 A;  3ILT B;  3FJ7 A;  5EYG A;  2XXH A;  4ESX A;  1FPD A;  4NF0 A;  1UTH B;  1UIV A;  2XX9 A;  2Z8E A;  3MZB A;  5BWJ A;  1P99 A;  4MF3 A;  3OXN A;  1US4 A;  3TTR A;  2B3B A;  5KDT B;  3HFU A;  2RCA A;  1LEV A;  2XXP A;  3UGW A;  3JZJ A;  3OSR A;  3HPI A;  1Z7N E;  3B6Q A;  5DVJ A;  3OO7 A;  1FQF A;  1UQW A;  3TQL A;  1JVX A; 
#chains in the Genus database with same CATH homology
 3C31 A;  4IO4 A;  4JSD A;  1DOT A;  1N3X A;  4LQ2 A;  4YIC A;  2Z22 A;  2RCB A;  1R9L A;  1B3G A;  2ZYN A;  3O97 A;  4GLI A;  4OTE A;  3V8X B;  3CI8 A;  3P7I A;  2G93 A;  3EHT A;  4R75 A;  3OO8 A;  3LSF B;  3OEL A;  3OO9 A;  3SET A;  1VFE A;  4XKR A;  1OVT A;  2E1S A;  5I84 A;  2ONR A;  1MDQ A;  4GXS B;  4KR5 A;  4UAC A;  4WEP A;  4X1B A;  4YKI A;  4JWX A;  4GL8 A;  1B5I A;  1ELJ A;  3RN8 A;  4E0X A;  4YMA A;  3PUV E;  4EF2 A;  5CC2 A;  3TDJ A;  3CFZ A;  1B1H A;  4EXK A;  5AA2 D;  1B7H A;  1US5 A;  2DQV A;  3EN3 A;  3K1P A;  1NMU A;  2HQ0 A;  2NUV A;  3CG3 A;  3CRB A;  4ISU A;  4P0I A;  4YZZ A;  1FW0 A;  1NKX A;  2OWS A;  1MXU A;  1XC1 A;  4GWO A;  4X48 A;  4KD5 A;  4Z0I A;  5JK4 A;  1S7Y A;  3FV2 A;  1LGB C;  1OIB A;  1VE4 A;  3TTK A;  4HS7 A;  3I3V A;  2QS3 A;  1P1O A;  4AQ4 A;  3CFX A;  4IY6 A;  1EZ9 A;  1N76 A;  1IEJ A;  3O6I A;  3TQW A;  1ZMG A;  3Q27 A;  3H6V A;  1N0T A;  3TEL A;  1JEU A;  2GFE A;  1H43 A;  2ZYM A;  4R2B A;  3RT8 A;  4FIM A;  4OEU A;  1MQG A;  1FTL A;  3VLW A;  1A7L A;  3A3C A;  1NFT A;  3EHU A;  3QAX A;  4OFO A;  5A5X A;  4ZE9 A;  1DPE A;  1QW0 A;  5L9M A;  4F3G A;  1O64 A;  1FTM A;  4KQP A;  3OO6 A;  3KZG A;  2XXQ A;  1ZBM A;  3FIR A;  3O29 A;  2DE3 A;  3K6X A;  5DT6 A;  4DXB A;  4ELP A;  5L9O A;  3HO7 A;  1ZU0 A;  4LP2 B;  4H8I A;  2XXI A;  3FXQ A;  2PYY A;  2DWJ A;  1FQE A;  2V93 A;  3V5A A;  4F18 A;  1DTZ A;  4XIG Q;  1ZTY A;  4R9G A;  4FEC A;  4QSD A;  3IB2 A;  5CI5 A;  3LSL A;  1DPP A;  3GLB A;  3OMB A;  4OMB A;  4AB6 A;  2G29 A;  2DWH A;  4EDP A;  1TT1 A;  3KJ7 A;  2H99 A;  3F11 A;  3O66 A;  3H4Z A;  1KWH A;  2H5Y A;  2DYX A;  4GRK A;  1URS A;  3HHG A;  1MY1 A;  1NNP A;  3RTF B;  1IXI A;  3PU5 A;  4GIZ A;  3T22 A;  4BDR A;  2R9J A;  4U23 A;  2RC8 A;  4EQB A;  2QMW A;  3LBS A;  1BIY A;  5TU0 A;  4ZE8 A;  4YKK A;  2HFB A;  4RK9 A;  4U1Z A;  4R74 A;  5I56 B;  2XXU A;  4UA8 A;  4ONY A;  1FQC A;  5JTY B;  4RA1 A;  3MAM A;  4HTG A;  2I0B A;  3OSQ A;  5H8S A;  3JV9 A;  1VFD A;  4GXA A;  5H8H B;  3RY3 A;  4U2R A;  2ZNS A;  5I58 A;  3N6U A;  3IL1 B;  2I4B A;  1B4Z A;  4WKM A;  4WXJ A;  1PDA A;  3VVE A;  3ZKK A;  3V83 A;  2B3F A;  1SW2 A;  3PMV A;  1Y3Q A;  4FAT A;  1D9Y A;  1QUL A;  3CR9 A;  5AA2 B;  3S9M C;  2IEE A;  2Q88 A;  4YKP A;  3T9V A;  4OWD A;  4F39 A;  2I49 A;  1Y3P A;  4TQU Q;  5HBC A;  5B7D A;  2P1S A;  3MVW A;  1IZ1 A;  1D9V A;  3MPK A;  4OYV A;  2Z8D A;  3IAZ A;  1MQH A;  1N7W A;  5IKB A;  1JET A;  1P1W A;  1B3L A;  3SKP A;  4O3A A;  5I57 B;  2H9B A;  4GQO A;  1N04 A;  1B3F A;  3KEI A;  3RUM A;  2UYF A;  2AYS A;  1FQB A;  1MXZ A;  3KBR A;  4QHQ A;  4R2F A;  5CMC A;  4K3F A;  3SDF A;  4OVJ A;  3ZKL A;  1H44 A;  3FXR A;  3QUF A;  3R6U A;  3T93 B;  1B52 A;  1TXF A;  3TAJ A;  3D4G A;  1I6A A;  1JW5 A;  4H6D A;  4HW8 A;  4YU0 A;  5KDT A;  3PUX E;  3MVZ A;  1BP5 A;  4I1D A;  2B65 A;  3VLV A;  1EZO A;  4JB7 A;  1B40 A;  1XT8 A;  2O69 A;  2PX1 A;  3G3G A;  3VDF A;  3N6T A;  3QYT A;  5FHN A;  2XX7 A;  1TFA A;  3EQ1 A;  1FTK A;  1H45 A;  3KSJ A;  4IO5 A;  3MZ1 A;  3FVO A;  4XKN A;  3U1O A;  4C1U A;  3FZV A;  5I56 A;  4DXU A;  4YMB A;  2F78 A;  1JW4 A;  1NL5 A;  2RC9 A;  1B51 A;  2V25 A;  4G68 A;  4G8N A;  4JDF A;  5TPA A;  2ESN A;  3EHS A;  2FA7 A;  3V89 B;  1LST A;  1ANF A;  5K2X A;  4Z7E A;  5H8N B;  3D4C A;  5I58 B;  2M8C A;  3T9H B;  4F3P A;  3PPO A;  1SBP A;  3UA8 A;  4YB5 A;  4LZ8 A;  1MG1 A;  2RKM A;  5H8Q B;  4ZDM A;  3TFL A;  3AXF A;  4DE8 A;  4MLQ A;  2O51 A;  3RT6 B;  4EQ7 A;  5FTI A;  2PT1 A;  1Y20 A;  2XHD A;  4NTL A;  1POY 1;  1QUJ A;  2VHA A;  2XX8 A;  3DP6 A;  4XKQ A;  2HAV A;  2I48 A;  3Q25 A;  1IXG A;  4NF8 B;  3U8Q A;  4EF1 A;  4KYE A;  1MPD A;  4QFL A;  2XXX A;  3TEP A;  4JWY A;  1QUI A;  2HZK A;  3HV1 A;  1F9B A;  3H6T A;  3KN7 A;  1UIU A;  2THI A;  4QFN A;  4R72 A;  3HHF A;  3TCG A;  4R6K A;  4ZEI A;  2YPN A;  2VOZ A;  4NF5 B;  2D5W A;  2F34 A;  1SYH A;  1MDP 1;  4RPO A;  2OBG A;  4RXL A;  3VVF A;  3RNN A;  1B5H A;  4XTC Q;  5I2K B;  1MH3 A;  4ZEC A;  4BDQ A;  3GZG A;  2ZNU A;  3MP6 A;  5KZT A;  3W9W A;  1WVJ A;  1AOV A;  4RPN A;  2QRY A;  4G4P A;  1NNT A;  4OFL A;  2P0S A;  4ELO A;  3FD3 A;  3PPQ A;  4P11 A;  4R73 A;  2ZMB A;  3K6U A;  2UVJ A;  5AA1 A;  3BFT A;  3RLF E;  4H5G A;  4F3B A;  5I59 B;  2H25 A;  3TZA A;  5CMK A;  3FVN A;  2GH9 A;  3G7W A;  3TUS A;  5J1D A;  4LZ5 A;  1OQH A;  4LVQ A;  4OET A;  2F8D A;  2I3W A;  1MY0 A;  3OOA A;  1TFD A;  2F5X A;  3VXB A;  1B7Z A;  4C0R A;  1T0K A;  1VSO A;  3MZ9 A;  4BDO A;  2DS9 A;  2ALU A;  2D3I A;  2Z23 A;  1S9T A;  1A8E A;  4Q30 B;  3T66 A;  2VD3 A;  3OD7 A;  4L17 A;  1DMB A;  5I57 A;  2Y7R A;  4GL0 A;  1JEV A;  1B3E A;  4LA9 A;  4DLD A;  3R7X A;  2CMO A;  1UTB B;  2DVC A;  1I69 A;  2PT2 A;  1BKA A;  1Q1K A;  3MC2 A;  1Q35 A;  5CMB A;  4BDL A;  1RYO A;  1SYI A;  2D21 A;  4F1U A;  2DXY A;  2HEU A;  2XXT A;  2DSF A;  2F7B A;  4OXV A;  3Q26 A;  4POX A;  3PPN A;  3RPW A;  3Q28 A;  3M3L A;  1QKB A;  3VVD A;  1PEB A;  4TOZ A;  2QS2 A;  4M4G A;  4RK2 A;  1BLF A;  2QSX A;  1ZLQ A;  4DZ1 A;  1YAE A;  1MQD A;  1SDX A;  4IO7 A;  4NF6 B;  5F1Q A;  4OZ9 A;  5I2K A;  2R6G E;  5FTH A;  2XXY A;  2QPQ A;  2F7A A;  4ZZE A;  4IGR A;  1YPN A;  1II5 A;  1LBB A;  3FAT A;  3K00 A;  3MWB A;  4AB5 A;  1J1N A;  3M3K A;  3IJX B;  5H8N A;  2Q8J A;  3FJM A;  2OJT A;  2OWT A;  2F6G A;  2GHA A;  5CRY A;  3GBB A;  3ODB A;  3FVK A;  3R26 A;  1SQY A;  2I58 A;  4O3C A;  5I59 A;  3MUQ A;  5B70 A;  3UP9 A;  4P0G A;  1OQG A;  4LAT A;  3H3G A;  4H5F A;  1UTH A;  4H0W A;  1NNK A;  2RF1 A;  4M1V A;  2H98 A;  3RTW B;  1Y3N A;  2I4C A;  4F19 A;  1URG A;  5TP9 A;  1WOD A;  3OEK A;  4DCY A;  3LSW A;  1B0H A;  2CZL A;  1MM6 A;  3PMX A;  3QXM A;  4X1D A;  1H3D A;  2XD3 A;  4IB2 A;  3RQT A;  3TCF A;  4EXL A;  3DP4 A;  2DE4 A;  2DOJ A;  3SEX A;  4H1X A;  4ND9 A;  4OER A;  4KI0 E;  2I0C A;  3O6G A;  1A55 A;  2PVU A;  5AA4 A;  3A3U A;  4RJZ A;  4IO6 A;  1TWY A;  2A5T A;  3WAE A;  4F22 A;  1H76 A;  3LUY A;  4ESW A;  4LQ5 A;  2XXR A;  2F6P A;  2YJP A;  1USY H;  4PE5 B;  4PP0 A;  4BDM A;  5ISU A;  4U1O A;  1LB9 A;  4ECF A;  1LCF A;  5HPQ A;  1HSJ A;  1JW1 A;  3N26 A;  3TYH A;  2A5S A;  1NNF A;  3EF7 A;  1R9Q A;  2QS1 A;  1VR5 A;  4YB7 A;  1PB8 A;  1D3K A;  3FJG A;  1IUD A;  1A54 A;  1MPB A;  1SI1 A;  2UXA A;  2ZYK A;  1FTJ A;  4R6H A;  3UN6 A;  2NVU B;  2AIX A;  2YLN A;  4RNS A;  5EHS A;  3TCH A;  3WAF A;  5BUU A;  3ECR A;  2X7P A;  1M5F A;  3B7D A;  2HXW A;  1IIT A;  1URD A;  4YKJ A;  2DWI A;  1MH4 A;  1N84 A;  1NH8 A;  1UTB A;  2DWA A;  5CMM A;  5ICT A;  1FQA A;  3MQ9 A;  1IXH A;  3DLN A;  5ITP A;  4PQJ A;  5TP9 B;  1M5C A;  4GF8 A;  3KFM A;  3K02 A;  4I9D A;  3G3F A;  3KSX A;  5TPA B;  1WDN A;  1O63 A;  1GTK A;  1M5E A;  1OVB A;  3G3I A;  2QL3 A;  2PBW A;  2UYE A;  3HN0 A;  1BTJ A;  3IOR A;  3L6G A;  1SVX B;  3LR1 A;  3PPP A;  1LFG A;  4IO2 A;  4KYD A;  4NF6 A;  1PBP A;  3MBP A;  3USD A;  2I6E A;  2IA4 A;  4H8J A;  4X9T A;  1FCK A;  5KCJ A;  4TLL B;  1AL3 A;  3DEL B;  4FE8 A;  1ZJL A;  4OEN A;  2F7C A;  3O6H A;  3SEV A;  3HCQ A;  1OMP A;  4PFY A;  1EH3 A;  1AH5 A;  3HST A;  4O3B A;  4OHN A;  4NF8 A;  3PUZ E;  4GVO A;  3B6W A;  4IGT A;  4G8H A;  1N7X A;  1S50 A;  1B58 A;  1QKA A;  3FVG A;  4I62 A;  1OLC A;  2GRV A;  1IIW A;  1GGG A;  2O7U A;  3FAS A;  1LAH E;  3C33 A;  4FOR A;  4OFJ A;  5DVF A;  3T96 B;  3O28 A;  2GHB A;  4NF5 A;  2R71 A;  5K2Y A;  4Q5T A;  3ZSF A;  4Q8R A;  5FHM A;  1MXW A;  1MS7 A;  5DVI A;  1Y9U A;  1QJM A;  3G3J A;  1B05 A;  2O6A A;  3E13 X;  3E3K A;  1LFH A;  4LON B;  1CE2 A;  1YTV A;  4MLV A;  1B32 A;  1MRP A;  3E9X A;  1POT A;  3B6T A;  4NF4 B;  3IOV A;  3UIF A;  3H6W A;  2F97 A;  4C1T A;  2O84 X;  3UOR A;  2QJE A;  2A5T B;  3PUW E;  5AA2 A;  1IQ7 A;  4OQO A;  3ZS6 A;  1JNF A;  1XVX A;  4NED A;  3A09 A;  1LB8 A;  2VGQ A;  3IR1 A;  1P1Q A;  4FEB A;  1SW4 A;  4ZEF A;  3PPR A;  5ITO A;  3BKI B;  4MBP A;  3IOU A;  3TTM A;  3RGY A;  2OCU A;  1QUK A;  2UVG A;  3K6V A;  4JWO A;  5KCJ B;  1AIV A;  3TMG A;  1AMF A;  3O9P A;  1DSN A;  4FAJ A;  2QS4 A;  1OLA A;  3TTL A;  5CM6 A;  3FXU A;  1IXC A;  4GD5 A;  3MPL A;  2KLF A;  1B6H A;  2BJJ X;  2V84 A;  1N3W A;  1Y1M A;  1LCT A;  2ONK E;  4RY1 A;  4U4S A;  1GVC A;  3PGF A;  1M5B A;  3U94 A;  3C4M A;  4DIG A;  1B9J A;  2X7Q A;  4THI A;  4XXU A;  4DCX A;  2DE2 A;  2PMS A;  3SEU A;  3BFU A;  1LAX A;  2UVI A;  3G3K A;  2Q9T A;  4KCC A;  3IK6 B;  4OEV A;  4EQ9 A;  1EZP A;  4G77 A;  4F29 A;  3C9H A;  3LC8 A;  4OES A;  3BBR A;  3Q29 A;  4QFK A;  1PC3 A;  3SEW A;  3C36 A;  1MY3 A;  4DDD A;  3M3F A;  1ZIU A;  3S9N C;  2H4I A;  1USY E;  2X26 A;  2ANJ A;  2ZNT A;  3I6V A;  3N94 A;  3O2A A;  5H8H A;  4ZEB A;  5LOM A;  1LBC A;  1SI0 A;  3TOD A;  1MXX A;  3PUY E;  3IB1 A;  3IO6 A;  1D4N A;  4MH5 A;  4QSE A;  3SER A;  3M8U A;  2REG A;  4N6P A;  3K1M A;  3H06 B;  1L5T A;  2Q2A A;  1XS5 A;  4ZEK A;  5L9S A;  4XKP A;  4R6Y A;  3PD9 A;  1MY2 A;  3VFJ A;  4BLA A;  2XXV A;  3FGS A;  3QUJ A;  3FUZ A;  4R9F A;  3DP8 A;  2HAU A;  3TKD A;  4G8M A;  3W15 C;  1RYX A;  1Z7M E;  3PMW A;  5DYH A;  5H8F B;  3KJT A;  2O1L A;  2ABH A;  3S4U A;  3KN8 A;  3EPE A;  2F35 A;  3KG2 A;  3CFL A;  3I5O A;  4GFR A;  4KCD A;  5DEX A;  3CG1 A;  4F3S A;  4F31 B;  3MP1 A;  4PET A;  5FHO A;  3THI A;  3SEY A;  3TPA A;  1MQJ A;  1PBQ A;  4FED A;  2UVH A;  2FNC A;  4E0W A;  4PFW A;  1B4H A;  4POW A;  1QVS A;  3CVG A;  4WED A;  2W7Y A;  1M5D A;  3UK4 A;  2XXW A;  1ATG A;  1GR2 A;  3KN3 A;  4G2Z A;  5I2N A;  5JEI A;  1SW1 A;  2LAO A;  3GBA A;  3K1N A;  3T9U A;  5A5X B;  5CBR A;  4ELQ A;  2HZL A;  4DXC A;  1B0L A;  1JQF A;  1ZKB A;  2REJ A;  2V3T A;  3E4R A;  3K2D A;  3KGC A;  2V3U A;  3CSG A;  1B3H A;  3G3H A;  4QFP A;  2DVZ A;  4H67 A;  2DP8 A;  4KYS A;  4F2Q A;  3PV0 E;  1Y4T A;  3S2V A;  3KOS A;  1R1N A;  2P2A A;  1A40 A;  4G68 B;  3TTN A;  4F1V A;  2Y7P A;  3C34 A;  1NH7 A;  4NE4 A;  1CB6 A;  3C35 A;  3MJN A;  2O1M A;  3QSL A;  4JSO A;  1JVY A;  2ONS A;  3PD8 A;  4NMY A;  4FJP A;  4HCW A;  1I6Q A;  2Y7I A;  5H8Q A;  4MFI A;  3K01 A;  3H6U A;  1P1U A;  5ELV A;  4TLM B;  1GV8 A;  5IAI A;  4ELR A;  2OZZ A;  2Z8F A;  1SD3 A;  4ZS9 A;  4N13 A;  4F1Y A;  1LFI A;  1DTG A;  1XOC A;  4JBZ A;  1MQI A;  4QFO A;  5DEX B;  4KFQ A;  4PFT A;  3QK6 A;  3W9V A;  1B46 A;  1B2H A;  1MM7 A;  3IJO B;  2FYI A;  3LSX A;  4GOT A;  4N07 A;  2F36 A;  4QSC A;  3K6W A;  3IOT A;  3QIM A;  4BDN A;  5AA3 A;  2I3V A;  5ICQ A;  3S9E A;  1PB9 A;  2OLB A;  4EUO A;  4KPT A;  1MXY A;  3U93 A;  2HCA A;  4Q0C A;  2Q2C A;  2NWJ A;  4NWC A;  1LLS A;  2QMX A;  2E0S A;  2O7I A;  4QRZ A;  4YB6 A;  1B1X A;  3MP8 A;  3OEM A;  1I6B A;  2AL5 A;  4ZED A;  5JTY A;  2OK2 A;  3U92 A;  3C32 A;  1A8F A;  1B5J A;  2VD2 A;  4I8C A;  4U4X A;  5F7V A;  2XD2 A;  3ILT B;  5AE4 A;  5HM4 B;  2Y7W A;  3FJ7 A;  3IX1 A;  4PFU A;  3VXC A;  1RKM A;  3L6H A;  1EU8 A;  4H65 A;  1MY4 A;  2DXR A;  3OEN A;  2ZXT A;  5CBS A;  2XXH A;  4ZZA A;  1HSL A;  4ESX A;  1Y1Z A;  3JYR A;  5DTB A;  1UTH B;  2NXO A;  4QF9 A;  2VP1 A;  2Y84 A;  5H8F A;  3FV1 A;  3K4U A;  4RYA A;  3T9X B;  1UIV A;  2XX9 A;  2Z8E A;  3ILU B;  5EHM A;  4NWD A;  3MZB A;  1MPC A;  4U21 A;  4LUB A;  3U72 A;  5BWJ A;  1P99 A;  2ZYO A;  4YAH X;  2V3Q A;  3CSB A;  3VE1 B;  4MF3 A;  4F2O A;  1XHY A;  3MW0 A;  3MVX A;  4NF4 A;  3SES A;  2Q89 A;  3OXN A;  1US4 A;  2RC7 A;  4LZ7 A;  5AA4 B;  1LAF E;  3TTR A;  2B3B A;  5KDT B;  3CIJ A;  3ONM A;  3MVY A;  1A99 A;  2RCA A;  2O68 A;  5I2N B;  3IB0 A;  4G68 C;  3VV5 A;  3N5L A;  2RIN A;  1SW5 A;  4HCY A;  1HSE A;  3DM0 A;  3VLU A;  2XXP A;  2WKY A;  1O7T A;  3UGW A;  1FQD A;  2Y7K A;  3JZJ A;  4JXI A;  3H7M A;  3K0V A;  3OSR A;  3S9L C;  3IOW A;  1YCJ A;  5EYF A;  3HPI A;  1Z7N E;  3B6Q A;  1B7U A;  3IO4 A;  4IY5 A;  3OO7 A;  5DVJ A;  1FTO A;  2AL4 A;  4KHZ E;  3H03 A;  4IO3 A;  1R6Z A;  1LAG E;  5L8D A;  5M2V A;  1FQF A;  1PB7 A;  1UQW A;  1Y4C A;  1XVY A;  3GXA A;  1MXV A;  1P1N A;  3KOT A;  2NOO A;  4U22 A;  3TQL A;  1JVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...