4NF4A

Crystal structure of glun1/glun2a ligand-binding domain in complex with dcka and glutamate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
284
structure length
277
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, receptor
molecule keywords Glutamate receptor ionotropic, NMDA 1
publication title Structural Insights into Competitive Antagonism in NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 75
structure length 277
sequence length 284
ec nomenclature
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf4A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf4A02
2ZYNA 1Y1MA 1P1QA 3CFLA 1FTLA 1MY2A 1URDA 2I3WA 4IO2A 1LGBC 3KOTA 5TPAB 4ZECA 1OVTA 5I57A 3SESA 3TCFA 3M3LA 4ZEIA 1UTHA 3RQTA 1GGGA 2HAVA 3TYHA 5KZTA 3I6VA 1QKAA 1A8EA 2HZLA 2OWSA 3O28A 1GTKA 3MVWA 2B3FA 2F5XA 4N07A 3OO8A 2Y7IA 3LC8A 1WODA 4L17A 3E9XA 3KSJA 3JYRA 4KQPA 2DSFA 3TAJA 3MZ1A 3K00A 4BDMA 4QFKA 4MF3A 1B5IA 1LFHA 4ELOA 4F3GA 1NNPA 5CM6A 3IAZA 3MW0A 2FNCA 4JSDA 2PBWA 5CMMA 5TU0A 3ZKLA 3VFJA 1LB9A 4LQ5A 2ZYKA 3W9WA 4H8JA 1F9BA 1VR5A 2RC7A 2I58A 5KCJB 3CSGA 1P1WA 2V25A 3TTRA 5H8FA 3A09A 4R6KA 3UORA 4IGTA 4TLLB 1R9QA 1O64A 3T93B 5H8HA 4GVOA 1IUDA 3MWBA 3T66A 4DIGA 2XXTA 4JWOA 4I8CA 1YCJA 4EF1A 3HHGA 2P0SA 1MQHA 3V89B 2QL3A 3IORA 4DXBA 3DLNA 3HPIA 5I2KA 2O1LA 2OCUA 1H44A 4WKMA 4WEDA 4YKIA 4BDNA 3FUZA 2Q9TA 3H6TA 3UGWA 1USYE 2ZNUA 5H8NA 1XVYA 3L6HA 3SEUA 3LUYA 3Q28A 5I56B 1Y3QA 2BJJX 2ZYMA 2OJTA 3DM0A 3MBPA 1BTJA 1ZU0A 5ELVA 3GBAA 1JVYA 1HSLA 3BKIB 4GRKA 2P1SA 1XHYA 1BP5A 4E0XA 2D21A 3ZKKA 5TPAA 4NF4B 3ECRA 3QK6A 4GL8A 4ZE9A 3O6GA 2QS2A 2Q89A 1FQFA 2DWJA 4XTCQ 4JWXA 4F39A 3FZVA 3KG2A 3MVYA 1Y9UA 2XXHA 3FXRA 4G68B 4F3SA 4UA8A 3RT8A 1M5DA 5L8DA 4IY6A 5JEIA 1RKMA 3OELA 2YLNA 1B1HA 3CRBA 2VD2A 4EQ9A 1JEUA 3KZGA 3VVDA 3QUJA 3ZSFA 3IK6B 4I1DA 4P11A 3CG3A 1LAFE 1YAEA 4ZEDA 2YPNA 3E13X 1IXGA 5M2VA 2PT2A 2ONSA 1B5JA 3VV5A 3TKDA 5CBSA 3PUXE 3IB0A 1QUIA 3BFTA 4GQOA 5KCJA 1MM6A 3FXUA 1P99A 4NE4A 1XOCA 4OFOA 3I5OA 1VE4A 5AA1A 1XT8A 3PU5A 3RT6B 3HN0A 4DCYA 3M3KA 3A3CA 3K6UA 3HO7A 4MH5A 4FEBA 1IXIA 4UACA 1B4ZA 4OXVA 4U2RA 3T9XB 1RYXA 3TQWA 2UXAA 1BKAA 4ZS9A 1Y3PA 2DOJA 4G77A 1TWYA 3V8XB 2OZZA 1ZMGA 1Z7NE 1SVXB 2Q2AA 5KDTB 2O6AA 2HZKA 1TFDA 1URGA 4LATA 1ATGA 3FIRA 3P7IA 1A99A 1MPBA 2V3TA 3KN3A 4I9DA 4XXUA 4GXSB 4YKJA 4ZZEA 4NEDA 2DXYA 3VVFA 2V84A 1NNTA 5I57B 1B3FA 5I56A 4G2ZA 1SYIA 1URSA 1UTHB 3C36A 3W15C 3OD7A 2HFBA 4AB6A 4NF4A 2ALUA 3KSXA 4OVJA 1IZ1A 2QMWA 4YU0A 1MY1A 4R73A 1B7ZA 5ICQA 4GWOA 5I58B 1HSEA 2DVZA 3TPAA 4C1UA 4X1DA 1T0KA 4PFWA 4LQ2A 1ZIUA 1NL5A 1R6ZA 3QIMA 3OOAA 1UIUA 4RPNA 3EQ1A 2F36A 3MP1A 4G68A 1OIBA 3RY3A 1UIVA 1NNFA 5FTHA 3SEXA 4RXLA 4ZEKA 3EF7A 2QPQA 1LFGA 3GZGA 4OMBA 4GF8A 2XXWA 4EUOA 3TTMA 5A5XB 4IO7A 3T9UA 3G3FA 3T22A 3MAMA 2HQ0A 1FQAA 3V83A 1NH8A 4U1OA 4MFIA 2R71A 1MRPA 4QHQA 4M1VA 2F35A 1B5HA 1P1OA 3IX1A 4XKRA 3S9NC 4XIGQ 1MH3A 2W7YA 3KN8A 3OSQA 4QFPA 4FAJA 3IO6A 1SW1A 2UYFA 2FYIA 4YB5A 4BDQA 3OSRA 3KN7A 1AL3A 5AA4B 4KPTA 1FW0A 2DQVA 1B40A 1YTVA 1LLSA 2QRYA 4DDDA 2THIA 3U72A 3PPRA 3R6UA 3MPKA 5LOMA 2OLBA 1US5A 4OTEA 3IOUA 4H5GA 4N13A 1XVXA 3B6QA 1BLFA 1FCKA 3VDFA 3MPLA 1VSOA 5HPQA 2H99A 3QYTA 3SKPA 3VE1B 2REGA 2Z8DA 1S7YA 5KDTA 2F6PA 1B05A 4MBPA 5DVFA 1Q1KA 3UP9A 3F11A 1B3GA 1JNFA 4OWDA 4OETA 4LZ5A 1Y1ZA 2M8CA 1D9VA 2Q2CA 5ITPA 3H6VA 3CFZA 4LZ7A 1FQDA 5CRYA 3PD9A 1N84A 1WVJA 1A7LA 1UTBB 3M3FA 4RYAA 3ONMA 4FE8A 4R72A 3CIJA 1PBQA 1B32A 3FJMA 3ODBA 2I49A 3TELA 3FATA 3LR1A 2Y7WA 4PETA 3VXCA 4KYDA 3FVNA 5I58A 3HCQA 1P1NA 2QS3A 1GV8A 4BDRA 3N5LA 3K01A 5DEXB 3H7MA 4R2FA 3TODA 3RPWA 3RNNA 3U94A 5BUUA 3G3JA 3RTWB 1FQEA 1N3XA 2UVJA 3JZJA 3C31A 3PUWE 4YICA 4DXUA 3G3KA 4PFTA 3D4CA 1S50A 2I6EA 3TCHA 2ONRA 3FJ7A 3K4UA 3N26A 3SEWA 2XD2A 2H98A 5A5XA 4MLVA 3TTLA 4LONB 2PYYA 5L9SA 1PB7A 3QUFA 3FASA 1HSJA 2KLFA 1PB9A 4IY5A 3IB1A 4QSDA 3H6UA 4KR5A 1SBPA 4LP2B 3S4UA 2F78A 3K6VA 4JBZA 1SQYA 1LFIA 3M8UA 5EHMA 3FXQA 4DXCA 2AIXA 3PUZE 5AA2B 5AA4A 3TDJA 3C9HA 1SI0A 1LBBA 4X48A 1EH3A 3C4MA 1IXCA 2RCAA 2RINA 1H45A 3BBRA 2XXYA 4C0RA 2IA4A 1QW0A 3B6WA 2QJEA 2XXQA 4EQBA 3PMXA 3VXBA 3UN6A 4GD5A 2NUVA 4NMYA 1H76A 3OENA 1LAXA 2F7CA 2REJA 4P0IA 1JW5A 4KI0E 2DWIA 4RNSA 3L6GA 4O3AA 1LAGE 2ESNA 2DXRA 2XX9A 2ZNTA 2F97A 2V3QA 3OO7A 4X9TA 3H06B 2XX8A 4F22A 2X7QA 2AL5A 1MXVA 2PX1A 1N0TA 4YB7A 4R9FA 1VFEA 1NFTA 1UTBA 3Q25A 1B0HA 3TFLA 1WDNA 3BFUA 3VLWA 5L9OA 2UVHA 2RF1A 1B3HA 4JDFA 3Q26A 2E0SA 1A8FA 3K2DA 3PUVE 4R75A 2PT1A 4H65A 1ZLQA 5DEXA 4ZEFA 4R9GA 3EPEA 4ISUA 4F3BA 3OXNA 1B7HA 4Z0IA 2F8DA 3DELB 2CZLA 1SW2A 3HV1A 1B46A 2NWJA 4OYVA 2I4BA 4PFYA 4ZE8A 1JQFA 5FTIA 4QFNA 3ILTB 1MQJA 4POXA 1TT1A 4ECFA 1IXHA 3N6UA 1IITA 2ANJA 3VLVA 4F1VA 3D4GA 1ZKBA 1B1XA 3FD3A 4G8MA 4PFUA 5ITOA 4U4XA 2DWAA 4PE5B 3MP8A 2XXXA 4XKPA 1EZPA 1CE2A 5BWJA 3OO6A 1B52A 4JSOA 2O69A 2O7UA 3THIA 4U4SA 1OQHA 1M5CA 5AA2A 3B6TA 3PUYE 1DTGA 1Y4TA 3IR1A 3KGCA 1R1NA 4DE8A 5CMKA 1FQBA 3KOSA 1II5A 2HEUA 3U1OA 4XKNA 4EXKA 3U93A 1FTJA 2X7PA 1FQCA 5I2NB 3O9PA 1FTOA 4H8IA 1QUKA 2VHAA 4GIZA 4QSCA 1N04A 1AOVA 1LB8A 1I6QA 1JW4A 4IO3A 1SI1A 4U22A 5AA3A 3OEKA 3SEYA 3MZBA 1MQIA 1XC1A 1H43A 4XKQA 3PD8A 1M5BA 4OFLA 1P1UA 4GOTA 3K0VA 4QSEA 3RTFB 4U23A 1MM7A 1OLCA 3E4RA 4DCXA 4LVQA 3MVXA 5HBCA 4NF6B 4GXAA 1MDP1 1PDAA 1SD3A 2ZMBA 3KBRA 2OWTA 2AL4A 1DPEA 4NTLA 1MXUA 1JVXA 3MZ9A 3G7WA 4BLAA 3N94A 4WXJA 4N6PA 2D5WA 4GFRA 4TOZA 5DT6A 4FATA 2VD3A 3O29A 4YAHX 1B6HA 1KWHA 2Z8EA 3IL1B 4F29A 2Z22A 3A3UA 1M5FA 4IB2A 2RC9A 3TCGA 4NF8B 1B58A 2DWHA 1POTA 2DE2A 3CVGA 2HCAA 4OENA 2AYSA 2IEEA 1LSTA 4H67A 3CI8A 3OMBA 4YZZA 1DPPA 4H6DA 2Y7KA 2XXPA 1A40A 1CB6A 3GLBA 2E1SA 1MXYA 2GFEA 3FGSA 4G68C 4F19A 2O1MA 3H4ZA 1JW1A 4X1BA 2G93A 1MPCA 3IOVA 4Q0CA 4FJPA 3UK4A 5DTBA 1Y3NA 3UA8A 2A5SA 4QFOA 2V3UA 3CFXA 4ESWA 1B3EA 2UVIA 3IOTA 1DOTA 3CSBA 5J1DA 1B7UA 3MC2A 3TEPA 3K1MA 3IJOB 4HTGA 1N3WA 2O51A 4GLIA 4FEDA 1N7WA 1TFAA 5CC2A 3QAXA 4FECA 1ANFA 4KD5A 5HM4B 4OEUA 3PV0E 1QVSA 4AB5A 2RCBA 1B3LA 2NVUB 1EZOA 1LCFA 5I2NA 1GVCA 2Q88A 5EYFA 3TUSA 5H8QB 3K1NA 3VVEA 4QF9A 1OLAA 4KYEA 3LSXA 5AA2D 1NH7A 4IO6A 3SETA 2G29A 3O6HA 2HAUA 3T96B 5JTYB 2QS1A 3HHFA 3GXAA 3PPPA 1DTZA 4NF6A 1MXWA 4U1ZA 3K6WA 4Q8RA 3G3GA 2FA7A 1R9LA 4EXLA 3UIFA 4KCCA 4IO5A 3IJXB 2Y7PA 3Q29A 4R6YA 4OERA 1LAHE 4ZDMA 1MPDA 4RY1A 3PPQA 3TTKA 2H5YA 3PPNA 2V93A 1PBPA 2ONKE 3S9MC 3C33A 3N6TA 2XX7A 4BDOA 4NF5B 3QXMA 1ZTYA 1QKBA 3C35A 4NF8A 2F6GA 5CMCA 3GBBA 5FHNA 3IO4A 1SYHA 3LSFB 2Z23A 4JB7A 2QSXA 1B9JA 5CMBA 1Q35A 1D9YA 2PMSA 5K2YA 3AXFA 3C34A 1ELJA 2DVCA 2Z8FA 4ZEBA 4KYSA 3C32A 1OVBA 4KCDA 2P2AA 3FVOA 4LA9A 1PC3A 3LSWA 4JXIA 5FHOA 1MS7A 1Y4CA 1SW4A 3K1PA 5AE4A 4WEPA 3MP6A 4TQUQ 4I62A 1B51A 3S9EA 4DZ1A 3S9LC 2I3VA 4M4GA 4F2OA 3CG1A 3EHSA 3I3VA 2DE3A 4R74A 1I69A 4O3BA 1MY4A 4YB6A 3FV1A 4YKKA 2XXRA 1RYOA 4F3PA 1GR2A 5DVIA 3RN8A 1NMUA 1H3DA 1SDXA 4K3FA 4ELQA 1M5EA 4HS7A 4F31B 4EQ7A 4IO4A 2XHDA 5H8SA 2D3IA 5H8QA 1IIWA 3SDFA 5DYHA 3G3HA 1LBCA 1EU8A 2GH9A 1B0LA 5B70A 2R6GE 2O68A 2F34A 2F7AA 4HCWA 5JTYA 4MLQA 4QRZA 3DP8A 2UVGA 4TLMB 1USYH 4G8NA 4H1XA 1OMPA 2O7IA 5TP9B 3ZS6A 3IOWA 3Q27A 1Y20A 3FV2A 1NNKA 4RK2A 1MY0A 4HCYA 1FTKA 4OESA 1IEJA 2ZNSA 2VP1A 4GL0A 2RKMA 2XD3A 3KEIA 1B2HA 4THIA 3H3GA 2B65A 3K02A 2H9BA 2VOZA 4KFQA 1IQ7A 1YPNA 4LUBA 4ZZAA 5I59B 4EDPA 4ELRA 4NF5A 1O7TA 5CI5A 2NOOA 5IAIA 3PPOA 3MVZA 4DLDA 4R2BA 4F1YA 3FVGA 4ND9A 1ZBMA 3QSLA 1N76A 4G8HA 2ZYOA 3JV9A 3KFMA 4OQOA 2B3BA 1MH4A 4FIMA 3USDA 4Q30B 1I6AA 4ESXA 3E3KA 4OEVA 4Z7EA 1A54A 2A5TB 2XXVA 3PMVA 3U92A 4P0GA 1MXZA 3H03A 1JEVA 4EF2A 2CMOA 1MQGA 4IGRA 4YMBA 1EZ9A 4RJZA 3PMWA 4R6HA 1TXFA 1B4HA 2H25A 3HSTA 3TTNA 3B7DA 3G3IA 4H0WA 4NWDA 5IKBA 2Q8JA 5EHSA 1POY1 3TQLA 2UYEA 4PQJA 3EHTA 1JETA 4PP0A 1MDQA 4RK9A 3W9VA 2Y7RA 1MY3A 2QMXA 2X26A 5ICTA 2ABHA 3PGFA 2OK2A 5B7DA 2GRVA 3EHUA 2O84X 2I48A 4Q5TA 2F7BA 1BIYA 3O66A 3DP4A 4OZ9A 2GHBA 3MJNA 2XXUA 3LSLA 2YJPA 4LZ8A 4OHNA 4C1TA 1J1NA 2DE4A 3T9VA 3KJ7A 4F2QA 1Z7ME 5DVJA 1A55A 4POWA 5CBRA 4ONYA 4RPOA 4E0WA 1AIVA 2VGQA 1L5TA 3O2AA 4AQ4A 4RA1A 2HXWA 1XS5A 1MG1A 3H6WA 3FVKA 4QFLA 3IB2A 1SW5A 5TP9A 2H4IA 1US4A 2DP8A 3T9HB 2ZXTA 5FHMA 4ELPA 1S9TA 2RC8A 3O6IA 3DP6A 1I6BA 1N7XA 1AMFA 2OBGA 1OQGA 5I84A 4G4PA 4JWYA 2I0CA 3WAEA 3CR9A 5I59A 2QS4A 2NXOA 1O63A 2WKYA 2GHAA 1AH5A 2I4CA 1DMBA 1QUJA 3FJGA 4YMAA 1DSNA 3OEMA 2I0BA 3MQ9A 5H8FB 1D3KA 3RUMA 4U21A 1NKXA 5JK4A 3WAFA 3OO9A 2DYXA 1D4NA 2PVUA 5H8HB 1MQDA 4F1UA 4HW8A 4F18A 1PEBA 2R9JA 1FTMA 3TMGA 4O3CA 1ZJLA 3U8QA 2DS9A 3K6XA 2LAOA 3R7XA 2A5TA 3R26A 3TZAA 3KJTA 5F1QA 3RGYA 4OFJA 4BDLA 3LBSA 3S2VA 3ILUB 1VFDA 5F7VA 1LCTA 3MUQA 1PB8A 3EN3A 3RLFE 3SERA 3O97A 5L9MA 5I2KB 4H5FA 5ISUA 4NWCA 3VLUA 4YKPA 1QULA 4FORA 3SEVA 5H8NB 1UQWA 4KHZE 2Y84A 2XXIA 1MXXA 1QJMA 3V5AA 5K2XA
chains in the Genus database with same CATH superfamily
2ZYNA 1SPIA 1Y1MA 1P1QA 1LBWA 1FBCA 3CFLA 4GWZA 4NX1A 1FTLA 1MY2A 1URDA 2I3WA 4IO2A 1LGBC 3KOTA 5TPAB 4PAFA 4ZECA 1OVTA 5I57A 3SESA 3TCFA 4GBVA 3M3LA 4ZEIA 1UTHA 3RQTA 1GGGA 2HAVA 1JP4A 3TYHA 5KZTA 3I6VA 1QKAA 1A8EA 2HZLA 2OWSA 3O28A 1GTKA 3MVWA 2B3FA 2F5XA 4N07A 3MYUA 3OO8A 4IR8A 4PC9A 4NN3A 5DW8A 5EQ9A 2Y7IA 3LC8A 1WODA 4L17A 3E9XA 3KSJA 3JYRA 1FPEA 2FVZA 4KQPA 2DSFA 3TAJA 3MZ1A 3K00A 4BDMA 4QFKA 4MF3A 1B5IA 1LFHA 4I40A 4ELOA 4F3GA 1NNPA 5CM6A 3IAZA 3MW0A 2FNCA 4JSDA 2PBWA 5CMMA 5TU0A 3ZKLA 4OVSA 3VFJA 1LB9A 4LQ5A 4PFBA 2ZYKA 3W9WA 1FJ9A 4H8JA 1F9BA 1VR5A 2RC7A 2I58A 5KCJB 3CSGA 1EYIA 1P1WA 2V25A 5ET8A 2ZZVA 3TTRA 5H8FA 3A09A 4R6KA 3UORA 4IGTA 4TLLB 1R9QA 4LN5A 1O64A 3T93B 4MJOA 1FPBA 5H8HA 4GVOA 1IUDA 1DK4A 3MWBA 4PF6A 3T66A 4DIGA 1G0IA 2XXTA 4JWOA 2XWIA 4I8CA 1YCJA 4EF1A 5EQ8A 3HHGA 2P0SA 1MQHA 3V89B 2QL3A 4PGNA 1KA1A 3IORA 4DXBA 3DLNA 4N8GA 3HPIA 5I2KA 2O1LA 1LBVA 2OCUA 2Q74A 1H44A 4PBHA 4WKMA 4WEDA 1FBFA 4YKIA 4BDNA 3FUZA 4OVPA 2Q9TA 3H6TA 3UGWA 1USYE 2ZNUA 5IZ1A 5H8NA 1XVYA 3L6HA 3SEUA 1INPA 3GYYA 3LUYA 3Q28A 5I56B 1Y3QA 2BJJX 2ZYMA 3QMFA 3FXBA 2OJTA 3DM0A 3MBPA 1BTJA 1ZU0A 5ELVA 3ISPA 3GBAA 1JVYA 1HSLA 3BKIB 4GRKA 2P1SA 1XHYA 1BP5A 4E0XA 2D21A 3ZKKA 1NV7A 5TPAA 4NF4B 3ECRA 3QK6A 2FIXA 2OWZA 4GL8A 4MHFA 5FBPA 4ZE9A 4N17A 1NUXA 3O6GA 1NUZA 2QS2A 2Q89A 2CEXA 1FQFA 2DWJA 4XTCQ 4JWXA 4F39A 3FZVA 3KG2A 3MVYA 2ZZWA 1Y9UA 1IMEA 2XXHA 3FXRA 4G68B 4F3SA 4UA8A 3RT8A 1M5DA 5L8DA 4IY6A 4H46A 5JEIA 1RKMA 3OELA 2YLNA 1B1HA 3CRBA 2VD2A 4EQ9A 1JEUA 3KZGA 4O8MA 3VVDA 3QUJA 3ZSFA 3IK6B 4I1DA 4MNPA 4P11A 3CG3A 1LAFE 2QVVA 4GX6A 1YAEA 4ZEDA 2YPNA 3E13X 3RPLB 1IXGA 5M2VA 2PT2A 2HPGA 2ONSA 1B5JA 3VV5A 3TKDA 5CBSA 1NI9A 3PUXE 1KA0A 3IB0A 1QUIA 3BFTA 4GQOA 5KCJA 1MM6A 3FXUA 4P1EA 3HFUA 1P99A 4NE4A 1XOCA 4OFOA 3I5OA 1VE4A 5AA1A 1XT8A 3PU5A 3RT6B 1DCUA 3HN0A 1G0HA 4DCYA 3M3KA 3A3CA 3K6UA 3HO7A 4MH5A 1FBHA 4FEBA 1IXIA 4UACA 1B4ZA 4OXVA 4MMPA 4U2RA 3T9XB 1RYXA 4GWXA 4O7IA 4QXDA 3TQWA 2UXAA 1BKAA 4ZS9A 1Y3PA 2DOJA 4G77A 2L5VA 1TWYA 3V8XB 2OZZA 1ZMGA 1Z7NE 5LTCA 1SVXB 2Q2AA 5KDTB 2O6AA 2HZKA 4MCOA 1TFDA 1URGA 4LATA 1ATGA 3FIRA 4P47A 3P7IA 1A99A 1MPBA 2V3TA 5EYHA 3KN3A 4I9DA 4XXUA 4GXSB 4YKJA 4ZZEA 4NEDA 2DXYA 3VVFA 2V84A 1NNTA 5I57B 1B3FA 5I56A 4G2ZA 1SYIA 1URSA 1UTHB 1NV5A 3C36A 1NV4A 3W15C 3OD7A 2HFBA 4AB6A 4NF4A 2ALUA 3KSXA 4OVJA 1IZ1A 2QMWA 4UABA 4YU0A 1MY1A 4R73A 1B7ZA 2CZIA 5ICQA 4GWOA 5I58B 1HSEA 2DVZA 3TPAA 4C1UA 1RDYA 4X1DA 1T0KA 4PFWA 4LQ2A 1EYKA 1ZIUA 1NL5A 1R6ZA 5A5LA 1RDXA 3RYDA 3QIMA 3OOAA 1UIUA 4RPNA 3EQ1A 2F36A 3MP1A 4G68A 1OIBA 3RY3A 1UIVA 1NNFA 5FTHA 3SEXA 4RXLA 4ZEKA 3EF7A 2QPQA 2CZKA 1LFGA 3GZGA 4OMBA 4GF8A 4GWUA 4X04A 2XXWA 4EUOA 3TTMA 5A5XB 4IO7A 3T9UA 3G3FA 3T22A 3MAMA 4N6KA 2HQ0A 2PFYA 1FQAA 3V83A 3B50A 1NH8A 2FIEA 4U1OA 4PE3A 4MFIA 5LDZA 2R71A 1MRPA 3RPLA 4QHQA 4M1VA 2F35A 4XFEA 1B5HA 3A29A 1P1OA 3IX1A 4XKRA 3S9NC 4XIGQ 1MH3A 2W7YA 3KN8A 3OSQA 4QFPA 4FAJA 3IO6A 1SW1A 2UYFA 2FYIA 4YB5A 4BDQA 2WYKA 3OSRA 3KN7A 1AL3A 5AA4B 4KPTA 1FW0A 2GQ1A 2DQVA 1B40A 1YTVA 1AWBA 1LLSA 2QRYA 4DDDA 2THIA 3U72A 3PPRA 3R6UA 3E78A 3MPKA 5LOMA 5IZZA 2OLBA 1US5A 4PTKA 4OTEA 3IOUA 4H5GA 4N13A 1XVXA 3B6QA 1BLFA 1FCKA 3VDFA 3MPLA 3T0JA 1VSOA 5HPQA 2H99A 3QYTA 3SKPA 3VE1B 2REGA 2Z8DA 1S7YA 2KR0A 1QGXA 5KDTA 2F6PA 1B05A 4MBPA 5DVFA 1Q1KA 3UP9A 3F11A 1B3GA 1JNFA 4OWDA 4OETA 4LZ5A 4MIJA 1Y1ZA 2M8CA 1D9VA 2Q2CA 5ITPA 3H6VA 3CFZA 4PFRA 4LZ7A 1FQDA 5CRYA 3PD9A 1N84A 1WVJA 1A7LA 1UTBB 3M3FA 3FBPA 4RYAA 3ONMA 4FE8A 4R72A 3CIJA 1PBQA 1B32A 3FJMA 1FPLA 3ODBA 2I49A 3TELA 3FATA 3LR1A 4I3EA 2Y7WA 4PETA 3VXCA 4KYDA 3FVNA 4PDHA 1NV3A 5I58A 3HCQA 1P1NA 2QS3A 1GV8A 5ET6A 4BDRA 3N5LA 3K01A 5DEXB 3H7MA 4R2FA 3TODA 3RPWA 3RNNA 3U94A 3G3JA 5BUUA 3RTWB 1FQEA 1N3XA 2UVJA 3JZJA 3ROJA 3C31A 3PUWE 4YICA 4DXUA 3G3KA 4PFTA 3D4CA 4JVIA 1S50A 2VPOA 2I6EA 3TCHA 2ONRA 3FJ7A 2JJKA 3K4UA 3N26A 3SEWA 2XD2A 5T3JA 2H98A 5A5XA 5I3SA 4KXPA 1IMDA 4MLVA 3TTLA 4LONB 2PYYA 5L9SA 4I3YA 1PB7A 2B4MA 3QUFA 1FBGA 3FASA 1FBPA 4GX4A 1HSJA 2KLFA 3T1BA 1PB9A 4IY5A 3IB1A 4QSDA 5IZ3B 3H6UA 4KR5A 2Y5LA 1SBPA 4LP2B 3S4UA 2F78A 3K6VA 4JBZA 4DI4B 1SQYA 1LFIA 4QBAA 3M8UA 5EHMA 4O7MA 3FXQA 4DXCA 2AIXA 5F24A 3PUZE 5AA2B 1EYJA 5AA4A 3TDJA 4O94A 3C9HA 1SI0A 1LBBA 4X48A 1EH3A 3C4MA 1IXCA 2RCAA 2RINA 1H45A 3BBRA 2XXYA 4C0RA 2IA4A 1QW0A 4HXVA 3B6WA 2QJEA 2XXQA 4EQBA 3PMXA 3VXBA 3UN6A 4GD5A 2NUVA 4NMYA 1H76A 3OENA 1LAXA 2F7CA 2REJA 4P0IA 4NHBA 1JW5A 4KI0E 2DWIA 4RNSA 3L6GA 2VPNA 4O3AA 1LAGE 2ESNA 2DXRA 2XX9A 2ZNTA 2F97A 2V3QA 3OO7A 4X9TA 1IMBA 2QVUA 3H06B 1YYZA 2XX8A 4F22A 2X7QA 2AL5A 1MXVA 2PX1A 1N0TA 4N15A 4YB7A 4R9FA 1VFEA 5IM2A 1NFTA 1UTBA 1FJ6A 3Q25A 1B0HA 3TFLA 1WDNA 3BFUA 4HE1A 3VLWA 2HHMA 5L9OA 2UVHA 2RF1A 1B3HA 4JDFA 3Q26A 2E0SA 1A8FA 3K2DA 3PUVE 4R75A 2PT1A 4H65A 1ZLQA 5DEXA 4ZEFA 2V4CA 4NG7A 4R9GA 3EPEA 4ISUA 4F3BA 3OXNA 1B7HA 4Z0IA 2F8DA 3DELB 2CZLA 1SW2A 3HV1A 1B46A 2P3NA 2NWJA 4OYVA 2I4BA 4PFYA 4ZE8A 1JQFA 5FTIA 4QFNA 3ILTB 1MQJA 4POXA 1TT1A 4ECFA 1IXHA 3N6UA 4GWWA 1IITA 2ANJA 3VLVA 4F1VA 3D4GA 1ZKBA 1FPDA 1B1XA 3FD3A 1LBZA 4G8MA 4PFUA 5ITOA 4U4XA 2DWAA 4PE5B 3MP8A 2XXXA 4XKPA 1EZPA 1CE2A 5BWJA 3OO6A 5IZ3A 1B52A 4JSOA 2O69A 2O7UA 3CHGA 3THIA 4U4SA 1OQHA 2HXRA 1M5CA 5AA2A 3B6TA 3PUYE 4PAIA 1DTGA 2WBDA 1Y4TA 3IR1A 3KGCA 1R1NA 1DBZA 4DE8A 3D1RA 5CMKA 1FQBA 3KOSA 1K9ZA 1II5A 5J16A 2HEUA 3U1OA 4XKNA 4EXKA 3NOHA 3U93A 1FTJA 1FTAA 2X7PA 1FQCA 5I2NB 3O9PA 4JVDA 1FTOA 4H8IA 1QUKA 2VHAA 4GIZA 4QSCA 1N04A 1AOVA 1LB8A 1I6QA 4OANA 1JW4A 4IO3A 1IMCA 1SI1A 4U22A 5AA3A 3OEKA 3SEYA 3MZBA 5EQAA 1MQIA 4GBWA 1XC1A 1H43A 4XKQA 3PD8A 1M5BA 4OFLA 5IGAA 1P1UA 4GOTA 3K0VA 4QSEA 4U23A 3RTFB 1MM7A 1OLCA 3E4RA 4DCXA 4LVQA 2XA5A 3MVXA 1K9YA 5HBCA 4NF6B 4GXAA 1MDP1 1PDAA 1SD3A 2ZMBA 3KBRA 2OWTA 2AL4A 1DPEA 4NTLA 1MXUA 1JVXA 3MZ9A 3G7WA 4NF0A 4AS4A 4BLAA 3N94A 4WXJA 4N6PA 1BK4A 4TOZA 2D5WA 4GFRA 5DT6A 4FATA 2VD3A 3O29A 4YAHX 2PCRA 1B6HA 1KWHA 2CEYA 2Z8EA 3IL1B 4F29A 2Z22A 3A3UA 1M5FA 4IB2A 2RC9A 3TCGA 4NF8B 3BIHA 4OVQA 1B58A 2DWHA 1POTA 2DE2A 3CVGA 4HE2A 2HCAA 4OENA 2AYSA 2IEEA 1LSTA 4H67A 3CI8A 3OMBA 4YZZA 1DPPA 4H6DA 2Y7KA 2XXPA 3EKIA 2VT5A 3U65A 1A40A 2B4LA 1CB6A 3GLBA 4GX3A 2E1SA 1MXYA 2GFEA 3FGSA 4G68C 4F19A 2O1MA 5EQ7A 3H4ZA 1JW1A 4PBQA 4X1BA 2G93A 1MPCA 3IOVA 4PCDA 4Q0CA 4FJPA 2FHYA 3UK4A 5DTBA 1Y3NA 3UA8A 2A5SA 4PFIA 4QFOA 2V3UA 3CFXA 4ESWA 1B3EA 2UVIA 3IOTA 1DOTA 3CSBA 5ESYA 5J1DA 1B7UA 3MC2A 3TEPA 3K1MA 3IJOB 4HTGA 1N3WA 2O51A 4GLIA 4FEDA 1N7WA 4XF5A 2WEFA 1YXIA 1TFAA 5CC2A 3QAXA 4FECA 1ANFA 3B8BA 4KD5A 5HM4B 4OEUA 3PV0E 1QVSA 4PGPA 4AB5A 2RCBA 1B3LA 2NVUB 1EZOA 1LCFA 5I2NA 1GVCA 2Q88A 4JVCA 5EYFA 3TUSA 5H8QB 3K1NA 3E79A 1FPFA 3VVEA 4QF9A 1OLAA 4KYEA 4P1LA 3LSXA 5AA2D 1NH7A 4IO6A 3SETA 2G29A 3O6HA 2HAUA 3T96B 5JTYB 2QS1A 3HHFA 4NAPA 1VDWA 3GXAA 3PPPA 1DTZA 4NF6A 1MXWA 4U1ZA 3K6WA 1FPGA 4Q8RA 3G3GA 2FA7A 1R9LA 4EXLA 3UIFA 4KCCA 4IO5A 3IJXB 2Y7PA 3Q29A 4R6YA 4OERA 1LAHE 4ZDMA 4P3LA 1MPDA 4RY1A 3PPQA 3TTKA 2XXKA 2H5YA 3PPNA 2V93A 1PBPA 2ONKE 4OVTA 3S9MC 3C33A 3N6TA 2KQZA 1LEVA 2XX7A 4BDOA 4NF5B 3QXMA 1ZTYA 1QKBA 3C35A 4NF8A 2F6GA 5CMCA 3GBBA 5FHNA 3IO4A 4AS5A 1SYHA 3LSFB 2Z23A 4JB7A 2QSXA 1B9JA 5CMBA 1YZ0A 1NV0A 1Q35A 1D9YA 2QFLA 2PMSA 5K2YA 3AXFA 3C34A 1ELJA 2DVCA 2Z8FA 4ZEBA 4PF8A 3KC1A 4GWYA 4KYSA 3C32A 2XWVA 5ET5A 1OVBA 4KCDA 2P2AA 3FVOA 4LA9A 1PC3A 3LSWA 4JXIA 2CZHA 5FHOA 1MS7A 1NV2A 1Y4CA 1SW4A 5I5PA 1FPIA 3K1PA 5AE4A 4WEPA 2Y5KA 3MP6A 2MKZA 4TQUQ 4I62A 1B51A 3S9EA 2WYPA 4DZ1A 4P9KA 3S9LC 2I3VA 4M4GA 3SZPA 4F2OA 3CG1A 2R8TA 3EHSA 3I3VA 2DE3A 2XWOA 4G61A 1I69A 4R74A 4N6DA 4FBPA 4O3BA 1MY4A 4YB6A 3FV1A 1Q9DA 2PFZA 4YKKA 2XXRA 1RYOA 4F3PA 1GR2A 1FBEA 5DVIA 3RN8A 1NMUA 4N91A 1H3DA 1SDXA 4K3FA 4X8RA 4OA4A 4ELQA 1M5EA 4HS7A 4F31B 4EQ7A 4IO4A 2QVRA 2XHDA 5H8SA 1D9QA 2D3IA 1NV6A 5H8QA 1IIWA 3SDFA 5DYHA 2BJIA 3G3HA 1LBCA 1EU8A 4N81A 2GH9A 1B0LA 5B70A 2R6GE 2O68A 2F34A 2XWKA 2F7AA 4MX6A 4HCWA 4P8BA 5JTYA 4MLQA 4QRZA 3DP8A 2UVGA 3MSTA 4TLMB 1USYH 4G8NA 4H1XA 1LBXA 1OMPA 2O7IA 5TP9B 1FPJA 3ZS6A 3IOWA 3Q27A 1Y20A 3FV2A 1NNKA 4RK2A 1MY0A 1NUWA 4HCYA 1FTKA 4OESA 2Q8MA 1IEJA 2ZNSA 2VP1A 4GL0A 2RKMA 4GWSA 2XD3A 3KEIA 1B2HA 4THIA 4P56A 3H3GA 2B65A 4PAKA 3K02A 2H9BA 2VOZA 4KFQA 4MAGA 1IQ7A 1YPNA 4LUBA 4ZZAA 5I59B 4EDPA 4ELRA 2WBBA 1O7TA 4NF5A 4MNIA 4HE0A 5CI5A 2NOOA 5IAIA 3PPOA 1NV1A 3MVZA 4DLDA 4R2BA 4XEQA 4F1YA 3FVGA 4ND9A 1ZBMA 3QSLA 1N76A 4G8HA 2ZYOA 3JV9A 3KFMA 4OQOA 2B3BA 1MH4A 4FIMA 3USDA 4Q30B 1I6AA 4ESXA 3E3KA 2WX9A 4OEVA 4Z7EA 1A54A 2A5TB 2XXVA 3PMVA 3U92A 4MEVA 2FBPA 4P0GA 1MXZA 3H03A 1JEVA 1IMAA 3LUZA 4EF2A 2CMOA 1MQGA 4IGRA 4YMBA 1EZ9A 4RJZA 4N4UA 3PMWA 4MNCA 4R6HA 1TXFA 1B4HA 2H25A 3HSTA 3TTNA 3B7DA 3G3IA 4H0WA 4NWDA 5IKBA 1RDZA 2Q8JA 5EHSA 1POY1 3TQLA 2UYEA 4PQJA 3PTYA 3EHTA 1JETA 4PP0A 1MDQA 2F3BA 4RK9A 3W9VA 2Y7RA 1MY3A 2QMXA 5I7IA 2X26A 5ICTA 2ABHA 3PGFA 2OK2A 5B7DA 2GRVA 3EHUA 2O84X 1FSAA 2I48A 4Q5TA 1LBYA 2F7BA 1BIYA 3O66A 3IFAA 3DP4A 4OZ9A 2GHBA 3MJNA 2XXUA 3LSLA 2YJPA 4LZ8A 4OHNA 4C1TA 1J1NA 2DE4A 1XI6A 3T9VA 3KJ7A 4F2QA 1Z7ME 5DVJA 4H45A 1A55A 4POWA 5CBRA 4ONYA 4RPOA 4E0WA 1AIVA 1KZ8A 2VGQA 1L5TA 3O2AA 4AQ4A 4RA1A 2HXWA 3BIGA 1XS5A 1MG1A 3H6WA 3FVKA 4QFLA 3IB2A 1SW5A 2H4IA 5TP9A 1US4A 2DP8A 3T9HB 2ZXTA 2DDKA 5FHMA 4ELPA 1FBDA 1S9TA 2RC8A 3O6IA 3DP6A 1I6BA 1N7XA 2P3VA 1FPKA 1AMFA 2OBGA 1OQGA 5I84A 4G4PA 4JWYA 1CNQA 2I0CA 3WAEA 3CR9A 3LV0A 5I59A 1NUYA 2QS4A 2NXOA 1O63A 2WKYA 2GHAA 1AH5A 2I4CA 1DMBA 1QUJA 3FJGA 4YMAA 4OVRA 1DSNA 3OEMA 2I0BA 3MQ9A 1IMFA 4NGUA 5H8FB 2OX3A 1D3KA 3RUMA 4NQ8A 1NKXA 4U21A 5JK4A 3WAFA 3OO9A 2DYXA 5EYGA 1D4NA 2PVUA 5H8HB 1MQDA 4F1UA 4HW8A 4F18A 1PEBA 3KC0A 4DI3D 2R9JA 1FTMA 3KBZA 3TMGA 4O3CA 1ZJLA 3U8QA 2DS9A 3K6XA 2LAOA 3R7XA 2A5TA 5ET7A 3R26A 3TZAA 1FRPA 3KJTA 5F1QA 3RGYA 4OFJA 4BDLA 3LBSA 3S2VA 3ILUB 1VFDA 5F7VA 1LCTA 3MUQA 1PB8A 3EN3A 2F3DA 3RLFE 2ZZXA 3SERA 3O97A 5L9MA 5I2KB 4H5FA 4N8YA 5ISUA 4NWCA 3VLUA 4YKPA 1QULA 3IFCA 4FORA 3SEVA 5H8NB 1UQWA 4KHZE 2Y84A 4PDDA 2XXIA 1MXXA 1QJMA 3V5AA 5K2XA
chains in the Genus database with same CATH topology
2ZYNA 1Y1MA 1P1QA 3CFLA 1FTLA 1MY2A 1URDA 2I3WA 4IO2A 1LGBC 3KOTA 5TPAB 4ZECA 1OVTA 5I57A 3SESA 3TCFA 3M3LA 4ZEIA 1UTHA 3RQTA 1GGGA 2HAVA 3TYHA 5KZTA 3I6VA 1QKAA 1A8EA 2HZLA 2OWSA 3O28A 1GTKA 3MVWA 2B3FA 2F5XA 4N07A 3OO8A 2Y7IA 3LC8A 1WODA 4L17A 3E9XA 3KSJA 3JYRA 4KQPA 2DSFA 3TAJA 3MZ1A 3K00A 4BDMA 4QFKA 4MF3A 1B5IA 1LFHA 4ELOA 4F3GA 1NNPA 5CM6A 3IAZA 3MW0A 2FNCA 4JSDA 2PBWA 5CMMA 5TU0A 3ZKLA 3VFJA 1LB9A 4LQ5A 2ZYKA 3W9WA 4H8JA 1F9BA 1VR5A 2RC7A 2I58A 5KCJB 3CSGA 1P1WA 2V25A 3TTRA 5H8FA 3A09A 4R6KA 3UORA 4IGTA 4TLLB 1R9QA 1O64A 3T93B 5H8HA 4GVOA 1IUDA 3MWBA 3T66A 4DIGA 2XXTA 4JWOA 4I8CA 1YCJA 4EF1A 3HHGA 2P0SA 1MQHA 3V89B 2QL3A 3IORA 4DXBA 3DLNA 3HPIA 5I2KA 2O1LA 2OCUA 1H44A 4WKMA 4WEDA 4YKIA 4BDNA 3FUZA 2Q9TA 3H6TA 3UGWA 1USYE 2ZNUA 5H8NA 1XVYA 3L6HA 3SEUA 3LUYA 3Q28A 5I56B 1Y3QA 2BJJX 2ZYMA 2OJTA 3DM0A 3MBPA 1BTJA 1ZU0A 5ELVA 3GBAA 1JVYA 1HSLA 3BKIB 4GRKA 2P1SA 1XHYA 1BP5A 4E0XA 2D21A 3ZKKA 5TPAA 4NF4B 3ECRA 3QK6A 4GL8A 4ZE9A 3O6GA 2QS2A 2Q89A 1FQFA 2DWJA 4XTCQ 4JWXA 4F39A 3FZVA 3KG2A 3MVYA 1Y9UA 2XXHA 3FXRA 4G68B 4F3SA 4UA8A 3RT8A 1M5DA 5L8DA 4IY6A 5JEIA 1RKMA 3OELA 2YLNA 1B1HA 3CRBA 2VD2A 4EQ9A 1JEUA 3KZGA 3VVDA 3QUJA 3ZSFA 3IK6B 4I1DA 4P11A 3CG3A 1LAFE 1YAEA 4ZEDA 2YPNA 3E13X 1IXGA 5M2VA 2PT2A 2ONSA 1B5JA 3VV5A 3TKDA 5CBSA 3PUXE 3IB0A 1QUIA 3BFTA 4GQOA 5KCJA 1MM6A 3FXUA 1P99A 4NE4A 1XOCA 4OFOA 3I5OA 1VE4A 5AA1A 1XT8A 3PU5A 3RT6B 3HN0A 4DCYA 3M3KA 3A3CA 3K6UA 3HO7A 4MH5A 4FEBA 1IXIA 4UACA 1B4ZA 4OXVA 4U2RA 3T9XB 1RYXA 3TQWA 2UXAA 1BKAA 4ZS9A 1Y3PA 2DOJA 4G77A 1TWYA 3V8XB 2OZZA 1ZMGA 1Z7NE 1SVXB 2Q2AA 5KDTB 2O6AA 2HZKA 1TFDA 1URGA 4LATA 1ATGA 3FIRA 3P7IA 1A99A 1MPBA 2V3TA 3KN3A 4I9DA 4XXUA 4GXSB 4YKJA 4ZZEA 4NEDA 2DXYA 3VVFA 2V84A 1NNTA 5I57B 1B3FA 5I56A 4G2ZA 1SYIA 1URSA 1UTHB 3C36A 3W15C 3OD7A 2HFBA 4AB6A 4NF4A 2ALUA 3KSXA 4OVJA 1IZ1A 2QMWA 4YU0A 1MY1A 4R73A 1B7ZA 5ICQA 4GWOA 5I58B 1HSEA 2DVZA 3TPAA 4C1UA 4X1DA 1T0KA 4PFWA 4LQ2A 1ZIUA 1NL5A 1R6ZA 3QIMA 3OOAA 1UIUA 4RPNA 3EQ1A 2F36A 3MP1A 4G68A 1OIBA 3RY3A 1UIVA 1NNFA 5FTHA 3SEXA 4RXLA 4ZEKA 3EF7A 2QPQA 1LFGA 3GZGA 4OMBA 4GF8A 2XXWA 4EUOA 3TTMA 5A5XB 4IO7A 3T9UA 3G3FA 3T22A 3MAMA 2HQ0A 1FQAA 3V83A 1NH8A 4U1OA 4MFIA 2R71A 1MRPA 4QHQA 4M1VA 2F35A 1B5HA 1P1OA 3IX1A 4XKRA 3S9NC 4XIGQ 1MH3A 2W7YA 3KN8A 3OSQA 4QFPA 4FAJA 3IO6A 1SW1A 2UYFA 2FYIA 4YB5A 4BDQA 3OSRA 3KN7A 1AL3A 5AA4B 4KPTA 1FW0A 2DQVA 1B40A 1YTVA 1LLSA 2QRYA 4DDDA 2THIA 3U72A 3PPRA 3R6UA 3MPKA 5LOMA 2OLBA 1US5A 4OTEA 3IOUA 4H5GA 4N13A 1XVXA 3B6QA 1BLFA 1FCKA 3VDFA 3MPLA 1VSOA 5HPQA 2H99A 3QYTA 3SKPA 3VE1B 2REGA 2Z8DA 1S7YA 5KDTA 2F6PA 1B05A 4MBPA 5DVFA 1Q1KA 3UP9A 3F11A 1B3GA 1JNFA 4OWDA 4OETA 4LZ5A 1Y1ZA 2M8CA 1D9VA 2Q2CA 5ITPA 3H6VA 3CFZA 4LZ7A 1FQDA 5CRYA 3PD9A 1N84A 1WVJA 1A7LA 1UTBB 3M3FA 4RYAA 3ONMA 4FE8A 4R72A 3CIJA 1PBQA 1B32A 3FJMA 3ODBA 2I49A 3TELA 3FATA 3LR1A 2Y7WA 4PETA 3VXCA 4KYDA 3FVNA 5I58A 3HCQA 1P1NA 2QS3A 1GV8A 4BDRA 3N5LA 3K01A 5DEXB 3H7MA 4R2FA 3TODA 3RPWA 3RNNA 3U94A 5BUUA 3G3JA 3RTWB 1FQEA 1N3XA 2UVJA 3JZJA 3C31A 3PUWE 4YICA 4DXUA 3G3KA 4PFTA 3D4CA 1S50A 2I6EA 3TCHA 2ONRA 3FJ7A 3K4UA 3N26A 3SEWA 2XD2A 2H98A 5A5XA 4MLVA 3TTLA 4LONB 2PYYA 5L9SA 1PB7A 3QUFA 3FASA 1HSJA 2KLFA 1PB9A 4IY5A 3IB1A 4QSDA 3H6UA 4KR5A 1SBPA 4LP2B 3S4UA 2F78A 3K6VA 4JBZA 1SQYA 1LFIA 3M8UA 5EHMA 3FXQA 4DXCA 2AIXA 3PUZE 5AA2B 5AA4A 3TDJA 3C9HA 1SI0A 1LBBA 4X48A 1EH3A 3C4MA 1IXCA 2RCAA 2RINA 1H45A 3BBRA 2XXYA 4C0RA 2IA4A 1QW0A 3B6WA 2QJEA 2XXQA 4EQBA 3PMXA 3VXBA 3UN6A 4GD5A 2NUVA 4NMYA 1H76A 3OENA 1LAXA 2F7CA 2REJA 4P0IA 1JW5A 4KI0E 2DWIA 4RNSA 3L6GA 4O3AA 1LAGE 2ESNA 2DXRA 2XX9A 2ZNTA 2F97A 2V3QA 3OO7A 4X9TA 3H06B 2XX8A 4F22A 2X7QA 2AL5A 1MXVA 2PX1A 1N0TA 4YB7A 4R9FA 1VFEA 1NFTA 1UTBA 3Q25A 1B0HA 3TFLA 1WDNA 3BFUA 3VLWA 5L9OA 2UVHA 2RF1A 1B3HA 4JDFA 3Q26A 2E0SA 1A8FA 3K2DA 3PUVE 4R75A 2PT1A 4H65A 1ZLQA 5DEXA 4ZEFA 4R9GA 3EPEA 4ISUA 4F3BA 3OXNA 1B7HA 4Z0IA 2F8DA 3DELB 2CZLA 1SW2A 3HV1A 1B46A 2NWJA 4OYVA 2I4BA 4PFYA 4ZE8A 1JQFA 5FTIA 4QFNA 3ILTB 1MQJA 4POXA 1TT1A 4ECFA 1IXHA 3N6UA 1IITA 2ANJA 3VLVA 4F1VA 3D4GA 1ZKBA 1B1XA 3FD3A 4G8MA 4PFUA 5ITOA 4U4XA 2DWAA 4PE5B 3MP8A 2XXXA 4XKPA 1EZPA 1CE2A 5BWJA 3OO6A 1B52A 4JSOA 2O69A 2O7UA 3THIA 4U4SA 1OQHA 1M5CA 5AA2A 3B6TA 3PUYE 1DTGA 1Y4TA 3IR1A 3KGCA 1R1NA 4DE8A 5CMKA 1FQBA 3KOSA 1II5A 2HEUA 3U1OA 4XKNA 4EXKA 3U93A 1FTJA 2X7PA 1FQCA 5I2NB 3O9PA 1FTOA 4H8IA 1QUKA 2VHAA 4GIZA 4QSCA 1N04A 1AOVA 1LB8A 1I6QA 1JW4A 4IO3A 1SI1A 4U22A 5AA3A 3OEKA 3SEYA 3MZBA 1MQIA 1XC1A 1H43A 4XKQA 3PD8A 1M5BA 4OFLA 1P1UA 4GOTA 3K0VA 4QSEA 3RTFB 4U23A 1MM7A 1OLCA 3E4RA 4DCXA 4LVQA 3MVXA 5HBCA 4NF6B 4GXAA 1MDP1 1PDAA 1SD3A 2ZMBA 3KBRA 2OWTA 2AL4A 1DPEA 4NTLA 1MXUA 1JVXA 3MZ9A 3G7WA 4BLAA 3N94A 4WXJA 4N6PA 2D5WA 4GFRA 4TOZA 5DT6A 4FATA 2VD3A 3O29A 4YAHX 1B6HA 1KWHA 2Z8EA 3IL1B 4F29A 2Z22A 3A3UA 1M5FA 4IB2A 2RC9A 3TCGA 4NF8B 1B58A 2DWHA 1POTA 2DE2A 3CVGA 2HCAA 4OENA 2AYSA 2IEEA 1LSTA 4H67A 3CI8A 3OMBA 4YZZA 1DPPA 4H6DA 2Y7KA 2XXPA 1A40A 1CB6A 3GLBA 2E1SA 1MXYA 2GFEA 3FGSA 4G68C 4F19A 2O1MA 3H4ZA 1JW1A 4X1BA 2G93A 1MPCA 3IOVA 4Q0CA 4FJPA 3UK4A 5DTBA 1Y3NA 3UA8A 2A5SA 4QFOA 2V3UA 3CFXA 4ESWA 1B3EA 2UVIA 3IOTA 1DOTA 3CSBA 5J1DA 1B7UA 3MC2A 3TEPA 3K1MA 3IJOB 4HTGA 1N3WA 2O51A 4GLIA 4FEDA 1N7WA 1TFAA 5CC2A 3QAXA 4FECA 1ANFA 4KD5A 5HM4B 4OEUA 3PV0E 1QVSA 4AB5A 2RCBA 1B3LA 2NVUB 1EZOA 1LCFA 5I2NA 1GVCA 2Q88A 5EYFA 3TUSA 5H8QB 3K1NA 3VVEA 4QF9A 1OLAA 4KYEA 3LSXA 5AA2D 1NH7A 4IO6A 3SETA 2G29A 3O6HA 2HAUA 3T96B 5JTYB 2QS1A 3HHFA 3GXAA 3PPPA 1DTZA 4NF6A 1MXWA 4U1ZA 3K6WA 4Q8RA 3G3GA 2FA7A 1R9LA 4EXLA 3UIFA 4KCCA 4IO5A 3IJXB 2Y7PA 3Q29A 4R6YA 4OERA 1LAHE 4ZDMA 1MPDA 4RY1A 3PPQA 3TTKA 2H5YA 3PPNA 2V93A 1PBPA 2ONKE 3S9MC 3C33A 3N6TA 2XX7A 4BDOA 4NF5B 3QXMA 1ZTYA 1QKBA 3C35A 4NF8A 2F6GA 5CMCA 3GBBA 5FHNA 3IO4A 1SYHA 3LSFB 2Z23A 4JB7A 2QSXA 1B9JA 5CMBA 1Q35A 1D9YA 2PMSA 5K2YA 3AXFA 3C34A 1ELJA 2DVCA 2Z8FA 4ZEBA 4KYSA 3C32A 1OVBA 4KCDA 2P2AA 3FVOA 4LA9A 1PC3A 3LSWA 4JXIA 5FHOA 1MS7A 1Y4CA 1SW4A 3K1PA 5AE4A 4WEPA 3MP6A 4TQUQ 4I62A 1B51A 3S9EA 4DZ1A 3S9LC 2I3VA 4M4GA 4F2OA 3CG1A 3EHSA 3I3VA 2DE3A 4R74A 1I69A 4O3BA 1MY4A 4YB6A 3FV1A 4YKKA 2XXRA 1RYOA 4F3PA 1GR2A 5DVIA 3RN8A 1NMUA 1H3DA 1SDXA 4K3FA 4ELQA 1M5EA 4HS7A 4F31B 4EQ7A 4IO4A 2XHDA 5H8SA 2D3IA 5H8QA 1IIWA 3SDFA 5DYHA 3G3HA 1LBCA 1EU8A 2GH9A 1B0LA 5B70A 2R6GE 2O68A 2F34A 2F7AA 4HCWA 5JTYA 4MLQA 4QRZA 3DP8A 2UVGA 4TLMB 1USYH 4G8NA 4H1XA 1OMPA 2O7IA 5TP9B 3ZS6A 3IOWA 3Q27A 1Y20A 3FV2A 1NNKA 4RK2A 1MY0A 4HCYA 1FTKA 4OESA 1IEJA 2ZNSA 2VP1A 4GL0A 2RKMA 2XD3A 3KEIA 1B2HA 4THIA 3H3GA 2B65A 3K02A 2H9BA 2VOZA 4KFQA 1IQ7A 1YPNA 4LUBA 4ZZAA 5I59B 4EDPA 4ELRA 4NF5A 1O7TA 5CI5A 2NOOA 5IAIA 3PPOA 3MVZA 4DLDA 4R2BA 4F1YA 3FVGA 4ND9A 1ZBMA 3QSLA 1N76A 4G8HA 2ZYOA 3JV9A 3KFMA 4OQOA 2B3BA 1MH4A 4FIMA 3USDA 4Q30B 1I6AA 4ESXA 3E3KA 4OEVA 4Z7EA 1A54A 2A5TB 2XXVA 3PMVA 3U92A 4P0GA 1MXZA 3H03A 1JEVA 4EF2A 2CMOA 1MQGA 4IGRA 4YMBA 1EZ9A 4RJZA 3PMWA 4R6HA 1TXFA 1B4HA 2H25A 3HSTA 3TTNA 3B7DA 3G3IA 4H0WA 4NWDA 5IKBA 2Q8JA 5EHSA 1POY1 3TQLA 2UYEA 4PQJA 3EHTA 1JETA 4PP0A 1MDQA 4RK9A 3W9VA 2Y7RA 1MY3A 2QMXA 2X26A 5ICTA 2ABHA 3PGFA 2OK2A 5B7DA 2GRVA 3EHUA 2O84X 2I48A 4Q5TA 2F7BA 1BIYA 3O66A 3DP4A 4OZ9A 2GHBA 3MJNA 2XXUA 3LSLA 2YJPA 4LZ8A 4OHNA 4C1TA 1J1NA 2DE4A 3T9VA 3KJ7A 4F2QA 1Z7ME 5DVJA 1A55A 4POWA 5CBRA 4ONYA 4RPOA 4E0WA 1AIVA 2VGQA 1L5TA 3O2AA 4AQ4A 4RA1A 2HXWA 1XS5A 1MG1A 3H6WA 3FVKA 4QFLA 3IB2A 1SW5A 5TP9A 2H4IA 1US4A 2DP8A 3T9HB 2ZXTA 5FHMA 4ELPA 1S9TA 2RC8A 3O6IA 3DP6A 1I6BA 1N7XA 1AMFA 2OBGA 1OQGA 5I84A 4G4PA 4JWYA 2I0CA 3WAEA 3CR9A 5I59A 2QS4A 2NXOA 1O63A 2WKYA 2GHAA 1AH5A 2I4CA 1DMBA 1QUJA 3FJGA 4YMAA 1DSNA 3OEMA 2I0BA 3MQ9A 5H8FB 1D3KA 3RUMA 4U21A 1NKXA 5JK4A 3WAFA 3OO9A 2DYXA 1D4NA 2PVUA 5H8HB 1MQDA 4F1UA 4HW8A 4F18A 1PEBA 2R9JA 1FTMA 3TMGA 4O3CA 1ZJLA 3U8QA 2DS9A 3K6XA 2LAOA 3R7XA 2A5TA 3R26A 3TZAA 3KJTA 5F1QA 3RGYA 4OFJA 4BDLA 3LBSA 3S2VA 3ILUB 1VFDA 5F7VA 1LCTA 3MUQA 1PB8A 3EN3A 3RLFE 3SERA 3O97A 5L9MA 5I2KB 4H5FA 5ISUA 4NWCA 3VLUA 4YKPA 1QULA 4FORA 3SEVA 5H8NB 1UQWA 4KHZE 2Y84A 2XXIA 1MXXA 1QJMA 3V5AA 5K2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZYN A;  1Y1M A;  1P1Q A;  3CFL A;  1FTL A;  1MY2 A;  1URD A;  2I3W A;  4IO2 A;  1LGB C;  3KOT A;  5TPA B;  4ZEC A;  1OVT A;  5I57 A;  3SES A;  3TCF A;  3M3L A;  4ZEI A;  1UTH A;  3RQT A;  1GGG A;  2HAV A;  3TYH A;  5KZT A;  3I6V A;  1QKA A;  1A8E A;  2HZL A;  2OWS A;  3O28 A;  1GTK A;  3MVW A;  2B3F A;  2F5X A;  4N07 A;  3OO8 A;  2Y7I A;  3LC8 A;  1WOD A;  4L17 A;  3E9X A;  3KSJ A;  3JYR A;  4KQP A;  2DSF A;  3TAJ A;  3MZ1 A;  3K00 A;  4BDM A;  4QFK A;  4MF3 A;  1B5I A;  1LFH A;  4ELO A;  4F3G A;  1NNP A;  5CM6 A;  3IAZ A;  3MW0 A;  2FNC A;  4JSD A;  2PBW A;  5CMM A;  5TU0 A;  3ZKL A;  3VFJ A;  1LB9 A;  4LQ5 A;  2ZYK A;  3W9W A;  4H8J A;  1F9B A;  1VR5 A;  2RC7 A;  2I58 A;  5KCJ B;  3CSG A;  1P1W A;  2V25 A;  3TTR A;  5H8F A;  3A09 A;  4R6K A;  3UOR A;  4IGT A;  4TLL B;  1R9Q A;  1O64 A;  3T93 B;  5H8H A;  4GVO A;  1IUD A;  3MWB A;  3T66 A;  4DIG A;  2XXT A;  4JWO A;  4I8C A;  1YCJ A;  4EF1 A;  3HHG A;  2P0S A;  1MQH A;  3V89 B;  2QL3 A;  3IOR A;  4DXB A;  3DLN A;  3HPI A;  5I2K A;  2O1L A;  2OCU A;  1H44 A;  4WKM A;  4WED A;  4YKI A;  4BDN A;  3FUZ A;  2Q9T A;  3H6T A;  3UGW A;  1USY E;  2ZNU A;  5H8N A;  1XVY A;  3L6H A;  3SEU A;  3LUY A;  3Q28 A;  5I56 B;  1Y3Q A;  2BJJ X;  2ZYM A;  2OJT A;  3DM0 A;  3MBP A;  1BTJ A;  1ZU0 A;  5ELV A;  3GBA A;  1JVY A;  1HSL A;  3BKI B;  4GRK A;  2P1S A;  1XHY A;  1BP5 A;  4E0X A;  2D21 A;  3ZKK A;  5TPA A;  4NF4 B;  3ECR A;  3QK6 A;  4GL8 A;  4ZE9 A;  3O6G A;  2QS2 A;  2Q89 A;  1FQF A;  2DWJ A;  4XTC Q;  4JWX A;  4F39 A;  3FZV A;  3KG2 A;  3MVY A;  1Y9U A;  2XXH A;  3FXR A;  4G68 B;  4F3S A;  4UA8 A;  3RT8 A;  1M5D A;  5L8D A;  4IY6 A;  5JEI A;  1RKM A;  3OEL A;  2YLN A;  1B1H A;  3CRB A;  2VD2 A;  4EQ9 A;  1JEU A;  3KZG A;  3VVD A;  3QUJ A;  3ZSF A;  3IK6 B;  4I1D A;  4P11 A;  3CG3 A;  1LAF E;  1YAE A;  4ZED A;  2YPN A;  3E13 X;  1IXG A;  5M2V A;  2PT2 A;  2ONS A;  1B5J A;  3VV5 A;  3TKD A;  5CBS A;  3PUX E;  3IB0 A;  1QUI A;  3BFT A;  4GQO A;  5KCJ A;  1MM6 A;  3FXU A;  1P99 A;  4NE4 A;  1XOC A;  4OFO A;  3I5O A;  1VE4 A;  5AA1 A;  1XT8 A;  3PU5 A;  3RT6 B;  3HN0 A;  4DCY A;  3M3K A;  3A3C A;  3K6U A;  3HO7 A;  4MH5 A;  4FEB A;  1IXI A;  4UAC A;  1B4Z A;  4OXV A;  4U2R A;  3T9X B;  1RYX A;  3TQW A;  2UXA A;  1BKA A;  4ZS9 A;  1Y3P A;  2DOJ A;  4G77 A;  1TWY A;  3V8X B;  2OZZ A;  1ZMG A;  1Z7N E;  1SVX B;  2Q2A A;  5KDT B;  2O6A A;  2HZK A;  1TFD A;  1URG A;  4LAT A;  1ATG A;  3FIR A;  3P7I A;  1A99 A;  1MPB A;  2V3T A;  3KN3 A;  4I9D A;  4XXU A;  4GXS B;  4YKJ A;  4ZZE A;  4NED A;  2DXY A;  3VVF A;  2V84 A;  1NNT A;  5I57 B;  1B3F A;  5I56 A;  4G2Z A;  1SYI A;  1URS A;  1UTH B;  3C36 A;  3W15 C;  3OD7 A;  2HFB A;  4AB6 A;  4NF4 A;  2ALU A;  3KSX A;  4OVJ A;  1IZ1 A;  2QMW A;  4YU0 A;  1MY1 A;  4R73 A;  1B7Z A;  5ICQ A;  4GWO A;  5I58 B;  1HSE A;  2DVZ A;  3TPA A;  4C1U A;  4X1D A;  1T0K A;  4PFW A;  4LQ2 A;  1ZIU A;  1NL5 A;  1R6Z A;  3QIM A;  3OOA A;  1UIU A;  4RPN A;  3EQ1 A;  2F36 A;  3MP1 A;  4G68 A;  1OIB A;  3RY3 A;  1UIV A;  1NNF A;  5FTH A;  3SEX A;  4RXL A;  4ZEK A;  3EF7 A;  2QPQ A;  1LFG A;  3GZG A;  4OMB A;  4GF8 A;  2XXW A;  4EUO A;  3TTM A;  5A5X B;  4IO7 A;  3T9U A;  3G3F A;  3T22 A;  3MAM A;  2HQ0 A;  1FQA A;  3V83 A;  1NH8 A;  4U1O A;  4MFI A;  2R71 A;  1MRP A;  4QHQ A;  4M1V A;  2F35 A;  1B5H A;  1P1O A;  3IX1 A;  4XKR A;  3S9N C;  4XIG Q;  1MH3 A;  2W7Y A;  3KN8 A;  3OSQ A;  4QFP A;  4FAJ A;  3IO6 A;  1SW1 A;  2UYF A;  2FYI A;  4YB5 A;  4BDQ A;  3OSR A;  3KN7 A;  1AL3 A;  5AA4 B;  4KPT A;  1FW0 A;  2DQV A;  1B40 A;  1YTV A;  1LLS A;  2QRY A;  4DDD A;  2THI A;  3U72 A;  3PPR A;  3R6U A;  3MPK A;  5LOM A;  2OLB A;  1US5 A;  4OTE A;  3IOU A;  4H5G A;  4N13 A;  1XVX A;  3B6Q A;  1BLF A;  1FCK A;  3VDF A;  3MPL A;  1VSO A;  5HPQ A;  2H99 A;  3QYT A;  3SKP A;  3VE1 B;  2REG A;  2Z8D A;  1S7Y A;  5KDT A;  2F6P A;  1B05 A;  4MBP A;  5DVF A;  1Q1K A;  3UP9 A;  3F11 A;  1B3G A;  1JNF A;  4OWD A;  4OET A;  4LZ5 A;  1Y1Z A;  2M8C A;  1D9V A;  2Q2C A;  5ITP A;  3H6V A;  3CFZ A;  4LZ7 A;  1FQD A;  5CRY A;  3PD9 A;  1N84 A;  1WVJ A;  1A7L A;  1UTB B;  3M3F A;  4RYA A;  3ONM A;  4FE8 A;  4R72 A;  3CIJ A;  1PBQ A;  1B32 A;  3FJM A;  3ODB A;  2I49 A;  3TEL A;  3FAT A;  3LR1 A;  2Y7W A;  4PET A;  3VXC A;  4KYD A;  3FVN A;  5I58 A;  3HCQ A;  1P1N A;  2QS3 A;  1GV8 A;  4BDR A;  3N5L A;  3K01 A;  5DEX B;  3H7M A;  4R2F A;  3TOD A;  3RPW A;  3RNN A;  3U94 A;  5BUU A;  3G3J A;  3RTW B;  1FQE A;  1N3X A;  2UVJ A;  3JZJ A;  3C31 A;  3PUW E;  4YIC A;  4DXU A;  3G3K A;  4PFT A;  3D4C A;  1S50 A;  2I6E A;  3TCH A;  2ONR A;  3FJ7 A;  3K4U A;  3N26 A;  3SEW A;  2XD2 A;  2H98 A;  5A5X A;  4MLV A;  3TTL A;  4LON B;  2PYY A;  5L9S A;  1PB7 A;  3QUF A;  3FAS A;  1HSJ A;  2KLF A;  1PB9 A;  4IY5 A;  3IB1 A;  4QSD A;  3H6U A;  4KR5 A;  1SBP A;  4LP2 B;  3S4U A;  2F78 A;  3K6V A;  4JBZ A;  1SQY A;  1LFI A;  3M8U A;  5EHM A;  3FXQ A;  4DXC A;  2AIX A;  3PUZ E;  5AA2 B;  5AA4 A;  3TDJ A;  3C9H A;  1SI0 A;  1LBB A;  4X48 A;  1EH3 A;  3C4M A;  1IXC A;  2RCA A;  2RIN A;  1H45 A;  3BBR A;  2XXY A;  4C0R A;  2IA4 A;  1QW0 A;  3B6W A;  2QJE A;  2XXQ A;  4EQB A;  3PMX A;  3VXB A;  3UN6 A;  4GD5 A;  2NUV A;  4NMY A;  1H76 A;  3OEN A;  1LAX A;  2F7C A;  2REJ A;  4P0I A;  1JW5 A;  4KI0 E;  2DWI A;  4RNS A;  3L6G A;  4O3A A;  1LAG E;  2ESN A;  2DXR A;  2XX9 A;  2ZNT A;  2F97 A;  2V3Q A;  3OO7 A;  4X9T A;  3H06 B;  2XX8 A;  4F22 A;  2X7Q A;  2AL5 A;  1MXV A;  2PX1 A;  1N0T A;  4YB7 A;  4R9F A;  1VFE A;  1NFT A;  1UTB A;  3Q25 A;  1B0H A;  3TFL A;  1WDN A;  3BFU A;  3VLW A;  5L9O A;  2UVH A;  2RF1 A;  1B3H A;  4JDF A;  3Q26 A;  2E0S A;  1A8F A;  3K2D A;  3PUV E;  4R75 A;  2PT1 A;  4H65 A;  1ZLQ A;  5DEX A;  4ZEF A;  4R9G A;  3EPE A;  4ISU A;  4F3B A;  3OXN A;  1B7H A;  4Z0I A;  2F8D A;  3DEL B;  2CZL A;  1SW2 A;  3HV1 A;  1B46 A;  2NWJ A;  4OYV A;  2I4B A;  4PFY A;  4ZE8 A;  1JQF A;  5FTI A;  4QFN A;  3ILT B;  1MQJ A;  4POX A;  1TT1 A;  4ECF A;  1IXH A;  3N6U A;  1IIT A;  2ANJ A;  3VLV A;  4F1V A;  3D4G A;  1ZKB A;  1B1X A;  3FD3 A;  4G8M A;  4PFU A;  5ITO A;  4U4X A;  2DWA A;  4PE5 B;  3MP8 A;  2XXX A;  4XKP A;  1EZP A;  1CE2 A;  5BWJ A;  3OO6 A;  1B52 A;  4JSO A;  2O69 A;  2O7U A;  3THI A;  4U4S A;  1OQH A;  1M5C A;  5AA2 A;  3B6T A;  3PUY E;  1DTG A;  1Y4T A;  3IR1 A;  3KGC A;  1R1N A;  4DE8 A;  5CMK A;  1FQB A;  3KOS A;  1II5 A;  2HEU A;  3U1O A;  4XKN A;  4EXK A;  3U93 A;  1FTJ A;  2X7P A;  1FQC A;  5I2N B;  3O9P A;  1FTO A;  4H8I A;  1QUK A;  2VHA A;  4GIZ A;  4QSC A;  1N04 A;  1AOV A;  1LB8 A;  1I6Q A;  1JW4 A;  4IO3 A;  1SI1 A;  4U22 A;  5AA3 A;  3OEK A;  3SEY A;  3MZB A;  1MQI A;  1XC1 A;  1H43 A;  4XKQ A;  3PD8 A;  1M5B A;  4OFL A;  1P1U A;  4GOT A;  3K0V A;  4QSE A;  3RTF B;  4U23 A;  1MM7 A;  1OLC A;  3E4R A;  4DCX A;  4LVQ A;  3MVX A;  5HBC A;  4NF6 B;  4GXA A;  1MDP 1;  1PDA A;  1SD3 A;  2ZMB A;  3KBR A;  2OWT A;  2AL4 A;  1DPE A;  4NTL A;  1MXU A;  1JVX A;  3MZ9 A;  3G7W A;  4BLA A;  3N94 A;  4WXJ A;  4N6P A;  2D5W A;  4GFR A;  4TOZ A;  5DT6 A;  4FAT A;  2VD3 A;  3O29 A;  4YAH X;  1B6H A;  1KWH A;  2Z8E A;  3IL1 B;  4F29 A;  2Z22 A;  3A3U A;  1M5F A;  4IB2 A;  2RC9 A;  3TCG A;  4NF8 B;  1B58 A;  2DWH A;  1POT A;  2DE2 A;  3CVG A;  2HCA A;  4OEN A;  2AYS A;  2IEE A;  1LST A;  4H67 A;  3CI8 A;  3OMB A;  4YZZ A;  1DPP A;  4H6D A;  2Y7K A;  2XXP A;  1A40 A;  1CB6 A;  3GLB A;  2E1S A;  1MXY A;  2GFE A;  3FGS A;  4G68 C;  4F19 A;  2O1M A;  3H4Z A;  1JW1 A;  4X1B A;  2G93 A;  1MPC A;  3IOV A;  4Q0C A;  4FJP A;  3UK4 A;  5DTB A;  1Y3N A;  3UA8 A;  2A5S A;  4QFO A;  2V3U A;  3CFX A;  4ESW A;  1B3E A;  2UVI A;  3IOT A;  1DOT A;  3CSB A;  5J1D A;  1B7U A;  3MC2 A;  3TEP A;  3K1M A;  3IJO B;  4HTG A;  1N3W A;  2O51 A;  4GLI A;  4FED A;  1N7W A;  1TFA A;  5CC2 A;  3QAX A;  4FEC A;  1ANF A;  4KD5 A;  5HM4 B;  4OEU A;  3PV0 E;  1QVS A;  4AB5 A;  2RCB A;  1B3L A;  2NVU B;  1EZO A;  1LCF A;  5I2N A;  1GVC A;  2Q88 A;  5EYF A;  3TUS A;  5H8Q B;  3K1N A;  3VVE A;  4QF9 A;  1OLA A;  4KYE A;  3LSX A;  5AA2 D;  1NH7 A;  4IO6 A;  3SET A;  2G29 A;  3O6H A;  2HAU A;  3T96 B;  5JTY B;  2QS1 A;  3HHF A;  3GXA A;  3PPP A;  1DTZ A;  4NF6 A;  1MXW A;  4U1Z A;  3K6W A;  4Q8R A;  3G3G A;  2FA7 A;  1R9L A;  4EXL A;  3UIF A;  4KCC A;  4IO5 A;  3IJX B;  2Y7P A;  3Q29 A;  4R6Y A;  4OER A;  1LAH E;  4ZDM A;  1MPD A;  4RY1 A;  3PPQ A;  3TTK A;  2H5Y A;  3PPN A;  2V93 A;  1PBP A;  2ONK E;  3S9M C;  3C33 A;  3N6T A;  2XX7 A;  4BDO A;  4NF5 B;  3QXM A;  1ZTY A;  1QKB A;  3C35 A;  4NF8 A;  2F6G A;  5CMC A;  3GBB A;  5FHN A;  3IO4 A;  1SYH A;  3LSF B;  2Z23 A;  4JB7 A;  2QSX A;  1B9J A;  5CMB A;  1Q35 A;  1D9Y A;  2PMS A;  5K2Y A;  3AXF A;  3C34 A;  1ELJ A;  2DVC A;  2Z8F A;  4ZEB A;  4KYS A;  3C32 A;  1OVB A;  4KCD A;  2P2A A;  3FVO A;  4LA9 A;  1PC3 A;  3LSW A;  4JXI A;  5FHO A;  1MS7 A;  1Y4C A;  1SW4 A;  3K1P A;  5AE4 A;  4WEP A;  3MP6 A;  4TQU Q;  4I62 A;  1B51 A;  3S9E A;  4DZ1 A;  3S9L C;  2I3V A;  4M4G A;  4F2O A;  3CG1 A;  3EHS A;  3I3V A;  2DE3 A;  4R74 A;  1I69 A;  4O3B A;  1MY4 A;  4YB6 A;  3FV1 A;  4YKK A;  2XXR A;  1RYO A;  4F3P A;  1GR2 A;  5DVI A;  3RN8 A;  1NMU A;  1H3D A;  1SDX A;  4K3F A;  4ELQ A;  1M5E A;  4HS7 A;  4F31 B;  4EQ7 A;  4IO4 A;  2XHD A;  5H8S A;  2D3I A;  5H8Q A;  1IIW A;  3SDF A;  5DYH A;  3G3H A;  1LBC A;  1EU8 A;  2GH9 A;  1B0L A;  5B70 A;  2R6G E;  2O68 A;  2F34 A;  2F7A A;  4HCW A;  5JTY A;  4MLQ A;  4QRZ A;  3DP8 A;  2UVG A;  4TLM B;  1USY H;  4G8N A;  4H1X A;  1OMP A;  2O7I A;  5TP9 B;  3ZS6 A;  3IOW A;  3Q27 A;  1Y20 A;  3FV2 A;  1NNK A;  4RK2 A;  1MY0 A;  4HCY A;  1FTK A;  4OES A;  1IEJ A;  2ZNS A;  2VP1 A;  4GL0 A;  2RKM A;  2XD3 A;  3KEI A;  1B2H A;  4THI A;  3H3G A;  2B65 A;  3K02 A;  2H9B A;  2VOZ A;  4KFQ A;  1IQ7 A;  1YPN A;  4LUB A;  4ZZA A;  5I59 B;  4EDP A;  4ELR A;  4NF5 A;  1O7T A;  5CI5 A;  2NOO A;  5IAI A;  3PPO A;  3MVZ A;  4DLD A;  4R2B A;  4F1Y A;  3FVG A;  4ND9 A;  1ZBM A;  3QSL A;  1N76 A;  4G8H A;  2ZYO A;  3JV9 A;  3KFM A;  4OQO A;  2B3B A;  1MH4 A;  4FIM A;  3USD A;  4Q30 B;  1I6A A;  4ESX A;  3E3K A;  4OEV A;  4Z7E A;  1A54 A;  2A5T B;  2XXV A;  3PMV A;  3U92 A;  4P0G A;  1MXZ A;  3H03 A;  1JEV A;  4EF2 A;  2CMO A;  1MQG A;  4IGR A;  4YMB A;  1EZ9 A;  4RJZ A;  3PMW A;  4R6H A;  1TXF A;  1B4H A;  2H25 A;  3HST A;  3TTN A;  3B7D A;  3G3I A;  4H0W A;  4NWD A;  5IKB A;  2Q8J A;  5EHS A;  1POY 1;  3TQL A;  2UYE A;  4PQJ A;  3EHT A;  1JET A;  4PP0 A;  1MDQ A;  4RK9 A;  3W9V A;  2Y7R A;  1MY3 A;  2QMX A;  2X26 A;  5ICT A;  2ABH A;  3PGF A;  2OK2 A;  5B7D A;  2GRV A;  3EHU A;  2O84 X;  2I48 A;  4Q5T A;  2F7B A;  1BIY A;  3O66 A;  3DP4 A;  4OZ9 A;  2GHB A;  3MJN A;  2XXU A;  3LSL A;  2YJP A;  4LZ8 A;  4OHN A;  4C1T A;  1J1N A;  2DE4 A;  3T9V A;  3KJ7 A;  4F2Q A;  1Z7M E;  5DVJ A;  1A55 A;  4POW A;  5CBR A;  4ONY A;  4RPO A;  4E0W A;  1AIV A;  2VGQ A;  1L5T A;  3O2A A;  4AQ4 A;  4RA1 A;  2HXW A;  1XS5 A;  1MG1 A;  3H6W A;  3FVK A;  4QFL A;  3IB2 A;  1SW5 A;  5TP9 A;  2H4I A;  1US4 A;  2DP8 A;  3T9H B;  2ZXT A;  5FHM A;  4ELP A;  1S9T A;  2RC8 A;  3O6I A;  3DP6 A;  1I6B A;  1N7X A;  1AMF A;  2OBG A;  1OQG A;  5I84 A;  4G4P A;  4JWY A;  2I0C A;  3WAE A;  3CR9 A;  5I59 A;  2QS4 A;  2NXO A;  1O63 A;  2WKY A;  2GHA A;  1AH5 A;  2I4C A;  1DMB A;  1QUJ A;  3FJG A;  4YMA A;  1DSN A;  3OEM A;  2I0B A;  3MQ9 A;  5H8F B;  1D3K A;  3RUM A;  4U21 A;  1NKX A;  5JK4 A;  3WAF A;  3OO9 A;  2DYX A;  1D4N A;  2PVU A;  5H8H B;  1MQD A;  4F1U A;  4HW8 A;  4F18 A;  1PEB A;  2R9J A;  1FTM A;  3TMG A;  4O3C A;  1ZJL A;  3U8Q A;  2DS9 A;  3K6X A;  2LAO A;  3R7X A;  2A5T A;  3R26 A;  3TZA A;  3KJT A;  5F1Q A;  3RGY A;  4OFJ A;  4BDL A;  3LBS A;  3S2V A;  3ILU B;  1VFD A;  5F7V A;  1LCT A;  3MUQ A;  1PB8 A;  3EN3 A;  3RLF E;  3SER A;  3O97 A;  5L9M A;  5I2K B;  4H5F A;  5ISU A;  4NWC A;  3VLU A;  4YKP A;  1QUL A;  4FOR A;  3SEV A;  5H8N B;  1UQW A;  4KHZ E;  2Y84 A;  2XXI A;  1MXX A;  1QJM A;  3V5A A;  5K2X A; 
#chains in the Genus database with same CATH topology
 2ZYN A;  1SPI A;  1Y1M A;  1P1Q A;  1LBW A;  1FBC A;  3CFL A;  4GWZ A;  4NX1 A;  1FTL A;  1MY2 A;  1URD A;  2I3W A;  4IO2 A;  1LGB C;  3KOT A;  5TPA B;  4PAF A;  4ZEC A;  1OVT A;  5I57 A;  3SES A;  3TCF A;  4GBV A;  3M3L A;  4ZEI A;  1UTH A;  3RQT A;  1GGG A;  2HAV A;  1JP4 A;  3TYH A;  5KZT A;  3I6V A;  1QKA A;  1A8E A;  2HZL A;  2OWS A;  3O28 A;  1GTK A;  3MVW A;  2B3F A;  2F5X A;  4N07 A;  3MYU A;  3OO8 A;  4IR8 A;  4PC9 A;  4NN3 A;  5DW8 A;  5EQ9 A;  2Y7I A;  3LC8 A;  1WOD A;  4L17 A;  3E9X A;  3KSJ A;  3JYR A;  1FPE A;  2FVZ A;  4KQP A;  2DSF A;  3TAJ A;  3MZ1 A;  3K00 A;  4BDM A;  4QFK A;  4MF3 A;  1B5I A;  1LFH A;  4I40 A;  4ELO A;  4F3G A;  1NNP A;  5CM6 A;  3IAZ A;  3MW0 A;  2FNC A;  4JSD A;  2PBW A;  5CMM A;  5TU0 A;  3ZKL A;  4OVS A;  3VFJ A;  1LB9 A;  4LQ5 A;  4PFB A;  2ZYK A;  3W9W A;  1FJ9 A;  4H8J A;  1F9B A;  1VR5 A;  2RC7 A;  2I58 A;  5KCJ B;  3CSG A;  1EYI A;  1P1W A;  2V25 A;  5ET8 A;  2ZZV A;  3TTR A;  5H8F A;  3A09 A;  4R6K A;  3UOR A;  4IGT A;  4TLL B;  1R9Q A;  4LN5 A;  1O64 A;  3T93 B;  4MJO A;  1FPB A;  5H8H A;  4GVO A;  1IUD A;  1DK4 A;  3MWB A;  4PF6 A;  3T66 A;  4DIG A;  1G0I A;  2XXT A;  4JWO A;  2XWI A;  4I8C A;  1YCJ A;  4EF1 A;  5EQ8 A;  3HHG A;  2P0S A;  1MQH A;  3V89 B;  2QL3 A;  4PGN A;  1KA1 A;  3IOR A;  4DXB A;  3DLN A;  4N8G A;  3HPI A;  5I2K A;  2O1L A;  1LBV A;  2OCU A;  2Q74 A;  1H44 A;  4PBH A;  4WKM A;  4WED A;  1FBF A;  4YKI A;  4BDN A;  3FUZ A;  4OVP A;  2Q9T A;  3H6T A;  3UGW A;  1USY E;  2ZNU A;  5IZ1 A;  5H8N A;  1XVY A;  3L6H A;  3SEU A;  1INP A;  3GYY A;  3LUY A;  3Q28 A;  5I56 B;  1Y3Q A;  2BJJ X;  2ZYM A;  3QMF A;  3FXB A;  2OJT A;  3DM0 A;  3MBP A;  1BTJ A;  1ZU0 A;  5ELV A;  3ISP A;  3GBA A;  1JVY A;  1HSL A;  3BKI B;  4GRK A;  2P1S A;  1XHY A;  1BP5 A;  4E0X A;  2D21 A;  3ZKK A;  1NV7 A;  5TPA A;  4NF4 B;  3ECR A;  3QK6 A;  2FIX A;  2OWZ A;  4GL8 A;  4MHF A;  5FBP A;  4ZE9 A;  4N17 A;  1NUX A;  3O6G A;  1NUZ A;  2QS2 A;  2Q89 A;  2CEX A;  1FQF A;  2DWJ A;  4XTC Q;  4JWX A;  4F39 A;  3FZV A;  3KG2 A;  3MVY A;  2ZZW A;  1Y9U A;  1IME A;  2XXH A;  3FXR A;  4G68 B;  4F3S A;  4UA8 A;  3RT8 A;  1M5D A;  5L8D A;  4IY6 A;  4H46 A;  5JEI A;  1RKM A;  3OEL A;  2YLN A;  1B1H A;  3CRB A;  2VD2 A;  4EQ9 A;  1JEU A;  3KZG A;  4O8M A;  3VVD A;  3QUJ A;  3ZSF A;  3IK6 B;  4I1D A;  4MNP A;  4P11 A;  3CG3 A;  1LAF E;  2QVV A;  4GX6 A;  1YAE A;  4ZED A;  2YPN A;  3E13 X;  3RPL B;  1IXG A;  5M2V A;  2PT2 A;  2HPG A;  2ONS A;  1B5J A;  3VV5 A;  3TKD A;  5CBS A;  1NI9 A;  3PUX E;  1KA0 A;  3IB0 A;  1QUI A;  3BFT A;  4GQO A;  5KCJ A;  1MM6 A;  3FXU A;  4P1E A;  3HFU A;  1P99 A;  4NE4 A;  1XOC A;  4OFO A;  3I5O A;  1VE4 A;  5AA1 A;  1XT8 A;  3PU5 A;  3RT6 B;  1DCU A;  3HN0 A;  1G0H A;  4DCY A;  3M3K A;  3A3C A;  3K6U A;  3HO7 A;  4MH5 A;  1FBH A;  4FEB A;  1IXI A;  4UAC A;  1B4Z A;  4OXV A;  4MMP A;  4U2R A;  3T9X B;  1RYX A;  4GWX A;  4O7I A;  4QXD A;  3TQW A;  2UXA A;  1BKA A;  4ZS9 A;  1Y3P A;  2DOJ A;  4G77 A;  2L5V A;  1TWY A;  3V8X B;  2OZZ A;  1ZMG A;  1Z7N E;  5LTC A;  1SVX B;  2Q2A A;  5KDT B;  2O6A A;  2HZK A;  4MCO A;  1TFD A;  1URG A;  4LAT A;  1ATG A;  3FIR A;  4P47 A;  3P7I A;  1A99 A;  1MPB A;  2V3T A;  5EYH A;  3KN3 A;  4I9D A;  4XXU A;  4GXS B;  4YKJ A;  4ZZE A;  4NED A;  2DXY A;  3VVF A;  2V84 A;  1NNT A;  5I57 B;  1B3F A;  5I56 A;  4G2Z A;  1SYI A;  1URS A;  1UTH B;  1NV5 A;  3C36 A;  1NV4 A;  3W15 C;  3OD7 A;  2HFB A;  4AB6 A;  4NF4 A;  2ALU A;  3KSX A;  4OVJ A;  1IZ1 A;  2QMW A;  4UAB A;  4YU0 A;  1MY1 A;  4R73 A;  1B7Z A;  2CZI A;  5ICQ A;  4GWO A;  5I58 B;  1HSE A;  2DVZ A;  3TPA A;  4C1U A;  1RDY A;  4X1D A;  1T0K A;  4PFW A;  4LQ2 A;  1EYK A;  1ZIU A;  1NL5 A;  1R6Z A;  5A5L A;  1RDX A;  3RYD A;  3QIM A;  3OOA A;  1UIU A;  4RPN A;  3EQ1 A;  2F36 A;  3MP1 A;  4G68 A;  1OIB A;  3RY3 A;  1UIV A;  1NNF A;  5FTH A;  3SEX A;  4RXL A;  4ZEK A;  3EF7 A;  2QPQ A;  2CZK A;  1LFG A;  3GZG A;  4OMB A;  4GF8 A;  4GWU A;  4X04 A;  2XXW A;  4EUO A;  3TTM A;  5A5X B;  4IO7 A;  3T9U A;  3G3F A;  3T22 A;  3MAM A;  4N6K A;  2HQ0 A;  2PFY A;  1FQA A;  3V83 A;  3B50 A;  1NH8 A;  2FIE A;  4U1O A;  4PE3 A;  4MFI A;  5LDZ A;  2R71 A;  1MRP A;  3RPL A;  4QHQ A;  4M1V A;  2F35 A;  4XFE A;  1B5H A;  3A29 A;  1P1O A;  3IX1 A;  4XKR A;  3S9N C;  4XIG Q;  1MH3 A;  2W7Y A;  3KN8 A;  3OSQ A;  4QFP A;  4FAJ A;  3IO6 A;  1SW1 A;  2UYF A;  2FYI A;  4YB5 A;  4BDQ A;  2WYK A;  3OSR A;  3KN7 A;  1AL3 A;  5AA4 B;  4KPT A;  1FW0 A;  2GQ1 A;  2DQV A;  1B40 A;  1YTV A;  1AWB A;  1LLS A;  2QRY A;  4DDD A;  2THI A;  3U72 A;  3PPR A;  3R6U A;  3E78 A;  3MPK A;  5LOM A;  5IZZ A;  2OLB A;  1US5 A;  4PTK A;  4OTE A;  3IOU A;  4H5G A;  4N13 A;  1XVX A;  3B6Q A;  1BLF A;  1FCK A;  3VDF A;  3MPL A;  3T0J A;  1VSO A;  5HPQ A;  2H99 A;  3QYT A;  3SKP A;  3VE1 B;  2REG A;  2Z8D A;  1S7Y A;  2KR0 A;  1QGX A;  5KDT A;  2F6P A;  1B05 A;  4MBP A;  5DVF A;  1Q1K A;  3UP9 A;  3F11 A;  1B3G A;  1JNF A;  4OWD A;  4OET A;  4LZ5 A;  4MIJ A;  1Y1Z A;  2M8C A;  1D9V A;  2Q2C A;  5ITP A;  3H6V A;  3CFZ A;  4PFR A;  4LZ7 A;  1FQD A;  5CRY A;  3PD9 A;  1N84 A;  1WVJ A;  1A7L A;  1UTB B;  3M3F A;  3FBP A;  4RYA A;  3ONM A;  4FE8 A;  4R72 A;  3CIJ A;  1PBQ A;  1B32 A;  3FJM A;  1FPL A;  3ODB A;  2I49 A;  3TEL A;  3FAT A;  3LR1 A;  4I3E A;  2Y7W A;  4PET A;  3VXC A;  4KYD A;  3FVN A;  4PDH A;  1NV3 A;  5I58 A;  3HCQ A;  1P1N A;  2QS3 A;  1GV8 A;  5ET6 A;  4BDR A;  3N5L A;  3K01 A;  5DEX B;  3H7M A;  4R2F A;  3TOD A;  3RPW A;  3RNN A;  3U94 A;  3G3J A;  5BUU A;  3RTW B;  1FQE A;  1N3X A;  2UVJ A;  3JZJ A;  3ROJ A;  3C31 A;  3PUW E;  4YIC A;  4DXU A;  3G3K A;  4PFT A;  3D4C A;  4JVI A;  1S50 A;  2VPO A;  2I6E A;  3TCH A;  2ONR A;  3FJ7 A;  2JJK A;  3K4U A;  3N26 A;  3SEW A;  2XD2 A;  5T3J A;  2H98 A;  5A5X A;  5I3S A;  4KXP A;  1IMD A;  4MLV A;  3TTL A;  4LON B;  2PYY A;  5L9S A;  4I3Y A;  1PB7 A;  2B4M A;  3QUF A;  1FBG A;  3FAS A;  1FBP A;  4GX4 A;  1HSJ A;  2KLF A;  3T1B A;  1PB9 A;  4IY5 A;  3IB1 A;  4QSD A;  5IZ3 B;  3H6U A;  4KR5 A;  2Y5L A;  1SBP A;  4LP2 B;  3S4U A;  2F78 A;  3K6V A;  4JBZ A;  4DI4 B;  1SQY A;  1LFI A;  4QBA A;  3M8U A;  5EHM A;  4O7M A;  3FXQ A;  4DXC A;  2AIX A;  5F24 A;  3PUZ E;  5AA2 B;  1EYJ A;  5AA4 A;  3TDJ A;  4O94 A;  3C9H A;  1SI0 A;  1LBB A;  4X48 A;  1EH3 A;  3C4M A;  1IXC A;  2RCA A;  2RIN A;  1H45 A;  3BBR A;  2XXY A;  4C0R A;  2IA4 A;  1QW0 A;  4HXV A;  3B6W A;  2QJE A;  2XXQ A;  4EQB A;  3PMX A;  3VXB A;  3UN6 A;  4GD5 A;  2NUV A;  4NMY A;  1H76 A;  3OEN A;  1LAX A;  2F7C A;  2REJ A;  4P0I A;  4NHB A;  1JW5 A;  4KI0 E;  2DWI A;  4RNS A;  3L6G A;  2VPN A;  4O3A A;  1LAG E;  2ESN A;  2DXR A;  2XX9 A;  2ZNT A;  2F97 A;  2V3Q A;  3OO7 A;  4X9T A;  1IMB A;  2QVU A;  3H06 B;  1YYZ A;  2XX8 A;  4F22 A;  2X7Q A;  2AL5 A;  1MXV A;  2PX1 A;  1N0T A;  4N15 A;  4YB7 A;  4R9F A;  1VFE A;  5IM2 A;  1NFT A;  1UTB A;  1FJ6 A;  3Q25 A;  1B0H A;  3TFL A;  1WDN A;  3BFU A;  4HE1 A;  3VLW A;  2HHM A;  5L9O A;  2UVH A;  2RF1 A;  1B3H A;  4JDF A;  3Q26 A;  2E0S A;  1A8F A;  3K2D A;  3PUV E;  4R75 A;  2PT1 A;  4H65 A;  1ZLQ A;  5DEX A;  4ZEF A;  2V4C A;  4NG7 A;  4R9G A;  3EPE A;  4ISU A;  4F3B A;  3OXN A;  1B7H A;  4Z0I A;  2F8D A;  3DEL B;  2CZL A;  1SW2 A;  3HV1 A;  1B46 A;  2P3N A;  2NWJ A;  4OYV A;  2I4B A;  4PFY A;  4ZE8 A;  1JQF A;  5FTI A;  4QFN A;  3ILT B;  1MQJ A;  4POX A;  1TT1 A;  4ECF A;  1IXH A;  3N6U A;  4GWW A;  1IIT A;  2ANJ A;  3VLV A;  4F1V A;  3D4G A;  1ZKB A;  1FPD A;  1B1X A;  3FD3 A;  1LBZ A;  4G8M A;  4PFU A;  5ITO A;  4U4X A;  2DWA A;  4PE5 B;  3MP8 A;  2XXX A;  4XKP A;  1EZP A;  1CE2 A;  5BWJ A;  3OO6 A;  5IZ3 A;  1B52 A;  4JSO A;  2O69 A;  2O7U A;  3CHG A;  3THI A;  4U4S A;  1OQH A;  2HXR A;  1M5C A;  5AA2 A;  3B6T A;  3PUY E;  4PAI A;  1DTG A;  2WBD A;  1Y4T A;  3IR1 A;  3KGC A;  1R1N A;  1DBZ A;  4DE8 A;  3D1R A;  5CMK A;  1FQB A;  3KOS A;  1K9Z A;  1II5 A;  5J16 A;  2HEU A;  3U1O A;  4XKN A;  4EXK A;  3NOH A;  3U93 A;  1FTJ A;  1FTA A;  2X7P A;  1FQC A;  5I2N B;  3O9P A;  4JVD A;  1FTO A;  4H8I A;  1QUK A;  2VHA A;  4GIZ A;  4QSC A;  1N04 A;  1AOV A;  1LB8 A;  1I6Q A;  4OAN A;  1JW4 A;  4IO3 A;  1IMC A;  1SI1 A;  4U22 A;  5AA3 A;  3OEK A;  3SEY A;  3MZB A;  5EQA A;  1MQI A;  4GBW A;  1XC1 A;  1H43 A;  4XKQ A;  3PD8 A;  1M5B A;  4OFL A;  5IGA A;  1P1U A;  4GOT A;  3K0V A;  4QSE A;  4U23 A;  3RTF B;  1MM7 A;  1OLC A;  3E4R A;  4DCX A;  4LVQ A;  2XA5 A;  3MVX A;  1K9Y A;  5HBC A;  4NF6 B;  4GXA A;  1MDP 1;  1PDA A;  1SD3 A;  2ZMB A;  3KBR A;  2OWT A;  2AL4 A;  1DPE A;  4NTL A;  1MXU A;  1JVX A;  3MZ9 A;  3G7W A;  4NF0 A;  4AS4 A;  4BLA A;  3N94 A;  4WXJ A;  4N6P A;  1BK4 A;  4TOZ A;  2D5W A;  4GFR A;  5DT6 A;  4FAT A;  2VD3 A;  3O29 A;  4YAH X;  2PCR A;  1B6H A;  1KWH A;  2CEY A;  2Z8E A;  3IL1 B;  4F29 A;  2Z22 A;  3A3U A;  1M5F A;  4IB2 A;  2RC9 A;  3TCG A;  4NF8 B;  3BIH A;  4OVQ A;  1B58 A;  2DWH A;  1POT A;  2DE2 A;  3CVG A;  4HE2 A;  2HCA A;  4OEN A;  2AYS A;  2IEE A;  1LST A;  4H67 A;  3CI8 A;  3OMB A;  4YZZ A;  1DPP A;  4H6D A;  2Y7K A;  2XXP A;  3EKI A;  2VT5 A;  3U65 A;  1A40 A;  2B4L A;  1CB6 A;  3GLB A;  4GX3 A;  2E1S A;  1MXY A;  2GFE A;  3FGS A;  4G68 C;  4F19 A;  2O1M A;  5EQ7 A;  3H4Z A;  1JW1 A;  4PBQ A;  4X1B A;  2G93 A;  1MPC A;  3IOV A;  4PCD A;  4Q0C A;  4FJP A;  2FHY A;  3UK4 A;  5DTB A;  1Y3N A;  3UA8 A;  2A5S A;  4PFI A;  4QFO A;  2V3U A;  3CFX A;  4ESW A;  1B3E A;  2UVI A;  3IOT A;  1DOT A;  3CSB A;  5ESY A;  5J1D A;  1B7U A;  3MC2 A;  3TEP A;  3K1M A;  3IJO B;  4HTG A;  1N3W A;  2O51 A;  4GLI A;  4FED A;  1N7W A;  4XF5 A;  2WEF A;  1YXI A;  1TFA A;  5CC2 A;  3QAX A;  4FEC A;  1ANF A;  3B8B A;  4KD5 A;  5HM4 B;  4OEU A;  3PV0 E;  1QVS A;  4PGP A;  4AB5 A;  2RCB A;  1B3L A;  2NVU B;  1EZO A;  1LCF A;  5I2N A;  1GVC A;  2Q88 A;  4JVC A;  5EYF A;  3TUS A;  5H8Q B;  3K1N A;  3E79 A;  1FPF A;  3VVE A;  4QF9 A;  1OLA A;  4KYE A;  4P1L A;  3LSX A;  5AA2 D;  1NH7 A;  4IO6 A;  3SET A;  2G29 A;  3O6H A;  2HAU A;  3T96 B;  5JTY B;  2QS1 A;  3HHF A;  4NAP A;  1VDW A;  3GXA A;  3PPP A;  1DTZ A;  4NF6 A;  1MXW A;  4U1Z A;  3K6W A;  1FPG A;  4Q8R A;  3G3G A;  2FA7 A;  1R9L A;  4EXL A;  3UIF A;  4KCC A;  4IO5 A;  3IJX B;  2Y7P A;  3Q29 A;  4R6Y A;  4OER A;  1LAH E;  4ZDM A;  4P3L A;  1MPD A;  4RY1 A;  3PPQ A;  3TTK A;  2XXK A;  2H5Y A;  3PPN A;  2V93 A;  1PBP A;  2ONK E;  4OVT A;  3S9M C;  3C33 A;  3N6T A;  2KQZ A;  1LEV A;  2XX7 A;  4BDO A;  4NF5 B;  3QXM A;  1ZTY A;  1QKB A;  3C35 A;  4NF8 A;  2F6G A;  5CMC A;  3GBB A;  5FHN A;  3IO4 A;  4AS5 A;  1SYH A;  3LSF B;  2Z23 A;  4JB7 A;  2QSX A;  1B9J A;  5CMB A;  1YZ0 A;  1NV0 A;  1Q35 A;  1D9Y A;  2QFL A;  2PMS A;  5K2Y A;  3AXF A;  3C34 A;  1ELJ A;  2DVC A;  2Z8F A;  4ZEB A;  4PF8 A;  3KC1 A;  4GWY A;  4KYS A;  3C32 A;  2XWV A;  5ET5 A;  1OVB A;  4KCD A;  2P2A A;  3FVO A;  4LA9 A;  1PC3 A;  3LSW A;  4JXI A;  2CZH A;  5FHO A;  1MS7 A;  1NV2 A;  1Y4C A;  1SW4 A;  5I5P A;  1FPI A;  3K1P A;  5AE4 A;  4WEP A;  2Y5K A;  3MP6 A;  2MKZ A;  4TQU Q;  4I62 A;  1B51 A;  3S9E A;  2WYP A;  4DZ1 A;  4P9K A;  3S9L C;  2I3V A;  4M4G A;  3SZP A;  4F2O A;  3CG1 A;  2R8T A;  3EHS A;  3I3V A;  2DE3 A;  2XWO A;  4G61 A;  1I69 A;  4R74 A;  4N6D A;  4FBP A;  4O3B A;  1MY4 A;  4YB6 A;  3FV1 A;  1Q9D A;  2PFZ A;  4YKK A;  2XXR A;  1RYO A;  4F3P A;  1GR2 A;  1FBE A;  5DVI A;  3RN8 A;  1NMU A;  4N91 A;  1H3D A;  1SDX A;  4K3F A;  4X8R A;  4OA4 A;  4ELQ A;  1M5E A;  4HS7 A;  4F31 B;  4EQ7 A;  4IO4 A;  2QVR A;  2XHD A;  5H8S A;  1D9Q A;  2D3I A;  1NV6 A;  5H8Q A;  1IIW A;  3SDF A;  5DYH A;  2BJI A;  3G3H A;  1LBC A;  1EU8 A;  4N81 A;  2GH9 A;  1B0L A;  5B70 A;  2R6G E;  2O68 A;  2F34 A;  2XWK A;  2F7A A;  4MX6 A;  4HCW A;  4P8B A;  5JTY A;  4MLQ A;  4QRZ A;  3DP8 A;  2UVG A;  3MST A;  4TLM B;  1USY H;  4G8N A;  4H1X A;  1LBX A;  1OMP A;  2O7I A;  5TP9 B;  1FPJ A;  3ZS6 A;  3IOW A;  3Q27 A;  1Y20 A;  3FV2 A;  1NNK A;  4RK2 A;  1MY0 A;  1NUW A;  4HCY A;  1FTK A;  4OES A;  2Q8M A;  1IEJ A;  2ZNS A;  2VP1 A;  4GL0 A;  2RKM A;  4GWS A;  2XD3 A;  3KEI A;  1B2H A;  4THI A;  4P56 A;  3H3G A;  2B65 A;  4PAK A;  3K02 A;  2H9B A;  2VOZ A;  4KFQ A;  4MAG A;  1IQ7 A;  1YPN A;  4LUB A;  4ZZA A;  5I59 B;  4EDP A;  4ELR A;  2WBB A;  1O7T A;  4NF5 A;  4MNI A;  4HE0 A;  5CI5 A;  2NOO A;  5IAI A;  3PPO A;  1NV1 A;  3MVZ A;  4DLD A;  4R2B A;  4XEQ A;  4F1Y A;  3FVG A;  4ND9 A;  1ZBM A;  3QSL A;  1N76 A;  4G8H A;  2ZYO A;  3JV9 A;  3KFM A;  4OQO A;  2B3B A;  1MH4 A;  4FIM A;  3USD A;  4Q30 B;  1I6A A;  4ESX A;  3E3K A;  2WX9 A;  4OEV A;  4Z7E A;  1A54 A;  2A5T B;  2XXV A;  3PMV A;  3U92 A;  4MEV A;  2FBP A;  4P0G A;  1MXZ A;  3H03 A;  1JEV A;  1IMA A;  3LUZ A;  4EF2 A;  2CMO A;  1MQG A;  4IGR A;  4YMB A;  1EZ9 A;  4RJZ A;  4N4U A;  3PMW A;  4MNC A;  4R6H A;  1TXF A;  1B4H A;  2H25 A;  3HST A;  3TTN A;  3B7D A;  3G3I A;  4H0W A;  4NWD A;  5IKB A;  1RDZ A;  2Q8J A;  5EHS A;  1POY 1;  3TQL A;  2UYE A;  4PQJ A;  3PTY A;  3EHT A;  1JET A;  4PP0 A;  1MDQ A;  2F3B A;  4RK9 A;  3W9V A;  2Y7R A;  1MY3 A;  2QMX A;  5I7I A;  2X26 A;  5ICT A;  2ABH A;  3PGF A;  2OK2 A;  5B7D A;  2GRV A;  3EHU A;  2O84 X;  1FSA A;  2I48 A;  4Q5T A;  1LBY A;  2F7B A;  1BIY A;  3O66 A;  3IFA A;  3DP4 A;  4OZ9 A;  2GHB A;  3MJN A;  2XXU A;  3LSL A;  2YJP A;  4LZ8 A;  4OHN A;  4C1T A;  1J1N A;  2DE4 A;  1XI6 A;  3T9V A;  3KJ7 A;  4F2Q A;  1Z7M E;  5DVJ A;  4H45 A;  1A55 A;  4POW A;  5CBR A;  4ONY A;  4RPO A;  4E0W A;  1AIV A;  1KZ8 A;  2VGQ A;  1L5T A;  3O2A A;  4AQ4 A;  4RA1 A;  2HXW A;  3BIG A;  1XS5 A;  1MG1 A;  3H6W A;  3FVK A;  4QFL A;  3IB2 A;  1SW5 A;  2H4I A;  5TP9 A;  1US4 A;  2DP8 A;  3T9H B;  2ZXT A;  2DDK A;  5FHM A;  4ELP A;  1FBD A;  1S9T A;  2RC8 A;  3O6I A;  3DP6 A;  1I6B A;  1N7X A;  2P3V A;  1FPK A;  1AMF A;  2OBG A;  1OQG A;  5I84 A;  4G4P A;  4JWY A;  1CNQ A;  2I0C A;  3WAE A;  3CR9 A;  3LV0 A;  5I59 A;  1NUY A;  2QS4 A;  2NXO A;  1O63 A;  2WKY A;  2GHA A;  1AH5 A;  2I4C A;  1DMB A;  1QUJ A;  3FJG A;  4YMA A;  4OVR A;  1DSN A;  3OEM A;  2I0B A;  3MQ9 A;  1IMF A;  4NGU A;  5H8F B;  2OX3 A;  1D3K A;  3RUM A;  4NQ8 A;  1NKX A;  4U21 A;  5JK4 A;  3WAF A;  3OO9 A;  2DYX A;  5EYG A;  1D4N A;  2PVU A;  5H8H B;  1MQD A;  4F1U A;  4HW8 A;  4F18 A;  1PEB A;  3KC0 A;  4DI3 D;  2R9J A;  1FTM A;  3KBZ A;  3TMG A;  4O3C A;  1ZJL A;  3U8Q A;  2DS9 A;  3K6X A;  2LAO A;  3R7X A;  2A5T A;  5ET7 A;  3R26 A;  3TZA A;  1FRP A;  3KJT A;  5F1Q A;  3RGY A;  4OFJ A;  4BDL A;  3LBS A;  3S2V A;  3ILU B;  1VFD A;  5F7V A;  1LCT A;  3MUQ A;  1PB8 A;  3EN3 A;  2F3D A;  3RLF E;  2ZZX A;  3SER A;  3O97 A;  5L9M A;  5I2K B;  4H5F A;  4N8Y A;  5ISU A;  4NWC A;  3VLU A;  4YKP A;  1QUL A;  3IFC A;  4FOR A;  3SEV A;  5H8N B;  1UQW A;  4KHZ E;  2Y84 A;  4PDD A;  2XXI A;  1MXX A;  1QJM A;  3V5A A;  5K2X A; 
#chains in the Genus database with same CATH homology
 2ZYN A;  1Y1M A;  1P1Q A;  3CFL A;  1FTL A;  1MY2 A;  1URD A;  2I3W A;  4IO2 A;  1LGB C;  3KOT A;  5TPA B;  4ZEC A;  1OVT A;  5I57 A;  3SES A;  3TCF A;  3M3L A;  4ZEI A;  1UTH A;  3RQT A;  1GGG A;  2HAV A;  3TYH A;  5KZT A;  3I6V A;  1QKA A;  1A8E A;  2HZL A;  2OWS A;  3O28 A;  1GTK A;  3MVW A;  2B3F A;  2F5X A;  4N07 A;  3OO8 A;  2Y7I A;  3LC8 A;  1WOD A;  4L17 A;  3E9X A;  3KSJ A;  3JYR A;  4KQP A;  2DSF A;  3TAJ A;  3MZ1 A;  3K00 A;  4BDM A;  4QFK A;  4MF3 A;  1B5I A;  1LFH A;  4ELO A;  4F3G A;  1NNP A;  5CM6 A;  3IAZ A;  3MW0 A;  2FNC A;  4JSD A;  2PBW A;  5CMM A;  5TU0 A;  3ZKL A;  3VFJ A;  1LB9 A;  4LQ5 A;  2ZYK A;  3W9W A;  4H8J A;  1F9B A;  1VR5 A;  2RC7 A;  2I58 A;  5KCJ B;  3CSG A;  1P1W A;  2V25 A;  3TTR A;  5H8F A;  3A09 A;  4R6K A;  3UOR A;  4IGT A;  4TLL B;  1R9Q A;  1O64 A;  3T93 B;  5H8H A;  4GVO A;  1IUD A;  3MWB A;  3T66 A;  4DIG A;  2XXT A;  4JWO A;  4I8C A;  1YCJ A;  4EF1 A;  3HHG A;  2P0S A;  1MQH A;  3V89 B;  2QL3 A;  3IOR A;  4DXB A;  3DLN A;  3HPI A;  5I2K A;  2O1L A;  2OCU A;  1H44 A;  4WKM A;  4WED A;  4YKI A;  4BDN A;  3FUZ A;  2Q9T A;  3H6T A;  3UGW A;  1USY E;  2ZNU A;  5H8N A;  1XVY A;  3L6H A;  3SEU A;  3LUY A;  3Q28 A;  5I56 B;  1Y3Q A;  2BJJ X;  2ZYM A;  2OJT A;  3DM0 A;  3MBP A;  1BTJ A;  1ZU0 A;  5ELV A;  3GBA A;  1JVY A;  1HSL A;  3BKI B;  4GRK A;  2P1S A;  1XHY A;  1BP5 A;  4E0X A;  2D21 A;  3ZKK A;  5TPA A;  4NF4 B;  3ECR A;  3QK6 A;  4GL8 A;  4ZE9 A;  3O6G A;  2QS2 A;  2Q89 A;  1FQF A;  2DWJ A;  4XTC Q;  4JWX A;  4F39 A;  3FZV A;  3KG2 A;  3MVY A;  1Y9U A;  2XXH A;  3FXR A;  4G68 B;  4F3S A;  4UA8 A;  3RT8 A;  1M5D A;  5L8D A;  4IY6 A;  5JEI A;  1RKM A;  3OEL A;  2YLN A;  1B1H A;  3CRB A;  2VD2 A;  4EQ9 A;  1JEU A;  3KZG A;  3VVD A;  3QUJ A;  3ZSF A;  3IK6 B;  4I1D A;  4P11 A;  3CG3 A;  1LAF E;  1YAE A;  4ZED A;  2YPN A;  3E13 X;  1IXG A;  5M2V A;  2PT2 A;  2ONS A;  1B5J A;  3VV5 A;  3TKD A;  5CBS A;  3PUX E;  3IB0 A;  1QUI A;  3BFT A;  4GQO A;  5KCJ A;  1MM6 A;  3FXU A;  1P99 A;  4NE4 A;  1XOC A;  4OFO A;  3I5O A;  1VE4 A;  5AA1 A;  1XT8 A;  3PU5 A;  3RT6 B;  3HN0 A;  4DCY A;  3M3K A;  3A3C A;  3K6U A;  3HO7 A;  4MH5 A;  4FEB A;  1IXI A;  4UAC A;  1B4Z A;  4OXV A;  4U2R A;  3T9X B;  1RYX A;  3TQW A;  2UXA A;  1BKA A;  4ZS9 A;  1Y3P A;  2DOJ A;  4G77 A;  1TWY A;  3V8X B;  2OZZ A;  1ZMG A;  1Z7N E;  1SVX B;  2Q2A A;  5KDT B;  2O6A A;  2HZK A;  1TFD A;  1URG A;  4LAT A;  1ATG A;  3FIR A;  3P7I A;  1A99 A;  1MPB A;  2V3T A;  3KN3 A;  4I9D A;  4XXU A;  4GXS B;  4YKJ A;  4ZZE A;  4NED A;  2DXY A;  3VVF A;  2V84 A;  1NNT A;  5I57 B;  1B3F A;  5I56 A;  4G2Z A;  1SYI A;  1URS A;  1UTH B;  3C36 A;  3W15 C;  3OD7 A;  2HFB A;  4AB6 A;  4NF4 A;  2ALU A;  3KSX A;  4OVJ A;  1IZ1 A;  2QMW A;  4YU0 A;  1MY1 A;  4R73 A;  1B7Z A;  5ICQ A;  4GWO A;  5I58 B;  1HSE A;  2DVZ A;  3TPA A;  4C1U A;  4X1D A;  1T0K A;  4PFW A;  4LQ2 A;  1ZIU A;  1NL5 A;  1R6Z A;  3QIM A;  3OOA A;  1UIU A;  4RPN A;  3EQ1 A;  2F36 A;  3MP1 A;  4G68 A;  1OIB A;  3RY3 A;  1UIV A;  1NNF A;  5FTH A;  3SEX A;  4RXL A;  4ZEK A;  3EF7 A;  2QPQ A;  1LFG A;  3GZG A;  4OMB A;  4GF8 A;  2XXW A;  4EUO A;  3TTM A;  5A5X B;  4IO7 A;  3T9U A;  3G3F A;  3T22 A;  3MAM A;  2HQ0 A;  1FQA A;  3V83 A;  1NH8 A;  4U1O A;  4MFI A;  2R71 A;  1MRP A;  4QHQ A;  4M1V A;  2F35 A;  1B5H A;  1P1O A;  3IX1 A;  4XKR A;  3S9N C;  4XIG Q;  1MH3 A;  2W7Y A;  3KN8 A;  3OSQ A;  4QFP A;  4FAJ A;  3IO6 A;  1SW1 A;  2UYF A;  2FYI A;  4YB5 A;  4BDQ A;  3OSR A;  3KN7 A;  1AL3 A;  5AA4 B;  4KPT A;  1FW0 A;  2DQV A;  1B40 A;  1YTV A;  1LLS A;  2QRY A;  4DDD A;  2THI A;  3U72 A;  3PPR A;  3R6U A;  3MPK A;  5LOM A;  2OLB A;  1US5 A;  4OTE A;  3IOU A;  4H5G A;  4N13 A;  1XVX A;  3B6Q A;  1BLF A;  1FCK A;  3VDF A;  3MPL A;  1VSO A;  5HPQ A;  2H99 A;  3QYT A;  3SKP A;  3VE1 B;  2REG A;  2Z8D A;  1S7Y A;  5KDT A;  2F6P A;  1B05 A;  4MBP A;  5DVF A;  1Q1K A;  3UP9 A;  3F11 A;  1B3G A;  1JNF A;  4OWD A;  4OET A;  4LZ5 A;  1Y1Z A;  2M8C A;  1D9V A;  2Q2C A;  5ITP A;  3H6V A;  3CFZ A;  4LZ7 A;  1FQD A;  5CRY A;  3PD9 A;  1N84 A;  1WVJ A;  1A7L A;  1UTB B;  3M3F A;  4RYA A;  3ONM A;  4FE8 A;  4R72 A;  3CIJ A;  1PBQ A;  1B32 A;  3FJM A;  3ODB A;  2I49 A;  3TEL A;  3FAT A;  3LR1 A;  2Y7W A;  4PET A;  3VXC A;  4KYD A;  3FVN A;  5I58 A;  3HCQ A;  1P1N A;  2QS3 A;  1GV8 A;  4BDR A;  3N5L A;  3K01 A;  5DEX B;  3H7M A;  4R2F A;  3TOD A;  3RPW A;  3RNN A;  3U94 A;  5BUU A;  3G3J A;  3RTW B;  1FQE A;  1N3X A;  2UVJ A;  3JZJ A;  3C31 A;  3PUW E;  4YIC A;  4DXU A;  3G3K A;  4PFT A;  3D4C A;  1S50 A;  2I6E A;  3TCH A;  2ONR A;  3FJ7 A;  3K4U A;  3N26 A;  3SEW A;  2XD2 A;  2H98 A;  5A5X A;  4MLV A;  3TTL A;  4LON B;  2PYY A;  5L9S A;  1PB7 A;  3QUF A;  3FAS A;  1HSJ A;  2KLF A;  1PB9 A;  4IY5 A;  3IB1 A;  4QSD A;  3H6U A;  4KR5 A;  1SBP A;  4LP2 B;  3S4U A;  2F78 A;  3K6V A;  4JBZ A;  1SQY A;  1LFI A;  3M8U A;  5EHM A;  3FXQ A;  4DXC A;  2AIX A;  3PUZ E;  5AA2 B;  5AA4 A;  3TDJ A;  3C9H A;  1SI0 A;  1LBB A;  4X48 A;  1EH3 A;  3C4M A;  1IXC A;  2RCA A;  2RIN A;  1H45 A;  3BBR A;  2XXY A;  4C0R A;  2IA4 A;  1QW0 A;  3B6W A;  2QJE A;  2XXQ A;  4EQB A;  3PMX A;  3VXB A;  3UN6 A;  4GD5 A;  2NUV A;  4NMY A;  1H76 A;  3OEN A;  1LAX A;  2F7C A;  2REJ A;  4P0I A;  1JW5 A;  4KI0 E;  2DWI A;  4RNS A;  3L6G A;  4O3A A;  1LAG E;  2ESN A;  2DXR A;  2XX9 A;  2ZNT A;  2F97 A;  2V3Q A;  3OO7 A;  4X9T A;  3H06 B;  2XX8 A;  4F22 A;  2X7Q A;  2AL5 A;  1MXV A;  2PX1 A;  1N0T A;  4YB7 A;  4R9F A;  1VFE A;  1NFT A;  1UTB A;  3Q25 A;  1B0H A;  3TFL A;  1WDN A;  3BFU A;  3VLW A;  5L9O A;  2UVH A;  2RF1 A;  1B3H A;  4JDF A;  3Q26 A;  2E0S A;  1A8F A;  3K2D A;  3PUV E;  4R75 A;  2PT1 A;  4H65 A;  1ZLQ A;  5DEX A;  4ZEF A;  4R9G A;  3EPE A;  4ISU A;  4F3B A;  3OXN A;  1B7H A;  4Z0I A;  2F8D A;  3DEL B;  2CZL A;  1SW2 A;  3HV1 A;  1B46 A;  2NWJ A;  4OYV A;  2I4B A;  4PFY A;  4ZE8 A;  1JQF A;  5FTI A;  4QFN A;  3ILT B;  1MQJ A;  4POX A;  1TT1 A;  4ECF A;  1IXH A;  3N6U A;  1IIT A;  2ANJ A;  3VLV A;  4F1V A;  3D4G A;  1ZKB A;  1B1X A;  3FD3 A;  4G8M A;  4PFU A;  5ITO A;  4U4X A;  2DWA A;  4PE5 B;  3MP8 A;  2XXX A;  4XKP A;  1EZP A;  1CE2 A;  5BWJ A;  3OO6 A;  1B52 A;  4JSO A;  2O69 A;  2O7U A;  3THI A;  4U4S A;  1OQH A;  1M5C A;  5AA2 A;  3B6T A;  3PUY E;  1DTG A;  1Y4T A;  3IR1 A;  3KGC A;  1R1N A;  4DE8 A;  5CMK A;  1FQB A;  3KOS A;  1II5 A;  2HEU A;  3U1O A;  4XKN A;  4EXK A;  3U93 A;  1FTJ A;  2X7P A;  1FQC A;  5I2N B;  3O9P A;  1FTO A;  4H8I A;  1QUK A;  2VHA A;  4GIZ A;  4QSC A;  1N04 A;  1AOV A;  1LB8 A;  1I6Q A;  1JW4 A;  4IO3 A;  1SI1 A;  4U22 A;  5AA3 A;  3OEK A;  3SEY A;  3MZB A;  1MQI A;  1XC1 A;  1H43 A;  4XKQ A;  3PD8 A;  1M5B A;  4OFL A;  1P1U A;  4GOT A;  3K0V A;  4QSE A;  3RTF B;  4U23 A;  1MM7 A;  1OLC A;  3E4R A;  4DCX A;  4LVQ A;  3MVX A;  5HBC A;  4NF6 B;  4GXA A;  1MDP 1;  1PDA A;  1SD3 A;  2ZMB A;  3KBR A;  2OWT A;  2AL4 A;  1DPE A;  4NTL A;  1MXU A;  1JVX A;  3MZ9 A;  3G7W A;  4BLA A;  3N94 A;  4WXJ A;  4N6P A;  2D5W A;  4GFR A;  4TOZ A;  5DT6 A;  4FAT A;  2VD3 A;  3O29 A;  4YAH X;  1B6H A;  1KWH A;  2Z8E A;  3IL1 B;  4F29 A;  2Z22 A;  3A3U A;  1M5F A;  4IB2 A;  2RC9 A;  3TCG A;  4NF8 B;  1B58 A;  2DWH A;  1POT A;  2DE2 A;  3CVG A;  2HCA A;  4OEN A;  2AYS A;  2IEE A;  1LST A;  4H67 A;  3CI8 A;  3OMB A;  4YZZ A;  1DPP A;  4H6D A;  2Y7K A;  2XXP A;  1A40 A;  1CB6 A;  3GLB A;  2E1S A;  1MXY A;  2GFE A;  3FGS A;  4G68 C;  4F19 A;  2O1M A;  3H4Z A;  1JW1 A;  4X1B A;  2G93 A;  1MPC A;  3IOV A;  4Q0C A;  4FJP A;  3UK4 A;  5DTB A;  1Y3N A;  3UA8 A;  2A5S A;  4QFO A;  2V3U A;  3CFX A;  4ESW A;  1B3E A;  2UVI A;  3IOT A;  1DOT A;  3CSB A;  5J1D A;  1B7U A;  3MC2 A;  3TEP A;  3K1M A;  3IJO B;  4HTG A;  1N3W A;  2O51 A;  4GLI A;  4FED A;  1N7W A;  1TFA A;  5CC2 A;  3QAX A;  4FEC A;  1ANF A;  4KD5 A;  5HM4 B;  4OEU A;  3PV0 E;  1QVS A;  4AB5 A;  2RCB A;  1B3L A;  2NVU B;  1EZO A;  1LCF A;  5I2N A;  1GVC A;  2Q88 A;  5EYF A;  3TUS A;  5H8Q B;  3K1N A;  3VVE A;  4QF9 A;  1OLA A;  4KYE A;  3LSX A;  5AA2 D;  1NH7 A;  4IO6 A;  3SET A;  2G29 A;  3O6H A;  2HAU A;  3T96 B;  5JTY B;  2QS1 A;  3HHF A;  3GXA A;  3PPP A;  1DTZ A;  4NF6 A;  1MXW A;  4U1Z A;  3K6W A;  4Q8R A;  3G3G A;  2FA7 A;  1R9L A;  4EXL A;  3UIF A;  4KCC A;  4IO5 A;  3IJX B;  2Y7P A;  3Q29 A;  4R6Y A;  4OER A;  1LAH E;  4ZDM A;  1MPD A;  4RY1 A;  3PPQ A;  3TTK A;  2H5Y A;  3PPN A;  2V93 A;  1PBP A;  2ONK E;  3S9M C;  3C33 A;  3N6T A;  2XX7 A;  4BDO A;  4NF5 B;  3QXM A;  1ZTY A;  1QKB A;  3C35 A;  4NF8 A;  2F6G A;  5CMC A;  3GBB A;  5FHN A;  3IO4 A;  1SYH A;  3LSF B;  2Z23 A;  4JB7 A;  2QSX A;  1B9J A;  5CMB A;  1Q35 A;  1D9Y A;  2PMS A;  5K2Y A;  3AXF A;  3C34 A;  1ELJ A;  2DVC A;  2Z8F A;  4ZEB A;  4KYS A;  3C32 A;  1OVB A;  4KCD A;  2P2A A;  3FVO A;  4LA9 A;  1PC3 A;  3LSW A;  4JXI A;  5FHO A;  1MS7 A;  1Y4C A;  1SW4 A;  3K1P A;  5AE4 A;  4WEP A;  3MP6 A;  4TQU Q;  4I62 A;  1B51 A;  3S9E A;  4DZ1 A;  3S9L C;  2I3V A;  4M4G A;  4F2O A;  3CG1 A;  3EHS A;  3I3V A;  2DE3 A;  4R74 A;  1I69 A;  4O3B A;  1MY4 A;  4YB6 A;  3FV1 A;  4YKK A;  2XXR A;  1RYO A;  4F3P A;  1GR2 A;  5DVI A;  3RN8 A;  1NMU A;  1H3D A;  1SDX A;  4K3F A;  4ELQ A;  1M5E A;  4HS7 A;  4F31 B;  4EQ7 A;  4IO4 A;  2XHD A;  5H8S A;  2D3I A;  5H8Q A;  1IIW A;  3SDF A;  5DYH A;  3G3H A;  1LBC A;  1EU8 A;  2GH9 A;  1B0L A;  5B70 A;  2R6G E;  2O68 A;  2F34 A;  2F7A A;  4HCW A;  5JTY A;  4MLQ A;  4QRZ A;  3DP8 A;  2UVG A;  4TLM B;  1USY H;  4G8N A;  4H1X A;  1OMP A;  2O7I A;  5TP9 B;  3ZS6 A;  3IOW A;  3Q27 A;  1Y20 A;  3FV2 A;  1NNK A;  4RK2 A;  1MY0 A;  4HCY A;  1FTK A;  4OES A;  1IEJ A;  2ZNS A;  2VP1 A;  4GL0 A;  2RKM A;  2XD3 A;  3KEI A;  1B2H A;  4THI A;  3H3G A;  2B65 A;  3K02 A;  2H9B A;  2VOZ A;  4KFQ A;  1IQ7 A;  1YPN A;  4LUB A;  4ZZA A;  5I59 B;  4EDP A;  4ELR A;  4NF5 A;  1O7T A;  5CI5 A;  2NOO A;  5IAI A;  3PPO A;  3MVZ A;  4DLD A;  4R2B A;  4F1Y A;  3FVG A;  4ND9 A;  1ZBM A;  3QSL A;  1N76 A;  4G8H A;  2ZYO A;  3JV9 A;  3KFM A;  4OQO A;  2B3B A;  1MH4 A;  4FIM A;  3USD A;  4Q30 B;  1I6A A;  4ESX A;  3E3K A;  4OEV A;  4Z7E A;  1A54 A;  2A5T B;  2XXV A;  3PMV A;  3U92 A;  4P0G A;  1MXZ A;  3H03 A;  1JEV A;  4EF2 A;  2CMO A;  1MQG A;  4IGR A;  4YMB A;  1EZ9 A;  4RJZ A;  3PMW A;  4R6H A;  1TXF A;  1B4H A;  2H25 A;  3HST A;  3TTN A;  3B7D A;  3G3I A;  4H0W A;  4NWD A;  5IKB A;  2Q8J A;  5EHS A;  1POY 1;  3TQL A;  2UYE A;  4PQJ A;  3EHT A;  1JET A;  4PP0 A;  1MDQ A;  4RK9 A;  3W9V A;  2Y7R A;  1MY3 A;  2QMX A;  2X26 A;  5ICT A;  2ABH A;  3PGF A;  2OK2 A;  5B7D A;  2GRV A;  3EHU A;  2O84 X;  2I48 A;  4Q5T A;  2F7B A;  1BIY A;  3O66 A;  3DP4 A;  4OZ9 A;  2GHB A;  3MJN A;  2XXU A;  3LSL A;  2YJP A;  4LZ8 A;  4OHN A;  4C1T A;  1J1N A;  2DE4 A;  3T9V A;  3KJ7 A;  4F2Q A;  1Z7M E;  5DVJ A;  1A55 A;  4POW A;  5CBR A;  4ONY A;  4RPO A;  4E0W A;  1AIV A;  2VGQ A;  1L5T A;  3O2A A;  4AQ4 A;  4RA1 A;  2HXW A;  1XS5 A;  1MG1 A;  3H6W A;  3FVK A;  4QFL A;  3IB2 A;  1SW5 A;  5TP9 A;  2H4I A;  1US4 A;  2DP8 A;  3T9H B;  2ZXT A;  5FHM A;  4ELP A;  1S9T A;  2RC8 A;  3O6I A;  3DP6 A;  1I6B A;  1N7X A;  1AMF A;  2OBG A;  1OQG A;  5I84 A;  4G4P A;  4JWY A;  2I0C A;  3WAE A;  3CR9 A;  5I59 A;  2QS4 A;  2NXO A;  1O63 A;  2WKY A;  2GHA A;  1AH5 A;  2I4C A;  1DMB A;  1QUJ A;  3FJG A;  4YMA A;  1DSN A;  3OEM A;  2I0B A;  3MQ9 A;  5H8F B;  1D3K A;  3RUM A;  4U21 A;  1NKX A;  5JK4 A;  3WAF A;  3OO9 A;  2DYX A;  1D4N A;  2PVU A;  5H8H B;  1MQD A;  4F1U A;  4HW8 A;  4F18 A;  1PEB A;  2R9J A;  1FTM A;  3TMG A;  4O3C A;  1ZJL A;  3U8Q A;  2DS9 A;  3K6X A;  2LAO A;  3R7X A;  2A5T A;  3R26 A;  3TZA A;  3KJT A;  5F1Q A;  3RGY A;  4OFJ A;  4BDL A;  3LBS A;  3S2V A;  3ILU B;  1VFD A;  5F7V A;  1LCT A;  3MUQ A;  1PB8 A;  3EN3 A;  3RLF E;  3SER A;  3O97 A;  5L9M A;  5I2K B;  4H5F A;  5ISU A;  4NWC A;  3VLU A;  4YKP A;  1QUL A;  4FOR A;  3SEV A;  5H8N B;  1UQW A;  4KHZ E;  2Y84 A;  2XXI A;  1MXX A;  1QJM A;  3V5A A;  5K2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...