4NF4A

Crystal structure of glun1/glun2a ligand-binding domain in complex with dcka and glutamate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
284
structure length
277
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor ionotropic, NMDA 1
publication title Structural Insights into Competitive Antagonism in NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, receptor
total genus 75
structure length 277
sequence length 284
ec nomenclature
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf4A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf4A02
2Z8FA 2ZYNA 4XKRA 3UK4A 3ZKLA 2F78A 4ZECA 4BDRA 1LB9A 4OTEA 1LAFE 1URDA 4XIGQ 1POY1 3VDFA 4IO4A 2UVHA 3PD9A 1UIVA 4DCXA 3HCQA 2DP8A 2HEUA 1SW4A 1MXZA 2HCAA 2DWIA 4BDMA 4PFYA 2V84A 4F19A 2XXTA 5H8FA 4QSEA 3UIFA 2OCUA 3DELB 3Q27A 4IO6A 3IB2A 2GH9A 2V93A 1NH8A 2VGQA 3R26A 4U1OA 3C34A 5CMCA 1MQJA 4QSDA 3TEPA 2GHAA 5AA2A 5HM4B 2XXQA 2ZMBA 3UP9A 1XOCA 2OK2A 1A99A 5AA2D 2NWJA 2OWTA 1LAGE 1UIUA 2Q8JA 5IKBA 3M3FA 4RXLA 3IX1A 1GVCA 2H98A 4OETA 4THIA 2NVUB 3RQTA 1SD3A 1MXVA 3FGSA 4KYSA 3UGWA 5TP9A 3EHSA 1P1UA 3TAJA 2PBWA 1B3HA 3IL1B 5L9OA 4ZE8A 4LA9A 3RTWB 4BDQA 2I0CA 2RC7A 3TQWA 4ESXA 4LATA 3SEUA 2HZLA 2QMWA 2DOJA 5JTYB 1MPCA 4R6HA 1LLSA 1LB8A 4FIMA 3CFZA 4KD5A 1AOVA 4YB6A 1Z7NE 1FQBA 4E0XA 1PB8A 2UYFA 2ALUA 4AQ4A 4LQ5A 1BLFA 1ELJA 2DE3A 4X1DA 3FXUA 5AA4A 3EF7A 3Q28A 1DTZA 3MW0A 4FEBA 3IO4A 4F39A 5DT6A 2P0SA 2QL3A 3OO7A 4FE8A 4ZZEA 1FQCA 4MLVA 2F97A 4MBPA 5I59A 4RK2A 2ZYMA 4OFJA 1O63A 3QXMA 4DXBA 3H4ZA 3TPAA 4LP2B 3H7MA 4MF3A 1US4A 3ILUB 3U93A 3K6WA 1T0KA 3DP8A 2X7PA 4JBZA 1GV8A 4HCWA 3FD3A 4H0WA 3C35A 2VHAA 4H5GA 4Q8RA 4GOTA 2IEEA 2HQ0A 4DE8A 2O7IA 4KYEA 3IOWA 3G3FA 2ONSA 1UTBA 1NNFA 2O1MA 3KJ7A 4XKPA 1MY4A 5B7DA 4KHZE 4LQ2A 3D4CA 3N6UA 4F3PA 3KJTA 4GF8A 1MQDA 2Y7KA 2D5WA 3U94A 2RC8A 2WKYA 3MP6A 3MWBA 4HTGA 1DTGA 1S50A 4RK9A 3QK6A 3PU5A 2YLNA 3I6VA 5IAIA 2ZNTA 4L17A 4NF5B 2Q88A 1URSA 2O68A 3PPOA 3TTNA 1USYH 1UQWA 3CIJA 3EN3A 1LCFA 1MDP1 4E0WA 1B7UA 2QS1A 5DEXB 3A09A 4EXLA 5AE4A 5B70A 3OEKA 1QKAA 1DSNA 3G3KA 1H3DA 1DPPA 4YKIA 4G2ZA 1XVYA 3MC2A 2XXVA 5KDTA 1RYOA 3B7DA 1N7XA 3G3JA 3KBRA 4NMYA 4KCCA 1FQAA 3G3GA 2E0SA 3KFMA 1P1NA 3N5LA 4H8IA 1WODA 3VV5A 4I62A 5FHMA 1MY0A 2V3TA 3K2DA 1Y9UA 4F2OA 4O3AA 2O84X 3PMWA 3LSFB 3PV0E 1Z7ME 2OLBA 3IB0A 1POTA 1I6AA 3MBPA 5H8QB 3N6TA 3PUZE 3KG2A 4GXSB 2Z8EA 2OWSA 4I1DA 4U21A 1D9VA 5I2KB 3C31A 3W9VA 1PDAA 2ZNUA 3THIA 4QFKA 2G29A 2QS3A 4NWCA 1EZ9A 2DQVA 1Y1ZA 4NF8B 3ZS6A 4TLMB 2XX7A 2XXHA 1A54A 4XKQA 1I6BA 1DPEA 1B6HA 4KQPA 4ECFA 2B3BA 2AL5A 1B7HA 3C9HA 2XX8A 1I69A 2ZXTA 2F6PA 3O6GA 2W7YA 4G68A 3K6UA 2FYIA 3VLUA 1YPNA 5EYFA 1NFTA 5KZTA 3Q29A 4PE5B 3T93B 2XXPA 3TODA 1URGA 1N3XA 1B1XA 3Q25A 4YKKA 3FVOA 1PEBA 3IOTA 1ATGA 4FAJA 1FQEA 3CI8A 2I3WA 3Q26A 2V25A 1HSJA 1HSEA 4IO7A 3PGFA 3T66A 1B0HA 4OERA 3T9HB 3U1OA 5AA2B 3IAZA 3FV1A 5BWJA 4F3GA 2O69A 1JETA 5EHMA 1CB6A 2QPQA 1ZKBA 2XD3A 1AH5A 3JZJA 3K6XA 4TQUQ 3MZBA 5CC2A 1AIVA 5H8NB 4LZ7A 1N84A 4PP0A 4O3CA 3QIMA 4MLQA 2A5TB 4U4SA 3O28A 3E4RA 2PVUA 3OO8A 2GHBA 3MVYA 1QUKA 4LVQA 2E1SA 1PB7A 2Y7RA 3V8XB 3R6UA 4RNSA 4ZEDA 1NNTA 3OMBA 1TT1A 3S2VA 2ZYKA 1GR2A 5KCJA 2D21A 4MH5A 2PMSA 1PBQA 4IO3A 4PETA 3RGYA 4U2RA 4R6KA 3K00A 2DYXA 4FORA 3IJOB 2QS2A 5AA4B 4F31B 3QAXA 5I2NA 1IITA 1MPDA 2I6EA 3T9UA 1MY1A 3SEYA 5I58A 5L8DA 2H4IA 3CR9A 4YKJA 1B4HA 2I49A 1MXWA 3PMVA 4JWYA 2FA7A 4FECA 1M5EA 4LONB 3FVGA 1VFDA 1SI0A 4U22A 3S9MC 4YMBA 4G77A 4GXAA 4RPOA 3TQLA 3IO6A 3SEXA 1RYXA 4H1XA 1Y3PA 2F34A 5K2YA 3V89B 1SW2A 1ZMGA 3M3LA 5DTBA 3FZVA 4R72A 2UXAA 4NF6A 1B4ZA 5ISUA 1BIYA 3ONMA 3OXNA 2PT1A 2OZZA 4GLIA 3CSBA 3ECRA 4G68C 3FVKA 3IJXB 1MY2A 3B6WA 3IORA 4UA8A 5ICQA 4X1BA 4JXIA 2Z8DA 2ZYOA 5ELVA 4IO2A 4GD5A 4OYVA 1IZ1A 4DXCA 3S9NC 4OEUA 1S9TA 5I57B 4AB6A 1AL3A 1A7LA 4EQ7A 1IUDA 2ESNA 1NKXA 3VVDA 4QFPA 3TTMA 3JYRA 3ZSFA 4HCYA 4KR5A 3MZ9A 1PC3A 1N76A 4JSOA 5CMKA 3FJ7A 2F7BA 3TTRA 3OSRA 4H6DA 2UYEA 1GTKA 1OMPA 2UVIA 4JWXA 4RY1A 3S9LC 4QFOA 3H03A 4Q0CA 2GRVA 1SVXB 3IK6B 1Q1KA 3GXAA 3HV1A 1HSLA 1USYE 1TWYA 1LFIA 1MXXA 1QVSA 3U92A 1NMUA 1Y3QA 4N07A 5TPAB 3DP6A 4OEVA 2ABHA 5JEIA 4YU0A 4GRKA 4ISUA 4NWDA 5ITOA 2G93A 4OHNA 4DCYA 4YZZA 4EF1A 5AA3A 3VLVA 1S7YA 1VE4A 4IGTA 2XXUA 2Y7IA 4OZ9A 5CBRA 3TUSA 4KI0E 2NOOA 2R6GE 1FTLA 3RN8A 2CZLA 3RT8A 2H25A 2VD3A 1B3LA 4JWOA 5TU0A 5FTIA 3T22A 4G8MA 3K6VA 3EPEA 3OELA 3DP4A 4Q5TA 5A5XB 4Q30B 4OMBA 2PT2A 4G4PA 2PYYA 2H99A 1IXGA 2XD2A 1D9YA 3K1NA 3KSJA 3VLWA 5CI5A 3SEWA 4FATA 3WAEA 4QHQA 1OQHA 4ESWA 3OSQA 5L9MA 4YB5A 3O66A 3TCGA 2HXWA 4FEDA 1N3WA 1N04A 1MH3A 4R73A 5ICTA 1FTKA 4OQOA 3MVXA 1A8EA 1CE2A 1QULA 3W9WA 4XKNA 4RPNA 1LAHE 4NE4A 3OO6A 4U23A 3RT6B 3CFLA 3FXRA 4FJPA 4OESA 4ZE9A 4G8HA 4ONYA 1H44A 1VR5A 3QUFA 3VVFA 1LFGA 2Q89A 3LSLA 2I0BA 2Y7WA 4OENA 4C1UA 3N94A 3W15C 5I56B 3MJNA 4NF4B 1QKBA 5CBSA 4XXUA 4XTCQ 3TTKA 1B0LA 3GBBA 4KYDA 3SESA 1TFDA 2Y7PA 3MP8A 3BKIB 1NH7A 1B3FA 1BP5A 2RINA 4NF5A 3HHGA 3TDJA 3TTLA 1YTVA 2F8DA 4ZDMA 1L5TA 2REJA 1ANFA 5EHSA 4R2BA 1US5A 4ELOA 4DIGA 1JQFA 3KOSA 3LC8A 2HAUA 5DEXA 4KFQA 4U1ZA 1I6QA 3E13X 1B7ZA 2P2AA 3M3KA 3OEMA 1H76A 1JEUA 4WEPA 1FQFA 3LBSA 3UA8A 5CM6A 4P11A 1BTJA 1Y4TA 2HAVA 2DWHA 2ONRA 1QUJA 1D3KA 2DWJA 3FJMA 4OFLA 4YKPA 1YAEA 3VXBA 3FXQA 3MZ1A 4DXUA 4P0IA 1MY3A 1TXFA 5F1QA 4ZS9A 3U8QA 3CFXA 2HZKA 3PPQA 4EQ9A 1JW1A 3GZGA 5H8FB 1UTHA 4YAHX 1NNPA 3F11A 5JK4A 4ZEKA 2REGA 3E3KA 4ELPA 4AB5A 4IO5A 1Q35A 1AMFA 3H06B 1R1NA 5H8SA 3KEIA 4F29A 3L6HA 1MXYA 3PUYE 3PPPA 5H8QA 1FW0A 2UVGA 3TCFA 3VFJA 4DLDA 1IXHA 2Q2CA 2FNCA 4HS7A 3RUMA 3HO7A 5I2KA 2I4BA 4RA1A 3TFLA 1Y4CA 4BDOA 1JW4A 3PUVE 1D4NA 3G3HA 1OIBA 4HW8A 3TZAA 3C32A 2VD2A 3KSXA 4N13A 3MP1A 4C0RA 4PFTA 1ZBMA 2YJPA 5TP9B 4NF8A 1MXUA 4EDPA 3TELA 1SW5A 1B3GA 5DVIA 2P1SA 4QFNA 3HN0A 1OVTA 4F1UA 1B32A 1B58A 1B2HA 2O7UA 2F7AA 4N6PA 2IA4A 2BJJX 2Q9TA 1IIWA 1NNKA 2DS9A 2F36A 2Z23A 3ILTB 5AA1A 5K2XA 5H8HA 4F3BA 3UN6A 4ND9A 3DM0A 3SKPA 2RCBA 1SQYA 3O29A 4KCDA 3FJGA 3K0VA 4H5FA 2QJEA 2Y84A 1RKMA 3T9XB 3OO9A 2QS4A 3I5OA 3VE1B 4Z0IA 1MPBA 3MQ9A 1IXCA 3HSTA 3LUYA 1O64A 1R9LA 4BLAA 1ZU0A 3LSXA 1B52A 1JNFA 2LAOA 2VP1A 4EF2A 2O51A 4H67A 1DOTA 4WEDA 4ZEFA 1FCKA 5I59B 1LGBC 2UVJA 1QW0A 3O2AA 4EXKA 3G3IA 1B51A 3SETA 2DVCA 1QUIA 4GWOA 3AXFA 3MUQA 1MQHA 4R9FA 1OLAA 4YICA 1IQ7A 1H45A 5DVFA 4GIZA 1M5BA 4X9TA 3A3UA 4OWDA 4R2FA 5H8NA 3QYTA 3K02A 4BDNA 5CMBA 4WKMA 2A5TA 3PPNA 1LFHA 1MRPA 3OOAA 2AIXA 1UTBB 2F5XA 2XXIA 3EHUA 3BBRA 3RY3A 4QSCA 3FVNA 2QSXA 1IXIA 3GLBA 5FHOA 3FV2A 4LZ5A 1YCJA 3KN3A 1TFAA 4ELRA 3H6VA 1B5IA 4F1YA 1ZJLA 4LZ8A 3DLNA 3K01A 1XS5A 4ZEBA 2NXOA 4NTLA 3FIRA 2V3QA 5I84A 1N0TA 3CG3A 3HHFA 3H6TA 3EQ1A 3MVZA 4KPTA 1B46A 1EZOA 4QRZA 4EQBA 3S4UA 4ZEIA 2F6GA 1BKAA 1SYHA 3BFTA 2I58A 1MQIA 1MQGA 2DWAA 3VXCA 5KDTB 1VFEA 1VSOA 2DE2A 4IY5A 4U4XA 1XVXA 3IOVA 1EH3A 4RYAA 1PBPA 2RC9A 3PD8A 1WVJA 2DVZA 3USDA 3KGCA 3EHTA 2F35A 1FTMA 4P0GA 3MAMA 5DYHA 1MG1A 2OBGA 1Y1MA 2VOZA 1IEJA 2AYSA 3KN8A 2M8CA 4R74A 1MDQA 5LOMA 4R6YA 1M5DA 3TYHA 4POWA 3ODBA 5JTYA 3PMXA 3C36A 4R9GA 2B3FA 1MM6A 3PPRA 3SEVA 2RKMA 3H3GA 1NL5A 3VVEA 3KN7A 1FTJA 4OFOA 1EZPA 4O3BA 1FQDA 3UORA 2THIA 3H6UA 2F7CA 2V3UA 3CG1A 2DSFA 3IR1A 4GL8A 5I57A 5BUUA 2DXYA 1OVBA 3QUJA 4PQJA 3CSGA 1P99A 1MM7A 3IOUA 4PFWA 1JEVA 1B1HA 1A40A 3U72A 2I4CA 4JSDA 1LAXA 4LUBA 2XXXA 2R9JA 3FATA 3IB1A 4JB7A 5DVJA 1PB9A 2D3IA 5ITPA 4IGRA 3K1PA 4GL0A 1ZTYA 3BFUA 4I8CA 4IY6A 5L9SA 1MS7A 1LBBA 3V5AA 5HBCA 4H8JA 2XXYA 1P1WA 3A3CA 3SERA 4G68B 3LR1A 5HPQA 2I48A 3S9EA 4TLLB 3G7WA 3C4MA 2PX1A 1SYIA 3FASA 2ZNSA 4K3FA 1OQGA 3H6WA 1H43A 1JVYA 1O7TA 5TPAA 3RNNA 3T9VA 1DMBA 4R75A 1XHYA 4POXA 4OVJA 2Q2AA 1UTHB 1SW1A 3QSLA 4I9DA 2X7QA 2XHDA 4YB7A 3O6HA 1Y20A 1P1OA 4F2QA 2RF1A 1LBCA 2DE4A 3RTFB 3L6GA 3PUWE 4EUOA 4IB2A 1B5JA 2A5SA 1II5A 3I3VA 2HFBA 1Y3NA 4DDDA 2X26A 1R9QA 3V83A 2NUVA 1SBPA 1B3EA 1MH4A 3K1MA 4F22A 5A5XA 2OJTA 1JVXA 1ZLQA 2YPNA 1GGGA 4F1VA 2AL4A 3K4UA 1LCTA 3B6TA 3P7IA 3FUZA 1J1NA 3LSWA 3CRBA 5CRYA 2I3VA 1B5HA 3PUXE 2QMXA 3O9PA 1M5FA 2XXWA 3B6QA 1M5CA 3T96B 1F9BA 2XX9A 2CMOA 4QF9A 4MFIA 3D4GA 2DXRA 1LSTA 5M2VA 4WXJA 4H65A 3OENA 4GVOA 3O6IA 4JDFA 2ONKE 1N7WA 1P1QA 3MPKA 4NEDA 3TMGA 4GFRA 4F3SA 4TOZA 1R6ZA 4M4GA 1XT8A 3TCHA 3RLFE 5F7VA 4UACA 5KCJB 3KZGA 1FTOA 3WAFA 5H8HB 1QJMA 4YMAA 4X48A 4DZ1A 5CMMA 4PFUA 4F18A 2KLFA 2RCAA 4QFLA 2B65A 1A8FA 5J1DA 5I2NB 5FTHA 3O97A 3ZKKA 1SDXA 5I56A 1KWHA 4M1VA 4OXVA 4NF4A 3SDFA 2XXRA 3OD7A 3HPIA 2QRYA 5I58B 3M8UA 2GFEA 1A55A 4ZZAA 3N26A 2H9BA 3MVWA 3RPWA 4G8NA 3MPLA 1EU8A 2O6AA 4GQOA 1OLCA 3GBAA 2H5YA 2R71A 1ZIUA 4C1TA 4Z7EA 2ANJA 1B9JA 1WDNA 3TKDA 1B40A 1B05A 3R7XA 1SI1A 2O1LA 3KOTA 2Z22A 3CVGA 3JV9A 4RJZA 5FHNA 1JW5A 1XC1A 4NF6B 4BDLA 4ELQA 3E9XA 3C33A
chains in the Genus database with same CATH superfamily
2Z8FA 2ZYNA 4XKRA 4NF0A 3UK4A 3ZKLA 2F78A 4ZECA 4BDRA 1LB9A 4MNPA 4OTEA 1LAFE 5DW8A 5EYHA 2XWVA 1URDA 4XIGQ 1POY1 3VDFA 4IO4A 2UVHA 3PD9A 4PDHA 2QVVA 1UIVA 1LBXA 1FBPA 4XEQA 4DCXA 3HCQA 2DP8A 2HEUA 1SW4A 4NG7A 1MXZA 2HCAA 2DWIA 4BDMA 4PFYA 2V84A 1IMDA 1D9QA 4F19A 4NHBA 2XXTA 5H8FA 4QSEA 3UIFA 2OCUA 3DELB 3Q27A 4IO6A 3IB2A 2GH9A 2V93A 1NH8A 3EKIA 1FRPA 2VGQA 3R26A 4U1OA 3C34A 5CMCA 1MQJA 4QSDA 3TEPA 2GHAA 5AA2A 5HM4B 2XXQA 2ZMBA 3UP9A 1XOCA 2OK2A 1A99A 5AA2D 2NWJA 2OWTA 1LAGE 1UIUA 2Q8JA 4XFEA 5IKBA 3M3FA 4RXLA 1NV0A 4O8MA 5EQ7A 3IX1A 1GVCA 2R8TA 2H98A 4OETA 4THIA 2NVUB 4NN3A 3RQTA 1SD3A 1MXVA 3FGSA 4KYSA 4GWWA 3GYYA 3UGWA 5TP9A 3EHSA 1P1UA 3TAJA 2PBWA 1Q9DA 1B3HA 3IL1B 5L9OA 4ZE8A 4LA9A 3RTWB 4BDQA 2I0CA 2RC7A 4MMPA 3TQWA 4ESXA 4LATA 3SEUA 2HZLA 2QMWA 2VT5A 2DOJA 5JTYB 1MPCA 4R6HA 1LLSA 1LB8A 4FIMA 3CFZA 4KD5A 1AOVA 4YB6A 1FQBA 1Z7NE 4E0XA 1PB8A 2UYFA 2ALUA 4AQ4A 2CEYA 4LQ5A 1BLFA 4OANA 1ELJA 2DE3A 3LV0A 4GX6A 1LBVA 4X1DA 3FXUA 5AA4A 3EF7A 3Q28A 2OX3A 1DTZA 3MW0A 4P8BA 4FEBA 3IO4A 4GX4A 4F39A 4I40A 5DT6A 2P0SA 2QL3A 3OO7A 1EYKA 4FE8A 4ZZEA 1FQCA 4MLVA 2F97A 4MBPA 5I59A 4RK2A 2ZYMA 4OFJA 1O63A 3QXMA 4DXBA 3H4ZA 3TPAA 4LP2B 2QFLA 3H7MA 4MF3A 1US4A 3ILUB 3U93A 3K6WA 1T0KA 3DP8A 2X7PA 2CZHA 4JBZA 4PTKA 3KBZA 1GV8A 2ZZWA 4HCWA 3FD3A 4H0WA 3C35A 2VHAA 4H5GA 5I3SA 3SZPA 4Q8RA 4GOTA 2IEEA 4PGNA 2HQ0A 5LDZA 4DE8A 2O7IA 4KYEA 3IOWA 2WYKA 4PAFA 4MNIA 2MKZA 3G3FA 2ONSA 1UTBA 1NNFA 2O1MA 3KJ7A 4XKPA 4PFBA 1MY4A 5B7DA 4KHZE 4LQ2A 3D4CA 3N6UA 4F3PA 3IFAA 4N6KA 3KJTA 4GF8A 1MQDA 2Y7KA 2D5WA 3U94A 2RC8A 2WKYA 3MP6A 3MWBA 4HTGA 1DTGA 1S50A 4RK9A 3QK6A 3PU5A 2YLNA 3I6VA 5IAIA 2ZNTA 4L17A 4NF5B 2Q88A 1URSA 2O68A 3PPOA 3TTNA 1USYH 1UQWA 3CIJA 5A5LA 3EN3A 1LCFA 4P9KA 4PGPA 4OVQA 1MDP1 4E0WA 1B7UA 2QS1A 5DEXB 3A09A 4PAKA 4EXLA 4N81A 5AE4A 5B70A 1QGXA 3OEKA 4PFRA 1QKAA 1DSNA 3G3KA 1H3DA 5ET7A 1DPPA 4YKIA 4G2ZA 1XVYA 3MC2A 2XXVA 5KDTA 1RYOA 3B7DA 1N7XA 3G3JA 4MCOA 3KBRA 4NMYA 4KCCA 1FQAA 3G3GA 2E0SA 3KFMA 1P1NA 3N5LA 4H8IA 1WODA 3VV5A 4I62A 5FHMA 1MY0A 2V3TA 3K2DA 1IMEA 5FBPA 1Y9UA 4F2OA 4O3AA 2O84X 3PMWA 4GBVA 3LSFB 3PV0E 1Z7ME 2OLBA 3IB0A 1POTA 1I6AA 3MBPA 4HE0A 5H8QB 3N6TA 3PUZE 3KG2A 4GXSB 2Z8EA 2OWSA 3D1RA 3E79A 4I1DA 4U21A 1D9VA 5I2KB 3C31A 3W9VA 1PDAA 5IZZA 3LUZA 4NQ8A 2ZNUA 3THIA 4QFKA 2G29A 4N17A 2QS3A 4NWCA 1EZ9A 1FPEA 2DQVA 4AS5A 1Y1ZA 3CHGA 4NF8B 3ZS6A 4TLMB 2XX7A 2XXHA 4N8GA 1A54A 2ZZXA 4XKQA 1I6BA 1DPEA 4XF5A 1B6HA 4KQPA 4ECFA 2B3BA 2AL5A 1B7HA 3C9HA 2XX8A 1I69A 2ZXTA 2F6PA 4OA4A 3O6GA 2W7YA 4G68A 3K6UA 2FYIA 4X8RA 3VLUA 1YXIA 1YPNA 5EYFA 1NFTA 5KZTA 3Q29A 4PE5B 3T93B 1KA0A 2XXPA 3TODA 1URGA 1N3XA 1B1XA 3Q25A 4YKKA 3FVOA 1PEBA 3IOTA 1ATGA 4FAJA 1FQEA 3CI8A 2VPNA 2I3WA 3E78A 3Q26A 4H45A 2V25A 1HSJA 4MNCA 1HSEA 4IO7A 2Q74A 3PGFA 3T66A 1B0HA 4OERA 3T9HB 3U1OA 5AA2B 3IAZA 3QMFA 3FV1A 5BWJA 4F3GA 5IZ3B 2O69A 1JETA 5EHMA 1CB6A 2QPQA 1ZKBA 2XD3A 1AH5A 1YZ0A 3JZJA 3K6XA 5EQ8A 4TQUQ 4N6DA 3MZBA 5CC2A 1AIVA 5H8NB 4LZ7A 1N84A 4PP0A 4O3CA 2VPOA 4GWSA 3QIMA 4MLQA 2A5TB 1NV3A 2V4CA 4U4SA 3O28A 3E4RA 2PVUA 3OO8A 2GHBA 3MVYA 1QUKA 2CZKA 4LVQA 2E1SA 1PB7A 4JVDA 2Y7RA 3V8XB 3R6UA 4RNSA 4ZEDA 1NNTA 3OMBA 1TT1A 3S2VA 1RDYA 2ZYKA 4FBPA 1GR2A 5KCJA 2HHMA 2D21A 2Y5LA 4MH5A 4HE1A 2PMSA 1PBQA 4IO3A 4PETA 3RGYA 4NAPA 4U2RA 4R6KA 3K00A 1YYZA 2DYXA 4FORA 3IJOB 2QS2A 5AA4B 4F31B 3QAXA 2GQ1A 2FIEA 5I2NA 1IITA 1MPDA 4MEVA 2I6EA 3T9UA 2XA5A 4GWZA 1MY1A 5EYGA 3SEYA 5I58A 2WX9A 5L8DA 2H4IA 3CR9A 4YKJA 1B4HA 2I49A 1MXWA 3PMVA 4JWYA 2FA7A 2DDKA 4P1LA 4FECA 1M5EA 4LONB 3FVGA 1VFDA 2B4LA 1SI0A 4U22A 3S9MC 1NV6A 4YMBA 4G77A 4GXAA 4RPOA 3TQLA 3IO6A 3SEXA 4MJOA 1RYXA 4PCDA 4H1XA 1FPJA 1Y3PA 2BJIA 2F34A 5K2YA 3V89B 1SW2A 1ZMGA 4HE2A 3M3LA 5DTBA 1K9YA 3FZVA 4R72A 3FXBA 2UXAA 4NF6A 1B4ZA 5ISUA 1BIYA 3ONMA 3OXNA 2PT1A 2OZZA 4GLIA 3CSBA 3ECRA 5IGAA 4G68C 3FVKA 3IJXB 1MY2A 2F3DA 3B6WA 3IORA 4UA8A 3B50A 4N8YA 5ICQA 3FBPA 4X1BA 4JXIA 2Z8DA 2ZYOA 5ELVA 4IO2A 4GD5A 4OYVA 4I3YA 1IZ1A 4DXCA 3RPLB 1LEVA 1G0HA 3S9NC 4OEUA 1S9TA 5I57B 4AB6A 4IR8A 1AL3A 4PAIA 1A7LA 4EQ7A 2PFYA 4O94A 1IUDA 2ESNA 1NKXA 2FVZA 3VVDA 2KQZA 4QFPA 3TTMA 3JYRA 3ZSFA 1DCUA 4HCYA 4JVIA 4KR5A 4PF6A 1NV4A 4P47A 3MZ9A 1PC3A 1N76A 4JSOA 5CMKA 3FJ7A 2F7BA 2XWOA 3TTRA 1IMCA 3OSRA 2FIXA 4H6DA 2UYEA 1GTKA 4GBWA 1OMPA 2UVIA 4JWXA 4RY1A 3S9LC 1NV1A 4QFOA 3H03A 4Q0CA 1FBHA 2GRVA 1SVXB 3IK6B 1Q1KA 3GXAA 3HV1A 1HSLA 1USYE 1TWYA 1LFIA 1MXXA 1QVSA 4P56A 3U92A 1NMUA 1Y3QA 4N07A 5TPAB 3DP6A 4OEVA 2ABHA 5JEIA 4YU0A 4GRKA 4ISUA 4NWDA 5ITOA 2G93A 4OHNA 4DCYA 4YZZA 4EF1A 5AA3A 3VLVA 1S7YA 1VE4A 4IGTA 4PFIA 2XXUA 2Y7IA 1FPLA 4OZ9A 5CBRA 3TUSA 4KI0E 2NOOA 4HXVA 2R6GE 1FTLA 3RN8A 2CZLA 1KZ8A 3RT8A 2H25A 2VD3A 1B3LA 4JWOA 5TU0A 1FBGA 5FTIA 3T22A 2CEXA 1NV5A 4G8MA 3K6VA 3EPEA 3OELA 1FBEA 2XXKA 3DP4A 4Q5TA 5A5XB 4Q30B 4H46A 4OMBA 2PT2A 4G4PA 2PYYA 2H99A 4MX6A 1IXGA 1FBFA 2XD2A 1D9YA 3K1NA 3KSJA 3VLWA 5CI5A 4X04A 3SEWA 3T1BA 4OVSA 4FATA 3WAEA 4QHQA 1OQHA 4ESWA 3OSQA 5L9MA 4YB5A 3O66A 3TCGA 4JVCA 2HXWA 4FEDA 1N3WA 1N04A 1MH3A 4R73A 5ICTA 1FTKA 4OQOA 3MVXA 1A8EA 1CE2A 1QULA 3W9WA 4XKNA 4RPNA 1LAHE 4NE4A 3OO6A 2Y5KA 4U23A 2XWIA 3RT6B 3CFLA 3FXRA 4FJPA 4OESA 4ZE9A 4G8HA 4ONYA 1H44A 1VR5A 3QUFA 3VVFA 1LFGA 2Q89A 3LSLA 2I0BA 2Y7WA 4OENA 4C1UA 5ET5A 3N94A 3W15C 5I56B 3MJNA 4NF4B 1QKBA 5CBSA 4XXUA 4NX1A 4XTCQ 3TTKA 1B0LA 3GBBA 5J16A 4KYDA 4MHFA 3SESA 1TFDA 2Y7PA 2XWKA 3MP8A 3BKIB 1NH7A 1B3FA 1BP5A 3HFUA 4DI4B 2RINA 4NF5A 3HHGA 3TDJA 3TTLA 1YTVA 2F8DA 4ZDMA 1L5TA 2REJA 1ANFA 5EHSA 5EQ9A 4R2BA 1US5A 4ELOA 4DIGA 1JQFA 3KOSA 3LC8A 2HAUA 5DEXA 4KFQA 4U1ZA 1I6QA 3E13X 4O7MA 1B7ZA 4OVRA 2P2AA 3M3KA 4WEPA 1H76A 1JEUA 3OEMA 1FQFA 1FPKA 3LBSA 3UA8A 5CM6A 4P11A 1BTJA 1Y4TA 2HAVA 2DWHA 2ONRA 1NUZA 5ET8A 1QUJA 1D3KA 2DWJA 4OFLA 3FJMA 4YKPA 1YAEA 3VXBA 3FXQA 3MZ1A 4DXUA 2P3VA 4P0IA 1MY3A 1RDZA 1LBYA 1TXFA 5F1QA 4ZS9A 3U8QA 3CFXA 2HZKA 3PPQA 4EQ9A 1JW1A 2F3BA 3GZGA 5H8FB 1UTHA 4YAHX 1NNPA 3F11A 5JK4A 4ZEKA 2REGA 3E3KA 1RDXA 4ELPA 4AB5A 4IO5A 1Q35A 1AMFA 2WBDA 3H06B 1R1NA 5H8SA 3KEIA 4F29A 3L6HA 1MXYA 3PUYE 3PPPA 5H8QA 1FW0A 4GWYA 2UVGA 3TCFA 3VFJA 4DLDA 2QVUA 1IXHA 2Q2CA 1SPIA 1LBZA 2FNCA 4HS7A 3RUMA 3HO7A 5I2KA 2I4BA 4RA1A 1FPGA 3TFLA 1Y4CA 4BDOA 1JW4A 3PUVE 1D4NA 3G3HA 1OIBA 4KXPA 4HW8A 3TZAA 3C32A 2VD2A 3KSXA 4N13A 3MP1A 4C0RA 1FPFA 4PFTA 1ZBMA 2YJPA 5TP9B 4NF8A 1MXUA 4EDPA 2Q8MA 3TELA 1SW5A 1B3GA 5DVIA 2P1SA 4QFNA 3HN0A 1OVTA 4F1UA 1B32A 1B58A 1B2HA 2O7UA 2F7AA 4PBQA 4N6PA 4AS4A 1FJ9A 2IA4A 2BJJX 2Q9TA 1IIWA 5LTCA 1NNKA 2DS9A 2F36A 1XI6A 2Z23A 3ILTB 5AA1A 4LN5A 5K2XA 5H8HA 4F3BA 3UN6A 4ND9A 5T3JA 3DM0A 3SKPA 2RCBA 1SQYA 3O29A 4PE3A 4KCDA 2PCRA 3FJGA 3K0VA 4H5FA 2QJEA 2Y84A 1RKMA 3T9XB 3OO9A 2FHYA 1NV2A 2QS4A 3I5OA 3VE1B 4Z0IA 1MPBA 3MQ9A 1IXCA 2WEFA 3HSTA 3LUYA 1O64A 1R9LA 1IMAA 4BLAA 1ZU0A 3LSXA 1B52A 1JNFA 2LAOA 2VP1A 4EF2A 2O51A 1FPIA 4H67A 1DOTA 4WEDA 4ZEFA 1FCKA 5I59B 1LGBC 2UVJA 1QW0A 2B4MA 3O2AA 4OVTA 5F24A 4EXKA 4PBHA 3G3IA 1FPDA 5IZ3A 1EYJA 1B51A 3SETA 2DVCA 1QUIA 4GWOA 3AXFA 3MUQA 1MQHA 4I3EA 4R9FA 1OLAA 4YICA 1IQ7A 1H45A 2FBPA 5DVFA 4GIZA 1M5BA 1NUWA 4X9TA 3A3UA 4OWDA 4R2FA 5H8NA 3A29A 3QYTA 3K02A 4BDNA 5CMBA 4WKMA 2A5TA 3PPNA 1LFHA 1MRPA 3OOAA 2AIXA 1UTBB 2F5XA 2XXIA 3EHUA 3BBRA 3RY3A 4QSCA 3FVNA 2QSXA 2WBBA 1IXIA 3GLBA 3KC1A 5FHOA 3NOHA 2WYPA 3FV2A 4LZ5A 1YCJA 3KN3A 1TFAA 4ELRA 3H6VA 1B5IA 4F1YA 1ZJLA 4LZ8A 3DLNA 3K01A 1XS5A 4ZEBA 3BIGA 2NXOA 4NTLA 3FIRA 2V3QA 5EQAA 1NV7A 3PTYA 5I84A 1N0TA 3CG3A 3HHFA 1FSAA 3H6TA 3EQ1A 3MVZA 4KPTA 1B46A 1EZOA 4QRZA 4GWUA 1NUYA 4EQBA 3S4UA 4ZEIA 4N4UA 2F6GA 1BKAA 1SYHA 3BFTA 2I58A 1INPA 1MQIA 1MQGA 2DWAA 3VXCA 4N91A 5KDTB 1VFEA 1VSOA 2DE2A 4IY5A 4U4XA 1XVXA 3IOVA 1EH3A 4RYAA 1PBPA 4OVPA 2RC9A 3PD8A 1WVJA 2DVZA 3USDA 3KGCA 3EHTA 2F35A 1FTMA 4P0GA 3MAMA 5DYHA 1MG1A 2OBGA 1Y1MA 2VOZA 1IEJA 2AYSA 2ZZVA 3KN8A 2M8CA 4GWXA 4R74A 1MDQA 4G61A 5LOMA 4R6YA 1M5DA 3BIHA 3TYHA 4POWA 1G0IA 3ODBA 5JTYA 3PMXA 3C36A 4R9GA 2B3FA 1MM6A 3PPRA 3SEVA 2RKMA 3H3GA 1NL5A 3VVEA 3KN7A 1FTJA 4OFOA 4QXDA 1EZPA 4O3BA 2P3NA 1FQDA 1AWBA 3UORA 2THIA 3H6UA 2F7CA 3RPLA 2V3UA 3CG1A 4O7IA 2DSFA 3B8BA 3IR1A 1FTAA 4GL8A 5I57A 5BUUA 2DXYA 1OVBA 1LBWA 3QUJA 4PQJA 3CSGA 5ET6A 1P99A 1MM7A 3IOUA 4PFWA 1JEVA 1B1HA 1A40A 3U72A 2I4CA 4LUBA 1LAXA 4JSDA 2XXXA 2R9JA 1VDWA 3FATA 3IB1A 4JB7A 5DVJA 3U65A 1PB9A 2CZIA 2D3IA 3IFCA 5ITPA 4IGRA 3K1PA 4GL0A 1ZTYA 2PFZA 3BFUA 4I8CA 4IY6A 5L9SA 1MS7A 1LBBA 3V5AA 5HBCA 4H8JA 2XXYA 1P1WA 3A3CA 3MYUA 5ESYA 3SERA 4G68B 3LR1A 5HPQA 2I48A 3S9EA 4TLLB 3G7WA 3C4MA 1IMBA 2PX1A 3ISPA 1SYIA 3FASA 2ZNSA 4P3LA 4K3FA 1OQGA 3H6WA 1H43A 1JVYA 1O7TA 5IM2A 5TPAA 3RNNA 3T9VA 1NUXA 1DMBA 4R75A 1XHYA 4GX3A 2OWZA 4POXA 4OVJA 2Q2AA 1UTHB 1SW1A 3QSLA 4I9DA 2X7QA 2L5VA 2XHDA 4YB7A 3O6HA 3MSTA 1Y20A 1P1OA 1FJ6A 4F2QA 2RF1A 1LBCA 2DE4A 3RTFB 1IMFA 3RYDA 3L6GA 3PUWE 4EUOA 1DK4A 4IB2A 4MAGA 1NI9A 1B5JA 1K9ZA 2A5SA 1II5A 3I3VA 2HFBA 1Y3NA 4PF8A 4DDDA 2X26A 4QBAA 1R9QA 3V83A 2NUVA 1SBPA 1B3EA 1MH4A 5I5PA 3K1MA 4F22A 5A5XA 2OJTA 1JVXA 1ZLQA 2YPNA 1FBCA 1GGGA 4F1VA 2AL4A 3K4UA 1LCTA 3B6TA 3P7IA 5IZ1A 4UABA 3FUZA 1J1NA 3LSWA 3CRBA 5CRYA 2I3VA 2HPGA 4MIJA 4PC9A 1B5HA 3PUXE 2QMXA 2HXRA 1DBZA 3O9PA 1CNQA 1M5FA 2XXWA 3B6QA 1M5CA 3T96B 1F9BA 2XX9A 2CMOA 4QF9A 4MFIA 3D4GA 5I7IA 2DXRA 1LSTA 1BK4A 5M2VA 4WXJA 4DI3D 4H65A 3OENA 4GVOA 3O6IA 4JDFA 2ONKE 1N7WA 1P1QA 3MPKA 4NEDA 3TMGA 3T0JA 4GFRA 4F3SA 4TOZA 1R6ZA 2QVRA 4M4GA 1XT8A 3TCHA 3RLFE 5F7VA 1JP4A 4UACA 5KCJB 3KZGA 1FTOA 1KA1A 4N15A 3WAFA 5H8HB 1QJMA 4YMAA 4X48A 4DZ1A 5CMMA 4PFUA 4F18A 2KLFA 2RCAA 4QFLA 4P1EA 2B65A 1A8FA 5J1DA 5I2NB 5FTHA 3O97A 1SDXA 3ZKKA 5I56A 1KWHA 4M1VA 4OXVA 4NF4A 3SDFA 2XXRA 3OD7A 3HPIA 2QRYA 5I58B 3M8UA 4NGUA 2GFEA 1A55A 4ZZAA 3N26A 2H9BA 3MVWA 3RPWA 1EYIA 4G8NA 4PDDA 3MPLA 1EU8A 3ROJA 3KC0A 2O6AA 4GQOA 1OLCA 3GBAA 2H5YA 2R71A 1ZIUA 2KR0A 4C1TA 4Z7EA 2ANJA 1B9JA 1WDNA 3TKDA 1B40A 1B05A 1FPBA 3R7XA 1SI1A 2O1LA 3KOTA 2JJKA 2Z22A 3CVGA 3JV9A 4RJZA 5FHNA 1JW5A 1XC1A 4NF6B 4BDLA 4ELQA 1FBDA 3E9XA 3C33A
chains in the Genus database with same CATH topology
2Z8FA 2ZYNA 4XKRA 3UK4A 3ZKLA 2F78A 4ZECA 4BDRA 1LB9A 4OTEA 1LAFE 1URDA 4XIGQ 1POY1 3VDFA 4IO4A 2UVHA 3PD9A 1UIVA 4DCXA 3HCQA 2DP8A 2HEUA 1SW4A 1MXZA 2HCAA 2DWIA 4BDMA 4PFYA 2V84A 4F19A 2XXTA 5H8FA 4QSEA 3UIFA 2OCUA 3DELB 3Q27A 4IO6A 3IB2A 2GH9A 2V93A 1NH8A 2VGQA 3R26A 4U1OA 3C34A 5CMCA 1MQJA 4QSDA 3TEPA 2GHAA 5AA2A 5HM4B 2XXQA 2ZMBA 3UP9A 1XOCA 2OK2A 1A99A 5AA2D 2NWJA 2OWTA 1LAGE 1UIUA 2Q8JA 5IKBA 3M3FA 4RXLA 3IX1A 1GVCA 2H98A 4OETA 4THIA 2NVUB 3RQTA 1SD3A 1MXVA 3FGSA 4KYSA 3UGWA 5TP9A 3EHSA 1P1UA 3TAJA 2PBWA 1B3HA 3IL1B 5L9OA 4ZE8A 4LA9A 3RTWB 4BDQA 2I0CA 2RC7A 3TQWA 4ESXA 4LATA 3SEUA 2HZLA 2QMWA 2DOJA 5JTYB 1MPCA 4R6HA 1LLSA 1LB8A 4FIMA 3CFZA 4KD5A 1AOVA 4YB6A 1Z7NE 1FQBA 4E0XA 1PB8A 2UYFA 2ALUA 4AQ4A 4LQ5A 1BLFA 1ELJA 2DE3A 4X1DA 3FXUA 5AA4A 3EF7A 3Q28A 1DTZA 3MW0A 4FEBA 3IO4A 4F39A 5DT6A 2P0SA 2QL3A 3OO7A 4FE8A 4ZZEA 1FQCA 4MLVA 2F97A 4MBPA 5I59A 4RK2A 2ZYMA 4OFJA 1O63A 3QXMA 4DXBA 3H4ZA 3TPAA 4LP2B 3H7MA 4MF3A 1US4A 3ILUB 3U93A 3K6WA 1T0KA 3DP8A 2X7PA 4JBZA 1GV8A 4HCWA 3FD3A 4H0WA 3C35A 2VHAA 4H5GA 4Q8RA 4GOTA 2IEEA 2HQ0A 4DE8A 2O7IA 4KYEA 3IOWA 3G3FA 2ONSA 1UTBA 1NNFA 2O1MA 3KJ7A 4XKPA 1MY4A 5B7DA 4KHZE 4LQ2A 3D4CA 3N6UA 4F3PA 3KJTA 4GF8A 1MQDA 2Y7KA 2D5WA 3U94A 2RC8A 2WKYA 3MP6A 3MWBA 4HTGA 1DTGA 1S50A 4RK9A 3QK6A 3PU5A 2YLNA 3I6VA 5IAIA 2ZNTA 4L17A 4NF5B 2Q88A 1URSA 2O68A 3PPOA 3TTNA 1USYH 1UQWA 3CIJA 3EN3A 1LCFA 1MDP1 4E0WA 1B7UA 2QS1A 5DEXB 3A09A 4EXLA 5AE4A 5B70A 3OEKA 1QKAA 1DSNA 3G3KA 1H3DA 1DPPA 4YKIA 4G2ZA 1XVYA 3MC2A 2XXVA 5KDTA 1RYOA 3B7DA 1N7XA 3G3JA 3KBRA 4NMYA 4KCCA 1FQAA 3G3GA 2E0SA 3KFMA 1P1NA 3N5LA 4H8IA 1WODA 3VV5A 4I62A 5FHMA 1MY0A 2V3TA 3K2DA 1Y9UA 4F2OA 4O3AA 2O84X 3PMWA 3LSFB 3PV0E 1Z7ME 2OLBA 3IB0A 1POTA 1I6AA 3MBPA 5H8QB 3N6TA 3PUZE 3KG2A 4GXSB 2Z8EA 2OWSA 4I1DA 4U21A 1D9VA 5I2KB 3C31A 3W9VA 1PDAA 2ZNUA 3THIA 4QFKA 2G29A 2QS3A 4NWCA 1EZ9A 2DQVA 1Y1ZA 4NF8B 3ZS6A 4TLMB 2XX7A 2XXHA 1A54A 4XKQA 1I6BA 1DPEA 1B6HA 4KQPA 4ECFA 2B3BA 2AL5A 1B7HA 3C9HA 2XX8A 1I69A 2ZXTA 2F6PA 3O6GA 2W7YA 4G68A 3K6UA 2FYIA 3VLUA 1YPNA 5EYFA 1NFTA 5KZTA 3Q29A 4PE5B 3T93B 2XXPA 3TODA 1URGA 1N3XA 1B1XA 3Q25A 4YKKA 3FVOA 1PEBA 3IOTA 1ATGA 4FAJA 1FQEA 3CI8A 2I3WA 3Q26A 2V25A 1HSJA 1HSEA 4IO7A 3PGFA 3T66A 1B0HA 4OERA 3T9HB 3U1OA 5AA2B 3IAZA 3FV1A 5BWJA 4F3GA 2O69A 1JETA 5EHMA 1CB6A 2QPQA 1ZKBA 2XD3A 1AH5A 3JZJA 3K6XA 4TQUQ 3MZBA 5CC2A 1AIVA 5H8NB 4LZ7A 1N84A 4PP0A 4O3CA 3QIMA 4MLQA 2A5TB 4U4SA 3O28A 3E4RA 2PVUA 3OO8A 2GHBA 3MVYA 1QUKA 4LVQA 2E1SA 1PB7A 2Y7RA 3V8XB 3R6UA 4RNSA 4ZEDA 1NNTA 3OMBA 1TT1A 3S2VA 2ZYKA 1GR2A 5KCJA 2D21A 4MH5A 2PMSA 1PBQA 4IO3A 4PETA 3RGYA 4U2RA 4R6KA 3K00A 2DYXA 4FORA 3IJOB 2QS2A 5AA4B 4F31B 3QAXA 5I2NA 1IITA 1MPDA 2I6EA 3T9UA 1MY1A 3SEYA 5I58A 5L8DA 2H4IA 3CR9A 4YKJA 1B4HA 2I49A 1MXWA 3PMVA 4JWYA 2FA7A 4FECA 1M5EA 4LONB 3FVGA 1VFDA 1SI0A 4U22A 3S9MC 4YMBA 4G77A 4GXAA 4RPOA 3TQLA 3IO6A 3SEXA 1RYXA 4H1XA 1Y3PA 2F34A 5K2YA 3V89B 1SW2A 1ZMGA 3M3LA 5DTBA 3FZVA 4R72A 2UXAA 4NF6A 1B4ZA 5ISUA 1BIYA 3ONMA 3OXNA 2PT1A 2OZZA 4GLIA 3CSBA 3ECRA 4G68C 3FVKA 3IJXB 1MY2A 3B6WA 3IORA 4UA8A 5ICQA 4X1BA 4JXIA 2Z8DA 2ZYOA 5ELVA 4IO2A 4GD5A 4OYVA 1IZ1A 4DXCA 3S9NC 4OEUA 1S9TA 5I57B 4AB6A 1AL3A 1A7LA 4EQ7A 1IUDA 2ESNA 1NKXA 3VVDA 4QFPA 3TTMA 3JYRA 3ZSFA 4HCYA 4KR5A 3MZ9A 1PC3A 1N76A 4JSOA 5CMKA 3FJ7A 2F7BA 3TTRA 3OSRA 4H6DA 2UYEA 1GTKA 1OMPA 2UVIA 4JWXA 4RY1A 3S9LC 4QFOA 3H03A 4Q0CA 2GRVA 1SVXB 3IK6B 1Q1KA 3GXAA 3HV1A 1HSLA 1USYE 1TWYA 1LFIA 1MXXA 1QVSA 3U92A 1NMUA 1Y3QA 4N07A 5TPAB 3DP6A 4OEVA 2ABHA 5JEIA 4YU0A 4GRKA 4ISUA 4NWDA 5ITOA 2G93A 4OHNA 4DCYA 4YZZA 4EF1A 5AA3A 3VLVA 1S7YA 1VE4A 4IGTA 2XXUA 2Y7IA 4OZ9A 5CBRA 3TUSA 4KI0E 2NOOA 2R6GE 1FTLA 3RN8A 2CZLA 3RT8A 2H25A 2VD3A 1B3LA 4JWOA 5TU0A 5FTIA 3T22A 4G8MA 3K6VA 3EPEA 3OELA 3DP4A 4Q5TA 5A5XB 4Q30B 4OMBA 2PT2A 4G4PA 2PYYA 2H99A 1IXGA 2XD2A 1D9YA 3K1NA 3KSJA 3VLWA 5CI5A 3SEWA 4FATA 3WAEA 4QHQA 1OQHA 4ESWA 3OSQA 5L9MA 4YB5A 3O66A 3TCGA 2HXWA 4FEDA 1N3WA 1N04A 1MH3A 4R73A 5ICTA 1FTKA 4OQOA 3MVXA 1A8EA 1CE2A 1QULA 3W9WA 4XKNA 4RPNA 1LAHE 4NE4A 3OO6A 4U23A 3RT6B 3CFLA 3FXRA 4FJPA 4OESA 4ZE9A 4G8HA 4ONYA 1H44A 1VR5A 3QUFA 3VVFA 1LFGA 2Q89A 3LSLA 2I0BA 2Y7WA 4OENA 4C1UA 3N94A 3W15C 5I56B 3MJNA 4NF4B 1QKBA 5CBSA 4XXUA 4XTCQ 3TTKA 1B0LA 3GBBA 4KYDA 3SESA 1TFDA 2Y7PA 3MP8A 3BKIB 1NH7A 1B3FA 1BP5A 2RINA 4NF5A 3HHGA 3TDJA 3TTLA 1YTVA 2F8DA 4ZDMA 1L5TA 2REJA 1ANFA 5EHSA 4R2BA 1US5A 4ELOA 4DIGA 1JQFA 3KOSA 3LC8A 2HAUA 5DEXA 4KFQA 4U1ZA 1I6QA 3E13X 1B7ZA 2P2AA 3M3KA 3OEMA 1H76A 1JEUA 4WEPA 1FQFA 3LBSA 3UA8A 5CM6A 4P11A 1BTJA 1Y4TA 2HAVA 2DWHA 2ONRA 1QUJA 1D3KA 2DWJA 3FJMA 4OFLA 4YKPA 1YAEA 3VXBA 3FXQA 3MZ1A 4DXUA 4P0IA 1MY3A 1TXFA 5F1QA 4ZS9A 3U8QA 3CFXA 2HZKA 3PPQA 4EQ9A 1JW1A 3GZGA 5H8FB 1UTHA 4YAHX 1NNPA 3F11A 5JK4A 4ZEKA 2REGA 3E3KA 4ELPA 4AB5A 4IO5A 1Q35A 1AMFA 3H06B 1R1NA 5H8SA 3KEIA 4F29A 3L6HA 1MXYA 3PUYE 3PPPA 5H8QA 1FW0A 2UVGA 3TCFA 3VFJA 4DLDA 1IXHA 2Q2CA 2FNCA 4HS7A 3RUMA 3HO7A 5I2KA 2I4BA 4RA1A 3TFLA 1Y4CA 4BDOA 1JW4A 3PUVE 1D4NA 3G3HA 1OIBA 4HW8A 3TZAA 3C32A 2VD2A 3KSXA 4N13A 3MP1A 4C0RA 4PFTA 1ZBMA 2YJPA 5TP9B 4NF8A 1MXUA 4EDPA 3TELA 1SW5A 1B3GA 5DVIA 2P1SA 4QFNA 3HN0A 1OVTA 4F1UA 1B32A 1B58A 1B2HA 2O7UA 2F7AA 4N6PA 2IA4A 2BJJX 2Q9TA 1IIWA 1NNKA 2DS9A 2F36A 2Z23A 3ILTB 5AA1A 5K2XA 5H8HA 4F3BA 3UN6A 4ND9A 3DM0A 3SKPA 2RCBA 1SQYA 3O29A 4KCDA 3FJGA 3K0VA 4H5FA 2QJEA 2Y84A 1RKMA 3T9XB 3OO9A 2QS4A 3I5OA 3VE1B 4Z0IA 1MPBA 3MQ9A 1IXCA 3HSTA 3LUYA 1O64A 1R9LA 4BLAA 1ZU0A 3LSXA 1B52A 1JNFA 2LAOA 2VP1A 4EF2A 2O51A 4H67A 1DOTA 4WEDA 4ZEFA 1FCKA 5I59B 1LGBC 2UVJA 1QW0A 3O2AA 4EXKA 3G3IA 1B51A 3SETA 2DVCA 1QUIA 4GWOA 3AXFA 3MUQA 1MQHA 4R9FA 1OLAA 4YICA 1IQ7A 1H45A 5DVFA 4GIZA 1M5BA 4X9TA 3A3UA 4OWDA 4R2FA 5H8NA 3QYTA 3K02A 4BDNA 5CMBA 4WKMA 2A5TA 3PPNA 1LFHA 1MRPA 3OOAA 2AIXA 1UTBB 2F5XA 2XXIA 3EHUA 3BBRA 3RY3A 4QSCA 3FVNA 2QSXA 1IXIA 3GLBA 5FHOA 3FV2A 4LZ5A 1YCJA 3KN3A 1TFAA 4ELRA 3H6VA 1B5IA 4F1YA 1ZJLA 4LZ8A 3DLNA 3K01A 1XS5A 4ZEBA 2NXOA 4NTLA 3FIRA 2V3QA 5I84A 1N0TA 3CG3A 3HHFA 3H6TA 3EQ1A 3MVZA 4KPTA 1B46A 1EZOA 4QRZA 4EQBA 3S4UA 4ZEIA 2F6GA 1BKAA 1SYHA 3BFTA 2I58A 1MQIA 1MQGA 2DWAA 3VXCA 5KDTB 1VFEA 1VSOA 2DE2A 4IY5A 4U4XA 1XVXA 3IOVA 1EH3A 4RYAA 1PBPA 2RC9A 3PD8A 1WVJA 2DVZA 3USDA 3KGCA 3EHTA 2F35A 1FTMA 4P0GA 3MAMA 5DYHA 1MG1A 2OBGA 1Y1MA 2VOZA 1IEJA 2AYSA 3KN8A 2M8CA 4R74A 1MDQA 5LOMA 4R6YA 1M5DA 3TYHA 4POWA 3ODBA 5JTYA 3PMXA 3C36A 4R9GA 2B3FA 1MM6A 3PPRA 3SEVA 2RKMA 3H3GA 1NL5A 3VVEA 3KN7A 1FTJA 4OFOA 1EZPA 4O3BA 1FQDA 3UORA 2THIA 3H6UA 2F7CA 2V3UA 3CG1A 2DSFA 3IR1A 4GL8A 5I57A 5BUUA 2DXYA 1OVBA 3QUJA 4PQJA 3CSGA 1P99A 1MM7A 3IOUA 4PFWA 1JEVA 1B1HA 1A40A 3U72A 2I4CA 4JSDA 1LAXA 4LUBA 2XXXA 2R9JA 3FATA 3IB1A 4JB7A 5DVJA 1PB9A 2D3IA 5ITPA 4IGRA 3K1PA 4GL0A 1ZTYA 3BFUA 4I8CA 4IY6A 5L9SA 1MS7A 1LBBA 3V5AA 5HBCA 4H8JA 2XXYA 1P1WA 3A3CA 3SERA 4G68B 3LR1A 5HPQA 2I48A 3S9EA 4TLLB 3G7WA 3C4MA 2PX1A 1SYIA 3FASA 2ZNSA 4K3FA 1OQGA 3H6WA 1H43A 1JVYA 1O7TA 5TPAA 3RNNA 3T9VA 1DMBA 4R75A 1XHYA 4POXA 4OVJA 2Q2AA 1UTHB 1SW1A 3QSLA 4I9DA 2X7QA 2XHDA 4YB7A 3O6HA 1Y20A 1P1OA 4F2QA 2RF1A 1LBCA 2DE4A 3RTFB 3L6GA 3PUWE 4EUOA 4IB2A 1B5JA 2A5SA 1II5A 3I3VA 2HFBA 1Y3NA 4DDDA 2X26A 1R9QA 3V83A 2NUVA 1SBPA 1B3EA 1MH4A 3K1MA 4F22A 5A5XA 2OJTA 1JVXA 1ZLQA 2YPNA 1GGGA 4F1VA 2AL4A 3K4UA 1LCTA 3B6TA 3P7IA 3FUZA 1J1NA 3LSWA 3CRBA 5CRYA 2I3VA 1B5HA 3PUXE 2QMXA 3O9PA 1M5FA 2XXWA 3B6QA 1M5CA 3T96B 1F9BA 2XX9A 2CMOA 4QF9A 4MFIA 3D4GA 2DXRA 1LSTA 5M2VA 4WXJA 4H65A 3OENA 4GVOA 3O6IA 4JDFA 2ONKE 1N7WA 1P1QA 3MPKA 4NEDA 3TMGA 4GFRA 4F3SA 4TOZA 1R6ZA 4M4GA 1XT8A 3TCHA 3RLFE 5F7VA 4UACA 5KCJB 3KZGA 1FTOA 3WAFA 5H8HB 1QJMA 4YMAA 4X48A 4DZ1A 5CMMA 4PFUA 4F18A 2KLFA 2RCAA 4QFLA 2B65A 1A8FA 5J1DA 5I2NB 5FTHA 3O97A 3ZKKA 1SDXA 5I56A 1KWHA 4M1VA 4OXVA 4NF4A 3SDFA 2XXRA 3OD7A 3HPIA 2QRYA 5I58B 3M8UA 2GFEA 1A55A 4ZZAA 3N26A 2H9BA 3MVWA 3RPWA 4G8NA 3MPLA 1EU8A 2O6AA 4GQOA 1OLCA 3GBAA 2H5YA 2R71A 1ZIUA 4C1TA 4Z7EA 2ANJA 1B9JA 1WDNA 3TKDA 1B40A 1B05A 3R7XA 1SI1A 2O1LA 3KOTA 2Z22A 3CVGA 3JV9A 4RJZA 5FHNA 1JW5A 1XC1A 4NF6B 4BDLA 4ELQA 3E9XA 3C33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8F A;  2ZYN A;  4XKR A;  3UK4 A;  3ZKL A;  2F78 A;  4ZEC A;  4BDR A;  1LB9 A;  4OTE A;  1LAF E;  1URD A;  4XIG Q;  1POY 1;  3VDF A;  4IO4 A;  2UVH A;  3PD9 A;  1UIV A;  4DCX A;  3HCQ A;  2DP8 A;  2HEU A;  1SW4 A;  1MXZ A;  2HCA A;  2DWI A;  4BDM A;  4PFY A;  2V84 A;  4F19 A;  2XXT A;  5H8F A;  4QSE A;  3UIF A;  2OCU A;  3DEL B;  3Q27 A;  4IO6 A;  3IB2 A;  2GH9 A;  2V93 A;  1NH8 A;  2VGQ A;  3R26 A;  4U1O A;  3C34 A;  5CMC A;  1MQJ A;  4QSD A;  3TEP A;  2GHA A;  5AA2 A;  5HM4 B;  2XXQ A;  2ZMB A;  3UP9 A;  1XOC A;  2OK2 A;  1A99 A;  5AA2 D;  2NWJ A;  2OWT A;  1LAG E;  1UIU A;  2Q8J A;  5IKB A;  3M3F A;  4RXL A;  3IX1 A;  1GVC A;  2H98 A;  4OET A;  4THI A;  2NVU B;  3RQT A;  1SD3 A;  1MXV A;  3FGS A;  4KYS A;  3UGW A;  5TP9 A;  3EHS A;  1P1U A;  3TAJ A;  2PBW A;  1B3H A;  3IL1 B;  5L9O A;  4ZE8 A;  4LA9 A;  3RTW B;  4BDQ A;  2I0C A;  2RC7 A;  3TQW A;  4ESX A;  4LAT A;  3SEU A;  2HZL A;  2QMW A;  2DOJ A;  5JTY B;  1MPC A;  4R6H A;  1LLS A;  1LB8 A;  4FIM A;  3CFZ A;  4KD5 A;  1AOV A;  4YB6 A;  1Z7N E;  1FQB A;  4E0X A;  1PB8 A;  2UYF A;  2ALU A;  4AQ4 A;  4LQ5 A;  1BLF A;  1ELJ A;  2DE3 A;  4X1D A;  3FXU A;  5AA4 A;  3EF7 A;  3Q28 A;  1DTZ A;  3MW0 A;  4FEB A;  3IO4 A;  4F39 A;  5DT6 A;  2P0S A;  2QL3 A;  3OO7 A;  4FE8 A;  4ZZE A;  1FQC A;  4MLV A;  2F97 A;  4MBP A;  5I59 A;  4RK2 A;  2ZYM A;  4OFJ A;  1O63 A;  3QXM A;  4DXB A;  3H4Z A;  3TPA A;  4LP2 B;  3H7M A;  4MF3 A;  1US4 A;  3ILU B;  3U93 A;  3K6W A;  1T0K A;  3DP8 A;  2X7P A;  4JBZ A;  1GV8 A;  4HCW A;  3FD3 A;  4H0W A;  3C35 A;  2VHA A;  4H5G A;  4Q8R A;  4GOT A;  2IEE A;  2HQ0 A;  4DE8 A;  2O7I A;  4KYE A;  3IOW A;  3G3F A;  2ONS A;  1UTB A;  1NNF A;  2O1M A;  3KJ7 A;  4XKP A;  1MY4 A;  5B7D A;  4KHZ E;  4LQ2 A;  3D4C A;  3N6U A;  4F3P A;  3KJT A;  4GF8 A;  1MQD A;  2Y7K A;  2D5W A;  3U94 A;  2RC8 A;  2WKY A;  3MP6 A;  3MWB A;  4HTG A;  1DTG A;  1S50 A;  4RK9 A;  3QK6 A;  3PU5 A;  2YLN A;  3I6V A;  5IAI A;  2ZNT A;  4L17 A;  4NF5 B;  2Q88 A;  1URS A;  2O68 A;  3PPO A;  3TTN A;  1USY H;  1UQW A;  3CIJ A;  3EN3 A;  1LCF A;  1MDP 1;  4E0W A;  1B7U A;  2QS1 A;  5DEX B;  3A09 A;  4EXL A;  5AE4 A;  5B70 A;  3OEK A;  1QKA A;  1DSN A;  3G3K A;  1H3D A;  1DPP A;  4YKI A;  4G2Z A;  1XVY A;  3MC2 A;  2XXV A;  5KDT A;  1RYO A;  3B7D A;  1N7X A;  3G3J A;  3KBR A;  4NMY A;  4KCC A;  1FQA A;  3G3G A;  2E0S A;  3KFM A;  1P1N A;  3N5L A;  4H8I A;  1WOD A;  3VV5 A;  4I62 A;  5FHM A;  1MY0 A;  2V3T A;  3K2D A;  1Y9U A;  4F2O A;  4O3A A;  2O84 X;  3PMW A;  3LSF B;  3PV0 E;  1Z7M E;  2OLB A;  3IB0 A;  1POT A;  1I6A A;  3MBP A;  5H8Q B;  3N6T A;  3PUZ E;  3KG2 A;  4GXS B;  2Z8E A;  2OWS A;  4I1D A;  4U21 A;  1D9V A;  5I2K B;  3C31 A;  3W9V A;  1PDA A;  2ZNU A;  3THI A;  4QFK A;  2G29 A;  2QS3 A;  4NWC A;  1EZ9 A;  2DQV A;  1Y1Z A;  4NF8 B;  3ZS6 A;  4TLM B;  2XX7 A;  2XXH A;  1A54 A;  4XKQ A;  1I6B A;  1DPE A;  1B6H A;  4KQP A;  4ECF A;  2B3B A;  2AL5 A;  1B7H A;  3C9H A;  2XX8 A;  1I69 A;  2ZXT A;  2F6P A;  3O6G A;  2W7Y A;  4G68 A;  3K6U A;  2FYI A;  3VLU A;  1YPN A;  5EYF A;  1NFT A;  5KZT A;  3Q29 A;  4PE5 B;  3T93 B;  2XXP A;  3TOD A;  1URG A;  1N3X A;  1B1X A;  3Q25 A;  4YKK A;  3FVO A;  1PEB A;  3IOT A;  1ATG A;  4FAJ A;  1FQE A;  3CI8 A;  2I3W A;  3Q26 A;  2V25 A;  1HSJ A;  1HSE A;  4IO7 A;  3PGF A;  3T66 A;  1B0H A;  4OER A;  3T9H B;  3U1O A;  5AA2 B;  3IAZ A;  3FV1 A;  5BWJ A;  4F3G A;  2O69 A;  1JET A;  5EHM A;  1CB6 A;  2QPQ A;  1ZKB A;  2XD3 A;  1AH5 A;  3JZJ A;  3K6X A;  4TQU Q;  3MZB A;  5CC2 A;  1AIV A;  5H8N B;  4LZ7 A;  1N84 A;  4PP0 A;  4O3C A;  3QIM A;  4MLQ A;  2A5T B;  4U4S A;  3O28 A;  3E4R A;  2PVU A;  3OO8 A;  2GHB A;  3MVY A;  1QUK A;  4LVQ A;  2E1S A;  1PB7 A;  2Y7R A;  3V8X B;  3R6U A;  4RNS A;  4ZED A;  1NNT A;  3OMB A;  1TT1 A;  3S2V A;  2ZYK A;  1GR2 A;  5KCJ A;  2D21 A;  4MH5 A;  2PMS A;  1PBQ A;  4IO3 A;  4PET A;  3RGY A;  4U2R A;  4R6K A;  3K00 A;  2DYX A;  4FOR A;  3IJO B;  2QS2 A;  5AA4 B;  4F31 B;  3QAX A;  5I2N A;  1IIT A;  1MPD A;  2I6E A;  3T9U A;  1MY1 A;  3SEY A;  5I58 A;  5L8D A;  2H4I A;  3CR9 A;  4YKJ A;  1B4H A;  2I49 A;  1MXW A;  3PMV A;  4JWY A;  2FA7 A;  4FEC A;  1M5E A;  4LON B;  3FVG A;  1VFD A;  1SI0 A;  4U22 A;  3S9M C;  4YMB A;  4G77 A;  4GXA A;  4RPO A;  3TQL A;  3IO6 A;  3SEX A;  1RYX A;  4H1X A;  1Y3P A;  2F34 A;  5K2Y A;  3V89 B;  1SW2 A;  1ZMG A;  3M3L A;  5DTB A;  3FZV A;  4R72 A;  2UXA A;  4NF6 A;  1B4Z A;  5ISU A;  1BIY A;  3ONM A;  3OXN A;  2PT1 A;  2OZZ A;  4GLI A;  3CSB A;  3ECR A;  4G68 C;  3FVK A;  3IJX B;  1MY2 A;  3B6W A;  3IOR A;  4UA8 A;  5ICQ A;  4X1B A;  4JXI A;  2Z8D A;  2ZYO A;  5ELV A;  4IO2 A;  4GD5 A;  4OYV A;  1IZ1 A;  4DXC A;  3S9N C;  4OEU A;  1S9T A;  5I57 B;  4AB6 A;  1AL3 A;  1A7L A;  4EQ7 A;  1IUD A;  2ESN A;  1NKX A;  3VVD A;  4QFP A;  3TTM A;  3JYR A;  3ZSF A;  4HCY A;  4KR5 A;  3MZ9 A;  1PC3 A;  1N76 A;  4JSO A;  5CMK A;  3FJ7 A;  2F7B A;  3TTR A;  3OSR A;  4H6D A;  2UYE A;  1GTK A;  1OMP A;  2UVI A;  4JWX A;  4RY1 A;  3S9L C;  4QFO A;  3H03 A;  4Q0C A;  2GRV A;  1SVX B;  3IK6 B;  1Q1K A;  3GXA A;  3HV1 A;  1HSL A;  1USY E;  1TWY A;  1LFI A;  1MXX A;  1QVS A;  3U92 A;  1NMU A;  1Y3Q A;  4N07 A;  5TPA B;  3DP6 A;  4OEV A;  2ABH A;  5JEI A;  4YU0 A;  4GRK A;  4ISU A;  4NWD A;  5ITO A;  2G93 A;  4OHN A;  4DCY A;  4YZZ A;  4EF1 A;  5AA3 A;  3VLV A;  1S7Y A;  1VE4 A;  4IGT A;  2XXU A;  2Y7I A;  4OZ9 A;  5CBR A;  3TUS A;  4KI0 E;  2NOO A;  2R6G E;  1FTL A;  3RN8 A;  2CZL A;  3RT8 A;  2H25 A;  2VD3 A;  1B3L A;  4JWO A;  5TU0 A;  5FTI A;  3T22 A;  4G8M A;  3K6V A;  3EPE A;  3OEL A;  3DP4 A;  4Q5T A;  5A5X B;  4Q30 B;  4OMB A;  2PT2 A;  4G4P A;  2PYY A;  2H99 A;  1IXG A;  2XD2 A;  1D9Y A;  3K1N A;  3KSJ A;  3VLW A;  5CI5 A;  3SEW A;  4FAT A;  3WAE A;  4QHQ A;  1OQH A;  4ESW A;  3OSQ A;  5L9M A;  4YB5 A;  3O66 A;  3TCG A;  2HXW A;  4FED A;  1N3W A;  1N04 A;  1MH3 A;  4R73 A;  5ICT A;  1FTK A;  4OQO A;  3MVX A;  1A8E A;  1CE2 A;  1QUL A;  3W9W A;  4XKN A;  4RPN A;  1LAH E;  4NE4 A;  3OO6 A;  4U23 A;  3RT6 B;  3CFL A;  3FXR A;  4FJP A;  4OES A;  4ZE9 A;  4G8H A;  4ONY A;  1H44 A;  1VR5 A;  3QUF A;  3VVF A;  1LFG A;  2Q89 A;  3LSL A;  2I0B A;  2Y7W A;  4OEN A;  4C1U A;  3N94 A;  3W15 C;  5I56 B;  3MJN A;  4NF4 B;  1QKB A;  5CBS A;  4XXU A;  4XTC Q;  3TTK A;  1B0L A;  3GBB A;  4KYD A;  3SES A;  1TFD A;  2Y7P A;  3MP8 A;  3BKI B;  1NH7 A;  1B3F A;  1BP5 A;  2RIN A;  4NF5 A;  3HHG A;  3TDJ A;  3TTL A;  1YTV A;  2F8D A;  4ZDM A;  1L5T A;  2REJ A;  1ANF A;  5EHS A;  4R2B A;  1US5 A;  4ELO A;  4DIG A;  1JQF A;  3KOS A;  3LC8 A;  2HAU A;  5DEX A;  4KFQ A;  4U1Z A;  1I6Q A;  3E13 X;  1B7Z A;  2P2A A;  3M3K A;  3OEM A;  1H76 A;  1JEU A;  4WEP A;  1FQF A;  3LBS A;  3UA8 A;  5CM6 A;  4P11 A;  1BTJ A;  1Y4T A;  2HAV A;  2DWH A;  2ONR A;  1QUJ A;  1D3K A;  2DWJ A;  3FJM A;  4OFL A;  4YKP A;  1YAE A;  3VXB A;  3FXQ A;  3MZ1 A;  4DXU A;  4P0I A;  1MY3 A;  1TXF A;  5F1Q A;  4ZS9 A;  3U8Q A;  3CFX A;  2HZK A;  3PPQ A;  4EQ9 A;  1JW1 A;  3GZG A;  5H8F B;  1UTH A;  4YAH X;  1NNP A;  3F11 A;  5JK4 A;  4ZEK A;  2REG A;  3E3K A;  4ELP A;  4AB5 A;  4IO5 A;  1Q35 A;  1AMF A;  3H06 B;  1R1N A;  5H8S A;  3KEI A;  4F29 A;  3L6H A;  1MXY A;  3PUY E;  3PPP A;  5H8Q A;  1FW0 A;  2UVG A;  3TCF A;  3VFJ A;  4DLD A;  1IXH A;  2Q2C A;  2FNC A;  4HS7 A;  3RUM A;  3HO7 A;  5I2K A;  2I4B A;  4RA1 A;  3TFL A;  1Y4C A;  4BDO A;  1JW4 A;  3PUV E;  1D4N A;  3G3H A;  1OIB A;  4HW8 A;  3TZA A;  3C32 A;  2VD2 A;  3KSX A;  4N13 A;  3MP1 A;  4C0R A;  4PFT A;  1ZBM A;  2YJP A;  5TP9 B;  4NF8 A;  1MXU A;  4EDP A;  3TEL A;  1SW5 A;  1B3G A;  5DVI A;  2P1S A;  4QFN A;  3HN0 A;  1OVT A;  4F1U A;  1B32 A;  1B58 A;  1B2H A;  2O7U A;  2F7A A;  4N6P A;  2IA4 A;  2BJJ X;  2Q9T A;  1IIW A;  1NNK A;  2DS9 A;  2F36 A;  2Z23 A;  3ILT B;  5AA1 A;  5K2X A;  5H8H A;  4F3B A;  3UN6 A;  4ND9 A;  3DM0 A;  3SKP A;  2RCB A;  1SQY A;  3O29 A;  4KCD A;  3FJG A;  3K0V A;  4H5F A;  2QJE A;  2Y84 A;  1RKM A;  3T9X B;  3OO9 A;  2QS4 A;  3I5O A;  3VE1 B;  4Z0I A;  1MPB A;  3MQ9 A;  1IXC A;  3HST A;  3LUY A;  1O64 A;  1R9L A;  4BLA A;  1ZU0 A;  3LSX A;  1B52 A;  1JNF A;  2LAO A;  2VP1 A;  4EF2 A;  2O51 A;  4H67 A;  1DOT A;  4WED A;  4ZEF A;  1FCK A;  5I59 B;  1LGB C;  2UVJ A;  1QW0 A;  3O2A A;  4EXK A;  3G3I A;  1B51 A;  3SET A;  2DVC A;  1QUI A;  4GWO A;  3AXF A;  3MUQ A;  1MQH A;  4R9F A;  1OLA A;  4YIC A;  1IQ7 A;  1H45 A;  5DVF A;  4GIZ A;  1M5B A;  4X9T A;  3A3U A;  4OWD A;  4R2F A;  5H8N A;  3QYT A;  3K02 A;  4BDN A;  5CMB A;  4WKM A;  2A5T A;  3PPN A;  1LFH A;  1MRP A;  3OOA A;  2AIX A;  1UTB B;  2F5X A;  2XXI A;  3EHU A;  3BBR A;  3RY3 A;  4QSC A;  3FVN A;  2QSX A;  1IXI A;  3GLB A;  5FHO A;  3FV2 A;  4LZ5 A;  1YCJ A;  3KN3 A;  1TFA A;  4ELR A;  3H6V A;  1B5I A;  4F1Y A;  1ZJL A;  4LZ8 A;  3DLN A;  3K01 A;  1XS5 A;  4ZEB A;  2NXO A;  4NTL A;  3FIR A;  2V3Q A;  5I84 A;  1N0T A;  3CG3 A;  3HHF A;  3H6T A;  3EQ1 A;  3MVZ A;  4KPT A;  1B46 A;  1EZO A;  4QRZ A;  4EQB A;  3S4U A;  4ZEI A;  2F6G A;  1BKA A;  1SYH A;  3BFT A;  2I58 A;  1MQI A;  1MQG A;  2DWA A;  3VXC A;  5KDT B;  1VFE A;  1VSO A;  2DE2 A;  4IY5 A;  4U4X A;  1XVX A;  3IOV A;  1EH3 A;  4RYA A;  1PBP A;  2RC9 A;  3PD8 A;  1WVJ A;  2DVZ A;  3USD A;  3KGC A;  3EHT A;  2F35 A;  1FTM A;  4P0G A;  3MAM A;  5DYH A;  1MG1 A;  2OBG A;  1Y1M A;  2VOZ A;  1IEJ A;  2AYS A;  3KN8 A;  2M8C A;  4R74 A;  1MDQ A;  5LOM A;  4R6Y A;  1M5D A;  3TYH A;  4POW A;  3ODB A;  5JTY A;  3PMX A;  3C36 A;  4R9G A;  2B3F A;  1MM6 A;  3PPR A;  3SEV A;  2RKM A;  3H3G A;  1NL5 A;  3VVE A;  3KN7 A;  1FTJ A;  4OFO A;  1EZP A;  4O3B A;  1FQD A;  3UOR A;  2THI A;  3H6U A;  2F7C A;  2V3U A;  3CG1 A;  2DSF A;  3IR1 A;  4GL8 A;  5I57 A;  5BUU A;  2DXY A;  1OVB A;  3QUJ A;  4PQJ A;  3CSG A;  1P99 A;  1MM7 A;  3IOU A;  4PFW A;  1JEV A;  1B1H A;  1A40 A;  3U72 A;  2I4C A;  4JSD A;  1LAX A;  4LUB A;  2XXX A;  2R9J A;  3FAT A;  3IB1 A;  4JB7 A;  5DVJ A;  1PB9 A;  2D3I A;  5ITP A;  4IGR A;  3K1P A;  4GL0 A;  1ZTY A;  3BFU A;  4I8C A;  4IY6 A;  5L9S A;  1MS7 A;  1LBB A;  3V5A A;  5HBC A;  4H8J A;  2XXY A;  1P1W A;  3A3C A;  3SER A;  4G68 B;  3LR1 A;  5HPQ A;  2I48 A;  3S9E A;  4TLL B;  3G7W A;  3C4M A;  2PX1 A;  1SYI A;  3FAS A;  2ZNS A;  4K3F A;  1OQG A;  3H6W A;  1H43 A;  1JVY A;  1O7T A;  5TPA A;  3RNN A;  3T9V A;  1DMB A;  4R75 A;  1XHY A;  4POX A;  4OVJ A;  2Q2A A;  1UTH B;  1SW1 A;  3QSL A;  4I9D A;  2X7Q A;  2XHD A;  4YB7 A;  3O6H A;  1Y20 A;  1P1O A;  4F2Q A;  2RF1 A;  1LBC A;  2DE4 A;  3RTF B;  3L6G A;  3PUW E;  4EUO A;  4IB2 A;  1B5J A;  2A5S A;  1II5 A;  3I3V A;  2HFB A;  1Y3N A;  4DDD A;  2X26 A;  1R9Q A;  3V83 A;  2NUV A;  1SBP A;  1B3E A;  1MH4 A;  3K1M A;  4F22 A;  5A5X A;  2OJT A;  1JVX A;  1ZLQ A;  2YPN A;  1GGG A;  4F1V A;  2AL4 A;  3K4U A;  1LCT A;  3B6T A;  3P7I A;  3FUZ A;  1J1N A;  3LSW A;  3CRB A;  5CRY A;  2I3V A;  1B5H A;  3PUX E;  2QMX A;  3O9P A;  1M5F A;  2XXW A;  3B6Q A;  1M5C A;  3T96 B;  1F9B A;  2XX9 A;  2CMO A;  4QF9 A;  4MFI A;  3D4G A;  2DXR A;  1LST A;  5M2V A;  4WXJ A;  4H65 A;  3OEN A;  4GVO A;  3O6I A;  4JDF A;  2ONK E;  1N7W A;  1P1Q A;  3MPK A;  4NED A;  3TMG A;  4GFR A;  4F3S A;  4TOZ A;  1R6Z A;  4M4G A;  1XT8 A;  3TCH A;  3RLF E;  5F7V A;  4UAC A;  5KCJ B;  3KZG A;  1FTO A;  3WAF A;  5H8H B;  1QJM A;  4YMA A;  4X48 A;  4DZ1 A;  5CMM A;  4PFU A;  4F18 A;  2KLF A;  2RCA A;  4QFL A;  2B65 A;  1A8F A;  5J1D A;  5I2N B;  5FTH A;  3O97 A;  3ZKK A;  1SDX A;  5I56 A;  1KWH A;  4M1V A;  4OXV A;  4NF4 A;  3SDF A;  2XXR A;  3OD7 A;  3HPI A;  2QRY A;  5I58 B;  3M8U A;  2GFE A;  1A55 A;  4ZZA A;  3N26 A;  2H9B A;  3MVW A;  3RPW A;  4G8N A;  3MPL A;  1EU8 A;  2O6A A;  4GQO A;  1OLC A;  3GBA A;  2H5Y A;  2R71 A;  1ZIU A;  4C1T A;  4Z7E A;  2ANJ A;  1B9J A;  1WDN A;  3TKD A;  1B40 A;  1B05 A;  3R7X A;  1SI1 A;  2O1L A;  3KOT A;  2Z22 A;  3CVG A;  3JV9 A;  4RJZ A;  5FHN A;  1JW5 A;  1XC1 A;  4NF6 B;  4BDL A;  4ELQ A;  3E9X A;  3C33 A; 
#chains in the Genus database with same CATH topology
 2Z8F A;  2ZYN A;  4XKR A;  4NF0 A;  3UK4 A;  3ZKL A;  2F78 A;  4ZEC A;  4BDR A;  1LB9 A;  4MNP A;  4OTE A;  1LAF E;  5DW8 A;  5EYH A;  2XWV A;  1URD A;  4XIG Q;  1POY 1;  3VDF A;  4IO4 A;  2UVH A;  3PD9 A;  4PDH A;  2QVV A;  1UIV A;  1LBX A;  1FBP A;  4XEQ A;  4DCX A;  3HCQ A;  2DP8 A;  2HEU A;  1SW4 A;  4NG7 A;  1MXZ A;  2HCA A;  2DWI A;  4BDM A;  4PFY A;  2V84 A;  1IMD A;  1D9Q A;  4F19 A;  4NHB A;  2XXT A;  5H8F A;  4QSE A;  3UIF A;  2OCU A;  3DEL B;  3Q27 A;  4IO6 A;  3IB2 A;  2GH9 A;  2V93 A;  1NH8 A;  3EKI A;  1FRP A;  2VGQ A;  3R26 A;  4U1O A;  3C34 A;  5CMC A;  1MQJ A;  4QSD A;  3TEP A;  2GHA A;  5AA2 A;  5HM4 B;  2XXQ A;  2ZMB A;  3UP9 A;  1XOC A;  2OK2 A;  1A99 A;  5AA2 D;  2NWJ A;  2OWT A;  1LAG E;  1UIU A;  2Q8J A;  4XFE A;  5IKB A;  3M3F A;  4RXL A;  1NV0 A;  4O8M A;  5EQ7 A;  3IX1 A;  1GVC A;  2R8T A;  2H98 A;  4OET A;  4THI A;  2NVU B;  4NN3 A;  3RQT A;  1SD3 A;  1MXV A;  3FGS A;  4KYS A;  4GWW A;  3GYY A;  3UGW A;  5TP9 A;  3EHS A;  1P1U A;  3TAJ A;  2PBW A;  1Q9D A;  1B3H A;  3IL1 B;  5L9O A;  4ZE8 A;  4LA9 A;  3RTW B;  4BDQ A;  2I0C A;  2RC7 A;  4MMP A;  3TQW A;  4ESX A;  4LAT A;  3SEU A;  2HZL A;  2QMW A;  2VT5 A;  2DOJ A;  5JTY B;  1MPC A;  4R6H A;  1LLS A;  1LB8 A;  4FIM A;  3CFZ A;  4KD5 A;  1AOV A;  4YB6 A;  1FQB A;  1Z7N E;  4E0X A;  1PB8 A;  2UYF A;  2ALU A;  4AQ4 A;  2CEY A;  4LQ5 A;  1BLF A;  4OAN A;  1ELJ A;  2DE3 A;  3LV0 A;  4GX6 A;  1LBV A;  4X1D A;  3FXU A;  5AA4 A;  3EF7 A;  3Q28 A;  2OX3 A;  1DTZ A;  3MW0 A;  4P8B A;  4FEB A;  3IO4 A;  4GX4 A;  4F39 A;  4I40 A;  5DT6 A;  2P0S A;  2QL3 A;  3OO7 A;  1EYK A;  4FE8 A;  4ZZE A;  1FQC A;  4MLV A;  2F97 A;  4MBP A;  5I59 A;  4RK2 A;  2ZYM A;  4OFJ A;  1O63 A;  3QXM A;  4DXB A;  3H4Z A;  3TPA A;  4LP2 B;  2QFL A;  3H7M A;  4MF3 A;  1US4 A;  3ILU B;  3U93 A;  3K6W A;  1T0K A;  3DP8 A;  2X7P A;  2CZH A;  4JBZ A;  4PTK A;  3KBZ A;  1GV8 A;  2ZZW A;  4HCW A;  3FD3 A;  4H0W A;  3C35 A;  2VHA A;  4H5G A;  5I3S A;  3SZP A;  4Q8R A;  4GOT A;  2IEE A;  4PGN A;  2HQ0 A;  5LDZ A;  4DE8 A;  2O7I A;  4KYE A;  3IOW A;  2WYK A;  4PAF A;  4MNI A;  2MKZ A;  3G3F A;  2ONS A;  1UTB A;  1NNF A;  2O1M A;  3KJ7 A;  4XKP A;  4PFB A;  1MY4 A;  5B7D A;  4KHZ E;  4LQ2 A;  3D4C A;  3N6U A;  4F3P A;  3IFA A;  4N6K A;  3KJT A;  4GF8 A;  1MQD A;  2Y7K A;  2D5W A;  3U94 A;  2RC8 A;  2WKY A;  3MP6 A;  3MWB A;  4HTG A;  1DTG A;  1S50 A;  4RK9 A;  3QK6 A;  3PU5 A;  2YLN A;  3I6V A;  5IAI A;  2ZNT A;  4L17 A;  4NF5 B;  2Q88 A;  1URS A;  2O68 A;  3PPO A;  3TTN A;  1USY H;  1UQW A;  3CIJ A;  5A5L A;  3EN3 A;  1LCF A;  4P9K A;  4PGP A;  4OVQ A;  1MDP 1;  4E0W A;  1B7U A;  2QS1 A;  5DEX B;  3A09 A;  4PAK A;  4EXL A;  4N81 A;  5AE4 A;  5B70 A;  1QGX A;  3OEK A;  4PFR A;  1QKA A;  1DSN A;  3G3K A;  1H3D A;  5ET7 A;  1DPP A;  4YKI A;  4G2Z A;  1XVY A;  3MC2 A;  2XXV A;  5KDT A;  1RYO A;  3B7D A;  1N7X A;  3G3J A;  4MCO A;  3KBR A;  4NMY A;  4KCC A;  1FQA A;  3G3G A;  2E0S A;  3KFM A;  1P1N A;  3N5L A;  4H8I A;  1WOD A;  3VV5 A;  4I62 A;  5FHM A;  1MY0 A;  2V3T A;  3K2D A;  1IME A;  5FBP A;  1Y9U A;  4F2O A;  4O3A A;  2O84 X;  3PMW A;  4GBV A;  3LSF B;  3PV0 E;  1Z7M E;  2OLB A;  3IB0 A;  1POT A;  1I6A A;  3MBP A;  4HE0 A;  5H8Q B;  3N6T A;  3PUZ E;  3KG2 A;  4GXS B;  2Z8E A;  2OWS A;  3D1R A;  3E79 A;  4I1D A;  4U21 A;  1D9V A;  5I2K B;  3C31 A;  3W9V A;  1PDA A;  5IZZ A;  3LUZ A;  4NQ8 A;  2ZNU A;  3THI A;  4QFK A;  2G29 A;  4N17 A;  2QS3 A;  4NWC A;  1EZ9 A;  1FPE A;  2DQV A;  4AS5 A;  1Y1Z A;  3CHG A;  4NF8 B;  3ZS6 A;  4TLM B;  2XX7 A;  2XXH A;  4N8G A;  1A54 A;  2ZZX A;  4XKQ A;  1I6B A;  1DPE A;  4XF5 A;  1B6H A;  4KQP A;  4ECF A;  2B3B A;  2AL5 A;  1B7H A;  3C9H A;  2XX8 A;  1I69 A;  2ZXT A;  2F6P A;  4OA4 A;  3O6G A;  2W7Y A;  4G68 A;  3K6U A;  2FYI A;  4X8R A;  3VLU A;  1YXI A;  1YPN A;  5EYF A;  1NFT A;  5KZT A;  3Q29 A;  4PE5 B;  3T93 B;  1KA0 A;  2XXP A;  3TOD A;  1URG A;  1N3X A;  1B1X A;  3Q25 A;  4YKK A;  3FVO A;  1PEB A;  3IOT A;  1ATG A;  4FAJ A;  1FQE A;  3CI8 A;  2VPN A;  2I3W A;  3E78 A;  3Q26 A;  4H45 A;  2V25 A;  1HSJ A;  4MNC A;  1HSE A;  4IO7 A;  2Q74 A;  3PGF A;  3T66 A;  1B0H A;  4OER A;  3T9H B;  3U1O A;  5AA2 B;  3IAZ A;  3QMF A;  3FV1 A;  5BWJ A;  4F3G A;  5IZ3 B;  2O69 A;  1JET A;  5EHM A;  1CB6 A;  2QPQ A;  1ZKB A;  2XD3 A;  1AH5 A;  1YZ0 A;  3JZJ A;  3K6X A;  5EQ8 A;  4TQU Q;  4N6D A;  3MZB A;  5CC2 A;  1AIV A;  5H8N B;  4LZ7 A;  1N84 A;  4PP0 A;  4O3C A;  2VPO A;  4GWS A;  3QIM A;  4MLQ A;  2A5T B;  1NV3 A;  2V4C A;  4U4S A;  3O28 A;  3E4R A;  2PVU A;  3OO8 A;  2GHB A;  3MVY A;  1QUK A;  2CZK A;  4LVQ A;  2E1S A;  1PB7 A;  4JVD A;  2Y7R A;  3V8X B;  3R6U A;  4RNS A;  4ZED A;  1NNT A;  3OMB A;  1TT1 A;  3S2V A;  1RDY A;  2ZYK A;  4FBP A;  1GR2 A;  5KCJ A;  2HHM A;  2D21 A;  2Y5L A;  4MH5 A;  4HE1 A;  2PMS A;  1PBQ A;  4IO3 A;  4PET A;  3RGY A;  4NAP A;  4U2R A;  4R6K A;  3K00 A;  1YYZ A;  2DYX A;  4FOR A;  3IJO B;  2QS2 A;  5AA4 B;  4F31 B;  3QAX A;  2GQ1 A;  2FIE A;  5I2N A;  1IIT A;  1MPD A;  4MEV A;  2I6E A;  3T9U A;  2XA5 A;  4GWZ A;  1MY1 A;  5EYG A;  3SEY A;  5I58 A;  2WX9 A;  5L8D A;  2H4I A;  3CR9 A;  4YKJ A;  1B4H A;  2I49 A;  1MXW A;  3PMV A;  4JWY A;  2FA7 A;  2DDK A;  4P1L A;  4FEC A;  1M5E A;  4LON B;  3FVG A;  1VFD A;  2B4L A;  1SI0 A;  4U22 A;  3S9M C;  1NV6 A;  4YMB A;  4G77 A;  4GXA A;  4RPO A;  3TQL A;  3IO6 A;  3SEX A;  4MJO A;  1RYX A;  4PCD A;  4H1X A;  1FPJ A;  1Y3P A;  2BJI A;  2F34 A;  5K2Y A;  3V89 B;  1SW2 A;  1ZMG A;  4HE2 A;  3M3L A;  5DTB A;  1K9Y A;  3FZV A;  4R72 A;  3FXB A;  2UXA A;  4NF6 A;  1B4Z A;  5ISU A;  1BIY A;  3ONM A;  3OXN A;  2PT1 A;  2OZZ A;  4GLI A;  3CSB A;  3ECR A;  5IGA A;  4G68 C;  3FVK A;  3IJX B;  1MY2 A;  2F3D A;  3B6W A;  3IOR A;  4UA8 A;  3B50 A;  4N8Y A;  5ICQ A;  3FBP A;  4X1B A;  4JXI A;  2Z8D A;  2ZYO A;  5ELV A;  4IO2 A;  4GD5 A;  4OYV A;  4I3Y A;  1IZ1 A;  4DXC A;  3RPL B;  1LEV A;  1G0H A;  3S9N C;  4OEU A;  1S9T A;  5I57 B;  4AB6 A;  4IR8 A;  1AL3 A;  4PAI A;  1A7L A;  4EQ7 A;  2PFY A;  4O94 A;  1IUD A;  2ESN A;  1NKX A;  2FVZ A;  3VVD A;  2KQZ A;  4QFP A;  3TTM A;  3JYR A;  3ZSF A;  1DCU A;  4HCY A;  4JVI A;  4KR5 A;  4PF6 A;  1NV4 A;  4P47 A;  3MZ9 A;  1PC3 A;  1N76 A;  4JSO A;  5CMK A;  3FJ7 A;  2F7B A;  2XWO A;  3TTR A;  1IMC A;  3OSR A;  2FIX A;  4H6D A;  2UYE A;  1GTK A;  4GBW A;  1OMP A;  2UVI A;  4JWX A;  4RY1 A;  3S9L C;  1NV1 A;  4QFO A;  3H03 A;  4Q0C A;  1FBH A;  2GRV A;  1SVX B;  3IK6 B;  1Q1K A;  3GXA A;  3HV1 A;  1HSL A;  1USY E;  1TWY A;  1LFI A;  1MXX A;  1QVS A;  4P56 A;  3U92 A;  1NMU A;  1Y3Q A;  4N07 A;  5TPA B;  3DP6 A;  4OEV A;  2ABH A;  5JEI A;  4YU0 A;  4GRK A;  4ISU A;  4NWD A;  5ITO A;  2G93 A;  4OHN A;  4DCY A;  4YZZ A;  4EF1 A;  5AA3 A;  3VLV A;  1S7Y A;  1VE4 A;  4IGT A;  4PFI A;  2XXU A;  2Y7I A;  1FPL A;  4OZ9 A;  5CBR A;  3TUS A;  4KI0 E;  2NOO A;  4HXV A;  2R6G E;  1FTL A;  3RN8 A;  2CZL A;  1KZ8 A;  3RT8 A;  2H25 A;  2VD3 A;  1B3L A;  4JWO A;  5TU0 A;  1FBG A;  5FTI A;  3T22 A;  2CEX A;  1NV5 A;  4G8M A;  3K6V A;  3EPE A;  3OEL A;  1FBE A;  2XXK A;  3DP4 A;  4Q5T A;  5A5X B;  4Q30 B;  4H46 A;  4OMB A;  2PT2 A;  4G4P A;  2PYY A;  2H99 A;  4MX6 A;  1IXG A;  1FBF A;  2XD2 A;  1D9Y A;  3K1N A;  3KSJ A;  3VLW A;  5CI5 A;  4X04 A;  3SEW A;  3T1B A;  4OVS A;  4FAT A;  3WAE A;  4QHQ A;  1OQH A;  4ESW A;  3OSQ A;  5L9M A;  4YB5 A;  3O66 A;  3TCG A;  4JVC A;  2HXW A;  4FED A;  1N3W A;  1N04 A;  1MH3 A;  4R73 A;  5ICT A;  1FTK A;  4OQO A;  3MVX A;  1A8E A;  1CE2 A;  1QUL A;  3W9W A;  4XKN A;  4RPN A;  1LAH E;  4NE4 A;  3OO6 A;  2Y5K A;  4U23 A;  2XWI A;  3RT6 B;  3CFL A;  3FXR A;  4FJP A;  4OES A;  4ZE9 A;  4G8H A;  4ONY A;  1H44 A;  1VR5 A;  3QUF A;  3VVF A;  1LFG A;  2Q89 A;  3LSL A;  2I0B A;  2Y7W A;  4OEN A;  4C1U A;  5ET5 A;  3N94 A;  3W15 C;  5I56 B;  3MJN A;  4NF4 B;  1QKB A;  5CBS A;  4XXU A;  4NX1 A;  4XTC Q;  3TTK A;  1B0L A;  3GBB A;  5J16 A;  4KYD A;  4MHF A;  3SES A;  1TFD A;  2Y7P A;  2XWK A;  3MP8 A;  3BKI B;  1NH7 A;  1B3F A;  1BP5 A;  3HFU A;  4DI4 B;  2RIN A;  4NF5 A;  3HHG A;  3TDJ A;  3TTL A;  1YTV A;  2F8D A;  4ZDM A;  1L5T A;  2REJ A;  1ANF A;  5EHS A;  5EQ9 A;  4R2B A;  1US5 A;  4ELO A;  4DIG A;  1JQF A;  3KOS A;  3LC8 A;  2HAU A;  5DEX A;  4KFQ A;  4U1Z A;  1I6Q A;  3E13 X;  4O7M A;  1B7Z A;  4OVR A;  2P2A A;  3M3K A;  4WEP A;  1H76 A;  1JEU A;  3OEM A;  1FQF A;  1FPK A;  3LBS A;  3UA8 A;  5CM6 A;  4P11 A;  1BTJ A;  1Y4T A;  2HAV A;  2DWH A;  2ONR A;  1NUZ A;  5ET8 A;  1QUJ A;  1D3K A;  2DWJ A;  4OFL A;  3FJM A;  4YKP A;  1YAE A;  3VXB A;  3FXQ A;  3MZ1 A;  4DXU A;  2P3V A;  4P0I A;  1MY3 A;  1RDZ A;  1LBY A;  1TXF A;  5F1Q A;  4ZS9 A;  3U8Q A;  3CFX A;  2HZK A;  3PPQ A;  4EQ9 A;  1JW1 A;  2F3B A;  3GZG A;  5H8F B;  1UTH A;  4YAH X;  1NNP A;  3F11 A;  5JK4 A;  4ZEK A;  2REG A;  3E3K A;  1RDX A;  4ELP A;  4AB5 A;  4IO5 A;  1Q35 A;  1AMF A;  2WBD A;  3H06 B;  1R1N A;  5H8S A;  3KEI A;  4F29 A;  3L6H A;  1MXY A;  3PUY E;  3PPP A;  5H8Q A;  1FW0 A;  4GWY A;  2UVG A;  3TCF A;  3VFJ A;  4DLD A;  2QVU A;  1IXH A;  2Q2C A;  1SPI A;  1LBZ A;  2FNC A;  4HS7 A;  3RUM A;  3HO7 A;  5I2K A;  2I4B A;  4RA1 A;  1FPG A;  3TFL A;  1Y4C A;  4BDO A;  1JW4 A;  3PUV E;  1D4N A;  3G3H A;  1OIB A;  4KXP A;  4HW8 A;  3TZA A;  3C32 A;  2VD2 A;  3KSX A;  4N13 A;  3MP1 A;  4C0R A;  1FPF A;  4PFT A;  1ZBM A;  2YJP A;  5TP9 B;  4NF8 A;  1MXU A;  4EDP A;  2Q8M A;  3TEL A;  1SW5 A;  1B3G A;  5DVI A;  2P1S A;  4QFN A;  3HN0 A;  1OVT A;  4F1U A;  1B32 A;  1B58 A;  1B2H A;  2O7U A;  2F7A A;  4PBQ A;  4N6P A;  4AS4 A;  1FJ9 A;  2IA4 A;  2BJJ X;  2Q9T A;  1IIW A;  5LTC A;  1NNK A;  2DS9 A;  2F36 A;  1XI6 A;  2Z23 A;  3ILT B;  5AA1 A;  4LN5 A;  5K2X A;  5H8H A;  4F3B A;  3UN6 A;  4ND9 A;  5T3J A;  3DM0 A;  3SKP A;  2RCB A;  1SQY A;  3O29 A;  4PE3 A;  4KCD A;  2PCR A;  3FJG A;  3K0V A;  4H5F A;  2QJE A;  2Y84 A;  1RKM A;  3T9X B;  3OO9 A;  2FHY A;  1NV2 A;  2QS4 A;  3I5O A;  3VE1 B;  4Z0I A;  1MPB A;  3MQ9 A;  1IXC A;  2WEF A;  3HST A;  3LUY A;  1O64 A;  1R9L A;  1IMA A;  4BLA A;  1ZU0 A;  3LSX A;  1B52 A;  1JNF A;  2LAO A;  2VP1 A;  4EF2 A;  2O51 A;  1FPI A;  4H67 A;  1DOT A;  4WED A;  4ZEF A;  1FCK A;  5I59 B;  1LGB C;  2UVJ A;  1QW0 A;  2B4M A;  3O2A A;  4OVT A;  5F24 A;  4EXK A;  4PBH A;  3G3I A;  1FPD A;  5IZ3 A;  1EYJ A;  1B51 A;  3SET A;  2DVC A;  1QUI A;  4GWO A;  3AXF A;  3MUQ A;  1MQH A;  4I3E A;  4R9F A;  1OLA A;  4YIC A;  1IQ7 A;  1H45 A;  2FBP A;  5DVF A;  4GIZ A;  1M5B A;  1NUW A;  4X9T A;  3A3U A;  4OWD A;  4R2F A;  5H8N A;  3A29 A;  3QYT A;  3K02 A;  4BDN A;  5CMB A;  4WKM A;  2A5T A;  3PPN A;  1LFH A;  1MRP A;  3OOA A;  2AIX A;  1UTB B;  2F5X A;  2XXI A;  3EHU A;  3BBR A;  3RY3 A;  4QSC A;  3FVN A;  2QSX A;  2WBB A;  1IXI A;  3GLB A;  3KC1 A;  5FHO A;  3NOH A;  2WYP A;  3FV2 A;  4LZ5 A;  1YCJ A;  3KN3 A;  1TFA A;  4ELR A;  3H6V A;  1B5I A;  4F1Y A;  1ZJL A;  4LZ8 A;  3DLN A;  3K01 A;  1XS5 A;  4ZEB A;  3BIG A;  2NXO A;  4NTL A;  3FIR A;  2V3Q A;  5EQA A;  1NV7 A;  3PTY A;  5I84 A;  1N0T A;  3CG3 A;  3HHF A;  1FSA A;  3H6T A;  3EQ1 A;  3MVZ A;  4KPT A;  1B46 A;  1EZO A;  4QRZ A;  4GWU A;  1NUY A;  4EQB A;  3S4U A;  4ZEI A;  4N4U A;  2F6G A;  1BKA A;  1SYH A;  3BFT A;  2I58 A;  1INP A;  1MQI A;  1MQG A;  2DWA A;  3VXC A;  4N91 A;  5KDT B;  1VFE A;  1VSO A;  2DE2 A;  4IY5 A;  4U4X A;  1XVX A;  3IOV A;  1EH3 A;  4RYA A;  1PBP A;  4OVP A;  2RC9 A;  3PD8 A;  1WVJ A;  2DVZ A;  3USD A;  3KGC A;  3EHT A;  2F35 A;  1FTM A;  4P0G A;  3MAM A;  5DYH A;  1MG1 A;  2OBG A;  1Y1M A;  2VOZ A;  1IEJ A;  2AYS A;  2ZZV A;  3KN8 A;  2M8C A;  4GWX A;  4R74 A;  1MDQ A;  4G61 A;  5LOM A;  4R6Y A;  1M5D A;  3BIH A;  3TYH A;  4POW A;  1G0I A;  3ODB A;  5JTY A;  3PMX A;  3C36 A;  4R9G A;  2B3F A;  1MM6 A;  3PPR A;  3SEV A;  2RKM A;  3H3G A;  1NL5 A;  3VVE A;  3KN7 A;  1FTJ A;  4OFO A;  4QXD A;  1EZP A;  4O3B A;  2P3N A;  1FQD A;  1AWB A;  3UOR A;  2THI A;  3H6U A;  2F7C A;  3RPL A;  2V3U A;  3CG1 A;  4O7I A;  2DSF A;  3B8B A;  3IR1 A;  1FTA A;  4GL8 A;  5I57 A;  5BUU A;  2DXY A;  1OVB A;  1LBW A;  3QUJ A;  4PQJ A;  3CSG A;  5ET6 A;  1P99 A;  1MM7 A;  3IOU A;  4PFW A;  1JEV A;  1B1H A;  1A40 A;  3U72 A;  2I4C A;  4LUB A;  1LAX A;  4JSD A;  2XXX A;  2R9J A;  1VDW A;  3FAT A;  3IB1 A;  4JB7 A;  5DVJ A;  3U65 A;  1PB9 A;  2CZI A;  2D3I A;  3IFC A;  5ITP A;  4IGR A;  3K1P A;  4GL0 A;  1ZTY A;  2PFZ A;  3BFU A;  4I8C A;  4IY6 A;  5L9S A;  1MS7 A;  1LBB A;  3V5A A;  5HBC A;  4H8J A;  2XXY A;  1P1W A;  3A3C A;  3MYU A;  5ESY A;  3SER A;  4G68 B;  3LR1 A;  5HPQ A;  2I48 A;  3S9E A;  4TLL B;  3G7W A;  3C4M A;  1IMB A;  2PX1 A;  3ISP A;  1SYI A;  3FAS A;  2ZNS A;  4P3L A;  4K3F A;  1OQG A;  3H6W A;  1H43 A;  1JVY A;  1O7T A;  5IM2 A;  5TPA A;  3RNN A;  3T9V A;  1NUX A;  1DMB A;  4R75 A;  1XHY A;  4GX3 A;  2OWZ A;  4POX A;  4OVJ A;  2Q2A A;  1UTH B;  1SW1 A;  3QSL A;  4I9D A;  2X7Q A;  2L5V A;  2XHD A;  4YB7 A;  3O6H A;  3MST A;  1Y20 A;  1P1O A;  1FJ6 A;  4F2Q A;  2RF1 A;  1LBC A;  2DE4 A;  3RTF B;  1IMF A;  3RYD A;  3L6G A;  3PUW E;  4EUO A;  1DK4 A;  4IB2 A;  4MAG A;  1NI9 A;  1B5J A;  1K9Z A;  2A5S A;  1II5 A;  3I3V A;  2HFB A;  1Y3N A;  4PF8 A;  4DDD A;  2X26 A;  4QBA A;  1R9Q A;  3V83 A;  2NUV A;  1SBP A;  1B3E A;  1MH4 A;  5I5P A;  3K1M A;  4F22 A;  5A5X A;  2OJT A;  1JVX A;  1ZLQ A;  2YPN A;  1FBC A;  1GGG A;  4F1V A;  2AL4 A;  3K4U A;  1LCT A;  3B6T A;  3P7I A;  5IZ1 A;  4UAB A;  3FUZ A;  1J1N A;  3LSW A;  3CRB A;  5CRY A;  2I3V A;  2HPG A;  4MIJ A;  4PC9 A;  1B5H A;  3PUX E;  2QMX A;  2HXR A;  1DBZ A;  3O9P A;  1CNQ A;  1M5F A;  2XXW A;  3B6Q A;  1M5C A;  3T96 B;  1F9B A;  2XX9 A;  2CMO A;  4QF9 A;  4MFI A;  3D4G A;  5I7I A;  2DXR A;  1LST A;  1BK4 A;  5M2V A;  4WXJ A;  4DI3 D;  4H65 A;  3OEN A;  4GVO A;  3O6I A;  4JDF A;  2ONK E;  1N7W A;  1P1Q A;  3MPK A;  4NED A;  3TMG A;  3T0J A;  4GFR A;  4F3S A;  4TOZ A;  1R6Z A;  2QVR A;  4M4G A;  1XT8 A;  3TCH A;  3RLF E;  5F7V A;  1JP4 A;  4UAC A;  5KCJ B;  3KZG A;  1FTO A;  1KA1 A;  4N15 A;  3WAF A;  5H8H B;  1QJM A;  4YMA A;  4X48 A;  4DZ1 A;  5CMM A;  4PFU A;  4F18 A;  2KLF A;  2RCA A;  4QFL A;  4P1E A;  2B65 A;  1A8F A;  5J1D A;  5I2N B;  5FTH A;  3O97 A;  1SDX A;  3ZKK A;  5I56 A;  1KWH A;  4M1V A;  4OXV A;  4NF4 A;  3SDF A;  2XXR A;  3OD7 A;  3HPI A;  2QRY A;  5I58 B;  3M8U A;  4NGU A;  2GFE A;  1A55 A;  4ZZA A;  3N26 A;  2H9B A;  3MVW A;  3RPW A;  1EYI A;  4G8N A;  4PDD A;  3MPL A;  1EU8 A;  3ROJ A;  3KC0 A;  2O6A A;  4GQO A;  1OLC A;  3GBA A;  2H5Y A;  2R71 A;  1ZIU A;  2KR0 A;  4C1T A;  4Z7E A;  2ANJ A;  1B9J A;  1WDN A;  3TKD A;  1B40 A;  1B05 A;  1FPB A;  3R7X A;  1SI1 A;  2O1L A;  3KOT A;  2JJK A;  2Z22 A;  3CVG A;  3JV9 A;  4RJZ A;  5FHN A;  1JW5 A;  1XC1 A;  4NF6 B;  4BDL A;  4ELQ A;  1FBD A;  3E9X A;  3C33 A; 
#chains in the Genus database with same CATH homology
 2Z8F A;  2ZYN A;  4XKR A;  3UK4 A;  3ZKL A;  2F78 A;  4ZEC A;  4BDR A;  1LB9 A;  4OTE A;  1LAF E;  1URD A;  4XIG Q;  1POY 1;  3VDF A;  4IO4 A;  2UVH A;  3PD9 A;  1UIV A;  4DCX A;  3HCQ A;  2DP8 A;  2HEU A;  1SW4 A;  1MXZ A;  2HCA A;  2DWI A;  4BDM A;  4PFY A;  2V84 A;  4F19 A;  2XXT A;  5H8F A;  4QSE A;  3UIF A;  2OCU A;  3DEL B;  3Q27 A;  4IO6 A;  3IB2 A;  2GH9 A;  2V93 A;  1NH8 A;  2VGQ A;  3R26 A;  4U1O A;  3C34 A;  5CMC A;  1MQJ A;  4QSD A;  3TEP A;  2GHA A;  5AA2 A;  5HM4 B;  2XXQ A;  2ZMB A;  3UP9 A;  1XOC A;  2OK2 A;  1A99 A;  5AA2 D;  2NWJ A;  2OWT A;  1LAG E;  1UIU A;  2Q8J A;  5IKB A;  3M3F A;  4RXL A;  3IX1 A;  1GVC A;  2H98 A;  4OET A;  4THI A;  2NVU B;  3RQT A;  1SD3 A;  1MXV A;  3FGS A;  4KYS A;  3UGW A;  5TP9 A;  3EHS A;  1P1U A;  3TAJ A;  2PBW A;  1B3H A;  3IL1 B;  5L9O A;  4ZE8 A;  4LA9 A;  3RTW B;  4BDQ A;  2I0C A;  2RC7 A;  3TQW A;  4ESX A;  4LAT A;  3SEU A;  2HZL A;  2QMW A;  2DOJ A;  5JTY B;  1MPC A;  4R6H A;  1LLS A;  1LB8 A;  4FIM A;  3CFZ A;  4KD5 A;  1AOV A;  4YB6 A;  1Z7N E;  1FQB A;  4E0X A;  1PB8 A;  2UYF A;  2ALU A;  4AQ4 A;  4LQ5 A;  1BLF A;  1ELJ A;  2DE3 A;  4X1D A;  3FXU A;  5AA4 A;  3EF7 A;  3Q28 A;  1DTZ A;  3MW0 A;  4FEB A;  3IO4 A;  4F39 A;  5DT6 A;  2P0S A;  2QL3 A;  3OO7 A;  4FE8 A;  4ZZE A;  1FQC A;  4MLV A;  2F97 A;  4MBP A;  5I59 A;  4RK2 A;  2ZYM A;  4OFJ A;  1O63 A;  3QXM A;  4DXB A;  3H4Z A;  3TPA A;  4LP2 B;  3H7M A;  4MF3 A;  1US4 A;  3ILU B;  3U93 A;  3K6W A;  1T0K A;  3DP8 A;  2X7P A;  4JBZ A;  1GV8 A;  4HCW A;  3FD3 A;  4H0W A;  3C35 A;  2VHA A;  4H5G A;  4Q8R A;  4GOT A;  2IEE A;  2HQ0 A;  4DE8 A;  2O7I A;  4KYE A;  3IOW A;  3G3F A;  2ONS A;  1UTB A;  1NNF A;  2O1M A;  3KJ7 A;  4XKP A;  1MY4 A;  5B7D A;  4KHZ E;  4LQ2 A;  3D4C A;  3N6U A;  4F3P A;  3KJT A;  4GF8 A;  1MQD A;  2Y7K A;  2D5W A;  3U94 A;  2RC8 A;  2WKY A;  3MP6 A;  3MWB A;  4HTG A;  1DTG A;  1S50 A;  4RK9 A;  3QK6 A;  3PU5 A;  2YLN A;  3I6V A;  5IAI A;  2ZNT A;  4L17 A;  4NF5 B;  2Q88 A;  1URS A;  2O68 A;  3PPO A;  3TTN A;  1USY H;  1UQW A;  3CIJ A;  3EN3 A;  1LCF A;  1MDP 1;  4E0W A;  1B7U A;  2QS1 A;  5DEX B;  3A09 A;  4EXL A;  5AE4 A;  5B70 A;  3OEK A;  1QKA A;  1DSN A;  3G3K A;  1H3D A;  1DPP A;  4YKI A;  4G2Z A;  1XVY A;  3MC2 A;  2XXV A;  5KDT A;  1RYO A;  3B7D A;  1N7X A;  3G3J A;  3KBR A;  4NMY A;  4KCC A;  1FQA A;  3G3G A;  2E0S A;  3KFM A;  1P1N A;  3N5L A;  4H8I A;  1WOD A;  3VV5 A;  4I62 A;  5FHM A;  1MY0 A;  2V3T A;  3K2D A;  1Y9U A;  4F2O A;  4O3A A;  2O84 X;  3PMW A;  3LSF B;  3PV0 E;  1Z7M E;  2OLB A;  3IB0 A;  1POT A;  1I6A A;  3MBP A;  5H8Q B;  3N6T A;  3PUZ E;  3KG2 A;  4GXS B;  2Z8E A;  2OWS A;  4I1D A;  4U21 A;  1D9V A;  5I2K B;  3C31 A;  3W9V A;  1PDA A;  2ZNU A;  3THI A;  4QFK A;  2G29 A;  2QS3 A;  4NWC A;  1EZ9 A;  2DQV A;  1Y1Z A;  4NF8 B;  3ZS6 A;  4TLM B;  2XX7 A;  2XXH A;  1A54 A;  4XKQ A;  1I6B A;  1DPE A;  1B6H A;  4KQP A;  4ECF A;  2B3B A;  2AL5 A;  1B7H A;  3C9H A;  2XX8 A;  1I69 A;  2ZXT A;  2F6P A;  3O6G A;  2W7Y A;  4G68 A;  3K6U A;  2FYI A;  3VLU A;  1YPN A;  5EYF A;  1NFT A;  5KZT A;  3Q29 A;  4PE5 B;  3T93 B;  2XXP A;  3TOD A;  1URG A;  1N3X A;  1B1X A;  3Q25 A;  4YKK A;  3FVO A;  1PEB A;  3IOT A;  1ATG A;  4FAJ A;  1FQE A;  3CI8 A;  2I3W A;  3Q26 A;  2V25 A;  1HSJ A;  1HSE A;  4IO7 A;  3PGF A;  3T66 A;  1B0H A;  4OER A;  3T9H B;  3U1O A;  5AA2 B;  3IAZ A;  3FV1 A;  5BWJ A;  4F3G A;  2O69 A;  1JET A;  5EHM A;  1CB6 A;  2QPQ A;  1ZKB A;  2XD3 A;  1AH5 A;  3JZJ A;  3K6X A;  4TQU Q;  3MZB A;  5CC2 A;  1AIV A;  5H8N B;  4LZ7 A;  1N84 A;  4PP0 A;  4O3C A;  3QIM A;  4MLQ A;  2A5T B;  4U4S A;  3O28 A;  3E4R A;  2PVU A;  3OO8 A;  2GHB A;  3MVY A;  1QUK A;  4LVQ A;  2E1S A;  1PB7 A;  2Y7R A;  3V8X B;  3R6U A;  4RNS A;  4ZED A;  1NNT A;  3OMB A;  1TT1 A;  3S2V A;  2ZYK A;  1GR2 A;  5KCJ A;  2D21 A;  4MH5 A;  2PMS A;  1PBQ A;  4IO3 A;  4PET A;  3RGY A;  4U2R A;  4R6K A;  3K00 A;  2DYX A;  4FOR A;  3IJO B;  2QS2 A;  5AA4 B;  4F31 B;  3QAX A;  5I2N A;  1IIT A;  1MPD A;  2I6E A;  3T9U A;  1MY1 A;  3SEY A;  5I58 A;  5L8D A;  2H4I A;  3CR9 A;  4YKJ A;  1B4H A;  2I49 A;  1MXW A;  3PMV A;  4JWY A;  2FA7 A;  4FEC A;  1M5E A;  4LON B;  3FVG A;  1VFD A;  1SI0 A;  4U22 A;  3S9M C;  4YMB A;  4G77 A;  4GXA A;  4RPO A;  3TQL A;  3IO6 A;  3SEX A;  1RYX A;  4H1X A;  1Y3P A;  2F34 A;  5K2Y A;  3V89 B;  1SW2 A;  1ZMG A;  3M3L A;  5DTB A;  3FZV A;  4R72 A;  2UXA A;  4NF6 A;  1B4Z A;  5ISU A;  1BIY A;  3ONM A;  3OXN A;  2PT1 A;  2OZZ A;  4GLI A;  3CSB A;  3ECR A;  4G68 C;  3FVK A;  3IJX B;  1MY2 A;  3B6W A;  3IOR A;  4UA8 A;  5ICQ A;  4X1B A;  4JXI A;  2Z8D A;  2ZYO A;  5ELV A;  4IO2 A;  4GD5 A;  4OYV A;  1IZ1 A;  4DXC A;  3S9N C;  4OEU A;  1S9T A;  5I57 B;  4AB6 A;  1AL3 A;  1A7L A;  4EQ7 A;  1IUD A;  2ESN A;  1NKX A;  3VVD A;  4QFP A;  3TTM A;  3JYR A;  3ZSF A;  4HCY A;  4KR5 A;  3MZ9 A;  1PC3 A;  1N76 A;  4JSO A;  5CMK A;  3FJ7 A;  2F7B A;  3TTR A;  3OSR A;  4H6D A;  2UYE A;  1GTK A;  1OMP A;  2UVI A;  4JWX A;  4RY1 A;  3S9L C;  4QFO A;  3H03 A;  4Q0C A;  2GRV A;  1SVX B;  3IK6 B;  1Q1K A;  3GXA A;  3HV1 A;  1HSL A;  1USY E;  1TWY A;  1LFI A;  1MXX A;  1QVS A;  3U92 A;  1NMU A;  1Y3Q A;  4N07 A;  5TPA B;  3DP6 A;  4OEV A;  2ABH A;  5JEI A;  4YU0 A;  4GRK A;  4ISU A;  4NWD A;  5ITO A;  2G93 A;  4OHN A;  4DCY A;  4YZZ A;  4EF1 A;  5AA3 A;  3VLV A;  1S7Y A;  1VE4 A;  4IGT A;  2XXU A;  2Y7I A;  4OZ9 A;  5CBR A;  3TUS A;  4KI0 E;  2NOO A;  2R6G E;  1FTL A;  3RN8 A;  2CZL A;  3RT8 A;  2H25 A;  2VD3 A;  1B3L A;  4JWO A;  5TU0 A;  5FTI A;  3T22 A;  4G8M A;  3K6V A;  3EPE A;  3OEL A;  3DP4 A;  4Q5T A;  5A5X B;  4Q30 B;  4OMB A;  2PT2 A;  4G4P A;  2PYY A;  2H99 A;  1IXG A;  2XD2 A;  1D9Y A;  3K1N A;  3KSJ A;  3VLW A;  5CI5 A;  3SEW A;  4FAT A;  3WAE A;  4QHQ A;  1OQH A;  4ESW A;  3OSQ A;  5L9M A;  4YB5 A;  3O66 A;  3TCG A;  2HXW A;  4FED A;  1N3W A;  1N04 A;  1MH3 A;  4R73 A;  5ICT A;  1FTK A;  4OQO A;  3MVX A;  1A8E A;  1CE2 A;  1QUL A;  3W9W A;  4XKN A;  4RPN A;  1LAH E;  4NE4 A;  3OO6 A;  4U23 A;  3RT6 B;  3CFL A;  3FXR A;  4FJP A;  4OES A;  4ZE9 A;  4G8H A;  4ONY A;  1H44 A;  1VR5 A;  3QUF A;  3VVF A;  1LFG A;  2Q89 A;  3LSL A;  2I0B A;  2Y7W A;  4OEN A;  4C1U A;  3N94 A;  3W15 C;  5I56 B;  3MJN A;  4NF4 B;  1QKB A;  5CBS A;  4XXU A;  4XTC Q;  3TTK A;  1B0L A;  3GBB A;  4KYD A;  3SES A;  1TFD A;  2Y7P A;  3MP8 A;  3BKI B;  1NH7 A;  1B3F A;  1BP5 A;  2RIN A;  4NF5 A;  3HHG A;  3TDJ A;  3TTL A;  1YTV A;  2F8D A;  4ZDM A;  1L5T A;  2REJ A;  1ANF A;  5EHS A;  4R2B A;  1US5 A;  4ELO A;  4DIG A;  1JQF A;  3KOS A;  3LC8 A;  2HAU A;  5DEX A;  4KFQ A;  4U1Z A;  1I6Q A;  3E13 X;  1B7Z A;  2P2A A;  3M3K A;  3OEM A;  1H76 A;  1JEU A;  4WEP A;  1FQF A;  3LBS A;  3UA8 A;  5CM6 A;  4P11 A;  1BTJ A;  1Y4T A;  2HAV A;  2DWH A;  2ONR A;  1QUJ A;  1D3K A;  2DWJ A;  3FJM A;  4OFL A;  4YKP A;  1YAE A;  3VXB A;  3FXQ A;  3MZ1 A;  4DXU A;  4P0I A;  1MY3 A;  1TXF A;  5F1Q A;  4ZS9 A;  3U8Q A;  3CFX A;  2HZK A;  3PPQ A;  4EQ9 A;  1JW1 A;  3GZG A;  5H8F B;  1UTH A;  4YAH X;  1NNP A;  3F11 A;  5JK4 A;  4ZEK A;  2REG A;  3E3K A;  4ELP A;  4AB5 A;  4IO5 A;  1Q35 A;  1AMF A;  3H06 B;  1R1N A;  5H8S A;  3KEI A;  4F29 A;  3L6H A;  1MXY A;  3PUY E;  3PPP A;  5H8Q A;  1FW0 A;  2UVG A;  3TCF A;  3VFJ A;  4DLD A;  1IXH A;  2Q2C A;  2FNC A;  4HS7 A;  3RUM A;  3HO7 A;  5I2K A;  2I4B A;  4RA1 A;  3TFL A;  1Y4C A;  4BDO A;  1JW4 A;  3PUV E;  1D4N A;  3G3H A;  1OIB A;  4HW8 A;  3TZA A;  3C32 A;  2VD2 A;  3KSX A;  4N13 A;  3MP1 A;  4C0R A;  4PFT A;  1ZBM A;  2YJP A;  5TP9 B;  4NF8 A;  1MXU A;  4EDP A;  3TEL A;  1SW5 A;  1B3G A;  5DVI A;  2P1S A;  4QFN A;  3HN0 A;  1OVT A;  4F1U A;  1B32 A;  1B58 A;  1B2H A;  2O7U A;  2F7A A;  4N6P A;  2IA4 A;  2BJJ X;  2Q9T A;  1IIW A;  1NNK A;  2DS9 A;  2F36 A;  2Z23 A;  3ILT B;  5AA1 A;  5K2X A;  5H8H A;  4F3B A;  3UN6 A;  4ND9 A;  3DM0 A;  3SKP A;  2RCB A;  1SQY A;  3O29 A;  4KCD A;  3FJG A;  3K0V A;  4H5F A;  2QJE A;  2Y84 A;  1RKM A;  3T9X B;  3OO9 A;  2QS4 A;  3I5O A;  3VE1 B;  4Z0I A;  1MPB A;  3MQ9 A;  1IXC A;  3HST A;  3LUY A;  1O64 A;  1R9L A;  4BLA A;  1ZU0 A;  3LSX A;  1B52 A;  1JNF A;  2LAO A;  2VP1 A;  4EF2 A;  2O51 A;  4H67 A;  1DOT A;  4WED A;  4ZEF A;  1FCK A;  5I59 B;  1LGB C;  2UVJ A;  1QW0 A;  3O2A A;  4EXK A;  3G3I A;  1B51 A;  3SET A;  2DVC A;  1QUI A;  4GWO A;  3AXF A;  3MUQ A;  1MQH A;  4R9F A;  1OLA A;  4YIC A;  1IQ7 A;  1H45 A;  5DVF A;  4GIZ A;  1M5B A;  4X9T A;  3A3U A;  4OWD A;  4R2F A;  5H8N A;  3QYT A;  3K02 A;  4BDN A;  5CMB A;  4WKM A;  2A5T A;  3PPN A;  1LFH A;  1MRP A;  3OOA A;  2AIX A;  1UTB B;  2F5X A;  2XXI A;  3EHU A;  3BBR A;  3RY3 A;  4QSC A;  3FVN A;  2QSX A;  1IXI A;  3GLB A;  5FHO A;  3FV2 A;  4LZ5 A;  1YCJ A;  3KN3 A;  1TFA A;  4ELR A;  3H6V A;  1B5I A;  4F1Y A;  1ZJL A;  4LZ8 A;  3DLN A;  3K01 A;  1XS5 A;  4ZEB A;  2NXO A;  4NTL A;  3FIR A;  2V3Q A;  5I84 A;  1N0T A;  3CG3 A;  3HHF A;  3H6T A;  3EQ1 A;  3MVZ A;  4KPT A;  1B46 A;  1EZO A;  4QRZ A;  4EQB A;  3S4U A;  4ZEI A;  2F6G A;  1BKA A;  1SYH A;  3BFT A;  2I58 A;  1MQI A;  1MQG A;  2DWA A;  3VXC A;  5KDT B;  1VFE A;  1VSO A;  2DE2 A;  4IY5 A;  4U4X A;  1XVX A;  3IOV A;  1EH3 A;  4RYA A;  1PBP A;  2RC9 A;  3PD8 A;  1WVJ A;  2DVZ A;  3USD A;  3KGC A;  3EHT A;  2F35 A;  1FTM A;  4P0G A;  3MAM A;  5DYH A;  1MG1 A;  2OBG A;  1Y1M A;  2VOZ A;  1IEJ A;  2AYS A;  3KN8 A;  2M8C A;  4R74 A;  1MDQ A;  5LOM A;  4R6Y A;  1M5D A;  3TYH A;  4POW A;  3ODB A;  5JTY A;  3PMX A;  3C36 A;  4R9G A;  2B3F A;  1MM6 A;  3PPR A;  3SEV A;  2RKM A;  3H3G A;  1NL5 A;  3VVE A;  3KN7 A;  1FTJ A;  4OFO A;  1EZP A;  4O3B A;  1FQD A;  3UOR A;  2THI A;  3H6U A;  2F7C A;  2V3U A;  3CG1 A;  2DSF A;  3IR1 A;  4GL8 A;  5I57 A;  5BUU A;  2DXY A;  1OVB A;  3QUJ A;  4PQJ A;  3CSG A;  1P99 A;  1MM7 A;  3IOU A;  4PFW A;  1JEV A;  1B1H A;  1A40 A;  3U72 A;  2I4C A;  4JSD A;  1LAX A;  4LUB A;  2XXX A;  2R9J A;  3FAT A;  3IB1 A;  4JB7 A;  5DVJ A;  1PB9 A;  2D3I A;  5ITP A;  4IGR A;  3K1P A;  4GL0 A;  1ZTY A;  3BFU A;  4I8C A;  4IY6 A;  5L9S A;  1MS7 A;  1LBB A;  3V5A A;  5HBC A;  4H8J A;  2XXY A;  1P1W A;  3A3C A;  3SER A;  4G68 B;  3LR1 A;  5HPQ A;  2I48 A;  3S9E A;  4TLL B;  3G7W A;  3C4M A;  2PX1 A;  1SYI A;  3FAS A;  2ZNS A;  4K3F A;  1OQG A;  3H6W A;  1H43 A;  1JVY A;  1O7T A;  5TPA A;  3RNN A;  3T9V A;  1DMB A;  4R75 A;  1XHY A;  4POX A;  4OVJ A;  2Q2A A;  1UTH B;  1SW1 A;  3QSL A;  4I9D A;  2X7Q A;  2XHD A;  4YB7 A;  3O6H A;  1Y20 A;  1P1O A;  4F2Q A;  2RF1 A;  1LBC A;  2DE4 A;  3RTF B;  3L6G A;  3PUW E;  4EUO A;  4IB2 A;  1B5J A;  2A5S A;  1II5 A;  3I3V A;  2HFB A;  1Y3N A;  4DDD A;  2X26 A;  1R9Q A;  3V83 A;  2NUV A;  1SBP A;  1B3E A;  1MH4 A;  3K1M A;  4F22 A;  5A5X A;  2OJT A;  1JVX A;  1ZLQ A;  2YPN A;  1GGG A;  4F1V A;  2AL4 A;  3K4U A;  1LCT A;  3B6T A;  3P7I A;  3FUZ A;  1J1N A;  3LSW A;  3CRB A;  5CRY A;  2I3V A;  1B5H A;  3PUX E;  2QMX A;  3O9P A;  1M5F A;  2XXW A;  3B6Q A;  1M5C A;  3T96 B;  1F9B A;  2XX9 A;  2CMO A;  4QF9 A;  4MFI A;  3D4G A;  2DXR A;  1LST A;  5M2V A;  4WXJ A;  4H65 A;  3OEN A;  4GVO A;  3O6I A;  4JDF A;  2ONK E;  1N7W A;  1P1Q A;  3MPK A;  4NED A;  3TMG A;  4GFR A;  4F3S A;  4TOZ A;  1R6Z A;  4M4G A;  1XT8 A;  3TCH A;  3RLF E;  5F7V A;  4UAC A;  5KCJ B;  3KZG A;  1FTO A;  3WAF A;  5H8H B;  1QJM A;  4YMA A;  4X48 A;  4DZ1 A;  5CMM A;  4PFU A;  4F18 A;  2KLF A;  2RCA A;  4QFL A;  2B65 A;  1A8F A;  5J1D A;  5I2N B;  5FTH A;  3O97 A;  3ZKK A;  1SDX A;  5I56 A;  1KWH A;  4M1V A;  4OXV A;  4NF4 A;  3SDF A;  2XXR A;  3OD7 A;  3HPI A;  2QRY A;  5I58 B;  3M8U A;  2GFE A;  1A55 A;  4ZZA A;  3N26 A;  2H9B A;  3MVW A;  3RPW A;  4G8N A;  3MPL A;  1EU8 A;  2O6A A;  4GQO A;  1OLC A;  3GBA A;  2H5Y A;  2R71 A;  1ZIU A;  4C1T A;  4Z7E A;  2ANJ A;  1B9J A;  1WDN A;  3TKD A;  1B40 A;  1B05 A;  3R7X A;  1SI1 A;  2O1L A;  3KOT A;  2Z22 A;  3CVG A;  3JV9 A;  4RJZ A;  5FHN A;  1JW5 A;  1XC1 A;  4NF6 B;  4BDL A;  4ELQ A;  3E9X A;  3C33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...