4NF4A

Crystal structure of glun1/glun2a ligand-binding domain in complex with dcka and glutamate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
284
structure length
277
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Competitive Antagonism in NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, receptor
molecule keywords Glutamate receptor ionotropic, NMDA 1
total genus 75
structure length 277
sequence length 284
ec nomenclature
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf4A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf4A02
2I4CA 2VP1A 3C33A 2A5SA 4F3BA 4OYVA 4RY1A 2HAUA 3CIJA 4U22A 5FTHA 1JEUA 4MLQA 1B7ZA 1UTHA 3LSLA 5ELVA 2V3TA 4QF9A 3TZAA 1B3EA 1MXZA 1XS5A 2Q9TA 3V83A 4X1DA 5L9SA 2QSXA 3LUYA 5I57B 2B3BA 1B5HA 4LONB 4R72A 3KFMA 3GXAA 2H4IA 1POY1 3C9HA 2XX9A 3B6WA 2H25A 1LBCA 1QW0A 1B3LA 3FXUA 3HN0A 3IB0A 3SESA 2I3VA 4H8JA 3A3CA 4MBPA 3TTNA 2O6AA 5HM4B 1R1NA 1SI0A 2I0CA 4EUOA 3G3GA 5IKBA 4DCYA 2XX8A 2OK2A 4YKKA 4ZEBA 4ZE8A 4ELOA 4ECFA 1FQFA 1MG1A 1B51A 1XC1A 3W9VA 2UXAA 2V84A 2VHAA 2YJPA 1FQCA 2CMOA 3KEIA 3QIMA 3QSLA 4BDRA 3OO7A 2Z22A 3QYTA 4NF6B 2Q89A 3N6UA 3OSRA 4I8CA 1IZ1A 1ZU0A 4KD5A 3ECRA 2O69A 4ONYA 3UK4A 2R6GE 3KJ7A 5F7VA 3LSWA 4OTEA 4HW8A 5H8NB 2Y7RA 2LAOA 3H03A 2PBWA 3MVZA 4XIGQ 4ZEIA 3TUSA 1LCFA 3SDFA 3CG1A 1A55A 1M5DA 1MPCA 1N04A 2E0SA 2DQVA 2REJA 4C1UA 3V5AA 4DLDA 1B6HA 4H67A 1QKBA 4F1UA 4IO7A 2RC7A 1HSJA 1MY4A 1F9BA 5A5XA 3SETA 1MQHA 4FJPA 1UIUA 5I2KB 2GHAA 2NUVA 3CG3A 3B6QA 3LC8A 3HHGA 3TDJA 1B05A 1JETA 1ZJLA 2I6EA 1JVXA 3GZGA 4O3AA 2Q2AA 4O3CA 4OEVA 1ZLQA 2PX1A 4OERA 4ZS9A 3IOUA 2OCUA 3IL1B 2NOOA 2AL5A 3EN3A 4DXCA 1MRPA 2ONSA 1GV8A 2DSFA 4RYAA 4YKIA 3S4UA 5ICTA 4DXBA 3S9MC 3SERA 3Q28A 1URSA 4HCWA 4RXLA 3UGWA 1JW5A 1LCTA 1T0KA 4WEDA 4XTCQ 1AL3A 1LB9A 4U21A 2GHBA 1MH3A 2DP8A 5L9MA 1FTKA 3OSQA 4GFRA 3VLVA 2BJJX 3QK6A 1Y4TA 4E0WA 3SKPA 3PUYE 1YTVA 3B6TA 3IO6A 4QSDA 1ZIUA 4U23A 3N5LA 2H99A 3RPWA 1NH7A 3HPIA 1SQYA 3TFLA 3QUJA 1MQDA 2R9JA 1FQAA 4R73A 1LFIA 3FGSA 3IJXB 3LBSA 4PFWA 3MVWA 1QUIA 2F34A 3PD9A 1JEVA 3MPLA 2DWIA 3VLWA 1M5BA 1MH4A 1MXYA 4X1BA 5I56A 2F8DA 3H6VA 4YU0A 2AIXA 5I59A 3TKDA 2GFEA 4C0RA 1N7WA 1NL5A 1DMBA 2VGQA 3QXMA 4KFQA 2ZYMA 3U94A 4NWDA 3EPEA 2UVGA 2RF1A 4H5FA 2DYXA 5KZTA 2I49A 3MVXA 1Y1MA 1TFDA 5DYHA 2V3QA 2QS2A 4I62A 1NMUA 4WKMA 3PPRA 4F31B 5AA3A 5ISUA 2CZLA 3FIRA 1IXHA 1XOCA 2RCBA 1MXVA 5DVIA 5FTIA 3CFXA 5KDTB 1OMPA 2HAVA 3DP8A 3OO8A 1BTJA 3TAJA 2XXPA 5H8HB 5AE4A 4NTLA 2QPQA 1EH3A 4F19A 1B4HA 3O66A 4YICA 1IEJA 3MPKA 1WVJA 2REGA 5M2VA 1NH8A 4GRKA 1A8EA 1FQDA 1Q35A 3DLNA 4UA8A 3WAEA 4N07A 2F6GA 3UP9A 1P1UA 1SYIA 3C4MA 3L6GA 1D4NA 4RK9A 4G2ZA 4GLIA 1D9VA 1FCKA 1TT1A 1LB8A 2XX7A 4MLVA 2AL4A 3ODBA 1LAGE 2Z8FA 3PV0E 4GWOA 4G8MA 4XXUA 1UTBB 3K02A 4P0IA 3FJ7A 4XKQA 3TCGA 3VVEA 4RK2A 3U1OA 4HS7A 3GBAA 5H8FB 1B9JA 1II5A 2DVCA 1PBPA 1CE2A 5A5XB 1MM6A 5AA2D 3TPAA 4H8IA 3KN3A 5I59B 3S9LC 4QSCA 1WODA 2Q2CA 5AA4B 3O2AA 1Y9UA 4MH5A 1ATGA 1XT8A 2DE4A 4U4XA 3T22A 1LLSA 1UTBA 1LSTA 1MQGA 4G68C 2ONRA 4ZEDA 1OVBA 3C31A 3H3GA 3HO7A 1SBPA 2RINA 4H0WA 3IB2A 2DXYA 3OEMA 3KZGA 4IGRA 4EXLA 3CRBA 3A3UA 4R6YA 2H5YA 3V89B 2HEUA 3RUMA 3LR1A 3IO4A 4LQ5A 2F7BA 5L8DA 4Z7EA 3K2DA 3K6UA 1M5EA 3ZKLA 2ONKE 2Z23A 1IQ7A 5JK4A 1MDQA 3DP4A 4PFYA 4OWDA 1SW2A 5I58A 3JV9A 1IIWA 1LGBC 1USYH 2THIA 3Q27A 3FVKA 3N94A 4F1VA 3D4GA 1FW0A 2ZXTA 1LAHE 4KI0E 4NF4B 4OFOA 3PPPA 1B1HA 4THIA 4XKPA 4ELRA 1P1NA 1FQEA 3FV1A 3IJOB 3THIA 3MP1A 4BLAA 4DZ1A 2O68A 4JSOA 5CRYA 2XD2A 4FEBA 5H8HA 5I57A 5J1DA 3G3JA 4H65A 1NNPA 3Q26A 1ZMGA 3K1MA 2DWHA 4Z0IA 5FHNA 3UN6A 1B4ZA 3T9HB 3B7DA 1US4A 4G4PA 1MY0A 3O6IA 4L17A 1B46A 2QS4A 1FTJA 4U2RA 3VFJA 4NF4A 3VV5A 3TCHA 3RQTA 2ESNA 1Y3NA 3EHTA 5TPAB 3KN7A 3N26A 4GIZA 2FNCA 2RC9A 3FVOA 1H3DA 3OD7A 5AA2B 3MVYA 3QAXA 1B5IA 2A5TA 1MPDA 5ITPA 4UACA 4K3FA 1VSOA 2GRVA 2ANJA 1IXCA 1H45A 2ZYOA 3IX1A 4ZEKA 2PVUA 3D4CA 3VXBA 4F2QA 1ELJA 1Q1KA 2VOZA 4EQ7A 2VD3A 2Y7PA 2O51A 3F11A 1DPPA 1B1XA 2O1LA 2XXIA 1Y1ZA 1GVCA 3T9VA 3VVFA 2H98A 1USYE 4QHQA 4BDNA 4JWYA 1BP5A 2XXYA 3G3KA 4OHNA 3W9WA 4ELPA 1EZ9A 3H4ZA 3T66A 2ZYKA 4FAJA 2RKMA 2P0SA 3H6TA 3K6XA 3MZBA 4F1YA 1P1QA 4IO6A 2UYFA 2F78A 4KQPA 1SW5A 2QS1A 4PFUA 2O7IA 4R9FA 3FXQA 4OXVA 3BBRA 2B65A 4KYEA 4QFKA 4LVQA 3HHFA 4FECA 1J1NA 4R2BA 5I2KA 5ITOA 3PUWE 3K00A 1FTMA 5DT6A 5DEXB 2ZMBA 4FEDA 1A8FA 1NFTA 4Q0CA 4F3PA 5AA4A 4ZZEA 1GR2A 2ZNTA 4NF5B 4F39A 1B3FA 4MFIA 3IORA 1BKAA 2XD3A 3E13X 4ZE9A 2KLFA 1VE4A 1DSNA 3SEYA 2UVHA 1SW4A 4BDOA 4GD5A 5CMMA 1MXWA 1SW1A 1P99A 4GL8A 3SEXA 3TTKA 4MF3A 2XXRA 5H8FA 3IOWA 3OXNA 2OZZA 1A99A 2XXWA 4GOTA 4OESA 1MS7A 2X7PA 4RPNA 3KN8A 4ZDMA 4QSEA 2V3UA 1OLAA 4KCCA 4EF2A 3MBPA 4F29A 1N76A 1LAFE 4BDMA 1PB7A 2YLNA 3OEKA 4G77A 3RLFE 2RCAA 2ZYNA 2Y84A 4JWOA 4OFLA 4QFLA 5FHOA 4R6KA 2XXQA 3I5OA 3O29A 1B58A 1AMFA 1YAEA 4EXKA 3C34A 3AXFA 1EU8A 2G29A 3C35A 3C32A 1S50A 3FD3A 3RNNA 4LZ8A 4NWCA 4OENA 4BDQA 4G8HA 4YKJA 2F97A 2DS9A 3TTLA 1N3XA 1B7UA 1H43A 3OO9A 1B3HA 5KCJA 3PPNA 3MZ1A 3R7XA 1SDXA 3S9EA 3EHUA 3O6HA 4JSDA 4YAHX 1R9LA 3FVNA 4ND9A 4FATA 1TFAA 4R6HA 3V8XB 4R9GA 2XHDA 3T9XB 5B70A 3KBRA 4LUBA 3FZVA 4GXSB 4P0GA 1MPBA 4EF1A 2PYYA 2XXHA 3TELA 3IK6B 1A40A 3KSXA 4PQJA 2QL3A 2HZLA 1DTZA 4QRZA 1QJMA 3BFUA 5CI5A 1ZKBA 4ESXA 3G3IA 4NF8A 1N7XA 2OWTA 2XXVA 3PMXA 3SEUA 3T9UA 3U92A 4Q8RA 1O63A 4KYDA 2I4BA 5H8SA 3OENA 1ZTYA 1LBBA 3N6TA 3PGFA 4XKRA 1BLFA 3E3KA 4POWA 5TPAA 3H6WA 5AA2A 1B52A 3BFTA 1B3GA 4RNSA 3BKIB 4IO3A 3KOSA 1AIVA 2F7AA 4H5GA 3FV2A 3PPQA 4IY6A 4LATA 4WEPA 3Q29A 1Y3PA 4QFNA 3VLUA 3EF7A 2DE3A 2DE2A 3IR1A 3K1NA 4LZ5A 1NNTA 1HSEA 1SD3A 2GH9A 1RKMA 3U93A 1MY3A 1VFDA 3FXRA 3MC2A 2Q88A 2F36A 1JW1A 3PU5A 4FORA 4H1XA 4PE5B 3OELA 3R6UA 5DTBA 2HFBA 2QMWA 4X48A 3OMBA 4DDDA 2WKYA 3ILTB 5JTYB 1LAXA 3I3VA 2PT1A 1PC3A 3OOAA 5FHMA 3VDFA 3RTFB 3TCFA 1M5FA 3GLBA 5CC2A 3TTRA 4QFPA 3O9PA 3ONMA 1QUKA 2Z8DA 3K0VA 4AQ4A 1R6ZA 4KYSA 4FIMA 1JW4A 1Y3QA 2ZNUA 2H9BA 3RGYA 3DM0A 1SYHA 4OMBA 2AYSA 4I9DA 1S7YA 3H7MA 3CFZA 4LZ7A 4F18A 2UYEA 4OQOA 2NVUB 2I58A 5I56B 1MQIA 1O7TA 3L6HA 4FE8A 4M4GA 3HV1A 5AA1A 4EQ9A 3FJMA 1OIBA 4PFTA 4P11A 2NWJA 1Y20A 5H8QB 4ZEFA 1VR5A 1B7HA 1AH5A 2VD2A 3K6VA 3LSXA 4IO4A 5K2XA 3SEVA 4F22A 1XVYA 1EZOA 1IUDA 2E1SA 1PDAA 2D3IA 2X26A 2QRYA 5EHMA 3UA8A 2ABHA 5TU0A 4DIGA 5EHSA 1MY2A 2Y7WA 4G8NA 4DXUA 4RJZA 1B0HA 4KR5A 5ICQA 2HZKA 3MJNA 5L9OA 1MQJA 3VXCA 1URDA 1S9TA 3G7WA 1PEBA 3KGCA 1IXIA 5TP9B 1P1OA 1KWHA 4JDFA 1FTLA 3CSGA 4GVOA 1JVYA 3TQWA 3G3FA 5I2NA 4GXAA 4R74A 3RT8A 1VFEA 4F2OA 4ZECA 3C36A 1CB6A 1MXXA 4X9TA 4ELQA 1PB9A 4TLMB 2I0BA 4U1ZA 3RT6B 4NE4A 3S2VA 3U8QA 1ANFA 3H6UA 3TQLA 2DOJA 3PPOA 4BDLA 1QULA 1NKXA 3I6VA 1US5A 3O28A 3MAMA 4JB7A 3LSFB 1D9YA 1DPEA 3TODA 1I6BA 4DCXA 4EDPA 2Y7IA 3P7IA 4GL0A 2A5TB 5I2NB 2XXUA 1WDNA 2ZNSA 3KSJA 3OO6A 4IO2A 3CSBA 4OETA 5CMKA 1AOVA 4DE8A 4POXA 4EQBA 3TMGA 3UIFA 2IA4A 3MP6A 4RA1A 1OQHA 3PMWA 1YCJA 5DEXA 3G3HA 2QJEA 1NNFA 2DVZA 2NXOA 3H06B 2OWSA 1URGA 3K6WA 3M3KA 4NMYA 1I6QA 1IITA 1OVTA 1OLCA 3RN8A 1N84A 3TYHA 2OBGA 4R75A 4M1VA 5JTYA 2HXWA 1YPNA 2O1MA 1DTGA 1H44A 2UVJA 4LP2B 5DVFA 5CBRA 4IB2A 2D21A 1QVSA 4HTGA 1I6AA 1FQBA 4ISUA 2O84X 4G68B 1UIVA 3FUZA 1M5CA 4N13A 4YZZA 4HCYA 2W7YA 4TOZA 1I69A 3T96B 3ILUB 4WXJA 3E4RA 1B0LA 1PBQA 2X7QA 1QUJA 4Q5TA 1L5TA 4JBZA 4LA9A 3QUFA 4O3BA 4AB5A 1DOTA 1O64A 2G93A 3Q25A 5CBSA 2I3WA 5K2YA 3U72A 2DXRA 3HSTA 3CR9A 3O97A 3O6GA 3R26A 3K1PA 3ZS6A 1GTKA 2FA7A 1HSLA 4IO5A 4ESWA 2M8CA 4TLLB 2Q8JA 3A09A 5F1QA 4F3GA 4YB7A 1B32A 3CI8A 2F35A 3EHSA 1R9QA 1SI1A 2RC8A 3MQ9A 3MUQA 4KCDA 4GF8A 4N6PA 4NF5A 5BWJA 3TEPA 1UTHB 3KJTA 4U1OA 1A54A 1Z7NE 2PT2A 1Z7ME 2IEEA 3JYRA 4R2FA 5LOMA 3IOTA 5TP9A 1EZPA 2DWAA 1XVXA 4KHZE 3K4UA 3DELB 1IXGA 4OVJA 5H8QA 5CM6A 3EQ1A 1MY1A 4TQUQ 3PUZE 5HPQA 2R71A 2UVIA 3JZJA 4NF6A 1RYOA 1QKAA 1RYXA 1B2HA 1MDP1 2OJTA 3KG2A 4XKNA 3RY3A 3PD8A 4NF8B 3WAFA 3ZKKA 4PP0A 5B7DA 1A7LA 3S9NC 1POTA 1XHYA 2P1SA 1ZBMA 1B40A 2Y7KA 3CFLA 3CVGA 3MW0A 4I1DA 4IY5A 3RTWB 1GGGA 1D3KA 1SVXB 2HQ0A 2PMSA 4OZ9A 1TXFA 4U4SA 4LQ2A 3HCQA 3GBBA 4JWXA 4KPTA 5HBCA 3SEWA 5IAIA 1UQWA 5KCJB 2DWJA 3PUVE 4YKPA 2F7CA 1B5JA 5JEIA 3VVDA 3IB1A 4C1TA 2F6PA 1P1WA 5I84A 5KDTA 2I48A 3E9XA 2V25A 2ALUA 1MM7A 4YB5A 3VE1B 5BUUA 2D5WA 1JQFA 2Z8EA 2FYIA 3MZ9A 1JNFA 3FVGA 4IGTA 4F3SA 1NNKA 4OFJA 1N3WA 1LFHA 3FJGA 2QS3A 2O7UA 2HCAA 5CMBA 3PMVA 4GQOA 4RPOA 2XXTA 3DP6A 3FATA 3IAZA 1MXUA 3M3FA 3PUXE 4AB6A 4ZZAA 3MWBA 4E0XA 4YMAA 4YB6A 1LFGA 3M3LA 2P2AA 2YPNA 3FASA 5H8NA 1BIYA 3UORA 3ZSFA 5I58B 4QFOA 1Y4CA 4H6DA 1OQGA 3KOTA 1H76A 4Q30B 3W15C 5EYFA 1TWYA 5CMCA 3K01A 3IOVA 3M8UA 3MP8A 4JXIA 3TTMA 3USDA 4YMBA 4PETA 2OLBA 2QMXA 4OEUA 5DVJA 1FTOA 4G68A 1N0TA 2F5XA 3T93B 2V93A 1PB8A 2B3FA 2XXXA 4NEDA
chains in the Genus database with same CATH superfamily
2I4CA 1KZ8A 1UTHA 2VPOA 5ELVA 5J16A 1B3EA 1MXZA 3V83A 4X1DA 2QSXA 3LUYA 2B3BA 4GWUA 4LONB 2FIXA 3KFMA 2XX9A 2H25A 4MBPA 3T0JA 5HM4B 5IKBA 4GWYA 4MIJA 1B51A 2UXAA 2V84A 3OO7A 3QYTA 3N6UA 3OSRA 1ZU0A 2O69A 2Y7RA 3H03A 3CG1A 1N04A 4DLDA 2REJA 4H67A 4F1UA 3SZPA 2NUVA 3B6QA 1B05A 1JETA 4P1EA 1JVXA 3SKPA 1ZLQA 2CZKA 2PX1A 2OCUA 1FRPA 2DSFA 2CEXA 3Q28A 4RXLA 3UGWA 3IFCA 3VLVA 1MH3A 1Y4TA 5LTCA 1YTVA 3B6TA 3B8BA 4U23A 3N5LA 3TFLA 4HE2A 1FQAA 1LFIA 4HXVA 3MVWA 2WBDA 2F34A 1RDYA 2DWIA 2F3DA 4X1BA 1MXYA 3TKDA 4C0RA 1DMBA 4KFQA 3U94A 4NWDA 2UVGA 1VDWA 1NMUA 5ISUA 1FBFA 1IXHA 1XOCA 2RCBA 1MXVA 5KDTB 1EYJA 1OMPA 2HAVA 3OO8A 2XXPA 2QPQA 4YICA 3NOHA 4PBHA 4GRKA 3WAEA 3RPLB 2WYPA 1D9VA 1FCKA 5A5LA 3PV0E 4XXUA 5FBPA 3K02A 3FJ7A 4GWZA 4XKQA 4RK2A 4GX6A 1MM6A 3TPAA 4H8IA 3KN3A 1LBZA 3S9LC 5AA4B 1KA1A 1LLSA 1UTBA 4ZEDA 3IB2A 2DXYA 3KZGA 4IGRA 3A3UA 1LBWA 2H5YA 1EYIA 3V89B 2HEUA 3RUMA 3LR1A 4Z7EA 5L8DA 4P8BA 1M5EA 1IIWA 4F1VA 3D4GA 1FW0A 2ZXTA 4OFOA 4THIA 4XKPA 1P1NA 3IJOB 2O68A 5CRYA 5I57A 1B4ZA 3D1RA 5IM2A 3EHTA 4X04A 3FVOA 2A5TA 4K3FA 1VSOA 2ANJA 2ZYOA 1LEVA 2Y7PA 1DPPA 1B1XA 2H98A 1USYE 3G3KA 5EQAA 4FAJA 2P0SA 3H6TA 2UYFA 4KQPA 2QS1A 4GWWA 3FXQA 4OXVA 3BBRA 4R2BA 3PUWE 3K00A 2ZMBA 4FEDA 1A8FA 2P3VA 4F3PA 4Q0CA 4F39A 1B3FA 1DSNA 5CMMA 1MXWA 1SW1A 1P99A 3SEXA 2B4LA 4I3YA 5H8FA 3E78A 2XXWA 2V3UA 4KCCA 4O94A 1N76A 2YLNA 1SPIA 4G77A 2ZYNA 2Y84A 4OFLA 5EYGA 4QFLA 5FHOA 2XXQA 3I5OA 1AMFA 4EXKA 2G29A 3C32A 4OENA 4G8HA 2F97A 1N3XA 1B7UA 3OO9A 1B3HA 3PPNA 3GYYA 4O8MA 4YAHX 1KA0A 4R6HA 3T9XB 3KBRA 4P0GA 4EF1A 4PQJA 2QL3A 1QJMA 1ZKBA 3G3IA 3T9UA 3PMXA 4Q8RA 4KYDA 2I4BA 5H8SA 2XA5A 1CNQA 1AIVA 4IO3A 3CHGA 3Q29A 4QFNA 3EF7A 4O7IA 3K1NA 1SD3A 1RKMA 2CZHA 4JVCA 4FORA 4N15A 3R6UA 5DTBA 2HFBA 2QMWA 1LAXA 1PC3A 3OOAA 3RTFB 1M5FA 3FXBA 2ZNUA 3DM0A 3H7MA 3CFZA 2UYEA 4OQOA 2NVUB 5I56B 4HE1A 4O7MA 4EQ9A 4ZEFA 5H8QB 4F22A 1XVYA 4N6DA 1EZOA 2ABHA 5TU0A 4G8NA 4DXUA 4RJZA 1B0HA 5L9OA 1S9TA 1PEBA 4QBAA 1KWHA 2WEFA 2XWKA 5I2NA 3G3FA 4R74A 3RT8A 4F2OA 4ZECA 4X9TA 2I0BA 3RT6B 1QULA 1NKXA 2Y7IA 3P7IA 4GL0A 3OO6A 3CSBA 4EQBA 2VPNA 1OQHA 3H06B 1OVTA 3RN8A 1H44A 2UVJA 2D21A 1FQBA 2O84X 4HCYA 1I69A 1QUJA 2HPGA 4O3BA 2G93A 2DXRA 1GTKA 2FA7A 4ESWA 2M8CA 4YB7A 3CI8A 3EHSA 1R9QA 1SI1A 2RC8A 3MUQA 4GF8A 4P47A 3IOTA 5TP9A 4KHZE 1IXGA 3PUZE 2R71A 2UVIA 1FPFA 1RYXA 1B2HA 2OJTA 3PD8A 3WAFA 2QFLA 3CFLA 1ZBMA 1B40A 4I1DA 5IZ1A 3RTWB 3QMFA 4PAIA 4JWXA 5IAIA 4AS4A 1UQWA 1B5JA 3IB1A 2V25A 5BUUA 2FYIA 2V4CA 2O7UA 4RPOA 4AB6A 3PUXE 4P9KA 2FBPA 2P2AA 5I58B 1BIYA 1Y4CA 4PTKA 4H6DA 5EYFA 1TWYA 5CMCA 3MP8A 3TUSA 3USDA 2QMXA 4G68A 2XXXA 4NEDA 3S9NC 5IGAA 3C33A 4F3BA 4PFIA 3MYUA 4OYVA 3CIJA 4U22A 3LSLA 2HXRA 4NGUA 2QVVA 4R72A 3GXAA 3C9HA 1POY1 1LBCA 3HN0A 3FXUA 3SESA 3A3CA 4DI3D 2O6AA 1R1NA 4EUOA 2L5VA 2XX8A 1FQFA 3QIMA 1FQCA 2CMOA 2Q89A 3UK4A 1IZ1A 4KD5A 5F7VA 4XIGQ 4IO7A 2RC7A 1HSJA 1MY4A 1F9BA 4I3EA 1NV5A 4NHBA 1UIUA 5I2KB 3KC1A 3BIGA 4OVQA 3TDJA 2I6EA 1ZJLA 4O3AA 4O3CA 3BIHA 3IL1B 2NOOA 2AL5A 1IMCA 2ONSA 2R8TA 3S4UA 4YKIA 5ICTA 4HCWA 4GBWA 1DCUA 1T0KA 4WEDA 1AL3A 2GHBA 1FTKA 4PAFA 3PUYE 4QSDA 3QUJA 2R9JA 4R73A 4PFWA 1QUIA 3PD9A 2XWIA 4YU0A 2AIXA 1N7WA 2FIEA 2VGQA 3QXMA 4N91A 2QVUA 2RF1A 2F3BA 3MVXA 1TFDA 3PPRA 1YZ0A 5FTIA 4MNPA 3TAJA 1LBXA 4NTLA 1NH8A 1K9YA 1A8EA 1Q35A 4P3LA 4UA8A 3UP9A 3L6GA 1D4NA 1TT1A 3ODBA 4GWOA 4G8MA 1UTBB 4PC9A 3VVEA 3TCGA 4HS7A 5H8FB 1PBPA 2Q2CA 5EQ8A 3O2AA 1Y9UA 1ATGA 4G68C 1LSTA 3C31A 1FBCA 3HO7A 3CRBA 4PF6A 3IO4A 2F7BA 3K2DA 3ROJA 5L9SA 2Z23A 5I58A 1USYH 1LAHE 4KI0E 1B1HA 4PDDA 4ELRA 1FQEA 3FV1A 3MP1A 4JSOA 5J1DA 3Q26A 3K1MA 3RYDA 4L17A 1MY0A 2CEYA 2QS4A 4U2RA 3TCHA 1Y3NA 2RC9A 3OD7A 5AA2B 3QAXA 3IX1A 2VD3A 1Y1ZA 3T9VA 2XXYA 3W9WA 1EZ9A 2RKMA 3K6XA 4IO6A 1SW5A 5F24A 4QFKA 1DBZA 5IZZA 5DEXB 1GR2A 2ZNTA 4MFIA 1BKAA 4ZE9A 2KLFA 4MMPA 3SEYA 2UVHA 1YYZA 2XXRA 3IOWA 1A99A 1MS7A 3KN8A 5I7IA 3MBPA 4PE3A 4F29A 2RCAA 4JWOA 4PBQA 3RNNA 1S50A 4LZ8A 2WYKA 4NWCA 2ZZWA 4YKJA 2DS9A 3R7XA 1AWBA 4JSDA 4ND9A 1Q9DA 1TFAA 4GXSB 3TELA 3IK6B 1DTZA 3BFUA 5CI5A 2OWTA 3U92A 1O63A 1LBBA 3N6TA 1BLFA 2Q74A 1B3GA 4RNSA 4PFBA 1RDZA 4LATA 4WEPA 1G0HA 3VLUA 2DE3A 3U93A 5IZ3B 3IR1A 4XF5A 1NV1A 4H1XA 3FXRA 3PU5A 4PE5B 4FATA 3OMBA 5JTYB 3I3VA 3VDFA 5CC2A 2Z8DA 4AQ4A 4FIMA 3T1BA 4OMBA 4LZ7A 4F18A 3A29A 2I58A 1MQIA 1O7TA 3HV1A 3FJMA 5K2XA 1VR5A 2VD2A 1AH5A 3LSXA 4G61A 4N4UA 4IO4A 4XFEA 5ET5A 2E1SA 2D3IA 2X26A 1K9ZA 2QRYA 5EHMA 5EHSA 1MY2A 3KBZA 1IXIA 4JDFA 3CSGA 4GVOA 1JVYA 1VFEA 1MXXA 4N17A 4NE4A 1IMEA 3U8QA 1ANFA 3H6UA 4BDLA 3MAMA 1I6BA 1FTAA 4IO2A 3TMGA 2IA4A 1D9QA 3MP6A 4RA1A 2QJEA 2NXOA 3K6WA 1OLCA 1N84A 4R75A 2O1MA 4N8YA 4PF8A 5CBRA 2FVZA 4HTGA 2KR0A 4G68B 3T96B 3ILUB 4MX6A 1B0LA 1PBQA 2X7QA 4Q5TA 1L5TA 4JBZA 2Y5LA 3QUFA 2I3WA 3CR9A 3O97A 2XXKA 4TLLB 1XI6A 2Q8JA 4F3GA 1B32A 4KCDA 4NF5A 5I3SA 3TEPA 3KJTA 4U1OA 1A54A 3JYRA 2IEEA 5H8QA 1FPGA 1MY1A 4TQUQ 1EYKA 4NF6A 1QKAA 4XKNA 4NF8B 4KXPA 3RPLA 4PP0A 5B7DA 1XHYA 5LDZA 2PMSA 4OZ9A 3SEWA 4LQ2A 3HCQA 4KPTA 4GWXA 2DWJA 3IFAA 3ISPA 5I84A 4DI4B 5KDTA 3E9XA 3VE1B 2D5WA 1JQFA 1NV0A 3MZ9A 1NNKA 1LFHA 3FJGA 3PMVA 3DP6A 3MWBA 2YPNA 3FASA 5H8NA 3ZSFA 1OQGA 4Q30B 4MNCA 4JXIA 4YMBA 4GX4A 2V93A 2VP1A 4MLQA 4OANA 1B7ZA 3TZAA 2V3TA 2Q9TA 4FBPA 5I57B 2QVRA 1QW0A 1B3LA 3IB0A 2I3VA 5ET6A 3TTNA 1SI0A 4AS5A 3G3GA 4DCYA 4ZEBA 4ZE8A 4ELOA 4MEVA 4ECFA 1MG1A 3W9VA 4BDRA 3QSLA 4PFRA 4NF6B 1INPA 1FPIA 1RDXA 5H8NB 2LAOA 3MVZA 1LCFA 2E0SA 1M5DA 1MPCA 3V5AA 1QKBA 5A5XA 3SETA 2GHAA 3LC8A 3HHGA 3GZGA 2Q2AA 4ZS9A 3EN3A 1MRPA 2PFZA 4RYAA 4DXBA 3S9MC 1JW5A 1LB9A 2DP8A 4GFRA 4I40A 2BJJX 4OVPA 4E0WA 1NUZA 3IO6A 1NH7A 1SQYA 4N81A 1MQDA 3FGSA 1JEVA 2PFYA 2XWVA 1M5BA 1MH4A 4PGNA 2GFEA 1NL5A 2ZYMA 4H5FA 2DYXA 5KZTA 5AA3A 3FIRA 5DVIA 3CFXA 4OVSA 1BTJA 5H8HB 4F19A 1B4HA 1IEJA 1WVJA 1P1UA 3C4MA 2XX7A 1LB8A 2AL4A 2Z8FA 4GBVA 4P0IA 3U1OA 1II5A 1NI9A 5AA2D 4QSCA 1XT8A 1OVBA 1SBPA 2RINA 4H0WA 3OEMA 4EXLA 3ZKLA 5JK4A 2ONKE 1MDQA 1SW2A 3FVKA 4XEQA 4NF4B 3PPPA 4DZ1A 5H8HA 4FEBA 1FPLA 4H65A 1NNPA 4Z0IA 1JP4A 3T9HB 3B7DA 1FTJA 3VFJA 3KN7A 3N26A 4GIZA 2FNCA 1H3DA 3MVYA 1B5IA 4UACA 1H45A 4ZEKA 3VXBA 2PVUA 3D4CA 1ELJA 1Q1KA 2O51A 3F11A 2O1LA 4QHQA 4ELPA 4JWYA 4PDHA 3H4ZA 3MZBA 4F1YA 1P1QA 4PFUA 4MAGA 4R9FA 2O7IA 2B65A 4KYEA 4LVQA 1J1NA 5I2KA 4OA4A 4ZZEA 5AA4A 4NF5B 3HFUA 3E13X 1VE4A 1SW4A 1IMFA 4GD5A 2GQ1A 4MF3A 3OXNA 2OZZA 4GOTA 4OESA 1PB7A 3RLFE 4R6KA 1YAEA 4NF0A 3FD3A 1H43A 5KCJA 3MZ1A 1SDXA 3EHUA 4P56A 3V8XB 5B70A 4LUBA 4H46A 3KSXA 2JJKA 2HZLA 4QRZA 4ESXA 4NF8A 1FBDA 1ZTYA 4XKRA 5TPAA 3E3KA 1B52A 3KOSA 4IY6A 1Y3PA 1NV2A 4M4GA 4LZ5A 5EQ9A 2GH9A 1VFDA 3MC2A 3SEUA 2Q88A 1JW1A 4DDDA 3OELA 2PT1A 3TCFA 3TTRA 4QFPA 3ONMA 1QUKA 1R6ZA 4KYSA 1JW4A 1Y3QA 1IMBA 4JVDA 1SYHA 2AYSA 4I9DA 4FE8A 5AA1A 2BJIA 1OIBA 4P11A 2NWJA 1Y20A 1B7HA 4NG7A 1IUDA 3UA8A 4DIGA 2B4MA 5ICQA 3MJNA 1MQJA 3G7WA 3KGCA 5TP9B 2FHYA 3TQWA 4GXAA 3U65A 4ELQA 1PB9A 4U1ZA 3S2VA 3TQLA 2DOJA 3I6VA 4JB7A 1FBPA 3LSFB 1D9YA 4DCXA 2A5TB 4X8RA 2XXUA 1NV4A 3KSJA 1AOVA 4POXA 3UIFA 3G3HA 2DVZA 3M3KA 1URGA 1I6QA 2OBGA 4M1VA 1DTGA 4IB2A 1I6AA 1UIVA 1M5CA 3PTYA 2W7YA 4WXJA 3E4RA 1DOTA 1O64A 3Q25A 5CBSA 3MSTA 5K2YA 3HSTA 3ZS6A 3K1PA 1G0IA 3A09A 5F1QA 2F35A 4N6PA 5BWJA 1Z7NE 4GX3A 1DK4A 4R2FA 3K4UA 4OVJA 5ESYA 5HPQA 1RYOA 3RY3A 2VT5A 3ZKKA 1A7LA 1POTA 2P1SA 3CVGA 3MW0A 4IY5A 1GGGA 2HQ0A 1SVXB 1TXFA 4U4SA 5KCJB 3PUVE 4YKPA 3VVDA 1P1WA 5EQ7A 1MM7A 4YB5A 1FSAA 4F3SA 1JNFA 3FVGA 4OFJA 1N3WA 5CMBA 4MNIA 2XXTA 3FATA 3IAZA 1MXUA 1LFGA 4QFOA 3KOTA 5ET7A 3IOVA 3TTMA 4OEUA 1FTOA 1N0TA 1PB8A 3VXCA 1QGXA 2DDKA 2A5SA 2Y5KA 4RY1A 4IR8A 2HAUA 5FTHA 1JEUA 4PCDA 4QF9A 1XS5A 4JVIA 1B5HA 2H4IA 3B6WA 4H8JA 1FBGA 2I0CA 4NN3A 1FPJA 2OK2A 4YKKA 1XC1A 2VHAA 2YJPA 3KEIA 1NUYA 2Z22A 4I8CA 1NV7A 4ONYA 3ECRA 5IZ3A 2R6GE 3KJ7A 3LSWA 4OTEA 4HW8A 2PBWA 4ZEIA 3SDFA 2PCRA 1A55A 4C1UA 2DQVA 1B6HA 1MQHA 4FJPA 3CG3A 4QXDA 3KC0A 4OERA 4OEVA 3IOUA 4DXCA 1GV8A 3SERA 1URSA 1LCTA 2P3NA 4XTCQ 4U21A 5L9MA 3OSQA 3QK6A 1ZIUA 2H99A 3RPWA 3HPIA 3IJXB 3LBSA 3B50A 3MPLA 3VLWA 5I56A 2F8DA 3H6VA 2MKZA 2OX3A 3EPEA 2I49A 1Y1MA 1FPEA 5DYHA 1LBVA 2V3QA 2QS2A 4I62A 4WKMA 4F31B 2CZLA 3DP8A 5AE4A 1EH3A 3O66A 3MPKA 2REGA 1FQDA 3DLNA 4MJOA 4N07A 2F6GA 1SYIA 4RK9A 4G2ZA 4GLIA 4MLVA 1LAGE 5EYHA 3GBAA 1B9JA 2DVCA 1CE2A 5A5XB 4MHFA 5I59B 1WODA 2HHMA 5T3JA 4MH5A 2DE4A 4U4XA 3T22A 1MQGA 2ONRA 3H3GA 5M2VA 4R6YA 4LQ5A 1FBEA 4NAPA 3K6UA 1IQ7A 1BK4A 3DP4A 4PFYA 4OWDA 3JV9A 1LGBC 2THIA 3Q27A 3N94A 4OVTA 3THIA 4BLAA 2XD2A 3G3JA 1ZMGA 5FHNA 2DWHA 3UN6A 1US4A 4G4PA 3O6IA 1B46A 4N6KA 3VV5A 4NF4A 1NUWA 3RQTA 2ESNA 5TPAB 1MPDA 5ITPA 2GRVA 1IXCA 4F2QA 1NV6A 2VOZA 4EQ7A 2XXIA 1GVCA 3VVFA 4BDNA 1BP5A 4OHNA 3T66A 2ZYKA 4PGPA 2CZIA 2F78A 3HHFA 4FECA 5ITOA 1FTMA 5DT6A 1NFTA 3IORA 2XD3A 4BDOA 1FPBA 4GL8A 3TTKA 4GWSA 4ZDMA 2X7PA 4RPNA 4QSEA 4EF2A 1OLAA 1LAFE 4N8GA 4BDMA 3OEKA 3O29A 1B58A 3C34A 3AXFA 1EU8A 3C35A 4BDQA 3TTLA 2ZZVA 2ZZXA 3S9EA 3O6HA 1R9LA 3FVNA 4R9GA 2XHDA 3FBPA 3FZVA 1MPBA 2PYYA 2XXHA 1A40A 1N7XA 2XXVA 3OENA 3PGFA 4POWA 3H6WA 5AA2A 3BFTA 5I5PA 1IMAA 3BKIB 2F7AA 4H5GA 3FV2A 3PPQA 1LBYA 2DE2A 5I59A 1NNTA 1HSEA 1MY3A 2F36A 3E79A 4X48A 2WKYA 3ILTB 5FHMA 3GLBA 1FPKA 3O9PA 1FJ6A 3K0VA 3RGYA 2H9BA 1S7YA 3L6HA 4PFTA 3SEVA 1FBHA 3K6VA 1FPDA 1PDAA 2Y7WA 4KR5A 2HZKA 1URDA 4MCOA 1P1OA 1FTLA 2XWOA 3C36A 1CB6A 4TLMB 4PAKA 4HE0A 3PPOA 1US5A 3O28A 1DPEA 3TODA 4EDPA 5I2NB 1WDNA 2ZNSA 5ET8A 4OETA 5CMKA 4DE8A 4LN5A 4NX1A 3PMWA 1YCJA 5DEXA 1NNFA 2OWSA 4NMYA 1IITA 3TYHA 5DW8A 5JTYA 2HXWA 1YPNA 4LP2B 5DVFA 1QVSA 4ISUA 3FUZA 4N13A 4YZZA 4TOZA 2KQZA 3LUZA 4LA9A 1FJ9A 2WBBA 4AB5A 2WX9A 4OVRA 3U72A 3O6GA 3R26A 1HSLA 4IO5A 3MQ9A 3EKIA 1UTHB 2PT2A 1Z7ME 5LOMA 4UABA 1EZPA 2DWAA 1XVXA 3DELB 2OWZA 3EQ1A 3JZJA 1MDP1 3KG2A 4P1LA 2Q8MA 2Y7KA 1D3KA 4NQ8A 3GBBA 1NV3A 5HBCA 2F7CA 5JEIA 3LV0A 4C1TA 2F6PA 2I48A 2ALUA 1IMDA 2Z8EA 4IGTA 2QS3A 1NUXA 2HCAA 4H45A 4GQOA 3M3FA 4ZZAA 4E0XA 4YMAA 4YB6A 3M3LA 3UORA 1H76A 1YXIA 3W15C 3K01A 3M8UA 4PETA 2OLBA 5DVJA 2F5XA 3T93B 2B3FA 5CM6A
chains in the Genus database with same CATH topology
2I4CA 2VP1A 3C33A 2A5SA 4F3BA 4OYVA 4RY1A 2HAUA 3CIJA 4U22A 5FTHA 1JEUA 4MLQA 1B7ZA 1UTHA 3LSLA 5ELVA 2V3TA 4QF9A 3TZAA 1B3EA 1MXZA 1XS5A 2Q9TA 3V83A 4X1DA 5L9SA 2QSXA 3LUYA 5I57B 2B3BA 1B5HA 4LONB 4R72A 3KFMA 3GXAA 2H4IA 1POY1 3C9HA 2XX9A 3B6WA 2H25A 1LBCA 1QW0A 1B3LA 3FXUA 3HN0A 3IB0A 3SESA 2I3VA 4H8JA 3A3CA 4MBPA 3TTNA 2O6AA 5HM4B 1R1NA 1SI0A 2I0CA 4EUOA 3G3GA 5IKBA 4DCYA 2XX8A 2OK2A 4YKKA 4ZEBA 4ZE8A 4ELOA 4ECFA 1FQFA 1MG1A 1B51A 1XC1A 3W9VA 2UXAA 2V84A 2VHAA 2YJPA 1FQCA 2CMOA 3KEIA 3QIMA 3QSLA 4BDRA 3OO7A 2Z22A 3QYTA 4NF6B 2Q89A 3N6UA 3OSRA 4I8CA 1IZ1A 1ZU0A 4KD5A 3ECRA 2O69A 4ONYA 3UK4A 2R6GE 3KJ7A 5F7VA 3LSWA 4OTEA 4HW8A 5H8NB 2Y7RA 2LAOA 3H03A 2PBWA 3MVZA 4XIGQ 4ZEIA 3TUSA 1LCFA 3SDFA 3CG1A 1A55A 1M5DA 1MPCA 1N04A 2E0SA 2DQVA 2REJA 4C1UA 3V5AA 4DLDA 1B6HA 4H67A 1QKBA 4F1UA 4IO7A 2RC7A 1HSJA 1MY4A 1F9BA 5A5XA 3SETA 1MQHA 4FJPA 1UIUA 5I2KB 2GHAA 2NUVA 3CG3A 3B6QA 3LC8A 3HHGA 3TDJA 1B05A 1JETA 1ZJLA 2I6EA 1JVXA 3GZGA 4O3AA 2Q2AA 4O3CA 4OEVA 1ZLQA 2PX1A 4OERA 4ZS9A 3IOUA 2OCUA 3IL1B 2NOOA 2AL5A 3EN3A 4DXCA 1MRPA 2ONSA 1GV8A 2DSFA 4RYAA 4YKIA 3S4UA 5ICTA 4DXBA 3S9MC 3SERA 3Q28A 1URSA 4HCWA 4RXLA 3UGWA 1JW5A 1LCTA 1T0KA 4WEDA 4XTCQ 1AL3A 1LB9A 4U21A 2GHBA 1MH3A 2DP8A 5L9MA 1FTKA 3OSQA 4GFRA 3VLVA 2BJJX 3QK6A 1Y4TA 4E0WA 3SKPA 3PUYE 1YTVA 3B6TA 3IO6A 4QSDA 1ZIUA 4U23A 3N5LA 2H99A 3RPWA 1NH7A 3HPIA 1SQYA 3TFLA 3QUJA 1MQDA 2R9JA 1FQAA 4R73A 1LFIA 3FGSA 3IJXB 3LBSA 4PFWA 3MVWA 1QUIA 2F34A 3PD9A 1JEVA 3MPLA 2DWIA 3VLWA 1M5BA 1MH4A 1MXYA 4X1BA 5I56A 2F8DA 3H6VA 4YU0A 2AIXA 5I59A 3TKDA 2GFEA 4C0RA 1N7WA 1NL5A 1DMBA 2VGQA 3QXMA 4KFQA 2ZYMA 3U94A 4NWDA 3EPEA 2UVGA 2RF1A 4H5FA 2DYXA 5KZTA 2I49A 3MVXA 1Y1MA 1TFDA 5DYHA 2V3QA 2QS2A 4I62A 1NMUA 4WKMA 3PPRA 4F31B 5AA3A 5ISUA 2CZLA 3FIRA 1IXHA 1XOCA 2RCBA 1MXVA 5DVIA 5FTIA 3CFXA 5KDTB 1OMPA 2HAVA 3DP8A 3OO8A 1BTJA 3TAJA 2XXPA 5H8HB 5AE4A 4NTLA 2QPQA 1EH3A 4F19A 1B4HA 3O66A 4YICA 1IEJA 3MPKA 1WVJA 2REGA 5M2VA 1NH8A 4GRKA 1A8EA 1FQDA 1Q35A 3DLNA 4UA8A 3WAEA 4N07A 2F6GA 3UP9A 1P1UA 1SYIA 3C4MA 3L6GA 1D4NA 4RK9A 4G2ZA 4GLIA 1D9VA 1FCKA 1TT1A 1LB8A 2XX7A 4MLVA 2AL4A 3ODBA 1LAGE 2Z8FA 3PV0E 4GWOA 4G8MA 4XXUA 1UTBB 3K02A 4P0IA 3FJ7A 4XKQA 3TCGA 3VVEA 4RK2A 3U1OA 4HS7A 3GBAA 5H8FB 1B9JA 1II5A 2DVCA 1PBPA 1CE2A 5A5XB 1MM6A 5AA2D 3TPAA 4H8IA 3KN3A 5I59B 3S9LC 4QSCA 1WODA 2Q2CA 5AA4B 3O2AA 1Y9UA 4MH5A 1ATGA 1XT8A 2DE4A 4U4XA 3T22A 1LLSA 1UTBA 1LSTA 1MQGA 4G68C 2ONRA 4ZEDA 1OVBA 3C31A 3H3GA 3HO7A 1SBPA 2RINA 4H0WA 3IB2A 2DXYA 3OEMA 3KZGA 4IGRA 4EXLA 3CRBA 3A3UA 4R6YA 2H5YA 3V89B 2HEUA 3RUMA 3LR1A 3IO4A 4LQ5A 2F7BA 5L8DA 4Z7EA 3K2DA 3K6UA 1M5EA 3ZKLA 2ONKE 2Z23A 1IQ7A 5JK4A 1MDQA 3DP4A 4PFYA 4OWDA 1SW2A 5I58A 3JV9A 1IIWA 1LGBC 1USYH 2THIA 3Q27A 3FVKA 3N94A 4F1VA 3D4GA 1FW0A 2ZXTA 1LAHE 4KI0E 4NF4B 4OFOA 3PPPA 1B1HA 4THIA 4XKPA 4ELRA 1P1NA 1FQEA 3FV1A 3IJOB 3THIA 3MP1A 4BLAA 4DZ1A 2O68A 4JSOA 5CRYA 2XD2A 4FEBA 5H8HA 5I57A 5J1DA 3G3JA 4H65A 1NNPA 3Q26A 1ZMGA 3K1MA 2DWHA 4Z0IA 5FHNA 3UN6A 1B4ZA 3T9HB 3B7DA 1US4A 4G4PA 1MY0A 3O6IA 4L17A 1B46A 2QS4A 1FTJA 4U2RA 3VFJA 4NF4A 3VV5A 3TCHA 3RQTA 2ESNA 1Y3NA 3EHTA 5TPAB 3KN7A 3N26A 4GIZA 2FNCA 2RC9A 3FVOA 1H3DA 3OD7A 5AA2B 3MVYA 3QAXA 1B5IA 2A5TA 1MPDA 5ITPA 4UACA 4K3FA 1VSOA 2GRVA 2ANJA 1IXCA 1H45A 2ZYOA 3IX1A 4ZEKA 2PVUA 3D4CA 3VXBA 4F2QA 1ELJA 1Q1KA 2VOZA 4EQ7A 2VD3A 2Y7PA 2O51A 3F11A 1DPPA 1B1XA 2O1LA 2XXIA 1Y1ZA 1GVCA 3T9VA 3VVFA 2H98A 1USYE 4QHQA 4BDNA 4JWYA 1BP5A 2XXYA 3G3KA 4OHNA 3W9WA 4ELPA 1EZ9A 3H4ZA 3T66A 2ZYKA 4FAJA 2RKMA 2P0SA 3H6TA 3K6XA 3MZBA 4F1YA 1P1QA 4IO6A 2UYFA 2F78A 4KQPA 1SW5A 2QS1A 4PFUA 2O7IA 4R9FA 3FXQA 4OXVA 3BBRA 2B65A 4KYEA 4QFKA 4LVQA 3HHFA 4FECA 1J1NA 4R2BA 5I2KA 5ITOA 3PUWE 3K00A 1FTMA 5DT6A 5DEXB 2ZMBA 4FEDA 1A8FA 1NFTA 4Q0CA 4F3PA 5AA4A 4ZZEA 1GR2A 2ZNTA 4NF5B 4F39A 1B3FA 4MFIA 3IORA 1BKAA 2XD3A 3E13X 4ZE9A 2KLFA 1VE4A 1DSNA 3SEYA 2UVHA 1SW4A 4BDOA 4GD5A 5CMMA 1MXWA 1SW1A 1P99A 4GL8A 3SEXA 3TTKA 4MF3A 2XXRA 5H8FA 3IOWA 3OXNA 2OZZA 1A99A 2XXWA 4GOTA 4OESA 1MS7A 2X7PA 4RPNA 3KN8A 4ZDMA 4QSEA 2V3UA 1OLAA 4KCCA 4EF2A 3MBPA 4F29A 1N76A 1LAFE 4BDMA 1PB7A 2YLNA 3OEKA 4G77A 3RLFE 2RCAA 2ZYNA 2Y84A 4JWOA 4OFLA 4QFLA 5FHOA 4R6KA 2XXQA 3I5OA 3O29A 1B58A 1AMFA 1YAEA 4EXKA 3C34A 3AXFA 1EU8A 2G29A 3C35A 3C32A 1S50A 3FD3A 3RNNA 4LZ8A 4NWCA 4OENA 4BDQA 4G8HA 4YKJA 2F97A 2DS9A 3TTLA 1N3XA 1B7UA 1H43A 3OO9A 1B3HA 5KCJA 3PPNA 3MZ1A 3R7XA 1SDXA 3S9EA 3EHUA 3O6HA 4JSDA 4YAHX 1R9LA 3FVNA 4ND9A 4FATA 1TFAA 4R6HA 3V8XB 4R9GA 2XHDA 3T9XB 5B70A 3KBRA 4LUBA 3FZVA 4GXSB 4P0GA 1MPBA 4EF1A 2PYYA 2XXHA 3TELA 3IK6B 1A40A 3KSXA 4PQJA 2QL3A 2HZLA 1DTZA 4QRZA 1QJMA 3BFUA 5CI5A 1ZKBA 4ESXA 3G3IA 4NF8A 1N7XA 2OWTA 2XXVA 3PMXA 3SEUA 3T9UA 3U92A 4Q8RA 1O63A 4KYDA 2I4BA 5H8SA 3OENA 1ZTYA 1LBBA 3N6TA 3PGFA 4XKRA 1BLFA 3E3KA 4POWA 5TPAA 3H6WA 5AA2A 1B52A 3BFTA 1B3GA 4RNSA 3BKIB 4IO3A 3KOSA 1AIVA 2F7AA 4H5GA 3FV2A 3PPQA 4IY6A 4LATA 4WEPA 3Q29A 1Y3PA 4QFNA 3VLUA 3EF7A 2DE3A 2DE2A 3IR1A 3K1NA 4LZ5A 1NNTA 1HSEA 1SD3A 2GH9A 1RKMA 3U93A 1MY3A 1VFDA 3FXRA 3MC2A 2Q88A 2F36A 1JW1A 3PU5A 4FORA 4H1XA 4PE5B 3OELA 3R6UA 5DTBA 2HFBA 2QMWA 4X48A 3OMBA 4DDDA 2WKYA 3ILTB 5JTYB 1LAXA 3I3VA 2PT1A 1PC3A 3OOAA 5FHMA 3VDFA 3RTFB 3TCFA 1M5FA 3GLBA 5CC2A 3TTRA 4QFPA 3O9PA 3ONMA 1QUKA 2Z8DA 3K0VA 4AQ4A 1R6ZA 4KYSA 4FIMA 1JW4A 1Y3QA 2ZNUA 2H9BA 3RGYA 3DM0A 1SYHA 4OMBA 2AYSA 4I9DA 1S7YA 3H7MA 3CFZA 4LZ7A 4F18A 2UYEA 4OQOA 2NVUB 2I58A 5I56B 1MQIA 1O7TA 3L6HA 4FE8A 4M4GA 3HV1A 5AA1A 4EQ9A 3FJMA 1OIBA 4PFTA 4P11A 2NWJA 1Y20A 5H8QB 4ZEFA 1VR5A 1B7HA 1AH5A 2VD2A 3K6VA 3LSXA 4IO4A 5K2XA 3SEVA 4F22A 1XVYA 1EZOA 1IUDA 2E1SA 1PDAA 2D3IA 2X26A 2QRYA 5EHMA 3UA8A 2ABHA 5TU0A 4DIGA 5EHSA 1MY2A 2Y7WA 4G8NA 4DXUA 4RJZA 1B0HA 4KR5A 5ICQA 2HZKA 3MJNA 5L9OA 1MQJA 3VXCA 1URDA 1S9TA 3G7WA 1PEBA 3KGCA 1IXIA 5TP9B 1P1OA 1KWHA 4JDFA 1FTLA 3CSGA 4GVOA 1JVYA 3TQWA 3G3FA 5I2NA 4GXAA 4R74A 3RT8A 1VFEA 4F2OA 4ZECA 3C36A 1CB6A 1MXXA 4X9TA 4ELQA 1PB9A 4TLMB 2I0BA 4U1ZA 3RT6B 4NE4A 3S2VA 3U8QA 1ANFA 3H6UA 3TQLA 2DOJA 3PPOA 4BDLA 1QULA 1NKXA 3I6VA 1US5A 3O28A 3MAMA 4JB7A 3LSFB 1D9YA 1DPEA 3TODA 1I6BA 4DCXA 4EDPA 2Y7IA 3P7IA 4GL0A 2A5TB 5I2NB 2XXUA 1WDNA 2ZNSA 3KSJA 3OO6A 4IO2A 3CSBA 4OETA 5CMKA 1AOVA 4DE8A 4POXA 4EQBA 3TMGA 3UIFA 2IA4A 3MP6A 4RA1A 1OQHA 3PMWA 1YCJA 5DEXA 3G3HA 2QJEA 1NNFA 2DVZA 2NXOA 3H06B 2OWSA 1URGA 3K6WA 3M3KA 4NMYA 1I6QA 1IITA 1OVTA 1OLCA 3RN8A 1N84A 3TYHA 2OBGA 4R75A 4M1VA 5JTYA 2HXWA 1YPNA 2O1MA 1DTGA 1H44A 2UVJA 4LP2B 5DVFA 5CBRA 4IB2A 2D21A 1QVSA 4HTGA 1I6AA 1FQBA 4ISUA 2O84X 4G68B 1UIVA 3FUZA 1M5CA 4N13A 4YZZA 4HCYA 2W7YA 4TOZA 1I69A 3T96B 3ILUB 4WXJA 3E4RA 1B0LA 1PBQA 2X7QA 1QUJA 4Q5TA 1L5TA 4JBZA 4LA9A 3QUFA 4O3BA 4AB5A 1DOTA 1O64A 2G93A 3Q25A 5CBSA 2I3WA 5K2YA 3U72A 2DXRA 3HSTA 3CR9A 3O97A 3O6GA 3R26A 3K1PA 3ZS6A 1GTKA 2FA7A 1HSLA 4IO5A 4ESWA 2M8CA 4TLLB 2Q8JA 3A09A 5F1QA 4F3GA 4YB7A 1B32A 3CI8A 2F35A 3EHSA 1R9QA 1SI1A 2RC8A 3MQ9A 3MUQA 4KCDA 4GF8A 4N6PA 4NF5A 5BWJA 3TEPA 1UTHB 3KJTA 4U1OA 1A54A 1Z7NE 2PT2A 1Z7ME 2IEEA 3JYRA 4R2FA 5LOMA 3IOTA 5TP9A 1EZPA 2DWAA 1XVXA 4KHZE 3K4UA 3DELB 1IXGA 4OVJA 5H8QA 5CM6A 3EQ1A 1MY1A 4TQUQ 3PUZE 5HPQA 2R71A 2UVIA 3JZJA 4NF6A 1RYOA 1QKAA 1RYXA 1B2HA 1MDP1 2OJTA 3KG2A 4XKNA 3RY3A 3PD8A 4NF8B 3WAFA 3ZKKA 4PP0A 5B7DA 1A7LA 3S9NC 1POTA 1XHYA 2P1SA 1ZBMA 1B40A 2Y7KA 3CFLA 3CVGA 3MW0A 4I1DA 4IY5A 3RTWB 1GGGA 1D3KA 1SVXB 2HQ0A 2PMSA 4OZ9A 1TXFA 4U4SA 4LQ2A 3HCQA 3GBBA 4JWXA 4KPTA 5HBCA 3SEWA 5IAIA 1UQWA 5KCJB 2DWJA 3PUVE 4YKPA 2F7CA 1B5JA 5JEIA 3VVDA 3IB1A 4C1TA 2F6PA 1P1WA 5I84A 5KDTA 2I48A 3E9XA 2V25A 2ALUA 1MM7A 4YB5A 3VE1B 5BUUA 2D5WA 1JQFA 2Z8EA 2FYIA 3MZ9A 1JNFA 3FVGA 4IGTA 4F3SA 1NNKA 4OFJA 1N3WA 1LFHA 3FJGA 2QS3A 2O7UA 2HCAA 5CMBA 3PMVA 4GQOA 4RPOA 2XXTA 3DP6A 3FATA 3IAZA 1MXUA 3M3FA 3PUXE 4AB6A 4ZZAA 3MWBA 4E0XA 4YMAA 4YB6A 1LFGA 3M3LA 2P2AA 2YPNA 3FASA 5H8NA 1BIYA 3UORA 3ZSFA 5I58B 4QFOA 1Y4CA 4H6DA 1OQGA 3KOTA 1H76A 4Q30B 3W15C 5EYFA 1TWYA 5CMCA 3K01A 3IOVA 3M8UA 3MP8A 4JXIA 3TTMA 3USDA 4YMBA 4PETA 2OLBA 2QMXA 4OEUA 5DVJA 1FTOA 4G68A 1N0TA 2F5XA 3T93B 2V93A 1PB8A 2B3FA 2XXXA 4NEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I4C A;  2VP1 A;  3C33 A;  2A5S A;  4F3B A;  4OYV A;  4RY1 A;  2HAU A;  3CIJ A;  4U22 A;  5FTH A;  1JEU A;  4MLQ A;  1B7Z A;  1UTH A;  3LSL A;  5ELV A;  2V3T A;  4QF9 A;  3TZA A;  1B3E A;  1MXZ A;  1XS5 A;  2Q9T A;  3V83 A;  4X1D A;  5L9S A;  2QSX A;  3LUY A;  5I57 B;  2B3B A;  1B5H A;  4LON B;  4R72 A;  3KFM A;  3GXA A;  2H4I A;  1POY 1;  3C9H A;  2XX9 A;  3B6W A;  2H25 A;  1LBC A;  1QW0 A;  1B3L A;  3FXU A;  3HN0 A;  3IB0 A;  3SES A;  2I3V A;  4H8J A;  3A3C A;  4MBP A;  3TTN A;  2O6A A;  5HM4 B;  1R1N A;  1SI0 A;  2I0C A;  4EUO A;  3G3G A;  5IKB A;  4DCY A;  2XX8 A;  2OK2 A;  4YKK A;  4ZEB A;  4ZE8 A;  4ELO A;  4ECF A;  1FQF A;  1MG1 A;  1B51 A;  1XC1 A;  3W9V A;  2UXA A;  2V84 A;  2VHA A;  2YJP A;  1FQC A;  2CMO A;  3KEI A;  3QIM A;  3QSL A;  4BDR A;  3OO7 A;  2Z22 A;  3QYT A;  4NF6 B;  2Q89 A;  3N6U A;  3OSR A;  4I8C A;  1IZ1 A;  1ZU0 A;  4KD5 A;  3ECR A;  2O69 A;  4ONY A;  3UK4 A;  2R6G E;  3KJ7 A;  5F7V A;  3LSW A;  4OTE A;  4HW8 A;  5H8N B;  2Y7R A;  2LAO A;  3H03 A;  2PBW A;  3MVZ A;  4XIG Q;  4ZEI A;  3TUS A;  1LCF A;  3SDF A;  3CG1 A;  1A55 A;  1M5D A;  1MPC A;  1N04 A;  2E0S A;  2DQV A;  2REJ A;  4C1U A;  3V5A A;  4DLD A;  1B6H A;  4H67 A;  1QKB A;  4F1U A;  4IO7 A;  2RC7 A;  1HSJ A;  1MY4 A;  1F9B A;  5A5X A;  3SET A;  1MQH A;  4FJP A;  1UIU A;  5I2K B;  2GHA A;  2NUV A;  3CG3 A;  3B6Q A;  3LC8 A;  3HHG A;  3TDJ A;  1B05 A;  1JET A;  1ZJL A;  2I6E A;  1JVX A;  3GZG A;  4O3A A;  2Q2A A;  4O3C A;  4OEV A;  1ZLQ A;  2PX1 A;  4OER A;  4ZS9 A;  3IOU A;  2OCU A;  3IL1 B;  2NOO A;  2AL5 A;  3EN3 A;  4DXC A;  1MRP A;  2ONS A;  1GV8 A;  2DSF A;  4RYA A;  4YKI A;  3S4U A;  5ICT A;  4DXB A;  3S9M C;  3SER A;  3Q28 A;  1URS A;  4HCW A;  4RXL A;  3UGW A;  1JW5 A;  1LCT A;  1T0K A;  4WED A;  4XTC Q;  1AL3 A;  1LB9 A;  4U21 A;  2GHB A;  1MH3 A;  2DP8 A;  5L9M A;  1FTK A;  3OSQ A;  4GFR A;  3VLV A;  2BJJ X;  3QK6 A;  1Y4T A;  4E0W A;  3SKP A;  3PUY E;  1YTV A;  3B6T A;  3IO6 A;  4QSD A;  1ZIU A;  4U23 A;  3N5L A;  2H99 A;  3RPW A;  1NH7 A;  3HPI A;  1SQY A;  3TFL A;  3QUJ A;  1MQD A;  2R9J A;  1FQA A;  4R73 A;  1LFI A;  3FGS A;  3IJX B;  3LBS A;  4PFW A;  3MVW A;  1QUI A;  2F34 A;  3PD9 A;  1JEV A;  3MPL A;  2DWI A;  3VLW A;  1M5B A;  1MH4 A;  1MXY A;  4X1B A;  5I56 A;  2F8D A;  3H6V A;  4YU0 A;  2AIX A;  5I59 A;  3TKD A;  2GFE A;  4C0R A;  1N7W A;  1NL5 A;  1DMB A;  2VGQ A;  3QXM A;  4KFQ A;  2ZYM A;  3U94 A;  4NWD A;  3EPE A;  2UVG A;  2RF1 A;  4H5F A;  2DYX A;  5KZT A;  2I49 A;  3MVX A;  1Y1M A;  1TFD A;  5DYH A;  2V3Q A;  2QS2 A;  4I62 A;  1NMU A;  4WKM A;  3PPR A;  4F31 B;  5AA3 A;  5ISU A;  2CZL A;  3FIR A;  1IXH A;  1XOC A;  2RCB A;  1MXV A;  5DVI A;  5FTI A;  3CFX A;  5KDT B;  1OMP A;  2HAV A;  3DP8 A;  3OO8 A;  1BTJ A;  3TAJ A;  2XXP A;  5H8H B;  5AE4 A;  4NTL A;  2QPQ A;  1EH3 A;  4F19 A;  1B4H A;  3O66 A;  4YIC A;  1IEJ A;  3MPK A;  1WVJ A;  2REG A;  5M2V A;  1NH8 A;  4GRK A;  1A8E A;  1FQD A;  1Q35 A;  3DLN A;  4UA8 A;  3WAE A;  4N07 A;  2F6G A;  3UP9 A;  1P1U A;  1SYI A;  3C4M A;  3L6G A;  1D4N A;  4RK9 A;  4G2Z A;  4GLI A;  1D9V A;  1FCK A;  1TT1 A;  1LB8 A;  2XX7 A;  4MLV A;  2AL4 A;  3ODB A;  1LAG E;  2Z8F A;  3PV0 E;  4GWO A;  4G8M A;  4XXU A;  1UTB B;  3K02 A;  4P0I A;  3FJ7 A;  4XKQ A;  3TCG A;  3VVE A;  4RK2 A;  3U1O A;  4HS7 A;  3GBA A;  5H8F B;  1B9J A;  1II5 A;  2DVC A;  1PBP A;  1CE2 A;  5A5X B;  1MM6 A;  5AA2 D;  3TPA A;  4H8I A;  3KN3 A;  5I59 B;  3S9L C;  4QSC A;  1WOD A;  2Q2C A;  5AA4 B;  3O2A A;  1Y9U A;  4MH5 A;  1ATG A;  1XT8 A;  2DE4 A;  4U4X A;  3T22 A;  1LLS A;  1UTB A;  1LST A;  1MQG A;  4G68 C;  2ONR A;  4ZED A;  1OVB A;  3C31 A;  3H3G A;  3HO7 A;  1SBP A;  2RIN A;  4H0W A;  3IB2 A;  2DXY A;  3OEM A;  3KZG A;  4IGR A;  4EXL A;  3CRB A;  3A3U A;  4R6Y A;  2H5Y A;  3V89 B;  2HEU A;  3RUM A;  3LR1 A;  3IO4 A;  4LQ5 A;  2F7B A;  5L8D A;  4Z7E A;  3K2D A;  3K6U A;  1M5E A;  3ZKL A;  2ONK E;  2Z23 A;  1IQ7 A;  5JK4 A;  1MDQ A;  3DP4 A;  4PFY A;  4OWD A;  1SW2 A;  5I58 A;  3JV9 A;  1IIW A;  1LGB C;  1USY H;  2THI A;  3Q27 A;  3FVK A;  3N94 A;  4F1V A;  3D4G A;  1FW0 A;  2ZXT A;  1LAH E;  4KI0 E;  4NF4 B;  4OFO A;  3PPP A;  1B1H A;  4THI A;  4XKP A;  4ELR A;  1P1N A;  1FQE A;  3FV1 A;  3IJO B;  3THI A;  3MP1 A;  4BLA A;  4DZ1 A;  2O68 A;  4JSO A;  5CRY A;  2XD2 A;  4FEB A;  5H8H A;  5I57 A;  5J1D A;  3G3J A;  4H65 A;  1NNP A;  3Q26 A;  1ZMG A;  3K1M A;  2DWH A;  4Z0I A;  5FHN A;  3UN6 A;  1B4Z A;  3T9H B;  3B7D A;  1US4 A;  4G4P A;  1MY0 A;  3O6I A;  4L17 A;  1B46 A;  2QS4 A;  1FTJ A;  4U2R A;  3VFJ A;  4NF4 A;  3VV5 A;  3TCH A;  3RQT A;  2ESN A;  1Y3N A;  3EHT A;  5TPA B;  3KN7 A;  3N26 A;  4GIZ A;  2FNC A;  2RC9 A;  3FVO A;  1H3D A;  3OD7 A;  5AA2 B;  3MVY A;  3QAX A;  1B5I A;  2A5T A;  1MPD A;  5ITP A;  4UAC A;  4K3F A;  1VSO A;  2GRV A;  2ANJ A;  1IXC A;  1H45 A;  2ZYO A;  3IX1 A;  4ZEK A;  2PVU A;  3D4C A;  3VXB A;  4F2Q A;  1ELJ A;  1Q1K A;  2VOZ A;  4EQ7 A;  2VD3 A;  2Y7P A;  2O51 A;  3F11 A;  1DPP A;  1B1X A;  2O1L A;  2XXI A;  1Y1Z A;  1GVC A;  3T9V A;  3VVF A;  2H98 A;  1USY E;  4QHQ A;  4BDN A;  4JWY A;  1BP5 A;  2XXY A;  3G3K A;  4OHN A;  3W9W A;  4ELP A;  1EZ9 A;  3H4Z A;  3T66 A;  2ZYK A;  4FAJ A;  2RKM A;  2P0S A;  3H6T A;  3K6X A;  3MZB A;  4F1Y A;  1P1Q A;  4IO6 A;  2UYF A;  2F78 A;  4KQP A;  1SW5 A;  2QS1 A;  4PFU A;  2O7I A;  4R9F A;  3FXQ A;  4OXV A;  3BBR A;  2B65 A;  4KYE A;  4QFK A;  4LVQ A;  3HHF A;  4FEC A;  1J1N A;  4R2B A;  5I2K A;  5ITO A;  3PUW E;  3K00 A;  1FTM A;  5DT6 A;  5DEX B;  2ZMB A;  4FED A;  1A8F A;  1NFT A;  4Q0C A;  4F3P A;  5AA4 A;  4ZZE A;  1GR2 A;  2ZNT A;  4NF5 B;  4F39 A;  1B3F A;  4MFI A;  3IOR A;  1BKA A;  2XD3 A;  3E13 X;  4ZE9 A;  2KLF A;  1VE4 A;  1DSN A;  3SEY A;  2UVH A;  1SW4 A;  4BDO A;  4GD5 A;  5CMM A;  1MXW A;  1SW1 A;  1P99 A;  4GL8 A;  3SEX A;  3TTK A;  4MF3 A;  2XXR A;  5H8F A;  3IOW A;  3OXN A;  2OZZ A;  1A99 A;  2XXW A;  4GOT A;  4OES A;  1MS7 A;  2X7P A;  4RPN A;  3KN8 A;  4ZDM A;  4QSE A;  2V3U A;  1OLA A;  4KCC A;  4EF2 A;  3MBP A;  4F29 A;  1N76 A;  1LAF E;  4BDM A;  1PB7 A;  2YLN A;  3OEK A;  4G77 A;  3RLF E;  2RCA A;  2ZYN A;  2Y84 A;  4JWO A;  4OFL A;  4QFL A;  5FHO A;  4R6K A;  2XXQ A;  3I5O A;  3O29 A;  1B58 A;  1AMF A;  1YAE A;  4EXK A;  3C34 A;  3AXF A;  1EU8 A;  2G29 A;  3C35 A;  3C32 A;  1S50 A;  3FD3 A;  3RNN A;  4LZ8 A;  4NWC A;  4OEN A;  4BDQ A;  4G8H A;  4YKJ A;  2F97 A;  2DS9 A;  3TTL A;  1N3X A;  1B7U A;  1H43 A;  3OO9 A;  1B3H A;  5KCJ A;  3PPN A;  3MZ1 A;  3R7X A;  1SDX A;  3S9E A;  3EHU A;  3O6H A;  4JSD A;  4YAH X;  1R9L A;  3FVN A;  4ND9 A;  4FAT A;  1TFA A;  4R6H A;  3V8X B;  4R9G A;  2XHD A;  3T9X B;  5B70 A;  3KBR A;  4LUB A;  3FZV A;  4GXS B;  4P0G A;  1MPB A;  4EF1 A;  2PYY A;  2XXH A;  3TEL A;  3IK6 B;  1A40 A;  3KSX A;  4PQJ A;  2QL3 A;  2HZL A;  1DTZ A;  4QRZ A;  1QJM A;  3BFU A;  5CI5 A;  1ZKB A;  4ESX A;  3G3I A;  4NF8 A;  1N7X A;  2OWT A;  2XXV A;  3PMX A;  3SEU A;  3T9U A;  3U92 A;  4Q8R A;  1O63 A;  4KYD A;  2I4B A;  5H8S A;  3OEN A;  1ZTY A;  1LBB A;  3N6T A;  3PGF A;  4XKR A;  1BLF A;  3E3K A;  4POW A;  5TPA A;  3H6W A;  5AA2 A;  1B52 A;  3BFT A;  1B3G A;  4RNS A;  3BKI B;  4IO3 A;  3KOS A;  1AIV A;  2F7A A;  4H5G A;  3FV2 A;  3PPQ A;  4IY6 A;  4LAT A;  4WEP A;  3Q29 A;  1Y3P A;  4QFN A;  3VLU A;  3EF7 A;  2DE3 A;  2DE2 A;  3IR1 A;  3K1N A;  4LZ5 A;  1NNT A;  1HSE A;  1SD3 A;  2GH9 A;  1RKM A;  3U93 A;  1MY3 A;  1VFD A;  3FXR A;  3MC2 A;  2Q88 A;  2F36 A;  1JW1 A;  3PU5 A;  4FOR A;  4H1X A;  4PE5 B;  3OEL A;  3R6U A;  5DTB A;  2HFB A;  2QMW A;  4X48 A;  3OMB A;  4DDD A;  2WKY A;  3ILT B;  5JTY B;  1LAX A;  3I3V A;  2PT1 A;  1PC3 A;  3OOA A;  5FHM A;  3VDF A;  3RTF B;  3TCF A;  1M5F A;  3GLB A;  5CC2 A;  3TTR A;  4QFP A;  3O9P A;  3ONM A;  1QUK A;  2Z8D A;  3K0V A;  4AQ4 A;  1R6Z A;  4KYS A;  4FIM A;  1JW4 A;  1Y3Q A;  2ZNU A;  2H9B A;  3RGY A;  3DM0 A;  1SYH A;  4OMB A;  2AYS A;  4I9D A;  1S7Y A;  3H7M A;  3CFZ A;  4LZ7 A;  4F18 A;  2UYE A;  4OQO A;  2NVU B;  2I58 A;  5I56 B;  1MQI A;  1O7T A;  3L6H A;  4FE8 A;  4M4G A;  3HV1 A;  5AA1 A;  4EQ9 A;  3FJM A;  1OIB A;  4PFT A;  4P11 A;  2NWJ A;  1Y20 A;  5H8Q B;  4ZEF A;  1VR5 A;  1B7H A;  1AH5 A;  2VD2 A;  3K6V A;  3LSX A;  4IO4 A;  5K2X A;  3SEV A;  4F22 A;  1XVY A;  1EZO A;  1IUD A;  2E1S A;  1PDA A;  2D3I A;  2X26 A;  2QRY A;  5EHM A;  3UA8 A;  2ABH A;  5TU0 A;  4DIG A;  5EHS A;  1MY2 A;  2Y7W A;  4G8N A;  4DXU A;  4RJZ A;  1B0H A;  4KR5 A;  5ICQ A;  2HZK A;  3MJN A;  5L9O A;  1MQJ A;  3VXC A;  1URD A;  1S9T A;  3G7W A;  1PEB A;  3KGC A;  1IXI A;  5TP9 B;  1P1O A;  1KWH A;  4JDF A;  1FTL A;  3CSG A;  4GVO A;  1JVY A;  3TQW A;  3G3F A;  5I2N A;  4GXA A;  4R74 A;  3RT8 A;  1VFE A;  4F2O A;  4ZEC A;  3C36 A;  1CB6 A;  1MXX A;  4X9T A;  4ELQ A;  1PB9 A;  4TLM B;  2I0B A;  4U1Z A;  3RT6 B;  4NE4 A;  3S2V A;  3U8Q A;  1ANF A;  3H6U A;  3TQL A;  2DOJ A;  3PPO A;  4BDL A;  1QUL A;  1NKX A;  3I6V A;  1US5 A;  3O28 A;  3MAM A;  4JB7 A;  3LSF B;  1D9Y A;  1DPE A;  3TOD A;  1I6B A;  4DCX A;  4EDP A;  2Y7I A;  3P7I A;  4GL0 A;  2A5T B;  5I2N B;  2XXU A;  1WDN A;  2ZNS A;  3KSJ A;  3OO6 A;  4IO2 A;  3CSB A;  4OET A;  5CMK A;  1AOV A;  4DE8 A;  4POX A;  4EQB A;  3TMG A;  3UIF A;  2IA4 A;  3MP6 A;  4RA1 A;  1OQH A;  3PMW A;  1YCJ A;  5DEX A;  3G3H A;  2QJE A;  1NNF A;  2DVZ A;  2NXO A;  3H06 B;  2OWS A;  1URG A;  3K6W A;  3M3K A;  4NMY A;  1I6Q A;  1IIT A;  1OVT A;  1OLC A;  3RN8 A;  1N84 A;  3TYH A;  2OBG A;  4R75 A;  4M1V A;  5JTY A;  2HXW A;  1YPN A;  2O1M A;  1DTG A;  1H44 A;  2UVJ A;  4LP2 B;  5DVF A;  5CBR A;  4IB2 A;  2D21 A;  1QVS A;  4HTG A;  1I6A A;  1FQB A;  4ISU A;  2O84 X;  4G68 B;  1UIV A;  3FUZ A;  1M5C A;  4N13 A;  4YZZ A;  4HCY A;  2W7Y A;  4TOZ A;  1I69 A;  3T96 B;  3ILU B;  4WXJ A;  3E4R A;  1B0L A;  1PBQ A;  2X7Q A;  1QUJ A;  4Q5T A;  1L5T A;  4JBZ A;  4LA9 A;  3QUF A;  4O3B A;  4AB5 A;  1DOT A;  1O64 A;  2G93 A;  3Q25 A;  5CBS A;  2I3W A;  5K2Y A;  3U72 A;  2DXR A;  3HST A;  3CR9 A;  3O97 A;  3O6G A;  3R26 A;  3K1P A;  3ZS6 A;  1GTK A;  2FA7 A;  1HSL A;  4IO5 A;  4ESW A;  2M8C A;  4TLL B;  2Q8J A;  3A09 A;  5F1Q A;  4F3G A;  4YB7 A;  1B32 A;  3CI8 A;  2F35 A;  3EHS A;  1R9Q A;  1SI1 A;  2RC8 A;  3MQ9 A;  3MUQ A;  4KCD A;  4GF8 A;  4N6P A;  4NF5 A;  5BWJ A;  3TEP A;  1UTH B;  3KJT A;  4U1O A;  1A54 A;  1Z7N E;  2PT2 A;  1Z7M E;  2IEE A;  3JYR A;  4R2F A;  5LOM A;  3IOT A;  5TP9 A;  1EZP A;  2DWA A;  1XVX A;  4KHZ E;  3K4U A;  3DEL B;  1IXG A;  4OVJ A;  5H8Q A;  5CM6 A;  3EQ1 A;  1MY1 A;  4TQU Q;  3PUZ E;  5HPQ A;  2R71 A;  2UVI A;  3JZJ A;  4NF6 A;  1RYO A;  1QKA A;  1RYX A;  1B2H A;  1MDP 1;  2OJT A;  3KG2 A;  4XKN A;  3RY3 A;  3PD8 A;  4NF8 B;  3WAF A;  3ZKK A;  4PP0 A;  5B7D A;  1A7L A;  3S9N C;  1POT A;  1XHY A;  2P1S A;  1ZBM A;  1B40 A;  2Y7K A;  3CFL A;  3CVG A;  3MW0 A;  4I1D A;  4IY5 A;  3RTW B;  1GGG A;  1D3K A;  1SVX B;  2HQ0 A;  2PMS A;  4OZ9 A;  1TXF A;  4U4S A;  4LQ2 A;  3HCQ A;  3GBB A;  4JWX A;  4KPT A;  5HBC A;  3SEW A;  5IAI A;  1UQW A;  5KCJ B;  2DWJ A;  3PUV E;  4YKP A;  2F7C A;  1B5J A;  5JEI A;  3VVD A;  3IB1 A;  4C1T A;  2F6P A;  1P1W A;  5I84 A;  5KDT A;  2I48 A;  3E9X A;  2V25 A;  2ALU A;  1MM7 A;  4YB5 A;  3VE1 B;  5BUU A;  2D5W A;  1JQF A;  2Z8E A;  2FYI A;  3MZ9 A;  1JNF A;  3FVG A;  4IGT A;  4F3S A;  1NNK A;  4OFJ A;  1N3W A;  1LFH A;  3FJG A;  2QS3 A;  2O7U A;  2HCA A;  5CMB A;  3PMV A;  4GQO A;  4RPO A;  2XXT A;  3DP6 A;  3FAT A;  3IAZ A;  1MXU A;  3M3F A;  3PUX E;  4AB6 A;  4ZZA A;  3MWB A;  4E0X A;  4YMA A;  4YB6 A;  1LFG A;  3M3L A;  2P2A A;  2YPN A;  3FAS A;  5H8N A;  1BIY A;  3UOR A;  3ZSF A;  5I58 B;  4QFO A;  1Y4C A;  4H6D A;  1OQG A;  3KOT A;  1H76 A;  4Q30 B;  3W15 C;  5EYF A;  1TWY A;  5CMC A;  3K01 A;  3IOV A;  3M8U A;  3MP8 A;  4JXI A;  3TTM A;  3USD A;  4YMB A;  4PET A;  2OLB A;  2QMX A;  4OEU A;  5DVJ A;  1FTO A;  4G68 A;  1N0T A;  2F5X A;  3T93 B;  2V93 A;  1PB8 A;  2B3F A;  2XXX A;  4NED A; 
#chains in the Genus database with same CATH topology
 2I4C A;  1KZ8 A;  1UTH A;  2VPO A;  5ELV A;  5J16 A;  1B3E A;  1MXZ A;  3V83 A;  4X1D A;  2QSX A;  3LUY A;  2B3B A;  4GWU A;  4LON B;  2FIX A;  3KFM A;  2XX9 A;  2H25 A;  4MBP A;  3T0J A;  5HM4 B;  5IKB A;  4GWY A;  4MIJ A;  1B51 A;  2UXA A;  2V84 A;  3OO7 A;  3QYT A;  3N6U A;  3OSR A;  1ZU0 A;  2O69 A;  2Y7R A;  3H03 A;  3CG1 A;  1N04 A;  4DLD A;  2REJ A;  4H67 A;  4F1U A;  3SZP A;  2NUV A;  3B6Q A;  1B05 A;  1JET A;  4P1E A;  1JVX A;  3SKP A;  1ZLQ A;  2CZK A;  2PX1 A;  2OCU A;  1FRP A;  2DSF A;  2CEX A;  3Q28 A;  4RXL A;  3UGW A;  3IFC A;  3VLV A;  1MH3 A;  1Y4T A;  5LTC A;  1YTV A;  3B6T A;  3B8B A;  4U23 A;  3N5L A;  3TFL A;  4HE2 A;  1FQA A;  1LFI A;  4HXV A;  3MVW A;  2WBD A;  2F34 A;  1RDY A;  2DWI A;  2F3D A;  4X1B A;  1MXY A;  3TKD A;  4C0R A;  1DMB A;  4KFQ A;  3U94 A;  4NWD A;  2UVG A;  1VDW A;  1NMU A;  5ISU A;  1FBF A;  1IXH A;  1XOC A;  2RCB A;  1MXV A;  5KDT B;  1EYJ A;  1OMP A;  2HAV A;  3OO8 A;  2XXP A;  2QPQ A;  4YIC A;  3NOH A;  4PBH A;  4GRK A;  3WAE A;  3RPL B;  2WYP A;  1D9V A;  1FCK A;  5A5L A;  3PV0 E;  4XXU A;  5FBP A;  3K02 A;  3FJ7 A;  4GWZ A;  4XKQ A;  4RK2 A;  4GX6 A;  1MM6 A;  3TPA A;  4H8I A;  3KN3 A;  1LBZ A;  3S9L C;  5AA4 B;  1KA1 A;  1LLS A;  1UTB A;  4ZED A;  3IB2 A;  2DXY A;  3KZG A;  4IGR A;  3A3U A;  1LBW A;  2H5Y A;  1EYI A;  3V89 B;  2HEU A;  3RUM A;  3LR1 A;  4Z7E A;  5L8D A;  4P8B A;  1M5E A;  1IIW A;  4F1V A;  3D4G A;  1FW0 A;  2ZXT A;  4OFO A;  4THI A;  4XKP A;  1P1N A;  3IJO B;  2O68 A;  5CRY A;  5I57 A;  1B4Z A;  3D1R A;  5IM2 A;  3EHT A;  4X04 A;  3FVO A;  2A5T A;  4K3F A;  1VSO A;  2ANJ A;  2ZYO A;  1LEV A;  2Y7P A;  1DPP A;  1B1X A;  2H98 A;  1USY E;  3G3K A;  5EQA A;  4FAJ A;  2P0S A;  3H6T A;  2UYF A;  4KQP A;  2QS1 A;  4GWW A;  3FXQ A;  4OXV A;  3BBR A;  4R2B A;  3PUW E;  3K00 A;  2ZMB A;  4FED A;  1A8F A;  2P3V A;  4F3P A;  4Q0C A;  4F39 A;  1B3F A;  1DSN A;  5CMM A;  1MXW A;  1SW1 A;  1P99 A;  3SEX A;  2B4L A;  4I3Y A;  5H8F A;  3E78 A;  2XXW A;  2V3U A;  4KCC A;  4O94 A;  1N76 A;  2YLN A;  1SPI A;  4G77 A;  2ZYN A;  2Y84 A;  4OFL A;  5EYG A;  4QFL A;  5FHO A;  2XXQ A;  3I5O A;  1AMF A;  4EXK A;  2G29 A;  3C32 A;  4OEN A;  4G8H A;  2F97 A;  1N3X A;  1B7U A;  3OO9 A;  1B3H A;  3PPN A;  3GYY A;  4O8M A;  4YAH X;  1KA0 A;  4R6H A;  3T9X B;  3KBR A;  4P0G A;  4EF1 A;  4PQJ A;  2QL3 A;  1QJM A;  1ZKB A;  3G3I A;  3T9U A;  3PMX A;  4Q8R A;  4KYD A;  2I4B A;  5H8S A;  2XA5 A;  1CNQ A;  1AIV A;  4IO3 A;  3CHG A;  3Q29 A;  4QFN A;  3EF7 A;  4O7I A;  3K1N A;  1SD3 A;  1RKM A;  2CZH A;  4JVC A;  4FOR A;  4N15 A;  3R6U A;  5DTB A;  2HFB A;  2QMW A;  1LAX A;  1PC3 A;  3OOA A;  3RTF B;  1M5F A;  3FXB A;  2ZNU A;  3DM0 A;  3H7M A;  3CFZ A;  2UYE A;  4OQO A;  2NVU B;  5I56 B;  4HE1 A;  4O7M A;  4EQ9 A;  4ZEF A;  5H8Q B;  4F22 A;  1XVY A;  4N6D A;  1EZO A;  2ABH A;  5TU0 A;  4G8N A;  4DXU A;  4RJZ A;  1B0H A;  5L9O A;  1S9T A;  1PEB A;  4QBA A;  1KWH A;  2WEF A;  2XWK A;  5I2N A;  3G3F A;  4R74 A;  3RT8 A;  4F2O A;  4ZEC A;  4X9T A;  2I0B A;  3RT6 B;  1QUL A;  1NKX A;  2Y7I A;  3P7I A;  4GL0 A;  3OO6 A;  3CSB A;  4EQB A;  2VPN A;  1OQH A;  3H06 B;  1OVT A;  3RN8 A;  1H44 A;  2UVJ A;  2D21 A;  1FQB A;  2O84 X;  4HCY A;  1I69 A;  1QUJ A;  2HPG A;  4O3B A;  2G93 A;  2DXR A;  1GTK A;  2FA7 A;  4ESW A;  2M8C A;  4YB7 A;  3CI8 A;  3EHS A;  1R9Q A;  1SI1 A;  2RC8 A;  3MUQ A;  4GF8 A;  4P47 A;  3IOT A;  5TP9 A;  4KHZ E;  1IXG A;  3PUZ E;  2R71 A;  2UVI A;  1FPF A;  1RYX A;  1B2H A;  2OJT A;  3PD8 A;  3WAF A;  2QFL A;  3CFL A;  1ZBM A;  1B40 A;  4I1D A;  5IZ1 A;  3RTW B;  3QMF A;  4PAI A;  4JWX A;  5IAI A;  4AS4 A;  1UQW A;  1B5J A;  3IB1 A;  2V25 A;  5BUU A;  2FYI A;  2V4C A;  2O7U A;  4RPO A;  4AB6 A;  3PUX E;  4P9K A;  2FBP A;  2P2A A;  5I58 B;  1BIY A;  1Y4C A;  4PTK A;  4H6D A;  5EYF A;  1TWY A;  5CMC A;  3MP8 A;  3TUS A;  3USD A;  2QMX A;  4G68 A;  2XXX A;  4NED A;  3S9N C;  5IGA A;  3C33 A;  4F3B A;  4PFI A;  3MYU A;  4OYV A;  3CIJ A;  4U22 A;  3LSL A;  2HXR A;  4NGU A;  2QVV A;  4R72 A;  3GXA A;  3C9H A;  1POY 1;  1LBC A;  3HN0 A;  3FXU A;  3SES A;  3A3C A;  4DI3 D;  2O6A A;  1R1N A;  4EUO A;  2L5V A;  2XX8 A;  1FQF A;  3QIM A;  1FQC A;  2CMO A;  2Q89 A;  3UK4 A;  1IZ1 A;  4KD5 A;  5F7V A;  4XIG Q;  4IO7 A;  2RC7 A;  1HSJ A;  1MY4 A;  1F9B A;  4I3E A;  1NV5 A;  4NHB A;  1UIU A;  5I2K B;  3KC1 A;  3BIG A;  4OVQ A;  3TDJ A;  2I6E A;  1ZJL A;  4O3A A;  4O3C A;  3BIH A;  3IL1 B;  2NOO A;  2AL5 A;  1IMC A;  2ONS A;  2R8T A;  3S4U A;  4YKI A;  5ICT A;  4HCW A;  4GBW A;  1DCU A;  1T0K A;  4WED A;  1AL3 A;  2GHB A;  1FTK A;  4PAF A;  3PUY E;  4QSD A;  3QUJ A;  2R9J A;  4R73 A;  4PFW A;  1QUI A;  3PD9 A;  2XWI A;  4YU0 A;  2AIX A;  1N7W A;  2FIE A;  2VGQ A;  3QXM A;  4N91 A;  2QVU A;  2RF1 A;  2F3B A;  3MVX A;  1TFD A;  3PPR A;  1YZ0 A;  5FTI A;  4MNP A;  3TAJ A;  1LBX A;  4NTL A;  1NH8 A;  1K9Y A;  1A8E A;  1Q35 A;  4P3L A;  4UA8 A;  3UP9 A;  3L6G A;  1D4N A;  1TT1 A;  3ODB A;  4GWO A;  4G8M A;  1UTB B;  4PC9 A;  3VVE A;  3TCG A;  4HS7 A;  5H8F B;  1PBP A;  2Q2C A;  5EQ8 A;  3O2A A;  1Y9U A;  1ATG A;  4G68 C;  1LST A;  3C31 A;  1FBC A;  3HO7 A;  3CRB A;  4PF6 A;  3IO4 A;  2F7B A;  3K2D A;  3ROJ A;  5L9S A;  2Z23 A;  5I58 A;  1USY H;  1LAH E;  4KI0 E;  1B1H A;  4PDD A;  4ELR A;  1FQE A;  3FV1 A;  3MP1 A;  4JSO A;  5J1D A;  3Q26 A;  3K1M A;  3RYD A;  4L17 A;  1MY0 A;  2CEY A;  2QS4 A;  4U2R A;  3TCH A;  1Y3N A;  2RC9 A;  3OD7 A;  5AA2 B;  3QAX A;  3IX1 A;  2VD3 A;  1Y1Z A;  3T9V A;  2XXY A;  3W9W A;  1EZ9 A;  2RKM A;  3K6X A;  4IO6 A;  1SW5 A;  5F24 A;  4QFK A;  1DBZ A;  5IZZ A;  5DEX B;  1GR2 A;  2ZNT A;  4MFI A;  1BKA A;  4ZE9 A;  2KLF A;  4MMP A;  3SEY A;  2UVH A;  1YYZ A;  2XXR A;  3IOW A;  1A99 A;  1MS7 A;  3KN8 A;  5I7I A;  3MBP A;  4PE3 A;  4F29 A;  2RCA A;  4JWO A;  4PBQ A;  3RNN A;  1S50 A;  4LZ8 A;  2WYK A;  4NWC A;  2ZZW A;  4YKJ A;  2DS9 A;  3R7X A;  1AWB A;  4JSD A;  4ND9 A;  1Q9D A;  1TFA A;  4GXS B;  3TEL A;  3IK6 B;  1DTZ A;  3BFU A;  5CI5 A;  2OWT A;  3U92 A;  1O63 A;  1LBB A;  3N6T A;  1BLF A;  2Q74 A;  1B3G A;  4RNS A;  4PFB A;  1RDZ A;  4LAT A;  4WEP A;  1G0H A;  3VLU A;  2DE3 A;  3U93 A;  5IZ3 B;  3IR1 A;  4XF5 A;  1NV1 A;  4H1X A;  3FXR A;  3PU5 A;  4PE5 B;  4FAT A;  3OMB A;  5JTY B;  3I3V A;  3VDF A;  5CC2 A;  2Z8D A;  4AQ4 A;  4FIM A;  3T1B A;  4OMB A;  4LZ7 A;  4F18 A;  3A29 A;  2I58 A;  1MQI A;  1O7T A;  3HV1 A;  3FJM A;  5K2X A;  1VR5 A;  2VD2 A;  1AH5 A;  3LSX A;  4G61 A;  4N4U A;  4IO4 A;  4XFE A;  5ET5 A;  2E1S A;  2D3I A;  2X26 A;  1K9Z A;  2QRY A;  5EHM A;  5EHS A;  1MY2 A;  3KBZ A;  1IXI A;  4JDF A;  3CSG A;  4GVO A;  1JVY A;  1VFE A;  1MXX A;  4N17 A;  4NE4 A;  1IME A;  3U8Q A;  1ANF A;  3H6U A;  4BDL A;  3MAM A;  1I6B A;  1FTA A;  4IO2 A;  3TMG A;  2IA4 A;  1D9Q A;  3MP6 A;  4RA1 A;  2QJE A;  2NXO A;  3K6W A;  1OLC A;  1N84 A;  4R75 A;  2O1M A;  4N8Y A;  4PF8 A;  5CBR A;  2FVZ A;  4HTG A;  2KR0 A;  4G68 B;  3T96 B;  3ILU B;  4MX6 A;  1B0L A;  1PBQ A;  2X7Q A;  4Q5T A;  1L5T A;  4JBZ A;  2Y5L A;  3QUF A;  2I3W A;  3CR9 A;  3O97 A;  2XXK A;  4TLL B;  1XI6 A;  2Q8J A;  4F3G A;  1B32 A;  4KCD A;  4NF5 A;  5I3S A;  3TEP A;  3KJT A;  4U1O A;  1A54 A;  3JYR A;  2IEE A;  5H8Q A;  1FPG A;  1MY1 A;  4TQU Q;  1EYK A;  4NF6 A;  1QKA A;  4XKN A;  4NF8 B;  4KXP A;  3RPL A;  4PP0 A;  5B7D A;  1XHY A;  5LDZ A;  2PMS A;  4OZ9 A;  3SEW A;  4LQ2 A;  3HCQ A;  4KPT A;  4GWX A;  2DWJ A;  3IFA A;  3ISP A;  5I84 A;  4DI4 B;  5KDT A;  3E9X A;  3VE1 B;  2D5W A;  1JQF A;  1NV0 A;  3MZ9 A;  1NNK A;  1LFH A;  3FJG A;  3PMV A;  3DP6 A;  3MWB A;  2YPN A;  3FAS A;  5H8N A;  3ZSF A;  1OQG A;  4Q30 B;  4MNC A;  4JXI A;  4YMB A;  4GX4 A;  2V93 A;  2VP1 A;  4MLQ A;  4OAN A;  1B7Z A;  3TZA A;  2V3T A;  2Q9T A;  4FBP A;  5I57 B;  2QVR A;  1QW0 A;  1B3L A;  3IB0 A;  2I3V A;  5ET6 A;  3TTN A;  1SI0 A;  4AS5 A;  3G3G A;  4DCY A;  4ZEB A;  4ZE8 A;  4ELO A;  4MEV A;  4ECF A;  1MG1 A;  3W9V A;  4BDR A;  3QSL A;  4PFR A;  4NF6 B;  1INP A;  1FPI A;  1RDX A;  5H8N B;  2LAO A;  3MVZ A;  1LCF A;  2E0S A;  1M5D A;  1MPC A;  3V5A A;  1QKB A;  5A5X A;  3SET A;  2GHA A;  3LC8 A;  3HHG A;  3GZG A;  2Q2A A;  4ZS9 A;  3EN3 A;  1MRP A;  2PFZ A;  4RYA A;  4DXB A;  3S9M C;  1JW5 A;  1LB9 A;  2DP8 A;  4GFR A;  4I40 A;  2BJJ X;  4OVP A;  4E0W A;  1NUZ A;  3IO6 A;  1NH7 A;  1SQY A;  4N81 A;  1MQD A;  3FGS A;  1JEV A;  2PFY A;  2XWV A;  1M5B A;  1MH4 A;  4PGN A;  2GFE A;  1NL5 A;  2ZYM A;  4H5F A;  2DYX A;  5KZT A;  5AA3 A;  3FIR A;  5DVI A;  3CFX A;  4OVS A;  1BTJ A;  5H8H B;  4F19 A;  1B4H A;  1IEJ A;  1WVJ A;  1P1U A;  3C4M A;  2XX7 A;  1LB8 A;  2AL4 A;  2Z8F A;  4GBV A;  4P0I A;  3U1O A;  1II5 A;  1NI9 A;  5AA2 D;  4QSC A;  1XT8 A;  1OVB A;  1SBP A;  2RIN A;  4H0W A;  3OEM A;  4EXL A;  3ZKL A;  5JK4 A;  2ONK E;  1MDQ A;  1SW2 A;  3FVK A;  4XEQ A;  4NF4 B;  3PPP A;  4DZ1 A;  5H8H A;  4FEB A;  1FPL A;  4H65 A;  1NNP A;  4Z0I A;  1JP4 A;  3T9H B;  3B7D A;  1FTJ A;  3VFJ A;  3KN7 A;  3N26 A;  4GIZ A;  2FNC A;  1H3D A;  3MVY A;  1B5I A;  4UAC A;  1H45 A;  4ZEK A;  3VXB A;  2PVU A;  3D4C A;  1ELJ A;  1Q1K A;  2O51 A;  3F11 A;  2O1L A;  4QHQ A;  4ELP A;  4JWY A;  4PDH A;  3H4Z A;  3MZB A;  4F1Y A;  1P1Q A;  4PFU A;  4MAG A;  4R9F A;  2O7I A;  2B65 A;  4KYE A;  4LVQ A;  1J1N A;  5I2K A;  4OA4 A;  4ZZE A;  5AA4 A;  4NF5 B;  3HFU A;  3E13 X;  1VE4 A;  1SW4 A;  1IMF A;  4GD5 A;  2GQ1 A;  4MF3 A;  3OXN A;  2OZZ A;  4GOT A;  4OES A;  1PB7 A;  3RLF E;  4R6K A;  1YAE A;  4NF0 A;  3FD3 A;  1H43 A;  5KCJ A;  3MZ1 A;  1SDX A;  3EHU A;  4P56 A;  3V8X B;  5B70 A;  4LUB A;  4H46 A;  3KSX A;  2JJK A;  2HZL A;  4QRZ A;  4ESX A;  4NF8 A;  1FBD A;  1ZTY A;  4XKR A;  5TPA A;  3E3K A;  1B52 A;  3KOS A;  4IY6 A;  1Y3P A;  1NV2 A;  4M4G A;  4LZ5 A;  5EQ9 A;  2GH9 A;  1VFD A;  3MC2 A;  3SEU A;  2Q88 A;  1JW1 A;  4DDD A;  3OEL A;  2PT1 A;  3TCF A;  3TTR A;  4QFP A;  3ONM A;  1QUK A;  1R6Z A;  4KYS A;  1JW4 A;  1Y3Q A;  1IMB A;  4JVD A;  1SYH A;  2AYS A;  4I9D A;  4FE8 A;  5AA1 A;  2BJI A;  1OIB A;  4P11 A;  2NWJ A;  1Y20 A;  1B7H A;  4NG7 A;  1IUD A;  3UA8 A;  4DIG A;  2B4M A;  5ICQ A;  3MJN A;  1MQJ A;  3G7W A;  3KGC A;  5TP9 B;  2FHY A;  3TQW A;  4GXA A;  3U65 A;  4ELQ A;  1PB9 A;  4U1Z A;  3S2V A;  3TQL A;  2DOJ A;  3I6V A;  4JB7 A;  1FBP A;  3LSF B;  1D9Y A;  4DCX A;  2A5T B;  4X8R A;  2XXU A;  1NV4 A;  3KSJ A;  1AOV A;  4POX A;  3UIF A;  3G3H A;  2DVZ A;  3M3K A;  1URG A;  1I6Q A;  2OBG A;  4M1V A;  1DTG A;  4IB2 A;  1I6A A;  1UIV A;  1M5C A;  3PTY A;  2W7Y A;  4WXJ A;  3E4R A;  1DOT A;  1O64 A;  3Q25 A;  5CBS A;  3MST A;  5K2Y A;  3HST A;  3ZS6 A;  3K1P A;  1G0I A;  3A09 A;  5F1Q A;  2F35 A;  4N6P A;  5BWJ A;  1Z7N E;  4GX3 A;  1DK4 A;  4R2F A;  3K4U A;  4OVJ A;  5ESY A;  5HPQ A;  1RYO A;  3RY3 A;  2VT5 A;  3ZKK A;  1A7L A;  1POT A;  2P1S A;  3CVG A;  3MW0 A;  4IY5 A;  1GGG A;  2HQ0 A;  1SVX B;  1TXF A;  4U4S A;  5KCJ B;  3PUV E;  4YKP A;  3VVD A;  1P1W A;  5EQ7 A;  1MM7 A;  4YB5 A;  1FSA A;  4F3S A;  1JNF A;  3FVG A;  4OFJ A;  1N3W A;  5CMB A;  4MNI A;  2XXT A;  3FAT A;  3IAZ A;  1MXU A;  1LFG A;  4QFO A;  3KOT A;  5ET7 A;  3IOV A;  3TTM A;  4OEU A;  1FTO A;  1N0T A;  1PB8 A;  3VXC A;  1QGX A;  2DDK A;  2A5S A;  2Y5K A;  4RY1 A;  4IR8 A;  2HAU A;  5FTH A;  1JEU A;  4PCD A;  4QF9 A;  1XS5 A;  4JVI A;  1B5H A;  2H4I A;  3B6W A;  4H8J A;  1FBG A;  2I0C A;  4NN3 A;  1FPJ A;  2OK2 A;  4YKK A;  1XC1 A;  2VHA A;  2YJP A;  3KEI A;  1NUY A;  2Z22 A;  4I8C A;  1NV7 A;  4ONY A;  3ECR A;  5IZ3 A;  2R6G E;  3KJ7 A;  3LSW A;  4OTE A;  4HW8 A;  2PBW A;  4ZEI A;  3SDF A;  2PCR A;  1A55 A;  4C1U A;  2DQV A;  1B6H A;  1MQH A;  4FJP A;  3CG3 A;  4QXD A;  3KC0 A;  4OER A;  4OEV A;  3IOU A;  4DXC A;  1GV8 A;  3SER A;  1URS A;  1LCT A;  2P3N A;  4XTC Q;  4U21 A;  5L9M A;  3OSQ A;  3QK6 A;  1ZIU A;  2H99 A;  3RPW A;  3HPI A;  3IJX B;  3LBS A;  3B50 A;  3MPL A;  3VLW A;  5I56 A;  2F8D A;  3H6V A;  2MKZ A;  2OX3 A;  3EPE A;  2I49 A;  1Y1M A;  1FPE A;  5DYH A;  1LBV A;  2V3Q A;  2QS2 A;  4I62 A;  4WKM A;  4F31 B;  2CZL A;  3DP8 A;  5AE4 A;  1EH3 A;  3O66 A;  3MPK A;  2REG A;  1FQD A;  3DLN A;  4MJO A;  4N07 A;  2F6G A;  1SYI A;  4RK9 A;  4G2Z A;  4GLI A;  4MLV A;  1LAG E;  5EYH A;  3GBA A;  1B9J A;  2DVC A;  1CE2 A;  5A5X B;  4MHF A;  5I59 B;  1WOD A;  2HHM A;  5T3J A;  4MH5 A;  2DE4 A;  4U4X A;  3T22 A;  1MQG A;  2ONR A;  3H3G A;  5M2V A;  4R6Y A;  4LQ5 A;  1FBE A;  4NAP A;  3K6U A;  1IQ7 A;  1BK4 A;  3DP4 A;  4PFY A;  4OWD A;  3JV9 A;  1LGB C;  2THI A;  3Q27 A;  3N94 A;  4OVT A;  3THI A;  4BLA A;  2XD2 A;  3G3J A;  1ZMG A;  5FHN A;  2DWH A;  3UN6 A;  1US4 A;  4G4P A;  3O6I A;  1B46 A;  4N6K A;  3VV5 A;  4NF4 A;  1NUW A;  3RQT A;  2ESN A;  5TPA B;  1MPD A;  5ITP A;  2GRV A;  1IXC A;  4F2Q A;  1NV6 A;  2VOZ A;  4EQ7 A;  2XXI A;  1GVC A;  3VVF A;  4BDN A;  1BP5 A;  4OHN A;  3T66 A;  2ZYK A;  4PGP A;  2CZI A;  2F78 A;  3HHF A;  4FEC A;  5ITO A;  1FTM A;  5DT6 A;  1NFT A;  3IOR A;  2XD3 A;  4BDO A;  1FPB A;  4GL8 A;  3TTK A;  4GWS A;  4ZDM A;  2X7P A;  4RPN A;  4QSE A;  4EF2 A;  1OLA A;  1LAF E;  4N8G A;  4BDM A;  3OEK A;  3O29 A;  1B58 A;  3C34 A;  3AXF A;  1EU8 A;  3C35 A;  4BDQ A;  3TTL A;  2ZZV A;  2ZZX A;  3S9E A;  3O6H A;  1R9L A;  3FVN A;  4R9G A;  2XHD A;  3FBP A;  3FZV A;  1MPB A;  2PYY A;  2XXH A;  1A40 A;  1N7X A;  2XXV A;  3OEN A;  3PGF A;  4POW A;  3H6W A;  5AA2 A;  3BFT A;  5I5P A;  1IMA A;  3BKI B;  2F7A A;  4H5G A;  3FV2 A;  3PPQ A;  1LBY A;  2DE2 A;  5I59 A;  1NNT A;  1HSE A;  1MY3 A;  2F36 A;  3E79 A;  4X48 A;  2WKY A;  3ILT B;  5FHM A;  3GLB A;  1FPK A;  3O9P A;  1FJ6 A;  3K0V A;  3RGY A;  2H9B A;  1S7Y A;  3L6H A;  4PFT A;  3SEV A;  1FBH A;  3K6V A;  1FPD A;  1PDA A;  2Y7W A;  4KR5 A;  2HZK A;  1URD A;  4MCO A;  1P1O A;  1FTL A;  2XWO A;  3C36 A;  1CB6 A;  4TLM B;  4PAK A;  4HE0 A;  3PPO A;  1US5 A;  3O28 A;  1DPE A;  3TOD A;  4EDP A;  5I2N B;  1WDN A;  2ZNS A;  5ET8 A;  4OET A;  5CMK A;  4DE8 A;  4LN5 A;  4NX1 A;  3PMW A;  1YCJ A;  5DEX A;  1NNF A;  2OWS A;  4NMY A;  1IIT A;  3TYH A;  5DW8 A;  5JTY A;  2HXW A;  1YPN A;  4LP2 B;  5DVF A;  1QVS A;  4ISU A;  3FUZ A;  4N13 A;  4YZZ A;  4TOZ A;  2KQZ A;  3LUZ A;  4LA9 A;  1FJ9 A;  2WBB A;  4AB5 A;  2WX9 A;  4OVR A;  3U72 A;  3O6G A;  3R26 A;  1HSL A;  4IO5 A;  3MQ9 A;  3EKI A;  1UTH B;  2PT2 A;  1Z7M E;  5LOM A;  4UAB A;  1EZP A;  2DWA A;  1XVX A;  3DEL B;  2OWZ A;  3EQ1 A;  3JZJ A;  1MDP 1;  3KG2 A;  4P1L A;  2Q8M A;  2Y7K A;  1D3K A;  4NQ8 A;  3GBB A;  1NV3 A;  5HBC A;  2F7C A;  5JEI A;  3LV0 A;  4C1T A;  2F6P A;  2I48 A;  2ALU A;  1IMD A;  2Z8E A;  4IGT A;  2QS3 A;  1NUX A;  2HCA A;  4H45 A;  4GQO A;  3M3F A;  4ZZA A;  4E0X A;  4YMA A;  4YB6 A;  3M3L A;  3UOR A;  1H76 A;  1YXI A;  3W15 C;  3K01 A;  3M8U A;  4PET A;  2OLB A;  5DVJ A;  2F5X A;  3T93 B;  2B3F A;  5CM6 A; 
#chains in the Genus database with same CATH homology
 2I4C A;  2VP1 A;  3C33 A;  2A5S A;  4F3B A;  4OYV A;  4RY1 A;  2HAU A;  3CIJ A;  4U22 A;  5FTH A;  1JEU A;  4MLQ A;  1B7Z A;  1UTH A;  3LSL A;  5ELV A;  2V3T A;  4QF9 A;  3TZA A;  1B3E A;  1MXZ A;  1XS5 A;  2Q9T A;  3V83 A;  4X1D A;  5L9S A;  2QSX A;  3LUY A;  5I57 B;  2B3B A;  1B5H A;  4LON B;  4R72 A;  3KFM A;  3GXA A;  2H4I A;  1POY 1;  3C9H A;  2XX9 A;  3B6W A;  2H25 A;  1LBC A;  1QW0 A;  1B3L A;  3FXU A;  3HN0 A;  3IB0 A;  3SES A;  2I3V A;  4H8J A;  3A3C A;  4MBP A;  3TTN A;  2O6A A;  5HM4 B;  1R1N A;  1SI0 A;  2I0C A;  4EUO A;  3G3G A;  5IKB A;  4DCY A;  2XX8 A;  2OK2 A;  4YKK A;  4ZEB A;  4ZE8 A;  4ELO A;  4ECF A;  1FQF A;  1MG1 A;  1B51 A;  1XC1 A;  3W9V A;  2UXA A;  2V84 A;  2VHA A;  2YJP A;  1FQC A;  2CMO A;  3KEI A;  3QIM A;  3QSL A;  4BDR A;  3OO7 A;  2Z22 A;  3QYT A;  4NF6 B;  2Q89 A;  3N6U A;  3OSR A;  4I8C A;  1IZ1 A;  1ZU0 A;  4KD5 A;  3ECR A;  2O69 A;  4ONY A;  3UK4 A;  2R6G E;  3KJ7 A;  5F7V A;  3LSW A;  4OTE A;  4HW8 A;  5H8N B;  2Y7R A;  2LAO A;  3H03 A;  2PBW A;  3MVZ A;  4XIG Q;  4ZEI A;  3TUS A;  1LCF A;  3SDF A;  3CG1 A;  1A55 A;  1M5D A;  1MPC A;  1N04 A;  2E0S A;  2DQV A;  2REJ A;  4C1U A;  3V5A A;  4DLD A;  1B6H A;  4H67 A;  1QKB A;  4F1U A;  4IO7 A;  2RC7 A;  1HSJ A;  1MY4 A;  1F9B A;  5A5X A;  3SET A;  1MQH A;  4FJP A;  1UIU A;  5I2K B;  2GHA A;  2NUV A;  3CG3 A;  3B6Q A;  3LC8 A;  3HHG A;  3TDJ A;  1B05 A;  1JET A;  1ZJL A;  2I6E A;  1JVX A;  3GZG A;  4O3A A;  2Q2A A;  4O3C A;  4OEV A;  1ZLQ A;  2PX1 A;  4OER A;  4ZS9 A;  3IOU A;  2OCU A;  3IL1 B;  2NOO A;  2AL5 A;  3EN3 A;  4DXC A;  1MRP A;  2ONS A;  1GV8 A;  2DSF A;  4RYA A;  4YKI A;  3S4U A;  5ICT A;  4DXB A;  3S9M C;  3SER A;  3Q28 A;  1URS A;  4HCW A;  4RXL A;  3UGW A;  1JW5 A;  1LCT A;  1T0K A;  4WED A;  4XTC Q;  1AL3 A;  1LB9 A;  4U21 A;  2GHB A;  1MH3 A;  2DP8 A;  5L9M A;  1FTK A;  3OSQ A;  4GFR A;  3VLV A;  2BJJ X;  3QK6 A;  1Y4T A;  4E0W A;  3SKP A;  3PUY E;  1YTV A;  3B6T A;  3IO6 A;  4QSD A;  1ZIU A;  4U23 A;  3N5L A;  2H99 A;  3RPW A;  1NH7 A;  3HPI A;  1SQY A;  3TFL A;  3QUJ A;  1MQD A;  2R9J A;  1FQA A;  4R73 A;  1LFI A;  3FGS A;  3IJX B;  3LBS A;  4PFW A;  3MVW A;  1QUI A;  2F34 A;  3PD9 A;  1JEV A;  3MPL A;  2DWI A;  3VLW A;  1M5B A;  1MH4 A;  1MXY A;  4X1B A;  5I56 A;  2F8D A;  3H6V A;  4YU0 A;  2AIX A;  5I59 A;  3TKD A;  2GFE A;  4C0R A;  1N7W A;  1NL5 A;  1DMB A;  2VGQ A;  3QXM A;  4KFQ A;  2ZYM A;  3U94 A;  4NWD A;  3EPE A;  2UVG A;  2RF1 A;  4H5F A;  2DYX A;  5KZT A;  2I49 A;  3MVX A;  1Y1M A;  1TFD A;  5DYH A;  2V3Q A;  2QS2 A;  4I62 A;  1NMU A;  4WKM A;  3PPR A;  4F31 B;  5AA3 A;  5ISU A;  2CZL A;  3FIR A;  1IXH A;  1XOC A;  2RCB A;  1MXV A;  5DVI A;  5FTI A;  3CFX A;  5KDT B;  1OMP A;  2HAV A;  3DP8 A;  3OO8 A;  1BTJ A;  3TAJ A;  2XXP A;  5H8H B;  5AE4 A;  4NTL A;  2QPQ A;  1EH3 A;  4F19 A;  1B4H A;  3O66 A;  4YIC A;  1IEJ A;  3MPK A;  1WVJ A;  2REG A;  5M2V A;  1NH8 A;  4GRK A;  1A8E A;  1FQD A;  1Q35 A;  3DLN A;  4UA8 A;  3WAE A;  4N07 A;  2F6G A;  3UP9 A;  1P1U A;  1SYI A;  3C4M A;  3L6G A;  1D4N A;  4RK9 A;  4G2Z A;  4GLI A;  1D9V A;  1FCK A;  1TT1 A;  1LB8 A;  2XX7 A;  4MLV A;  2AL4 A;  3ODB A;  1LAG E;  2Z8F A;  3PV0 E;  4GWO A;  4G8M A;  4XXU A;  1UTB B;  3K02 A;  4P0I A;  3FJ7 A;  4XKQ A;  3TCG A;  3VVE A;  4RK2 A;  3U1O A;  4HS7 A;  3GBA A;  5H8F B;  1B9J A;  1II5 A;  2DVC A;  1PBP A;  1CE2 A;  5A5X B;  1MM6 A;  5AA2 D;  3TPA A;  4H8I A;  3KN3 A;  5I59 B;  3S9L C;  4QSC A;  1WOD A;  2Q2C A;  5AA4 B;  3O2A A;  1Y9U A;  4MH5 A;  1ATG A;  1XT8 A;  2DE4 A;  4U4X A;  3T22 A;  1LLS A;  1UTB A;  1LST A;  1MQG A;  4G68 C;  2ONR A;  4ZED A;  1OVB A;  3C31 A;  3H3G A;  3HO7 A;  1SBP A;  2RIN A;  4H0W A;  3IB2 A;  2DXY A;  3OEM A;  3KZG A;  4IGR A;  4EXL A;  3CRB A;  3A3U A;  4R6Y A;  2H5Y A;  3V89 B;  2HEU A;  3RUM A;  3LR1 A;  3IO4 A;  4LQ5 A;  2F7B A;  5L8D A;  4Z7E A;  3K2D A;  3K6U A;  1M5E A;  3ZKL A;  2ONK E;  2Z23 A;  1IQ7 A;  5JK4 A;  1MDQ A;  3DP4 A;  4PFY A;  4OWD A;  1SW2 A;  5I58 A;  3JV9 A;  1IIW A;  1LGB C;  1USY H;  2THI A;  3Q27 A;  3FVK A;  3N94 A;  4F1V A;  3D4G A;  1FW0 A;  2ZXT A;  1LAH E;  4KI0 E;  4NF4 B;  4OFO A;  3PPP A;  1B1H A;  4THI A;  4XKP A;  4ELR A;  1P1N A;  1FQE A;  3FV1 A;  3IJO B;  3THI A;  3MP1 A;  4BLA A;  4DZ1 A;  2O68 A;  4JSO A;  5CRY A;  2XD2 A;  4FEB A;  5H8H A;  5I57 A;  5J1D A;  3G3J A;  4H65 A;  1NNP A;  3Q26 A;  1ZMG A;  3K1M A;  2DWH A;  4Z0I A;  5FHN A;  3UN6 A;  1B4Z A;  3T9H B;  3B7D A;  1US4 A;  4G4P A;  1MY0 A;  3O6I A;  4L17 A;  1B46 A;  2QS4 A;  1FTJ A;  4U2R A;  3VFJ A;  4NF4 A;  3VV5 A;  3TCH A;  3RQT A;  2ESN A;  1Y3N A;  3EHT A;  5TPA B;  3KN7 A;  3N26 A;  4GIZ A;  2FNC A;  2RC9 A;  3FVO A;  1H3D A;  3OD7 A;  5AA2 B;  3MVY A;  3QAX A;  1B5I A;  2A5T A;  1MPD A;  5ITP A;  4UAC A;  4K3F A;  1VSO A;  2GRV A;  2ANJ A;  1IXC A;  1H45 A;  2ZYO A;  3IX1 A;  4ZEK A;  2PVU A;  3D4C A;  3VXB A;  4F2Q A;  1ELJ A;  1Q1K A;  2VOZ A;  4EQ7 A;  2VD3 A;  2Y7P A;  2O51 A;  3F11 A;  1DPP A;  1B1X A;  2O1L A;  2XXI A;  1Y1Z A;  1GVC A;  3T9V A;  3VVF A;  2H98 A;  1USY E;  4QHQ A;  4BDN A;  4JWY A;  1BP5 A;  2XXY A;  3G3K A;  4OHN A;  3W9W A;  4ELP A;  1EZ9 A;  3H4Z A;  3T66 A;  2ZYK A;  4FAJ A;  2RKM A;  2P0S A;  3H6T A;  3K6X A;  3MZB A;  4F1Y A;  1P1Q A;  4IO6 A;  2UYF A;  2F78 A;  4KQP A;  1SW5 A;  2QS1 A;  4PFU A;  2O7I A;  4R9F A;  3FXQ A;  4OXV A;  3BBR A;  2B65 A;  4KYE A;  4QFK A;  4LVQ A;  3HHF A;  4FEC A;  1J1N A;  4R2B A;  5I2K A;  5ITO A;  3PUW E;  3K00 A;  1FTM A;  5DT6 A;  5DEX B;  2ZMB A;  4FED A;  1A8F A;  1NFT A;  4Q0C A;  4F3P A;  5AA4 A;  4ZZE A;  1GR2 A;  2ZNT A;  4NF5 B;  4F39 A;  1B3F A;  4MFI A;  3IOR A;  1BKA A;  2XD3 A;  3E13 X;  4ZE9 A;  2KLF A;  1VE4 A;  1DSN A;  3SEY A;  2UVH A;  1SW4 A;  4BDO A;  4GD5 A;  5CMM A;  1MXW A;  1SW1 A;  1P99 A;  4GL8 A;  3SEX A;  3TTK A;  4MF3 A;  2XXR A;  5H8F A;  3IOW A;  3OXN A;  2OZZ A;  1A99 A;  2XXW A;  4GOT A;  4OES A;  1MS7 A;  2X7P A;  4RPN A;  3KN8 A;  4ZDM A;  4QSE A;  2V3U A;  1OLA A;  4KCC A;  4EF2 A;  3MBP A;  4F29 A;  1N76 A;  1LAF E;  4BDM A;  1PB7 A;  2YLN A;  3OEK A;  4G77 A;  3RLF E;  2RCA A;  2ZYN A;  2Y84 A;  4JWO A;  4OFL A;  4QFL A;  5FHO A;  4R6K A;  2XXQ A;  3I5O A;  3O29 A;  1B58 A;  1AMF A;  1YAE A;  4EXK A;  3C34 A;  3AXF A;  1EU8 A;  2G29 A;  3C35 A;  3C32 A;  1S50 A;  3FD3 A;  3RNN A;  4LZ8 A;  4NWC A;  4OEN A;  4BDQ A;  4G8H A;  4YKJ A;  2F97 A;  2DS9 A;  3TTL A;  1N3X A;  1B7U A;  1H43 A;  3OO9 A;  1B3H A;  5KCJ A;  3PPN A;  3MZ1 A;  3R7X A;  1SDX A;  3S9E A;  3EHU A;  3O6H A;  4JSD A;  4YAH X;  1R9L A;  3FVN A;  4ND9 A;  4FAT A;  1TFA A;  4R6H A;  3V8X B;  4R9G A;  2XHD A;  3T9X B;  5B70 A;  3KBR A;  4LUB A;  3FZV A;  4GXS B;  4P0G A;  1MPB A;  4EF1 A;  2PYY A;  2XXH A;  3TEL A;  3IK6 B;  1A40 A;  3KSX A;  4PQJ A;  2QL3 A;  2HZL A;  1DTZ A;  4QRZ A;  1QJM A;  3BFU A;  5CI5 A;  1ZKB A;  4ESX A;  3G3I A;  4NF8 A;  1N7X A;  2OWT A;  2XXV A;  3PMX A;  3SEU A;  3T9U A;  3U92 A;  4Q8R A;  1O63 A;  4KYD A;  2I4B A;  5H8S A;  3OEN A;  1ZTY A;  1LBB A;  3N6T A;  3PGF A;  4XKR A;  1BLF A;  3E3K A;  4POW A;  5TPA A;  3H6W A;  5AA2 A;  1B52 A;  3BFT A;  1B3G A;  4RNS A;  3BKI B;  4IO3 A;  3KOS A;  1AIV A;  2F7A A;  4H5G A;  3FV2 A;  3PPQ A;  4IY6 A;  4LAT A;  4WEP A;  3Q29 A;  1Y3P A;  4QFN A;  3VLU A;  3EF7 A;  2DE3 A;  2DE2 A;  3IR1 A;  3K1N A;  4LZ5 A;  1NNT A;  1HSE A;  1SD3 A;  2GH9 A;  1RKM A;  3U93 A;  1MY3 A;  1VFD A;  3FXR A;  3MC2 A;  2Q88 A;  2F36 A;  1JW1 A;  3PU5 A;  4FOR A;  4H1X A;  4PE5 B;  3OEL A;  3R6U A;  5DTB A;  2HFB A;  2QMW A;  4X48 A;  3OMB A;  4DDD A;  2WKY A;  3ILT B;  5JTY B;  1LAX A;  3I3V A;  2PT1 A;  1PC3 A;  3OOA A;  5FHM A;  3VDF A;  3RTF B;  3TCF A;  1M5F A;  3GLB A;  5CC2 A;  3TTR A;  4QFP A;  3O9P A;  3ONM A;  1QUK A;  2Z8D A;  3K0V A;  4AQ4 A;  1R6Z A;  4KYS A;  4FIM A;  1JW4 A;  1Y3Q A;  2ZNU A;  2H9B A;  3RGY A;  3DM0 A;  1SYH A;  4OMB A;  2AYS A;  4I9D A;  1S7Y A;  3H7M A;  3CFZ A;  4LZ7 A;  4F18 A;  2UYE A;  4OQO A;  2NVU B;  2I58 A;  5I56 B;  1MQI A;  1O7T A;  3L6H A;  4FE8 A;  4M4G A;  3HV1 A;  5AA1 A;  4EQ9 A;  3FJM A;  1OIB A;  4PFT A;  4P11 A;  2NWJ A;  1Y20 A;  5H8Q B;  4ZEF A;  1VR5 A;  1B7H A;  1AH5 A;  2VD2 A;  3K6V A;  3LSX A;  4IO4 A;  5K2X A;  3SEV A;  4F22 A;  1XVY A;  1EZO A;  1IUD A;  2E1S A;  1PDA A;  2D3I A;  2X26 A;  2QRY A;  5EHM A;  3UA8 A;  2ABH A;  5TU0 A;  4DIG A;  5EHS A;  1MY2 A;  2Y7W A;  4G8N A;  4DXU A;  4RJZ A;  1B0H A;  4KR5 A;  5ICQ A;  2HZK A;  3MJN A;  5L9O A;  1MQJ A;  3VXC A;  1URD A;  1S9T A;  3G7W A;  1PEB A;  3KGC A;  1IXI A;  5TP9 B;  1P1O A;  1KWH A;  4JDF A;  1FTL A;  3CSG A;  4GVO A;  1JVY A;  3TQW A;  3G3F A;  5I2N A;  4GXA A;  4R74 A;  3RT8 A;  1VFE A;  4F2O A;  4ZEC A;  3C36 A;  1CB6 A;  1MXX A;  4X9T A;  4ELQ A;  1PB9 A;  4TLM B;  2I0B A;  4U1Z A;  3RT6 B;  4NE4 A;  3S2V A;  3U8Q A;  1ANF A;  3H6U A;  3TQL A;  2DOJ A;  3PPO A;  4BDL A;  1QUL A;  1NKX A;  3I6V A;  1US5 A;  3O28 A;  3MAM A;  4JB7 A;  3LSF B;  1D9Y A;  1DPE A;  3TOD A;  1I6B A;  4DCX A;  4EDP A;  2Y7I A;  3P7I A;  4GL0 A;  2A5T B;  5I2N B;  2XXU A;  1WDN A;  2ZNS A;  3KSJ A;  3OO6 A;  4IO2 A;  3CSB A;  4OET A;  5CMK A;  1AOV A;  4DE8 A;  4POX A;  4EQB A;  3TMG A;  3UIF A;  2IA4 A;  3MP6 A;  4RA1 A;  1OQH A;  3PMW A;  1YCJ A;  5DEX A;  3G3H A;  2QJE A;  1NNF A;  2DVZ A;  2NXO A;  3H06 B;  2OWS A;  1URG A;  3K6W A;  3M3K A;  4NMY A;  1I6Q A;  1IIT A;  1OVT A;  1OLC A;  3RN8 A;  1N84 A;  3TYH A;  2OBG A;  4R75 A;  4M1V A;  5JTY A;  2HXW A;  1YPN A;  2O1M A;  1DTG A;  1H44 A;  2UVJ A;  4LP2 B;  5DVF A;  5CBR A;  4IB2 A;  2D21 A;  1QVS A;  4HTG A;  1I6A A;  1FQB A;  4ISU A;  2O84 X;  4G68 B;  1UIV A;  3FUZ A;  1M5C A;  4N13 A;  4YZZ A;  4HCY A;  2W7Y A;  4TOZ A;  1I69 A;  3T96 B;  3ILU B;  4WXJ A;  3E4R A;  1B0L A;  1PBQ A;  2X7Q A;  1QUJ A;  4Q5T A;  1L5T A;  4JBZ A;  4LA9 A;  3QUF A;  4O3B A;  4AB5 A;  1DOT A;  1O64 A;  2G93 A;  3Q25 A;  5CBS A;  2I3W A;  5K2Y A;  3U72 A;  2DXR A;  3HST A;  3CR9 A;  3O97 A;  3O6G A;  3R26 A;  3K1P A;  3ZS6 A;  1GTK A;  2FA7 A;  1HSL A;  4IO5 A;  4ESW A;  2M8C A;  4TLL B;  2Q8J A;  3A09 A;  5F1Q A;  4F3G A;  4YB7 A;  1B32 A;  3CI8 A;  2F35 A;  3EHS A;  1R9Q A;  1SI1 A;  2RC8 A;  3MQ9 A;  3MUQ A;  4KCD A;  4GF8 A;  4N6P A;  4NF5 A;  5BWJ A;  3TEP A;  1UTH B;  3KJT A;  4U1O A;  1A54 A;  1Z7N E;  2PT2 A;  1Z7M E;  2IEE A;  3JYR A;  4R2F A;  5LOM A;  3IOT A;  5TP9 A;  1EZP A;  2DWA A;  1XVX A;  4KHZ E;  3K4U A;  3DEL B;  1IXG A;  4OVJ A;  5H8Q A;  5CM6 A;  3EQ1 A;  1MY1 A;  4TQU Q;  3PUZ E;  5HPQ A;  2R71 A;  2UVI A;  3JZJ A;  4NF6 A;  1RYO A;  1QKA A;  1RYX A;  1B2H A;  1MDP 1;  2OJT A;  3KG2 A;  4XKN A;  3RY3 A;  3PD8 A;  4NF8 B;  3WAF A;  3ZKK A;  4PP0 A;  5B7D A;  1A7L A;  3S9N C;  1POT A;  1XHY A;  2P1S A;  1ZBM A;  1B40 A;  2Y7K A;  3CFL A;  3CVG A;  3MW0 A;  4I1D A;  4IY5 A;  3RTW B;  1GGG A;  1D3K A;  1SVX B;  2HQ0 A;  2PMS A;  4OZ9 A;  1TXF A;  4U4S A;  4LQ2 A;  3HCQ A;  3GBB A;  4JWX A;  4KPT A;  5HBC A;  3SEW A;  5IAI A;  1UQW A;  5KCJ B;  2DWJ A;  3PUV E;  4YKP A;  2F7C A;  1B5J A;  5JEI A;  3VVD A;  3IB1 A;  4C1T A;  2F6P A;  1P1W A;  5I84 A;  5KDT A;  2I48 A;  3E9X A;  2V25 A;  2ALU A;  1MM7 A;  4YB5 A;  3VE1 B;  5BUU A;  2D5W A;  1JQF A;  2Z8E A;  2FYI A;  3MZ9 A;  1JNF A;  3FVG A;  4IGT A;  4F3S A;  1NNK A;  4OFJ A;  1N3W A;  1LFH A;  3FJG A;  2QS3 A;  2O7U A;  2HCA A;  5CMB A;  3PMV A;  4GQO A;  4RPO A;  2XXT A;  3DP6 A;  3FAT A;  3IAZ A;  1MXU A;  3M3F A;  3PUX E;  4AB6 A;  4ZZA A;  3MWB A;  4E0X A;  4YMA A;  4YB6 A;  1LFG A;  3M3L A;  2P2A A;  2YPN A;  3FAS A;  5H8N A;  1BIY A;  3UOR A;  3ZSF A;  5I58 B;  4QFO A;  1Y4C A;  4H6D A;  1OQG A;  3KOT A;  1H76 A;  4Q30 B;  3W15 C;  5EYF A;  1TWY A;  5CMC A;  3K01 A;  3IOV A;  3M8U A;  3MP8 A;  4JXI A;  3TTM A;  3USD A;  4YMB A;  4PET A;  2OLB A;  2QMX A;  4OEU A;  5DVJ A;  1FTO A;  4G68 A;  1N0T A;  2F5X A;  3T93 B;  2V93 A;  1PB8 A;  2B3F A;  2XXX A;  4NED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...