1WODA

Crystal structure of moda, a molybdate protein, complexed with tungstate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
GKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODA
publication title Crystal structure of the molybdate binding protein ModA.
pubmed doi rcsb
molecule tags Transport
total genus 78
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 1997-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1wodA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1wodA02
3TZAA 5TPAB 1BTJA 4I9DA 3O6HA 3OSRA 1AH5A 4OWDA 4JWYA 3TKDA 4OETA 5AA2A 1POTA 5ICTA 1VFDA 3IAZA 1UTHA 1B9JA 4NMYA 5CBRA 1P1QA 4H5FA 4U4XA 4GQOA 1NFTA 4EF1A 5I84A 1USYE 2QS3A 4PFWA 4R9FA 3LSWA 3TTMA 2PX1A 5I2KA 1IEJA 1IXCA 4ZS9A 4GOTA 2I6EA 5H8QB 1KWHA 3CFLA 3T96B 4ZEIA 3S2VA 1MY3A 3W9WA 3RT8A 3FVKA 1PBPA 4F1YA 2HQ0A 2I3WA 3PPPA 3TCHA 4GIZA 1WVJA 4EQBA 1JNFA 4IB2A 3H6VA 1JETA 4NEDA 3UORA 1LLSA 1BP5A 3C36A 4F29A 3BFTA 2G29A 3O28A 2W7YA 3TYHA 2OLBA 2P1SA 2RC9A 3AXFA 4ESWA 1FQBA 3ZKLA 4O3AA 2DP8A 3CFZA 4DCYA 1NH8A 3RT6B 4ZEDA 3K6VA 3PPRA 4QFPA 1S9TA 2XXPA 2Q2AA 3I6VA 3H3GA 1MXWA 3HHFA 3THIA 1IUDA 1N76A 2VP1A 1MDP1 2O1LA 3FATA 1FTLA 4F3GA 5DYHA 4U22A 2FYIA 3CI8A 4NF8A 1P99A 4R6YA 2DWJA 3C4MA 3H06B 2HZKA 2B65A 5L9OA 3IJXB 3FIRA 2REJA 4EXKA 4TOZA 2XXVA 3IB1A 1VR5A 1S7YA 4IO4A 2Q88A 1ZJLA 2QSXA 4YICA 4R6HA 3JYRA 3N5LA 1SBPA 1UTHB 4QFLA 3K01A 2UYEA 4KHZE 2H9BA 3MP6A 1GR2A 3SETA 1MH4A 4DXUA 4AB6A 3N26A 3UK4A 4IO3A 3IO6A 4P11A 4M1VA 5FHNA 1Y3QA 3KOSA 3OENA 4YKJA 1ZMGA 1LB9A 3LC8A 2PYYA 3RLFE 3CG3A 2XXTA 1B46A 4EQ7A 4M4GA 1BIYA 4H1XA 2UVGA 4LQ5A 4YB5A 2O7UA 3FGSA 1B5HA 3SEVA 3H6UA 2XXRA 1EH3A 2A5TA 5EYFA 3Q26A 3OEKA 3T9XB 4WEPA 4JB7A 4IO7A 1UTBA 4OFJA 4LQ2A 3MZ1A 4WKMA 3B7DA 1TT1A 4ZEBA 3A3CA 5DVFA 3T93B 4C1TA 3DP6A 1MQJA 2UVIA 4KD5A 3IORA 1B0HA 4O3CA 4IGTA 3V8XB 4OXVA 3DM0A 1LCTA 3GXAA 4MFIA 3A3UA 3IOTA 3U72A 4R9GA 1LBCA 1P1NA 4FE8A 1XS5A 1MRPA 4G4PA 2VD3A 2UVHA 4LATA 4H6DA 2Q2CA 3SEUA 4X1DA 4THIA 4ZEFA 3FV1A 3SEYA 1B0LA 1PBQA 5TP9A 3PUZE 5DVIA 3UGWA 1N84A 3EQ1A 4RXLA 3T66A 3V5AA 4I1DA 2QS1A 5CRYA 3IO4A 5CBSA 2ONSA 3FVGA 2V93A 2RF1A 3R7XA 1MQHA 3VXBA 2Q9TA 1B1HA 3K4UA 2ONKE 4DLDA 3LSFB 4RPOA 4NE4A 3KEIA 2XXYA 1LAHE 5I59A 3ZS6A 1ZBMA 4F22A 4DDDA 1GGGA 2F6GA 1MXXA 5ITOA 2OK2A 4XIGQ 1Y1ZA 1LFHA 2LAOA 1UTBB 4R75A 2RC8A 1B51A 3TMGA 5TU0A 1F9BA 4RA1A 2YPNA 4R2FA 1SVXB 4ZEKA 2Z23A 3TTRA 1NKXA 1NNTA 3IOUA 1H3DA 2IA4A 1QUJA 1ZKBA 4PP0A 2PVUA 3MJNA 4P0GA 4NWDA 1IZ1A 4MLVA 1US5A 3K1NA 1EZOA 3KOTA 1Y4TA 4QFNA 2O51A 3MC2A 2I0BA 1P1OA 1OQGA 3GBBA 4YZZA 2PT1A 1RKMA 4Q0CA 3U94A 1FQCA 1YCJA 1QULA 1H76A 3V83A 2DQVA 3H4ZA 4IGRA 2WKYA 4XKPA 3KN8A 2O84X 3OSQA 1IITA 1A40A 1MH3A 3SDFA 3PV0E 2QS2A 4U4SA 1LCFA 1H43A 2XXXA 3CR9A 3G3FA 1MQGA 2V84A 4IO6A 2UXAA 2XXIA 1MY1A 3KBRA 3KZGA 1CB6A 1NNPA 2ZNSA 3QIMA 4H65A 3BFUA 4YKIA 3R6UA 2E0SA 3UA8A 4EXLA 3ONMA 1AMFA 3S9EA 4HCYA 3QYTA 3ECRA 3KG2A 3EHSA 3IJOB 4GWOA 4LZ8A 2FA7A 1EZ9A 4FAJA 1B3FA 4C0RA 3MVWA 2XX9A 1CE2A 3JV9A 4R72A 3VDFA 1SI1A 2NOOA 4POWA 3TUSA 2H5YA 3CSGA 3OELA 2D5WA 4RPNA 1YTVA 3O66A 3T9HB 4JSDA 3VXCA 1IXIA 1RYOA 5DT6A 3PD9A 3K6UA 2RKMA 1ANFA 2AYSA 1I6QA 3GBAA 2NVUB 4Z7EA 1EZPA 4X48A 3FXQA 2F78A 5EHMA 3PPQA 1O63A 3ODBA 3H03A 5M2VA 5KZTA 1TWYA 4OHNA 4E0XA 1R9QA 3H7MA 5H8FA 1SD3A 4IY5A 3IK6B 5B70A 3VVEA 4QF9A 5HBCA 3USDA 4BLAA 1HSLA 4ZZAA 3FVOA 2DYXA 3IB2A 1XVXA 2GRVA 4OZ9A 1MXUA 3MVXA 5I2NB 3SEWA 3IB0A 4K3FA 4LUBA 1B40A 3U93A 1M5DA 4PFTA 4KFQA 1D9YA 5I56A 1URSA 4GFRA 4ZDMA 3TFLA 3OMBA 2DXYA 3UIFA 1ZIUA 4U23A 2ZNTA 4PE5B 3PUVE 4JWXA 1IQ7A 3SKPA 2CZLA 1FTOA 3MP8A 3U8QA 4LVQA 3IR1A 1GVCA 1SW5A 2B3BA 4G68C 3TDJA 3EN3A 1VFEA 4YKPA 4U21A 1TFDA 4NF5B 1DPPA 2XXUA 1JVXA 3N94A 2V25A 5ELVA 4MF3A 5CI5A 1GV8A 1MG1A 2NWJA 3RGYA 3LUYA 3KGCA 2PMSA 4FECA 4IO5A 2DWHA 2I0CA 2XD3A 3DELB 4LA9A 2ZYOA 3S9NC 4OESA 3S9MC 3EHUA 3DP8A 4ECFA 4KYDA 1OLAA 4XKRA 5H8FB 1Y9UA 4YB6A 3H6WA 1JW1A 4GL8A 4F1UA 4G77A 4FJPA 1H44A 3Q25A 3RN8A 4H8IA 3HPIA 1Z7ME 2O7IA 1SW1A 3OO7A 3M8UA 4EDPA 2A5SA 4DE8A 2R9JA 2ABHA 1R9LA 1JW4A 3SEXA 5AA2B 4EF2A 4ONYA 5AA4A 4N07A 3HV1A 1DTZA 3TAJA 1JW5A 3W9VA 2KLFA 4ZECA 2HAUA 2ZYKA 4F2OA 1B5IA 3LSLA 3WAEA 4I8CA 2H4IA 1BLFA 1NNFA 1Y4CA 2V3QA 2UVJA 3U92A 5I2KB 5I56B 5L8DA 1LGBC 3K2DA 2B3FA 1ZLQA 3KJ7A 1DTGA 2QJEA 4XXUA 3CSBA 1N04A 4RJZA 4R74A 3GZGA 4MH5A 4F3PA 3K6XA 3G3JA 2OWTA 1YAEA 4OEUA 2F36A 1IXGA 2GHAA 4FATA 3D4CA 4ESXA 1USYH 4F3SA 2Y7RA 3MQ9A 1MPBA 4HTGA 2QMWA 4F19A 1OVBA 4QFKA 3JZJA 3MVYA 4ZZEA 1N3WA 3G3GA 3E9XA 1B52A 3L6HA 4QHQA 3TQWA 3TEPA 4GF8A 1B7ZA 4RNSA 3OO9A 2GH9A 1T0KA 2XX7A 1IXHA 4XKNA 2DE2A 4KI0E 1AL3A 4JDFA 1B3HA 3FD3A 5I57A 1ZTYA 3K02A 4NF8B 5A5XA 2Y7PA 4QSCA 4KPTA 4AQ4A 3TTKA 1Y1MA 4YMBA 3RUMA 1QKBA 1FTMA 2F97A 3K6WA 2F6PA 5I58A 3TTNA 1WODA 1B5JA 3F11A 5K2XA 3HHGA 2I3VA 2F7AA 4N6PA 2F34A 4UA8A 4OFLA 3D4GA 5FTIA 4HW8A 3IOWA 3Q29A 1FQEA 4OTEA 3E4RA 4YU0A 1A54A 3CIJA 3VVDA 2F5XA 3SESA 3PUYE 2ZMBA 2X7QA 1JEUA 3FJMA 2VD2A 3FVNA 3C31A 1ELJA 4ZE9A 5IAIA 1B58A 1OLCA 3PPNA 3M3KA 3M3LA 4RYAA 1H45A 3VVFA 2XHDA 1A8FA 3HO7A 4GD5A 1A55A 2A5TB 3ZSFA 2ZXTA 4NF6A 2O1MA 4H8JA 4DXCA 5BUUA 3N6UA 2ZNUA 1Q35A 2THIA 4KYSA 1NMUA 3B6WA 2F7BA 4QSDA 4AB5A 2D21A 3T22A 1HSEA 1B7UA 3QXMA 3Q27A 5IKBA 4OERA 2VHAA 4PETA 2UYFA 3C32A 4RK9A 3RNNA 3K0VA 1ATGA 2V3UA 3CVGA 5AA1A 4WEDA 5I58B 4OVJA 3HSTA 4LONB 3C9HA 1SYIA 3VLWA 1PB7A 2F8DA 4L17A 5TP9B 3A09A 1SI0A 5TPAA 4JSOA 4G8NA 5KDTA 4KR5A 4DCXA 1MXVA 3KSXA 5FHMA 3PD8A 1OIBA 5K2YA 3L6GA 1R1NA 4E0WA 1VE4A 4U2RA 5CMCA 2RINA 5BWJA 4Q5TA 1MY2A 1UIVA 1P1UA 3MPKA 3ZKKA 3G3IA 3FJ7A 3FZVA 4BDLA 4UACA 2F35A 3OEMA 4Z0IA 2HAVA 3EF7A 3BKIB 2DS9A 5B7DA 1TFAA 4F2QA 5I59B 1UIUA 3EPEA 1LAXA 5CMMA 3RY3A 3TODA 1FTKA 4GRKA 5JK4A 3K1MA 3MW0A 4F31B 4ELRA 3HN0A 4OFOA 1URDA 1FTJA 2P2AA 1QW0A 2HFBA 3QK6A 3C35A 1Y3PA 3EHTA 2H99A 3G3HA 1B7HA 4HS7A 3CFXA 4TQUQ 1JVYA 3FUZA 1PB9A 1D3KA 2Q8JA 2RCAA 2AL4A 3VE1B 4DIGA 3IX1A 2X7PA 2AL5A 5DEXA 3RQTA 4R6KA 3O6IA 3PU5A 3VLVA 1I69A 3VLUA 4JWOA 1DPEA 3B6QA 2Q89A 1MM6A 2DE4A 2QRYA 1LSTA 1XC1A 1EU8A 4G2ZA 2YLNA 3MUQA 4RY1A 2REGA 3MVZA 5ICQA 1YPNA 3TCGA 2O69A 3OO6A 1B1XA 1XT8A 4OYVA 2H98A 1B05A 4ZE8A 5KDTB 3I3VA 2G93A 4JXIA 4OMBA 4N13A 5AA3A 1FW0A 2DVCA 2OJTA 1B4HA 3LR1A 4YAHX 4OEVA 3M3FA 3UP9A 2IEEA 5L9MA 2ALUA 1B3GA 4Q30B 1TXFA 3OO8A 5JTYA 5KCJA 2GFEA 1B2HA 2R6GE 2H25A 3R26A 4F1VA 1J1NA 3TPAA 2XXHA 1B3LA 3GLBA 3S4UA 4BDMA 1MXZA 4C1UA 4F3BA 1QVSA 3VFJA 1M5BA 3TELA 3SERA 2ONRA 4GL0A 1M5FA 4DZ1A 1FCKA 2Z8FA 1I6AA 3C33A 1D4NA 2NXOA 2QS4A 3PMWA 2OWSA 2XXQA 2DWAA 3TCFA 2GHBA 3PMVA 4YB7A 2HCAA 1MPCA 2Y7IA 5CMBA 1B3EA 3Q28A 4LZ5A 5DEXB 3T9VA 2HXWA 2FNCA 2DVZA 2XD2A 4F39A 4LZ7A 3TQLA 2O68A 1S50A 1II5A 3QUFA 1UQWA 1XHYA 3MBPA 4IY6A 4QFOA 1PDAA 2PBWA 3O2AA 2O6AA 3HCQA 3U1OA 2Y7WA 1SW2A 1SYHA 4R2BA 2HEUA 1N7XA 4I62A 1LFIA 2I49A 1P1WA 4ISUA 4O3BA 2DWIA 4WXJA 1QUKA 4OENA 2Z22A 1N3XA 1SW4A 3O9PA 1O64A 1A99A 3FXRA 5LOMA 5EHSA 4GVOA 5H8NA 3KFMA 5JTYB 5KCJB 2I58A 5DTBA 5F1QA 2RC7A 4FEBA 4U1ZA 5FTHA 4YMAA 3E3KA 1LAGE 2R71A 3O6GA 4QRZA 2M8CA 3E13X 2ZYNA 1OMPA 3PUWE 4BDNA 4KQPA 3CRBA 3MZ9A 1B32A 4PFUA 1PB8A 4EUOA 3PMXA 3RPWA 2YJPA 2OBGA 4HCWA 3KN7A 3IOVA 1N0TA 1R6ZA 1ZU0A 2QL3A 2I4BA 2PT2A 1DMBA 5H8HA 2E1SA 4FEDA 1SDXA 1QJMA 1MY0A 2AIXA 4BDOA 1Y20A 4GXSB 1FQFA 4GXAA 1B6HA 3MZBA 1BKAA 4H0WA 1LBBA 3BBRA 3H6TA 2OCUA 2I48A 1MXYA 3DLNA 1Q1KA 5H8SA 5AA4B 5ITPA 2Y7KA 1POY1 1FQAA 4RK2A 1DSNA 3I5OA 4ND9A 3N6TA 4FORA 4QSEA 4TLLB 4U1OA 3O97A 3W15C 1XVYA 3G3KA 5H8NB 4X1BA 1B4ZA 1MQIA 5CC2A 4NTLA 3QUJA 1MM7A 4R73A 2Y84A 4NF4A 4Q8RA 4G8MA 3PGFA 5HM4B 3T9UA 3MP1A 2F7CA 2NUVA 3MPLA 5HPQA 4KYEA 5CM6A 1QUIA 4H5GA 3PPOA 2ANJA 1HSJA 1LFGA 1A7LA 3FXUA 1XOCA 2XX8A 3UN6A 1M5EA 3DP4A 1I6BA 1RYXA 2RCBA 1MY4A 2ZYMA 5AA2D 1N7WA 3QSLA 5H8HB 1IIWA 5DVJA 4TLMB 4KCCA 3MWBA 1MPDA 3PUXE 2P0SA 2HZLA 2I4CA 4BDRA 5I57B 4NWCA 1MS7A 1OQHA 5A5XB 1NL5A 1FQDA 4DXBA 2OZZA 5J1DA 1LB8A 3QAXA 3O29A 4XTCQ 1SQYA 3B6TA 3FASA 2Z8DA 1GTKA 4P0IA 1PC3A 3ILUB 1MDQA 4G68A 2DSFA 2ESNA 4KCDA 4MLQA 1URGA 4JBZA 1Y3NA 5F7VA 3ILTB 2VGQA 3K00A 4G8HA 1AIVA 1D9VA 3OXNA 3KJTA 4ELQA 3MAMA 2DXRA 4IO2A 1MQDA 2CMOA 3WAFA 4OQOA 2QPQA 4GLIA 4NF4B 3TTLA 1JEVA 1US4A 5I2NA 4XKQA 2DOJA 4PFYA 1WDNA 5CMKA 1L5TA 3CG1A 4ELPA 1QKAA 4BDQA 2V3TA 3VV5A 5H8QA 1DOTA 4PQJA 4NF6B 1JQFA 3G7WA 3RTFB 3RTWB 4POXA 2Z8EA 3OOAA 1A8EA 1OVTA 2BJJX 1LAFE 1PEBA 4MBPA 5AE4A 4ELOA 3C34A 3LSXA 4X9TA 3FV2A 3KSJA 4H67A 4NF5A 2QMXA 3LBSA 1NNKA 3OD7A 4EQ9A 1M5CA 3P7IA 3K1PA 1NH7A 3S9LC 1O7TA 4F18A 4FIMA 2D3IA 3V89B 4G68B 5ISUA 2VOZA 4YKKA 5FHOA 2DE3A 2XXWA 3KN3A 4LP2B 1VSOA 3FJGA 1Z7NE 5L9SA 5JEIA 1AOVA 3IL1B 2X26A
chains in the Genus database with same CATH superfamily
3TZAA 5TPAB 2B4MA 4NHBA 1BTJA 4I9DA 3O6HA 3OSRA 1AH5A 4OWDA 4JWYA 3TKDA 4OETA 5AA2A 1POTA 3CHGA 4PAFA 5ICTA 1VFDA 3IAZA 1UTHA 2B4LA 1B9JA 4NMYA 5CBRA 1P1QA 4H5FA 3MYUA 4U4XA 4GQOA 1NFTA 4EF1A 5I84A 1USYE 2QS3A 4PFWA 4R9FA 3LSWA 3TTMA 2PX1A 5I2KA 1IEJA 1IXCA 4ZS9A 4P1LA 4GOTA 2I6EA 5H8QB 1KWHA 3CFLA 2L5VA 3T96B 4ZEIA 4GBWA 3S2VA 1MY3A 3W9WA 5ET7A 3RT8A 3FVKA 2CZKA 1PBPA 4F1YA 2HQ0A 5ET5A 1FPGA 2I3WA 3PPPA 3TCHA 4GIZA 1WVJA 4EQBA 1JNFA 2VT5A 4IB2A 2F3BA 3H6VA 1JETA 2XWVA 4NEDA 3UORA 1LLSA 1BP5A 3C36A 2PFZA 4F29A 3BFTA 2G29A 3O28A 2WBDA 2W7YA 3TYHA 4P9KA 2OLBA 1DCUA 2P1SA 2RC9A 3AXFA 4PGPA 4ESWA 1FQBA 3ZKLA 4O3AA 2DP8A 3CFZA 4DCYA 1NH8A 3RT6B 4ZEDA 3K6VA 3PPRA 3A29A 4QFPA 1S9TA 3FBPA 2XXPA 2Q2AA 3I6VA 4PF6A 3H3GA 1MXWA 3HHFA 3THIA 1IUDA 1N76A 2VP1A 1MDP1 2O1LA 3FATA 1FTLA 4F3GA 5DYHA 4U22A 2FYIA 3CI8A 4NF8A 1P99A 4R6YA 2DWJA 3C4MA 3H06B 2HZKA 2B65A 5L9OA 3IJXB 3FIRA 2REJA 4EXKA 4TOZA 2XXVA 3IB1A 1VR5A 1S7YA 4IO4A 2Q88A 1ZJLA 2QSXA 4N91A 2XWKA 4YICA 4R6HA 3JYRA 5EQ9A 3N5LA 1SBPA 1UTHB 3BIHA 4QFLA 1FPJA 4PBQA 5IZ3A 3K01A 2UYEA 4KHZE 2H9BA 3MP6A 1GR2A 3FXBA 4GWUA 3SETA 1MH4A 4DXUA 4AB6A 3N26A 3UK4A 4IO3A 3IO6A 4P11A 4M1VA 5FHNA 1Y3QA 3KOSA 3OENA 1FPFA 4YKJA 1ZMGA 1LB9A 3LC8A 2PYYA 3RLFE 3CG3A 2XXTA 1B46A 4EQ7A 5F24A 4M4GA 1BIYA 4H1XA 2UVGA 4LQ5A 4YB5A 2O7UA 3FGSA 1B5HA 3SEVA 3H6UA 2XXRA 1EH3A 2A5TA 5EYFA 3Q26A 3OEKA 3T9XB 4WEPA 4JB7A 4IO7A 1UTBA 4OFJA 4OVSA 4LQ2A 3MZ1A 4WKMA 4MMPA 3B7DA 1K9ZA 1TT1A 4ZEBA 3A3CA 5DVFA 2QVUA 1K9YA 2DDKA 3T93B 4C1TA 3DP6A 1MQJA 2UVIA 4KD5A 3IORA 1B0HA 4O3CA 4IGTA 3V8XB 4OXVA 3DM0A 3E78A 1LCTA 3GXAA 4MFIA 3A3UA 3IOTA 2MKZA 3U72A 4N15A 4R9GA 1LBCA 3B50A 4O7IA 5DW8A 1P1NA 2CEYA 4FE8A 1XS5A 1MRPA 4NQ8A 4G4PA 2VD3A 4IR8A 2UVHA 4LATA 4N17A 4H6DA 2Q2CA 3SEUA 4X1DA 4THIA 4ZEFA 3FV1A 3SEYA 1B0LA 1PBQA 5TP9A 3E79A 3PUZE 5DVIA 3UGWA 1N84A 3EQ1A 4RXLA 3T66A 3V5AA 4I1DA 2QS1A 5CRYA 3IO4A 5CBSA 2ONSA 3FVGA 2V93A 2RF1A 2Q8MA 3R7XA 1MQHA 3VXBA 2Q9TA 1B1HA 3K4UA 1NI9A 1NV6A 2ONKE 4DLDA 1DK4A 3LSFB 4PC9A 4RPOA 4MNIA 4NE4A 2ZZXA 3KBZA 3KEIA 2XXYA 1LAHE 5I59A 3ZS6A 1ZBMA 4F22A 4DDDA 1GGGA 2F6GA 1MXXA 5ITOA 2OK2A 1NV3A 4XIGQ 1Y1ZA 1LFHA 2LAOA 1UTBB 4R75A 2RC8A 1B51A 3TMGA 5TU0A 1F9BA 4RA1A 2YPNA 4GX6A 4R2FA 1SVXB 4ZEKA 4P3LA 2Z23A 3TTRA 1Q9DA 1NKXA 1NNTA 3IOUA 1H3DA 2Y5KA 4MNCA 2IA4A 1QUJA 1ZKBA 4PP0A 2JJKA 2PVUA 3MJNA 4P0GA 4NWDA 1IZ1A 4MLVA 3KC0A 1US5A 3K1NA 1EZOA 2ZZVA 3KOTA 1Y4TA 4QFNA 2O51A 3MC2A 2I0BA 1P1OA 1OQGA 3GBBA 4YZZA 2PT1A 1NV2A 1RKMA 2BJIA 4Q0CA 3U94A 1FQCA 1YCJA 1QULA 1H76A 3V83A 2DQVA 3H4ZA 4IGRA 2WKYA 4XKPA 3KN8A 2O84X 3OSQA 1INPA 1BK4A 1IITA 2XA5A 1A40A 1MH3A 3SDFA 1RDYA 3PV0E 2QS2A 4U4SA 1LCFA 1H43A 2XXXA 3CR9A 3G3FA 1MQGA 2V84A 4IO6A 2UXAA 2XXIA 1MY1A 3KBRA 3KZGA 1CB6A 1NNPA 2ZNSA 3QIMA 4H65A 3BFUA 4OVTA 4YKIA 3R6UA 4X8RA 2E0SA 3UA8A 4EXLA 3ONMA 1AMFA 3S9EA 4HCYA 3QYTA 3ECRA 3KG2A 3EHSA 3IJOB 4GWOA 4LZ8A 2FA7A 1EZ9A 4FAJA 1B3FA 4C0RA 3MVWA 2XX9A 1CE2A 3JV9A 4R72A 3VDFA 1SI1A 2NOOA 4POWA 3TUSA 2H5YA 3CSGA 3OELA 2D5WA 4RPNA 1YTVA 3O66A 3T9HB 4JSDA 3VXCA 1IXIA 1RYOA 2FBPA 5DT6A 3PD9A 3K6UA 2RKMA 1ANFA 2AYSA 1I6QA 3GBAA 2NVUB 4Z7EA 1EZPA 4X48A 3FXQA 2F78A 1FBPA 5EHMA 3PPQA 1O63A 3ODBA 3H03A 5M2VA 5KZTA 1TWYA 4OHNA 4E0XA 1R9QA 3H7MA 5H8FA 1SD3A 2XXKA 1YYZA 4IY5A 3D1RA 3IK6B 5B70A 1YZ0A 3VVEA 4QF9A 5HBCA 3USDA 4BLAA 1HSLA 4ZZAA 1IMCA 1YXIA 4OA4A 3FVOA 2DYXA 3IB2A 1XVXA 1LBVA 2GRVA 4OZ9A 1MXUA 3MVXA 5I2NB 3SEWA 3IB0A 4K3FA 4LUBA 1B40A 3U93A 1M5DA 4PFTA 4KFQA 1D9YA 5I56A 1URSA 4GFRA 4ZDMA 3TFLA 2OWZA 3OMBA 2WEFA 2DXYA 3UIFA 1ZIUA 4U23A 2ZNTA 4PE5B 3PUVE 4JWXA 1IQ7A 3SKPA 2CZLA 1FTOA 1NV4A 3MP8A 3U8QA 4LVQA 3IR1A 1GVCA 1SW5A 2B3BA 4G68C 1FPLA 3TDJA 3EN3A 4MEVA 1VFEA 4YKPA 4U21A 1TFDA 4NF5B 1DPPA 2HXRA 2XXUA 1JVXA 3N94A 2V25A 4HE2A 5ELVA 4MF3A 5CI5A 1GV8A 1MG1A 2NWJA 3RGYA 3LUYA 3KGCA 4O8MA 2PMSA 4FECA 4PF8A 4IO5A 1FBFA 2DWHA 2I0CA 1KZ8A 2XD3A 3ISPA 3DELB 4LA9A 2ZYOA 2KR0A 3S9NC 4OESA 3S9MC 3EHUA 3DP8A 4ECFA 4KYDA 1OLAA 4XKRA 5H8FB 1Y9UA 4YB6A 3H6WA 1JW1A 4GL8A 4F1UA 4G77A 4PAIA 4FJPA 1H44A 3Q25A 3RN8A 4H8IA 3HPIA 1Z7ME 2O7IA 1SW1A 3LV0A 3OO7A 3M8UA 4EDPA 2A5SA 4DE8A 2R9JA 2ABHA 1R9LA 1JW4A 3SEXA 5AA2B 5A5LA 4EF2A 4ONYA 5AA4A 4N07A 3HV1A 1DTZA 3TAJA 1JW5A 3W9VA 2KLFA 4N6KA 4ZECA 2HAUA 2ZYKA 4F2OA 1B5IA 3LSLA 3WAEA 4I8CA 2H4IA 1BLFA 5IM2A 1NNFA 1Y4CA 2V3QA 2UVJA 5EYGA 3U92A 5I2KB 5I56B 5L8DA 4PCDA 1NUYA 1LGBC 1G0HA 4PDDA 3K2DA 2B3FA 1ZLQA 3KJ7A 1DTGA 1DBZA 2QJEA 4XXUA 3CSBA 1N04A 4RJZA 4R74A 3GZGA 4MH5A 4N6DA 4F3PA 3K6XA 4PFBA 3G3JA 2OWTA 1YAEA 4OEUA 2F36A 1IXGA 2GHAA 4FATA 3D4CA 4ESXA 1USYH 4F3SA 2Y7RA 3MQ9A 1MPBA 4HTGA 2QMWA 1EYIA 4F19A 1OVBA 4QFKA 3JZJA 3MVYA 4ZZEA 4PE3A 1N3WA 3G3GA 3E9XA 1B52A 3L6HA 4QHQA 3TQWA 4PBHA 3TEPA 1EYJA 4GF8A 1B7ZA 4RNSA 3OO9A 2GH9A 1T0KA 2XX7A 1IXHA 3B8BA 1IMFA 4XKNA 2DE2A 4KI0E 1AL3A 4JDFA 4NGUA 1B3HA 3FD3A 5I57A 1ZTYA 3K02A 4NF8B 5IGAA 5A5XA 2Y7PA 4QSCA 4KPTA 4AQ4A 3TTKA 1Y1MA 4YMBA 3RUMA 1LBZA 4UABA 1QKBA 1FTMA 2F97A 3K6WA 3EKIA 2QVVA 4NG7A 2F6PA 5I58A 3TTNA 1WODA 1B5JA 3F11A 5K2XA 3HHGA 2I3VA 2F7AA 4PGNA 4N6PA 2F34A 4UA8A 4OFLA 4AS4A 5T3JA 3D4GA 5IZ3B 5FTIA 4HW8A 3IOWA 3Q29A 1FQEA 4OTEA 3E4RA 4YU0A 1A54A 3CIJA 3VVDA 2F5XA 4QBAA 3SESA 3PUYE 2ZMBA 1NV5A 2X7QA 1JEUA 3FJMA 2VD2A 3FVNA 4N81A 4MAGA 3U65A 3C31A 2QVRA 4PAKA 1ELJA 4ZE9A 4XF5A 5IAIA 1B58A 1OLCA 2WYPA 4GWXA 3PPNA 3M3KA 3M3LA 4RYAA 1H45A 5LTCA 3VVFA 2XHDA 5EYHA 1A8FA 3HO7A 3PTYA 4GD5A 1A55A 2A5TB 3ZSFA 2ZXTA 4NF6A 2O1MA 4H8JA 4DXCA 5BUUA 1FBEA 3N6UA 2ZNUA 1Q35A 3SZPA 2THIA 4KYSA 1NMUA 3B6WA 2F7BA 4QSDA 4AB5A 2D21A 3T22A 1HSEA 1B7UA 3QXMA 3Q27A 5IKBA 4GX3A 2P3NA 4OERA 1FPDA 2VHAA 1FJ6A 4HE1A 4PETA 2HHMA 2UYFA 3C32A 4RK9A 3RNNA 3K0VA 1ATGA 2V3UA 2WBBA 3CVGA 5AA1A 4WEDA 5I58B 4G61A 4OVJA 3HSTA 4NX1A 4LONB 3C9HA 1SYIA 3VLWA 1PB7A 4OVPA 2F8DA 4L17A 5TP9B 3A09A 4P8BA 1SI0A 5TPAA 4N4UA 4JSOA 4G8NA 5KDTA 4KR5A 4DCXA 1FPBA 1MXVA 3KSXA 5FHMA 3PD8A 1OIBA 5K2YA 3L6GA 1R1NA 1FPKA 4E0WA 3RPLA 1VE4A 4U2RA 5CMCA 2RINA 4OVQA 5BWJA 4Q5TA 1KA0A 1MY2A 1UIVA 4DI3D 1P1UA 4FBPA 3BIGA 3MPKA 3ZKKA 3G3IA 3FJ7A 3FZVA 4BDLA 2V4CA 4I40A 4UACA 4P1EA 1FRPA 2F35A 3OEMA 4Z0IA 4KXPA 2HAVA 2HPGA 3EF7A 3BKIB 2DS9A 5B7DA 1TFAA 4F2QA 5I59B 1UIUA 3EPEA 1LAXA 5CMMA 5I3SA 3RY3A 3TODA 1FTKA 4GRKA 5JK4A 3K1MA 3MW0A 4F31B 5EQ7A 4ELRA 3HN0A 4OFOA 1URDA 1FTJA 2P2AA 1QW0A 3IFAA 2HFBA 3QK6A 3C35A 1Y3PA 1FBHA 3EHTA 2H99A 3G3HA 1B7HA 4HS7A 3CFXA 4TQUQ 1JVYA 3FUZA 1PB9A 1D3KA 2Q8JA 2RCAA 2AL4A 4I3YA 3VE1B 4DIGA 3IX1A 2X7PA 2AL5A 5DEXA 3RQTA 4R6KA 3O6IA 3PU5A 3VLVA 1I69A 3VLUA 4JWOA 1DPEA 4GWSA 3B6QA 2Q89A 1MM6A 2DE4A 1IMBA 2QRYA 1LSTA 1XC1A 1EU8A 4G2ZA 2YLNA 3MUQA 4RY1A 2REGA 3MVZA 1FTAA 2CZIA 1YPNA 3GYYA 5ICQA 3TCGA 4H45A 2O69A 5IZZA 4GBVA 3OO6A 1B1XA 1XT8A 4OYVA 2H98A 1B05A 4ZE8A 5KDTB 3I3VA 2G93A 4HXVA 4JXIA 1FBCA 4OMBA 4N13A 5AA3A 1FW0A 2DVCA 2XWIA 2OJTA 4QXDA 1B4HA 3LR1A 4YAHX 4O94A 4OEVA 3M3FA 3RPLB 3UP9A 2IEEA 5L9MA 2ALUA 1B3GA 4Q30B 4H46A 1TXFA 3OO8A 5JTYA 5KCJA 2GFEA 1B2HA 2CZHA 2R6GE 2H25A 3R26A 4MJOA 4F1VA 4GWWA 1J1NA 3TPAA 4MX6A 2XXHA 1B3LA 1FPEA 3GLBA 3S4UA 4BDMA 1MXZA 4C1UA 4F3BA 1QVSA 1LBWA 3VFJA 1M5BA 3TELA 1VDWA 3SERA 2ONRA 4O7MA 4XEQA 4GL0A 1M5FA 4DZ1A 1FCKA 4NN3A 2Z8FA 1I6AA 3C33A 1D4NA 5I5PA 2NXOA 2QS4A 3MSTA 3PMWA 2OWSA 2XXQA 4P56A 2DWAA 3TCFA 2GHBA 3PMVA 4YB7A 2HCAA 1MPCA 2Y7IA 5CMBA 4X04A 1B3EA 3Q28A 4LZ5A 5DEXB 3T0JA 2HXWA 2FNCA 2DVZA 2XD2A 3T9VA 4F39A 4AS5A 1RDXA 4LZ7A 3TQLA 2O68A 1S50A 1II5A 2P3VA 3QUFA 1UQWA 1XHYA 3MBPA 4IY6A 4QFOA 3ROJA 1PDAA 2PBWA 3O2AA 2O6AA 1NV1A 3HCQA 3U1OA 2Y7WA 2FHYA 1SW2A 1SYHA 3NOHA 3LUZA 4R2BA 2HEUA 1N7XA 4I62A 1LFIA 1NUZA 2I49A 1P1WA 4ISUA 4O3BA 2DWIA 2FIEA 4LN5A 4WXJA 1QUKA 4OENA 2Z22A 1N3XA 1SW4A 3O9PA 1G0IA 1O64A 1A99A 2FVZA 3FXRA 5LOMA 5EHSA 4GVOA 5H8NA 3KFMA 5JTYB 5KCJB 2I58A 5DTBA 2Y5LA 5F1QA 2RC7A 4FEBA 4JVCA 2QFLA 4U1ZA 4P47A 5FTHA 4YMAA 3E3KA 1LAGE 2R71A 2OX3A 2CEXA 3O6GA 4QRZA 2M8CA 3E13X 2ZYNA 4DI4B 1OMPA 3PUWE 4BDNA 4KQPA 3CRBA 5FBPA 4MIJA 3MZ9A 1B32A 4PFUA 5EQAA 1PB8A 5ESYA 4EUOA 5ET6A 3PMXA 1NUXA 3RPWA 2YJPA 2OBGA 2PCRA 4HCWA 3KN7A 3IOVA 1N0TA 1R6ZA 1ZU0A 2QL3A 4PFRA 2I4BA 2PT2A 1DMBA 5H8HA 2E1SA 4FEDA 1SDXA 1QJMA 1MY0A 2AIXA 2GQ1A 4BDOA 1Y20A 4GXSB 1FQFA 4GXAA 1B6HA 3MZBA 1BKAA 4H0WA 1LBBA 4N8YA 3BBRA 3H6TA 2OCUA 5J16A 2I48A 2ZZWA 2KQZA 1MXYA 4HE0A 4PDHA 3KC1A 3DLNA 1Q1KA 4NAPA 5H8SA 5AA4B 3HFUA 5ITPA 2Y7KA 1POY1 1FQAA 4RK2A 4GWZA 1DSNA 3I5OA 4ND9A 3N6TA 1SPIA 4FORA 1KA1A 4QSEA 3RYDA 4TLLB 4U1OA 2VPOA 3O97A 3W15C 1XVYA 1LBXA 3G3KA 5H8NB 4X1BA 1B4ZA 1MQIA 5CC2A 1CNQA 4NTLA 3QUJA 1MM7A 4N8GA 4R73A 2Y84A 4NF4A 4Q8RA 1IMDA 4G8MA 3PGFA 5HM4B 3T9UA 4XFEA 2FIXA 3MP1A 2F7CA 2NUVA 3MPLA 5HPQA 4KYEA 5CM6A 1QUIA 1IMEA 4H5GA 3PPOA 2ANJA 5EQ8A 1HSJA 3T1BA 1LFGA 1A7LA 3FXUA 1XOCA 2XX8A 3UN6A 1M5EA 1EYKA 1LBYA 3DP4A 1FSAA 1I6BA 1RYXA 1NUWA 2RCBA 1MY4A 2ZYMA 5AA2D 1N7WA 3QSLA 5H8HB 2WX9A 1RDZA 1IIWA 5DVJA 4I3EA 4TLMB 4KCCA 3MWBA 5ET8A 1MPDA 3PUXE 2P0SA 2HZLA 2I4CA 4BDRA 5I57B 4NWCA 1MS7A 1OQHA 5A5XB 1NL5A 1FQDA 4DXBA 2OZZA 5J1DA 1LB8A 5LDZA 3QAXA 3O29A 4XTCQ 1FPIA 1SQYA 3B6TA 3FASA 2Z8DA 1GTKA 4NF0A 4P0IA 1PC3A 2XWOA 3ILUB 1MDQA 4G68A 2DSFA 2PFYA 4PTKA 2ESNA 4KCDA 1QGXA 4MLQA 1URGA 1NV0A 4JBZA 1Y3NA 5F7VA 3ILTB 2VGQA 4JVIA 3K00A 4G8HA 1AIVA 2F3DA 4PFIA 1D9VA 3OXNA 3KJTA 4ELQA 3MAMA 1AWBA 2DXRA 4IO2A 1MQDA 1NV7A 2CMOA 3WAFA 4OQOA 2QPQA 4JVDA 4MHFA 1LEVA 2R8TA 4GLIA 4NF4B 3TTLA 1JEVA 1US4A 5I2NA 1FBDA 4XKQA 2DOJA 4PFYA 1WDNA 5CMKA 1L5TA 3CG1A 4ELPA 4OVRA 1QKAA 1JP4A 4BDQA 2V3TA 3VV5A 5H8QA 1DOTA 4PQJA 1IMAA 4NF6B 3IFCA 1JQFA 2VPNA 3G7WA 1D9QA 3RTFB 4MNPA 3RTWB 4POXA 4GWYA 2Z8EA 5IZ1A 3OOAA 1A8EA 1OVTA 3QMFA 2BJJX 1LAFE 1PEBA 4MBPA 5AE4A 4ELOA 3C34A 3LSXA 4X9TA 3FV2A 3KSJA 4H67A 4MCOA 4NF5A 2QMXA 3LBSA 1NNKA 3OD7A 4EQ9A 1M5CA 4OANA 3P7IA 3K1PA 1FJ9A 1NH7A 3S9LC 1O7TA 4F18A 4FIMA 2D3IA 3V89B 4G68B 5ISUA 2Q74A 2VOZA 4YKKA 5FHOA 1FBGA 2DE3A 2XXWA 3KN3A 4LP2B 1VSOA 3FJGA 1Z7NE 5L9SA 5JEIA 1AOVA 3IL1B 4GX4A 2WYKA 5I7IA 1XI6A 2X26A
chains in the Genus database with same CATH topology
3TZAA 5TPAB 1BTJA 4I9DA 3O6HA 3OSRA 1AH5A 4OWDA 4JWYA 3TKDA 4OETA 5AA2A 1POTA 5ICTA 1VFDA 3IAZA 1UTHA 1B9JA 4NMYA 5CBRA 1P1QA 4H5FA 4U4XA 4GQOA 1NFTA 4EF1A 5I84A 1USYE 2QS3A 4PFWA 4R9FA 3LSWA 3TTMA 2PX1A 5I2KA 1IEJA 1IXCA 4ZS9A 4GOTA 2I6EA 5H8QB 1KWHA 3CFLA 3T96B 4ZEIA 3S2VA 1MY3A 3W9WA 3RT8A 3FVKA 1PBPA 4F1YA 2HQ0A 2I3WA 3PPPA 3TCHA 4GIZA 1WVJA 4EQBA 1JNFA 4IB2A 3H6VA 1JETA 4NEDA 3UORA 1LLSA 1BP5A 3C36A 4F29A 3BFTA 2G29A 3O28A 2W7YA 3TYHA 2OLBA 2P1SA 2RC9A 3AXFA 4ESWA 1FQBA 3ZKLA 4O3AA 2DP8A 3CFZA 4DCYA 1NH8A 3RT6B 4ZEDA 3K6VA 3PPRA 4QFPA 1S9TA 2XXPA 2Q2AA 3I6VA 3H3GA 1MXWA 3HHFA 3THIA 1IUDA 1N76A 2VP1A 1MDP1 2O1LA 3FATA 1FTLA 4F3GA 5DYHA 4U22A 2FYIA 3CI8A 4NF8A 1P99A 4R6YA 2DWJA 3C4MA 3H06B 2HZKA 2B65A 5L9OA 3IJXB 3FIRA 2REJA 4EXKA 4TOZA 2XXVA 3IB1A 1VR5A 1S7YA 4IO4A 2Q88A 1ZJLA 2QSXA 4YICA 4R6HA 3JYRA 3N5LA 1SBPA 1UTHB 4QFLA 3K01A 2UYEA 4KHZE 2H9BA 3MP6A 1GR2A 3SETA 1MH4A 4DXUA 4AB6A 3N26A 3UK4A 4IO3A 3IO6A 4P11A 4M1VA 5FHNA 1Y3QA 3KOSA 3OENA 4YKJA 1ZMGA 1LB9A 3LC8A 2PYYA 3RLFE 3CG3A 2XXTA 1B46A 4EQ7A 4M4GA 1BIYA 4H1XA 2UVGA 4LQ5A 4YB5A 2O7UA 3FGSA 1B5HA 3SEVA 3H6UA 2XXRA 1EH3A 2A5TA 5EYFA 3Q26A 3OEKA 3T9XB 4WEPA 4JB7A 4IO7A 1UTBA 4OFJA 4LQ2A 3MZ1A 4WKMA 3B7DA 1TT1A 4ZEBA 3A3CA 5DVFA 3T93B 4C1TA 3DP6A 1MQJA 2UVIA 4KD5A 3IORA 1B0HA 4O3CA 4IGTA 3V8XB 4OXVA 3DM0A 1LCTA 3GXAA 4MFIA 3A3UA 3IOTA 3U72A 4R9GA 1LBCA 1P1NA 4FE8A 1XS5A 1MRPA 4G4PA 2VD3A 2UVHA 4LATA 4H6DA 2Q2CA 3SEUA 4X1DA 4THIA 4ZEFA 3FV1A 3SEYA 1B0LA 1PBQA 5TP9A 3PUZE 5DVIA 3UGWA 1N84A 3EQ1A 4RXLA 3T66A 3V5AA 4I1DA 2QS1A 5CRYA 3IO4A 5CBSA 2ONSA 3FVGA 2V93A 2RF1A 3R7XA 1MQHA 3VXBA 2Q9TA 1B1HA 3K4UA 2ONKE 4DLDA 3LSFB 4RPOA 4NE4A 3KEIA 2XXYA 1LAHE 5I59A 3ZS6A 1ZBMA 4F22A 4DDDA 1GGGA 2F6GA 1MXXA 5ITOA 2OK2A 4XIGQ 1Y1ZA 1LFHA 2LAOA 1UTBB 4R75A 2RC8A 1B51A 3TMGA 5TU0A 1F9BA 4RA1A 2YPNA 4R2FA 1SVXB 4ZEKA 2Z23A 3TTRA 1NKXA 1NNTA 3IOUA 1H3DA 2IA4A 1QUJA 1ZKBA 4PP0A 2PVUA 3MJNA 4P0GA 4NWDA 1IZ1A 4MLVA 1US5A 3K1NA 1EZOA 3KOTA 1Y4TA 4QFNA 2O51A 3MC2A 2I0BA 1P1OA 1OQGA 3GBBA 4YZZA 2PT1A 1RKMA 4Q0CA 3U94A 1FQCA 1YCJA 1QULA 1H76A 3V83A 2DQVA 3H4ZA 4IGRA 2WKYA 4XKPA 3KN8A 2O84X 3OSQA 1IITA 1A40A 1MH3A 3SDFA 3PV0E 2QS2A 4U4SA 1LCFA 1H43A 2XXXA 3CR9A 3G3FA 1MQGA 2V84A 4IO6A 2UXAA 2XXIA 1MY1A 3KBRA 3KZGA 1CB6A 1NNPA 2ZNSA 3QIMA 4H65A 3BFUA 4YKIA 3R6UA 2E0SA 3UA8A 4EXLA 3ONMA 1AMFA 3S9EA 4HCYA 3QYTA 3ECRA 3KG2A 3EHSA 3IJOB 4GWOA 4LZ8A 2FA7A 1EZ9A 4FAJA 1B3FA 4C0RA 3MVWA 2XX9A 1CE2A 3JV9A 4R72A 3VDFA 1SI1A 2NOOA 4POWA 3TUSA 2H5YA 3CSGA 3OELA 2D5WA 4RPNA 1YTVA 3O66A 3T9HB 4JSDA 3VXCA 1IXIA 1RYOA 5DT6A 3PD9A 3K6UA 2RKMA 1ANFA 2AYSA 1I6QA 3GBAA 2NVUB 4Z7EA 1EZPA 4X48A 3FXQA 2F78A 5EHMA 3PPQA 1O63A 3ODBA 3H03A 5M2VA 5KZTA 1TWYA 4OHNA 4E0XA 1R9QA 3H7MA 5H8FA 1SD3A 4IY5A 3IK6B 5B70A 3VVEA 4QF9A 5HBCA 3USDA 4BLAA 1HSLA 4ZZAA 3FVOA 2DYXA 3IB2A 1XVXA 2GRVA 4OZ9A 1MXUA 3MVXA 5I2NB 3SEWA 3IB0A 4K3FA 4LUBA 1B40A 3U93A 1M5DA 4PFTA 4KFQA 1D9YA 5I56A 1URSA 4GFRA 4ZDMA 3TFLA 3OMBA 2DXYA 3UIFA 1ZIUA 4U23A 2ZNTA 4PE5B 3PUVE 4JWXA 1IQ7A 3SKPA 2CZLA 1FTOA 3MP8A 3U8QA 4LVQA 3IR1A 1GVCA 1SW5A 2B3BA 4G68C 3TDJA 3EN3A 1VFEA 4YKPA 4U21A 1TFDA 4NF5B 1DPPA 2XXUA 1JVXA 3N94A 2V25A 5ELVA 4MF3A 5CI5A 1GV8A 1MG1A 2NWJA 3RGYA 3LUYA 3KGCA 2PMSA 4FECA 4IO5A 2DWHA 2I0CA 2XD3A 3DELB 4LA9A 2ZYOA 3S9NC 4OESA 3S9MC 3EHUA 3DP8A 4ECFA 4KYDA 1OLAA 4XKRA 5H8FB 1Y9UA 4YB6A 3H6WA 1JW1A 4GL8A 4F1UA 4G77A 4FJPA 1H44A 3Q25A 3RN8A 4H8IA 3HPIA 1Z7ME 2O7IA 1SW1A 3OO7A 3M8UA 4EDPA 2A5SA 4DE8A 2R9JA 2ABHA 1R9LA 1JW4A 3SEXA 5AA2B 4EF2A 4ONYA 5AA4A 4N07A 3HV1A 1DTZA 3TAJA 1JW5A 3W9VA 2KLFA 4ZECA 2HAUA 2ZYKA 4F2OA 1B5IA 3LSLA 3WAEA 4I8CA 2H4IA 1BLFA 1NNFA 1Y4CA 2V3QA 2UVJA 3U92A 5I2KB 5I56B 5L8DA 1LGBC 3K2DA 2B3FA 1ZLQA 3KJ7A 1DTGA 2QJEA 4XXUA 3CSBA 1N04A 4RJZA 4R74A 3GZGA 4MH5A 4F3PA 3K6XA 3G3JA 2OWTA 1YAEA 4OEUA 2F36A 1IXGA 2GHAA 4FATA 3D4CA 4ESXA 1USYH 4F3SA 2Y7RA 3MQ9A 1MPBA 4HTGA 2QMWA 4F19A 1OVBA 4QFKA 3JZJA 3MVYA 4ZZEA 1N3WA 3G3GA 3E9XA 1B52A 3L6HA 4QHQA 3TQWA 3TEPA 4GF8A 1B7ZA 4RNSA 3OO9A 2GH9A 1T0KA 2XX7A 1IXHA 4XKNA 2DE2A 4KI0E 1AL3A 4JDFA 1B3HA 3FD3A 5I57A 1ZTYA 3K02A 4NF8B 5A5XA 2Y7PA 4QSCA 4KPTA 4AQ4A 3TTKA 1Y1MA 4YMBA 3RUMA 1QKBA 1FTMA 2F97A 3K6WA 2F6PA 5I58A 3TTNA 1WODA 1B5JA 3F11A 5K2XA 3HHGA 2I3VA 2F7AA 4N6PA 2F34A 4UA8A 4OFLA 3D4GA 5FTIA 4HW8A 3IOWA 3Q29A 1FQEA 4OTEA 3E4RA 4YU0A 1A54A 3CIJA 3VVDA 2F5XA 3SESA 3PUYE 2ZMBA 2X7QA 1JEUA 3FJMA 2VD2A 3FVNA 3C31A 1ELJA 4ZE9A 5IAIA 1B58A 1OLCA 3PPNA 3M3KA 3M3LA 4RYAA 1H45A 3VVFA 2XHDA 1A8FA 3HO7A 4GD5A 1A55A 2A5TB 3ZSFA 2ZXTA 4NF6A 2O1MA 4H8JA 4DXCA 5BUUA 3N6UA 2ZNUA 1Q35A 2THIA 4KYSA 1NMUA 3B6WA 2F7BA 4QSDA 4AB5A 2D21A 3T22A 1HSEA 1B7UA 3QXMA 3Q27A 5IKBA 4OERA 2VHAA 4PETA 2UYFA 3C32A 4RK9A 3RNNA 3K0VA 1ATGA 2V3UA 3CVGA 5AA1A 4WEDA 5I58B 4OVJA 3HSTA 4LONB 3C9HA 1SYIA 3VLWA 1PB7A 2F8DA 4L17A 5TP9B 3A09A 1SI0A 5TPAA 4JSOA 4G8NA 5KDTA 4KR5A 4DCXA 1MXVA 3KSXA 5FHMA 3PD8A 1OIBA 5K2YA 3L6GA 1R1NA 4E0WA 1VE4A 4U2RA 5CMCA 2RINA 5BWJA 4Q5TA 1MY2A 1UIVA 1P1UA 3MPKA 3ZKKA 3G3IA 3FJ7A 3FZVA 4BDLA 4UACA 2F35A 3OEMA 4Z0IA 2HAVA 3EF7A 3BKIB 2DS9A 5B7DA 1TFAA 4F2QA 5I59B 1UIUA 3EPEA 1LAXA 5CMMA 3RY3A 3TODA 1FTKA 4GRKA 5JK4A 3K1MA 3MW0A 4F31B 4ELRA 3HN0A 4OFOA 1URDA 1FTJA 2P2AA 1QW0A 2HFBA 3QK6A 3C35A 1Y3PA 3EHTA 2H99A 3G3HA 1B7HA 4HS7A 3CFXA 4TQUQ 1JVYA 3FUZA 1PB9A 1D3KA 2Q8JA 2RCAA 2AL4A 3VE1B 4DIGA 3IX1A 2X7PA 2AL5A 5DEXA 3RQTA 4R6KA 3O6IA 3PU5A 3VLVA 1I69A 3VLUA 4JWOA 1DPEA 3B6QA 2Q89A 1MM6A 2DE4A 2QRYA 1LSTA 1XC1A 1EU8A 4G2ZA 2YLNA 3MUQA 4RY1A 2REGA 3MVZA 5ICQA 1YPNA 3TCGA 2O69A 3OO6A 1B1XA 1XT8A 4OYVA 2H98A 1B05A 4ZE8A 5KDTB 3I3VA 2G93A 4JXIA 4OMBA 4N13A 5AA3A 1FW0A 2DVCA 2OJTA 1B4HA 3LR1A 4YAHX 4OEVA 3M3FA 3UP9A 2IEEA 5L9MA 2ALUA 1B3GA 4Q30B 1TXFA 3OO8A 5JTYA 5KCJA 2GFEA 1B2HA 2R6GE 2H25A 3R26A 4F1VA 1J1NA 3TPAA 2XXHA 1B3LA 3GLBA 3S4UA 4BDMA 1MXZA 4C1UA 4F3BA 1QVSA 3VFJA 1M5BA 3TELA 3SERA 2ONRA 4GL0A 1M5FA 4DZ1A 1FCKA 2Z8FA 1I6AA 3C33A 1D4NA 2NXOA 2QS4A 3PMWA 2OWSA 2XXQA 2DWAA 3TCFA 2GHBA 3PMVA 4YB7A 2HCAA 1MPCA 2Y7IA 5CMBA 1B3EA 3Q28A 4LZ5A 5DEXB 3T9VA 2HXWA 2FNCA 2DVZA 2XD2A 4F39A 4LZ7A 3TQLA 2O68A 1S50A 1II5A 3QUFA 1UQWA 1XHYA 3MBPA 4IY6A 4QFOA 1PDAA 2PBWA 3O2AA 2O6AA 3HCQA 3U1OA 2Y7WA 1SW2A 1SYHA 4R2BA 2HEUA 1N7XA 4I62A 1LFIA 2I49A 1P1WA 4ISUA 4O3BA 2DWIA 4WXJA 1QUKA 4OENA 2Z22A 1N3XA 1SW4A 3O9PA 1O64A 1A99A 3FXRA 5LOMA 5EHSA 4GVOA 5H8NA 3KFMA 5JTYB 5KCJB 2I58A 5DTBA 5F1QA 2RC7A 4FEBA 4U1ZA 5FTHA 4YMAA 3E3KA 1LAGE 2R71A 3O6GA 4QRZA 2M8CA 3E13X 2ZYNA 1OMPA 3PUWE 4BDNA 4KQPA 3CRBA 3MZ9A 1B32A 4PFUA 1PB8A 4EUOA 3PMXA 3RPWA 2YJPA 2OBGA 4HCWA 3KN7A 3IOVA 1N0TA 1R6ZA 1ZU0A 2QL3A 2I4BA 2PT2A 1DMBA 5H8HA 2E1SA 4FEDA 1SDXA 1QJMA 1MY0A 2AIXA 4BDOA 1Y20A 4GXSB 1FQFA 4GXAA 1B6HA 3MZBA 1BKAA 4H0WA 1LBBA 3BBRA 3H6TA 2OCUA 2I48A 1MXYA 3DLNA 1Q1KA 5H8SA 5AA4B 5ITPA 2Y7KA 1POY1 1FQAA 4RK2A 1DSNA 3I5OA 4ND9A 3N6TA 4FORA 4QSEA 4TLLB 4U1OA 3O97A 3W15C 1XVYA 3G3KA 5H8NB 4X1BA 1B4ZA 1MQIA 5CC2A 4NTLA 3QUJA 1MM7A 4R73A 2Y84A 4NF4A 4Q8RA 4G8MA 3PGFA 5HM4B 3T9UA 3MP1A 2F7CA 2NUVA 3MPLA 5HPQA 4KYEA 5CM6A 1QUIA 4H5GA 3PPOA 2ANJA 1HSJA 1LFGA 1A7LA 3FXUA 1XOCA 2XX8A 3UN6A 1M5EA 3DP4A 1I6BA 1RYXA 2RCBA 1MY4A 2ZYMA 5AA2D 1N7WA 3QSLA 5H8HB 1IIWA 5DVJA 4TLMB 4KCCA 3MWBA 1MPDA 3PUXE 2P0SA 2HZLA 2I4CA 4BDRA 5I57B 4NWCA 1MS7A 1OQHA 5A5XB 1NL5A 1FQDA 4DXBA 2OZZA 5J1DA 1LB8A 3QAXA 3O29A 4XTCQ 1SQYA 3B6TA 3FASA 2Z8DA 1GTKA 4P0IA 1PC3A 3ILUB 1MDQA 4G68A 2DSFA 2ESNA 4KCDA 4MLQA 1URGA 4JBZA 1Y3NA 5F7VA 3ILTB 2VGQA 3K00A 4G8HA 1AIVA 1D9VA 3OXNA 3KJTA 4ELQA 3MAMA 2DXRA 4IO2A 1MQDA 2CMOA 3WAFA 4OQOA 2QPQA 4GLIA 4NF4B 3TTLA 1JEVA 1US4A 5I2NA 4XKQA 2DOJA 4PFYA 1WDNA 5CMKA 1L5TA 3CG1A 4ELPA 1QKAA 4BDQA 2V3TA 3VV5A 5H8QA 1DOTA 4PQJA 4NF6B 1JQFA 3G7WA 3RTFB 3RTWB 4POXA 2Z8EA 3OOAA 1A8EA 1OVTA 2BJJX 1LAFE 1PEBA 4MBPA 5AE4A 4ELOA 3C34A 3LSXA 4X9TA 3FV2A 3KSJA 4H67A 4NF5A 2QMXA 3LBSA 1NNKA 3OD7A 4EQ9A 1M5CA 3P7IA 3K1PA 1NH7A 3S9LC 1O7TA 4F18A 4FIMA 2D3IA 3V89B 4G68B 5ISUA 2VOZA 4YKKA 5FHOA 2DE3A 2XXWA 3KN3A 4LP2B 1VSOA 3FJGA 1Z7NE 5L9SA 5JEIA 1AOVA 3IL1B 2X26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZA A;  5TPA B;  1BTJ A;  4I9D A;  3O6H A;  3OSR A;  1AH5 A;  4OWD A;  4JWY A;  3TKD A;  4OET A;  5AA2 A;  1POT A;  5ICT A;  1VFD A;  3IAZ A;  1UTH A;  1B9J A;  4NMY A;  5CBR A;  1P1Q A;  4H5F A;  4U4X A;  4GQO A;  1NFT A;  4EF1 A;  5I84 A;  1USY E;  2QS3 A;  4PFW A;  4R9F A;  3LSW A;  3TTM A;  2PX1 A;  5I2K A;  1IEJ A;  1IXC A;  4ZS9 A;  4GOT A;  2I6E A;  5H8Q B;  1KWH A;  3CFL A;  3T96 B;  4ZEI A;  3S2V A;  1MY3 A;  3W9W A;  3RT8 A;  3FVK A;  1PBP A;  4F1Y A;  2HQ0 A;  2I3W A;  3PPP A;  3TCH A;  4GIZ A;  1WVJ A;  4EQB A;  1JNF A;  4IB2 A;  3H6V A;  1JET A;  4NED A;  3UOR A;  1LLS A;  1BP5 A;  3C36 A;  4F29 A;  3BFT A;  2G29 A;  3O28 A;  2W7Y A;  3TYH A;  2OLB A;  2P1S A;  2RC9 A;  3AXF A;  4ESW A;  1FQB A;  3ZKL A;  4O3A A;  2DP8 A;  3CFZ A;  4DCY A;  1NH8 A;  3RT6 B;  4ZED A;  3K6V A;  3PPR A;  4QFP A;  1S9T A;  2XXP A;  2Q2A A;  3I6V A;  3H3G A;  1MXW A;  3HHF A;  3THI A;  1IUD A;  1N76 A;  2VP1 A;  1MDP 1;  2O1L A;  3FAT A;  1FTL A;  4F3G A;  5DYH A;  4U22 A;  2FYI A;  3CI8 A;  4NF8 A;  1P99 A;  4R6Y A;  2DWJ A;  3C4M A;  3H06 B;  2HZK A;  2B65 A;  5L9O A;  3IJX B;  3FIR A;  2REJ A;  4EXK A;  4TOZ A;  2XXV A;  3IB1 A;  1VR5 A;  1S7Y A;  4IO4 A;  2Q88 A;  1ZJL A;  2QSX A;  4YIC A;  4R6H A;  3JYR A;  3N5L A;  1SBP A;  1UTH B;  4QFL A;  3K01 A;  2UYE A;  4KHZ E;  2H9B A;  3MP6 A;  1GR2 A;  3SET A;  1MH4 A;  4DXU A;  4AB6 A;  3N26 A;  3UK4 A;  4IO3 A;  3IO6 A;  4P11 A;  4M1V A;  5FHN A;  1Y3Q A;  3KOS A;  3OEN A;  4YKJ A;  1ZMG A;  1LB9 A;  3LC8 A;  2PYY A;  3RLF E;  3CG3 A;  2XXT A;  1B46 A;  4EQ7 A;  4M4G A;  1BIY A;  4H1X A;  2UVG A;  4LQ5 A;  4YB5 A;  2O7U A;  3FGS A;  1B5H A;  3SEV A;  3H6U A;  2XXR A;  1EH3 A;  2A5T A;  5EYF A;  3Q26 A;  3OEK A;  3T9X B;  4WEP A;  4JB7 A;  4IO7 A;  1UTB A;  4OFJ A;  4LQ2 A;  3MZ1 A;  4WKM A;  3B7D A;  1TT1 A;  4ZEB A;  3A3C A;  5DVF A;  3T93 B;  4C1T A;  3DP6 A;  1MQJ A;  2UVI A;  4KD5 A;  3IOR A;  1B0H A;  4O3C A;  4IGT A;  3V8X B;  4OXV A;  3DM0 A;  1LCT A;  3GXA A;  4MFI A;  3A3U A;  3IOT A;  3U72 A;  4R9G A;  1LBC A;  1P1N A;  4FE8 A;  1XS5 A;  1MRP A;  4G4P A;  2VD3 A;  2UVH A;  4LAT A;  4H6D A;  2Q2C A;  3SEU A;  4X1D A;  4THI A;  4ZEF A;  3FV1 A;  3SEY A;  1B0L A;  1PBQ A;  5TP9 A;  3PUZ E;  5DVI A;  3UGW A;  1N84 A;  3EQ1 A;  4RXL A;  3T66 A;  3V5A A;  4I1D A;  2QS1 A;  5CRY A;  3IO4 A;  5CBS A;  2ONS A;  3FVG A;  2V93 A;  2RF1 A;  3R7X A;  1MQH A;  3VXB A;  2Q9T A;  1B1H A;  3K4U A;  2ONK E;  4DLD A;  3LSF B;  4RPO A;  4NE4 A;  3KEI A;  2XXY A;  1LAH E;  5I59 A;  3ZS6 A;  1ZBM A;  4F22 A;  4DDD A;  1GGG A;  2F6G A;  1MXX A;  5ITO A;  2OK2 A;  4XIG Q;  1Y1Z A;  1LFH A;  2LAO A;  1UTB B;  4R75 A;  2RC8 A;  1B51 A;  3TMG A;  5TU0 A;  1F9B A;  4RA1 A;  2YPN A;  4R2F A;  1SVX B;  4ZEK A;  2Z23 A;  3TTR A;  1NKX A;  1NNT A;  3IOU A;  1H3D A;  2IA4 A;  1QUJ A;  1ZKB A;  4PP0 A;  2PVU A;  3MJN A;  4P0G A;  4NWD A;  1IZ1 A;  4MLV A;  1US5 A;  3K1N A;  1EZO A;  3KOT A;  1Y4T A;  4QFN A;  2O51 A;  3MC2 A;  2I0B A;  1P1O A;  1OQG A;  3GBB A;  4YZZ A;  2PT1 A;  1RKM A;  4Q0C A;  3U94 A;  1FQC A;  1YCJ A;  1QUL A;  1H76 A;  3V83 A;  2DQV A;  3H4Z A;  4IGR A;  2WKY A;  4XKP A;  3KN8 A;  2O84 X;  3OSQ A;  1IIT A;  1A40 A;  1MH3 A;  3SDF A;  3PV0 E;  2QS2 A;  4U4S A;  1LCF A;  1H43 A;  2XXX A;  3CR9 A;  3G3F A;  1MQG A;  2V84 A;  4IO6 A;  2UXA A;  2XXI A;  1MY1 A;  3KBR A;  3KZG A;  1CB6 A;  1NNP A;  2ZNS A;  3QIM A;  4H65 A;  3BFU A;  4YKI A;  3R6U A;  2E0S A;  3UA8 A;  4EXL A;  3ONM A;  1AMF A;  3S9E A;  4HCY A;  3QYT A;  3ECR A;  3KG2 A;  3EHS A;  3IJO B;  4GWO A;  4LZ8 A;  2FA7 A;  1EZ9 A;  4FAJ A;  1B3F A;  4C0R A;  3MVW A;  2XX9 A;  1CE2 A;  3JV9 A;  4R72 A;  3VDF A;  1SI1 A;  2NOO A;  4POW A;  3TUS A;  2H5Y A;  3CSG A;  3OEL A;  2D5W A;  4RPN A;  1YTV A;  3O66 A;  3T9H B;  4JSD A;  3VXC A;  1IXI A;  1RYO A;  5DT6 A;  3PD9 A;  3K6U A;  2RKM A;  1ANF A;  2AYS A;  1I6Q A;  3GBA A;  2NVU B;  4Z7E A;  1EZP A;  4X48 A;  3FXQ A;  2F78 A;  5EHM A;  3PPQ A;  1O63 A;  3ODB A;  3H03 A;  5M2V A;  5KZT A;  1TWY A;  4OHN A;  4E0X A;  1R9Q A;  3H7M A;  5H8F A;  1SD3 A;  4IY5 A;  3IK6 B;  5B70 A;  3VVE A;  4QF9 A;  5HBC A;  3USD A;  4BLA A;  1HSL A;  4ZZA A;  3FVO A;  2DYX A;  3IB2 A;  1XVX A;  2GRV A;  4OZ9 A;  1MXU A;  3MVX A;  5I2N B;  3SEW A;  3IB0 A;  4K3F A;  4LUB A;  1B40 A;  3U93 A;  1M5D A;  4PFT A;  4KFQ A;  1D9Y A;  5I56 A;  1URS A;  4GFR A;  4ZDM A;  3TFL A;  3OMB A;  2DXY A;  3UIF A;  1ZIU A;  4U23 A;  2ZNT A;  4PE5 B;  3PUV E;  4JWX A;  1IQ7 A;  3SKP A;  2CZL A;  1FTO A;  3MP8 A;  3U8Q A;  4LVQ A;  3IR1 A;  1GVC A;  1SW5 A;  2B3B A;  4G68 C;  3TDJ A;  3EN3 A;  1VFE A;  4YKP A;  4U21 A;  1TFD A;  4NF5 B;  1DPP A;  2XXU A;  1JVX A;  3N94 A;  2V25 A;  5ELV A;  4MF3 A;  5CI5 A;  1GV8 A;  1MG1 A;  2NWJ A;  3RGY A;  3LUY A;  3KGC A;  2PMS A;  4FEC A;  4IO5 A;  2DWH A;  2I0C A;  2XD3 A;  3DEL B;  4LA9 A;  2ZYO A;  3S9N C;  4OES A;  3S9M C;  3EHU A;  3DP8 A;  4ECF A;  4KYD A;  1OLA A;  4XKR A;  5H8F B;  1Y9U A;  4YB6 A;  3H6W A;  1JW1 A;  4GL8 A;  4F1U A;  4G77 A;  4FJP A;  1H44 A;  3Q25 A;  3RN8 A;  4H8I A;  3HPI A;  1Z7M E;  2O7I A;  1SW1 A;  3OO7 A;  3M8U A;  4EDP A;  2A5S A;  4DE8 A;  2R9J A;  2ABH A;  1R9L A;  1JW4 A;  3SEX A;  5AA2 B;  4EF2 A;  4ONY A;  5AA4 A;  4N07 A;  3HV1 A;  1DTZ A;  3TAJ A;  1JW5 A;  3W9V A;  2KLF A;  4ZEC A;  2HAU A;  2ZYK A;  4F2O A;  1B5I A;  3LSL A;  3WAE A;  4I8C A;  2H4I A;  1BLF A;  1NNF A;  1Y4C A;  2V3Q A;  2UVJ A;  3U92 A;  5I2K B;  5I56 B;  5L8D A;  1LGB C;  3K2D A;  2B3F A;  1ZLQ A;  3KJ7 A;  1DTG A;  2QJE A;  4XXU A;  3CSB A;  1N04 A;  4RJZ A;  4R74 A;  3GZG A;  4MH5 A;  4F3P A;  3K6X A;  3G3J A;  2OWT A;  1YAE A;  4OEU A;  2F36 A;  1IXG A;  2GHA A;  4FAT A;  3D4C A;  4ESX A;  1USY H;  4F3S A;  2Y7R A;  3MQ9 A;  1MPB A;  4HTG A;  2QMW A;  4F19 A;  1OVB A;  4QFK A;  3JZJ A;  3MVY A;  4ZZE A;  1N3W A;  3G3G A;  3E9X A;  1B52 A;  3L6H A;  4QHQ A;  3TQW A;  3TEP A;  4GF8 A;  1B7Z A;  4RNS A;  3OO9 A;  2GH9 A;  1T0K A;  2XX7 A;  1IXH A;  4XKN A;  2DE2 A;  4KI0 E;  1AL3 A;  4JDF A;  1B3H A;  3FD3 A;  5I57 A;  1ZTY A;  3K02 A;  4NF8 B;  5A5X A;  2Y7P A;  4QSC A;  4KPT A;  4AQ4 A;  3TTK A;  1Y1M A;  4YMB A;  3RUM A;  1QKB A;  1FTM A;  2F97 A;  3K6W A;  2F6P A;  5I58 A;  3TTN A;  1WOD A;  1B5J A;  3F11 A;  5K2X A;  3HHG A;  2I3V A;  2F7A A;  4N6P A;  2F34 A;  4UA8 A;  4OFL A;  3D4G A;  5FTI A;  4HW8 A;  3IOW A;  3Q29 A;  1FQE A;  4OTE A;  3E4R A;  4YU0 A;  1A54 A;  3CIJ A;  3VVD A;  2F5X A;  3SES A;  3PUY E;  2ZMB A;  2X7Q A;  1JEU A;  3FJM A;  2VD2 A;  3FVN A;  3C31 A;  1ELJ A;  4ZE9 A;  5IAI A;  1B58 A;  1OLC A;  3PPN A;  3M3K A;  3M3L A;  4RYA A;  1H45 A;  3VVF A;  2XHD A;  1A8F A;  3HO7 A;  4GD5 A;  1A55 A;  2A5T B;  3ZSF A;  2ZXT A;  4NF6 A;  2O1M A;  4H8J A;  4DXC A;  5BUU A;  3N6U A;  2ZNU A;  1Q35 A;  2THI A;  4KYS A;  1NMU A;  3B6W A;  2F7B A;  4QSD A;  4AB5 A;  2D21 A;  3T22 A;  1HSE A;  1B7U A;  3QXM A;  3Q27 A;  5IKB A;  4OER A;  2VHA A;  4PET A;  2UYF A;  3C32 A;  4RK9 A;  3RNN A;  3K0V A;  1ATG A;  2V3U A;  3CVG A;  5AA1 A;  4WED A;  5I58 B;  4OVJ A;  3HST A;  4LON B;  3C9H A;  1SYI A;  3VLW A;  1PB7 A;  2F8D A;  4L17 A;  5TP9 B;  3A09 A;  1SI0 A;  5TPA A;  4JSO A;  4G8N A;  5KDT A;  4KR5 A;  4DCX A;  1MXV A;  3KSX A;  5FHM A;  3PD8 A;  1OIB A;  5K2Y A;  3L6G A;  1R1N A;  4E0W A;  1VE4 A;  4U2R A;  5CMC A;  2RIN A;  5BWJ A;  4Q5T A;  1MY2 A;  1UIV A;  1P1U A;  3MPK A;  3ZKK A;  3G3I A;  3FJ7 A;  3FZV A;  4BDL A;  4UAC A;  2F35 A;  3OEM A;  4Z0I A;  2HAV A;  3EF7 A;  3BKI B;  2DS9 A;  5B7D A;  1TFA A;  4F2Q A;  5I59 B;  1UIU A;  3EPE A;  1LAX A;  5CMM A;  3RY3 A;  3TOD A;  1FTK A;  4GRK A;  5JK4 A;  3K1M A;  3MW0 A;  4F31 B;  4ELR A;  3HN0 A;  4OFO A;  1URD A;  1FTJ A;  2P2A A;  1QW0 A;  2HFB A;  3QK6 A;  3C35 A;  1Y3P A;  3EHT A;  2H99 A;  3G3H A;  1B7H A;  4HS7 A;  3CFX A;  4TQU Q;  1JVY A;  3FUZ A;  1PB9 A;  1D3K A;  2Q8J A;  2RCA A;  2AL4 A;  3VE1 B;  4DIG A;  3IX1 A;  2X7P A;  2AL5 A;  5DEX A;  3RQT A;  4R6K A;  3O6I A;  3PU5 A;  3VLV A;  1I69 A;  3VLU A;  4JWO A;  1DPE A;  3B6Q A;  2Q89 A;  1MM6 A;  2DE4 A;  2QRY A;  1LST A;  1XC1 A;  1EU8 A;  4G2Z A;  2YLN A;  3MUQ A;  4RY1 A;  2REG A;  3MVZ A;  5ICQ A;  1YPN A;  3TCG A;  2O69 A;  3OO6 A;  1B1X A;  1XT8 A;  4OYV A;  2H98 A;  1B05 A;  4ZE8 A;  5KDT B;  3I3V A;  2G93 A;  4JXI A;  4OMB A;  4N13 A;  5AA3 A;  1FW0 A;  2DVC A;  2OJT A;  1B4H A;  3LR1 A;  4YAH X;  4OEV A;  3M3F A;  3UP9 A;  2IEE A;  5L9M A;  2ALU A;  1B3G A;  4Q30 B;  1TXF A;  3OO8 A;  5JTY A;  5KCJ A;  2GFE A;  1B2H A;  2R6G E;  2H25 A;  3R26 A;  4F1V A;  1J1N A;  3TPA A;  2XXH A;  1B3L A;  3GLB A;  3S4U A;  4BDM A;  1MXZ A;  4C1U A;  4F3B A;  1QVS A;  3VFJ A;  1M5B A;  3TEL A;  3SER A;  2ONR A;  4GL0 A;  1M5F A;  4DZ1 A;  1FCK A;  2Z8F A;  1I6A A;  3C33 A;  1D4N A;  2NXO A;  2QS4 A;  3PMW A;  2OWS A;  2XXQ A;  2DWA A;  3TCF A;  2GHB A;  3PMV A;  4YB7 A;  2HCA A;  1MPC A;  2Y7I A;  5CMB A;  1B3E A;  3Q28 A;  4LZ5 A;  5DEX B;  3T9V A;  2HXW A;  2FNC A;  2DVZ A;  2XD2 A;  4F39 A;  4LZ7 A;  3TQL A;  2O68 A;  1S50 A;  1II5 A;  3QUF A;  1UQW A;  1XHY A;  3MBP A;  4IY6 A;  4QFO A;  1PDA A;  2PBW A;  3O2A A;  2O6A A;  3HCQ A;  3U1O A;  2Y7W A;  1SW2 A;  1SYH A;  4R2B A;  2HEU A;  1N7X A;  4I62 A;  1LFI A;  2I49 A;  1P1W A;  4ISU A;  4O3B A;  2DWI A;  4WXJ A;  1QUK A;  4OEN A;  2Z22 A;  1N3X A;  1SW4 A;  3O9P A;  1O64 A;  1A99 A;  3FXR A;  5LOM A;  5EHS A;  4GVO A;  5H8N A;  3KFM A;  5JTY B;  5KCJ B;  2I58 A;  5DTB A;  5F1Q A;  2RC7 A;  4FEB A;  4U1Z A;  5FTH A;  4YMA A;  3E3K A;  1LAG E;  2R71 A;  3O6G A;  4QRZ A;  2M8C A;  3E13 X;  2ZYN A;  1OMP A;  3PUW E;  4BDN A;  4KQP A;  3CRB A;  3MZ9 A;  1B32 A;  4PFU A;  1PB8 A;  4EUO A;  3PMX A;  3RPW A;  2YJP A;  2OBG A;  4HCW A;  3KN7 A;  3IOV A;  1N0T A;  1R6Z A;  1ZU0 A;  2QL3 A;  2I4B A;  2PT2 A;  1DMB A;  5H8H A;  2E1S A;  4FED A;  1SDX A;  1QJM A;  1MY0 A;  2AIX A;  4BDO A;  1Y20 A;  4GXS B;  1FQF A;  4GXA A;  1B6H A;  3MZB A;  1BKA A;  4H0W A;  1LBB A;  3BBR A;  3H6T A;  2OCU A;  2I48 A;  1MXY A;  3DLN A;  1Q1K A;  5H8S A;  5AA4 B;  5ITP A;  2Y7K A;  1POY 1;  1FQA A;  4RK2 A;  1DSN A;  3I5O A;  4ND9 A;  3N6T A;  4FOR A;  4QSE A;  4TLL B;  4U1O A;  3O97 A;  3W15 C;  1XVY A;  3G3K A;  5H8N B;  4X1B A;  1B4Z A;  1MQI A;  5CC2 A;  4NTL A;  3QUJ A;  1MM7 A;  4R73 A;  2Y84 A;  4NF4 A;  4Q8R A;  4G8M A;  3PGF A;  5HM4 B;  3T9U A;  3MP1 A;  2F7C A;  2NUV A;  3MPL A;  5HPQ A;  4KYE A;  5CM6 A;  1QUI A;  4H5G A;  3PPO A;  2ANJ A;  1HSJ A;  1LFG A;  1A7L A;  3FXU A;  1XOC A;  2XX8 A;  3UN6 A;  1M5E A;  3DP4 A;  1I6B A;  1RYX A;  2RCB A;  1MY4 A;  2ZYM A;  5AA2 D;  1N7W A;  3QSL A;  5H8H B;  1IIW A;  5DVJ A;  4TLM B;  4KCC A;  3MWB A;  1MPD A;  3PUX E;  2P0S A;  2HZL A;  2I4C A;  4BDR A;  5I57 B;  4NWC A;  1MS7 A;  1OQH A;  5A5X B;  1NL5 A;  1FQD A;  4DXB A;  2OZZ A;  5J1D A;  1LB8 A;  3QAX A;  3O29 A;  4XTC Q;  1SQY A;  3B6T A;  3FAS A;  2Z8D A;  1GTK A;  4P0I A;  1PC3 A;  3ILU B;  1MDQ A;  4G68 A;  2DSF A;  2ESN A;  4KCD A;  4MLQ A;  1URG A;  4JBZ A;  1Y3N A;  5F7V A;  3ILT B;  2VGQ A;  3K00 A;  4G8H A;  1AIV A;  1D9V A;  3OXN A;  3KJT A;  4ELQ A;  3MAM A;  2DXR A;  4IO2 A;  1MQD A;  2CMO A;  3WAF A;  4OQO A;  2QPQ A;  4GLI A;  4NF4 B;  3TTL A;  1JEV A;  1US4 A;  5I2N A;  4XKQ A;  2DOJ A;  4PFY A;  1WDN A;  5CMK A;  1L5T A;  3CG1 A;  4ELP A;  1QKA A;  4BDQ A;  2V3T A;  3VV5 A;  5H8Q A;  1DOT A;  4PQJ A;  4NF6 B;  1JQF A;  3G7W A;  3RTF B;  3RTW B;  4POX A;  2Z8E A;  3OOA A;  1A8E A;  1OVT A;  2BJJ X;  1LAF E;  1PEB A;  4MBP A;  5AE4 A;  4ELO A;  3C34 A;  3LSX A;  4X9T A;  3FV2 A;  3KSJ A;  4H67 A;  4NF5 A;  2QMX A;  3LBS A;  1NNK A;  3OD7 A;  4EQ9 A;  1M5C A;  3P7I A;  3K1P A;  1NH7 A;  3S9L C;  1O7T A;  4F18 A;  4FIM A;  2D3I A;  3V89 B;  4G68 B;  5ISU A;  2VOZ A;  4YKK A;  5FHO A;  2DE3 A;  2XXW A;  3KN3 A;  4LP2 B;  1VSO A;  3FJG A;  1Z7N E;  5L9S A;  5JEI A;  1AOV A;  3IL1 B;  2X26 A; 
#chains in the Genus database with same CATH topology
 3TZA A;  5TPA B;  2B4M A;  4NHB A;  1BTJ A;  4I9D A;  3O6H A;  3OSR A;  1AH5 A;  4OWD A;  4JWY A;  3TKD A;  4OET A;  5AA2 A;  1POT A;  3CHG A;  4PAF A;  5ICT A;  1VFD A;  3IAZ A;  1UTH A;  2B4L A;  1B9J A;  4NMY A;  5CBR A;  1P1Q A;  4H5F A;  3MYU A;  4U4X A;  4GQO A;  1NFT A;  4EF1 A;  5I84 A;  1USY E;  2QS3 A;  4PFW A;  4R9F A;  3LSW A;  3TTM A;  2PX1 A;  5I2K A;  1IEJ A;  1IXC A;  4ZS9 A;  4P1L A;  4GOT A;  2I6E A;  5H8Q B;  1KWH A;  3CFL A;  2L5V A;  3T96 B;  4ZEI A;  4GBW A;  3S2V A;  1MY3 A;  3W9W A;  5ET7 A;  3RT8 A;  3FVK A;  2CZK A;  1PBP A;  4F1Y A;  2HQ0 A;  5ET5 A;  1FPG A;  2I3W A;  3PPP A;  3TCH A;  4GIZ A;  1WVJ A;  4EQB A;  1JNF A;  2VT5 A;  4IB2 A;  2F3B A;  3H6V A;  1JET A;  2XWV A;  4NED A;  3UOR A;  1LLS A;  1BP5 A;  3C36 A;  2PFZ A;  4F29 A;  3BFT A;  2G29 A;  3O28 A;  2WBD A;  2W7Y A;  3TYH A;  4P9K A;  2OLB A;  1DCU A;  2P1S A;  2RC9 A;  3AXF A;  4PGP A;  4ESW A;  1FQB A;  3ZKL A;  4O3A A;  2DP8 A;  3CFZ A;  4DCY A;  1NH8 A;  3RT6 B;  4ZED A;  3K6V A;  3PPR A;  3A29 A;  4QFP A;  1S9T A;  3FBP A;  2XXP A;  2Q2A A;  3I6V A;  4PF6 A;  3H3G A;  1MXW A;  3HHF A;  3THI A;  1IUD A;  1N76 A;  2VP1 A;  1MDP 1;  2O1L A;  3FAT A;  1FTL A;  4F3G A;  5DYH A;  4U22 A;  2FYI A;  3CI8 A;  4NF8 A;  1P99 A;  4R6Y A;  2DWJ A;  3C4M A;  3H06 B;  2HZK A;  2B65 A;  5L9O A;  3IJX B;  3FIR A;  2REJ A;  4EXK A;  4TOZ A;  2XXV A;  3IB1 A;  1VR5 A;  1S7Y A;  4IO4 A;  2Q88 A;  1ZJL A;  2QSX A;  4N91 A;  2XWK A;  4YIC A;  4R6H A;  3JYR A;  5EQ9 A;  3N5L A;  1SBP A;  1UTH B;  3BIH A;  4QFL A;  1FPJ A;  4PBQ A;  5IZ3 A;  3K01 A;  2UYE A;  4KHZ E;  2H9B A;  3MP6 A;  1GR2 A;  3FXB A;  4GWU A;  3SET A;  1MH4 A;  4DXU A;  4AB6 A;  3N26 A;  3UK4 A;  4IO3 A;  3IO6 A;  4P11 A;  4M1V A;  5FHN A;  1Y3Q A;  3KOS A;  3OEN A;  1FPF A;  4YKJ A;  1ZMG A;  1LB9 A;  3LC8 A;  2PYY A;  3RLF E;  3CG3 A;  2XXT A;  1B46 A;  4EQ7 A;  5F24 A;  4M4G A;  1BIY A;  4H1X A;  2UVG A;  4LQ5 A;  4YB5 A;  2O7U A;  3FGS A;  1B5H A;  3SEV A;  3H6U A;  2XXR A;  1EH3 A;  2A5T A;  5EYF A;  3Q26 A;  3OEK A;  3T9X B;  4WEP A;  4JB7 A;  4IO7 A;  1UTB A;  4OFJ A;  4OVS A;  4LQ2 A;  3MZ1 A;  4WKM A;  4MMP A;  3B7D A;  1K9Z A;  1TT1 A;  4ZEB A;  3A3C A;  5DVF A;  2QVU A;  1K9Y A;  2DDK A;  3T93 B;  4C1T A;  3DP6 A;  1MQJ A;  2UVI A;  4KD5 A;  3IOR A;  1B0H A;  4O3C A;  4IGT A;  3V8X B;  4OXV A;  3DM0 A;  3E78 A;  1LCT A;  3GXA A;  4MFI A;  3A3U A;  3IOT A;  2MKZ A;  3U72 A;  4N15 A;  4R9G A;  1LBC A;  3B50 A;  4O7I A;  5DW8 A;  1P1N A;  2CEY A;  4FE8 A;  1XS5 A;  1MRP A;  4NQ8 A;  4G4P A;  2VD3 A;  4IR8 A;  2UVH A;  4LAT A;  4N17 A;  4H6D A;  2Q2C A;  3SEU A;  4X1D A;  4THI A;  4ZEF A;  3FV1 A;  3SEY A;  1B0L A;  1PBQ A;  5TP9 A;  3E79 A;  3PUZ E;  5DVI A;  3UGW A;  1N84 A;  3EQ1 A;  4RXL A;  3T66 A;  3V5A A;  4I1D A;  2QS1 A;  5CRY A;  3IO4 A;  5CBS A;  2ONS A;  3FVG A;  2V93 A;  2RF1 A;  2Q8M A;  3R7X A;  1MQH A;  3VXB A;  2Q9T A;  1B1H A;  3K4U A;  1NI9 A;  1NV6 A;  2ONK E;  4DLD A;  1DK4 A;  3LSF B;  4PC9 A;  4RPO A;  4MNI A;  4NE4 A;  2ZZX A;  3KBZ A;  3KEI A;  2XXY A;  1LAH E;  5I59 A;  3ZS6 A;  1ZBM A;  4F22 A;  4DDD A;  1GGG A;  2F6G A;  1MXX A;  5ITO A;  2OK2 A;  1NV3 A;  4XIG Q;  1Y1Z A;  1LFH A;  2LAO A;  1UTB B;  4R75 A;  2RC8 A;  1B51 A;  3TMG A;  5TU0 A;  1F9B A;  4RA1 A;  2YPN A;  4GX6 A;  4R2F A;  1SVX B;  4ZEK A;  4P3L A;  2Z23 A;  3TTR A;  1Q9D A;  1NKX A;  1NNT A;  3IOU A;  1H3D A;  2Y5K A;  4MNC A;  2IA4 A;  1QUJ A;  1ZKB A;  4PP0 A;  2JJK A;  2PVU A;  3MJN A;  4P0G A;  4NWD A;  1IZ1 A;  4MLV A;  3KC0 A;  1US5 A;  3K1N A;  1EZO A;  2ZZV A;  3KOT A;  1Y4T A;  4QFN A;  2O51 A;  3MC2 A;  2I0B A;  1P1O A;  1OQG A;  3GBB A;  4YZZ A;  2PT1 A;  1NV2 A;  1RKM A;  2BJI A;  4Q0C A;  3U94 A;  1FQC A;  1YCJ A;  1QUL A;  1H76 A;  3V83 A;  2DQV A;  3H4Z A;  4IGR A;  2WKY A;  4XKP A;  3KN8 A;  2O84 X;  3OSQ A;  1INP A;  1BK4 A;  1IIT A;  2XA5 A;  1A40 A;  1MH3 A;  3SDF A;  1RDY A;  3PV0 E;  2QS2 A;  4U4S A;  1LCF A;  1H43 A;  2XXX A;  3CR9 A;  3G3F A;  1MQG A;  2V84 A;  4IO6 A;  2UXA A;  2XXI A;  1MY1 A;  3KBR A;  3KZG A;  1CB6 A;  1NNP A;  2ZNS A;  3QIM A;  4H65 A;  3BFU A;  4OVT A;  4YKI A;  3R6U A;  4X8R A;  2E0S A;  3UA8 A;  4EXL A;  3ONM A;  1AMF A;  3S9E A;  4HCY A;  3QYT A;  3ECR A;  3KG2 A;  3EHS A;  3IJO B;  4GWO A;  4LZ8 A;  2FA7 A;  1EZ9 A;  4FAJ A;  1B3F A;  4C0R A;  3MVW A;  2XX9 A;  1CE2 A;  3JV9 A;  4R72 A;  3VDF A;  1SI1 A;  2NOO A;  4POW A;  3TUS A;  2H5Y A;  3CSG A;  3OEL A;  2D5W A;  4RPN A;  1YTV A;  3O66 A;  3T9H B;  4JSD A;  3VXC A;  1IXI A;  1RYO A;  2FBP A;  5DT6 A;  3PD9 A;  3K6U A;  2RKM A;  1ANF A;  2AYS A;  1I6Q A;  3GBA A;  2NVU B;  4Z7E A;  1EZP A;  4X48 A;  3FXQ A;  2F78 A;  1FBP A;  5EHM A;  3PPQ A;  1O63 A;  3ODB A;  3H03 A;  5M2V A;  5KZT A;  1TWY A;  4OHN A;  4E0X A;  1R9Q A;  3H7M A;  5H8F A;  1SD3 A;  2XXK A;  1YYZ A;  4IY5 A;  3D1R A;  3IK6 B;  5B70 A;  1YZ0 A;  3VVE A;  4QF9 A;  5HBC A;  3USD A;  4BLA A;  1HSL A;  4ZZA A;  1IMC A;  1YXI A;  4OA4 A;  3FVO A;  2DYX A;  3IB2 A;  1XVX A;  1LBV A;  2GRV A;  4OZ9 A;  1MXU A;  3MVX A;  5I2N B;  3SEW A;  3IB0 A;  4K3F A;  4LUB A;  1B40 A;  3U93 A;  1M5D A;  4PFT A;  4KFQ A;  1D9Y A;  5I56 A;  1URS A;  4GFR A;  4ZDM A;  3TFL A;  2OWZ A;  3OMB A;  2WEF A;  2DXY A;  3UIF A;  1ZIU A;  4U23 A;  2ZNT A;  4PE5 B;  3PUV E;  4JWX A;  1IQ7 A;  3SKP A;  2CZL A;  1FTO A;  1NV4 A;  3MP8 A;  3U8Q A;  4LVQ A;  3IR1 A;  1GVC A;  1SW5 A;  2B3B A;  4G68 C;  1FPL A;  3TDJ A;  3EN3 A;  4MEV A;  1VFE A;  4YKP A;  4U21 A;  1TFD A;  4NF5 B;  1DPP A;  2HXR A;  2XXU A;  1JVX A;  3N94 A;  2V25 A;  4HE2 A;  5ELV A;  4MF3 A;  5CI5 A;  1GV8 A;  1MG1 A;  2NWJ A;  3RGY A;  3LUY A;  3KGC A;  4O8M A;  2PMS A;  4FEC A;  4PF8 A;  4IO5 A;  1FBF A;  2DWH A;  2I0C A;  1KZ8 A;  2XD3 A;  3ISP A;  3DEL B;  4LA9 A;  2ZYO A;  2KR0 A;  3S9N C;  4OES A;  3S9M C;  3EHU A;  3DP8 A;  4ECF A;  4KYD A;  1OLA A;  4XKR A;  5H8F B;  1Y9U A;  4YB6 A;  3H6W A;  1JW1 A;  4GL8 A;  4F1U A;  4G77 A;  4PAI A;  4FJP A;  1H44 A;  3Q25 A;  3RN8 A;  4H8I A;  3HPI A;  1Z7M E;  2O7I A;  1SW1 A;  3LV0 A;  3OO7 A;  3M8U A;  4EDP A;  2A5S A;  4DE8 A;  2R9J A;  2ABH A;  1R9L A;  1JW4 A;  3SEX A;  5AA2 B;  5A5L A;  4EF2 A;  4ONY A;  5AA4 A;  4N07 A;  3HV1 A;  1DTZ A;  3TAJ A;  1JW5 A;  3W9V A;  2KLF A;  4N6K A;  4ZEC A;  2HAU A;  2ZYK A;  4F2O A;  1B5I A;  3LSL A;  3WAE A;  4I8C A;  2H4I A;  1BLF A;  5IM2 A;  1NNF A;  1Y4C A;  2V3Q A;  2UVJ A;  5EYG A;  3U92 A;  5I2K B;  5I56 B;  5L8D A;  4PCD A;  1NUY A;  1LGB C;  1G0H A;  4PDD A;  3K2D A;  2B3F A;  1ZLQ A;  3KJ7 A;  1DTG A;  1DBZ A;  2QJE A;  4XXU A;  3CSB A;  1N04 A;  4RJZ A;  4R74 A;  3GZG A;  4MH5 A;  4N6D A;  4F3P A;  3K6X A;  4PFB A;  3G3J A;  2OWT A;  1YAE A;  4OEU A;  2F36 A;  1IXG A;  2GHA A;  4FAT A;  3D4C A;  4ESX A;  1USY H;  4F3S A;  2Y7R A;  3MQ9 A;  1MPB A;  4HTG A;  2QMW A;  1EYI A;  4F19 A;  1OVB A;  4QFK A;  3JZJ A;  3MVY A;  4ZZE A;  4PE3 A;  1N3W A;  3G3G A;  3E9X A;  1B52 A;  3L6H A;  4QHQ A;  3TQW A;  4PBH A;  3TEP A;  1EYJ A;  4GF8 A;  1B7Z A;  4RNS A;  3OO9 A;  2GH9 A;  1T0K A;  2XX7 A;  1IXH A;  3B8B A;  1IMF A;  4XKN A;  2DE2 A;  4KI0 E;  1AL3 A;  4JDF A;  4NGU A;  1B3H A;  3FD3 A;  5I57 A;  1ZTY A;  3K02 A;  4NF8 B;  5IGA A;  5A5X A;  2Y7P A;  4QSC A;  4KPT A;  4AQ4 A;  3TTK A;  1Y1M A;  4YMB A;  3RUM A;  1LBZ A;  4UAB A;  1QKB A;  1FTM A;  2F97 A;  3K6W A;  3EKI A;  2QVV A;  4NG7 A;  2F6P A;  5I58 A;  3TTN A;  1WOD A;  1B5J A;  3F11 A;  5K2X A;  3HHG A;  2I3V A;  2F7A A;  4PGN A;  4N6P A;  2F34 A;  4UA8 A;  4OFL A;  4AS4 A;  5T3J A;  3D4G A;  5IZ3 B;  5FTI A;  4HW8 A;  3IOW A;  3Q29 A;  1FQE A;  4OTE A;  3E4R A;  4YU0 A;  1A54 A;  3CIJ A;  3VVD A;  2F5X A;  4QBA A;  3SES A;  3PUY E;  2ZMB A;  1NV5 A;  2X7Q A;  1JEU A;  3FJM A;  2VD2 A;  3FVN A;  4N81 A;  4MAG A;  3U65 A;  3C31 A;  2QVR A;  4PAK A;  1ELJ A;  4ZE9 A;  4XF5 A;  5IAI A;  1B58 A;  1OLC A;  2WYP A;  4GWX A;  3PPN A;  3M3K A;  3M3L A;  4RYA A;  1H45 A;  5LTC A;  3VVF A;  2XHD A;  5EYH A;  1A8F A;  3HO7 A;  3PTY A;  4GD5 A;  1A55 A;  2A5T B;  3ZSF A;  2ZXT A;  4NF6 A;  2O1M A;  4H8J A;  4DXC A;  5BUU A;  1FBE A;  3N6U A;  2ZNU A;  1Q35 A;  3SZP A;  2THI A;  4KYS A;  1NMU A;  3B6W A;  2F7B A;  4QSD A;  4AB5 A;  2D21 A;  3T22 A;  1HSE A;  1B7U A;  3QXM A;  3Q27 A;  5IKB A;  4GX3 A;  2P3N A;  4OER A;  1FPD A;  2VHA A;  1FJ6 A;  4HE1 A;  4PET A;  2HHM A;  2UYF A;  3C32 A;  4RK9 A;  3RNN A;  3K0V A;  1ATG A;  2V3U A;  2WBB A;  3CVG A;  5AA1 A;  4WED A;  5I58 B;  4G61 A;  4OVJ A;  3HST A;  4NX1 A;  4LON B;  3C9H A;  1SYI A;  3VLW A;  1PB7 A;  4OVP A;  2F8D A;  4L17 A;  5TP9 B;  3A09 A;  4P8B A;  1SI0 A;  5TPA A;  4N4U A;  4JSO A;  4G8N A;  5KDT A;  4KR5 A;  4DCX A;  1FPB A;  1MXV A;  3KSX A;  5FHM A;  3PD8 A;  1OIB A;  5K2Y A;  3L6G A;  1R1N A;  1FPK A;  4E0W A;  3RPL A;  1VE4 A;  4U2R A;  5CMC A;  2RIN A;  4OVQ A;  5BWJ A;  4Q5T A;  1KA0 A;  1MY2 A;  1UIV A;  4DI3 D;  1P1U A;  4FBP A;  3BIG A;  3MPK A;  3ZKK A;  3G3I A;  3FJ7 A;  3FZV A;  4BDL A;  2V4C A;  4I40 A;  4UAC A;  4P1E A;  1FRP A;  2F35 A;  3OEM A;  4Z0I A;  4KXP A;  2HAV A;  2HPG A;  3EF7 A;  3BKI B;  2DS9 A;  5B7D A;  1TFA A;  4F2Q A;  5I59 B;  1UIU A;  3EPE A;  1LAX A;  5CMM A;  5I3S A;  3RY3 A;  3TOD A;  1FTK A;  4GRK A;  5JK4 A;  3K1M A;  3MW0 A;  4F31 B;  5EQ7 A;  4ELR A;  3HN0 A;  4OFO A;  1URD A;  1FTJ A;  2P2A A;  1QW0 A;  3IFA A;  2HFB A;  3QK6 A;  3C35 A;  1Y3P A;  1FBH A;  3EHT A;  2H99 A;  3G3H A;  1B7H A;  4HS7 A;  3CFX A;  4TQU Q;  1JVY A;  3FUZ A;  1PB9 A;  1D3K A;  2Q8J A;  2RCA A;  2AL4 A;  4I3Y A;  3VE1 B;  4DIG A;  3IX1 A;  2X7P A;  2AL5 A;  5DEX A;  3RQT A;  4R6K A;  3O6I A;  3PU5 A;  3VLV A;  1I69 A;  3VLU A;  4JWO A;  1DPE A;  4GWS A;  3B6Q A;  2Q89 A;  1MM6 A;  2DE4 A;  1IMB A;  2QRY A;  1LST A;  1XC1 A;  1EU8 A;  4G2Z A;  2YLN A;  3MUQ A;  4RY1 A;  2REG A;  3MVZ A;  1FTA A;  2CZI A;  1YPN A;  3GYY A;  5ICQ A;  3TCG A;  4H45 A;  2O69 A;  5IZZ A;  4GBV A;  3OO6 A;  1B1X A;  1XT8 A;  4OYV A;  2H98 A;  1B05 A;  4ZE8 A;  5KDT B;  3I3V A;  2G93 A;  4HXV A;  4JXI A;  1FBC A;  4OMB A;  4N13 A;  5AA3 A;  1FW0 A;  2DVC A;  2XWI A;  2OJT A;  4QXD A;  1B4H A;  3LR1 A;  4YAH X;  4O94 A;  4OEV A;  3M3F A;  3RPL B;  3UP9 A;  2IEE A;  5L9M A;  2ALU A;  1B3G A;  4Q30 B;  4H46 A;  1TXF A;  3OO8 A;  5JTY A;  5KCJ A;  2GFE A;  1B2H A;  2CZH A;  2R6G E;  2H25 A;  3R26 A;  4MJO A;  4F1V A;  4GWW A;  1J1N A;  3TPA A;  4MX6 A;  2XXH A;  1B3L A;  1FPE A;  3GLB A;  3S4U A;  4BDM A;  1MXZ A;  4C1U A;  4F3B A;  1QVS A;  1LBW A;  3VFJ A;  1M5B A;  3TEL A;  1VDW A;  3SER A;  2ONR A;  4O7M A;  4XEQ A;  4GL0 A;  1M5F A;  4DZ1 A;  1FCK A;  4NN3 A;  2Z8F A;  1I6A A;  3C33 A;  1D4N A;  5I5P A;  2NXO A;  2QS4 A;  3MST A;  3PMW A;  2OWS A;  2XXQ A;  4P56 A;  2DWA A;  3TCF A;  2GHB A;  3PMV A;  4YB7 A;  2HCA A;  1MPC A;  2Y7I A;  5CMB A;  4X04 A;  1B3E A;  3Q28 A;  4LZ5 A;  5DEX B;  3T0J A;  2HXW A;  2FNC A;  2DVZ A;  2XD2 A;  3T9V A;  4F39 A;  4AS5 A;  1RDX A;  4LZ7 A;  3TQL A;  2O68 A;  1S50 A;  1II5 A;  2P3V A;  3QUF A;  1UQW A;  1XHY A;  3MBP A;  4IY6 A;  4QFO A;  3ROJ A;  1PDA A;  2PBW A;  3O2A A;  2O6A A;  1NV1 A;  3HCQ A;  3U1O A;  2Y7W A;  2FHY A;  1SW2 A;  1SYH A;  3NOH A;  3LUZ A;  4R2B A;  2HEU A;  1N7X A;  4I62 A;  1LFI A;  1NUZ A;  2I49 A;  1P1W A;  4ISU A;  4O3B A;  2DWI A;  2FIE A;  4LN5 A;  4WXJ A;  1QUK A;  4OEN A;  2Z22 A;  1N3X A;  1SW4 A;  3O9P A;  1G0I A;  1O64 A;  1A99 A;  2FVZ A;  3FXR A;  5LOM A;  5EHS A;  4GVO A;  5H8N A;  3KFM A;  5JTY B;  5KCJ B;  2I58 A;  5DTB A;  2Y5L A;  5F1Q A;  2RC7 A;  4FEB A;  4JVC A;  2QFL A;  4U1Z A;  4P47 A;  5FTH A;  4YMA A;  3E3K A;  1LAG E;  2R71 A;  2OX3 A;  2CEX A;  3O6G A;  4QRZ A;  2M8C A;  3E13 X;  2ZYN A;  4DI4 B;  1OMP A;  3PUW E;  4BDN A;  4KQP A;  3CRB A;  5FBP A;  4MIJ A;  3MZ9 A;  1B32 A;  4PFU A;  5EQA A;  1PB8 A;  5ESY A;  4EUO A;  5ET6 A;  3PMX A;  1NUX A;  3RPW A;  2YJP A;  2OBG A;  2PCR A;  4HCW A;  3KN7 A;  3IOV A;  1N0T A;  1R6Z A;  1ZU0 A;  2QL3 A;  4PFR A;  2I4B A;  2PT2 A;  1DMB A;  5H8H A;  2E1S A;  4FED A;  1SDX A;  1QJM A;  1MY0 A;  2AIX A;  2GQ1 A;  4BDO A;  1Y20 A;  4GXS B;  1FQF A;  4GXA A;  1B6H A;  3MZB A;  1BKA A;  4H0W A;  1LBB A;  4N8Y A;  3BBR A;  3H6T A;  2OCU A;  5J16 A;  2I48 A;  2ZZW A;  2KQZ A;  1MXY A;  4HE0 A;  4PDH A;  3KC1 A;  3DLN A;  1Q1K A;  4NAP A;  5H8S A;  5AA4 B;  3HFU A;  5ITP A;  2Y7K A;  1POY 1;  1FQA A;  4RK2 A;  4GWZ A;  1DSN A;  3I5O A;  4ND9 A;  3N6T A;  1SPI A;  4FOR A;  1KA1 A;  4QSE A;  3RYD A;  4TLL B;  4U1O A;  2VPO A;  3O97 A;  3W15 C;  1XVY A;  1LBX A;  3G3K A;  5H8N B;  4X1B A;  1B4Z A;  1MQI A;  5CC2 A;  1CNQ A;  4NTL A;  3QUJ A;  1MM7 A;  4N8G A;  4R73 A;  2Y84 A;  4NF4 A;  4Q8R A;  1IMD A;  4G8M A;  3PGF A;  5HM4 B;  3T9U A;  4XFE A;  2FIX A;  3MP1 A;  2F7C A;  2NUV A;  3MPL A;  5HPQ A;  4KYE A;  5CM6 A;  1QUI A;  1IME A;  4H5G A;  3PPO A;  2ANJ A;  5EQ8 A;  1HSJ A;  3T1B A;  1LFG A;  1A7L A;  3FXU A;  1XOC A;  2XX8 A;  3UN6 A;  1M5E A;  1EYK A;  1LBY A;  3DP4 A;  1FSA A;  1I6B A;  1RYX A;  1NUW A;  2RCB A;  1MY4 A;  2ZYM A;  5AA2 D;  1N7W A;  3QSL A;  5H8H B;  2WX9 A;  1RDZ A;  1IIW A;  5DVJ A;  4I3E A;  4TLM B;  4KCC A;  3MWB A;  5ET8 A;  1MPD A;  3PUX E;  2P0S A;  2HZL A;  2I4C A;  4BDR A;  5I57 B;  4NWC A;  1MS7 A;  1OQH A;  5A5X B;  1NL5 A;  1FQD A;  4DXB A;  2OZZ A;  5J1D A;  1LB8 A;  5LDZ A;  3QAX A;  3O29 A;  4XTC Q;  1FPI A;  1SQY A;  3B6T A;  3FAS A;  2Z8D A;  1GTK A;  4NF0 A;  4P0I A;  1PC3 A;  2XWO A;  3ILU B;  1MDQ A;  4G68 A;  2DSF A;  2PFY A;  4PTK A;  2ESN A;  4KCD A;  1QGX A;  4MLQ A;  1URG A;  1NV0 A;  4JBZ A;  1Y3N A;  5F7V A;  3ILT B;  2VGQ A;  4JVI A;  3K00 A;  4G8H A;  1AIV A;  2F3D A;  4PFI A;  1D9V A;  3OXN A;  3KJT A;  4ELQ A;  3MAM A;  1AWB A;  2DXR A;  4IO2 A;  1MQD A;  1NV7 A;  2CMO A;  3WAF A;  4OQO A;  2QPQ A;  4JVD A;  4MHF A;  1LEV A;  2R8T A;  4GLI A;  4NF4 B;  3TTL A;  1JEV A;  1US4 A;  5I2N A;  1FBD A;  4XKQ A;  2DOJ A;  4PFY A;  1WDN A;  5CMK A;  1L5T A;  3CG1 A;  4ELP A;  4OVR A;  1QKA A;  1JP4 A;  4BDQ A;  2V3T A;  3VV5 A;  5H8Q A;  1DOT A;  4PQJ A;  1IMA A;  4NF6 B;  3IFC A;  1JQF A;  2VPN A;  3G7W A;  1D9Q A;  3RTF B;  4MNP A;  3RTW B;  4POX A;  4GWY A;  2Z8E A;  5IZ1 A;  3OOA A;  1A8E A;  1OVT A;  3QMF A;  2BJJ X;  1LAF E;  1PEB A;  4MBP A;  5AE4 A;  4ELO A;  3C34 A;  3LSX A;  4X9T A;  3FV2 A;  3KSJ A;  4H67 A;  4MCO A;  4NF5 A;  2QMX A;  3LBS A;  1NNK A;  3OD7 A;  4EQ9 A;  1M5C A;  4OAN A;  3P7I A;  3K1P A;  1FJ9 A;  1NH7 A;  3S9L C;  1O7T A;  4F18 A;  4FIM A;  2D3I A;  3V89 B;  4G68 B;  5ISU A;  2Q74 A;  2VOZ A;  4YKK A;  5FHO A;  1FBG A;  2DE3 A;  2XXW A;  3KN3 A;  4LP2 B;  1VSO A;  3FJG A;  1Z7N E;  5L9S A;  5JEI A;  1AOV A;  3IL1 B;  4GX4 A;  2WYK A;  5I7I A;  1XI6 A;  2X26 A; 
#chains in the Genus database with same CATH homology
 3TZA A;  5TPA B;  1BTJ A;  4I9D A;  3O6H A;  3OSR A;  1AH5 A;  4OWD A;  4JWY A;  3TKD A;  4OET A;  5AA2 A;  1POT A;  5ICT A;  1VFD A;  3IAZ A;  1UTH A;  1B9J A;  4NMY A;  5CBR A;  1P1Q A;  4H5F A;  4U4X A;  4GQO A;  1NFT A;  4EF1 A;  5I84 A;  1USY E;  2QS3 A;  4PFW A;  4R9F A;  3LSW A;  3TTM A;  2PX1 A;  5I2K A;  1IEJ A;  1IXC A;  4ZS9 A;  4GOT A;  2I6E A;  5H8Q B;  1KWH A;  3CFL A;  3T96 B;  4ZEI A;  3S2V A;  1MY3 A;  3W9W A;  3RT8 A;  3FVK A;  1PBP A;  4F1Y A;  2HQ0 A;  2I3W A;  3PPP A;  3TCH A;  4GIZ A;  1WVJ A;  4EQB A;  1JNF A;  4IB2 A;  3H6V A;  1JET A;  4NED A;  3UOR A;  1LLS A;  1BP5 A;  3C36 A;  4F29 A;  3BFT A;  2G29 A;  3O28 A;  2W7Y A;  3TYH A;  2OLB A;  2P1S A;  2RC9 A;  3AXF A;  4ESW A;  1FQB A;  3ZKL A;  4O3A A;  2DP8 A;  3CFZ A;  4DCY A;  1NH8 A;  3RT6 B;  4ZED A;  3K6V A;  3PPR A;  4QFP A;  1S9T A;  2XXP A;  2Q2A A;  3I6V A;  3H3G A;  1MXW A;  3HHF A;  3THI A;  1IUD A;  1N76 A;  2VP1 A;  1MDP 1;  2O1L A;  3FAT A;  1FTL A;  4F3G A;  5DYH A;  4U22 A;  2FYI A;  3CI8 A;  4NF8 A;  1P99 A;  4R6Y A;  2DWJ A;  3C4M A;  3H06 B;  2HZK A;  2B65 A;  5L9O A;  3IJX B;  3FIR A;  2REJ A;  4EXK A;  4TOZ A;  2XXV A;  3IB1 A;  1VR5 A;  1S7Y A;  4IO4 A;  2Q88 A;  1ZJL A;  2QSX A;  4YIC A;  4R6H A;  3JYR A;  3N5L A;  1SBP A;  1UTH B;  4QFL A;  3K01 A;  2UYE A;  4KHZ E;  2H9B A;  3MP6 A;  1GR2 A;  3SET A;  1MH4 A;  4DXU A;  4AB6 A;  3N26 A;  3UK4 A;  4IO3 A;  3IO6 A;  4P11 A;  4M1V A;  5FHN A;  1Y3Q A;  3KOS A;  3OEN A;  4YKJ A;  1ZMG A;  1LB9 A;  3LC8 A;  2PYY A;  3RLF E;  3CG3 A;  2XXT A;  1B46 A;  4EQ7 A;  4M4G A;  1BIY A;  4H1X A;  2UVG A;  4LQ5 A;  4YB5 A;  2O7U A;  3FGS A;  1B5H A;  3SEV A;  3H6U A;  2XXR A;  1EH3 A;  2A5T A;  5EYF A;  3Q26 A;  3OEK A;  3T9X B;  4WEP A;  4JB7 A;  4IO7 A;  1UTB A;  4OFJ A;  4LQ2 A;  3MZ1 A;  4WKM A;  3B7D A;  1TT1 A;  4ZEB A;  3A3C A;  5DVF A;  3T93 B;  4C1T A;  3DP6 A;  1MQJ A;  2UVI A;  4KD5 A;  3IOR A;  1B0H A;  4O3C A;  4IGT A;  3V8X B;  4OXV A;  3DM0 A;  1LCT A;  3GXA A;  4MFI A;  3A3U A;  3IOT A;  3U72 A;  4R9G A;  1LBC A;  1P1N A;  4FE8 A;  1XS5 A;  1MRP A;  4G4P A;  2VD3 A;  2UVH A;  4LAT A;  4H6D A;  2Q2C A;  3SEU A;  4X1D A;  4THI A;  4ZEF A;  3FV1 A;  3SEY A;  1B0L A;  1PBQ A;  5TP9 A;  3PUZ E;  5DVI A;  3UGW A;  1N84 A;  3EQ1 A;  4RXL A;  3T66 A;  3V5A A;  4I1D A;  2QS1 A;  5CRY A;  3IO4 A;  5CBS A;  2ONS A;  3FVG A;  2V93 A;  2RF1 A;  3R7X A;  1MQH A;  3VXB A;  2Q9T A;  1B1H A;  3K4U A;  2ONK E;  4DLD A;  3LSF B;  4RPO A;  4NE4 A;  3KEI A;  2XXY A;  1LAH E;  5I59 A;  3ZS6 A;  1ZBM A;  4F22 A;  4DDD A;  1GGG A;  2F6G A;  1MXX A;  5ITO A;  2OK2 A;  4XIG Q;  1Y1Z A;  1LFH A;  2LAO A;  1UTB B;  4R75 A;  2RC8 A;  1B51 A;  3TMG A;  5TU0 A;  1F9B A;  4RA1 A;  2YPN A;  4R2F A;  1SVX B;  4ZEK A;  2Z23 A;  3TTR A;  1NKX A;  1NNT A;  3IOU A;  1H3D A;  2IA4 A;  1QUJ A;  1ZKB A;  4PP0 A;  2PVU A;  3MJN A;  4P0G A;  4NWD A;  1IZ1 A;  4MLV A;  1US5 A;  3K1N A;  1EZO A;  3KOT A;  1Y4T A;  4QFN A;  2O51 A;  3MC2 A;  2I0B A;  1P1O A;  1OQG A;  3GBB A;  4YZZ A;  2PT1 A;  1RKM A;  4Q0C A;  3U94 A;  1FQC A;  1YCJ A;  1QUL A;  1H76 A;  3V83 A;  2DQV A;  3H4Z A;  4IGR A;  2WKY A;  4XKP A;  3KN8 A;  2O84 X;  3OSQ A;  1IIT A;  1A40 A;  1MH3 A;  3SDF A;  3PV0 E;  2QS2 A;  4U4S A;  1LCF A;  1H43 A;  2XXX A;  3CR9 A;  3G3F A;  1MQG A;  2V84 A;  4IO6 A;  2UXA A;  2XXI A;  1MY1 A;  3KBR A;  3KZG A;  1CB6 A;  1NNP A;  2ZNS A;  3QIM A;  4H65 A;  3BFU A;  4YKI A;  3R6U A;  2E0S A;  3UA8 A;  4EXL A;  3ONM A;  1AMF A;  3S9E A;  4HCY A;  3QYT A;  3ECR A;  3KG2 A;  3EHS A;  3IJO B;  4GWO A;  4LZ8 A;  2FA7 A;  1EZ9 A;  4FAJ A;  1B3F A;  4C0R A;  3MVW A;  2XX9 A;  1CE2 A;  3JV9 A;  4R72 A;  3VDF A;  1SI1 A;  2NOO A;  4POW A;  3TUS A;  2H5Y A;  3CSG A;  3OEL A;  2D5W A;  4RPN A;  1YTV A;  3O66 A;  3T9H B;  4JSD A;  3VXC A;  1IXI A;  1RYO A;  5DT6 A;  3PD9 A;  3K6U A;  2RKM A;  1ANF A;  2AYS A;  1I6Q A;  3GBA A;  2NVU B;  4Z7E A;  1EZP A;  4X48 A;  3FXQ A;  2F78 A;  5EHM A;  3PPQ A;  1O63 A;  3ODB A;  3H03 A;  5M2V A;  5KZT A;  1TWY A;  4OHN A;  4E0X A;  1R9Q A;  3H7M A;  5H8F A;  1SD3 A;  4IY5 A;  3IK6 B;  5B70 A;  3VVE A;  4QF9 A;  5HBC A;  3USD A;  4BLA A;  1HSL A;  4ZZA A;  3FVO A;  2DYX A;  3IB2 A;  1XVX A;  2GRV A;  4OZ9 A;  1MXU A;  3MVX A;  5I2N B;  3SEW A;  3IB0 A;  4K3F A;  4LUB A;  1B40 A;  3U93 A;  1M5D A;  4PFT A;  4KFQ A;  1D9Y A;  5I56 A;  1URS A;  4GFR A;  4ZDM A;  3TFL A;  3OMB A;  2DXY A;  3UIF A;  1ZIU A;  4U23 A;  2ZNT A;  4PE5 B;  3PUV E;  4JWX A;  1IQ7 A;  3SKP A;  2CZL A;  1FTO A;  3MP8 A;  3U8Q A;  4LVQ A;  3IR1 A;  1GVC A;  1SW5 A;  2B3B A;  4G68 C;  3TDJ A;  3EN3 A;  1VFE A;  4YKP A;  4U21 A;  1TFD A;  4NF5 B;  1DPP A;  2XXU A;  1JVX A;  3N94 A;  2V25 A;  5ELV A;  4MF3 A;  5CI5 A;  1GV8 A;  1MG1 A;  2NWJ A;  3RGY A;  3LUY A;  3KGC A;  2PMS A;  4FEC A;  4IO5 A;  2DWH A;  2I0C A;  2XD3 A;  3DEL B;  4LA9 A;  2ZYO A;  3S9N C;  4OES A;  3S9M C;  3EHU A;  3DP8 A;  4ECF A;  4KYD A;  1OLA A;  4XKR A;  5H8F B;  1Y9U A;  4YB6 A;  3H6W A;  1JW1 A;  4GL8 A;  4F1U A;  4G77 A;  4FJP A;  1H44 A;  3Q25 A;  3RN8 A;  4H8I A;  3HPI A;  1Z7M E;  2O7I A;  1SW1 A;  3OO7 A;  3M8U A;  4EDP A;  2A5S A;  4DE8 A;  2R9J A;  2ABH A;  1R9L A;  1JW4 A;  3SEX A;  5AA2 B;  4EF2 A;  4ONY A;  5AA4 A;  4N07 A;  3HV1 A;  1DTZ A;  3TAJ A;  1JW5 A;  3W9V A;  2KLF A;  4ZEC A;  2HAU A;  2ZYK A;  4F2O A;  1B5I A;  3LSL A;  3WAE A;  4I8C A;  2H4I A;  1BLF A;  1NNF A;  1Y4C A;  2V3Q A;  2UVJ A;  3U92 A;  5I2K B;  5I56 B;  5L8D A;  1LGB C;  3K2D A;  2B3F A;  1ZLQ A;  3KJ7 A;  1DTG A;  2QJE A;  4XXU A;  3CSB A;  1N04 A;  4RJZ A;  4R74 A;  3GZG A;  4MH5 A;  4F3P A;  3K6X A;  3G3J A;  2OWT A;  1YAE A;  4OEU A;  2F36 A;  1IXG A;  2GHA A;  4FAT A;  3D4C A;  4ESX A;  1USY H;  4F3S A;  2Y7R A;  3MQ9 A;  1MPB A;  4HTG A;  2QMW A;  4F19 A;  1OVB A;  4QFK A;  3JZJ A;  3MVY A;  4ZZE A;  1N3W A;  3G3G A;  3E9X A;  1B52 A;  3L6H A;  4QHQ A;  3TQW A;  3TEP A;  4GF8 A;  1B7Z A;  4RNS A;  3OO9 A;  2GH9 A;  1T0K A;  2XX7 A;  1IXH A;  4XKN A;  2DE2 A;  4KI0 E;  1AL3 A;  4JDF A;  1B3H A;  3FD3 A;  5I57 A;  1ZTY A;  3K02 A;  4NF8 B;  5A5X A;  2Y7P A;  4QSC A;  4KPT A;  4AQ4 A;  3TTK A;  1Y1M A;  4YMB A;  3RUM A;  1QKB A;  1FTM A;  2F97 A;  3K6W A;  2F6P A;  5I58 A;  3TTN A;  1WOD A;  1B5J A;  3F11 A;  5K2X A;  3HHG A;  2I3V A;  2F7A A;  4N6P A;  2F34 A;  4UA8 A;  4OFL A;  3D4G A;  5FTI A;  4HW8 A;  3IOW A;  3Q29 A;  1FQE A;  4OTE A;  3E4R A;  4YU0 A;  1A54 A;  3CIJ A;  3VVD A;  2F5X A;  3SES A;  3PUY E;  2ZMB A;  2X7Q A;  1JEU A;  3FJM A;  2VD2 A;  3FVN A;  3C31 A;  1ELJ A;  4ZE9 A;  5IAI A;  1B58 A;  1OLC A;  3PPN A;  3M3K A;  3M3L A;  4RYA A;  1H45 A;  3VVF A;  2XHD A;  1A8F A;  3HO7 A;  4GD5 A;  1A55 A;  2A5T B;  3ZSF A;  2ZXT A;  4NF6 A;  2O1M A;  4H8J A;  4DXC A;  5BUU A;  3N6U A;  2ZNU A;  1Q35 A;  2THI A;  4KYS A;  1NMU A;  3B6W A;  2F7B A;  4QSD A;  4AB5 A;  2D21 A;  3T22 A;  1HSE A;  1B7U A;  3QXM A;  3Q27 A;  5IKB A;  4OER A;  2VHA A;  4PET A;  2UYF A;  3C32 A;  4RK9 A;  3RNN A;  3K0V A;  1ATG A;  2V3U A;  3CVG A;  5AA1 A;  4WED A;  5I58 B;  4OVJ A;  3HST A;  4LON B;  3C9H A;  1SYI A;  3VLW A;  1PB7 A;  2F8D A;  4L17 A;  5TP9 B;  3A09 A;  1SI0 A;  5TPA A;  4JSO A;  4G8N A;  5KDT A;  4KR5 A;  4DCX A;  1MXV A;  3KSX A;  5FHM A;  3PD8 A;  1OIB A;  5K2Y A;  3L6G A;  1R1N A;  4E0W A;  1VE4 A;  4U2R A;  5CMC A;  2RIN A;  5BWJ A;  4Q5T A;  1MY2 A;  1UIV A;  1P1U A;  3MPK A;  3ZKK A;  3G3I A;  3FJ7 A;  3FZV A;  4BDL A;  4UAC A;  2F35 A;  3OEM A;  4Z0I A;  2HAV A;  3EF7 A;  3BKI B;  2DS9 A;  5B7D A;  1TFA A;  4F2Q A;  5I59 B;  1UIU A;  3EPE A;  1LAX A;  5CMM A;  3RY3 A;  3TOD A;  1FTK A;  4GRK A;  5JK4 A;  3K1M A;  3MW0 A;  4F31 B;  4ELR A;  3HN0 A;  4OFO A;  1URD A;  1FTJ A;  2P2A A;  1QW0 A;  2HFB A;  3QK6 A;  3C35 A;  1Y3P A;  3EHT A;  2H99 A;  3G3H A;  1B7H A;  4HS7 A;  3CFX A;  4TQU Q;  1JVY A;  3FUZ A;  1PB9 A;  1D3K A;  2Q8J A;  2RCA A;  2AL4 A;  3VE1 B;  4DIG A;  3IX1 A;  2X7P A;  2AL5 A;  5DEX A;  3RQT A;  4R6K A;  3O6I A;  3PU5 A;  3VLV A;  1I69 A;  3VLU A;  4JWO A;  1DPE A;  3B6Q A;  2Q89 A;  1MM6 A;  2DE4 A;  2QRY A;  1LST A;  1XC1 A;  1EU8 A;  4G2Z A;  2YLN A;  3MUQ A;  4RY1 A;  2REG A;  3MVZ A;  5ICQ A;  1YPN A;  3TCG A;  2O69 A;  3OO6 A;  1B1X A;  1XT8 A;  4OYV A;  2H98 A;  1B05 A;  4ZE8 A;  5KDT B;  3I3V A;  2G93 A;  4JXI A;  4OMB A;  4N13 A;  5AA3 A;  1FW0 A;  2DVC A;  2OJT A;  1B4H A;  3LR1 A;  4YAH X;  4OEV A;  3M3F A;  3UP9 A;  2IEE A;  5L9M A;  2ALU A;  1B3G A;  4Q30 B;  1TXF A;  3OO8 A;  5JTY A;  5KCJ A;  2GFE A;  1B2H A;  2R6G E;  2H25 A;  3R26 A;  4F1V A;  1J1N A;  3TPA A;  2XXH A;  1B3L A;  3GLB A;  3S4U A;  4BDM A;  1MXZ A;  4C1U A;  4F3B A;  1QVS A;  3VFJ A;  1M5B A;  3TEL A;  3SER A;  2ONR A;  4GL0 A;  1M5F A;  4DZ1 A;  1FCK A;  2Z8F A;  1I6A A;  3C33 A;  1D4N A;  2NXO A;  2QS4 A;  3PMW A;  2OWS A;  2XXQ A;  2DWA A;  3TCF A;  2GHB A;  3PMV A;  4YB7 A;  2HCA A;  1MPC A;  2Y7I A;  5CMB A;  1B3E A;  3Q28 A;  4LZ5 A;  5DEX B;  3T9V A;  2HXW A;  2FNC A;  2DVZ A;  2XD2 A;  4F39 A;  4LZ7 A;  3TQL A;  2O68 A;  1S50 A;  1II5 A;  3QUF A;  1UQW A;  1XHY A;  3MBP A;  4IY6 A;  4QFO A;  1PDA A;  2PBW A;  3O2A A;  2O6A A;  3HCQ A;  3U1O A;  2Y7W A;  1SW2 A;  1SYH A;  4R2B A;  2HEU A;  1N7X A;  4I62 A;  1LFI A;  2I49 A;  1P1W A;  4ISU A;  4O3B A;  2DWI A;  4WXJ A;  1QUK A;  4OEN A;  2Z22 A;  1N3X A;  1SW4 A;  3O9P A;  1O64 A;  1A99 A;  3FXR A;  5LOM A;  5EHS A;  4GVO A;  5H8N A;  3KFM A;  5JTY B;  5KCJ B;  2I58 A;  5DTB A;  5F1Q A;  2RC7 A;  4FEB A;  4U1Z A;  5FTH A;  4YMA A;  3E3K A;  1LAG E;  2R71 A;  3O6G A;  4QRZ A;  2M8C A;  3E13 X;  2ZYN A;  1OMP A;  3PUW E;  4BDN A;  4KQP A;  3CRB A;  3MZ9 A;  1B32 A;  4PFU A;  1PB8 A;  4EUO A;  3PMX A;  3RPW A;  2YJP A;  2OBG A;  4HCW A;  3KN7 A;  3IOV A;  1N0T A;  1R6Z A;  1ZU0 A;  2QL3 A;  2I4B A;  2PT2 A;  1DMB A;  5H8H A;  2E1S A;  4FED A;  1SDX A;  1QJM A;  1MY0 A;  2AIX A;  4BDO A;  1Y20 A;  4GXS B;  1FQF A;  4GXA A;  1B6H A;  3MZB A;  1BKA A;  4H0W A;  1LBB A;  3BBR A;  3H6T A;  2OCU A;  2I48 A;  1MXY A;  3DLN A;  1Q1K A;  5H8S A;  5AA4 B;  5ITP A;  2Y7K A;  1POY 1;  1FQA A;  4RK2 A;  1DSN A;  3I5O A;  4ND9 A;  3N6T A;  4FOR A;  4QSE A;  4TLL B;  4U1O A;  3O97 A;  3W15 C;  1XVY A;  3G3K A;  5H8N B;  4X1B A;  1B4Z A;  1MQI A;  5CC2 A;  4NTL A;  3QUJ A;  1MM7 A;  4R73 A;  2Y84 A;  4NF4 A;  4Q8R A;  4G8M A;  3PGF A;  5HM4 B;  3T9U A;  3MP1 A;  2F7C A;  2NUV A;  3MPL A;  5HPQ A;  4KYE A;  5CM6 A;  1QUI A;  4H5G A;  3PPO A;  2ANJ A;  1HSJ A;  1LFG A;  1A7L A;  3FXU A;  1XOC A;  2XX8 A;  3UN6 A;  1M5E A;  3DP4 A;  1I6B A;  1RYX A;  2RCB A;  1MY4 A;  2ZYM A;  5AA2 D;  1N7W A;  3QSL A;  5H8H B;  1IIW A;  5DVJ A;  4TLM B;  4KCC A;  3MWB A;  1MPD A;  3PUX E;  2P0S A;  2HZL A;  2I4C A;  4BDR A;  5I57 B;  4NWC A;  1MS7 A;  1OQH A;  5A5X B;  1NL5 A;  1FQD A;  4DXB A;  2OZZ A;  5J1D A;  1LB8 A;  3QAX A;  3O29 A;  4XTC Q;  1SQY A;  3B6T A;  3FAS A;  2Z8D A;  1GTK A;  4P0I A;  1PC3 A;  3ILU B;  1MDQ A;  4G68 A;  2DSF A;  2ESN A;  4KCD A;  4MLQ A;  1URG A;  4JBZ A;  1Y3N A;  5F7V A;  3ILT B;  2VGQ A;  3K00 A;  4G8H A;  1AIV A;  1D9V A;  3OXN A;  3KJT A;  4ELQ A;  3MAM A;  2DXR A;  4IO2 A;  1MQD A;  2CMO A;  3WAF A;  4OQO A;  2QPQ A;  4GLI A;  4NF4 B;  3TTL A;  1JEV A;  1US4 A;  5I2N A;  4XKQ A;  2DOJ A;  4PFY A;  1WDN A;  5CMK A;  1L5T A;  3CG1 A;  4ELP A;  1QKA A;  4BDQ A;  2V3T A;  3VV5 A;  5H8Q A;  1DOT A;  4PQJ A;  4NF6 B;  1JQF A;  3G7W A;  3RTF B;  3RTW B;  4POX A;  2Z8E A;  3OOA A;  1A8E A;  1OVT A;  2BJJ X;  1LAF E;  1PEB A;  4MBP A;  5AE4 A;  4ELO A;  3C34 A;  3LSX A;  4X9T A;  3FV2 A;  3KSJ A;  4H67 A;  4NF5 A;  2QMX A;  3LBS A;  1NNK A;  3OD7 A;  4EQ9 A;  1M5C A;  3P7I A;  3K1P A;  1NH7 A;  3S9L C;  1O7T A;  4F18 A;  4FIM A;  2D3I A;  3V89 B;  4G68 B;  5ISU A;  2VOZ A;  4YKK A;  5FHO A;  2DE3 A;  2XXW A;  3KN3 A;  4LP2 B;  1VSO A;  3FJG A;  1Z7N E;  5L9S A;  5JEI A;  1AOV A;  3IL1 B;  2X26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...