1Q35A

Crystal structure of pasteurella haemolytica apo ferric ion-binding protein a
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
318
structure length
317
Chain Sequence
ANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADGLVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDRVGKLPAGFDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKANLARKPQGGDRDQVKAIKEGICDYSIGNSYYYGKMLDDEKQKSWAEAAIINFPSGEHGTHKNISGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHEYPVKEGIEPSAIVKGWGTFKSDTIKLEDIAKNYEAALKLVDEVKFDDFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords iron binding protein FbpA
publication title Crystal structure of Pasteurella haemolytica ferric ion-binding protein A reveals a novel class of bacterial iron-binding proteins
pubmed doi rcsb
source organism Mannheimia haemolytica
molecule tags Metal binding protein
total genus 124
structure length 317
sequence length 318
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1q35A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1q35A02
4AB5A 2UVJA 2I4CA 3A09A 3FV2A 5JTYA 3K01A 1MM7A 3G3HA 3I3VA 5TU0A 5FTIA 1MY1A 2QJEA 3GXAA 3EHTA 3GZGA 3LUYA 4Q8RA 2OJTA 2F6PA 1BTJA 1N3WA 1B58A 2DSFA 4QFPA 2THIA 4WEPA 3U1OA 2O1LA 4Z0IA 3KN3A 2DWJA 4OESA 4HS7A 3DM0A 4ISUA 4JXIA 3TUSA 2RC7A 2F8DA 4G8MA 2ZYNA 1B3EA 2UYFA 4NEDA 3M3KA 1MDQA 3K6XA 1POTA 3EPEA 1NH8A 1SW4A 3OO6A 4R72A 1B0HA 3KJTA 2O7IA 1MQHA 2Y7IA 4U1OA 3B6WA 4H8IA 1IXCA 2QL3A 3Q26A 3W9VA 3OSRA 1EU8A 3U8QA 3HV1A 3KN8A 1EH3A 1N0TA 4DXBA 2XXQA 4XTCQ 5CM6A 1B7ZA 2ANJA 3T93B 4JSOA 3OEKA 3VVFA 1UTBB 4F1VA 4EXKA 3ZS6A 3ODBA 1VFEA 1QULA 5AA2A 2ZXTA 1B6HA 3C35A 1ZLQA 4HTGA 2DP8A 3MP8A 4XKRA 4I9DA 4H8JA 4ONYA 4GF8A 4BDNA 3K6VA 1MRPA 4BDLA 3FIRA 4YB6A 1B3FA 4PFWA 4RXLA 4LP2B 1USYH 3EHSA 4BLAA 4F2QA 1SYHA 3UIFA 3VFJA 1MH3A 3N5LA 4O3AA 2P2AA 2YLNA 1Y1MA 4F1UA 4M1VA 3N26A 1SYIA 1A55A 3QK6A 3S2VA 4F31B 4YU0A 1NH7A 3KOTA 1AOVA 4NF6A 1HSJA 3LBSA 4UA8A 4TLLB 1L5TA 4DXUA 4X9TA 1B7UA 4GOTA 1LAGE 4NE4A 1B51A 4F29A 1XVXA 4G8HA 1NNPA 2GH9A 4DXCA 1Y1ZA 1XC1A 4HCWA 2F7AA 4F3PA 4GRKA 1Y4CA 2Y7WA 3TDJA 3IO6A 4RJZA 3TZAA 1MPDA 3C36A 5I58A 4ZZEA 4F39A 1LCFA 3VLWA 1SI1A 4YICA 1LAFE 5IAIA 2E0SA 2DWIA 3VLVA 1BKAA 1M5CA 5ICTA 4P0IA 1TWYA 2ZNUA 4IO3A 4GL0A 4I62A 2UXAA 3TAJA 4LA9A 1QVSA 2QS2A 2O6AA 1BLFA 3LC8A 5H8HA 3SKPA 2M8CA 3VV5A 3IB1A 2PT1A 3C4MA 3Q29A 4U4XA 2AIXA 4NF8A 3MVWA 3MVYA 3OO7A 3RN8A 2OBGA 2PBWA 2XXYA 3MUQA 3DLNA 4OFLA 2O84X 3FXQA 5KCJA 4H0WA 1S7YA 4KD5A 1A40A 2VOZA 3MW0A 3OEMA 3SESA 1B46A 4OERA 3KGCA 3K4UA 4R75A 3SEVA 2GFEA 5FHNA 2F5XA 2QS4A 5I2NA 5AA2B 1MXWA 3B7DA 4FIMA 2OCUA 1MQDA 3ILUB 2NWJA 3FJGA 1TFAA 4JWYA 4ZECA 2OLBA 4GXAA 1B32A 4EQBA 4IY6A 3BBRA 2Z8EA 2E1SA 1MQJA 3GLBA 5CMMA 1Y3PA 1DTGA 1GGGA 3IB0A 3OO8A 5EHMA 4JWOA 3S9LC 1I6AA 2XXHA 4ZZAA 1M5BA 4ELQA 1LSTA 3V89B 1LB9A 5DT6A 4YMBA 1PBQA 5B70A 1BIYA 1J1NA 1YPNA 3O9PA 3TYHA 1B3LA 3OSQA 3H06B 3K2DA 3VDFA 3T9VA 1IUDA 1D3KA 4NF6B 2AYSA 2XXRA 4YMAA 5L8DA 2H5YA 1AH5A 3N6TA 2ESNA 4Z7EA 2Q89A 3E3KA 3R7XA 3I6VA 4XKQA 2O1MA 3RTFB 3K0VA 1M5FA 4R9GA 1LGBC 3CG3A 4I8CA 3OD7A 5H8FA 4YKKA 2ZYKA 2Z8FA 1CB6A 4R73A 3IO4A 3RT6B 3TFLA 4IY5A 2PMSA 2DXRA 3FGSA 4IB2A 3BKIB 3VXCA 5HBCA 3V5AA 2VP1A 1F9BA 4ECFA 4QSDA 3MP6A 3CSGA 4DDDA 1XVYA 4H65A 3PPRA 4U2RA 3Q25A 1PC3A 4YKJA 1TXFA 3B6QA 3PD9A 2V3TA 3PGFA 3CIJA 2VGQA 5CMCA 1URDA 3PPQA 5EHSA 3ONMA 5H8HB 1XS5A 4EF1A 1LBBA 1ZKBA 5CRYA 2I0CA 3T66A 4KYDA 1GV8A 1R6ZA 3CFXA 2UVHA 3T96B 5KZTA 2HAVA 1DSNA 1FTOA 2DYXA 1NL5A 4GIZA 1B3HA 3K00A 3TTMA 1QUJA 2VHAA 3O6IA 3S9MC 4I1DA 2NXOA 4QSCA 4RYAA 1TFDA 5KCJB 4GLIA 2DQVA 2YPNA 3RTWB 1O64A 3P7IA 5DVFA 1NKXA 2A5SA 5HPQA 1A7LA 1P1QA 2HEUA 5I2NB 5I56A 3UA8A 4IO5A 4ESXA 4XKNA 1D9YA 2HZLA 1O7TA 5L9OA 1GVCA 3IR1A 2W7YA 4F18A 1PEBA 1DTZA 4QF9A 4PP0A 4WEDA 1P1OA 1H45A 4ELPA 4EQ9A 4XXUA 3OO9A 3LR1A 1Z7ME 2Z8DA 3HPIA 3PV0E 1B5JA 1P1NA 1IXIA 4OXVA 1Y9UA 1P99A 1Z7NE 4OWDA 5H8NA 4OENA 2R6GE 4O3BA 2I4BA 1ANFA 4TLMB 2D5WA 1YCJA 4FEDA 2P0SA 4IGRA 4ZDMA 3FVNA 1JW5A 3LSXA 4YKIA 2DWHA 4N07A 4MLVA 5ITOA 3TCGA 4U22A 4PFUA 1DPPA 1OLAA 2H99A 4GD5A 3KG2A 3C33A 4XIGQ 1ZTYA 1SQYA 2QS1A 3W9WA 4AB6A 3T9UA 3CRBA 4ZEDA 2HZKA 2O68A 3C9HA 4ZEFA 1A54A 1ATGA 4R6KA 4N13A 2V84A 2ZNTA 5H8FB 2DVZA 4IO6A 4NWCA 1LB8A 4OMBA 5JEIA 5B7DA 3E4RA 1PB7A 1R9QA 3FVOA 1II5A 1VR5A 5TPAA 3FATA 4MH5A 4PETA 4MFIA 2QS3A 3QIMA 2CZLA 2I0BA 1FTMA 1MS7A 3VVEA 3OELA 3HHGA 3PUVE 1SI0A 4KCCA 1OVBA 4OFOA 3O2AA 2RC8A 4ELOA 2F7CA 4RNSA 5F7VA 4X1BA 1EZOA 3RY3A 4QSEA 2IA4A 2DE4A 3RQTA 1MY0A 4H6DA 3ZSFA 1M5DA 3EN3A 1Y4TA 4ZEIA 5H8SA 4DIGA 3KZGA 3D4CA 4ZE8A 4MBPA 3QUFA 1FQFA 4QRZA 3SEUA 3KJ7A 5I2KA 1AIVA 1B4ZA 2DVCA 3I5OA 2X26A 2B65A 4THIA 1LCTA 1A99A 2Q2AA 4POXA 4R9FA 3DP6A 4L17A 3OXNA 4DCXA 2F7BA 3T9HB 1YAEA 3PPPA 1O63A 1FCKA 4UACA 1MXZA 1PDAA 3TCFA 3N94A 3HN0A 4KCDA 3SEXA 2HCAA 3EF7A 3ZKLA 4MLQA 5I56B 2GHAA 3IL1B 4GXSB 1IZ1A 3PPOA 1MPCA 3QSLA 2O51A 3H6WA 1FW0A 4KHZE 3O6HA 5DVIA 1R9LA 3MZ9A 2KLFA 4KPTA 2LAOA 3RPWA 2R9JA 4U23A 1N84A 2F78A 4R2FA 3WAEA 3QXMA 4F2OA 3CFLA 5H8NB 2VD3A 1OIBA 3R26A 3S4UA 4OTEA 2RCBA 1IEJA 2DE3A 4NF5A 4RPOA 3IX1A 2OZZA 3A3CA 3OOAA 4LONB 3G3FA 4FECA 4ZS9A 2VD2A 1N7WA 3KSXA 2Y7PA 2HFBA 5A5XA 3G3IA 5CC2A 5I57A 3G7WA 3W15C 5H8QA 3FV1A 1SW1A 3PMVA 4NWDA 2I58A 4YZZA 1P1WA 3JZJA 1US5A 2G93A 3C32A 4K3FA 1WODA 3BFUA 5CBRA 1QUIA 3MJNA 5L9SA 2XXPA 1ZJLA 3H7MA 4IO7A 1EZ9A 4ZEKA 4ELRA 3FD3A 4JDFA 5JK4A 2AL4A 1TT1A 5TPAB 1GR2A 4GVOA 3H3GA 2OWTA 3EQ1A 3FUZA 1T0KA 3OMBA 2OK2A 3SERA 3FASA 2PT2A 2QMXA 3ILTB 1NNKA 3JV9A 1JETA 3K1NA 2O69A 2ABHA 2HXWA 5EYFA 1UIVA 4OEVA 2H25A 2UVGA 4FEBA 4Q30B 1I6BA 4C1TA 2HQ0A 4U1ZA 2FNCA 3O6GA 3VVDA 4EDPA 1YTVA 1N7XA 3ECRA 4BDRA 3K1PA 3M3FA 3B6TA 1SBPA 4PFTA 2REJA 4FATA 1USYE 1B7HA 1JW1A 1DPEA 4P0GA 1NNTA 3C31A 3RGYA 4MF3A 5I2KB 2Z22A 1OQGA 3OENA 1QUKA 3RUMA 3QAXA 1LAHE 1A8EA 5KDTA 1I6QA 3DP8A 3KEIA 1XHYA 2UVIA 1IXGA 2NUVA 3JYRA 1NNFA 1ZBMA 3C34A 1MH4A 3CR9A 1B0LA 4KI0E 4OEUA 4G2ZA 5TP9A 3SETA 4FAJA 2Q8JA 3TTLA 3MZBA 4JBZA 2YJPA 2PYYA 1LAXA 1B4HA 3TQLA 4U21A 3THIA 5AA1A 4PQJA 3DP4A 3TTNA 4RA1A 4QFKA 2V93A 4OZ9A 3LSLA 3IOTA 2ONRA 1KWHA 4NF5B 3MC2A 4N6PA 5FHMA 3K6WA 3S9EA 4YB7A 3D4GA 2XX9A 2PX1A 3MAMA 4H5FA 5A5XB 1S50A 4LQ2A 4IGTA 5I57B 5H8QB 2Q88A 1VSOA 4G68A 2CMOA 3M8UA 1MY2A 4XKPA 3G3JA 3BFTA 1B5HA 1VFDA 2D3IA 3M3LA 4GFRA 3K02A 1B1XA 4HCYA 1JW4A 1FQBA 2ONKE 1N3XA 2B3FA 3CVGA 1ZMGA 1MDP1 2Y84A 1JEUA 3O29A 3PUXE 3U94A 1OMPA 1IXHA 4NMYA 4H67A 1FTKA 1D4NA 3S9NC 3TQWA 1B2HA 2GRVA 3K6UA 4RK2A 4EXLA 5F1QA 3E13X 5ICQA 3TCHA 1URSA 1Y3NA 3MZ1A 1H43A 2ALUA 3PMXA 5ITPA 1JVXA 2QRYA 3TODA 1FTJA 1UTHB 1EZPA 2RC9A 3LSFB 4LQ5A 3T9XB 1PBPA 5BUUA 1RYOA 1RYXA 3SDFA 2NOOA 3U92A 4LZ8A 2XHDA 1CE2A 2XXUA 2WKYA 1MXVA 4R6HA 1D9VA 1B52A 4IO2A 2HAUA 2G29A 4OETA 3L6GA 2V25A 4QFLA 4X48A 3TTKA 5M2VA 3VE1B 5AA4A 2V3UA 5L9MA 4EQ7A 1PB9A 2RINA 4RY1A 5IKBA 4BDQA 1A8FA 3IOUA 5BWJA 2AL5A 3MBPA 3O28A 4HW8A 4NTLA 4R2BA 2A5TA 5K2XA 5KDTB 1H76A 2P1SA 3UN6A 3O97A 4H5GA 1DOTA 4M4GA 1HSEA 4LUBA 4X1DA 1LFGA 2I48A 1JNFA 3FVKA 1MG1A 1SDXA 1P1UA 2OWSA 1Q1KA 3Q28A 4KYEA 3WAFA 4ZEBA 4OFJA 5TP9B 3T22A 4OHNA 5J1DA 5DEXA 2FA7A 4DLDA 4G77A 5ISUA 4KYSA 1I69A 3MPKA 4Q5TA 1UQWA 4ESWA 3DELB 3GBBA 4DZ1A 3GBAA 3RNNA 3CG1A 3UP9A 5AA2D 2V3QA 3O66A 5DYHA 1R1NA 4TOZA 3UGWA 3EHUA 1FQEA 1IQ7A 1MXXA 5I84A 4QFNA 5CMBA 3UK4A 1QJMA 4G68B 3KBRA 1MY4A 3PMWA 2NVUB 2H9BA 3E9XA 4R74A 5I59A 3U93A 4PE5B 4LATA 1URGA 2F36A 1AMFA 4P11A 3KN7A 4F22A 1MY3A 1MXUA 2IEEA 1XT8A 1SD3A 2DE2A 3F11A 4NF4A 1US4A 3SEYA 3H4ZA 4IO4A 3LSWA 4KR5A 1N76A 4G68C 3K1MA 1XOCA 1DMBA 2I6EA 3TTRA 3KOSA 3CI8A 3CSBA 2DOJA 3MP1A 3MVZA 5LOMA 1IITA 1OLCA 4OVJA 3TELA 3RLFE 2R71A 5JTYB 2RKMA 3IAZA 3USDA 1H3DA 1WVJA 3QUJA 2XX8A 3IOVA 5AA4B 3KFMA 1FQAA 4F1YA 2F34A 5CI5A 4QFOA 1RKMA 2DS9A 4DCYA 1OQHA 2QSXA 2XD3A 5DTBA 2Q9TA 1Y3QA 4ND9A 2H4IA 5HM4B 5DVJA 1SW2A 2F97A 4DE8A 3HSTA 3PD8A 3QYTA 5FTHA 2ZYOA 2A5TB 2X7PA 3FXRA 2XD2A 2XXVA 3FZVA 4LZ7A 4U4SA 4PFYA 4YKPA 3A3UA 3L6HA 4RK9A 4OYVA 1N04A 2ZNSA 3H03A 3IK6B 3R6UA 3MPLA 1Q35A 3KSJA 4Q0CA 1B5IA 4GWOA 4F3SA 4C1UA 1QKAA 2GHBA 3IB2A 2B3BA 5DEXB 3HCQA 3FJ7A 2DXYA 3FJMA 1B9JA 1ZU0A 5AE4A 1H44A 1FTLA 1VE4A 4EF2A 1ELJA 3H6TA 3RT8A 1UIUA 3Q27A 2BJJX 4C0RA 4QHQA 3IJOB 1UTHA 4TQUQ 4BDOA 3G3GA 4FE8A 3PUYE 3H6UA 3IORA 1B1HA 2Y7RA 4WKMA 4G8NA 3G3KA 4F3BA 3TMGA 1GTKA 1MQGA 2UYEA 3MWBA 3TPAA 4JSDA 2DWAA 1OVTA 3U72A 3N6UA 4F3GA 1S9TA 1LLSA 1SW5A 2X7QA 2ZYMA 2RCAA 2XXXA 1HSLA 1LBCA 5I59B 1LFIA 1SVXB 5FHOA 2XXIA 5CBSA 1BP5A 3TEPA 3PU5A 4ZE9A 3TKDA 3MVXA 3HHFA 2PVUA 3PPNA 3ZKKA 1QKBA 5CMKA 3VLUA 2O7UA 3UORA 4NF4B 2H98A 2RF1A 4E0XA 2I3VA 1MPBA 1JEVA 1MM6A 1PB8A 4GQOA 1MXYA 1POY1 3HO7A 2REGA 4F19A 3PUWE 4OQOA 1Y20A 2QMWA 1B40A 4EUOA 1WDNA 4POWA 3FXUA 4E0WA 1IIWA 2F35A 4KQPA 2Q2CA 4RPNA 1FQCA 1MQIA 5I58B 3V83A 3V8XB 1LFHA 1B05A 1NFTA 1UTBA 3SEWA 1NMUA 3MQ9A 4BDMA 2XXTA 2ZMBA 1JVYA 5ELVA 2F6GA 2XXWA 4LVQA 1FQDA 4GL8A 2FYIA 4JWXA 4FORA 3IOWA 4AQ4A 2I49A 1B3GA 2D21A 4G4PA 5K2YA 5AA3A 4LZ5A 2QPQA 3H6VA 1AL3A 4R6YA 1JQFA 4KFQA 4FJPA 2Z23A 4O3CA 4NF8B 2ONSA 4YAHX 3FVGA 2I3WA 3PUZE 1QW0A 3CFZA 1M5EA 2Y7KA 4WXJA 3IJXB 3AXFA 4JB7A 4H1XA 4YB5A 2XX7A 3VXBA 1ZIUA
chains in the Genus database with same CATH superfamily
3T0JA 4AB5A 2UVJA 2I4CA 3A09A 3FV2A 1RDZA 5JTYA 3K01A 1MM7A 3G3HA 3I3VA 5TU0A 5FTIA 5EYGA 1NV7A 1MY1A 2QJEA 3GXAA 1RDYA 3EHTA 3GZGA 3LUYA 4Q8RA 2OJTA 2F6PA 1BTJA 1N3WA 3BIGA 1DBZA 4MMPA 1B58A 4GBVA 5IZ1A 4PDDA 1FPJA 2DSFA 4QFPA 2THIA 4WEPA 4MEVA 3U1OA 1LEVA 2O1LA 4Z0IA 3KN3A 1FPIA 2DWJA 4OESA 4HS7A 3DM0A 4ISUA 4JXIA 3TUSA 1D9QA 2RC7A 2F8DA 4G8MA 2ZYNA 1B3EA 2UYFA 2XWOA 4NEDA 3M3KA 4IR8A 1MDQA 3K6XA 1POTA 3EPEA 1NH8A 1SW4A 3OO6A 4R72A 1B0HA 3KJTA 2O7IA 1MQHA 2JJKA 2Y7IA 4OVRA 4U1OA 3B6WA 2VT5A 4N6DA 2BJIA 4H8IA 1IXCA 2QL3A 2PCRA 3Q26A 3W9VA 3OSRA 1EU8A 3U8QA 3HV1A 2Y5KA 3KN8A 1EH3A 1N0TA 4PAIA 4DXBA 2XXQA 4PFIA 4XTCQ 5CM6A 4PF6A 1B7ZA 2ANJA 3T93B 4JSOA 4O7MA 3OEKA 3VVFA 1IMFA 1UTBB 4F1VA 4EXKA 3ZS6A 3ODBA 1VFEA 1QULA 5AA2A 2ZXTA 4GWSA 1B6HA 3C35A 1ZLQA 4HTGA 5IM2A 2DP8A 3MP8A 4XKRA 4I9DA 1FPFA 4H8JA 4ONYA 4GF8A 4BDNA 3K6VA 1MRPA 4BDLA 3FIRA 1YYZA 4YB6A 1B3FA 4PFWA 4RXLA 4LP2B 1USYH 3EHSA 4BLAA 4F2QA 4HXVA 1IMAA 1SYHA 3UIFA 3VFJA 1MH3A 3IFCA 3N5LA 4O3AA 2P2AA 2YLNA 1Y1MA 4F1UA 1KZ8A 4M1VA 3N26A 1SYIA 1A55A 3QK6A 3S2VA 4F31B 4YU0A 1NH7A 5IZ3B 3KOTA 1AOVA 4NF6A 1HSJA 3LBSA 4UA8A 4TLLB 1L5TA 4DXUA 4UABA 2WBDA 4X9TA 1B7UA 4GOTA 1LAGE 4NE4A 1B51A 4DI4B 4P8BA 5DW8A 4F29A 1XVXA 4G8HA 1NNPA 2DDKA 2GH9A 4DXCA 1Y1ZA 1XC1A 4HCWA 2F7AA 4F3PA 4P1LA 4GRKA 1Y4CA 2Y7WA 1IMDA 3TDJA 3IO6A 4RJZA 1IMEA 3TZAA 1MPDA 1XI6A 3C36A 2P3VA 5I58A 4P56A 4ZZEA 4F39A 1LCFA 4HE1A 3VLWA 1SI1A 4YICA 1LAFE 1G0IA 5IAIA 2E0SA 2DWIA 2QVUA 1NV5A 3VLVA 1BKAA 1M5CA 5ICTA 4P0IA 1TWYA 2ZNUA 4IO3A 4GL0A 4I62A 2UXAA 3TAJA 4LA9A 1QVSA 2QS2A 2FIEA 2O6AA 1BLFA 4P1EA 3LC8A 5H8HA 2WX9A 3SKPA 2M8CA 4MJOA 3VV5A 3IB1A 3KC0A 2PT1A 3C4MA 5F24A 3Q29A 4O7IA 4U4XA 2AIXA 4NF8A 3MVWA 3MVYA 3OO7A 3RN8A 2OBGA 2PBWA 2XXYA 5FBPA 3MUQA 1FSAA 3DLNA 4OFLA 2O84X 3LV0A 3FXQA 5KCJA 4H0WA 1S7YA 4KD5A 1A40A 2F3BA 2VOZA 3MW0A 4MX6A 1KA1A 1FPKA 3OEMA 3SESA 1B46A 4OERA 3KGCA 3K4UA 4NX1A 4R75A 3SEVA 2GFEA 5FHNA 2F5XA 2QS4A 5I2NA 5AA2B 1MXWA 3B7DA 4FIMA 2OCUA 1MQDA 3ILUB 2NWJA 2WYKA 3FJGA 1TFAA 4JWYA 4ZECA 2OLBA 4GXAA 1B32A 4EQBA 4JVDA 4IY6A 1BK4A 3BBRA 2Z8EA 2E1SA 1MQJA 3GLBA 1YZ0A 5CMMA 1Y3PA 1DTGA 1GGGA 3IB0A 3OO8A 5EHMA 4JWOA 3S9LC 1I6AA 2XXHA 4ZZAA 1M5BA 4ELQA 3D1RA 4O94A 1LSTA 3V89B 3GYYA 1LB9A 5DT6A 4YMBA 1PBQA 5B70A 1BIYA 1J1NA 1YPNA 3O9PA 3TYHA 1KA0A 1B3LA 3OSQA 3H06B 4KXPA 3K2DA 3VDFA 3T9VA 4OVSA 1IUDA 1D3KA 4NF6B 2AYSA 2XXRA 4YMAA 5L8DA 2H5YA 1AWBA 1AH5A 3N6TA 2ESNA 4Z7EA 2Q89A 3E3KA 3R7XA 3I6VA 4XKQA 2O1MA 3RTFB 3K0VA 2Y5LA 1M5FA 4R9GA 1FJ9A 1LGBC 1FPBA 3CG3A 4I8CA 3OD7A 5H8FA 4YKKA 2ZYKA 2Z8FA 1CB6A 4R73A 3IO4A 3RT6B 3TFLA 4IY5A 4X8RA 2PMSA 2DXRA 3FGSA 4IB2A 3BKIB 3VXCA 5HBCA 3V5AA 2B4LA 2VP1A 1F9BA 4ECFA 1EYJA 2P3NA 2HPGA 4QSDA 3MP6A 3CSGA 4DDDA 4OA4A 1XVYA 4H65A 3PPRA 4N8YA 4U2RA 3Q25A 1PC3A 4YKJA 1TXFA 3B6QA 3PD9A 2V3TA 3PGFA 3CIJA 2VGQA 5CMCA 1URDA 3PPQA 5ET8A 5EHSA 3ONMA 5H8HB 1XS5A 4EF1A 1LBBA 1ZKBA 5CRYA 2I0CA 3T66A 4KYDA 1GV8A 1R6ZA 3CFXA 2UVHA 3T96B 5KZTA 2HAVA 1DSNA 2WEFA 4PBHA 1FBDA 2QVVA 2XWIA 1FTOA 2DYXA 1NL5A 4GIZA 1B3HA 3K00A 3TTMA 1QUJA 2VHAA 3O6IA 3S9MC 4I1DA 2NXOA 4QSCA 4RYAA 1TFDA 4P9KA 5KCJB 2VPNA 4GLIA 2DQVA 2YPNA 3RTWB 1O64A 3P7IA 5DVFA 1FTAA 2Q74A 2HXRA 4I3YA 1NKXA 4P47A 2A5SA 5HPQA 1A7LA 1P1QA 2HEUA 5I2NB 1FPDA 5I56A 4HE2A 4IO5A 3UA8A 4XKNA 1D9YA 4ESXA 2HZLA 2XWVA 1O7TA 2V4CA 5L9OA 1GVCA 3IR1A 3FBPA 2W7YA 4F18A 1PEBA 1DTZA 3ISPA 4QF9A 4PP0A 4WEDA 1P1OA 1H45A 4ELPA 4EQ9A 5I7IA 4XXUA 3OO9A 3LR1A 1Z7ME 2Z8DA 3HPIA 3PV0E 1VDWA 1B5JA 1P1NA 1IXIA 4PE3A 4OXVA 1Y9UA 3MYUA 1P99A 1Z7NE 4OWDA 5H8NA 4OENA 2R6GE 2CZIA 4O3BA 2I4BA 1ANFA 4TLMB 2D5WA 1YCJA 4PGNA 2F3DA 4FEDA 2P0SA 4IGRA 4ZDMA 3FVNA 1JW5A 4N8GA 3LSXA 4YKIA 2DWHA 4N07A 4MLVA 2QVRA 5ITOA 1LBYA 3TCGA 1G0HA 4U22A 4PFUA 1DPPA 1OLAA 2H99A 4GD5A 3KG2A 3C33A 4XIGQ 1ZTYA 1SQYA 2QS1A 3W9WA 5IZZA 4N6KA 4AB6A 3CRBA 2HZKA 2O68A 3C9HA 4ZEFA 3T9UA 4ZEDA 1A54A 1ATGA 4R6KA 4N13A 2V84A 2ZNTA 2DVZA 5H8FB 4IO6A 4NWCA 3SZPA 1LB8A 4OMBA 5JEIA 5B7DA 2GQ1A 3E4RA 1PB7A 1R9QA 3MSTA 3FVOA 1II5A 1VR5A 5TPAA 3FATA 4MH5A 4PETA 4MFIA 2QS3A 3QIMA 2CZLA 2I0BA 1FTMA 1MS7A 3VVEA 3OELA 2FHYA 3HHGA 3PUVE 1SI0A 4MIJA 4KCCA 1OVBA 4OFOA 3O2AA 1LBWA 2RC8A 3E78A 4ELOA 2F7CA 4RNSA 5F7VA 3IFAA 4X1BA 1EZOA 4PTKA 3RY3A 4QSEA 2IA4A 3B50A 2DE4A 3RQTA 5A5LA 1MY0A 1FBCA 2CEXA 4H6DA 3ZSFA 1M5DA 3EN3A 1Y4TA 4ZEIA 5H8SA 4DIGA 3KZGA 3D4CA 4ZE8A 4MCOA 2OWZA 4MBPA 3QUFA 1FQFA 4QRZA 4PAKA 3SEUA 3KJ7A 5I2KA 1AIVA 1B4ZA 2DVCA 3I5OA 2X26A 2B65A 4THIA 1LCTA 1A99A 2Q2AA 4POXA 4R9FA 3DP6A 4L17A 1NV6A 3OXNA 4DCXA 2F7BA 3T9HB 1YAEA 3PPPA 1O63A 1FCKA 4UACA 1MXZA 1PDAA 3TCFA 3N94A 3HN0A 4KCDA 3SEXA 2HCAA 3EF7A 3ZKLA 4MLQA 5I56B 2GHAA 3IL1B 4GXSB 1IZ1A 3PPOA 1MPCA 3QSLA 3KBZA 2O51A 3H6WA 1FW0A 4KHZE 3ROJA 3O6HA 5DVIA 1R9LA 3MZ9A 3EKIA 2KLFA 4KPTA 2LAOA 3RPWA 2R9JA 4U23A 1RDXA 1N84A 2F78A 4R2FA 3WAEA 3QXMA 4F2OA 3CFLA 5H8NB 2VD3A 1OIBA 3R26A 3S4UA 4OTEA 2RCBA 1IEJA 2DE3A 4NF5A 4RPOA 3IX1A 2OZZA 5LTCA 3A3CA 3OOAA 4LONB 3G3FA 3PTYA 4FECA 4ZS9A 2VD2A 1N7WA 3CHGA 3KSXA 2HHMA 2Y7PA 2HFBA 5A5XA 3G3IA 5CC2A 5I57A 3G7WA 3W15C 5H8QA 3FV1A 1SW1A 3PMVA 4O8MA 4NWDA 2I58A 4YZZA 1P1WA 3JZJA 1US5A 2G93A 3C32A 4K3FA 1WODA 2XXKA 3BFUA 5CBRA 1K9YA 1QUIA 3MJNA 5L9SA 2XXPA 1ZJLA 3H7MA 4IO7A 2KR0A 1EZ9A 4ZEKA 4ELRA 3FD3A 4NN3A 4JDFA 5JK4A 2VPOA 2AL4A 2L5VA 1TT1A 5TPAB 1GR2A 4GVOA 3H3GA 4QBAA 2OWTA 3EQ1A 3FUZA 4OVPA 1T0KA 3OMBA 2OK2A 4DI3D 3SERA 3FASA 1FPGA 2PT2A 2QMXA 3ILTB 1NNKA 4MHFA 4MNIA 3JV9A 1JETA 3K1NA 2O69A 2ABHA 2HXWA 1SPIA 5EYFA 1UIVA 4OEVA 2H25A 2UVGA 4FEBA 4Q30B 5EQ9A 1I6BA 1LBVA 4C1TA 2HQ0A 4U1ZA 2FNCA 3O6GA 3VVDA 4EDPA 1YTVA 5ET7A 1N7XA 2OX3A 3ECRA 4BDRA 3K1PA 2XA5A 3M3FA 3B6TA 1SBPA 4MNCA 4PFTA 2REJA 4FATA 1USYE 1B7HA 1JW1A 1FPEA 1DPEA 4P0GA 1NNTA 3C31A 3RGYA 4MF3A 5I2KB 2Z22A 1OQGA 3OENA 1QUKA 4N4UA 3RUMA 4MNPA 3QAXA 1LAHE 1A8EA 5KDTA 1I6QA 3DP8A 1LBZA 3KEIA 1NV3A 1XHYA 2UVIA 1IXGA 2NUVA 3JYRA 1NNFA 1ZBMA 4FBPA 4NG7A 3C34A 1MH4A 3CR9A 1B0LA 5ET5A 4KI0E 2CZHA 4OEUA 4G2ZA 5TP9A 3SETA 4FAJA 5J16A 2ZZXA 2Q8JA 3TTLA 3MZBA 4JBZA 2YJPA 2PYYA 1LAXA 1B4HA 3TQLA 4U21A 3THIA 5AA1A 4PQJA 3DP4A 3TTNA 2FVZA 3RPLA 4RA1A 4QFKA 2R8TA 2V93A 4OZ9A 3LUZA 3LSLA 1IMBA 3IOTA 2ONRA 1KWHA 4NF5B 4PFRA 3MC2A 4N6PA 5FHMA 3K6WA 3S9EA 4YB7A 3D4GA 2XX9A 2PX1A 3MAMA 4H5FA 5A5XB 1S50A 4LQ2A 3KC1A 4IGTA 5I57B 5H8QB 4OVTA 2Q88A 1VSOA 4G68A 2CMOA 3M8UA 1MY2A 4XKPA 3G3JA 3BFTA 1B5HA 1VFDA 2D3IA 3M3LA 4G61A 4GFRA 3K02A 1B1XA 4HCYA 1JW4A 1FQBA 2ONKE 1N3XA 2B3FA 3CVGA 1ZMGA 4NF0A 1MDP1 2Y84A 1JEUA 3O29A 4N81A 3PUXE 3U94A 1OMPA 2QFLA 1IXHA 4NMYA 4H67A 1FTKA 1D4NA 3S9NC 3TQWA 1B2HA 2GRVA 3K6UA 4RK2A 4EXLA 5F1QA 3E13X 5ICQA 3TCHA 1URSA 1Y3NA 3MZ1A 1H43A 2ALUA 3PMXA 4GX4A 5ITPA 4X04A 1JVXA 2QRYA 3TODA 1FTJA 1UTHB 1EZPA 1QGXA 2RC9A 3LSFB 4LQ5A 3T9XB 5EQAA 1PBPA 5BUUA 1RYOA 1RYXA 3SDFA 1NUWA 2NOOA 3U92A 4LZ8A 2XHDA 1CE2A 2XXUA 4JVCA 4AS4A 1FBGA 2WKYA 1MXVA 4R6HA 1D9VA 1B52A 4IO2A 2HAUA 2G29A 4OETA 3L6GA 2V25A 4QFLA 4X48A 3TTKA 5M2VA 3VE1B 5AA4A 1IMCA 1CNQA 2V3UA 5L9MA 4EQ7A 1PB9A 2RINA 4RY1A 5IKBA 4BDQA 1A8FA 3IOUA 5BWJA 5LDZA 2AL5A 3MBPA 4PCDA 3O28A 4HW8A 4NTLA 4N15A 4R2BA 2A5TA 5K2XA 5KDTB 1H76A 2P1SA 3UN6A 3O97A 4H5GA 4NQ8A 1DOTA 4M4GA 1HSEA 1NUXA 2PFYA 4LUBA 4X1DA 1LFGA 4GWXA 3U65A 2I48A 1JNFA 3FVKA 4PBQA 1MG1A 4XF5A 1SDXA 1P1UA 2OWSA 1Q1KA 3Q28A 4KYEA 3WAFA 4XEQA 4OFJA 4ZEBA 5TP9B 3T22A 4OHNA 1FJ6A 5J1DA 5DEXA 1NV2A 2FA7A 4DLDA 4G77A 5ISUA 4KYSA 3RPLB 1Q9DA 1I69A 3MPKA 4Q5TA 1UQWA 4ESWA 3DELB 3GBBA 4I3EA 4DZ1A 3GBAA 3RNNA 3CG1A 4PGPA 3UP9A 5AA2D 2V3QA 3O66A 5DYHA 3T1BA 1R1NA 5EQ7A 4TOZA 4NAPA 3UGWA 3EHUA 1FQEA 1IQ7A 1MXXA 5I84A 4QFNA 5CMBA 3UK4A 1QJMA 4G68B 3KBRA 1DCUA 1MY4A 3PMWA 2NVUB 2H9BA 3E9XA 4R74A 5I59A 3U93A 4PE5B 4LATA 1URGA 3A29A 4GWZA 2F36A 1AMFA 4P11A 3KN7A 4F22A 1MY3A 4NHBA 1MXUA 2IEEA 3NOHA 1XT8A 1SD3A 2DE2A 3F11A 4H46A 1US4A 4NF4A 3E79A 3SEYA 4PC9A 3H4ZA 4IO4A 3LSWA 4KR5A 1EYKA 4GWWA 2KQZA 1N76A 4G68C 2XWKA 3K1MA 1XOCA 4NGUA 1DMBA 2I6EA 3TTRA 3KOSA 3CI8A 3CSBA 1FBEA 2DOJA 3MP1A 3MVZA 5LOMA 1IITA 1OLCA 4OVJA 3TELA 3RLFE 2R71A 2MKZA 5JTYB 2RKMA 4AS5A 3IAZA 3USDA 1H3DA 1WVJA 3QUJA 2XX8A 3IOVA 5T3JA 5AA4B 3KFMA 5EYHA 1FQAA 4F1YA 4GWUA 2F34A 5CI5A 4QFOA 1RKMA 2DS9A 1NI9A 4DCYA 1OQHA 2QSXA 3QMFA 2XD3A 5DTBA 2Q9TA 1Y3QA 4ND9A 2H4IA 5HM4B 5DVJA 1SW2A 2F97A 4DE8A 3HSTA 3PD8A 3QYTA 5FTHA 5ET6A 2ZYOA 2A5TB 2X7PA 5ESYA 3FXRA 2XD2A 1FPLA 2ZZWA 4P3LA 2XXVA 2CZKA 3FZVA 1FBHA 4LZ7A 4OANA 4GX3A 4PFYA 4U4SA 4YKPA 3A3UA 3L6HA 4RK9A 4OYVA 1N04A 5I3SA 2ZNSA 3H03A 3IK6B 4PF8A 3R6UA 4PFBA 3RYDA 3MPLA 1Q35A 3KSJA 4Q0CA 2PFZA 1B5IA 4GWOA 2FBPA 1NUYA 4F3SA 4C1UA 1QKAA 2GHBA 3IB2A 2B3BA 5DEXB 3HCQA 3FJ7A 2DXYA 5IGAA 3FJMA 1B9JA 1ZU0A 5AE4A 1H44A 1FTLA 1VE4A 4EF2A 1ELJA 3H6TA 3RT8A 1UIUA 3Q27A 2BJJX 3FXBA 1JP4A 4C0RA 4QHQA 3IJOB 1UTHA 4TQUQ 4BDOA 3G3GA 4FE8A 3PUYE 3H6UA 3IORA 4GBWA 1B1HA 2Y7RA 4WKMA 4G8NA 1NV0A 3G3KA 4F3BA 3TMGA 1GTKA 1MQGA 2UYEA 3MWBA 3TPAA 4JVIA 4JSDA 5I5PA 2DWAA 1OVTA 3U72A 3N6UA 4F3GA 4N91A 1S9TA 1LLSA 1SW5A 2X7QA 2ZYMA 2RCAA 2XXXA 1HSLA 1LBCA 5I59B 2B4MA 1LFIA 1FRPA 1SVXB 1FBFA 5FHOA 2XXIA 5CBSA 1BP5A 4MAGA 1EYIA 3TEPA 3PU5A 4ZE9A 3TKDA 3MVXA 2Q8MA 1FBPA 3HHFA 2PVUA 3PPNA 3ZKKA 1QKBA 5CMKA 3VLUA 2O7UA 3UORA 4NF4B 1NUZA 1K9ZA 2H98A 2RF1A 4E0XA 2I3VA 1MPBA 1JEVA 1MM6A 1PB8A 1DK4A 4GQOA 1MXYA 1POY1 3HO7A 2WBBA 2REGA 4F19A 3PUWE 4I40A 4OQOA 1Y20A 2QMWA 1B40A 4EUOA 2CEYA 1WDNA 3BIHA 4POWA 4OVQA 3FXUA 4N17A 4E0WA 1NV4A 1IIWA 2F35A 1NV1A 4KQPA 4GWYA 2Q2CA 4RPNA 4XFEA 3B8BA 1FQCA 1MQIA 5I58B 3V83A 3V8XB 1LFHA 1B05A 5EQ8A 4HE0A 1NFTA 1UTBA 3SEWA 1NMUA 3MQ9A 4H45A 1INPA 4BDMA 4QXDA 2XXTA 2ZMBA 1JVYA 5ELVA 2F6GA 2XXWA 4LVQA 1FQDA 4GL8A 4PDHA 2FYIA 4JWXA 4FORA 3IOWA 4AQ4A 2I49A 4LN5A 1B3GA 2D21A 4G4PA 5K2YA 5AA3A 3HFUA 2ZZVA 4LZ5A 2QPQA 3H6VA 1AL3A 4R6YA 1JQFA 4KFQA 4FJPA 2Z23A 4O3CA 4NF8B 1YXIA 5IZ3A 2ONSA 4YAHX 4PAFA 1LBXA 2FIXA 3FVGA 2I3WA 3PUZE 2WYPA 1QW0A 3CFZA 1M5EA 2Y7KA 4WXJA 3IJXB 3AXFA 4JB7A 4H1XA 4YB5A 2XX7A 4GX6A 3VXBA 1ZIUA
chains in the Genus database with same CATH topology
4AB5A 2UVJA 2I4CA 3A09A 3FV2A 5JTYA 3K01A 1MM7A 3G3HA 3I3VA 5TU0A 5FTIA 1MY1A 2QJEA 3GXAA 3EHTA 3GZGA 3LUYA 4Q8RA 2OJTA 2F6PA 1BTJA 1N3WA 1B58A 2DSFA 4QFPA 2THIA 4WEPA 3U1OA 2O1LA 4Z0IA 3KN3A 2DWJA 4OESA 4HS7A 3DM0A 4ISUA 4JXIA 3TUSA 2RC7A 2F8DA 4G8MA 2ZYNA 1B3EA 2UYFA 4NEDA 3M3KA 1MDQA 3K6XA 1POTA 3EPEA 1NH8A 1SW4A 3OO6A 4R72A 1B0HA 3KJTA 2O7IA 1MQHA 2Y7IA 4U1OA 3B6WA 4H8IA 1IXCA 2QL3A 3Q26A 3W9VA 3OSRA 1EU8A 3U8QA 3HV1A 3KN8A 1EH3A 1N0TA 4DXBA 2XXQA 4XTCQ 5CM6A 1B7ZA 2ANJA 3T93B 4JSOA 3OEKA 3VVFA 1UTBB 4F1VA 4EXKA 3ZS6A 3ODBA 1VFEA 1QULA 5AA2A 2ZXTA 1B6HA 3C35A 1ZLQA 4HTGA 2DP8A 3MP8A 4XKRA 4I9DA 4H8JA 4ONYA 4GF8A 4BDNA 3K6VA 1MRPA 4BDLA 3FIRA 4YB6A 1B3FA 4PFWA 4RXLA 4LP2B 1USYH 3EHSA 4BLAA 4F2QA 1SYHA 3UIFA 3VFJA 1MH3A 3N5LA 4O3AA 2P2AA 2YLNA 1Y1MA 4F1UA 4M1VA 3N26A 1SYIA 1A55A 3QK6A 3S2VA 4F31B 4YU0A 1NH7A 3KOTA 1AOVA 4NF6A 1HSJA 3LBSA 4UA8A 4TLLB 1L5TA 4DXUA 4X9TA 1B7UA 4GOTA 1LAGE 4NE4A 1B51A 4F29A 1XVXA 4G8HA 1NNPA 2GH9A 4DXCA 1Y1ZA 1XC1A 4HCWA 2F7AA 4F3PA 4GRKA 1Y4CA 2Y7WA 3TDJA 3IO6A 4RJZA 3TZAA 1MPDA 3C36A 5I58A 4ZZEA 4F39A 1LCFA 3VLWA 1SI1A 4YICA 1LAFE 5IAIA 2E0SA 2DWIA 3VLVA 1BKAA 1M5CA 5ICTA 4P0IA 1TWYA 2ZNUA 4IO3A 4GL0A 4I62A 2UXAA 3TAJA 4LA9A 1QVSA 2QS2A 2O6AA 1BLFA 3LC8A 5H8HA 3SKPA 2M8CA 3VV5A 3IB1A 2PT1A 3C4MA 3Q29A 4U4XA 2AIXA 4NF8A 3MVWA 3MVYA 3OO7A 3RN8A 2OBGA 2PBWA 2XXYA 3MUQA 3DLNA 4OFLA 2O84X 3FXQA 5KCJA 4H0WA 1S7YA 4KD5A 1A40A 2VOZA 3MW0A 3OEMA 3SESA 1B46A 4OERA 3KGCA 3K4UA 4R75A 3SEVA 2GFEA 5FHNA 2F5XA 2QS4A 5I2NA 5AA2B 1MXWA 3B7DA 4FIMA 2OCUA 1MQDA 3ILUB 2NWJA 3FJGA 1TFAA 4JWYA 4ZECA 2OLBA 4GXAA 1B32A 4EQBA 4IY6A 3BBRA 2Z8EA 2E1SA 1MQJA 3GLBA 5CMMA 1Y3PA 1DTGA 1GGGA 3IB0A 3OO8A 5EHMA 4JWOA 3S9LC 1I6AA 2XXHA 4ZZAA 1M5BA 4ELQA 1LSTA 3V89B 1LB9A 5DT6A 4YMBA 1PBQA 5B70A 1BIYA 1J1NA 1YPNA 3O9PA 3TYHA 1B3LA 3OSQA 3H06B 3K2DA 3VDFA 3T9VA 1IUDA 1D3KA 4NF6B 2AYSA 2XXRA 4YMAA 5L8DA 2H5YA 1AH5A 3N6TA 2ESNA 4Z7EA 2Q89A 3E3KA 3R7XA 3I6VA 4XKQA 2O1MA 3RTFB 3K0VA 1M5FA 4R9GA 1LGBC 3CG3A 4I8CA 3OD7A 5H8FA 4YKKA 2ZYKA 2Z8FA 1CB6A 4R73A 3IO4A 3RT6B 3TFLA 4IY5A 2PMSA 2DXRA 3FGSA 4IB2A 3BKIB 3VXCA 5HBCA 3V5AA 2VP1A 1F9BA 4ECFA 4QSDA 3MP6A 3CSGA 4DDDA 1XVYA 4H65A 3PPRA 4U2RA 3Q25A 1PC3A 4YKJA 1TXFA 3B6QA 3PD9A 2V3TA 3PGFA 3CIJA 2VGQA 5CMCA 1URDA 3PPQA 5EHSA 3ONMA 5H8HB 1XS5A 4EF1A 1LBBA 1ZKBA 5CRYA 2I0CA 3T66A 4KYDA 1GV8A 1R6ZA 3CFXA 2UVHA 3T96B 5KZTA 2HAVA 1DSNA 1FTOA 2DYXA 1NL5A 4GIZA 1B3HA 3K00A 3TTMA 1QUJA 2VHAA 3O6IA 3S9MC 4I1DA 2NXOA 4QSCA 4RYAA 1TFDA 5KCJB 4GLIA 2DQVA 2YPNA 3RTWB 1O64A 3P7IA 5DVFA 1NKXA 2A5SA 5HPQA 1A7LA 1P1QA 2HEUA 5I2NB 5I56A 3UA8A 4IO5A 4ESXA 4XKNA 1D9YA 2HZLA 1O7TA 5L9OA 1GVCA 3IR1A 2W7YA 4F18A 1PEBA 1DTZA 4QF9A 4PP0A 4WEDA 1P1OA 1H45A 4ELPA 4EQ9A 4XXUA 3OO9A 3LR1A 1Z7ME 2Z8DA 3HPIA 3PV0E 1B5JA 1P1NA 1IXIA 4OXVA 1Y9UA 1P99A 1Z7NE 4OWDA 5H8NA 4OENA 2R6GE 4O3BA 2I4BA 1ANFA 4TLMB 2D5WA 1YCJA 4FEDA 2P0SA 4IGRA 4ZDMA 3FVNA 1JW5A 3LSXA 4YKIA 2DWHA 4N07A 4MLVA 5ITOA 3TCGA 4U22A 4PFUA 1DPPA 1OLAA 2H99A 4GD5A 3KG2A 3C33A 4XIGQ 1ZTYA 1SQYA 2QS1A 3W9WA 4AB6A 3T9UA 3CRBA 4ZEDA 2HZKA 2O68A 3C9HA 4ZEFA 1A54A 1ATGA 4R6KA 4N13A 2V84A 2ZNTA 5H8FB 2DVZA 4IO6A 4NWCA 1LB8A 4OMBA 5JEIA 5B7DA 3E4RA 1PB7A 1R9QA 3FVOA 1II5A 1VR5A 5TPAA 3FATA 4MH5A 4PETA 4MFIA 2QS3A 3QIMA 2CZLA 2I0BA 1FTMA 1MS7A 3VVEA 3OELA 3HHGA 3PUVE 1SI0A 4KCCA 1OVBA 4OFOA 3O2AA 2RC8A 4ELOA 2F7CA 4RNSA 5F7VA 4X1BA 1EZOA 3RY3A 4QSEA 2IA4A 2DE4A 3RQTA 1MY0A 4H6DA 3ZSFA 1M5DA 3EN3A 1Y4TA 4ZEIA 5H8SA 4DIGA 3KZGA 3D4CA 4ZE8A 4MBPA 3QUFA 1FQFA 4QRZA 3SEUA 3KJ7A 5I2KA 1AIVA 1B4ZA 2DVCA 3I5OA 2X26A 2B65A 4THIA 1LCTA 1A99A 2Q2AA 4POXA 4R9FA 3DP6A 4L17A 3OXNA 4DCXA 2F7BA 3T9HB 1YAEA 3PPPA 1O63A 1FCKA 4UACA 1MXZA 1PDAA 3TCFA 3N94A 3HN0A 4KCDA 3SEXA 2HCAA 3EF7A 3ZKLA 4MLQA 5I56B 2GHAA 3IL1B 4GXSB 1IZ1A 3PPOA 1MPCA 3QSLA 2O51A 3H6WA 1FW0A 4KHZE 3O6HA 5DVIA 1R9LA 3MZ9A 2KLFA 4KPTA 2LAOA 3RPWA 2R9JA 4U23A 1N84A 2F78A 4R2FA 3WAEA 3QXMA 4F2OA 3CFLA 5H8NB 2VD3A 1OIBA 3R26A 3S4UA 4OTEA 2RCBA 1IEJA 2DE3A 4NF5A 4RPOA 3IX1A 2OZZA 3A3CA 3OOAA 4LONB 3G3FA 4FECA 4ZS9A 2VD2A 1N7WA 3KSXA 2Y7PA 2HFBA 5A5XA 3G3IA 5CC2A 5I57A 3G7WA 3W15C 5H8QA 3FV1A 1SW1A 3PMVA 4NWDA 2I58A 4YZZA 1P1WA 3JZJA 1US5A 2G93A 3C32A 4K3FA 1WODA 3BFUA 5CBRA 1QUIA 3MJNA 5L9SA 2XXPA 1ZJLA 3H7MA 4IO7A 1EZ9A 4ZEKA 4ELRA 3FD3A 4JDFA 5JK4A 2AL4A 1TT1A 5TPAB 1GR2A 4GVOA 3H3GA 2OWTA 3EQ1A 3FUZA 1T0KA 3OMBA 2OK2A 3SERA 3FASA 2PT2A 2QMXA 3ILTB 1NNKA 3JV9A 1JETA 3K1NA 2O69A 2ABHA 2HXWA 5EYFA 1UIVA 4OEVA 2H25A 2UVGA 4FEBA 4Q30B 1I6BA 4C1TA 2HQ0A 4U1ZA 2FNCA 3O6GA 3VVDA 4EDPA 1YTVA 1N7XA 3ECRA 4BDRA 3K1PA 3M3FA 3B6TA 1SBPA 4PFTA 2REJA 4FATA 1USYE 1B7HA 1JW1A 1DPEA 4P0GA 1NNTA 3C31A 3RGYA 4MF3A 5I2KB 2Z22A 1OQGA 3OENA 1QUKA 3RUMA 3QAXA 1LAHE 1A8EA 5KDTA 1I6QA 3DP8A 3KEIA 1XHYA 2UVIA 1IXGA 2NUVA 3JYRA 1NNFA 1ZBMA 3C34A 1MH4A 3CR9A 1B0LA 4KI0E 4OEUA 4G2ZA 5TP9A 3SETA 4FAJA 2Q8JA 3TTLA 3MZBA 4JBZA 2YJPA 2PYYA 1LAXA 1B4HA 3TQLA 4U21A 3THIA 5AA1A 4PQJA 3DP4A 3TTNA 4RA1A 4QFKA 2V93A 4OZ9A 3LSLA 3IOTA 2ONRA 1KWHA 4NF5B 3MC2A 4N6PA 5FHMA 3K6WA 3S9EA 4YB7A 3D4GA 2XX9A 2PX1A 3MAMA 4H5FA 5A5XB 1S50A 4LQ2A 4IGTA 5I57B 5H8QB 2Q88A 1VSOA 4G68A 2CMOA 3M8UA 1MY2A 4XKPA 3G3JA 3BFTA 1B5HA 1VFDA 2D3IA 3M3LA 4GFRA 3K02A 1B1XA 4HCYA 1JW4A 1FQBA 2ONKE 1N3XA 2B3FA 3CVGA 1ZMGA 1MDP1 2Y84A 1JEUA 3O29A 3PUXE 3U94A 1OMPA 1IXHA 4NMYA 4H67A 1FTKA 1D4NA 3S9NC 3TQWA 1B2HA 2GRVA 3K6UA 4RK2A 4EXLA 5F1QA 3E13X 5ICQA 3TCHA 1URSA 1Y3NA 3MZ1A 1H43A 2ALUA 3PMXA 5ITPA 1JVXA 2QRYA 3TODA 1FTJA 1UTHB 1EZPA 2RC9A 3LSFB 4LQ5A 3T9XB 1PBPA 5BUUA 1RYOA 1RYXA 3SDFA 2NOOA 3U92A 4LZ8A 2XHDA 1CE2A 2XXUA 2WKYA 1MXVA 4R6HA 1D9VA 1B52A 4IO2A 2HAUA 2G29A 4OETA 3L6GA 2V25A 4QFLA 4X48A 3TTKA 5M2VA 3VE1B 5AA4A 2V3UA 5L9MA 4EQ7A 1PB9A 2RINA 4RY1A 5IKBA 4BDQA 1A8FA 3IOUA 5BWJA 2AL5A 3MBPA 3O28A 4HW8A 4NTLA 4R2BA 2A5TA 5K2XA 5KDTB 1H76A 2P1SA 3UN6A 3O97A 4H5GA 1DOTA 4M4GA 1HSEA 4LUBA 4X1DA 1LFGA 2I48A 1JNFA 3FVKA 1MG1A 1SDXA 1P1UA 2OWSA 1Q1KA 3Q28A 4KYEA 3WAFA 4ZEBA 4OFJA 5TP9B 3T22A 4OHNA 5J1DA 5DEXA 2FA7A 4DLDA 4G77A 5ISUA 4KYSA 1I69A 3MPKA 4Q5TA 1UQWA 4ESWA 3DELB 3GBBA 4DZ1A 3GBAA 3RNNA 3CG1A 3UP9A 5AA2D 2V3QA 3O66A 5DYHA 1R1NA 4TOZA 3UGWA 3EHUA 1FQEA 1IQ7A 1MXXA 5I84A 4QFNA 5CMBA 3UK4A 1QJMA 4G68B 3KBRA 1MY4A 3PMWA 2NVUB 2H9BA 3E9XA 4R74A 5I59A 3U93A 4PE5B 4LATA 1URGA 2F36A 1AMFA 4P11A 3KN7A 4F22A 1MY3A 1MXUA 2IEEA 1XT8A 1SD3A 2DE2A 3F11A 4NF4A 1US4A 3SEYA 3H4ZA 4IO4A 3LSWA 4KR5A 1N76A 4G68C 3K1MA 1XOCA 1DMBA 2I6EA 3TTRA 3KOSA 3CI8A 3CSBA 2DOJA 3MP1A 3MVZA 5LOMA 1IITA 1OLCA 4OVJA 3TELA 3RLFE 2R71A 5JTYB 2RKMA 3IAZA 3USDA 1H3DA 1WVJA 3QUJA 2XX8A 3IOVA 5AA4B 3KFMA 1FQAA 4F1YA 2F34A 5CI5A 4QFOA 1RKMA 2DS9A 4DCYA 1OQHA 2QSXA 2XD3A 5DTBA 2Q9TA 1Y3QA 4ND9A 2H4IA 5HM4B 5DVJA 1SW2A 2F97A 4DE8A 3HSTA 3PD8A 3QYTA 5FTHA 2ZYOA 2A5TB 2X7PA 3FXRA 2XD2A 2XXVA 3FZVA 4LZ7A 4U4SA 4PFYA 4YKPA 3A3UA 3L6HA 4RK9A 4OYVA 1N04A 2ZNSA 3H03A 3IK6B 3R6UA 3MPLA 1Q35A 3KSJA 4Q0CA 1B5IA 4GWOA 4F3SA 4C1UA 1QKAA 2GHBA 3IB2A 2B3BA 5DEXB 3HCQA 3FJ7A 2DXYA 3FJMA 1B9JA 1ZU0A 5AE4A 1H44A 1FTLA 1VE4A 4EF2A 1ELJA 3H6TA 3RT8A 1UIUA 3Q27A 2BJJX 4C0RA 4QHQA 3IJOB 1UTHA 4TQUQ 4BDOA 3G3GA 4FE8A 3PUYE 3H6UA 3IORA 1B1HA 2Y7RA 4WKMA 4G8NA 3G3KA 4F3BA 3TMGA 1GTKA 1MQGA 2UYEA 3MWBA 3TPAA 4JSDA 2DWAA 1OVTA 3U72A 3N6UA 4F3GA 1S9TA 1LLSA 1SW5A 2X7QA 2ZYMA 2RCAA 2XXXA 1HSLA 1LBCA 5I59B 1LFIA 1SVXB 5FHOA 2XXIA 5CBSA 1BP5A 3TEPA 3PU5A 4ZE9A 3TKDA 3MVXA 3HHFA 2PVUA 3PPNA 3ZKKA 1QKBA 5CMKA 3VLUA 2O7UA 3UORA 4NF4B 2H98A 2RF1A 4E0XA 2I3VA 1MPBA 1JEVA 1MM6A 1PB8A 4GQOA 1MXYA 1POY1 3HO7A 2REGA 4F19A 3PUWE 4OQOA 1Y20A 2QMWA 1B40A 4EUOA 1WDNA 4POWA 3FXUA 4E0WA 1IIWA 2F35A 4KQPA 2Q2CA 4RPNA 1FQCA 1MQIA 5I58B 3V83A 3V8XB 1LFHA 1B05A 1NFTA 1UTBA 3SEWA 1NMUA 3MQ9A 4BDMA 2XXTA 2ZMBA 1JVYA 5ELVA 2F6GA 2XXWA 4LVQA 1FQDA 4GL8A 2FYIA 4JWXA 4FORA 3IOWA 4AQ4A 2I49A 1B3GA 2D21A 4G4PA 5K2YA 5AA3A 4LZ5A 2QPQA 3H6VA 1AL3A 4R6YA 1JQFA 4KFQA 4FJPA 2Z23A 4O3CA 4NF8B 2ONSA 4YAHX 3FVGA 2I3WA 3PUZE 1QW0A 3CFZA 1M5EA 2Y7KA 4WXJA 3IJXB 3AXFA 4JB7A 4H1XA 4YB5A 2XX7A 3VXBA 1ZIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AB5 A;  2UVJ A;  2I4C A;  3A09 A;  3FV2 A;  5JTY A;  3K01 A;  1MM7 A;  3G3H A;  3I3V A;  5TU0 A;  5FTI A;  1MY1 A;  2QJE A;  3GXA A;  3EHT A;  3GZG A;  3LUY A;  4Q8R A;  2OJT A;  2F6P A;  1BTJ A;  1N3W A;  1B58 A;  2DSF A;  4QFP A;  2THI A;  4WEP A;  3U1O A;  2O1L A;  4Z0I A;  3KN3 A;  2DWJ A;  4OES A;  4HS7 A;  3DM0 A;  4ISU A;  4JXI A;  3TUS A;  2RC7 A;  2F8D A;  4G8M A;  2ZYN A;  1B3E A;  2UYF A;  4NED A;  3M3K A;  1MDQ A;  3K6X A;  1POT A;  3EPE A;  1NH8 A;  1SW4 A;  3OO6 A;  4R72 A;  1B0H A;  3KJT A;  2O7I A;  1MQH A;  2Y7I A;  4U1O A;  3B6W A;  4H8I A;  1IXC A;  2QL3 A;  3Q26 A;  3W9V A;  3OSR A;  1EU8 A;  3U8Q A;  3HV1 A;  3KN8 A;  1EH3 A;  1N0T A;  4DXB A;  2XXQ A;  4XTC Q;  5CM6 A;  1B7Z A;  2ANJ A;  3T93 B;  4JSO A;  3OEK A;  3VVF A;  1UTB B;  4F1V A;  4EXK A;  3ZS6 A;  3ODB A;  1VFE A;  1QUL A;  5AA2 A;  2ZXT A;  1B6H A;  3C35 A;  1ZLQ A;  4HTG A;  2DP8 A;  3MP8 A;  4XKR A;  4I9D A;  4H8J A;  4ONY A;  4GF8 A;  4BDN A;  3K6V A;  1MRP A;  4BDL A;  3FIR A;  4YB6 A;  1B3F A;  4PFW A;  4RXL A;  4LP2 B;  1USY H;  3EHS A;  4BLA A;  4F2Q A;  1SYH A;  3UIF A;  3VFJ A;  1MH3 A;  3N5L A;  4O3A A;  2P2A A;  2YLN A;  1Y1M A;  4F1U A;  4M1V A;  3N26 A;  1SYI A;  1A55 A;  3QK6 A;  3S2V A;  4F31 B;  4YU0 A;  1NH7 A;  3KOT A;  1AOV A;  4NF6 A;  1HSJ A;  3LBS A;  4UA8 A;  4TLL B;  1L5T A;  4DXU A;  4X9T A;  1B7U A;  4GOT A;  1LAG E;  4NE4 A;  1B51 A;  4F29 A;  1XVX A;  4G8H A;  1NNP A;  2GH9 A;  4DXC A;  1Y1Z A;  1XC1 A;  4HCW A;  2F7A A;  4F3P A;  4GRK A;  1Y4C A;  2Y7W A;  3TDJ A;  3IO6 A;  4RJZ A;  3TZA A;  1MPD A;  3C36 A;  5I58 A;  4ZZE A;  4F39 A;  1LCF A;  3VLW A;  1SI1 A;  4YIC A;  1LAF E;  5IAI A;  2E0S A;  2DWI A;  3VLV A;  1BKA A;  1M5C A;  5ICT A;  4P0I A;  1TWY A;  2ZNU A;  4IO3 A;  4GL0 A;  4I62 A;  2UXA A;  3TAJ A;  4LA9 A;  1QVS A;  2QS2 A;  2O6A A;  1BLF A;  3LC8 A;  5H8H A;  3SKP A;  2M8C A;  3VV5 A;  3IB1 A;  2PT1 A;  3C4M A;  3Q29 A;  4U4X A;  2AIX A;  4NF8 A;  3MVW A;  3MVY A;  3OO7 A;  3RN8 A;  2OBG A;  2PBW A;  2XXY A;  3MUQ A;  3DLN A;  4OFL A;  2O84 X;  3FXQ A;  5KCJ A;  4H0W A;  1S7Y A;  4KD5 A;  1A40 A;  2VOZ A;  3MW0 A;  3OEM A;  3SES A;  1B46 A;  4OER A;  3KGC A;  3K4U A;  4R75 A;  3SEV A;  2GFE A;  5FHN A;  2F5X A;  2QS4 A;  5I2N A;  5AA2 B;  1MXW A;  3B7D A;  4FIM A;  2OCU A;  1MQD A;  3ILU B;  2NWJ A;  3FJG A;  1TFA A;  4JWY A;  4ZEC A;  2OLB A;  4GXA A;  1B32 A;  4EQB A;  4IY6 A;  3BBR A;  2Z8E A;  2E1S A;  1MQJ A;  3GLB A;  5CMM A;  1Y3P A;  1DTG A;  1GGG A;  3IB0 A;  3OO8 A;  5EHM A;  4JWO A;  3S9L C;  1I6A A;  2XXH A;  4ZZA A;  1M5B A;  4ELQ A;  1LST A;  3V89 B;  1LB9 A;  5DT6 A;  4YMB A;  1PBQ A;  5B70 A;  1BIY A;  1J1N A;  1YPN A;  3O9P A;  3TYH A;  1B3L A;  3OSQ A;  3H06 B;  3K2D A;  3VDF A;  3T9V A;  1IUD A;  1D3K A;  4NF6 B;  2AYS A;  2XXR A;  4YMA A;  5L8D A;  2H5Y A;  1AH5 A;  3N6T A;  2ESN A;  4Z7E A;  2Q89 A;  3E3K A;  3R7X A;  3I6V A;  4XKQ A;  2O1M A;  3RTF B;  3K0V A;  1M5F A;  4R9G A;  1LGB C;  3CG3 A;  4I8C A;  3OD7 A;  5H8F A;  4YKK A;  2ZYK A;  2Z8F A;  1CB6 A;  4R73 A;  3IO4 A;  3RT6 B;  3TFL A;  4IY5 A;  2PMS A;  2DXR A;  3FGS A;  4IB2 A;  3BKI B;  3VXC A;  5HBC A;  3V5A A;  2VP1 A;  1F9B A;  4ECF A;  4QSD A;  3MP6 A;  3CSG A;  4DDD A;  1XVY A;  4H65 A;  3PPR A;  4U2R A;  3Q25 A;  1PC3 A;  4YKJ A;  1TXF A;  3B6Q A;  3PD9 A;  2V3T A;  3PGF A;  3CIJ A;  2VGQ A;  5CMC A;  1URD A;  3PPQ A;  5EHS A;  3ONM A;  5H8H B;  1XS5 A;  4EF1 A;  1LBB A;  1ZKB A;  5CRY A;  2I0C A;  3T66 A;  4KYD A;  1GV8 A;  1R6Z A;  3CFX A;  2UVH A;  3T96 B;  5KZT A;  2HAV A;  1DSN A;  1FTO A;  2DYX A;  1NL5 A;  4GIZ A;  1B3H A;  3K00 A;  3TTM A;  1QUJ A;  2VHA A;  3O6I A;  3S9M C;  4I1D A;  2NXO A;  4QSC A;  4RYA A;  1TFD A;  5KCJ B;  4GLI A;  2DQV A;  2YPN A;  3RTW B;  1O64 A;  3P7I A;  5DVF A;  1NKX A;  2A5S A;  5HPQ A;  1A7L A;  1P1Q A;  2HEU A;  5I2N B;  5I56 A;  3UA8 A;  4IO5 A;  4ESX A;  4XKN A;  1D9Y A;  2HZL A;  1O7T A;  5L9O A;  1GVC A;  3IR1 A;  2W7Y A;  4F18 A;  1PEB A;  1DTZ A;  4QF9 A;  4PP0 A;  4WED A;  1P1O A;  1H45 A;  4ELP A;  4EQ9 A;  4XXU A;  3OO9 A;  3LR1 A;  1Z7M E;  2Z8D A;  3HPI A;  3PV0 E;  1B5J A;  1P1N A;  1IXI A;  4OXV A;  1Y9U A;  1P99 A;  1Z7N E;  4OWD A;  5H8N A;  4OEN A;  2R6G E;  4O3B A;  2I4B A;  1ANF A;  4TLM B;  2D5W A;  1YCJ A;  4FED A;  2P0S A;  4IGR A;  4ZDM A;  3FVN A;  1JW5 A;  3LSX A;  4YKI A;  2DWH A;  4N07 A;  4MLV A;  5ITO A;  3TCG A;  4U22 A;  4PFU A;  1DPP A;  1OLA A;  2H99 A;  4GD5 A;  3KG2 A;  3C33 A;  4XIG Q;  1ZTY A;  1SQY A;  2QS1 A;  3W9W A;  4AB6 A;  3T9U A;  3CRB A;  4ZED A;  2HZK A;  2O68 A;  3C9H A;  4ZEF A;  1A54 A;  1ATG A;  4R6K A;  4N13 A;  2V84 A;  2ZNT A;  5H8F B;  2DVZ A;  4IO6 A;  4NWC A;  1LB8 A;  4OMB A;  5JEI A;  5B7D A;  3E4R A;  1PB7 A;  1R9Q A;  3FVO A;  1II5 A;  1VR5 A;  5TPA A;  3FAT A;  4MH5 A;  4PET A;  4MFI A;  2QS3 A;  3QIM A;  2CZL A;  2I0B A;  1FTM A;  1MS7 A;  3VVE A;  3OEL A;  3HHG A;  3PUV E;  1SI0 A;  4KCC A;  1OVB A;  4OFO A;  3O2A A;  2RC8 A;  4ELO A;  2F7C A;  4RNS A;  5F7V A;  4X1B A;  1EZO A;  3RY3 A;  4QSE A;  2IA4 A;  2DE4 A;  3RQT A;  1MY0 A;  4H6D A;  3ZSF A;  1M5D A;  3EN3 A;  1Y4T A;  4ZEI A;  5H8S A;  4DIG A;  3KZG A;  3D4C A;  4ZE8 A;  4MBP A;  3QUF A;  1FQF A;  4QRZ A;  3SEU A;  3KJ7 A;  5I2K A;  1AIV A;  1B4Z A;  2DVC A;  3I5O A;  2X26 A;  2B65 A;  4THI A;  1LCT A;  1A99 A;  2Q2A A;  4POX A;  4R9F A;  3DP6 A;  4L17 A;  3OXN A;  4DCX A;  2F7B A;  3T9H B;  1YAE A;  3PPP A;  1O63 A;  1FCK A;  4UAC A;  1MXZ A;  1PDA A;  3TCF A;  3N94 A;  3HN0 A;  4KCD A;  3SEX A;  2HCA A;  3EF7 A;  3ZKL A;  4MLQ A;  5I56 B;  2GHA A;  3IL1 B;  4GXS B;  1IZ1 A;  3PPO A;  1MPC A;  3QSL A;  2O51 A;  3H6W A;  1FW0 A;  4KHZ E;  3O6H A;  5DVI A;  1R9L A;  3MZ9 A;  2KLF A;  4KPT A;  2LAO A;  3RPW A;  2R9J A;  4U23 A;  1N84 A;  2F78 A;  4R2F A;  3WAE A;  3QXM A;  4F2O A;  3CFL A;  5H8N B;  2VD3 A;  1OIB A;  3R26 A;  3S4U A;  4OTE A;  2RCB A;  1IEJ A;  2DE3 A;  4NF5 A;  4RPO A;  3IX1 A;  2OZZ A;  3A3C A;  3OOA A;  4LON B;  3G3F A;  4FEC A;  4ZS9 A;  2VD2 A;  1N7W A;  3KSX A;  2Y7P A;  2HFB A;  5A5X A;  3G3I A;  5CC2 A;  5I57 A;  3G7W A;  3W15 C;  5H8Q A;  3FV1 A;  1SW1 A;  3PMV A;  4NWD A;  2I58 A;  4YZZ A;  1P1W A;  3JZJ A;  1US5 A;  2G93 A;  3C32 A;  4K3F A;  1WOD A;  3BFU A;  5CBR A;  1QUI A;  3MJN A;  5L9S A;  2XXP A;  1ZJL A;  3H7M A;  4IO7 A;  1EZ9 A;  4ZEK A;  4ELR A;  3FD3 A;  4JDF A;  5JK4 A;  2AL4 A;  1TT1 A;  5TPA B;  1GR2 A;  4GVO A;  3H3G A;  2OWT A;  3EQ1 A;  3FUZ A;  1T0K A;  3OMB A;  2OK2 A;  3SER A;  3FAS A;  2PT2 A;  2QMX A;  3ILT B;  1NNK A;  3JV9 A;  1JET A;  3K1N A;  2O69 A;  2ABH A;  2HXW A;  5EYF A;  1UIV A;  4OEV A;  2H25 A;  2UVG A;  4FEB A;  4Q30 B;  1I6B A;  4C1T A;  2HQ0 A;  4U1Z A;  2FNC A;  3O6G A;  3VVD A;  4EDP A;  1YTV A;  1N7X A;  3ECR A;  4BDR A;  3K1P A;  3M3F A;  3B6T A;  1SBP A;  4PFT A;  2REJ A;  4FAT A;  1USY E;  1B7H A;  1JW1 A;  1DPE A;  4P0G A;  1NNT A;  3C31 A;  3RGY A;  4MF3 A;  5I2K B;  2Z22 A;  1OQG A;  3OEN A;  1QUK A;  3RUM A;  3QAX A;  1LAH E;  1A8E A;  5KDT A;  1I6Q A;  3DP8 A;  3KEI A;  1XHY A;  2UVI A;  1IXG A;  2NUV A;  3JYR A;  1NNF A;  1ZBM A;  3C34 A;  1MH4 A;  3CR9 A;  1B0L A;  4KI0 E;  4OEU A;  4G2Z A;  5TP9 A;  3SET A;  4FAJ A;  2Q8J A;  3TTL A;  3MZB A;  4JBZ A;  2YJP A;  2PYY A;  1LAX A;  1B4H A;  3TQL A;  4U21 A;  3THI A;  5AA1 A;  4PQJ A;  3DP4 A;  3TTN A;  4RA1 A;  4QFK A;  2V93 A;  4OZ9 A;  3LSL A;  3IOT A;  2ONR A;  1KWH A;  4NF5 B;  3MC2 A;  4N6P A;  5FHM A;  3K6W A;  3S9E A;  4YB7 A;  3D4G A;  2XX9 A;  2PX1 A;  3MAM A;  4H5F A;  5A5X B;  1S50 A;  4LQ2 A;  4IGT A;  5I57 B;  5H8Q B;  2Q88 A;  1VSO A;  4G68 A;  2CMO A;  3M8U A;  1MY2 A;  4XKP A;  3G3J A;  3BFT A;  1B5H A;  1VFD A;  2D3I A;  3M3L A;  4GFR A;  3K02 A;  1B1X A;  4HCY A;  1JW4 A;  1FQB A;  2ONK E;  1N3X A;  2B3F A;  3CVG A;  1ZMG A;  1MDP 1;  2Y84 A;  1JEU A;  3O29 A;  3PUX E;  3U94 A;  1OMP A;  1IXH A;  4NMY A;  4H67 A;  1FTK A;  1D4N A;  3S9N C;  3TQW A;  1B2H A;  2GRV A;  3K6U A;  4RK2 A;  4EXL A;  5F1Q A;  3E13 X;  5ICQ A;  3TCH A;  1URS A;  1Y3N A;  3MZ1 A;  1H43 A;  2ALU A;  3PMX A;  5ITP A;  1JVX A;  2QRY A;  3TOD A;  1FTJ A;  1UTH B;  1EZP A;  2RC9 A;  3LSF B;  4LQ5 A;  3T9X B;  1PBP A;  5BUU A;  1RYO A;  1RYX A;  3SDF A;  2NOO A;  3U92 A;  4LZ8 A;  2XHD A;  1CE2 A;  2XXU A;  2WKY A;  1MXV A;  4R6H A;  1D9V A;  1B52 A;  4IO2 A;  2HAU A;  2G29 A;  4OET A;  3L6G A;  2V25 A;  4QFL A;  4X48 A;  3TTK A;  5M2V A;  3VE1 B;  5AA4 A;  2V3U A;  5L9M A;  4EQ7 A;  1PB9 A;  2RIN A;  4RY1 A;  5IKB A;  4BDQ A;  1A8F A;  3IOU A;  5BWJ A;  2AL5 A;  3MBP A;  3O28 A;  4HW8 A;  4NTL A;  4R2B A;  2A5T A;  5K2X A;  5KDT B;  1H76 A;  2P1S A;  3UN6 A;  3O97 A;  4H5G A;  1DOT A;  4M4G A;  1HSE A;  4LUB A;  4X1D A;  1LFG A;  2I48 A;  1JNF A;  3FVK A;  1MG1 A;  1SDX A;  1P1U A;  2OWS A;  1Q1K A;  3Q28 A;  4KYE A;  3WAF A;  4ZEB A;  4OFJ A;  5TP9 B;  3T22 A;  4OHN A;  5J1D A;  5DEX A;  2FA7 A;  4DLD A;  4G77 A;  5ISU A;  4KYS A;  1I69 A;  3MPK A;  4Q5T A;  1UQW A;  4ESW A;  3DEL B;  3GBB A;  4DZ1 A;  3GBA A;  3RNN A;  3CG1 A;  3UP9 A;  5AA2 D;  2V3Q A;  3O66 A;  5DYH A;  1R1N A;  4TOZ A;  3UGW A;  3EHU A;  1FQE A;  1IQ7 A;  1MXX A;  5I84 A;  4QFN A;  5CMB A;  3UK4 A;  1QJM A;  4G68 B;  3KBR A;  1MY4 A;  3PMW A;  2NVU B;  2H9B A;  3E9X A;  4R74 A;  5I59 A;  3U93 A;  4PE5 B;  4LAT A;  1URG A;  2F36 A;  1AMF A;  4P11 A;  3KN7 A;  4F22 A;  1MY3 A;  1MXU A;  2IEE A;  1XT8 A;  1SD3 A;  2DE2 A;  3F11 A;  4NF4 A;  1US4 A;  3SEY A;  3H4Z A;  4IO4 A;  3LSW A;  4KR5 A;  1N76 A;  4G68 C;  3K1M A;  1XOC A;  1DMB A;  2I6E A;  3TTR A;  3KOS A;  3CI8 A;  3CSB A;  2DOJ A;  3MP1 A;  3MVZ A;  5LOM A;  1IIT A;  1OLC A;  4OVJ A;  3TEL A;  3RLF E;  2R71 A;  5JTY B;  2RKM A;  3IAZ A;  3USD A;  1H3D A;  1WVJ A;  3QUJ A;  2XX8 A;  3IOV A;  5AA4 B;  3KFM A;  1FQA A;  4F1Y A;  2F34 A;  5CI5 A;  4QFO A;  1RKM A;  2DS9 A;  4DCY A;  1OQH A;  2QSX A;  2XD3 A;  5DTB A;  2Q9T A;  1Y3Q A;  4ND9 A;  2H4I A;  5HM4 B;  5DVJ A;  1SW2 A;  2F97 A;  4DE8 A;  3HST A;  3PD8 A;  3QYT A;  5FTH A;  2ZYO A;  2A5T B;  2X7P A;  3FXR A;  2XD2 A;  2XXV A;  3FZV A;  4LZ7 A;  4U4S A;  4PFY A;  4YKP A;  3A3U A;  3L6H A;  4RK9 A;  4OYV A;  1N04 A;  2ZNS A;  3H03 A;  3IK6 B;  3R6U A;  3MPL A;  1Q35 A;  3KSJ A;  4Q0C A;  1B5I A;  4GWO A;  4F3S A;  4C1U A;  1QKA A;  2GHB A;  3IB2 A;  2B3B A;  5DEX B;  3HCQ A;  3FJ7 A;  2DXY A;  3FJM A;  1B9J A;  1ZU0 A;  5AE4 A;  1H44 A;  1FTL A;  1VE4 A;  4EF2 A;  1ELJ A;  3H6T A;  3RT8 A;  1UIU A;  3Q27 A;  2BJJ X;  4C0R A;  4QHQ A;  3IJO B;  1UTH A;  4TQU Q;  4BDO A;  3G3G A;  4FE8 A;  3PUY E;  3H6U A;  3IOR A;  1B1H A;  2Y7R A;  4WKM A;  4G8N A;  3G3K A;  4F3B A;  3TMG A;  1GTK A;  1MQG A;  2UYE A;  3MWB A;  3TPA A;  4JSD A;  2DWA A;  1OVT A;  3U72 A;  3N6U A;  4F3G A;  1S9T A;  1LLS A;  1SW5 A;  2X7Q A;  2ZYM A;  2RCA A;  2XXX A;  1HSL A;  1LBC A;  5I59 B;  1LFI A;  1SVX B;  5FHO A;  2XXI A;  5CBS A;  1BP5 A;  3TEP A;  3PU5 A;  4ZE9 A;  3TKD A;  3MVX A;  3HHF A;  2PVU A;  3PPN A;  3ZKK A;  1QKB A;  5CMK A;  3VLU A;  2O7U A;  3UOR A;  4NF4 B;  2H98 A;  2RF1 A;  4E0X A;  2I3V A;  1MPB A;  1JEV A;  1MM6 A;  1PB8 A;  4GQO A;  1MXY A;  1POY 1;  3HO7 A;  2REG A;  4F19 A;  3PUW E;  4OQO A;  1Y20 A;  2QMW A;  1B40 A;  4EUO A;  1WDN A;  4POW A;  3FXU A;  4E0W A;  1IIW A;  2F35 A;  4KQP A;  2Q2C A;  4RPN A;  1FQC A;  1MQI A;  5I58 B;  3V83 A;  3V8X B;  1LFH A;  1B05 A;  1NFT A;  1UTB A;  3SEW A;  1NMU A;  3MQ9 A;  4BDM A;  2XXT A;  2ZMB A;  1JVY A;  5ELV A;  2F6G A;  2XXW A;  4LVQ A;  1FQD A;  4GL8 A;  2FYI A;  4JWX A;  4FOR A;  3IOW A;  4AQ4 A;  2I49 A;  1B3G A;  2D21 A;  4G4P A;  5K2Y A;  5AA3 A;  4LZ5 A;  2QPQ A;  3H6V A;  1AL3 A;  4R6Y A;  1JQF A;  4KFQ A;  4FJP A;  2Z23 A;  4O3C A;  4NF8 B;  2ONS A;  4YAH X;  3FVG A;  2I3W A;  3PUZ E;  1QW0 A;  3CFZ A;  1M5E A;  2Y7K A;  4WXJ A;  3IJX B;  3AXF A;  4JB7 A;  4H1X A;  4YB5 A;  2XX7 A;  3VXB A;  1ZIU A; 
#chains in the Genus database with same CATH topology
 3T0J A;  4AB5 A;  2UVJ A;  2I4C A;  3A09 A;  3FV2 A;  1RDZ A;  5JTY A;  3K01 A;  1MM7 A;  3G3H A;  3I3V A;  5TU0 A;  5FTI A;  5EYG A;  1NV7 A;  1MY1 A;  2QJE A;  3GXA A;  1RDY A;  3EHT A;  3GZG A;  3LUY A;  4Q8R A;  2OJT A;  2F6P A;  1BTJ A;  1N3W A;  3BIG A;  1DBZ A;  4MMP A;  1B58 A;  4GBV A;  5IZ1 A;  4PDD A;  1FPJ A;  2DSF A;  4QFP A;  2THI A;  4WEP A;  4MEV A;  3U1O A;  1LEV A;  2O1L A;  4Z0I A;  3KN3 A;  1FPI A;  2DWJ A;  4OES A;  4HS7 A;  3DM0 A;  4ISU A;  4JXI A;  3TUS A;  1D9Q A;  2RC7 A;  2F8D A;  4G8M A;  2ZYN A;  1B3E A;  2UYF A;  2XWO A;  4NED A;  3M3K A;  4IR8 A;  1MDQ A;  3K6X A;  1POT A;  3EPE A;  1NH8 A;  1SW4 A;  3OO6 A;  4R72 A;  1B0H A;  3KJT A;  2O7I A;  1MQH A;  2JJK A;  2Y7I A;  4OVR A;  4U1O A;  3B6W A;  2VT5 A;  4N6D A;  2BJI A;  4H8I A;  1IXC A;  2QL3 A;  2PCR A;  3Q26 A;  3W9V A;  3OSR A;  1EU8 A;  3U8Q A;  3HV1 A;  2Y5K A;  3KN8 A;  1EH3 A;  1N0T A;  4PAI A;  4DXB A;  2XXQ A;  4PFI A;  4XTC Q;  5CM6 A;  4PF6 A;  1B7Z A;  2ANJ A;  3T93 B;  4JSO A;  4O7M A;  3OEK A;  3VVF A;  1IMF A;  1UTB B;  4F1V A;  4EXK A;  3ZS6 A;  3ODB A;  1VFE A;  1QUL A;  5AA2 A;  2ZXT A;  4GWS A;  1B6H A;  3C35 A;  1ZLQ A;  4HTG A;  5IM2 A;  2DP8 A;  3MP8 A;  4XKR A;  4I9D A;  1FPF A;  4H8J A;  4ONY A;  4GF8 A;  4BDN A;  3K6V A;  1MRP A;  4BDL A;  3FIR A;  1YYZ A;  4YB6 A;  1B3F A;  4PFW A;  4RXL A;  4LP2 B;  1USY H;  3EHS A;  4BLA A;  4F2Q A;  4HXV A;  1IMA A;  1SYH A;  3UIF A;  3VFJ A;  1MH3 A;  3IFC A;  3N5L A;  4O3A A;  2P2A A;  2YLN A;  1Y1M A;  4F1U A;  1KZ8 A;  4M1V A;  3N26 A;  1SYI A;  1A55 A;  3QK6 A;  3S2V A;  4F31 B;  4YU0 A;  1NH7 A;  5IZ3 B;  3KOT A;  1AOV A;  4NF6 A;  1HSJ A;  3LBS A;  4UA8 A;  4TLL B;  1L5T A;  4DXU A;  4UAB A;  2WBD A;  4X9T A;  1B7U A;  4GOT A;  1LAG E;  4NE4 A;  1B51 A;  4DI4 B;  4P8B A;  5DW8 A;  4F29 A;  1XVX A;  4G8H A;  1NNP A;  2DDK A;  2GH9 A;  4DXC A;  1Y1Z A;  1XC1 A;  4HCW A;  2F7A A;  4F3P A;  4P1L A;  4GRK A;  1Y4C A;  2Y7W A;  1IMD A;  3TDJ A;  3IO6 A;  4RJZ A;  1IME A;  3TZA A;  1MPD A;  1XI6 A;  3C36 A;  2P3V A;  5I58 A;  4P56 A;  4ZZE A;  4F39 A;  1LCF A;  4HE1 A;  3VLW A;  1SI1 A;  4YIC A;  1LAF E;  1G0I A;  5IAI A;  2E0S A;  2DWI A;  2QVU A;  1NV5 A;  3VLV A;  1BKA A;  1M5C A;  5ICT A;  4P0I A;  1TWY A;  2ZNU A;  4IO3 A;  4GL0 A;  4I62 A;  2UXA A;  3TAJ A;  4LA9 A;  1QVS A;  2QS2 A;  2FIE A;  2O6A A;  1BLF A;  4P1E A;  3LC8 A;  5H8H A;  2WX9 A;  3SKP A;  2M8C A;  4MJO A;  3VV5 A;  3IB1 A;  3KC0 A;  2PT1 A;  3C4M A;  5F24 A;  3Q29 A;  4O7I A;  4U4X A;  2AIX A;  4NF8 A;  3MVW A;  3MVY A;  3OO7 A;  3RN8 A;  2OBG A;  2PBW A;  2XXY A;  5FBP A;  3MUQ A;  1FSA A;  3DLN A;  4OFL A;  2O84 X;  3LV0 A;  3FXQ A;  5KCJ A;  4H0W A;  1S7Y A;  4KD5 A;  1A40 A;  2F3B A;  2VOZ A;  3MW0 A;  4MX6 A;  1KA1 A;  1FPK A;  3OEM A;  3SES A;  1B46 A;  4OER A;  3KGC A;  3K4U A;  4NX1 A;  4R75 A;  3SEV A;  2GFE A;  5FHN A;  2F5X A;  2QS4 A;  5I2N A;  5AA2 B;  1MXW A;  3B7D A;  4FIM A;  2OCU A;  1MQD A;  3ILU B;  2NWJ A;  2WYK A;  3FJG A;  1TFA A;  4JWY A;  4ZEC A;  2OLB A;  4GXA A;  1B32 A;  4EQB A;  4JVD A;  4IY6 A;  1BK4 A;  3BBR A;  2Z8E A;  2E1S A;  1MQJ A;  3GLB A;  1YZ0 A;  5CMM A;  1Y3P A;  1DTG A;  1GGG A;  3IB0 A;  3OO8 A;  5EHM A;  4JWO A;  3S9L C;  1I6A A;  2XXH A;  4ZZA A;  1M5B A;  4ELQ A;  3D1R A;  4O94 A;  1LST A;  3V89 B;  3GYY A;  1LB9 A;  5DT6 A;  4YMB A;  1PBQ A;  5B70 A;  1BIY A;  1J1N A;  1YPN A;  3O9P A;  3TYH A;  1KA0 A;  1B3L A;  3OSQ A;  3H06 B;  4KXP A;  3K2D A;  3VDF A;  3T9V A;  4OVS A;  1IUD A;  1D3K A;  4NF6 B;  2AYS A;  2XXR A;  4YMA A;  5L8D A;  2H5Y A;  1AWB A;  1AH5 A;  3N6T A;  2ESN A;  4Z7E A;  2Q89 A;  3E3K A;  3R7X A;  3I6V A;  4XKQ A;  2O1M A;  3RTF B;  3K0V A;  2Y5L A;  1M5F A;  4R9G A;  1FJ9 A;  1LGB C;  1FPB A;  3CG3 A;  4I8C A;  3OD7 A;  5H8F A;  4YKK A;  2ZYK A;  2Z8F A;  1CB6 A;  4R73 A;  3IO4 A;  3RT6 B;  3TFL A;  4IY5 A;  4X8R A;  2PMS A;  2DXR A;  3FGS A;  4IB2 A;  3BKI B;  3VXC A;  5HBC A;  3V5A A;  2B4L A;  2VP1 A;  1F9B A;  4ECF A;  1EYJ A;  2P3N A;  2HPG A;  4QSD A;  3MP6 A;  3CSG A;  4DDD A;  4OA4 A;  1XVY A;  4H65 A;  3PPR A;  4N8Y A;  4U2R A;  3Q25 A;  1PC3 A;  4YKJ A;  1TXF A;  3B6Q A;  3PD9 A;  2V3T A;  3PGF A;  3CIJ A;  2VGQ A;  5CMC A;  1URD A;  3PPQ A;  5ET8 A;  5EHS A;  3ONM A;  5H8H B;  1XS5 A;  4EF1 A;  1LBB A;  1ZKB A;  5CRY A;  2I0C A;  3T66 A;  4KYD A;  1GV8 A;  1R6Z A;  3CFX A;  2UVH A;  3T96 B;  5KZT A;  2HAV A;  1DSN A;  2WEF A;  4PBH A;  1FBD A;  2QVV A;  2XWI A;  1FTO A;  2DYX A;  1NL5 A;  4GIZ A;  1B3H A;  3K00 A;  3TTM A;  1QUJ A;  2VHA A;  3O6I A;  3S9M C;  4I1D A;  2NXO A;  4QSC A;  4RYA A;  1TFD A;  4P9K A;  5KCJ B;  2VPN A;  4GLI A;  2DQV A;  2YPN A;  3RTW B;  1O64 A;  3P7I A;  5DVF A;  1FTA A;  2Q74 A;  2HXR A;  4I3Y A;  1NKX A;  4P47 A;  2A5S A;  5HPQ A;  1A7L A;  1P1Q A;  2HEU A;  5I2N B;  1FPD A;  5I56 A;  4HE2 A;  4IO5 A;  3UA8 A;  4XKN A;  1D9Y A;  4ESX A;  2HZL A;  2XWV A;  1O7T A;  2V4C A;  5L9O A;  1GVC A;  3IR1 A;  3FBP A;  2W7Y A;  4F18 A;  1PEB A;  1DTZ A;  3ISP A;  4QF9 A;  4PP0 A;  4WED A;  1P1O A;  1H45 A;  4ELP A;  4EQ9 A;  5I7I A;  4XXU A;  3OO9 A;  3LR1 A;  1Z7M E;  2Z8D A;  3HPI A;  3PV0 E;  1VDW A;  1B5J A;  1P1N A;  1IXI A;  4PE3 A;  4OXV A;  1Y9U A;  3MYU A;  1P99 A;  1Z7N E;  4OWD A;  5H8N A;  4OEN A;  2R6G E;  2CZI A;  4O3B A;  2I4B A;  1ANF A;  4TLM B;  2D5W A;  1YCJ A;  4PGN A;  2F3D A;  4FED A;  2P0S A;  4IGR A;  4ZDM A;  3FVN A;  1JW5 A;  4N8G A;  3LSX A;  4YKI A;  2DWH A;  4N07 A;  4MLV A;  2QVR A;  5ITO A;  1LBY A;  3TCG A;  1G0H A;  4U22 A;  4PFU A;  1DPP A;  1OLA A;  2H99 A;  4GD5 A;  3KG2 A;  3C33 A;  4XIG Q;  1ZTY A;  1SQY A;  2QS1 A;  3W9W A;  5IZZ A;  4N6K A;  4AB6 A;  3CRB A;  2HZK A;  2O68 A;  3C9H A;  4ZEF A;  3T9U A;  4ZED A;  1A54 A;  1ATG A;  4R6K A;  4N13 A;  2V84 A;  2ZNT A;  2DVZ A;  5H8F B;  4IO6 A;  4NWC A;  3SZP A;  1LB8 A;  4OMB A;  5JEI A;  5B7D A;  2GQ1 A;  3E4R A;  1PB7 A;  1R9Q A;  3MST A;  3FVO A;  1II5 A;  1VR5 A;  5TPA A;  3FAT A;  4MH5 A;  4PET A;  4MFI A;  2QS3 A;  3QIM A;  2CZL A;  2I0B A;  1FTM A;  1MS7 A;  3VVE A;  3OEL A;  2FHY A;  3HHG A;  3PUV E;  1SI0 A;  4MIJ A;  4KCC A;  1OVB A;  4OFO A;  3O2A A;  1LBW A;  2RC8 A;  3E78 A;  4ELO A;  2F7C A;  4RNS A;  5F7V A;  3IFA A;  4X1B A;  1EZO A;  4PTK A;  3RY3 A;  4QSE A;  2IA4 A;  3B50 A;  2DE4 A;  3RQT A;  5A5L A;  1MY0 A;  1FBC A;  2CEX A;  4H6D A;  3ZSF A;  1M5D A;  3EN3 A;  1Y4T A;  4ZEI A;  5H8S A;  4DIG A;  3KZG A;  3D4C A;  4ZE8 A;  4MCO A;  2OWZ A;  4MBP A;  3QUF A;  1FQF A;  4QRZ A;  4PAK A;  3SEU A;  3KJ7 A;  5I2K A;  1AIV A;  1B4Z A;  2DVC A;  3I5O A;  2X26 A;  2B65 A;  4THI A;  1LCT A;  1A99 A;  2Q2A A;  4POX A;  4R9F A;  3DP6 A;  4L17 A;  1NV6 A;  3OXN A;  4DCX A;  2F7B A;  3T9H B;  1YAE A;  3PPP A;  1O63 A;  1FCK A;  4UAC A;  1MXZ A;  1PDA A;  3TCF A;  3N94 A;  3HN0 A;  4KCD A;  3SEX A;  2HCA A;  3EF7 A;  3ZKL A;  4MLQ A;  5I56 B;  2GHA A;  3IL1 B;  4GXS B;  1IZ1 A;  3PPO A;  1MPC A;  3QSL A;  3KBZ A;  2O51 A;  3H6W A;  1FW0 A;  4KHZ E;  3ROJ A;  3O6H A;  5DVI A;  1R9L A;  3MZ9 A;  3EKI A;  2KLF A;  4KPT A;  2LAO A;  3RPW A;  2R9J A;  4U23 A;  1RDX A;  1N84 A;  2F78 A;  4R2F A;  3WAE A;  3QXM A;  4F2O A;  3CFL A;  5H8N B;  2VD3 A;  1OIB A;  3R26 A;  3S4U A;  4OTE A;  2RCB A;  1IEJ A;  2DE3 A;  4NF5 A;  4RPO A;  3IX1 A;  2OZZ A;  5LTC A;  3A3C A;  3OOA A;  4LON B;  3G3F A;  3PTY A;  4FEC A;  4ZS9 A;  2VD2 A;  1N7W A;  3CHG A;  3KSX A;  2HHM A;  2Y7P A;  2HFB A;  5A5X A;  3G3I A;  5CC2 A;  5I57 A;  3G7W A;  3W15 C;  5H8Q A;  3FV1 A;  1SW1 A;  3PMV A;  4O8M A;  4NWD A;  2I58 A;  4YZZ A;  1P1W A;  3JZJ A;  1US5 A;  2G93 A;  3C32 A;  4K3F A;  1WOD A;  2XXK A;  3BFU A;  5CBR A;  1K9Y A;  1QUI A;  3MJN A;  5L9S A;  2XXP A;  1ZJL A;  3H7M A;  4IO7 A;  2KR0 A;  1EZ9 A;  4ZEK A;  4ELR A;  3FD3 A;  4NN3 A;  4JDF A;  5JK4 A;  2VPO A;  2AL4 A;  2L5V A;  1TT1 A;  5TPA B;  1GR2 A;  4GVO A;  3H3G A;  4QBA A;  2OWT A;  3EQ1 A;  3FUZ A;  4OVP A;  1T0K A;  3OMB A;  2OK2 A;  4DI3 D;  3SER A;  3FAS A;  1FPG A;  2PT2 A;  2QMX A;  3ILT B;  1NNK A;  4MHF A;  4MNI A;  3JV9 A;  1JET A;  3K1N A;  2O69 A;  2ABH A;  2HXW A;  1SPI A;  5EYF A;  1UIV A;  4OEV A;  2H25 A;  2UVG A;  4FEB A;  4Q30 B;  5EQ9 A;  1I6B A;  1LBV A;  4C1T A;  2HQ0 A;  4U1Z A;  2FNC A;  3O6G A;  3VVD A;  4EDP A;  1YTV A;  5ET7 A;  1N7X A;  2OX3 A;  3ECR A;  4BDR A;  3K1P A;  2XA5 A;  3M3F A;  3B6T A;  1SBP A;  4MNC A;  4PFT A;  2REJ A;  4FAT A;  1USY E;  1B7H A;  1JW1 A;  1FPE A;  1DPE A;  4P0G A;  1NNT A;  3C31 A;  3RGY A;  4MF3 A;  5I2K B;  2Z22 A;  1OQG A;  3OEN A;  1QUK A;  4N4U A;  3RUM A;  4MNP A;  3QAX A;  1LAH E;  1A8E A;  5KDT A;  1I6Q A;  3DP8 A;  1LBZ A;  3KEI A;  1NV3 A;  1XHY A;  2UVI A;  1IXG A;  2NUV A;  3JYR A;  1NNF A;  1ZBM A;  4FBP A;  4NG7 A;  3C34 A;  1MH4 A;  3CR9 A;  1B0L A;  5ET5 A;  4KI0 E;  2CZH A;  4OEU A;  4G2Z A;  5TP9 A;  3SET A;  4FAJ A;  5J16 A;  2ZZX A;  2Q8J A;  3TTL A;  3MZB A;  4JBZ A;  2YJP A;  2PYY A;  1LAX A;  1B4H A;  3TQL A;  4U21 A;  3THI A;  5AA1 A;  4PQJ A;  3DP4 A;  3TTN A;  2FVZ A;  3RPL A;  4RA1 A;  4QFK A;  2R8T A;  2V93 A;  4OZ9 A;  3LUZ A;  3LSL A;  1IMB A;  3IOT A;  2ONR A;  1KWH A;  4NF5 B;  4PFR A;  3MC2 A;  4N6P A;  5FHM A;  3K6W A;  3S9E A;  4YB7 A;  3D4G A;  2XX9 A;  2PX1 A;  3MAM A;  4H5F A;  5A5X B;  1S50 A;  4LQ2 A;  3KC1 A;  4IGT A;  5I57 B;  5H8Q B;  4OVT A;  2Q88 A;  1VSO A;  4G68 A;  2CMO A;  3M8U A;  1MY2 A;  4XKP A;  3G3J A;  3BFT A;  1B5H A;  1VFD A;  2D3I A;  3M3L A;  4G61 A;  4GFR A;  3K02 A;  1B1X A;  4HCY A;  1JW4 A;  1FQB A;  2ONK E;  1N3X A;  2B3F A;  3CVG A;  1ZMG A;  4NF0 A;  1MDP 1;  2Y84 A;  1JEU A;  3O29 A;  4N81 A;  3PUX E;  3U94 A;  1OMP A;  2QFL A;  1IXH A;  4NMY A;  4H67 A;  1FTK A;  1D4N A;  3S9N C;  3TQW A;  1B2H A;  2GRV A;  3K6U A;  4RK2 A;  4EXL A;  5F1Q A;  3E13 X;  5ICQ A;  3TCH A;  1URS A;  1Y3N A;  3MZ1 A;  1H43 A;  2ALU A;  3PMX A;  4GX4 A;  5ITP A;  4X04 A;  1JVX A;  2QRY A;  3TOD A;  1FTJ A;  1UTH B;  1EZP A;  1QGX A;  2RC9 A;  3LSF B;  4LQ5 A;  3T9X B;  5EQA A;  1PBP A;  5BUU A;  1RYO A;  1RYX A;  3SDF A;  1NUW A;  2NOO A;  3U92 A;  4LZ8 A;  2XHD A;  1CE2 A;  2XXU A;  4JVC A;  4AS4 A;  1FBG A;  2WKY A;  1MXV A;  4R6H A;  1D9V A;  1B52 A;  4IO2 A;  2HAU A;  2G29 A;  4OET A;  3L6G A;  2V25 A;  4QFL A;  4X48 A;  3TTK A;  5M2V A;  3VE1 B;  5AA4 A;  1IMC A;  1CNQ A;  2V3U A;  5L9M A;  4EQ7 A;  1PB9 A;  2RIN A;  4RY1 A;  5IKB A;  4BDQ A;  1A8F A;  3IOU A;  5BWJ A;  5LDZ A;  2AL5 A;  3MBP A;  4PCD A;  3O28 A;  4HW8 A;  4NTL A;  4N15 A;  4R2B A;  2A5T A;  5K2X A;  5KDT B;  1H76 A;  2P1S A;  3UN6 A;  3O97 A;  4H5G A;  4NQ8 A;  1DOT A;  4M4G A;  1HSE A;  1NUX A;  2PFY A;  4LUB A;  4X1D A;  1LFG A;  4GWX A;  3U65 A;  2I48 A;  1JNF A;  3FVK A;  4PBQ A;  1MG1 A;  4XF5 A;  1SDX A;  1P1U A;  2OWS A;  1Q1K A;  3Q28 A;  4KYE A;  3WAF A;  4XEQ A;  4OFJ A;  4ZEB A;  5TP9 B;  3T22 A;  4OHN A;  1FJ6 A;  5J1D A;  5DEX A;  1NV2 A;  2FA7 A;  4DLD A;  4G77 A;  5ISU A;  4KYS A;  3RPL B;  1Q9D A;  1I69 A;  3MPK A;  4Q5T A;  1UQW A;  4ESW A;  3DEL B;  3GBB A;  4I3E A;  4DZ1 A;  3GBA A;  3RNN A;  3CG1 A;  4PGP A;  3UP9 A;  5AA2 D;  2V3Q A;  3O66 A;  5DYH A;  3T1B A;  1R1N A;  5EQ7 A;  4TOZ A;  4NAP A;  3UGW A;  3EHU A;  1FQE A;  1IQ7 A;  1MXX A;  5I84 A;  4QFN A;  5CMB A;  3UK4 A;  1QJM A;  4G68 B;  3KBR A;  1DCU A;  1MY4 A;  3PMW A;  2NVU B;  2H9B A;  3E9X A;  4R74 A;  5I59 A;  3U93 A;  4PE5 B;  4LAT A;  1URG A;  3A29 A;  4GWZ A;  2F36 A;  1AMF A;  4P11 A;  3KN7 A;  4F22 A;  1MY3 A;  4NHB A;  1MXU A;  2IEE A;  3NOH A;  1XT8 A;  1SD3 A;  2DE2 A;  3F11 A;  4H46 A;  1US4 A;  4NF4 A;  3E79 A;  3SEY A;  4PC9 A;  3H4Z A;  4IO4 A;  3LSW A;  4KR5 A;  1EYK A;  4GWW A;  2KQZ A;  1N76 A;  4G68 C;  2XWK A;  3K1M A;  1XOC A;  4NGU A;  1DMB A;  2I6E A;  3TTR A;  3KOS A;  3CI8 A;  3CSB A;  1FBE A;  2DOJ A;  3MP1 A;  3MVZ A;  5LOM A;  1IIT A;  1OLC A;  4OVJ A;  3TEL A;  3RLF E;  2R71 A;  2MKZ A;  5JTY B;  2RKM A;  4AS5 A;  3IAZ A;  3USD A;  1H3D A;  1WVJ A;  3QUJ A;  2XX8 A;  3IOV A;  5T3J A;  5AA4 B;  3KFM A;  5EYH A;  1FQA A;  4F1Y A;  4GWU A;  2F34 A;  5CI5 A;  4QFO A;  1RKM A;  2DS9 A;  1NI9 A;  4DCY A;  1OQH A;  2QSX A;  3QMF A;  2XD3 A;  5DTB A;  2Q9T A;  1Y3Q A;  4ND9 A;  2H4I A;  5HM4 B;  5DVJ A;  1SW2 A;  2F97 A;  4DE8 A;  3HST A;  3PD8 A;  3QYT A;  5FTH A;  5ET6 A;  2ZYO A;  2A5T B;  2X7P A;  5ESY A;  3FXR A;  2XD2 A;  1FPL A;  2ZZW A;  4P3L A;  2XXV A;  2CZK A;  3FZV A;  1FBH A;  4LZ7 A;  4OAN A;  4GX3 A;  4PFY A;  4U4S A;  4YKP A;  3A3U A;  3L6H A;  4RK9 A;  4OYV A;  1N04 A;  5I3S A;  2ZNS A;  3H03 A;  3IK6 B;  4PF8 A;  3R6U A;  4PFB A;  3RYD A;  3MPL A;  1Q35 A;  3KSJ A;  4Q0C A;  2PFZ A;  1B5I A;  4GWO A;  2FBP A;  1NUY A;  4F3S A;  4C1U A;  1QKA A;  2GHB A;  3IB2 A;  2B3B A;  5DEX B;  3HCQ A;  3FJ7 A;  2DXY A;  5IGA A;  3FJM A;  1B9J A;  1ZU0 A;  5AE4 A;  1H44 A;  1FTL A;  1VE4 A;  4EF2 A;  1ELJ A;  3H6T A;  3RT8 A;  1UIU A;  3Q27 A;  2BJJ X;  3FXB A;  1JP4 A;  4C0R A;  4QHQ A;  3IJO B;  1UTH A;  4TQU Q;  4BDO A;  3G3G A;  4FE8 A;  3PUY E;  3H6U A;  3IOR A;  4GBW A;  1B1H A;  2Y7R A;  4WKM A;  4G8N A;  1NV0 A;  3G3K A;  4F3B A;  3TMG A;  1GTK A;  1MQG A;  2UYE A;  3MWB A;  3TPA A;  4JVI A;  4JSD A;  5I5P A;  2DWA A;  1OVT A;  3U72 A;  3N6U A;  4F3G A;  4N91 A;  1S9T A;  1LLS A;  1SW5 A;  2X7Q A;  2ZYM A;  2RCA A;  2XXX A;  1HSL A;  1LBC A;  5I59 B;  2B4M A;  1LFI A;  1FRP A;  1SVX B;  1FBF A;  5FHO A;  2XXI A;  5CBS A;  1BP5 A;  4MAG A;  1EYI A;  3TEP A;  3PU5 A;  4ZE9 A;  3TKD A;  3MVX A;  2Q8M A;  1FBP A;  3HHF A;  2PVU A;  3PPN A;  3ZKK A;  1QKB A;  5CMK A;  3VLU A;  2O7U A;  3UOR A;  4NF4 B;  1NUZ A;  1K9Z A;  2H98 A;  2RF1 A;  4E0X A;  2I3V A;  1MPB A;  1JEV A;  1MM6 A;  1PB8 A;  1DK4 A;  4GQO A;  1MXY A;  1POY 1;  3HO7 A;  2WBB A;  2REG A;  4F19 A;  3PUW E;  4I40 A;  4OQO A;  1Y20 A;  2QMW A;  1B40 A;  4EUO A;  2CEY A;  1WDN A;  3BIH A;  4POW A;  4OVQ A;  3FXU A;  4N17 A;  4E0W A;  1NV4 A;  1IIW A;  2F35 A;  1NV1 A;  4KQP A;  4GWY A;  2Q2C A;  4RPN A;  4XFE A;  3B8B A;  1FQC A;  1MQI A;  5I58 B;  3V83 A;  3V8X B;  1LFH A;  1B05 A;  5EQ8 A;  4HE0 A;  1NFT A;  1UTB A;  3SEW A;  1NMU A;  3MQ9 A;  4H45 A;  1INP A;  4BDM A;  4QXD A;  2XXT A;  2ZMB A;  1JVY A;  5ELV A;  2F6G A;  2XXW A;  4LVQ A;  1FQD A;  4GL8 A;  4PDH A;  2FYI A;  4JWX A;  4FOR A;  3IOW A;  4AQ4 A;  2I49 A;  4LN5 A;  1B3G A;  2D21 A;  4G4P A;  5K2Y A;  5AA3 A;  3HFU A;  2ZZV A;  4LZ5 A;  2QPQ A;  3H6V A;  1AL3 A;  4R6Y A;  1JQF A;  4KFQ A;  4FJP A;  2Z23 A;  4O3C A;  4NF8 B;  1YXI A;  5IZ3 A;  2ONS A;  4YAH X;  4PAF A;  1LBX A;  2FIX A;  3FVG A;  2I3W A;  3PUZ E;  2WYP A;  1QW0 A;  3CFZ A;  1M5E A;  2Y7K A;  4WXJ A;  3IJX B;  3AXF A;  4JB7 A;  4H1X A;  4YB5 A;  2XX7 A;  4GX6 A;  3VXB A;  1ZIU A; 
#chains in the Genus database with same CATH homology
 4AB5 A;  2UVJ A;  2I4C A;  3A09 A;  3FV2 A;  5JTY A;  3K01 A;  1MM7 A;  3G3H A;  3I3V A;  5TU0 A;  5FTI A;  1MY1 A;  2QJE A;  3GXA A;  3EHT A;  3GZG A;  3LUY A;  4Q8R A;  2OJT A;  2F6P A;  1BTJ A;  1N3W A;  1B58 A;  2DSF A;  4QFP A;  2THI A;  4WEP A;  3U1O A;  2O1L A;  4Z0I A;  3KN3 A;  2DWJ A;  4OES A;  4HS7 A;  3DM0 A;  4ISU A;  4JXI A;  3TUS A;  2RC7 A;  2F8D A;  4G8M A;  2ZYN A;  1B3E A;  2UYF A;  4NED A;  3M3K A;  1MDQ A;  3K6X A;  1POT A;  3EPE A;  1NH8 A;  1SW4 A;  3OO6 A;  4R72 A;  1B0H A;  3KJT A;  2O7I A;  1MQH A;  2Y7I A;  4U1O A;  3B6W A;  4H8I A;  1IXC A;  2QL3 A;  3Q26 A;  3W9V A;  3OSR A;  1EU8 A;  3U8Q A;  3HV1 A;  3KN8 A;  1EH3 A;  1N0T A;  4DXB A;  2XXQ A;  4XTC Q;  5CM6 A;  1B7Z A;  2ANJ A;  3T93 B;  4JSO A;  3OEK A;  3VVF A;  1UTB B;  4F1V A;  4EXK A;  3ZS6 A;  3ODB A;  1VFE A;  1QUL A;  5AA2 A;  2ZXT A;  1B6H A;  3C35 A;  1ZLQ A;  4HTG A;  2DP8 A;  3MP8 A;  4XKR A;  4I9D A;  4H8J A;  4ONY A;  4GF8 A;  4BDN A;  3K6V A;  1MRP A;  4BDL A;  3FIR A;  4YB6 A;  1B3F A;  4PFW A;  4RXL A;  4LP2 B;  1USY H;  3EHS A;  4BLA A;  4F2Q A;  1SYH A;  3UIF A;  3VFJ A;  1MH3 A;  3N5L A;  4O3A A;  2P2A A;  2YLN A;  1Y1M A;  4F1U A;  4M1V A;  3N26 A;  1SYI A;  1A55 A;  3QK6 A;  3S2V A;  4F31 B;  4YU0 A;  1NH7 A;  3KOT A;  1AOV A;  4NF6 A;  1HSJ A;  3LBS A;  4UA8 A;  4TLL B;  1L5T A;  4DXU A;  4X9T A;  1B7U A;  4GOT A;  1LAG E;  4NE4 A;  1B51 A;  4F29 A;  1XVX A;  4G8H A;  1NNP A;  2GH9 A;  4DXC A;  1Y1Z A;  1XC1 A;  4HCW A;  2F7A A;  4F3P A;  4GRK A;  1Y4C A;  2Y7W A;  3TDJ A;  3IO6 A;  4RJZ A;  3TZA A;  1MPD A;  3C36 A;  5I58 A;  4ZZE A;  4F39 A;  1LCF A;  3VLW A;  1SI1 A;  4YIC A;  1LAF E;  5IAI A;  2E0S A;  2DWI A;  3VLV A;  1BKA A;  1M5C A;  5ICT A;  4P0I A;  1TWY A;  2ZNU A;  4IO3 A;  4GL0 A;  4I62 A;  2UXA A;  3TAJ A;  4LA9 A;  1QVS A;  2QS2 A;  2O6A A;  1BLF A;  3LC8 A;  5H8H A;  3SKP A;  2M8C A;  3VV5 A;  3IB1 A;  2PT1 A;  3C4M A;  3Q29 A;  4U4X A;  2AIX A;  4NF8 A;  3MVW A;  3MVY A;  3OO7 A;  3RN8 A;  2OBG A;  2PBW A;  2XXY A;  3MUQ A;  3DLN A;  4OFL A;  2O84 X;  3FXQ A;  5KCJ A;  4H0W A;  1S7Y A;  4KD5 A;  1A40 A;  2VOZ A;  3MW0 A;  3OEM A;  3SES A;  1B46 A;  4OER A;  3KGC A;  3K4U A;  4R75 A;  3SEV A;  2GFE A;  5FHN A;  2F5X A;  2QS4 A;  5I2N A;  5AA2 B;  1MXW A;  3B7D A;  4FIM A;  2OCU A;  1MQD A;  3ILU B;  2NWJ A;  3FJG A;  1TFA A;  4JWY A;  4ZEC A;  2OLB A;  4GXA A;  1B32 A;  4EQB A;  4IY6 A;  3BBR A;  2Z8E A;  2E1S A;  1MQJ A;  3GLB A;  5CMM A;  1Y3P A;  1DTG A;  1GGG A;  3IB0 A;  3OO8 A;  5EHM A;  4JWO A;  3S9L C;  1I6A A;  2XXH A;  4ZZA A;  1M5B A;  4ELQ A;  1LST A;  3V89 B;  1LB9 A;  5DT6 A;  4YMB A;  1PBQ A;  5B70 A;  1BIY A;  1J1N A;  1YPN A;  3O9P A;  3TYH A;  1B3L A;  3OSQ A;  3H06 B;  3K2D A;  3VDF A;  3T9V A;  1IUD A;  1D3K A;  4NF6 B;  2AYS A;  2XXR A;  4YMA A;  5L8D A;  2H5Y A;  1AH5 A;  3N6T A;  2ESN A;  4Z7E A;  2Q89 A;  3E3K A;  3R7X A;  3I6V A;  4XKQ A;  2O1M A;  3RTF B;  3K0V A;  1M5F A;  4R9G A;  1LGB C;  3CG3 A;  4I8C A;  3OD7 A;  5H8F A;  4YKK A;  2ZYK A;  2Z8F A;  1CB6 A;  4R73 A;  3IO4 A;  3RT6 B;  3TFL A;  4IY5 A;  2PMS A;  2DXR A;  3FGS A;  4IB2 A;  3BKI B;  3VXC A;  5HBC A;  3V5A A;  2VP1 A;  1F9B A;  4ECF A;  4QSD A;  3MP6 A;  3CSG A;  4DDD A;  1XVY A;  4H65 A;  3PPR A;  4U2R A;  3Q25 A;  1PC3 A;  4YKJ A;  1TXF A;  3B6Q A;  3PD9 A;  2V3T A;  3PGF A;  3CIJ A;  2VGQ A;  5CMC A;  1URD A;  3PPQ A;  5EHS A;  3ONM A;  5H8H B;  1XS5 A;  4EF1 A;  1LBB A;  1ZKB A;  5CRY A;  2I0C A;  3T66 A;  4KYD A;  1GV8 A;  1R6Z A;  3CFX A;  2UVH A;  3T96 B;  5KZT A;  2HAV A;  1DSN A;  1FTO A;  2DYX A;  1NL5 A;  4GIZ A;  1B3H A;  3K00 A;  3TTM A;  1QUJ A;  2VHA A;  3O6I A;  3S9M C;  4I1D A;  2NXO A;  4QSC A;  4RYA A;  1TFD A;  5KCJ B;  4GLI A;  2DQV A;  2YPN A;  3RTW B;  1O64 A;  3P7I A;  5DVF A;  1NKX A;  2A5S A;  5HPQ A;  1A7L A;  1P1Q A;  2HEU A;  5I2N B;  5I56 A;  3UA8 A;  4IO5 A;  4ESX A;  4XKN A;  1D9Y A;  2HZL A;  1O7T A;  5L9O A;  1GVC A;  3IR1 A;  2W7Y A;  4F18 A;  1PEB A;  1DTZ A;  4QF9 A;  4PP0 A;  4WED A;  1P1O A;  1H45 A;  4ELP A;  4EQ9 A;  4XXU A;  3OO9 A;  3LR1 A;  1Z7M E;  2Z8D A;  3HPI A;  3PV0 E;  1B5J A;  1P1N A;  1IXI A;  4OXV A;  1Y9U A;  1P99 A;  1Z7N E;  4OWD A;  5H8N A;  4OEN A;  2R6G E;  4O3B A;  2I4B A;  1ANF A;  4TLM B;  2D5W A;  1YCJ A;  4FED A;  2P0S A;  4IGR A;  4ZDM A;  3FVN A;  1JW5 A;  3LSX A;  4YKI A;  2DWH A;  4N07 A;  4MLV A;  5ITO A;  3TCG A;  4U22 A;  4PFU A;  1DPP A;  1OLA A;  2H99 A;  4GD5 A;  3KG2 A;  3C33 A;  4XIG Q;  1ZTY A;  1SQY A;  2QS1 A;  3W9W A;  4AB6 A;  3T9U A;  3CRB A;  4ZED A;  2HZK A;  2O68 A;  3C9H A;  4ZEF A;  1A54 A;  1ATG A;  4R6K A;  4N13 A;  2V84 A;  2ZNT A;  5H8F B;  2DVZ A;  4IO6 A;  4NWC A;  1LB8 A;  4OMB A;  5JEI A;  5B7D A;  3E4R A;  1PB7 A;  1R9Q A;  3FVO A;  1II5 A;  1VR5 A;  5TPA A;  3FAT A;  4MH5 A;  4PET A;  4MFI A;  2QS3 A;  3QIM A;  2CZL A;  2I0B A;  1FTM A;  1MS7 A;  3VVE A;  3OEL A;  3HHG A;  3PUV E;  1SI0 A;  4KCC A;  1OVB A;  4OFO A;  3O2A A;  2RC8 A;  4ELO A;  2F7C A;  4RNS A;  5F7V A;  4X1B A;  1EZO A;  3RY3 A;  4QSE A;  2IA4 A;  2DE4 A;  3RQT A;  1MY0 A;  4H6D A;  3ZSF A;  1M5D A;  3EN3 A;  1Y4T A;  4ZEI A;  5H8S A;  4DIG A;  3KZG A;  3D4C A;  4ZE8 A;  4MBP A;  3QUF A;  1FQF A;  4QRZ A;  3SEU A;  3KJ7 A;  5I2K A;  1AIV A;  1B4Z A;  2DVC A;  3I5O A;  2X26 A;  2B65 A;  4THI A;  1LCT A;  1A99 A;  2Q2A A;  4POX A;  4R9F A;  3DP6 A;  4L17 A;  3OXN A;  4DCX A;  2F7B A;  3T9H B;  1YAE A;  3PPP A;  1O63 A;  1FCK A;  4UAC A;  1MXZ A;  1PDA A;  3TCF A;  3N94 A;  3HN0 A;  4KCD A;  3SEX A;  2HCA A;  3EF7 A;  3ZKL A;  4MLQ A;  5I56 B;  2GHA A;  3IL1 B;  4GXS B;  1IZ1 A;  3PPO A;  1MPC A;  3QSL A;  2O51 A;  3H6W A;  1FW0 A;  4KHZ E;  3O6H A;  5DVI A;  1R9L A;  3MZ9 A;  2KLF A;  4KPT A;  2LAO A;  3RPW A;  2R9J A;  4U23 A;  1N84 A;  2F78 A;  4R2F A;  3WAE A;  3QXM A;  4F2O A;  3CFL A;  5H8N B;  2VD3 A;  1OIB A;  3R26 A;  3S4U A;  4OTE A;  2RCB A;  1IEJ A;  2DE3 A;  4NF5 A;  4RPO A;  3IX1 A;  2OZZ A;  3A3C A;  3OOA A;  4LON B;  3G3F A;  4FEC A;  4ZS9 A;  2VD2 A;  1N7W A;  3KSX A;  2Y7P A;  2HFB A;  5A5X A;  3G3I A;  5CC2 A;  5I57 A;  3G7W A;  3W15 C;  5H8Q A;  3FV1 A;  1SW1 A;  3PMV A;  4NWD A;  2I58 A;  4YZZ A;  1P1W A;  3JZJ A;  1US5 A;  2G93 A;  3C32 A;  4K3F A;  1WOD A;  3BFU A;  5CBR A;  1QUI A;  3MJN A;  5L9S A;  2XXP A;  1ZJL A;  3H7M A;  4IO7 A;  1EZ9 A;  4ZEK A;  4ELR A;  3FD3 A;  4JDF A;  5JK4 A;  2AL4 A;  1TT1 A;  5TPA B;  1GR2 A;  4GVO A;  3H3G A;  2OWT A;  3EQ1 A;  3FUZ A;  1T0K A;  3OMB A;  2OK2 A;  3SER A;  3FAS A;  2PT2 A;  2QMX A;  3ILT B;  1NNK A;  3JV9 A;  1JET A;  3K1N A;  2O69 A;  2ABH A;  2HXW A;  5EYF A;  1UIV A;  4OEV A;  2H25 A;  2UVG A;  4FEB A;  4Q30 B;  1I6B A;  4C1T A;  2HQ0 A;  4U1Z A;  2FNC A;  3O6G A;  3VVD A;  4EDP A;  1YTV A;  1N7X A;  3ECR A;  4BDR A;  3K1P A;  3M3F A;  3B6T A;  1SBP A;  4PFT A;  2REJ A;  4FAT A;  1USY E;  1B7H A;  1JW1 A;  1DPE A;  4P0G A;  1NNT A;  3C31 A;  3RGY A;  4MF3 A;  5I2K B;  2Z22 A;  1OQG A;  3OEN A;  1QUK A;  3RUM A;  3QAX A;  1LAH E;  1A8E A;  5KDT A;  1I6Q A;  3DP8 A;  3KEI A;  1XHY A;  2UVI A;  1IXG A;  2NUV A;  3JYR A;  1NNF A;  1ZBM A;  3C34 A;  1MH4 A;  3CR9 A;  1B0L A;  4KI0 E;  4OEU A;  4G2Z A;  5TP9 A;  3SET A;  4FAJ A;  2Q8J A;  3TTL A;  3MZB A;  4JBZ A;  2YJP A;  2PYY A;  1LAX A;  1B4H A;  3TQL A;  4U21 A;  3THI A;  5AA1 A;  4PQJ A;  3DP4 A;  3TTN A;  4RA1 A;  4QFK A;  2V93 A;  4OZ9 A;  3LSL A;  3IOT A;  2ONR A;  1KWH A;  4NF5 B;  3MC2 A;  4N6P A;  5FHM A;  3K6W A;  3S9E A;  4YB7 A;  3D4G A;  2XX9 A;  2PX1 A;  3MAM A;  4H5F A;  5A5X B;  1S50 A;  4LQ2 A;  4IGT A;  5I57 B;  5H8Q B;  2Q88 A;  1VSO A;  4G68 A;  2CMO A;  3M8U A;  1MY2 A;  4XKP A;  3G3J A;  3BFT A;  1B5H A;  1VFD A;  2D3I A;  3M3L A;  4GFR A;  3K02 A;  1B1X A;  4HCY A;  1JW4 A;  1FQB A;  2ONK E;  1N3X A;  2B3F A;  3CVG A;  1ZMG A;  1MDP 1;  2Y84 A;  1JEU A;  3O29 A;  3PUX E;  3U94 A;  1OMP A;  1IXH A;  4NMY A;  4H67 A;  1FTK A;  1D4N A;  3S9N C;  3TQW A;  1B2H A;  2GRV A;  3K6U A;  4RK2 A;  4EXL A;  5F1Q A;  3E13 X;  5ICQ A;  3TCH A;  1URS A;  1Y3N A;  3MZ1 A;  1H43 A;  2ALU A;  3PMX A;  5ITP A;  1JVX A;  2QRY A;  3TOD A;  1FTJ A;  1UTH B;  1EZP A;  2RC9 A;  3LSF B;  4LQ5 A;  3T9X B;  1PBP A;  5BUU A;  1RYO A;  1RYX A;  3SDF A;  2NOO A;  3U92 A;  4LZ8 A;  2XHD A;  1CE2 A;  2XXU A;  2WKY A;  1MXV A;  4R6H A;  1D9V A;  1B52 A;  4IO2 A;  2HAU A;  2G29 A;  4OET A;  3L6G A;  2V25 A;  4QFL A;  4X48 A;  3TTK A;  5M2V A;  3VE1 B;  5AA4 A;  2V3U A;  5L9M A;  4EQ7 A;  1PB9 A;  2RIN A;  4RY1 A;  5IKB A;  4BDQ A;  1A8F A;  3IOU A;  5BWJ A;  2AL5 A;  3MBP A;  3O28 A;  4HW8 A;  4NTL A;  4R2B A;  2A5T A;  5K2X A;  5KDT B;  1H76 A;  2P1S A;  3UN6 A;  3O97 A;  4H5G A;  1DOT A;  4M4G A;  1HSE A;  4LUB A;  4X1D A;  1LFG A;  2I48 A;  1JNF A;  3FVK A;  1MG1 A;  1SDX A;  1P1U A;  2OWS A;  1Q1K A;  3Q28 A;  4KYE A;  3WAF A;  4ZEB A;  4OFJ A;  5TP9 B;  3T22 A;  4OHN A;  5J1D A;  5DEX A;  2FA7 A;  4DLD A;  4G77 A;  5ISU A;  4KYS A;  1I69 A;  3MPK A;  4Q5T A;  1UQW A;  4ESW A;  3DEL B;  3GBB A;  4DZ1 A;  3GBA A;  3RNN A;  3CG1 A;  3UP9 A;  5AA2 D;  2V3Q A;  3O66 A;  5DYH A;  1R1N A;  4TOZ A;  3UGW A;  3EHU A;  1FQE A;  1IQ7 A;  1MXX A;  5I84 A;  4QFN A;  5CMB A;  3UK4 A;  1QJM A;  4G68 B;  3KBR A;  1MY4 A;  3PMW A;  2NVU B;  2H9B A;  3E9X A;  4R74 A;  5I59 A;  3U93 A;  4PE5 B;  4LAT A;  1URG A;  2F36 A;  1AMF A;  4P11 A;  3KN7 A;  4F22 A;  1MY3 A;  1MXU A;  2IEE A;  1XT8 A;  1SD3 A;  2DE2 A;  3F11 A;  4NF4 A;  1US4 A;  3SEY A;  3H4Z A;  4IO4 A;  3LSW A;  4KR5 A;  1N76 A;  4G68 C;  3K1M A;  1XOC A;  1DMB A;  2I6E A;  3TTR A;  3KOS A;  3CI8 A;  3CSB A;  2DOJ A;  3MP1 A;  3MVZ A;  5LOM A;  1IIT A;  1OLC A;  4OVJ A;  3TEL A;  3RLF E;  2R71 A;  5JTY B;  2RKM A;  3IAZ A;  3USD A;  1H3D A;  1WVJ A;  3QUJ A;  2XX8 A;  3IOV A;  5AA4 B;  3KFM A;  1FQA A;  4F1Y A;  2F34 A;  5CI5 A;  4QFO A;  1RKM A;  2DS9 A;  4DCY A;  1OQH A;  2QSX A;  2XD3 A;  5DTB A;  2Q9T A;  1Y3Q A;  4ND9 A;  2H4I A;  5HM4 B;  5DVJ A;  1SW2 A;  2F97 A;  4DE8 A;  3HST A;  3PD8 A;  3QYT A;  5FTH A;  2ZYO A;  2A5T B;  2X7P A;  3FXR A;  2XD2 A;  2XXV A;  3FZV A;  4LZ7 A;  4U4S A;  4PFY A;  4YKP A;  3A3U A;  3L6H A;  4RK9 A;  4OYV A;  1N04 A;  2ZNS A;  3H03 A;  3IK6 B;  3R6U A;  3MPL A;  1Q35 A;  3KSJ A;  4Q0C A;  1B5I A;  4GWO A;  4F3S A;  4C1U A;  1QKA A;  2GHB A;  3IB2 A;  2B3B A;  5DEX B;  3HCQ A;  3FJ7 A;  2DXY A;  3FJM A;  1B9J A;  1ZU0 A;  5AE4 A;  1H44 A;  1FTL A;  1VE4 A;  4EF2 A;  1ELJ A;  3H6T A;  3RT8 A;  1UIU A;  3Q27 A;  2BJJ X;  4C0R A;  4QHQ A;  3IJO B;  1UTH A;  4TQU Q;  4BDO A;  3G3G A;  4FE8 A;  3PUY E;  3H6U A;  3IOR A;  1B1H A;  2Y7R A;  4WKM A;  4G8N A;  3G3K A;  4F3B A;  3TMG A;  1GTK A;  1MQG A;  2UYE A;  3MWB A;  3TPA A;  4JSD A;  2DWA A;  1OVT A;  3U72 A;  3N6U A;  4F3G A;  1S9T A;  1LLS A;  1SW5 A;  2X7Q A;  2ZYM A;  2RCA A;  2XXX A;  1HSL A;  1LBC A;  5I59 B;  1LFI A;  1SVX B;  5FHO A;  2XXI A;  5CBS A;  1BP5 A;  3TEP A;  3PU5 A;  4ZE9 A;  3TKD A;  3MVX A;  3HHF A;  2PVU A;  3PPN A;  3ZKK A;  1QKB A;  5CMK A;  3VLU A;  2O7U A;  3UOR A;  4NF4 B;  2H98 A;  2RF1 A;  4E0X A;  2I3V A;  1MPB A;  1JEV A;  1MM6 A;  1PB8 A;  4GQO A;  1MXY A;  1POY 1;  3HO7 A;  2REG A;  4F19 A;  3PUW E;  4OQO A;  1Y20 A;  2QMW A;  1B40 A;  4EUO A;  1WDN A;  4POW A;  3FXU A;  4E0W A;  1IIW A;  2F35 A;  4KQP A;  2Q2C A;  4RPN A;  1FQC A;  1MQI A;  5I58 B;  3V83 A;  3V8X B;  1LFH A;  1B05 A;  1NFT A;  1UTB A;  3SEW A;  1NMU A;  3MQ9 A;  4BDM A;  2XXT A;  2ZMB A;  1JVY A;  5ELV A;  2F6G A;  2XXW A;  4LVQ A;  1FQD A;  4GL8 A;  2FYI A;  4JWX A;  4FOR A;  3IOW A;  4AQ4 A;  2I49 A;  1B3G A;  2D21 A;  4G4P A;  5K2Y A;  5AA3 A;  4LZ5 A;  2QPQ A;  3H6V A;  1AL3 A;  4R6Y A;  1JQF A;  4KFQ A;  4FJP A;  2Z23 A;  4O3C A;  4NF8 B;  2ONS A;  4YAH X;  3FVG A;  2I3W A;  3PUZ E;  1QW0 A;  3CFZ A;  1M5E A;  2Y7K A;  4WXJ A;  3IJX B;  3AXF A;  4JB7 A;  4H1X A;  4YB5 A;  2XX7 A;  3VXB A;  1ZIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...