1Q35A

Crystal structure of pasteurella haemolytica apo ferric ion-binding protein a
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
318
structure length
317
Chain Sequence
ANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADGLVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDRVGKLPAGFDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKANLARKPQGGDRDQVKAIKEGICDYSIGNSYYYGKMLDDEKQKSWAEAAIINFPSGEHGTHKNISGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHEYPVKEGIEPSAIVKGWGTFKSDTIKLEDIAKNYEAALKLVDEVKFDDFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords iron binding protein FbpA
publication title Crystal structure of Pasteurella haemolytica ferric ion-binding protein A reveals a novel class of bacterial iron-binding proteins
pubmed doi rcsb
source organism Mannheimia haemolytica
molecule tags Metal binding protein
total genus 124
structure length 317
sequence length 318
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1q35A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1q35A02
3TMGA 3KBRA 2RCBA 4ZEBA 4NE4A 2PBWA 5CMKA 1B46A 4KI0E 5TU0A 3RGYA 2G29A 3B7DA 3HHFA 3R7XA 4ZEDA 4H1XA 3TDJA 1Z7NE 1B3FA 1P1OA 2XX7A 4YKKA 1SYIA 1TWYA 3V5AA 3IOVA 1MH3A 3RT6B 4DLDA 4IO4A 2Z22A 5DEXA 3N26A 4F39A 2I6EA 2DVCA 3EN3A 1FQAA 4GLIA 4QHQA 2OJTA 1P1QA 4NWCA 1IXIA 3IB0A 3KN7A 4X9TA 3EQ1A 3KGCA 2DP8A 3A3CA 4DDDA 1BTJA 4GOTA 1AMFA 1N04A 3H6WA 3CFLA 1KWHA 4H65A 3UORA 4OHNA 3TEPA 1B5IA 5M2VA 3D4GA 1LCTA 3IAZA 3TAJA 3IB2A 3TQLA 4PETA 4X1DA 4G8HA 2VD2A 1GR2A 2DE2A 2V3TA 4I62A 3CSGA 3FV2A 1GTKA 1US4A 4BDOA 4LUBA 1JETA 1Y1MA 1Y1ZA 4YKPA 2Z8FA 3OD7A 4U23A 4ZEFA 4LVQA 2ABHA 4ESXA 3K6UA 3OEMA 5A5XB 1CE2A 1MQHA 1LSTA 3Q26A 3U8QA 1LBBA 1BP5A 2F97A 5I58B 4IO6A 2O7IA 4YKJA 3RUMA 2FA7A 3PUYE 4JSOA 5KDTB 3KZGA 1Y3QA 1OMPA 4OVJA 1BLFA 2DWHA 3LUYA 1DOTA 4P0IA 1XC1A 4F3BA 5BWJA 1MY2A 4N07A 3FVOA 3EHSA 3O97A 3MP6A 2O84X 4F1VA 2I3VA 1B3GA 3KN3A 3CG1A 2DXYA 4PP0A 3S9EA 4IO7A 3W9VA 1FTMA 3EF7A 1L5TA 3QIMA 3RLFE 4LQ2A 2ZYNA 4IO2A 2R71A 3OXNA 2HXWA 4PFUA 5AA2A 3RPWA 3PPRA 4EF2A 4GXAA 3D4CA 3S4UA 1R9LA 2DS9A 1LLSA 1N84A 4Z7EA 4QRZA 1MQJA 1NMUA 4NF8A 1JW5A 4DE8A 3O6HA 3PPOA 3DLNA 4GL0A 1VR5A 2Z8EA 1PBPA 4ZECA 5CBRA 2ZYKA 4I1DA 2FNCA 1URDA 3ZKLA 3G3FA 1XVXA 1B40A 1Q1KA 3T93B 4IGTA 3KFMA 2QMWA 2DQVA 3SEUA 1A8EA 4U2RA 4FEDA 1ZBMA 2QS1A 3F11A 4QF9A 1TT1A 3T96B 4GIZA 5AA4B 5CM6A 3C4MA 2NWJA 3ODBA 2ONRA 1P1NA 1A99A 4P11A 2UVGA 4XKRA 3EPEA 3HV1A 1DMBA 4H5GA 3K02A 3R26A 2XXPA 4EF1A 2F7CA 2RINA 1M5BA 3UP9A 5DYHA 2ZMBA 4XTCQ 1Q35A 1ZMGA 1DSNA 3G7WA 3VXCA 1QKBA 1CB6A 1QJMA 2YJPA 3MPLA 2O6AA 2A5TB 4DXUA 4P0GA 4F2OA 3CFXA 2OLBA 1NFTA 4YMBA 1IXHA 4RPOA 3MWBA 1H44A 2Y7IA 3E4RA 3N5LA 4WXJA 4EXKA 1TXFA 1FQEA 1OLAA 2XXHA 1XVYA 3CG3A 1P1UA 3EHTA 3DP4A 4XIGQ 4JDFA 3RY3A 5KCJB 2D3IA 4GXSB 4KFQA 1S9TA 3WAFA 2BJJX 3O6GA 4RPNA 1B5JA 2VHAA 1POTA 4ELQA 2V93A 4R6KA 4U22A 3LC8A 4NTLA 2I48A 4YB5A 5TPAA 3SERA 1LAFE 1GVCA 4G68A 3VVEA 3C36A 1SW2A 3T66A 5H8NA 2Q2AA 2OK2A 2HEUA 2RC7A 1Y3NA 2I0BA 2I4BA 3IK6B 4R75A 4BDQA 2XXUA 4HTGA 3MP8A 1Y4TA 3QK6A 1NNPA 4IO5A 4RA1A 4R73A 2UYFA 4KCDA 1PB8A 5AA3A 3VLUA 2HFBA 1RYXA 4R72A 2H25A 3VLVA 1R1NA 1H76A 3S9LC 3N6TA 3ZSFA 4MH5A 4Z0IA 2D21A 3OO6A 4H67A 4XKQA 4C1UA 3ZKKA 3SEVA 5HBCA 1B4ZA 5H8HB 1R6ZA 2X7QA 5TP9B 3C35A 3CVGA 1GGGA 4YICA 1JVXA 3TTRA 1EU8A 5DVFA 2ZXTA 1MQGA 4KD5A 5H8FA 3OO7A 2YPNA 4XKNA 1WODA 2E1SA 1AIVA 2X26A 2Q9TA 1VFEA 4GL8A 1IIWA 3BKIB 5B7DA 4RK2A 4OEUA 3FV1A 5L9MA 4BDMA 1UTHA 5I2KA 1AH5A 3OSRA 2PT2A 1J1NA 4DCXA 4F1UA 4GWOA 3FASA 1JW4A 1PB9A 1JEUA 4WEDA 2OZZA 2ZYOA 5DTBA 4DXCA 1O7TA 3HSTA 5I56B 3O29A 5CI5A 3SEYA 3IB1A 4DIGA 1AOVA 2QSXA 2O69A 1QW0A 4GQOA 1ZTYA 1B3LA 2DWAA 3JYRA 3MVYA 5CC2A 4G77A 2UVIA 1LB9A 4U4SA 2PX1A 1A40A 1B51A 5F1QA 4N6PA 4QFNA 5H8SA 5ICQA 3I5OA 3TQWA 2I0CA 3U1OA 1ZIUA 3PV0E 1VSOA 1WVJA 2F7AA 3E3KA 3RTFB 3U92A 3LSLA 5I2NA 4JWXA 4H0WA 1MPCA 5DVJA 1MXWA 1FW0A 3MJNA 3I6VA 1N3WA 3K01A 3IO4A 1UIUA 1P99A 3TODA 3MPKA 3U93A 4RNSA 3PMVA 3FZVA 1VFDA 4BDNA 4K3FA 4OENA 4X48A 4BLAA 1B7ZA 3FVGA 2UVJA 1A54A 5L8DA 4POWA 2Y7PA 2PT1A 1I69A 2F6GA 1NKXA 1FTKA 2Q2CA 1A7LA 1MXVA 1MXZA 2XXQA 4FJPA 4KPTA 4YB6A 1SDXA 4OEVA 4YZZA 2V25A 5ELVA 2I4CA 3T22A 4F31B 3IX1A 5EHSA 3FATA 4IO3A 3C34A 3DM0A 4KR5A 3T9HB 3MVZA 2F35A 3IL1B 1LFGA 3K1NA 5EHMA 1ZU0A 1DPPA 5H8QA 2DVZA 1EZOA 1LAHE 3CIJA 5FTIA 4BDLA 1JVYA 2GRVA 2HZKA 4OESA 1XT8A 1LAXA 4YAHX 1B52A 3GLBA 4O3CA 4PFWA 4OXVA 4KYDA 3HPIA 4FECA 4NF6B 3QXMA 4RK9A 3FJGA 3K1MA 2QJEA 4DCYA 2H4IA 3PUXE 3SESA 1NNFA 1MY0A 4PFTA 1N76A 4NWDA 3QUJA 1M5FA 3U72A 1T0KA 1IXGA 3A3UA 1D9YA 1M5DA 4NF4B 3JZJA 1GV8A 1NNTA 3N6UA 4E0XA 3TPAA 3TELA 3KG2A 3QUFA 3LR1A 2H98A 3OMBA 4YB7A 3MAMA 4LZ8A 3SKPA 3OO8A 3TTKA 1LBCA 4H8IA 4OERA 4ELOA 3T9UA 2REJA 1UTBB 3DP6A 1MXXA 4OFLA 3TYHA 1B32A 4KHZE 5I59B 3WAEA 3N94A 4F3PA 4KYEA 1JQFA 1NH8A 2O1LA 4ZEKA 3QYTA 4OFJA 2XXIA 1HSJA 1SI1A 3VDFA 4FE8A 3Q29A 1B1XA 4L17A 3K00A 3KOSA 4OWDA 5I57A 4F1YA 1QUJA 1URGA 2XXWA 1FCKA 3MC2A 4H6DA 1B7UA 1SYHA 4Q8RA 5FTHA 5IAIA 2O51A 4NF5A 3IOWA 4OFOA 2KLFA 3PPPA 2QS4A 4R9FA 3G3IA 3RTWB 2XXXA 3FXRA 4LATA 3M3FA 2Q89A 4ZE8A 2M8CA 3T9XB 2V3QA 4H5FA 1B3HA 2RC9A 4UACA 4QFKA 1SW1A 2V3UA 1YTVA 3IJOB 4WKMA 1BIYA 3VLWA 2HAUA 4G8MA 2RCAA 3PPNA 3ONMA 4NMYA 3BFTA 2UYEA 1QKAA 1US5A 2VOZA 3FVKA 4POXA 3UN6A 2AL4A 3C31A 4C0RA 2P0SA 2QL3A 2QS2A 4OTEA 3OSQA 1SBPA 4HCWA 1ZJLA 1P1WA 3PMWA 3V83A 1QUKA 1MY4A 3HCQA 2DSFA 5AA1A 3FGSA 2GHAA 2DOJA 3IO6A 4ISUA 2NXOA 3MP1A 3G3GA 3VFJA 3R6UA 4ELRA 3BFUA 2Y7KA 1MXUA 2PMSA 3FD3A 2F6PA 3FJMA 4F18A 3H6VA 4XXUA 1Y9UA 2XD2A 4AQ4A 1HSEA 1IXCA 2AL5A 3IR1A 3GXAA 3E13X 1O63A 3VVDA 1JEVA 3MZ9A 5ITOA 1N3XA 3V89B 3SETA 3CFZA 3T9VA 3K2DA 1LCFA 2O1MA 2O7UA 3ILTB 4ELPA 3W15C 2YLNA 3MQ9A 4F29A 5FHOA 3ILUB 2F78A 5AA2B 1ATGA 3G3HA 2XD3A 3O28A 1MM7A 3FUZA 2P2AA 1NH7A 4IGRA 4XKPA 1FTOA 3E9XA 2PYYA 4QSEA 2I58A 4NF8B 3EHUA 1I6BA 3RN8A 1H43A 3CI8A 2Q88A 2LAOA 2AIXA 2FYIA 2XXVA 1MRPA 2Z8DA 4YKIA 2G93A 1YCJA 2VP1A 3MZ1A 2H9BA 4G8NA 5A5XA 4FATA 3TTLA 2F7BA 2DE4A 1M5EA 4U21A 2NVUB 2NUVA 5I58A 5K2XA 1OLCA 1WDNA 3K6VA 3VE1B 2DYXA 3OO9A 2R9JA 2ALUA 4EDPA 5DT6A 3B6QA 3QAXA 2P1SA 1B05A 3PUZE 3K4UA 5KDTA 4OMBA 4M1VA 4ZEIA 2F36A 1H45A 3PUVE 4G4PA 4KCCA 1ZLQA 2OWSA 1PDAA 1B58A 3PUWE 4ZZAA 1B0LA 4O3AA 1LB8A 3PPQA 1SQYA 1B2HA 3KJTA 3OOAA 5HM4B 1EH3A 1N0TA 2RF1A 4F19A 3TUSA 1FQCA 3DP8A 2RC8A 4RXLA 4FORA 1SD3A 4IY6A 4O3BA 2ZYMA 5F7VA 4R6YA 3O66A 2GH9A 5BUUA 5L9SA 3Q27A 3FIRA 2GFEA 3GBAA 2F34A 3H3GA 1MY1A 4FIMA 4F22A 3O2AA 4JWYA 1MS7A 4HS7A 5JTYB 1MQIA 3H4ZA 4QSDA 4IB2A 4LZ7A 4PQJA 1MXYA 1PBQA 3PMXA 2D5WA 3DELB 4MLVA 4RYAA 4TQUQ 4R9GA 1PEBA 2ONKE 5TPAB 2QRYA 4G68B 1FQBA 1LFIA 5AA4A 2I3WA 3KN8A 5H8NB 4QFOA 4U4XA 2WKYA 3SEXA 1PB7A 4ZE9A 5EYFA 5IKBA 3PD9A 5K2YA 4EQ7A 2DWJA 1HSLA 3L6GA 4JWOA 4FAJA 5B70A 4N13A 1IQ7A 5AE4A 2A5TA 5KZTA 5FHNA 1FQDA 1LAGE 4WEPA 1YPNA 2B3FA 4Q5TA 1BKAA 1IZ1A 3CR9A 4IY5A 5DVIA 1B1HA 3GBBA 1NNKA 3KEIA 3OEKA 3ZS6A 1MPBA 4ZDMA 1QUIA 2UVHA 4LZ5A 4JSDA 1II5A 5KCJA 4OZ9A 4GVOA 5H8FB 3C33A 1FQFA 1Z7ME 3MVWA 2QPQA 4C1TA 4ND9A 4AB6A 4GRKA 3HO7A 1USYE 1IITA 4R2FA 1Y20A 1M5CA 1UQWA 2VD3A 2I49A 4GF8A 1DPEA 3VVFA 5J1DA 1UTHB 5I2KB 4ESWA 1F9BA 5I84A 2ANJA 3G3JA 4G68C 2CZLA 2XX9A 5FHMA 2ZNTA 3W9WA 2F5XA 4YU0A 2XXYA 4GD5A 3M3KA 2O68A 4E0WA 3VV5A 2B65A 3B6TA 3RQTA 4AB5A 3A09A 5JEIA 2ONSA 3CRBA 1MQDA 1D3KA 1JW1A 1I6AA 2PVUA 2HAVA 3H03A 1JNFA 3OELA 1SVXB 2HQ0A 2OBGA 3UK4A 3SEWA 4I9DA 4R2BA 2HCAA 2ESNA 5I2NB 1B6HA 4UA8A 3S9MC 1A8FA 4QFPA 4Q30B 4GFRA 3H7MA 5JK4A 1S7YA 1USYH 3FJ7A 1SI0A 1MG1A 3LSFB 4RY1A 4KYSA 4M4GA 2NOOA 5H8HA 5TP9A 4F3SA 2V84A 3O6IA 2AYSA 5LOMA 3KJ7A 2VGQA 1UIVA 4OQOA 1XHYA 4HW8A 2THIA 3RNNA 1URSA 3O9PA 3FVNA 3PU5A 4LA9A 3VXBA 1QVSA 1FTJA 3TCGA 5DEXB 2Y84A 1POY1 3Q28A 4KQPA 1MPDA 3HN0A 4LQ5A 1OVBA 1EZPA 4U1ZA 3K6WA 1MDQA 1LFHA 4OYVA 1YAEA 2Y7WA 3IOUA 4PFYA 1MH4A 3MBPA 1RKMA 3C9HA 4BDRA 4ONYA 3USDA 1S50A 2RKMA 5I56A 1B5HA 1MDP1 1ELJA 4PE5B 3M8UA 3H6UA 4G2ZA 5CMCA 4NEDA 3B6WA 3KSXA 4OETA 2UXAA 3PD8A 3TCHA 3K6XA 4JB7A 1NL5A 3TKDA 4HCYA 4LP2B 5H8QB 4TLMB 4EQBA 2R6GE 5ITPA 1B7HA 1OQGA 1O64A 3G3KA 3C32A 3BBRA 4F2QA 2REGA 4DXBA 4LONB 2F8DA 4RJZA 1XS5A 2Z23A 1ZKBA 5ICTA 1EZ9A 4ECFA 4MFIA 1B0HA 3LBSA 5HPQA 2DE3A 4MLQA 3LSWA 1XOCA 3QSLA 1I6QA 4DZ1A 4TLLB 3TTNA 5JTYA 3U94A 4F3GA 2IA4A 3PGFA 1B3EA 1D4NA 2H99A 2OWTA 2W7YA 3AXFA 4JBZA 4ZZEA 1ANFA 2Q8JA 3KSJA 5CRYA 4TOZA 3TZAA 2ZNUA 3S2VA 2DWIA 1B9JA 4MF3A 3MW0A 1A55A 1MY3A 1Y3PA 3TCFA 3FXQA 3FXUA 4Q0CA 2Y7RA 5CBSA 4R6HA 3SDFA 3TTMA 1OQHA 1B4HA 2B3BA 1Y4CA 4FEBA 1DTGA 2E0SA 1R9QA 3TFLA 4YMAA 1TFAA 1DTZA 2DXRA 4R74A 5I57B 2QMXA 1N7XA 3UA8A 3GZGA 4JXIA 2HZLA 1FTLA 3H6TA 3CSBA 2CMOA 4EUOA 1D9VA 3HHGA 3OENA 5CMMA 4NF6A 3MUQA 2XXRA 2XHDA 4NF5B 4EXLA 1VE4A 3S9NC 3I3VA 2OCUA 2IEEA 3IORA 3V8XB 1QULA 2ZNSA 3THIA 3UIFA 3ECRA 1SW4A 1H3DA 1LGBC 3JV9A 4QSCA 3IOTA 2X7PA 4NF4A 4QFLA 3UGWA 1IEJA 3L6HA 1TFDA 1OIBA 2XXTA 2XX8A 4H8JA 5ISUA 3KOTA 5L9OA 4THIA 3P7IA 2A5SA 3H06B 4X1BA 4EQ9A 1SW5A 4MBPA 1AL3A 2QS3A 1RYOA 1PC3A 5AA2D 2H5YA 1UTBA 3IJXB 1OVTA 4I8CA 3LSXA 2GHBA 4U1OA 5I59A 4ZS9A 3M3LA 3MZBA 3RT8A 3Q25A 5CMBA 3K1PA 3K0VA 1IUDA 1MM6A 3MVXA 1N7WA
chains in the Genus database with same CATH superfamily
3TMGA 3KBRA 2XWOA 2RCBA 4AS5A 4ZEBA 4NE4A 2PBWA 1RDXA 3MYUA 5CMKA 1B46A 4KI0E 5TU0A 3RGYA 1NV3A 4FBPA 2G29A 3B7DA 3HHFA 3R7XA 4ZEDA 4H1XA 3TDJA 2JJKA 3B50A 1Z7NE 1B3FA 1P1OA 4OVSA 2XX7A 4YKKA 1SYIA 1TWYA 4GBVA 3V5AA 3IOVA 4H46A 1MH3A 3RT6B 4DLDA 4IO4A 2Z22A 5DEXA 3N26A 4F39A 2I6EA 2DVCA 3EN3A 1FQAA 4GLIA 4QHQA 2OJTA 5DW8A 1P1QA 4NWCA 1IXIA 3IB0A 3KN7A 4X9TA 2CEXA 3EQ1A 3KGCA 4XFEA 2R8TA 2DP8A 3A3CA 4DDDA 4NX1A 1BTJA 4GOTA 1AMFA 1N04A 3H6WA 1FJ6A 3CFLA 1KWHA 4H65A 1FPIA 3UORA 4OHNA 3TEPA 3A29A 1B5IA 5M2VA 3D4GA 1LCTA 4I40A 3BIGA 3IAZA 3TAJA 3IB2A 3TQLA 4PETA 4X1DA 4G8HA 2VD2A 1GR2A 2DE2A 2V3TA 4I62A 5EQ8A 3GYYA 3CSGA 3FV2A 1GTKA 1US4A 4BDOA 4LUBA 1JETA 1Y1MA 1Y1ZA 4YKPA 2Z8FA 3OD7A 4U23A 4ZEFA 4LVQA 2ABHA 4ESXA 3K6UA 3OEMA 5A5XB 1CE2A 4NAPA 1NV1A 1XI6A 1MQHA 1LSTA 3Q26A 3U8QA 4PF8A 1LBBA 4P1LA 4P3LA 1BP5A 2F97A 5I58B 4IO6A 4GWXA 2O7IA 4YKJA 3RPLB 4MIJA 3RUMA 2FA7A 3PUYE 4JSOA 5KDTB 3KZGA 1Y3QA 1OMPA 4OVJA 4X8RA 1BLFA 2DWHA 5ET5A 3LUYA 1DOTA 4P0IA 1XC1A 4F3BA 5BWJA 1MY2A 4N07A 3FVOA 3EHSA 1FPJA 3O97A 3MP6A 2O84X 4P56A 3ISPA 5LDZA 4F1VA 2I3VA 1B3GA 3KN3A 3CG1A 2DXYA 4PP0A 3S9EA 4IO7A 3W9VA 1FTMA 3EF7A 4GWWA 1L5TA 3QIMA 3RLFE 2F3DA 4LQ2A 2ZYNA 4IO2A 2R71A 3OXNA 2HXWA 4PFUA 5AA2A 2F3BA 3RPWA 3PPRA 4EF2A 4GXAA 3D4CA 4PE3A 3S4UA 4NGUA 1R9LA 2DS9A 1LLSA 1N84A 4Z7EA 4QRZA 1MQJA 1NMUA 4PAFA 4NF8A 1JW5A 4DE8A 3O6HA 3PPOA 3QMFA 3DLNA 4GL0A 1VR5A 3LV0A 2Z8EA 1PBPA 1IMFA 4ZECA 1KA0A 5CBRA 2ZYKA 4OVTA 4I1DA 2FNCA 4KXPA 1URDA 3ZKLA 3G3FA 1XVXA 1B40A 1Q1KA 3T93B 4IGTA 3KFMA 2QMWA 2DQVA 3SEUA 1A8EA 4U2RA 4FEDA 1ZBMA 2QS1A 3F11A 4QF9A 1TT1A 3T96B 1LBWA 4GIZA 5AA4B 2XWKA 5CM6A 3C4MA 2NWJA 3ODBA 2ONRA 1P1NA 1A99A 4P11A 2UVGA 4XKRA 3T0JA 3EPEA 3HV1A 1DMBA 4H5GA 3K02A 3R26A 2XXPA 4EF1A 2F7CA 2RINA 1M5BA 3UP9A 5DYHA 2ZMBA 4XTCQ 1Q35A 1ZMGA 1DSNA 3G7WA 3VXCA 1QKBA 1CB6A 1QJMA 2WEFA 2YJPA 3MPLA 2O6AA 2A5TB 4DXUA 4P0GA 4F2OA 3CFXA 2OLBA 1NFTA 4YMBA 1IXHA 2WYPA 4RPOA 3MWBA 1H44A 1LBVA 2Y7IA 3E4RA 3N5LA 4WXJA 4EXKA 4N6KA 1TXFA 1FQEA 1OLAA 2XXHA 1XVYA 3CG3A 1P1UA 3EHTA 3DP4A 4PBQA 4XIGQ 4JDFA 3RY3A 5KCJB 2D3IA 4O94A 4GXSB 4KFQA 1S9TA 3WAFA 2BJJX 3O6GA 4QXDA 4RPNA 1LBYA 5EQAA 1B5JA 2VHAA 1POTA 4ELQA 2V93A 3BIHA 4R6KA 4U22A 4IR8A 3LC8A 4NTLA 2I48A 4YB5A 2QFLA 5TPAA 3SERA 1LAFE 1GVCA 4G68A 3VVEA 2VT5A 3C36A 1SW2A 3T66A 5H8NA 2Q2AA 2WYKA 2OK2A 2HEUA 2RC7A 1Y3NA 2I0BA 2I4BA 3IK6B 4R75A 4BDQA 2XXUA 4HTGA 3MP8A 1Y4TA 3QK6A 1NNPA 4IO5A 4RA1A 4R73A 2UYFA 4KCDA 1PB8A 4N8YA 5AA3A 3VLUA 4O8MA 2HFBA 1NV5A 1RYXA 4R72A 1FPFA 2H25A 3VLVA 1R1NA 1H76A 3S9LC 3N6TA 3ZSFA 4JVCA 4MH5A 4Z0IA 2D21A 3OO6A 4H67A 4XKQA 4C1UA 3ZKKA 3SEVA 5HBCA 1B4ZA 5H8HB 1R6ZA 2X7QA 5TP9B 3C35A 1IMEA 3CVGA 1GGGA 3ROJA 4YICA 4OVQA 1JVXA 3TTRA 1EU8A 5DVFA 2ZXTA 1MQGA 4KD5A 5H8FA 1NI9A 3OO7A 2YPNA 1YYZA 4XKNA 1WODA 2E1SA 2VPNA 1AIVA 2X26A 2Q9TA 1VFEA 4GL8A 1IIWA 3BKIB 5B7DA 4RK2A 4OEUA 3FV1A 5L9MA 4BDMA 2CZHA 1UTHA 5I2KA 1AH5A 4MX6A 3OSRA 2PT2A 1J1NA 4DCXA 4F1UA 4GWOA 3FASA 1JW4A 4H45A 1PB9A 5I3SA 1JEUA 3E79A 4WEDA 2OZZA 2ZYOA 5DTBA 1NV7A 1O7TA 4DXCA 3HSTA 5I56B 3O29A 5CI5A 3SEYA 3IB1A 4N6DA 4DIGA 4XF5A 1AOVA 2QSXA 2O69A 1FPBA 1QW0A 2CEYA 4GQOA 1ZTYA 3U65A 1B3LA 2DWAA 3JYRA 3MVYA 5CC2A 4G77A 2UVIA 1LB9A 4U4SA 2PX1A 1A40A 1B51A 5F1QA 4N6PA 4QFNA 5H8SA 5ICQA 5IZZA 3I5OA 3TQWA 4I3EA 3KBZA 2I0CA 3U1OA 1ZIUA 3PV0E 1IMDA 1VSOA 1LBZA 1WVJA 2F7AA 3E3KA 3RTFB 3U92A 3LSLA 4XEQA 5I2NA 4JWXA 4H0WA 1MPCA 2P3NA 5DVJA 1MXWA 1FW0A 3MJNA 3I6VA 1N3WA 3K01A 3IO4A 1UIUA 1P99A 3NOHA 3TODA 3MPKA 1FPKA 4PAKA 3U93A 4RNSA 3PMVA 3FZVA 4PAIA 1VFDA 1D9QA 4BDNA 4K3FA 4OENA 4X48A 4BLAA 4OA4A 2PFYA 1B7ZA 3FVGA 2B4MA 1LEVA 4HE1A 2UVJA 1A54A 5L8DA 4JVDA 2Y7PA 4POWA 2PT1A 1I69A 2F6GA 1NKXA 1FTKA 2Q2CA 5EQ7A 1A7LA 1MXVA 1MXZA 1IMAA 2XXQA 4FJPA 4KPTA 4YB6A 1SDXA 4OEVA 4YZZA 2PCRA 2V25A 5ELVA 2I4CA 3T22A 4F31B 3HFUA 3IX1A 5EHSA 3FATA 4IO3A 3C34A 3DM0A 4KR5A 5A5LA 2XA5A 3T9HB 3MVZA 2F35A 3IL1B 1LFGA 3K1NA 5EHMA 1ZU0A 1DPPA 5H8QA 4OVRA 2DVZA 1EZOA 5IZ3A 1LAHE 3CIJA 5FTIA 4GX4A 4BDLA 1JVYA 2GRVA 2HZKA 4OESA 1XT8A 1LAXA 4YAHX 1B52A 3GLBA 4O3CA 4PFWA 3CHGA 4OXVA 4KYDA 3HPIA 4FECA 4NF6B 1DBZA 3QXMA 4RK9A 3FJGA 3K1MA 2QJEA 4DCYA 2H4IA 1EYJA 3PUXE 2ZZXA 3SESA 1NNFA 5I5PA 1MY0A 4PFTA 1N76A 1NV2A 3E78A 4NWDA 3QUJA 1M5FA 3U72A 1T0KA 1IXGA 4PF6A 3A3UA 1D9YA 1M5DA 4NF4B 3JZJA 1GV8A 1NNTA 3N6UA 4E0XA 3TPAA 3TELA 3KG2A 3QUFA 3LR1A 2H98A 3OMBA 4MEVA 4YB7A 5LTCA 3MAMA 4LZ8A 3SKPA 3OO8A 3TTKA 1LBCA 4GWUA 4H8IA 4OERA 4ELOA 3T9UA 2REJA 1UTBB 3DP6A 1MXXA 4OFLA 3TYHA 1B32A 4KHZE 5I59B 1NUXA 3WAEA 3N94A 1FBCA 4F3PA 4MNCA 4KYEA 1JQFA 1NH8A 2O1LA 4ZEKA 3QYTA 4OFJA 2XXIA 1HSJA 1SI1A 3VDFA 4FE8A 3Q29A 1B1XA 4L17A 3K00A 3KOSA 4OWDA 2OWZA 4MMPA 5I57A 4F1YA 1KZ8A 1QUJA 1G0HA 1URGA 4MNPA 2XXWA 4DI3D 1FCKA 3MC2A 1NV0A 4H6DA 1B7UA 1SYHA 4O7IA 5FTHA 4Q8RA 5IAIA 2O51A 4NF5A 3IOWA 4G61A 4OFOA 2KLFA 3PPPA 4I3YA 2QS4A 4R9FA 3G3IA 3RTWB 2XXXA 3FXRA 4LATA 3M3FA 2Q89A 4ZE8A 2M8CA 3T9XB 2V3QA 4H5FA 3FBPA 4NF0A 2FBPA 1B3HA 4PGNA 2RC9A 4UACA 4QFKA 1SW1A 2V3UA 1YTVA 3IJOB 4NN3A 4WKMA 1BIYA 3VLWA 2HAUA 1KA1A 4G8MA 4P1EA 4P8BA 2RCAA 2FIXA 3PPNA 3ONMA 4NMYA 3BFTA 2UYEA 2B4LA 1QKAA 4GWZA 1BK4A 1US5A 2VOZA 2L5VA 3FVKA 4POXA 3UN6A 2AL4A 3C31A 4C0RA 4GX6A 2XWIA 4PC9A 2P0SA 2QL3A 2QS2A 4OTEA 3OSQA 1SBPA 4HCWA 1ZJLA 4N4UA 1P1WA 3PMWA 3V83A 1QUKA 1MY4A 2XWVA 3HCQA 2DSFA 4N81A 5AA1A 3FGSA 1FPLA 2GHAA 2DOJA 3IO6A 4ISUA 2Y5LA 2QVUA 2NXOA 3MP1A 4NG7A 3G3GA 3VFJA 3R6UA 1EYKA 2WBBA 4ELRA 4N17A 3BFUA 2Y7KA 1MXUA 2PMSA 3FD3A 2F6PA 3FJMA 4F18A 3H6VA 4XXUA 1Y9UA 2XD2A 4AQ4A 1HSEA 1IXCA 2AL5A 3IR1A 3GXAA 3E13X 1O63A 3VVDA 1JEVA 1FBPA 3MZ9A 5ITOA 5F24A 1N3XA 3V89B 3SETA 3CFZA 3T9VA 3K2DA 1LCFA 2O1MA 2O7UA 3ILTB 4ELPA 3W15C 2YLNA 3MQ9A 4PBHA 4F29A 5FHOA 3ILUB 1DCUA 2F78A 5AA2B 4OVPA 1ATGA 1IMBA 3G3HA 2XD3A 3O28A 1MM7A 3FUZA 2P2AA 1NH7A 4IGRA 4XKPA 1FTOA 3E9XA 2PYYA 4QSEA 2I58A 4NF8B 3EHUA 1I6BA 1RDYA 3RN8A 1H43A 4LN5A 4HE0A 3CI8A 2Q88A 4N91A 4NHBA 2LAOA 2AIXA 2FYIA 4PCDA 2XXVA 3FXBA 1MRPA 2Z8DA 4O7MA 4YKIA 2G93A 1DK4A 1YCJA 2VP1A 3MZ1A 2H9BA 4G8NA 5A5XA 4FATA 3TTLA 2GQ1A 2F7BA 2FVZA 2DE4A 4MCOA 1M5EA 4U21A 2NVUB 2NUVA 4PDHA 5I58A 5K2XA 2KR0A 1OLCA 1WDNA 3K6VA 3VE1B 2DYXA 3OO9A 2QVRA 3RPLA 2R9JA 2ALUA 4EDPA 5DT6A 3B6QA 3QAXA 2P1SA 1B05A 3PUZE 3K4UA 5KDTA 4OMBA 4M1VA 4GWYA 4ZEIA 2F36A 1H45A 3PUVE 4G4PA 4P9KA 4KCCA 1ZLQA 2OWSA 1PDAA 1B58A 3PUWE 4ZZAA 1B0LA 4O3AA 1LB8A 3PPQA 1SQYA 1B2HA 3KJTA 3OOAA 5HM4B 2HHMA 1EH3A 1N0TA 1SPIA 2RF1A 4F19A 3TUSA 1FQCA 3DP8A 2RC8A 4RXLA 4FORA 1SD3A 4IY6A 4O3BA 2ZYMA 5F7VA 4R6YA 5IM2A 3O66A 2GH9A 5BUUA 5L9SA 3Q27A 3FIRA 2GFEA 3GBAA 2KQZA 2F34A 3H3GA 1MY1A 4FIMA 4F22A 3O2AA 4JWYA 1MS7A 1FBGA 4HS7A 5JTYB 1MQIA 3H4ZA 4QSDA 4IB2A 4HE2A 4LZ7A 5EQ9A 2WX9A 4PQJA 1MXYA 1PBQA 2PFZA 4NQ8A 3PMXA 2D5WA 3DELB 4MLVA 4RYAA 2HPGA 4TQUQ 4R9GA 1PEBA 2ONKE 5TPAB 4X04A 3T1BA 1K9YA 2QRYA 4G68B 1FQBA 1LFIA 1FBDA 5AA4A 2I3WA 3KN8A 5H8NB 1FBEA 4QFOA 4U4XA 2WKYA 3PTYA 3SEXA 4MJOA 1PB7A 4ZE9A 5EYFA 5IKBA 2CZIA 3PD9A 5K2YA 4EQ7A 1FBFA 2DWJA 1HSLA 3L6GA 4JWOA 4FAJA 5B70A 4N13A 1IQ7A 4PGPA 5AE4A 5ET6A 2A5TA 5KZTA 5FHNA 5ET8A 1FQDA 1LAGE 4WEPA 1YPNA 2B3FA 4Q5TA 2WBDA 4GWSA 1BKAA 1JP4A 1IZ1A 3CR9A 4IY5A 5DVIA 1B1HA 3GBBA 1NNKA 3KEIA 3OEKA 3ZS6A 1MPBA 4ZDMA 1QUIA 2UVHA 4LZ5A 4JSDA 5EYHA 1II5A 5KCJA 4OZ9A 4GVOA 5H8FB 3C33A 1FQFA 4GX3A 1Z7ME 3IFAA 3MVWA 2QPQA 4C1TA 4ND9A 4AB6A 2OX3A 4GRKA 3HO7A 1USYE 1IITA 4R2FA 1Y20A 1M5CA 4PFRA 1UQWA 2VD3A 2I49A 4GF8A 1DPEA 1G0IA 3VVFA 5J1DA 3KC0A 1UTHB 5I2KB 4ESWA 4HXVA 1F9BA 2P3VA 5I84A 2ANJA 3G3JA 4G68C 2CZLA 2XX9A 5FHMA 5T3JA 2ZNTA 3W9WA 2F5XA 4YU0A 2XXYA 4GD5A 3M3KA 2O68A 4E0WA 2FHYA 3VV5A 2B65A 1LBXA 3B6TA 1FSAA 4N15A 3RQTA 4AB5A 3A09A 5JEIA 2ONSA 3CRBA 1MQDA 1D3KA 1JW1A 1I6AA 2PVUA 2HAVA 3H03A 1JNFA 3OELA 2Q8MA 1SVXB 2HQ0A 2FIEA 2OBGA 3UK4A 1RDZA 3SEWA 5I7IA 4I9DA 3SZPA 4R2BA 2HCAA 2ESNA 5I2NB 1B6HA 4UA8A 3S9MC 1A8FA 4QFPA 4Q30B 2BJIA 4GFRA 3H7MA 5JK4A 1S7YA 1USYH 3FJ7A 1SI0A 1MG1A 3LSFB 4RY1A 4KYSA 1NUYA 4M4GA 2NOOA 5H8HA 5TP9A 4F3SA 2V84A 3O6IA 2AYSA 5LOMA 1FPGA 3KJ7A 2VGQA 3MSTA 1UIVA 4OQOA 1XHYA 4HW8A 2THIA 3RNNA 5IGAA 1NV4A 1URSA 3O9PA 3FVNA 3PU5A 4LA9A 3VXBA 1QVSA 1INPA 1FTJA 3TCGA 3B8BA 5DEXB 2Y84A 1POY1 3Q28A 4DI4B 4KQPA 1MPDA 3HN0A 4LQ5A 1OVBA 1EZPA 1YXIA 4U1ZA 3K6WA 1MDQA 4PDDA 1LFHA 4OYVA 1YAEA 2Y7WA 3IOUA 4PFYA 1MH4A 3MBPA 1RKMA 3C9HA 4BDRA 4ONYA 3USDA 2V4CA 1S50A 2RKMA 5I56A 1B5HA 1MDP1 1ELJA 4PE5B 3M8UA 3H6UA 4G2ZA 1Q9DA 5CMCA 4NEDA 5FBPA 1IMCA 3B6WA 3KSXA 4OETA 5ESYA 2UXAA 4JVIA 4P47A 3PD8A 3TCHA 3K6XA 4JB7A 1NL5A 3TKDA 3KC1A 4HCYA 4LP2B 5H8QB 4TLMB 4EQBA 5IZ3B 2R6GE 1EYIA 5ITPA 2XXKA 1B7HA 1QGXA 1OQGA 1O64A 3G3KA 1FBHA 2QVVA 3C32A 3BBRA 4F2QA 2REGA 4DXBA 4LONB 2F8DA 4RJZA 1XS5A 2Z23A 1ZKBA 5ICTA 1EZ9A 5EYGA 4ECFA 4MFIA 1B0HA 3LBSA 5HPQA 2DE3A 4MLQA 2DDKA 3LSWA 3EKIA 4OANA 1XOCA 3QSLA 1I6QA 4DZ1A 4TLLB 3TTNA 4PTKA 5JTYA 3U94A 4MHFA 4F3GA 2IA4A 3PGFA 1B3EA 1D4NA 2H99A 2OWTA 2W7YA 3AXFA 4JBZA 4ZZEA 1ANFA 5ET7A 4N8GA 2Q8JA 3KSJA 5CRYA 4TOZA 3TZAA 2ZNUA 3S2VA 2DWIA 1B9JA 4MF3A 3MW0A 1A55A 4PFIA 1MY3A 1Y3PA 3TCFA 3FXQA 3FXUA 1FPDA 4Q0CA 4QBAA 1AWBA 2Y7RA 3RYDA 1CNQA 1K9ZA 5CBSA 4R6HA 3SDFA 3TTMA 1OQHA 1B4HA 2B3BA 1Y4CA 2ZZWA 4FEBA 1DTGA 2E0SA 1R9QA 3TFLA 4YMAA 4AS4A 1TFAA 1DTZA 2DXRA 4R74A 5I57B 2VPOA 1VDWA 2QMXA 1N7XA 3UA8A 1FPEA 3GZGA 4JXIA 2HZLA 1FTLA 1FTAA 3H6TA 3CSBA 2CMOA 4EUOA 1D9VA 3HHGA 3OENA 5CMMA 4NF6A 3MUQA 2XXRA 2XHDA 4NF5B 1NUWA 4EXLA 1VE4A 4MNIA 3S9NC 3I3VA 2OCUA 2IEEA 4UABA 3IORA 3V8XB 4PFBA 3D1RA 2Y5KA 1QULA 2ZNSA 3THIA 3UIFA 3ECRA 1SW4A 1FRPA 1H3DA 1LGBC 3JV9A 4QSCA 3IOTA 2X7PA 4NF4A 4QFLA 2ZZVA 3UGWA 1IEJA 3L6HA 1TFDA 1OIBA 2XXTA 2XX8A 4H8JA 5ISUA 1FJ9A 3KOTA 5L9OA 4THIA 3P7IA 4MAGA 5J16A 2A5SA 3H06B 4X1BA 1NV6A 4EQ9A 1SW5A 4MBPA 1AL3A 2Q74A 2QS3A 1RYOA 2HXRA 1PC3A 3LUZA 5AA2D 2H5YA 1UTBA 3IJXB 1OVTA 4I8CA 2MKZA 3LSXA 5IZ1A 2GHBA 4U1OA 5I59A 4ZS9A 3M3LA 3MZBA 3RT8A 3Q25A 5CMBA 3K1PA 1YZ0A 3K0VA 1IUDA 1MM6A 1NUZA 2CZKA 3MVXA 4GBWA 3IFCA 1N7WA
chains in the Genus database with same CATH topology
3TMGA 3KBRA 2RCBA 4ZEBA 4NE4A 2PBWA 5CMKA 1B46A 4KI0E 5TU0A 3RGYA 2G29A 3B7DA 3HHFA 3R7XA 4ZEDA 4H1XA 3TDJA 1Z7NE 1B3FA 1P1OA 2XX7A 4YKKA 1SYIA 1TWYA 3V5AA 3IOVA 1MH3A 3RT6B 4DLDA 4IO4A 2Z22A 5DEXA 3N26A 4F39A 2I6EA 2DVCA 3EN3A 1FQAA 4GLIA 4QHQA 2OJTA 1P1QA 4NWCA 1IXIA 3IB0A 3KN7A 4X9TA 3EQ1A 3KGCA 2DP8A 3A3CA 4DDDA 1BTJA 4GOTA 1AMFA 1N04A 3H6WA 3CFLA 1KWHA 4H65A 3UORA 4OHNA 3TEPA 1B5IA 5M2VA 3D4GA 1LCTA 3IAZA 3TAJA 3IB2A 3TQLA 4PETA 4X1DA 4G8HA 2VD2A 1GR2A 2DE2A 2V3TA 4I62A 3CSGA 3FV2A 1GTKA 1US4A 4BDOA 4LUBA 1JETA 1Y1MA 1Y1ZA 4YKPA 2Z8FA 3OD7A 4U23A 4ZEFA 4LVQA 2ABHA 4ESXA 3K6UA 3OEMA 5A5XB 1CE2A 1MQHA 1LSTA 3Q26A 3U8QA 1LBBA 1BP5A 2F97A 5I58B 4IO6A 2O7IA 4YKJA 3RUMA 2FA7A 3PUYE 4JSOA 5KDTB 3KZGA 1Y3QA 1OMPA 4OVJA 1BLFA 2DWHA 3LUYA 1DOTA 4P0IA 1XC1A 4F3BA 5BWJA 1MY2A 4N07A 3FVOA 3EHSA 3O97A 3MP6A 2O84X 4F1VA 2I3VA 1B3GA 3KN3A 3CG1A 2DXYA 4PP0A 3S9EA 4IO7A 3W9VA 1FTMA 3EF7A 1L5TA 3QIMA 3RLFE 4LQ2A 2ZYNA 4IO2A 2R71A 3OXNA 2HXWA 4PFUA 5AA2A 3RPWA 3PPRA 4EF2A 4GXAA 3D4CA 3S4UA 1R9LA 2DS9A 1LLSA 1N84A 4Z7EA 4QRZA 1MQJA 1NMUA 4NF8A 1JW5A 4DE8A 3O6HA 3PPOA 3DLNA 4GL0A 1VR5A 2Z8EA 1PBPA 4ZECA 5CBRA 2ZYKA 4I1DA 2FNCA 1URDA 3ZKLA 3G3FA 1XVXA 1B40A 1Q1KA 3T93B 4IGTA 3KFMA 2QMWA 2DQVA 3SEUA 1A8EA 4U2RA 4FEDA 1ZBMA 2QS1A 3F11A 4QF9A 1TT1A 3T96B 4GIZA 5AA4B 5CM6A 3C4MA 2NWJA 3ODBA 2ONRA 1P1NA 1A99A 4P11A 2UVGA 4XKRA 3EPEA 3HV1A 1DMBA 4H5GA 3K02A 3R26A 2XXPA 4EF1A 2F7CA 2RINA 1M5BA 3UP9A 5DYHA 2ZMBA 4XTCQ 1Q35A 1ZMGA 1DSNA 3G7WA 3VXCA 1QKBA 1CB6A 1QJMA 2YJPA 3MPLA 2O6AA 2A5TB 4DXUA 4P0GA 4F2OA 3CFXA 2OLBA 1NFTA 4YMBA 1IXHA 4RPOA 3MWBA 1H44A 2Y7IA 3E4RA 3N5LA 4WXJA 4EXKA 1TXFA 1FQEA 1OLAA 2XXHA 1XVYA 3CG3A 1P1UA 3EHTA 3DP4A 4XIGQ 4JDFA 3RY3A 5KCJB 2D3IA 4GXSB 4KFQA 1S9TA 3WAFA 2BJJX 3O6GA 4RPNA 1B5JA 2VHAA 1POTA 4ELQA 2V93A 4R6KA 4U22A 3LC8A 4NTLA 2I48A 4YB5A 5TPAA 3SERA 1LAFE 1GVCA 4G68A 3VVEA 3C36A 1SW2A 3T66A 5H8NA 2Q2AA 2OK2A 2HEUA 2RC7A 1Y3NA 2I0BA 2I4BA 3IK6B 4R75A 4BDQA 2XXUA 4HTGA 3MP8A 1Y4TA 3QK6A 1NNPA 4IO5A 4RA1A 4R73A 2UYFA 4KCDA 1PB8A 5AA3A 3VLUA 2HFBA 1RYXA 4R72A 2H25A 3VLVA 1R1NA 1H76A 3S9LC 3N6TA 3ZSFA 4MH5A 4Z0IA 2D21A 3OO6A 4H67A 4XKQA 4C1UA 3ZKKA 3SEVA 5HBCA 1B4ZA 5H8HB 1R6ZA 2X7QA 5TP9B 3C35A 3CVGA 1GGGA 4YICA 1JVXA 3TTRA 1EU8A 5DVFA 2ZXTA 1MQGA 4KD5A 5H8FA 3OO7A 2YPNA 4XKNA 1WODA 2E1SA 1AIVA 2X26A 2Q9TA 1VFEA 4GL8A 1IIWA 3BKIB 5B7DA 4RK2A 4OEUA 3FV1A 5L9MA 4BDMA 1UTHA 5I2KA 1AH5A 3OSRA 2PT2A 1J1NA 4DCXA 4F1UA 4GWOA 3FASA 1JW4A 1PB9A 1JEUA 4WEDA 2OZZA 2ZYOA 5DTBA 4DXCA 1O7TA 3HSTA 5I56B 3O29A 5CI5A 3SEYA 3IB1A 4DIGA 1AOVA 2QSXA 2O69A 1QW0A 4GQOA 1ZTYA 1B3LA 2DWAA 3JYRA 3MVYA 5CC2A 4G77A 2UVIA 1LB9A 4U4SA 2PX1A 1A40A 1B51A 5F1QA 4N6PA 4QFNA 5H8SA 5ICQA 3I5OA 3TQWA 2I0CA 3U1OA 1ZIUA 3PV0E 1VSOA 1WVJA 2F7AA 3E3KA 3RTFB 3U92A 3LSLA 5I2NA 4JWXA 4H0WA 1MPCA 5DVJA 1MXWA 1FW0A 3MJNA 3I6VA 1N3WA 3K01A 3IO4A 1UIUA 1P99A 3TODA 3MPKA 3U93A 4RNSA 3PMVA 3FZVA 1VFDA 4BDNA 4K3FA 4OENA 4X48A 4BLAA 1B7ZA 3FVGA 2UVJA 1A54A 5L8DA 4POWA 2Y7PA 2PT1A 1I69A 2F6GA 1NKXA 1FTKA 2Q2CA 1A7LA 1MXVA 1MXZA 2XXQA 4FJPA 4KPTA 4YB6A 1SDXA 4OEVA 4YZZA 2V25A 5ELVA 2I4CA 3T22A 4F31B 3IX1A 5EHSA 3FATA 4IO3A 3C34A 3DM0A 4KR5A 3T9HB 3MVZA 2F35A 3IL1B 1LFGA 3K1NA 5EHMA 1ZU0A 1DPPA 5H8QA 2DVZA 1EZOA 1LAHE 3CIJA 5FTIA 4BDLA 1JVYA 2GRVA 2HZKA 4OESA 1XT8A 1LAXA 4YAHX 1B52A 3GLBA 4O3CA 4PFWA 4OXVA 4KYDA 3HPIA 4FECA 4NF6B 3QXMA 4RK9A 3FJGA 3K1MA 2QJEA 4DCYA 2H4IA 3PUXE 3SESA 1NNFA 1MY0A 4PFTA 1N76A 4NWDA 3QUJA 1M5FA 3U72A 1T0KA 1IXGA 3A3UA 1D9YA 1M5DA 4NF4B 3JZJA 1GV8A 1NNTA 3N6UA 4E0XA 3TPAA 3TELA 3KG2A 3QUFA 3LR1A 2H98A 3OMBA 4YB7A 3MAMA 4LZ8A 3SKPA 3OO8A 3TTKA 1LBCA 4H8IA 4OERA 4ELOA 3T9UA 2REJA 1UTBB 3DP6A 1MXXA 4OFLA 3TYHA 1B32A 4KHZE 5I59B 3WAEA 3N94A 4F3PA 4KYEA 1JQFA 1NH8A 2O1LA 4ZEKA 3QYTA 4OFJA 2XXIA 1HSJA 1SI1A 3VDFA 4FE8A 3Q29A 1B1XA 4L17A 3K00A 3KOSA 4OWDA 5I57A 4F1YA 1QUJA 1URGA 2XXWA 1FCKA 3MC2A 4H6DA 1B7UA 1SYHA 4Q8RA 5FTHA 5IAIA 2O51A 4NF5A 3IOWA 4OFOA 2KLFA 3PPPA 2QS4A 4R9FA 3G3IA 3RTWB 2XXXA 3FXRA 4LATA 3M3FA 2Q89A 4ZE8A 2M8CA 3T9XB 2V3QA 4H5FA 1B3HA 2RC9A 4UACA 4QFKA 1SW1A 2V3UA 1YTVA 3IJOB 4WKMA 1BIYA 3VLWA 2HAUA 4G8MA 2RCAA 3PPNA 3ONMA 4NMYA 3BFTA 2UYEA 1QKAA 1US5A 2VOZA 3FVKA 4POXA 3UN6A 2AL4A 3C31A 4C0RA 2P0SA 2QL3A 2QS2A 4OTEA 3OSQA 1SBPA 4HCWA 1ZJLA 1P1WA 3PMWA 3V83A 1QUKA 1MY4A 3HCQA 2DSFA 5AA1A 3FGSA 2GHAA 2DOJA 3IO6A 4ISUA 2NXOA 3MP1A 3G3GA 3VFJA 3R6UA 4ELRA 3BFUA 2Y7KA 1MXUA 2PMSA 3FD3A 2F6PA 3FJMA 4F18A 3H6VA 4XXUA 1Y9UA 2XD2A 4AQ4A 1HSEA 1IXCA 2AL5A 3IR1A 3GXAA 3E13X 1O63A 3VVDA 1JEVA 3MZ9A 5ITOA 1N3XA 3V89B 3SETA 3CFZA 3T9VA 3K2DA 1LCFA 2O1MA 2O7UA 3ILTB 4ELPA 3W15C 2YLNA 3MQ9A 4F29A 5FHOA 3ILUB 2F78A 5AA2B 1ATGA 3G3HA 2XD3A 3O28A 1MM7A 3FUZA 2P2AA 1NH7A 4IGRA 4XKPA 1FTOA 3E9XA 2PYYA 4QSEA 2I58A 4NF8B 3EHUA 1I6BA 3RN8A 1H43A 3CI8A 2Q88A 2LAOA 2AIXA 2FYIA 2XXVA 1MRPA 2Z8DA 4YKIA 2G93A 1YCJA 2VP1A 3MZ1A 2H9BA 4G8NA 5A5XA 4FATA 3TTLA 2F7BA 2DE4A 1M5EA 4U21A 2NVUB 2NUVA 5I58A 5K2XA 1OLCA 1WDNA 3K6VA 3VE1B 2DYXA 3OO9A 2R9JA 2ALUA 4EDPA 5DT6A 3B6QA 3QAXA 2P1SA 1B05A 3PUZE 3K4UA 5KDTA 4OMBA 4M1VA 4ZEIA 2F36A 1H45A 3PUVE 4G4PA 4KCCA 1ZLQA 2OWSA 1PDAA 1B58A 3PUWE 4ZZAA 1B0LA 4O3AA 1LB8A 3PPQA 1SQYA 1B2HA 3KJTA 3OOAA 5HM4B 1EH3A 1N0TA 2RF1A 4F19A 3TUSA 1FQCA 3DP8A 2RC8A 4RXLA 4FORA 1SD3A 4IY6A 4O3BA 2ZYMA 5F7VA 4R6YA 3O66A 2GH9A 5BUUA 5L9SA 3Q27A 3FIRA 2GFEA 3GBAA 2F34A 3H3GA 1MY1A 4FIMA 4F22A 3O2AA 4JWYA 1MS7A 4HS7A 5JTYB 1MQIA 3H4ZA 4QSDA 4IB2A 4LZ7A 4PQJA 1MXYA 1PBQA 3PMXA 2D5WA 3DELB 4MLVA 4RYAA 4TQUQ 4R9GA 1PEBA 2ONKE 5TPAB 2QRYA 4G68B 1FQBA 1LFIA 5AA4A 2I3WA 3KN8A 5H8NB 4QFOA 4U4XA 2WKYA 3SEXA 1PB7A 4ZE9A 5EYFA 5IKBA 3PD9A 5K2YA 4EQ7A 2DWJA 1HSLA 3L6GA 4JWOA 4FAJA 5B70A 4N13A 1IQ7A 5AE4A 2A5TA 5KZTA 5FHNA 1FQDA 1LAGE 4WEPA 1YPNA 2B3FA 4Q5TA 1BKAA 1IZ1A 3CR9A 4IY5A 5DVIA 1B1HA 3GBBA 1NNKA 3KEIA 3OEKA 3ZS6A 1MPBA 4ZDMA 1QUIA 2UVHA 4LZ5A 4JSDA 1II5A 5KCJA 4OZ9A 4GVOA 5H8FB 3C33A 1FQFA 1Z7ME 3MVWA 2QPQA 4C1TA 4ND9A 4AB6A 4GRKA 3HO7A 1USYE 1IITA 4R2FA 1Y20A 1M5CA 1UQWA 2VD3A 2I49A 4GF8A 1DPEA 3VVFA 5J1DA 1UTHB 5I2KB 4ESWA 1F9BA 5I84A 2ANJA 3G3JA 4G68C 2CZLA 2XX9A 5FHMA 2ZNTA 3W9WA 2F5XA 4YU0A 2XXYA 4GD5A 3M3KA 2O68A 4E0WA 3VV5A 2B65A 3B6TA 3RQTA 4AB5A 3A09A 5JEIA 2ONSA 3CRBA 1MQDA 1D3KA 1JW1A 1I6AA 2PVUA 2HAVA 3H03A 1JNFA 3OELA 1SVXB 2HQ0A 2OBGA 3UK4A 3SEWA 4I9DA 4R2BA 2HCAA 2ESNA 5I2NB 1B6HA 4UA8A 3S9MC 1A8FA 4QFPA 4Q30B 4GFRA 3H7MA 5JK4A 1S7YA 1USYH 3FJ7A 1SI0A 1MG1A 3LSFB 4RY1A 4KYSA 4M4GA 2NOOA 5H8HA 5TP9A 4F3SA 2V84A 3O6IA 2AYSA 5LOMA 3KJ7A 2VGQA 1UIVA 4OQOA 1XHYA 4HW8A 2THIA 3RNNA 1URSA 3O9PA 3FVNA 3PU5A 4LA9A 3VXBA 1QVSA 1FTJA 3TCGA 5DEXB 2Y84A 1POY1 3Q28A 4KQPA 1MPDA 3HN0A 4LQ5A 1OVBA 1EZPA 4U1ZA 3K6WA 1MDQA 1LFHA 4OYVA 1YAEA 2Y7WA 3IOUA 4PFYA 1MH4A 3MBPA 1RKMA 3C9HA 4BDRA 4ONYA 3USDA 1S50A 2RKMA 5I56A 1B5HA 1MDP1 1ELJA 4PE5B 3M8UA 3H6UA 4G2ZA 5CMCA 4NEDA 3B6WA 3KSXA 4OETA 2UXAA 3PD8A 3TCHA 3K6XA 4JB7A 1NL5A 3TKDA 4HCYA 4LP2B 5H8QB 4TLMB 4EQBA 2R6GE 5ITPA 1B7HA 1OQGA 1O64A 3G3KA 3C32A 3BBRA 4F2QA 2REGA 4DXBA 4LONB 2F8DA 4RJZA 1XS5A 2Z23A 1ZKBA 5ICTA 1EZ9A 4ECFA 4MFIA 1B0HA 3LBSA 5HPQA 2DE3A 4MLQA 3LSWA 1XOCA 3QSLA 1I6QA 4DZ1A 4TLLB 3TTNA 5JTYA 3U94A 4F3GA 2IA4A 3PGFA 1B3EA 1D4NA 2H99A 2OWTA 2W7YA 3AXFA 4JBZA 4ZZEA 1ANFA 2Q8JA 3KSJA 5CRYA 4TOZA 3TZAA 2ZNUA 3S2VA 2DWIA 1B9JA 4MF3A 3MW0A 1A55A 1MY3A 1Y3PA 3TCFA 3FXQA 3FXUA 4Q0CA 2Y7RA 5CBSA 4R6HA 3SDFA 3TTMA 1OQHA 1B4HA 2B3BA 1Y4CA 4FEBA 1DTGA 2E0SA 1R9QA 3TFLA 4YMAA 1TFAA 1DTZA 2DXRA 4R74A 5I57B 2QMXA 1N7XA 3UA8A 3GZGA 4JXIA 2HZLA 1FTLA 3H6TA 3CSBA 2CMOA 4EUOA 1D9VA 3HHGA 3OENA 5CMMA 4NF6A 3MUQA 2XXRA 2XHDA 4NF5B 4EXLA 1VE4A 3S9NC 3I3VA 2OCUA 2IEEA 3IORA 3V8XB 1QULA 2ZNSA 3THIA 3UIFA 3ECRA 1SW4A 1H3DA 1LGBC 3JV9A 4QSCA 3IOTA 2X7PA 4NF4A 4QFLA 3UGWA 1IEJA 3L6HA 1TFDA 1OIBA 2XXTA 2XX8A 4H8JA 5ISUA 3KOTA 5L9OA 4THIA 3P7IA 2A5SA 3H06B 4X1BA 4EQ9A 1SW5A 4MBPA 1AL3A 2QS3A 1RYOA 1PC3A 5AA2D 2H5YA 1UTBA 3IJXB 1OVTA 4I8CA 3LSXA 2GHBA 4U1OA 5I59A 4ZS9A 3M3LA 3MZBA 3RT8A 3Q25A 5CMBA 3K1PA 3K0VA 1IUDA 1MM6A 3MVXA 1N7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TMG A;  3KBR A;  2RCB A;  4ZEB A;  4NE4 A;  2PBW A;  5CMK A;  1B46 A;  4KI0 E;  5TU0 A;  3RGY A;  2G29 A;  3B7D A;  3HHF A;  3R7X A;  4ZED A;  4H1X A;  3TDJ A;  1Z7N E;  1B3F A;  1P1O A;  2XX7 A;  4YKK A;  1SYI A;  1TWY A;  3V5A A;  3IOV A;  1MH3 A;  3RT6 B;  4DLD A;  4IO4 A;  2Z22 A;  5DEX A;  3N26 A;  4F39 A;  2I6E A;  2DVC A;  3EN3 A;  1FQA A;  4GLI A;  4QHQ A;  2OJT A;  1P1Q A;  4NWC A;  1IXI A;  3IB0 A;  3KN7 A;  4X9T A;  3EQ1 A;  3KGC A;  2DP8 A;  3A3C A;  4DDD A;  1BTJ A;  4GOT A;  1AMF A;  1N04 A;  3H6W A;  3CFL A;  1KWH A;  4H65 A;  3UOR A;  4OHN A;  3TEP A;  1B5I A;  5M2V A;  3D4G A;  1LCT A;  3IAZ A;  3TAJ A;  3IB2 A;  3TQL A;  4PET A;  4X1D A;  4G8H A;  2VD2 A;  1GR2 A;  2DE2 A;  2V3T A;  4I62 A;  3CSG A;  3FV2 A;  1GTK A;  1US4 A;  4BDO A;  4LUB A;  1JET A;  1Y1M A;  1Y1Z A;  4YKP A;  2Z8F A;  3OD7 A;  4U23 A;  4ZEF A;  4LVQ A;  2ABH A;  4ESX A;  3K6U A;  3OEM A;  5A5X B;  1CE2 A;  1MQH A;  1LST A;  3Q26 A;  3U8Q A;  1LBB A;  1BP5 A;  2F97 A;  5I58 B;  4IO6 A;  2O7I A;  4YKJ A;  3RUM A;  2FA7 A;  3PUY E;  4JSO A;  5KDT B;  3KZG A;  1Y3Q A;  1OMP A;  4OVJ A;  1BLF A;  2DWH A;  3LUY A;  1DOT A;  4P0I A;  1XC1 A;  4F3B A;  5BWJ A;  1MY2 A;  4N07 A;  3FVO A;  3EHS A;  3O97 A;  3MP6 A;  2O84 X;  4F1V A;  2I3V A;  1B3G A;  3KN3 A;  3CG1 A;  2DXY A;  4PP0 A;  3S9E A;  4IO7 A;  3W9V A;  1FTM A;  3EF7 A;  1L5T A;  3QIM A;  3RLF E;  4LQ2 A;  2ZYN A;  4IO2 A;  2R71 A;  3OXN A;  2HXW A;  4PFU A;  5AA2 A;  3RPW A;  3PPR A;  4EF2 A;  4GXA A;  3D4C A;  3S4U A;  1R9L A;  2DS9 A;  1LLS A;  1N84 A;  4Z7E A;  4QRZ A;  1MQJ A;  1NMU A;  4NF8 A;  1JW5 A;  4DE8 A;  3O6H A;  3PPO A;  3DLN A;  4GL0 A;  1VR5 A;  2Z8E A;  1PBP A;  4ZEC A;  5CBR A;  2ZYK A;  4I1D A;  2FNC A;  1URD A;  3ZKL A;  3G3F A;  1XVX A;  1B40 A;  1Q1K A;  3T93 B;  4IGT A;  3KFM A;  2QMW A;  2DQV A;  3SEU A;  1A8E A;  4U2R A;  4FED A;  1ZBM A;  2QS1 A;  3F11 A;  4QF9 A;  1TT1 A;  3T96 B;  4GIZ A;  5AA4 B;  5CM6 A;  3C4M A;  2NWJ A;  3ODB A;  2ONR A;  1P1N A;  1A99 A;  4P11 A;  2UVG A;  4XKR A;  3EPE A;  3HV1 A;  1DMB A;  4H5G A;  3K02 A;  3R26 A;  2XXP A;  4EF1 A;  2F7C A;  2RIN A;  1M5B A;  3UP9 A;  5DYH A;  2ZMB A;  4XTC Q;  1Q35 A;  1ZMG A;  1DSN A;  3G7W A;  3VXC A;  1QKB A;  1CB6 A;  1QJM A;  2YJP A;  3MPL A;  2O6A A;  2A5T B;  4DXU A;  4P0G A;  4F2O A;  3CFX A;  2OLB A;  1NFT A;  4YMB A;  1IXH A;  4RPO A;  3MWB A;  1H44 A;  2Y7I A;  3E4R A;  3N5L A;  4WXJ A;  4EXK A;  1TXF A;  1FQE A;  1OLA A;  2XXH A;  1XVY A;  3CG3 A;  1P1U A;  3EHT A;  3DP4 A;  4XIG Q;  4JDF A;  3RY3 A;  5KCJ B;  2D3I A;  4GXS B;  4KFQ A;  1S9T A;  3WAF A;  2BJJ X;  3O6G A;  4RPN A;  1B5J A;  2VHA A;  1POT A;  4ELQ A;  2V93 A;  4R6K A;  4U22 A;  3LC8 A;  4NTL A;  2I48 A;  4YB5 A;  5TPA A;  3SER A;  1LAF E;  1GVC A;  4G68 A;  3VVE A;  3C36 A;  1SW2 A;  3T66 A;  5H8N A;  2Q2A A;  2OK2 A;  2HEU A;  2RC7 A;  1Y3N A;  2I0B A;  2I4B A;  3IK6 B;  4R75 A;  4BDQ A;  2XXU A;  4HTG A;  3MP8 A;  1Y4T A;  3QK6 A;  1NNP A;  4IO5 A;  4RA1 A;  4R73 A;  2UYF A;  4KCD A;  1PB8 A;  5AA3 A;  3VLU A;  2HFB A;  1RYX A;  4R72 A;  2H25 A;  3VLV A;  1R1N A;  1H76 A;  3S9L C;  3N6T A;  3ZSF A;  4MH5 A;  4Z0I A;  2D21 A;  3OO6 A;  4H67 A;  4XKQ A;  4C1U A;  3ZKK A;  3SEV A;  5HBC A;  1B4Z A;  5H8H B;  1R6Z A;  2X7Q A;  5TP9 B;  3C35 A;  3CVG A;  1GGG A;  4YIC A;  1JVX A;  3TTR A;  1EU8 A;  5DVF A;  2ZXT A;  1MQG A;  4KD5 A;  5H8F A;  3OO7 A;  2YPN A;  4XKN A;  1WOD A;  2E1S A;  1AIV A;  2X26 A;  2Q9T A;  1VFE A;  4GL8 A;  1IIW A;  3BKI B;  5B7D A;  4RK2 A;  4OEU A;  3FV1 A;  5L9M A;  4BDM A;  1UTH A;  5I2K A;  1AH5 A;  3OSR A;  2PT2 A;  1J1N A;  4DCX A;  4F1U A;  4GWO A;  3FAS A;  1JW4 A;  1PB9 A;  1JEU A;  4WED A;  2OZZ A;  2ZYO A;  5DTB A;  4DXC A;  1O7T A;  3HST A;  5I56 B;  3O29 A;  5CI5 A;  3SEY A;  3IB1 A;  4DIG A;  1AOV A;  2QSX A;  2O69 A;  1QW0 A;  4GQO A;  1ZTY A;  1B3L A;  2DWA A;  3JYR A;  3MVY A;  5CC2 A;  4G77 A;  2UVI A;  1LB9 A;  4U4S A;  2PX1 A;  1A40 A;  1B51 A;  5F1Q A;  4N6P A;  4QFN A;  5H8S A;  5ICQ A;  3I5O A;  3TQW A;  2I0C A;  3U1O A;  1ZIU A;  3PV0 E;  1VSO A;  1WVJ A;  2F7A A;  3E3K A;  3RTF B;  3U92 A;  3LSL A;  5I2N A;  4JWX A;  4H0W A;  1MPC A;  5DVJ A;  1MXW A;  1FW0 A;  3MJN A;  3I6V A;  1N3W A;  3K01 A;  3IO4 A;  1UIU A;  1P99 A;  3TOD A;  3MPK A;  3U93 A;  4RNS A;  3PMV A;  3FZV A;  1VFD A;  4BDN A;  4K3F A;  4OEN A;  4X48 A;  4BLA A;  1B7Z A;  3FVG A;  2UVJ A;  1A54 A;  5L8D A;  4POW A;  2Y7P A;  2PT1 A;  1I69 A;  2F6G A;  1NKX A;  1FTK A;  2Q2C A;  1A7L A;  1MXV A;  1MXZ A;  2XXQ A;  4FJP A;  4KPT A;  4YB6 A;  1SDX A;  4OEV A;  4YZZ A;  2V25 A;  5ELV A;  2I4C A;  3T22 A;  4F31 B;  3IX1 A;  5EHS A;  3FAT A;  4IO3 A;  3C34 A;  3DM0 A;  4KR5 A;  3T9H B;  3MVZ A;  2F35 A;  3IL1 B;  1LFG A;  3K1N A;  5EHM A;  1ZU0 A;  1DPP A;  5H8Q A;  2DVZ A;  1EZO A;  1LAH E;  3CIJ A;  5FTI A;  4BDL A;  1JVY A;  2GRV A;  2HZK A;  4OES A;  1XT8 A;  1LAX A;  4YAH X;  1B52 A;  3GLB A;  4O3C A;  4PFW A;  4OXV A;  4KYD A;  3HPI A;  4FEC A;  4NF6 B;  3QXM A;  4RK9 A;  3FJG A;  3K1M A;  2QJE A;  4DCY A;  2H4I A;  3PUX E;  3SES A;  1NNF A;  1MY0 A;  4PFT A;  1N76 A;  4NWD A;  3QUJ A;  1M5F A;  3U72 A;  1T0K A;  1IXG A;  3A3U A;  1D9Y A;  1M5D A;  4NF4 B;  3JZJ A;  1GV8 A;  1NNT A;  3N6U A;  4E0X A;  3TPA A;  3TEL A;  3KG2 A;  3QUF A;  3LR1 A;  2H98 A;  3OMB A;  4YB7 A;  3MAM A;  4LZ8 A;  3SKP A;  3OO8 A;  3TTK A;  1LBC A;  4H8I A;  4OER A;  4ELO A;  3T9U A;  2REJ A;  1UTB B;  3DP6 A;  1MXX A;  4OFL A;  3TYH A;  1B32 A;  4KHZ E;  5I59 B;  3WAE A;  3N94 A;  4F3P A;  4KYE A;  1JQF A;  1NH8 A;  2O1L A;  4ZEK A;  3QYT A;  4OFJ A;  2XXI A;  1HSJ A;  1SI1 A;  3VDF A;  4FE8 A;  3Q29 A;  1B1X A;  4L17 A;  3K00 A;  3KOS A;  4OWD A;  5I57 A;  4F1Y A;  1QUJ A;  1URG A;  2XXW A;  1FCK A;  3MC2 A;  4H6D A;  1B7U A;  1SYH A;  4Q8R A;  5FTH A;  5IAI A;  2O51 A;  4NF5 A;  3IOW A;  4OFO A;  2KLF A;  3PPP A;  2QS4 A;  4R9F A;  3G3I A;  3RTW B;  2XXX A;  3FXR A;  4LAT A;  3M3F A;  2Q89 A;  4ZE8 A;  2M8C A;  3T9X B;  2V3Q A;  4H5F A;  1B3H A;  2RC9 A;  4UAC A;  4QFK A;  1SW1 A;  2V3U A;  1YTV A;  3IJO B;  4WKM A;  1BIY A;  3VLW A;  2HAU A;  4G8M A;  2RCA A;  3PPN A;  3ONM A;  4NMY A;  3BFT A;  2UYE A;  1QKA A;  1US5 A;  2VOZ A;  3FVK A;  4POX A;  3UN6 A;  2AL4 A;  3C31 A;  4C0R A;  2P0S A;  2QL3 A;  2QS2 A;  4OTE A;  3OSQ A;  1SBP A;  4HCW A;  1ZJL A;  1P1W A;  3PMW A;  3V83 A;  1QUK A;  1MY4 A;  3HCQ A;  2DSF A;  5AA1 A;  3FGS A;  2GHA A;  2DOJ A;  3IO6 A;  4ISU A;  2NXO A;  3MP1 A;  3G3G A;  3VFJ A;  3R6U A;  4ELR A;  3BFU A;  2Y7K A;  1MXU A;  2PMS A;  3FD3 A;  2F6P A;  3FJM A;  4F18 A;  3H6V A;  4XXU A;  1Y9U A;  2XD2 A;  4AQ4 A;  1HSE A;  1IXC A;  2AL5 A;  3IR1 A;  3GXA A;  3E13 X;  1O63 A;  3VVD A;  1JEV A;  3MZ9 A;  5ITO A;  1N3X A;  3V89 B;  3SET A;  3CFZ A;  3T9V A;  3K2D A;  1LCF A;  2O1M A;  2O7U A;  3ILT B;  4ELP A;  3W15 C;  2YLN A;  3MQ9 A;  4F29 A;  5FHO A;  3ILU B;  2F78 A;  5AA2 B;  1ATG A;  3G3H A;  2XD3 A;  3O28 A;  1MM7 A;  3FUZ A;  2P2A A;  1NH7 A;  4IGR A;  4XKP A;  1FTO A;  3E9X A;  2PYY A;  4QSE A;  2I58 A;  4NF8 B;  3EHU A;  1I6B A;  3RN8 A;  1H43 A;  3CI8 A;  2Q88 A;  2LAO A;  2AIX A;  2FYI A;  2XXV A;  1MRP A;  2Z8D A;  4YKI A;  2G93 A;  1YCJ A;  2VP1 A;  3MZ1 A;  2H9B A;  4G8N A;  5A5X A;  4FAT A;  3TTL A;  2F7B A;  2DE4 A;  1M5E A;  4U21 A;  2NVU B;  2NUV A;  5I58 A;  5K2X A;  1OLC A;  1WDN A;  3K6V A;  3VE1 B;  2DYX A;  3OO9 A;  2R9J A;  2ALU A;  4EDP A;  5DT6 A;  3B6Q A;  3QAX A;  2P1S A;  1B05 A;  3PUZ E;  3K4U A;  5KDT A;  4OMB A;  4M1V A;  4ZEI A;  2F36 A;  1H45 A;  3PUV E;  4G4P A;  4KCC A;  1ZLQ A;  2OWS A;  1PDA A;  1B58 A;  3PUW E;  4ZZA A;  1B0L A;  4O3A A;  1LB8 A;  3PPQ A;  1SQY A;  1B2H A;  3KJT A;  3OOA A;  5HM4 B;  1EH3 A;  1N0T A;  2RF1 A;  4F19 A;  3TUS A;  1FQC A;  3DP8 A;  2RC8 A;  4RXL A;  4FOR A;  1SD3 A;  4IY6 A;  4O3B A;  2ZYM A;  5F7V A;  4R6Y A;  3O66 A;  2GH9 A;  5BUU A;  5L9S A;  3Q27 A;  3FIR A;  2GFE A;  3GBA A;  2F34 A;  3H3G A;  1MY1 A;  4FIM A;  4F22 A;  3O2A A;  4JWY A;  1MS7 A;  4HS7 A;  5JTY B;  1MQI A;  3H4Z A;  4QSD A;  4IB2 A;  4LZ7 A;  4PQJ A;  1MXY A;  1PBQ A;  3PMX A;  2D5W A;  3DEL B;  4MLV A;  4RYA A;  4TQU Q;  4R9G A;  1PEB A;  2ONK E;  5TPA B;  2QRY A;  4G68 B;  1FQB A;  1LFI A;  5AA4 A;  2I3W A;  3KN8 A;  5H8N B;  4QFO A;  4U4X A;  2WKY A;  3SEX A;  1PB7 A;  4ZE9 A;  5EYF A;  5IKB A;  3PD9 A;  5K2Y A;  4EQ7 A;  2DWJ A;  1HSL A;  3L6G A;  4JWO A;  4FAJ A;  5B70 A;  4N13 A;  1IQ7 A;  5AE4 A;  2A5T A;  5KZT A;  5FHN A;  1FQD A;  1LAG E;  4WEP A;  1YPN A;  2B3F A;  4Q5T A;  1BKA A;  1IZ1 A;  3CR9 A;  4IY5 A;  5DVI A;  1B1H A;  3GBB A;  1NNK A;  3KEI A;  3OEK A;  3ZS6 A;  1MPB A;  4ZDM A;  1QUI A;  2UVH A;  4LZ5 A;  4JSD A;  1II5 A;  5KCJ A;  4OZ9 A;  4GVO A;  5H8F B;  3C33 A;  1FQF A;  1Z7M E;  3MVW A;  2QPQ A;  4C1T A;  4ND9 A;  4AB6 A;  4GRK A;  3HO7 A;  1USY E;  1IIT A;  4R2F A;  1Y20 A;  1M5C A;  1UQW A;  2VD3 A;  2I49 A;  4GF8 A;  1DPE A;  3VVF A;  5J1D A;  1UTH B;  5I2K B;  4ESW A;  1F9B A;  5I84 A;  2ANJ A;  3G3J A;  4G68 C;  2CZL A;  2XX9 A;  5FHM A;  2ZNT A;  3W9W A;  2F5X A;  4YU0 A;  2XXY A;  4GD5 A;  3M3K A;  2O68 A;  4E0W A;  3VV5 A;  2B65 A;  3B6T A;  3RQT A;  4AB5 A;  3A09 A;  5JEI A;  2ONS A;  3CRB A;  1MQD A;  1D3K A;  1JW1 A;  1I6A A;  2PVU A;  2HAV A;  3H03 A;  1JNF A;  3OEL A;  1SVX B;  2HQ0 A;  2OBG A;  3UK4 A;  3SEW A;  4I9D A;  4R2B A;  2HCA A;  2ESN A;  5I2N B;  1B6H A;  4UA8 A;  3S9M C;  1A8F A;  4QFP A;  4Q30 B;  4GFR A;  3H7M A;  5JK4 A;  1S7Y A;  1USY H;  3FJ7 A;  1SI0 A;  1MG1 A;  3LSF B;  4RY1 A;  4KYS A;  4M4G A;  2NOO A;  5H8H A;  5TP9 A;  4F3S A;  2V84 A;  3O6I A;  2AYS A;  5LOM A;  3KJ7 A;  2VGQ A;  1UIV A;  4OQO A;  1XHY A;  4HW8 A;  2THI A;  3RNN A;  1URS A;  3O9P A;  3FVN A;  3PU5 A;  4LA9 A;  3VXB A;  1QVS A;  1FTJ A;  3TCG A;  5DEX B;  2Y84 A;  1POY 1;  3Q28 A;  4KQP A;  1MPD A;  3HN0 A;  4LQ5 A;  1OVB A;  1EZP A;  4U1Z A;  3K6W A;  1MDQ A;  1LFH A;  4OYV A;  1YAE A;  2Y7W A;  3IOU A;  4PFY A;  1MH4 A;  3MBP A;  1RKM A;  3C9H A;  4BDR A;  4ONY A;  3USD A;  1S50 A;  2RKM A;  5I56 A;  1B5H A;  1MDP 1;  1ELJ A;  4PE5 B;  3M8U A;  3H6U A;  4G2Z A;  5CMC A;  4NED A;  3B6W A;  3KSX A;  4OET A;  2UXA A;  3PD8 A;  3TCH A;  3K6X A;  4JB7 A;  1NL5 A;  3TKD A;  4HCY A;  4LP2 B;  5H8Q B;  4TLM B;  4EQB A;  2R6G E;  5ITP A;  1B7H A;  1OQG A;  1O64 A;  3G3K A;  3C32 A;  3BBR A;  4F2Q A;  2REG A;  4DXB A;  4LON B;  2F8D A;  4RJZ A;  1XS5 A;  2Z23 A;  1ZKB A;  5ICT A;  1EZ9 A;  4ECF A;  4MFI A;  1B0H A;  3LBS A;  5HPQ A;  2DE3 A;  4MLQ A;  3LSW A;  1XOC A;  3QSL A;  1I6Q A;  4DZ1 A;  4TLL B;  3TTN A;  5JTY A;  3U94 A;  4F3G A;  2IA4 A;  3PGF A;  1B3E A;  1D4N A;  2H99 A;  2OWT A;  2W7Y A;  3AXF A;  4JBZ A;  4ZZE A;  1ANF A;  2Q8J A;  3KSJ A;  5CRY A;  4TOZ A;  3TZA A;  2ZNU A;  3S2V A;  2DWI A;  1B9J A;  4MF3 A;  3MW0 A;  1A55 A;  1MY3 A;  1Y3P A;  3TCF A;  3FXQ A;  3FXU A;  4Q0C A;  2Y7R A;  5CBS A;  4R6H A;  3SDF A;  3TTM A;  1OQH A;  1B4H A;  2B3B A;  1Y4C A;  4FEB A;  1DTG A;  2E0S A;  1R9Q A;  3TFL A;  4YMA A;  1TFA A;  1DTZ A;  2DXR A;  4R74 A;  5I57 B;  2QMX A;  1N7X A;  3UA8 A;  3GZG A;  4JXI A;  2HZL A;  1FTL A;  3H6T A;  3CSB A;  2CMO A;  4EUO A;  1D9V A;  3HHG A;  3OEN A;  5CMM A;  4NF6 A;  3MUQ A;  2XXR A;  2XHD A;  4NF5 B;  4EXL A;  1VE4 A;  3S9N C;  3I3V A;  2OCU A;  2IEE A;  3IOR A;  3V8X B;  1QUL A;  2ZNS A;  3THI A;  3UIF A;  3ECR A;  1SW4 A;  1H3D A;  1LGB C;  3JV9 A;  4QSC A;  3IOT A;  2X7P A;  4NF4 A;  4QFL A;  3UGW A;  1IEJ A;  3L6H A;  1TFD A;  1OIB A;  2XXT A;  2XX8 A;  4H8J A;  5ISU A;  3KOT A;  5L9O A;  4THI A;  3P7I A;  2A5S A;  3H06 B;  4X1B A;  4EQ9 A;  1SW5 A;  4MBP A;  1AL3 A;  2QS3 A;  1RYO A;  1PC3 A;  5AA2 D;  2H5Y A;  1UTB A;  3IJX B;  1OVT A;  4I8C A;  3LSX A;  2GHB A;  4U1O A;  5I59 A;  4ZS9 A;  3M3L A;  3MZB A;  3RT8 A;  3Q25 A;  5CMB A;  3K1P A;  3K0V A;  1IUD A;  1MM6 A;  3MVX A;  1N7W A; 
#chains in the Genus database with same CATH topology
 3TMG A;  3KBR A;  2XWO A;  2RCB A;  4AS5 A;  4ZEB A;  4NE4 A;  2PBW A;  1RDX A;  3MYU A;  5CMK A;  1B46 A;  4KI0 E;  5TU0 A;  3RGY A;  1NV3 A;  4FBP A;  2G29 A;  3B7D A;  3HHF A;  3R7X A;  4ZED A;  4H1X A;  3TDJ A;  2JJK A;  3B50 A;  1Z7N E;  1B3F A;  1P1O A;  4OVS A;  2XX7 A;  4YKK A;  1SYI A;  1TWY A;  4GBV A;  3V5A A;  3IOV A;  4H46 A;  1MH3 A;  3RT6 B;  4DLD A;  4IO4 A;  2Z22 A;  5DEX A;  3N26 A;  4F39 A;  2I6E A;  2DVC A;  3EN3 A;  1FQA A;  4GLI A;  4QHQ A;  2OJT A;  5DW8 A;  1P1Q A;  4NWC A;  1IXI A;  3IB0 A;  3KN7 A;  4X9T A;  2CEX A;  3EQ1 A;  3KGC A;  4XFE A;  2R8T A;  2DP8 A;  3A3C A;  4DDD A;  4NX1 A;  1BTJ A;  4GOT A;  1AMF A;  1N04 A;  3H6W A;  1FJ6 A;  3CFL A;  1KWH A;  4H65 A;  1FPI A;  3UOR A;  4OHN A;  3TEP A;  3A29 A;  1B5I A;  5M2V A;  3D4G A;  1LCT A;  4I40 A;  3BIG A;  3IAZ A;  3TAJ A;  3IB2 A;  3TQL A;  4PET A;  4X1D A;  4G8H A;  2VD2 A;  1GR2 A;  2DE2 A;  2V3T A;  4I62 A;  5EQ8 A;  3GYY A;  3CSG A;  3FV2 A;  1GTK A;  1US4 A;  4BDO A;  4LUB A;  1JET A;  1Y1M A;  1Y1Z A;  4YKP A;  2Z8F A;  3OD7 A;  4U23 A;  4ZEF A;  4LVQ A;  2ABH A;  4ESX A;  3K6U A;  3OEM A;  5A5X B;  1CE2 A;  4NAP A;  1NV1 A;  1XI6 A;  1MQH A;  1LST A;  3Q26 A;  3U8Q A;  4PF8 A;  1LBB A;  4P1L A;  4P3L A;  1BP5 A;  2F97 A;  5I58 B;  4IO6 A;  4GWX A;  2O7I A;  4YKJ A;  3RPL B;  4MIJ A;  3RUM A;  2FA7 A;  3PUY E;  4JSO A;  5KDT B;  3KZG A;  1Y3Q A;  1OMP A;  4OVJ A;  4X8R A;  1BLF A;  2DWH A;  5ET5 A;  3LUY A;  1DOT A;  4P0I A;  1XC1 A;  4F3B A;  5BWJ A;  1MY2 A;  4N07 A;  3FVO A;  3EHS A;  1FPJ A;  3O97 A;  3MP6 A;  2O84 X;  4P56 A;  3ISP A;  5LDZ A;  4F1V A;  2I3V A;  1B3G A;  3KN3 A;  3CG1 A;  2DXY A;  4PP0 A;  3S9E A;  4IO7 A;  3W9V A;  1FTM A;  3EF7 A;  4GWW A;  1L5T A;  3QIM A;  3RLF E;  2F3D A;  4LQ2 A;  2ZYN A;  4IO2 A;  2R71 A;  3OXN A;  2HXW A;  4PFU A;  5AA2 A;  2F3B A;  3RPW A;  3PPR A;  4EF2 A;  4GXA A;  3D4C A;  4PE3 A;  3S4U A;  4NGU A;  1R9L A;  2DS9 A;  1LLS A;  1N84 A;  4Z7E A;  4QRZ A;  1MQJ A;  1NMU A;  4PAF A;  4NF8 A;  1JW5 A;  4DE8 A;  3O6H A;  3PPO A;  3QMF A;  3DLN A;  4GL0 A;  1VR5 A;  3LV0 A;  2Z8E A;  1PBP A;  1IMF A;  4ZEC A;  1KA0 A;  5CBR A;  2ZYK A;  4OVT A;  4I1D A;  2FNC A;  4KXP A;  1URD A;  3ZKL A;  3G3F A;  1XVX A;  1B40 A;  1Q1K A;  3T93 B;  4IGT A;  3KFM A;  2QMW A;  2DQV A;  3SEU A;  1A8E A;  4U2R A;  4FED A;  1ZBM A;  2QS1 A;  3F11 A;  4QF9 A;  1TT1 A;  3T96 B;  1LBW A;  4GIZ A;  5AA4 B;  2XWK A;  5CM6 A;  3C4M A;  2NWJ A;  3ODB A;  2ONR A;  1P1N A;  1A99 A;  4P11 A;  2UVG A;  4XKR A;  3T0J A;  3EPE A;  3HV1 A;  1DMB A;  4H5G A;  3K02 A;  3R26 A;  2XXP A;  4EF1 A;  2F7C A;  2RIN A;  1M5B A;  3UP9 A;  5DYH A;  2ZMB A;  4XTC Q;  1Q35 A;  1ZMG A;  1DSN A;  3G7W A;  3VXC A;  1QKB A;  1CB6 A;  1QJM A;  2WEF A;  2YJP A;  3MPL A;  2O6A A;  2A5T B;  4DXU A;  4P0G A;  4F2O A;  3CFX A;  2OLB A;  1NFT A;  4YMB A;  1IXH A;  2WYP A;  4RPO A;  3MWB A;  1H44 A;  1LBV A;  2Y7I A;  3E4R A;  3N5L A;  4WXJ A;  4EXK A;  4N6K A;  1TXF A;  1FQE A;  1OLA A;  2XXH A;  1XVY A;  3CG3 A;  1P1U A;  3EHT A;  3DP4 A;  4PBQ A;  4XIG Q;  4JDF A;  3RY3 A;  5KCJ B;  2D3I A;  4O94 A;  4GXS B;  4KFQ A;  1S9T A;  3WAF A;  2BJJ X;  3O6G A;  4QXD A;  4RPN A;  1LBY A;  5EQA A;  1B5J A;  2VHA A;  1POT A;  4ELQ A;  2V93 A;  3BIH A;  4R6K A;  4U22 A;  4IR8 A;  3LC8 A;  4NTL A;  2I48 A;  4YB5 A;  2QFL A;  5TPA A;  3SER A;  1LAF E;  1GVC A;  4G68 A;  3VVE A;  2VT5 A;  3C36 A;  1SW2 A;  3T66 A;  5H8N A;  2Q2A A;  2WYK A;  2OK2 A;  2HEU A;  2RC7 A;  1Y3N A;  2I0B A;  2I4B A;  3IK6 B;  4R75 A;  4BDQ A;  2XXU A;  4HTG A;  3MP8 A;  1Y4T A;  3QK6 A;  1NNP A;  4IO5 A;  4RA1 A;  4R73 A;  2UYF A;  4KCD A;  1PB8 A;  4N8Y A;  5AA3 A;  3VLU A;  4O8M A;  2HFB A;  1NV5 A;  1RYX A;  4R72 A;  1FPF A;  2H25 A;  3VLV A;  1R1N A;  1H76 A;  3S9L C;  3N6T A;  3ZSF A;  4JVC A;  4MH5 A;  4Z0I A;  2D21 A;  3OO6 A;  4H67 A;  4XKQ A;  4C1U A;  3ZKK A;  3SEV A;  5HBC A;  1B4Z A;  5H8H B;  1R6Z A;  2X7Q A;  5TP9 B;  3C35 A;  1IME A;  3CVG A;  1GGG A;  3ROJ A;  4YIC A;  4OVQ A;  1JVX A;  3TTR A;  1EU8 A;  5DVF A;  2ZXT A;  1MQG A;  4KD5 A;  5H8F A;  1NI9 A;  3OO7 A;  2YPN A;  1YYZ A;  4XKN A;  1WOD A;  2E1S A;  2VPN A;  1AIV A;  2X26 A;  2Q9T A;  1VFE A;  4GL8 A;  1IIW A;  3BKI B;  5B7D A;  4RK2 A;  4OEU A;  3FV1 A;  5L9M A;  4BDM A;  2CZH A;  1UTH A;  5I2K A;  1AH5 A;  4MX6 A;  3OSR A;  2PT2 A;  1J1N A;  4DCX A;  4F1U A;  4GWO A;  3FAS A;  1JW4 A;  4H45 A;  1PB9 A;  5I3S A;  1JEU A;  3E79 A;  4WED A;  2OZZ A;  2ZYO A;  5DTB A;  1NV7 A;  1O7T A;  4DXC A;  3HST A;  5I56 B;  3O29 A;  5CI5 A;  3SEY A;  3IB1 A;  4N6D A;  4DIG A;  4XF5 A;  1AOV A;  2QSX A;  2O69 A;  1FPB A;  1QW0 A;  2CEY A;  4GQO A;  1ZTY A;  3U65 A;  1B3L A;  2DWA A;  3JYR A;  3MVY A;  5CC2 A;  4G77 A;  2UVI A;  1LB9 A;  4U4S A;  2PX1 A;  1A40 A;  1B51 A;  5F1Q A;  4N6P A;  4QFN A;  5H8S A;  5ICQ A;  5IZZ A;  3I5O A;  3TQW A;  4I3E A;  3KBZ A;  2I0C A;  3U1O A;  1ZIU A;  3PV0 E;  1IMD A;  1VSO A;  1LBZ A;  1WVJ A;  2F7A A;  3E3K A;  3RTF B;  3U92 A;  3LSL A;  4XEQ A;  5I2N A;  4JWX A;  4H0W A;  1MPC A;  2P3N A;  5DVJ A;  1MXW A;  1FW0 A;  3MJN A;  3I6V A;  1N3W A;  3K01 A;  3IO4 A;  1UIU A;  1P99 A;  3NOH A;  3TOD A;  3MPK A;  1FPK A;  4PAK A;  3U93 A;  4RNS A;  3PMV A;  3FZV A;  4PAI A;  1VFD A;  1D9Q A;  4BDN A;  4K3F A;  4OEN A;  4X48 A;  4BLA A;  4OA4 A;  2PFY A;  1B7Z A;  3FVG A;  2B4M A;  1LEV A;  4HE1 A;  2UVJ A;  1A54 A;  5L8D A;  4JVD A;  2Y7P A;  4POW A;  2PT1 A;  1I69 A;  2F6G A;  1NKX A;  1FTK A;  2Q2C A;  5EQ7 A;  1A7L A;  1MXV A;  1MXZ A;  1IMA A;  2XXQ A;  4FJP A;  4KPT A;  4YB6 A;  1SDX A;  4OEV A;  4YZZ A;  2PCR A;  2V25 A;  5ELV A;  2I4C A;  3T22 A;  4F31 B;  3HFU A;  3IX1 A;  5EHS A;  3FAT A;  4IO3 A;  3C34 A;  3DM0 A;  4KR5 A;  5A5L A;  2XA5 A;  3T9H B;  3MVZ A;  2F35 A;  3IL1 B;  1LFG A;  3K1N A;  5EHM A;  1ZU0 A;  1DPP A;  5H8Q A;  4OVR A;  2DVZ A;  1EZO A;  5IZ3 A;  1LAH E;  3CIJ A;  5FTI A;  4GX4 A;  4BDL A;  1JVY A;  2GRV A;  2HZK A;  4OES A;  1XT8 A;  1LAX A;  4YAH X;  1B52 A;  3GLB A;  4O3C A;  4PFW A;  3CHG A;  4OXV A;  4KYD A;  3HPI A;  4FEC A;  4NF6 B;  1DBZ A;  3QXM A;  4RK9 A;  3FJG A;  3K1M A;  2QJE A;  4DCY A;  2H4I A;  1EYJ A;  3PUX E;  2ZZX A;  3SES A;  1NNF A;  5I5P A;  1MY0 A;  4PFT A;  1N76 A;  1NV2 A;  3E78 A;  4NWD A;  3QUJ A;  1M5F A;  3U72 A;  1T0K A;  1IXG A;  4PF6 A;  3A3U A;  1D9Y A;  1M5D A;  4NF4 B;  3JZJ A;  1GV8 A;  1NNT A;  3N6U A;  4E0X A;  3TPA A;  3TEL A;  3KG2 A;  3QUF A;  3LR1 A;  2H98 A;  3OMB A;  4MEV A;  4YB7 A;  5LTC A;  3MAM A;  4LZ8 A;  3SKP A;  3OO8 A;  3TTK A;  1LBC A;  4GWU A;  4H8I A;  4OER A;  4ELO A;  3T9U A;  2REJ A;  1UTB B;  3DP6 A;  1MXX A;  4OFL A;  3TYH A;  1B32 A;  4KHZ E;  5I59 B;  1NUX A;  3WAE A;  3N94 A;  1FBC A;  4F3P A;  4MNC A;  4KYE A;  1JQF A;  1NH8 A;  2O1L A;  4ZEK A;  3QYT A;  4OFJ A;  2XXI A;  1HSJ A;  1SI1 A;  3VDF A;  4FE8 A;  3Q29 A;  1B1X A;  4L17 A;  3K00 A;  3KOS A;  4OWD A;  2OWZ A;  4MMP A;  5I57 A;  4F1Y A;  1KZ8 A;  1QUJ A;  1G0H A;  1URG A;  4MNP A;  2XXW A;  4DI3 D;  1FCK A;  3MC2 A;  1NV0 A;  4H6D A;  1B7U A;  1SYH A;  4O7I A;  5FTH A;  4Q8R A;  5IAI A;  2O51 A;  4NF5 A;  3IOW A;  4G61 A;  4OFO A;  2KLF A;  3PPP A;  4I3Y A;  2QS4 A;  4R9F A;  3G3I A;  3RTW B;  2XXX A;  3FXR A;  4LAT A;  3M3F A;  2Q89 A;  4ZE8 A;  2M8C A;  3T9X B;  2V3Q A;  4H5F A;  3FBP A;  4NF0 A;  2FBP A;  1B3H A;  4PGN A;  2RC9 A;  4UAC A;  4QFK A;  1SW1 A;  2V3U A;  1YTV A;  3IJO B;  4NN3 A;  4WKM A;  1BIY A;  3VLW A;  2HAU A;  1KA1 A;  4G8M A;  4P1E A;  4P8B A;  2RCA A;  2FIX A;  3PPN A;  3ONM A;  4NMY A;  3BFT A;  2UYE A;  2B4L A;  1QKA A;  4GWZ A;  1BK4 A;  1US5 A;  2VOZ A;  2L5V A;  3FVK A;  4POX A;  3UN6 A;  2AL4 A;  3C31 A;  4C0R A;  4GX6 A;  2XWI A;  4PC9 A;  2P0S A;  2QL3 A;  2QS2 A;  4OTE A;  3OSQ A;  1SBP A;  4HCW A;  1ZJL A;  4N4U A;  1P1W A;  3PMW A;  3V83 A;  1QUK A;  1MY4 A;  2XWV A;  3HCQ A;  2DSF A;  4N81 A;  5AA1 A;  3FGS A;  1FPL A;  2GHA A;  2DOJ A;  3IO6 A;  4ISU A;  2Y5L A;  2QVU A;  2NXO A;  3MP1 A;  4NG7 A;  3G3G A;  3VFJ A;  3R6U A;  1EYK A;  2WBB A;  4ELR A;  4N17 A;  3BFU A;  2Y7K A;  1MXU A;  2PMS A;  3FD3 A;  2F6P A;  3FJM A;  4F18 A;  3H6V A;  4XXU A;  1Y9U A;  2XD2 A;  4AQ4 A;  1HSE A;  1IXC A;  2AL5 A;  3IR1 A;  3GXA A;  3E13 X;  1O63 A;  3VVD A;  1JEV A;  1FBP A;  3MZ9 A;  5ITO A;  5F24 A;  1N3X A;  3V89 B;  3SET A;  3CFZ A;  3T9V A;  3K2D A;  1LCF A;  2O1M A;  2O7U A;  3ILT B;  4ELP A;  3W15 C;  2YLN A;  3MQ9 A;  4PBH A;  4F29 A;  5FHO A;  3ILU B;  1DCU A;  2F78 A;  5AA2 B;  4OVP A;  1ATG A;  1IMB A;  3G3H A;  2XD3 A;  3O28 A;  1MM7 A;  3FUZ A;  2P2A A;  1NH7 A;  4IGR A;  4XKP A;  1FTO A;  3E9X A;  2PYY A;  4QSE A;  2I58 A;  4NF8 B;  3EHU A;  1I6B A;  1RDY A;  3RN8 A;  1H43 A;  4LN5 A;  4HE0 A;  3CI8 A;  2Q88 A;  4N91 A;  4NHB A;  2LAO A;  2AIX A;  2FYI A;  4PCD A;  2XXV A;  3FXB A;  1MRP A;  2Z8D A;  4O7M A;  4YKI A;  2G93 A;  1DK4 A;  1YCJ A;  2VP1 A;  3MZ1 A;  2H9B A;  4G8N A;  5A5X A;  4FAT A;  3TTL A;  2GQ1 A;  2F7B A;  2FVZ A;  2DE4 A;  4MCO A;  1M5E A;  4U21 A;  2NVU B;  2NUV A;  4PDH A;  5I58 A;  5K2X A;  2KR0 A;  1OLC A;  1WDN A;  3K6V A;  3VE1 B;  2DYX A;  3OO9 A;  2QVR A;  3RPL A;  2R9J A;  2ALU A;  4EDP A;  5DT6 A;  3B6Q A;  3QAX A;  2P1S A;  1B05 A;  3PUZ E;  3K4U A;  5KDT A;  4OMB A;  4M1V A;  4GWY A;  4ZEI A;  2F36 A;  1H45 A;  3PUV E;  4G4P A;  4P9K A;  4KCC A;  1ZLQ A;  2OWS A;  1PDA A;  1B58 A;  3PUW E;  4ZZA A;  1B0L A;  4O3A A;  1LB8 A;  3PPQ A;  1SQY A;  1B2H A;  3KJT A;  3OOA A;  5HM4 B;  2HHM A;  1EH3 A;  1N0T A;  1SPI A;  2RF1 A;  4F19 A;  3TUS A;  1FQC A;  3DP8 A;  2RC8 A;  4RXL A;  4FOR A;  1SD3 A;  4IY6 A;  4O3B A;  2ZYM A;  5F7V A;  4R6Y A;  5IM2 A;  3O66 A;  2GH9 A;  5BUU A;  5L9S A;  3Q27 A;  3FIR A;  2GFE A;  3GBA A;  2KQZ A;  2F34 A;  3H3G A;  1MY1 A;  4FIM A;  4F22 A;  3O2A A;  4JWY A;  1MS7 A;  1FBG A;  4HS7 A;  5JTY B;  1MQI A;  3H4Z A;  4QSD A;  4IB2 A;  4HE2 A;  4LZ7 A;  5EQ9 A;  2WX9 A;  4PQJ A;  1MXY A;  1PBQ A;  2PFZ A;  4NQ8 A;  3PMX A;  2D5W A;  3DEL B;  4MLV A;  4RYA A;  2HPG A;  4TQU Q;  4R9G A;  1PEB A;  2ONK E;  5TPA B;  4X04 A;  3T1B A;  1K9Y A;  2QRY A;  4G68 B;  1FQB A;  1LFI A;  1FBD A;  5AA4 A;  2I3W A;  3KN8 A;  5H8N B;  1FBE A;  4QFO A;  4U4X A;  2WKY A;  3PTY A;  3SEX A;  4MJO A;  1PB7 A;  4ZE9 A;  5EYF A;  5IKB A;  2CZI A;  3PD9 A;  5K2Y A;  4EQ7 A;  1FBF A;  2DWJ A;  1HSL A;  3L6G A;  4JWO A;  4FAJ A;  5B70 A;  4N13 A;  1IQ7 A;  4PGP A;  5AE4 A;  5ET6 A;  2A5T A;  5KZT A;  5FHN A;  5ET8 A;  1FQD A;  1LAG E;  4WEP A;  1YPN A;  2B3F A;  4Q5T A;  2WBD A;  4GWS A;  1BKA A;  1JP4 A;  1IZ1 A;  3CR9 A;  4IY5 A;  5DVI A;  1B1H A;  3GBB A;  1NNK A;  3KEI A;  3OEK A;  3ZS6 A;  1MPB A;  4ZDM A;  1QUI A;  2UVH A;  4LZ5 A;  4JSD A;  5EYH A;  1II5 A;  5KCJ A;  4OZ9 A;  4GVO A;  5H8F B;  3C33 A;  1FQF A;  4GX3 A;  1Z7M E;  3IFA A;  3MVW A;  2QPQ A;  4C1T A;  4ND9 A;  4AB6 A;  2OX3 A;  4GRK A;  3HO7 A;  1USY E;  1IIT A;  4R2F A;  1Y20 A;  1M5C A;  4PFR A;  1UQW A;  2VD3 A;  2I49 A;  4GF8 A;  1DPE A;  1G0I A;  3VVF A;  5J1D A;  3KC0 A;  1UTH B;  5I2K B;  4ESW A;  4HXV A;  1F9B A;  2P3V A;  5I84 A;  2ANJ A;  3G3J A;  4G68 C;  2CZL A;  2XX9 A;  5FHM A;  5T3J A;  2ZNT A;  3W9W A;  2F5X A;  4YU0 A;  2XXY A;  4GD5 A;  3M3K A;  2O68 A;  4E0W A;  2FHY A;  3VV5 A;  2B65 A;  1LBX A;  3B6T A;  1FSA A;  4N15 A;  3RQT A;  4AB5 A;  3A09 A;  5JEI A;  2ONS A;  3CRB A;  1MQD A;  1D3K A;  1JW1 A;  1I6A A;  2PVU A;  2HAV A;  3H03 A;  1JNF A;  3OEL A;  2Q8M A;  1SVX B;  2HQ0 A;  2FIE A;  2OBG A;  3UK4 A;  1RDZ A;  3SEW A;  5I7I A;  4I9D A;  3SZP A;  4R2B A;  2HCA A;  2ESN A;  5I2N B;  1B6H A;  4UA8 A;  3S9M C;  1A8F A;  4QFP A;  4Q30 B;  2BJI A;  4GFR A;  3H7M A;  5JK4 A;  1S7Y A;  1USY H;  3FJ7 A;  1SI0 A;  1MG1 A;  3LSF B;  4RY1 A;  4KYS A;  1NUY A;  4M4G A;  2NOO A;  5H8H A;  5TP9 A;  4F3S A;  2V84 A;  3O6I A;  2AYS A;  5LOM A;  1FPG A;  3KJ7 A;  2VGQ A;  3MST A;  1UIV A;  4OQO A;  1XHY A;  4HW8 A;  2THI A;  3RNN A;  5IGA A;  1NV4 A;  1URS A;  3O9P A;  3FVN A;  3PU5 A;  4LA9 A;  3VXB A;  1QVS A;  1INP A;  1FTJ A;  3TCG A;  3B8B A;  5DEX B;  2Y84 A;  1POY 1;  3Q28 A;  4DI4 B;  4KQP A;  1MPD A;  3HN0 A;  4LQ5 A;  1OVB A;  1EZP A;  1YXI A;  4U1Z A;  3K6W A;  1MDQ A;  4PDD A;  1LFH A;  4OYV A;  1YAE A;  2Y7W A;  3IOU A;  4PFY A;  1MH4 A;  3MBP A;  1RKM A;  3C9H A;  4BDR A;  4ONY A;  3USD A;  2V4C A;  1S50 A;  2RKM A;  5I56 A;  1B5H A;  1MDP 1;  1ELJ A;  4PE5 B;  3M8U A;  3H6U A;  4G2Z A;  1Q9D A;  5CMC A;  4NED A;  5FBP A;  1IMC A;  3B6W A;  3KSX A;  4OET A;  5ESY A;  2UXA A;  4JVI A;  4P47 A;  3PD8 A;  3TCH A;  3K6X A;  4JB7 A;  1NL5 A;  3TKD A;  3KC1 A;  4HCY A;  4LP2 B;  5H8Q B;  4TLM B;  4EQB A;  5IZ3 B;  2R6G E;  1EYI A;  5ITP A;  2XXK A;  1B7H A;  1QGX A;  1OQG A;  1O64 A;  3G3K A;  1FBH A;  2QVV A;  3C32 A;  3BBR A;  4F2Q A;  2REG A;  4DXB A;  4LON B;  2F8D A;  4RJZ A;  1XS5 A;  2Z23 A;  1ZKB A;  5ICT A;  1EZ9 A;  5EYG A;  4ECF A;  4MFI A;  1B0H A;  3LBS A;  5HPQ A;  2DE3 A;  4MLQ A;  2DDK A;  3LSW A;  3EKI A;  4OAN A;  1XOC A;  3QSL A;  1I6Q A;  4DZ1 A;  4TLL B;  3TTN A;  4PTK A;  5JTY A;  3U94 A;  4MHF A;  4F3G A;  2IA4 A;  3PGF A;  1B3E A;  1D4N A;  2H99 A;  2OWT A;  2W7Y A;  3AXF A;  4JBZ A;  4ZZE A;  1ANF A;  5ET7 A;  4N8G A;  2Q8J A;  3KSJ A;  5CRY A;  4TOZ A;  3TZA A;  2ZNU A;  3S2V A;  2DWI A;  1B9J A;  4MF3 A;  3MW0 A;  1A55 A;  4PFI A;  1MY3 A;  1Y3P A;  3TCF A;  3FXQ A;  3FXU A;  1FPD A;  4Q0C A;  4QBA A;  1AWB A;  2Y7R A;  3RYD A;  1CNQ A;  1K9Z A;  5CBS A;  4R6H A;  3SDF A;  3TTM A;  1OQH A;  1B4H A;  2B3B A;  1Y4C A;  2ZZW A;  4FEB A;  1DTG A;  2E0S A;  1R9Q A;  3TFL A;  4YMA A;  4AS4 A;  1TFA A;  1DTZ A;  2DXR A;  4R74 A;  5I57 B;  2VPO A;  1VDW A;  2QMX A;  1N7X A;  3UA8 A;  1FPE A;  3GZG A;  4JXI A;  2HZL A;  1FTL A;  1FTA A;  3H6T A;  3CSB A;  2CMO A;  4EUO A;  1D9V A;  3HHG A;  3OEN A;  5CMM A;  4NF6 A;  3MUQ A;  2XXR A;  2XHD A;  4NF5 B;  1NUW A;  4EXL A;  1VE4 A;  4MNI A;  3S9N C;  3I3V A;  2OCU A;  2IEE A;  4UAB A;  3IOR A;  3V8X B;  4PFB A;  3D1R A;  2Y5K A;  1QUL A;  2ZNS A;  3THI A;  3UIF A;  3ECR A;  1SW4 A;  1FRP A;  1H3D A;  1LGB C;  3JV9 A;  4QSC A;  3IOT A;  2X7P A;  4NF4 A;  4QFL A;  2ZZV A;  3UGW A;  1IEJ A;  3L6H A;  1TFD A;  1OIB A;  2XXT A;  2XX8 A;  4H8J A;  5ISU A;  1FJ9 A;  3KOT A;  5L9O A;  4THI A;  3P7I A;  4MAG A;  5J16 A;  2A5S A;  3H06 B;  4X1B A;  1NV6 A;  4EQ9 A;  1SW5 A;  4MBP A;  1AL3 A;  2Q74 A;  2QS3 A;  1RYO A;  2HXR A;  1PC3 A;  3LUZ A;  5AA2 D;  2H5Y A;  1UTB A;  3IJX B;  1OVT A;  4I8C A;  2MKZ A;  3LSX A;  5IZ1 A;  2GHB A;  4U1O A;  5I59 A;  4ZS9 A;  3M3L A;  3MZB A;  3RT8 A;  3Q25 A;  5CMB A;  3K1P A;  1YZ0 A;  3K0V A;  1IUD A;  1MM6 A;  1NUZ A;  2CZK A;  3MVX A;  4GBW A;  3IFC A;  1N7W A; 
#chains in the Genus database with same CATH homology
 3TMG A;  3KBR A;  2RCB A;  4ZEB A;  4NE4 A;  2PBW A;  5CMK A;  1B46 A;  4KI0 E;  5TU0 A;  3RGY A;  2G29 A;  3B7D A;  3HHF A;  3R7X A;  4ZED A;  4H1X A;  3TDJ A;  1Z7N E;  1B3F A;  1P1O A;  2XX7 A;  4YKK A;  1SYI A;  1TWY A;  3V5A A;  3IOV A;  1MH3 A;  3RT6 B;  4DLD A;  4IO4 A;  2Z22 A;  5DEX A;  3N26 A;  4F39 A;  2I6E A;  2DVC A;  3EN3 A;  1FQA A;  4GLI A;  4QHQ A;  2OJT A;  1P1Q A;  4NWC A;  1IXI A;  3IB0 A;  3KN7 A;  4X9T A;  3EQ1 A;  3KGC A;  2DP8 A;  3A3C A;  4DDD A;  1BTJ A;  4GOT A;  1AMF A;  1N04 A;  3H6W A;  3CFL A;  1KWH A;  4H65 A;  3UOR A;  4OHN A;  3TEP A;  1B5I A;  5M2V A;  3D4G A;  1LCT A;  3IAZ A;  3TAJ A;  3IB2 A;  3TQL A;  4PET A;  4X1D A;  4G8H A;  2VD2 A;  1GR2 A;  2DE2 A;  2V3T A;  4I62 A;  3CSG A;  3FV2 A;  1GTK A;  1US4 A;  4BDO A;  4LUB A;  1JET A;  1Y1M A;  1Y1Z A;  4YKP A;  2Z8F A;  3OD7 A;  4U23 A;  4ZEF A;  4LVQ A;  2ABH A;  4ESX A;  3K6U A;  3OEM A;  5A5X B;  1CE2 A;  1MQH A;  1LST A;  3Q26 A;  3U8Q A;  1LBB A;  1BP5 A;  2F97 A;  5I58 B;  4IO6 A;  2O7I A;  4YKJ A;  3RUM A;  2FA7 A;  3PUY E;  4JSO A;  5KDT B;  3KZG A;  1Y3Q A;  1OMP A;  4OVJ A;  1BLF A;  2DWH A;  3LUY A;  1DOT A;  4P0I A;  1XC1 A;  4F3B A;  5BWJ A;  1MY2 A;  4N07 A;  3FVO A;  3EHS A;  3O97 A;  3MP6 A;  2O84 X;  4F1V A;  2I3V A;  1B3G A;  3KN3 A;  3CG1 A;  2DXY A;  4PP0 A;  3S9E A;  4IO7 A;  3W9V A;  1FTM A;  3EF7 A;  1L5T A;  3QIM A;  3RLF E;  4LQ2 A;  2ZYN A;  4IO2 A;  2R71 A;  3OXN A;  2HXW A;  4PFU A;  5AA2 A;  3RPW A;  3PPR A;  4EF2 A;  4GXA A;  3D4C A;  3S4U A;  1R9L A;  2DS9 A;  1LLS A;  1N84 A;  4Z7E A;  4QRZ A;  1MQJ A;  1NMU A;  4NF8 A;  1JW5 A;  4DE8 A;  3O6H A;  3PPO A;  3DLN A;  4GL0 A;  1VR5 A;  2Z8E A;  1PBP A;  4ZEC A;  5CBR A;  2ZYK A;  4I1D A;  2FNC A;  1URD A;  3ZKL A;  3G3F A;  1XVX A;  1B40 A;  1Q1K A;  3T93 B;  4IGT A;  3KFM A;  2QMW A;  2DQV A;  3SEU A;  1A8E A;  4U2R A;  4FED A;  1ZBM A;  2QS1 A;  3F11 A;  4QF9 A;  1TT1 A;  3T96 B;  4GIZ A;  5AA4 B;  5CM6 A;  3C4M A;  2NWJ A;  3ODB A;  2ONR A;  1P1N A;  1A99 A;  4P11 A;  2UVG A;  4XKR A;  3EPE A;  3HV1 A;  1DMB A;  4H5G A;  3K02 A;  3R26 A;  2XXP A;  4EF1 A;  2F7C A;  2RIN A;  1M5B A;  3UP9 A;  5DYH A;  2ZMB A;  4XTC Q;  1Q35 A;  1ZMG A;  1DSN A;  3G7W A;  3VXC A;  1QKB A;  1CB6 A;  1QJM A;  2YJP A;  3MPL A;  2O6A A;  2A5T B;  4DXU A;  4P0G A;  4F2O A;  3CFX A;  2OLB A;  1NFT A;  4YMB A;  1IXH A;  4RPO A;  3MWB A;  1H44 A;  2Y7I A;  3E4R A;  3N5L A;  4WXJ A;  4EXK A;  1TXF A;  1FQE A;  1OLA A;  2XXH A;  1XVY A;  3CG3 A;  1P1U A;  3EHT A;  3DP4 A;  4XIG Q;  4JDF A;  3RY3 A;  5KCJ B;  2D3I A;  4GXS B;  4KFQ A;  1S9T A;  3WAF A;  2BJJ X;  3O6G A;  4RPN A;  1B5J A;  2VHA A;  1POT A;  4ELQ A;  2V93 A;  4R6K A;  4U22 A;  3LC8 A;  4NTL A;  2I48 A;  4YB5 A;  5TPA A;  3SER A;  1LAF E;  1GVC A;  4G68 A;  3VVE A;  3C36 A;  1SW2 A;  3T66 A;  5H8N A;  2Q2A A;  2OK2 A;  2HEU A;  2RC7 A;  1Y3N A;  2I0B A;  2I4B A;  3IK6 B;  4R75 A;  4BDQ A;  2XXU A;  4HTG A;  3MP8 A;  1Y4T A;  3QK6 A;  1NNP A;  4IO5 A;  4RA1 A;  4R73 A;  2UYF A;  4KCD A;  1PB8 A;  5AA3 A;  3VLU A;  2HFB A;  1RYX A;  4R72 A;  2H25 A;  3VLV A;  1R1N A;  1H76 A;  3S9L C;  3N6T A;  3ZSF A;  4MH5 A;  4Z0I A;  2D21 A;  3OO6 A;  4H67 A;  4XKQ A;  4C1U A;  3ZKK A;  3SEV A;  5HBC A;  1B4Z A;  5H8H B;  1R6Z A;  2X7Q A;  5TP9 B;  3C35 A;  3CVG A;  1GGG A;  4YIC A;  1JVX A;  3TTR A;  1EU8 A;  5DVF A;  2ZXT A;  1MQG A;  4KD5 A;  5H8F A;  3OO7 A;  2YPN A;  4XKN A;  1WOD A;  2E1S A;  1AIV A;  2X26 A;  2Q9T A;  1VFE A;  4GL8 A;  1IIW A;  3BKI B;  5B7D A;  4RK2 A;  4OEU A;  3FV1 A;  5L9M A;  4BDM A;  1UTH A;  5I2K A;  1AH5 A;  3OSR A;  2PT2 A;  1J1N A;  4DCX A;  4F1U A;  4GWO A;  3FAS A;  1JW4 A;  1PB9 A;  1JEU A;  4WED A;  2OZZ A;  2ZYO A;  5DTB A;  4DXC A;  1O7T A;  3HST A;  5I56 B;  3O29 A;  5CI5 A;  3SEY A;  3IB1 A;  4DIG A;  1AOV A;  2QSX A;  2O69 A;  1QW0 A;  4GQO A;  1ZTY A;  1B3L A;  2DWA A;  3JYR A;  3MVY A;  5CC2 A;  4G77 A;  2UVI A;  1LB9 A;  4U4S A;  2PX1 A;  1A40 A;  1B51 A;  5F1Q A;  4N6P A;  4QFN A;  5H8S A;  5ICQ A;  3I5O A;  3TQW A;  2I0C A;  3U1O A;  1ZIU A;  3PV0 E;  1VSO A;  1WVJ A;  2F7A A;  3E3K A;  3RTF B;  3U92 A;  3LSL A;  5I2N A;  4JWX A;  4H0W A;  1MPC A;  5DVJ A;  1MXW A;  1FW0 A;  3MJN A;  3I6V A;  1N3W A;  3K01 A;  3IO4 A;  1UIU A;  1P99 A;  3TOD A;  3MPK A;  3U93 A;  4RNS A;  3PMV A;  3FZV A;  1VFD A;  4BDN A;  4K3F A;  4OEN A;  4X48 A;  4BLA A;  1B7Z A;  3FVG A;  2UVJ A;  1A54 A;  5L8D A;  4POW A;  2Y7P A;  2PT1 A;  1I69 A;  2F6G A;  1NKX A;  1FTK A;  2Q2C A;  1A7L A;  1MXV A;  1MXZ A;  2XXQ A;  4FJP A;  4KPT A;  4YB6 A;  1SDX A;  4OEV A;  4YZZ A;  2V25 A;  5ELV A;  2I4C A;  3T22 A;  4F31 B;  3IX1 A;  5EHS A;  3FAT A;  4IO3 A;  3C34 A;  3DM0 A;  4KR5 A;  3T9H B;  3MVZ A;  2F35 A;  3IL1 B;  1LFG A;  3K1N A;  5EHM A;  1ZU0 A;  1DPP A;  5H8Q A;  2DVZ A;  1EZO A;  1LAH E;  3CIJ A;  5FTI A;  4BDL A;  1JVY A;  2GRV A;  2HZK A;  4OES A;  1XT8 A;  1LAX A;  4YAH X;  1B52 A;  3GLB A;  4O3C A;  4PFW A;  4OXV A;  4KYD A;  3HPI A;  4FEC A;  4NF6 B;  3QXM A;  4RK9 A;  3FJG A;  3K1M A;  2QJE A;  4DCY A;  2H4I A;  3PUX E;  3SES A;  1NNF A;  1MY0 A;  4PFT A;  1N76 A;  4NWD A;  3QUJ A;  1M5F A;  3U72 A;  1T0K A;  1IXG A;  3A3U A;  1D9Y A;  1M5D A;  4NF4 B;  3JZJ A;  1GV8 A;  1NNT A;  3N6U A;  4E0X A;  3TPA A;  3TEL A;  3KG2 A;  3QUF A;  3LR1 A;  2H98 A;  3OMB A;  4YB7 A;  3MAM A;  4LZ8 A;  3SKP A;  3OO8 A;  3TTK A;  1LBC A;  4H8I A;  4OER A;  4ELO A;  3T9U A;  2REJ A;  1UTB B;  3DP6 A;  1MXX A;  4OFL A;  3TYH A;  1B32 A;  4KHZ E;  5I59 B;  3WAE A;  3N94 A;  4F3P A;  4KYE A;  1JQF A;  1NH8 A;  2O1L A;  4ZEK A;  3QYT A;  4OFJ A;  2XXI A;  1HSJ A;  1SI1 A;  3VDF A;  4FE8 A;  3Q29 A;  1B1X A;  4L17 A;  3K00 A;  3KOS A;  4OWD A;  5I57 A;  4F1Y A;  1QUJ A;  1URG A;  2XXW A;  1FCK A;  3MC2 A;  4H6D A;  1B7U A;  1SYH A;  4Q8R A;  5FTH A;  5IAI A;  2O51 A;  4NF5 A;  3IOW A;  4OFO A;  2KLF A;  3PPP A;  2QS4 A;  4R9F A;  3G3I A;  3RTW B;  2XXX A;  3FXR A;  4LAT A;  3M3F A;  2Q89 A;  4ZE8 A;  2M8C A;  3T9X B;  2V3Q A;  4H5F A;  1B3H A;  2RC9 A;  4UAC A;  4QFK A;  1SW1 A;  2V3U A;  1YTV A;  3IJO B;  4WKM A;  1BIY A;  3VLW A;  2HAU A;  4G8M A;  2RCA A;  3PPN A;  3ONM A;  4NMY A;  3BFT A;  2UYE A;  1QKA A;  1US5 A;  2VOZ A;  3FVK A;  4POX A;  3UN6 A;  2AL4 A;  3C31 A;  4C0R A;  2P0S A;  2QL3 A;  2QS2 A;  4OTE A;  3OSQ A;  1SBP A;  4HCW A;  1ZJL A;  1P1W A;  3PMW A;  3V83 A;  1QUK A;  1MY4 A;  3HCQ A;  2DSF A;  5AA1 A;  3FGS A;  2GHA A;  2DOJ A;  3IO6 A;  4ISU A;  2NXO A;  3MP1 A;  3G3G A;  3VFJ A;  3R6U A;  4ELR A;  3BFU A;  2Y7K A;  1MXU A;  2PMS A;  3FD3 A;  2F6P A;  3FJM A;  4F18 A;  3H6V A;  4XXU A;  1Y9U A;  2XD2 A;  4AQ4 A;  1HSE A;  1IXC A;  2AL5 A;  3IR1 A;  3GXA A;  3E13 X;  1O63 A;  3VVD A;  1JEV A;  3MZ9 A;  5ITO A;  1N3X A;  3V89 B;  3SET A;  3CFZ A;  3T9V A;  3K2D A;  1LCF A;  2O1M A;  2O7U A;  3ILT B;  4ELP A;  3W15 C;  2YLN A;  3MQ9 A;  4F29 A;  5FHO A;  3ILU B;  2F78 A;  5AA2 B;  1ATG A;  3G3H A;  2XD3 A;  3O28 A;  1MM7 A;  3FUZ A;  2P2A A;  1NH7 A;  4IGR A;  4XKP A;  1FTO A;  3E9X A;  2PYY A;  4QSE A;  2I58 A;  4NF8 B;  3EHU A;  1I6B A;  3RN8 A;  1H43 A;  3CI8 A;  2Q88 A;  2LAO A;  2AIX A;  2FYI A;  2XXV A;  1MRP A;  2Z8D A;  4YKI A;  2G93 A;  1YCJ A;  2VP1 A;  3MZ1 A;  2H9B A;  4G8N A;  5A5X A;  4FAT A;  3TTL A;  2F7B A;  2DE4 A;  1M5E A;  4U21 A;  2NVU B;  2NUV A;  5I58 A;  5K2X A;  1OLC A;  1WDN A;  3K6V A;  3VE1 B;  2DYX A;  3OO9 A;  2R9J A;  2ALU A;  4EDP A;  5DT6 A;  3B6Q A;  3QAX A;  2P1S A;  1B05 A;  3PUZ E;  3K4U A;  5KDT A;  4OMB A;  4M1V A;  4ZEI A;  2F36 A;  1H45 A;  3PUV E;  4G4P A;  4KCC A;  1ZLQ A;  2OWS A;  1PDA A;  1B58 A;  3PUW E;  4ZZA A;  1B0L A;  4O3A A;  1LB8 A;  3PPQ A;  1SQY A;  1B2H A;  3KJT A;  3OOA A;  5HM4 B;  1EH3 A;  1N0T A;  2RF1 A;  4F19 A;  3TUS A;  1FQC A;  3DP8 A;  2RC8 A;  4RXL A;  4FOR A;  1SD3 A;  4IY6 A;  4O3B A;  2ZYM A;  5F7V A;  4R6Y A;  3O66 A;  2GH9 A;  5BUU A;  5L9S A;  3Q27 A;  3FIR A;  2GFE A;  3GBA A;  2F34 A;  3H3G A;  1MY1 A;  4FIM A;  4F22 A;  3O2A A;  4JWY A;  1MS7 A;  4HS7 A;  5JTY B;  1MQI A;  3H4Z A;  4QSD A;  4IB2 A;  4LZ7 A;  4PQJ A;  1MXY A;  1PBQ A;  3PMX A;  2D5W A;  3DEL B;  4MLV A;  4RYA A;  4TQU Q;  4R9G A;  1PEB A;  2ONK E;  5TPA B;  2QRY A;  4G68 B;  1FQB A;  1LFI A;  5AA4 A;  2I3W A;  3KN8 A;  5H8N B;  4QFO A;  4U4X A;  2WKY A;  3SEX A;  1PB7 A;  4ZE9 A;  5EYF A;  5IKB A;  3PD9 A;  5K2Y A;  4EQ7 A;  2DWJ A;  1HSL A;  3L6G A;  4JWO A;  4FAJ A;  5B70 A;  4N13 A;  1IQ7 A;  5AE4 A;  2A5T A;  5KZT A;  5FHN A;  1FQD A;  1LAG E;  4WEP A;  1YPN A;  2B3F A;  4Q5T A;  1BKA A;  1IZ1 A;  3CR9 A;  4IY5 A;  5DVI A;  1B1H A;  3GBB A;  1NNK A;  3KEI A;  3OEK A;  3ZS6 A;  1MPB A;  4ZDM A;  1QUI A;  2UVH A;  4LZ5 A;  4JSD A;  1II5 A;  5KCJ A;  4OZ9 A;  4GVO A;  5H8F B;  3C33 A;  1FQF A;  1Z7M E;  3MVW A;  2QPQ A;  4C1T A;  4ND9 A;  4AB6 A;  4GRK A;  3HO7 A;  1USY E;  1IIT A;  4R2F A;  1Y20 A;  1M5C A;  1UQW A;  2VD3 A;  2I49 A;  4GF8 A;  1DPE A;  3VVF A;  5J1D A;  1UTH B;  5I2K B;  4ESW A;  1F9B A;  5I84 A;  2ANJ A;  3G3J A;  4G68 C;  2CZL A;  2XX9 A;  5FHM A;  2ZNT A;  3W9W A;  2F5X A;  4YU0 A;  2XXY A;  4GD5 A;  3M3K A;  2O68 A;  4E0W A;  3VV5 A;  2B65 A;  3B6T A;  3RQT A;  4AB5 A;  3A09 A;  5JEI A;  2ONS A;  3CRB A;  1MQD A;  1D3K A;  1JW1 A;  1I6A A;  2PVU A;  2HAV A;  3H03 A;  1JNF A;  3OEL A;  1SVX B;  2HQ0 A;  2OBG A;  3UK4 A;  3SEW A;  4I9D A;  4R2B A;  2HCA A;  2ESN A;  5I2N B;  1B6H A;  4UA8 A;  3S9M C;  1A8F A;  4QFP A;  4Q30 B;  4GFR A;  3H7M A;  5JK4 A;  1S7Y A;  1USY H;  3FJ7 A;  1SI0 A;  1MG1 A;  3LSF B;  4RY1 A;  4KYS A;  4M4G A;  2NOO A;  5H8H A;  5TP9 A;  4F3S A;  2V84 A;  3O6I A;  2AYS A;  5LOM A;  3KJ7 A;  2VGQ A;  1UIV A;  4OQO A;  1XHY A;  4HW8 A;  2THI A;  3RNN A;  1URS A;  3O9P A;  3FVN A;  3PU5 A;  4LA9 A;  3VXB A;  1QVS A;  1FTJ A;  3TCG A;  5DEX B;  2Y84 A;  1POY 1;  3Q28 A;  4KQP A;  1MPD A;  3HN0 A;  4LQ5 A;  1OVB A;  1EZP A;  4U1Z A;  3K6W A;  1MDQ A;  1LFH A;  4OYV A;  1YAE A;  2Y7W A;  3IOU A;  4PFY A;  1MH4 A;  3MBP A;  1RKM A;  3C9H A;  4BDR A;  4ONY A;  3USD A;  1S50 A;  2RKM A;  5I56 A;  1B5H A;  1MDP 1;  1ELJ A;  4PE5 B;  3M8U A;  3H6U A;  4G2Z A;  5CMC A;  4NED A;  3B6W A;  3KSX A;  4OET A;  2UXA A;  3PD8 A;  3TCH A;  3K6X A;  4JB7 A;  1NL5 A;  3TKD A;  4HCY A;  4LP2 B;  5H8Q B;  4TLM B;  4EQB A;  2R6G E;  5ITP A;  1B7H A;  1OQG A;  1O64 A;  3G3K A;  3C32 A;  3BBR A;  4F2Q A;  2REG A;  4DXB A;  4LON B;  2F8D A;  4RJZ A;  1XS5 A;  2Z23 A;  1ZKB A;  5ICT A;  1EZ9 A;  4ECF A;  4MFI A;  1B0H A;  3LBS A;  5HPQ A;  2DE3 A;  4MLQ A;  3LSW A;  1XOC A;  3QSL A;  1I6Q A;  4DZ1 A;  4TLL B;  3TTN A;  5JTY A;  3U94 A;  4F3G A;  2IA4 A;  3PGF A;  1B3E A;  1D4N A;  2H99 A;  2OWT A;  2W7Y A;  3AXF A;  4JBZ A;  4ZZE A;  1ANF A;  2Q8J A;  3KSJ A;  5CRY A;  4TOZ A;  3TZA A;  2ZNU A;  3S2V A;  2DWI A;  1B9J A;  4MF3 A;  3MW0 A;  1A55 A;  1MY3 A;  1Y3P A;  3TCF A;  3FXQ A;  3FXU A;  4Q0C A;  2Y7R A;  5CBS A;  4R6H A;  3SDF A;  3TTM A;  1OQH A;  1B4H A;  2B3B A;  1Y4C A;  4FEB A;  1DTG A;  2E0S A;  1R9Q A;  3TFL A;  4YMA A;  1TFA A;  1DTZ A;  2DXR A;  4R74 A;  5I57 B;  2QMX A;  1N7X A;  3UA8 A;  3GZG A;  4JXI A;  2HZL A;  1FTL A;  3H6T A;  3CSB A;  2CMO A;  4EUO A;  1D9V A;  3HHG A;  3OEN A;  5CMM A;  4NF6 A;  3MUQ A;  2XXR A;  2XHD A;  4NF5 B;  4EXL A;  1VE4 A;  3S9N C;  3I3V A;  2OCU A;  2IEE A;  3IOR A;  3V8X B;  1QUL A;  2ZNS A;  3THI A;  3UIF A;  3ECR A;  1SW4 A;  1H3D A;  1LGB C;  3JV9 A;  4QSC A;  3IOT A;  2X7P A;  4NF4 A;  4QFL A;  3UGW A;  1IEJ A;  3L6H A;  1TFD A;  1OIB A;  2XXT A;  2XX8 A;  4H8J A;  5ISU A;  3KOT A;  5L9O A;  4THI A;  3P7I A;  2A5S A;  3H06 B;  4X1B A;  4EQ9 A;  1SW5 A;  4MBP A;  1AL3 A;  2QS3 A;  1RYO A;  1PC3 A;  5AA2 D;  2H5Y A;  1UTB A;  3IJX B;  1OVT A;  4I8C A;  3LSX A;  2GHB A;  4U1O A;  5I59 A;  4ZS9 A;  3M3L A;  3MZB A;  3RT8 A;  3Q25 A;  5CMB A;  3K1P A;  3K0V A;  1IUD A;  1MM6 A;  3MVX A;  1N7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...