1Q35A

Crystal structure of pasteurella haemolytica apo ferric ion-binding protein a
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
318
structure length
317
Chain Sequence
ANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADGLVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDRVGKLPAGFDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKANLARKPQGGDRDQVKAIKEGICDYSIGNSYYYGKMLDDEKQKSWAEAAIINFPSGEHGTHKNISGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHEYPVKEGIEPSAIVKGWGTFKSDTIKLEDIAKNYEAALKLVDEVKFDDFSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords iron binding protein FbpA
publication title Crystal structure of Pasteurella haemolytica ferric ion-binding protein A reveals a novel class of bacterial iron-binding proteins
pubmed doi rcsb
source organism Mannheimia haemolytica
total genus 124
structure length 317
sequence length 318
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1q35A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1q35A02
2OZZA 2HAVA 5I58B 1UIVA 4BDLA 3MVXA 2NWJA 2DWHA 1SBPA 3TTLA 2HQ0A 5CRYA 4KCCA 2CZLA 4TOZA 3IOVA 4GF8A 1N76A 4NF4B 4R6YA 3U92A 3IK6B 4R2FA 3OSRA 4R75A 1IIWA 5HBCA 5I2KA 4IB2A 3RQTA 3K0VA 3PMVA 3O66A 3G3HA 3MWBA 5I59A 2R9JA 1EZPA 3VFJA 2THIA 3VVFA 3MZBA 5I2KB 4M1VA 3FUZA 4POXA 1URGA 3ZS6A 2OCUA 5I57A 2PYYA 3VLVA 3DP4A 5I59B 2DE4A 1IUDA 1N0TA 1SYIA 4HCWA 1ZKBA 1I6AA 2XXIA 4NTLA 1TT1A 3TCGA 1MY4A 4KPTA 4H67A 2B3FA 5H8QA 3E9XA 2H4IA 4ZEBA 1I6QA 1UTHA 5L9MA 1MQGA 4FATA 2Q2CA 2Q8JA 3FGSA 2NVUB 4RJZA 3UA8A 2XXPA 3SEXA 3Q29A 4OZ9A 3SEUA 5H8QB 1LB9A 4I9DA 4IY5A 1UTHB 3MZ9A 4Q5TA 3W9VA 2OK2A 1B3LA 4X9TA 2F7AA 4GXSB 1MXVA 4QFOA 3TTKA 1A8FA 4E0XA 4BDOA 1FQAA 4PE5B 3T22A 4EXLA 5F1QA 2PT1A 4UACA 3F11A 2P0SA 3VE1B 4GOTA 1IZ1A 3KZGA 4JWXA 4EQBA 1SI1A 3M8UA 1N3XA 1MY3A 1NNTA 3HO7A 3QIMA 2E1SA 3FV1A 2PVUA 2HCAA 3ONMA 4FEBA 3MP1A 5AA4A 4ZE9A 2DP8A 3U1OA 1XC1A 3IB0A 4LVQA 3TUSA 1B1HA 3CSBA 1US5A 1RYXA 3U94A 3PPRA 1RKMA 4F19A 2UVIA 5AA4B 1GTKA 4LONB 1AIVA 3LUYA 1SQYA 2BJJX 1YCJA 3FVGA 4GL8A 4YKJA 2ZYNA 3CG3A 2OWSA 2ZYKA 3KN7A 5K2XA 4HTGA 3CI8A 5EHSA 3GBBA 4YKPA 4F18A 5DEXB 1MS7A 1UQWA 3O29A 1PDAA 1S9TA 2G93A 3C34A 3T93B 2F7CA 1VFEA 1QKBA 1H45A 1Z7NE 5CBRA 3CFZA 1FTMA 4IGTA 1J1NA 4YB6A 3ECRA 2UYFA 1LGBC 1DTGA 5FTIA 4U21A 1A99A 1USYH 2AL5A 2IA4A 3PUWE 3OELA 4EUOA 4F2OA 3JV9A 4U1ZA 1MM7A 4BDRA 3TTMA 2H9BA 3BFTA 4F2QA 2O69A 5BUUA 2Q2AA 1SVXB 4C1TA 3ZKKA 1B7UA 3VDFA 2PT2A 2DWJA 2O68A 1BTJA 1DTZA 4DCYA 3A3CA 1IITA 4IO4A 5AA3A 4AB5A 3B7DA 4N13A 1M5DA 2ONRA 5I56A 1B52A 3LSXA 3FVOA 4Q0CA 1TWYA 5H8NA 4G77A 4NWDA 2QRYA 2XXVA 4IO6A 4ELQA 4O3CA 4U22A 2F6PA 3K6VA 2XXYA 1ZTYA 5I56B 2UYEA 4X1BA 3T96B 3B6WA 4RY1A 4R6HA 5H8NB 4O3BA 4HS7A 3G3IA 3K1NA 1MDP1 1O64A 5I84A 1A54A 1N84A 3O6HA 4GD5A 3OENA 4POWA 1NH8A 3C35A 4AQ4A 1ANFA 2ONKE 2NUVA 3UK4A 5DTBA 2I48A 3V8XB 3RY3A 4R74A 4U4SA 1EZ9A 3A09A 2F34A 1WODA 4XTCQ 5AA2A 1M5FA 2PBWA 3MAMA 4LATA 3FXQA 3FZVA 1SW1A 4OWDA 2HFBA 3K4UA 1LFHA 3RLFE 5KDTA 4OENA 1LAHE 3H6UA 3O6GA 2P2AA 3CRBA 4LUBA 2R6GE 1WVJA 1B3HA 1XVYA 3LSWA 1I69A 3N26A 1QW0A 2H99A 3C32A 5B7DA 4R9FA 5KDTB 3KG2A 4MFIA 4OVJA 3RGYA 4EF2A 1R1NA 2F36A 2GH9A 1GGGA 3IOWA 5FHMA 4TQUQ 1IXCA 4ELOA 3IOUA 4QFNA 3KOSA 2KLFA 2D21A 1DPPA 1FQBA 3MPKA 5FHNA 4PFYA 2XXRA 4MH5A 2DVZA 3TDJA 4F29A 1OLCA 1MPDA 3RNNA 1TFAA 4QSCA 5EYFA 1PB9A 2DWIA 3CSGA 2O7IA 1QJMA 3OO8A 3OO7A 4U23A 2I4CA 3QYTA 5B70A 4IO7A 1JW5A 4LQ5A 3Q25A 2O1LA 1YAEA 1WDNA 3FJGA 1N7XA 3ZSFA 2HZKA 4QSDA 2I0CA 1CB6A 1QUIA 1LBCA 3TELA 1B5IA 4RYAA 2B3BA 2Z22A 1SYHA 4AB6A 2DYXA 3EN3A 1MXUA 4OFLA 1VE4A 1MQIA 4X1DA 2Y7RA 1USYE 2XX7A 4F1YA 4N07A 2ZYMA 4PQJA 3K2DA 3QUFA 4ELRA 5AA2D 4LA9A 1GV8A 3Q27A 3SKPA 2ESNA 2ZNTA 1MXZA 4FORA 1YTVA 4C0RA 1XT8A 3IOTA 4ZEIA 3MUQA 1BIYA 4ECFA 4ZE8A 1MY0A 4ZDMA 4QFLA 2VD3A 1P1QA 2V84A 3O97A 4OMBA 1XS5A 1POY1 5H8FA 3H3GA 4R73A 3N94A 3K6WA 3L6HA 2A5SA 1AOVA 4EQ7A 3V83A 4NF6A 3PPPA 3VVEA 1FW0A 2B65A 2XXWA 3IB1A 2AYSA 1B0HA 3BFUA 2F8DA 4RXLA 4OETA 5H8FB 1QUJA 4XKRA 2ABHA 4NEDA 2V3TA 4BDMA 4EF1A 3PMXA 2WKYA 3HHFA 4NF6B 1LSTA 1Q35A 2DQVA 4P11A 4LZ5A 2OLBA 4JWOA 4G8HA 2YPNA 1XOCA 5CM6A 1R9QA 3A3UA 1MXWA 4RA1A 4ZZEA 3MBPA 4ZEKA 3MJNA 2Z8DA 3MW0A 1IXGA 5ICTA 5I57B 2Y7WA 1MQHA 4GXAA 2DE2A 3MQ9A 3U72A 1R9LA 1JEVA 1D4NA 1LFIA 2I6EA 3C33A 3LC8A 3FJ7A 3G3GA 5IKBA 2X7PA 2UVHA 1FQFA 4KI0E 1SW5A 1Y4TA 4DDDA 4H0WA 3S9NC 4JWYA 3USDA 4DXUA 1LAFE 3SEVA 5CBSA 4IY6A 1XHYA 1Y1ZA 2GHBA 3O9PA 4PFWA 3L6GA 4G8NA 2UXAA 5TU0A 1JEUA 5BWJA 5J1DA 5IAIA 4ZECA 2F97A 1LFGA 1SI0A 1B0LA 3IORA 5K2YA 3TKDA 1PEBA 3N5LA 4IO5A 1SD3A 4YMBA 4QFKA 2RC8A 3K00A 3V5AA 4F3SA 4DXBA 4ZEFA 4BLAA 2RF1A 5I2NA 4F22A 3MZ1A 1P1NA 5CMBA 3FV2A 3G3KA 3HSTA 5ITOA 2RKMA 1H44A 4FE8A 4F39A 2D3IA 2HZLA 2ZNSA 4F3PA 3SDFA 4ZS9A 1BKAA 2QS2A 4DLDA 5I2NB 4G68C 3HPIA 4Q8RA 2Q89A 4WKMA 2QMWA 2Y84A 4ZEDA 4FIMA 4OYVA 1NL5A 3PUZE 4KR5A 4F3GA 3OO6A 4YB7A 1FQDA 3KSXA 3VVDA 4GQOA 4XIGQ 3AXFA 2I58A 3R7XA 3PPNA 4GWOA 4XKQA 3PUXE 4U4XA 4MF3A 4KHZE 1B5HA 4TLLB 4GFRA 3IR1A 1TXFA 4I1DA 2ANJA 1AH5A 4KYDA 2I3VA 1Y1MA 1A8EA 1DPEA 1B58A 2Q9TA 1JETA 4ESXA 3G3JA 4OXVA 1P1OA 2F78A 4TLMB 1AL3A 3S9MC 1EU8A 1JVXA 3CIJA 5L9OA 4H8IA 2AIXA 3UGWA 2HAUA 3KJ7A 4U2RA 1FTOA 2X26A 3KFMA 4YMAA 3TZAA 1IXHA 4G68A 3R6UA 3D4GA 4KYSA 2F6GA 1ELJA 4KQPA 4FECA 3HN0A 3K1MA 3FVNA 4JBZA 3RN8A 1MDQA 3EQ1A 4LP2B 3DM0A 1JNFA 4G68B 3VXBA 2GFEA 3IAZA 4RNSA 2GRVA 1GVCA 1QKAA 2ALUA 4FEDA 2XX9A 3QK6A 4ONYA 3RT8A 4ND9A 3PD9A 1IQ7A 3Q26A 5ELVA 5DYHA 2QSXA 1ZLQA 3DLNA 3UN6A 2GHAA 3T9HB 4OESA 3EHSA 2Z8FA 2ONSA 2H5YA 2DE3A 4P0IA 2YJPA 1UTBA 3PUVE 5LOMA 2O1MA 3JYRA 1N7WA 1ZJLA 4YU0A 4H1XA 4WEPA 3C36A 1AMFA 1M5CA 3RTFB 3S9LC 2LAOA 1UTBB 4IO2A 3TTNA 3B6TA 4Z7EA 1F9BA 2PMSA 5AE4A 1UIUA 5AA2B 1BLFA 3LSLA 3B6QA 3OEKA 2ZYOA 4ZZAA 5ITPA 2I4BA 4NF5A 1Y3NA 4KCDA 4NMYA 1MH4A 3BBRA 2Z23A 1A40A 2RCBA 4G2ZA 3MPLA 3RTWB 4PFTA 4NF5B 3TEPA 3TMGA 2DXYA 4RPNA 1MRPA 4KFQA 4C1UA 3E3KA 1DOTA 5L8DA 1A7LA 3JZJA 1YPNA 4QF9A 5M2VA 1KWHA 3DP6A 5JTYA 2IEEA 3FXRA 1P99A 5JK4A 4OQOA 1N04A 5DVJA 1LAXA 3MVYA 1LCFA 3LSFB 4FAJA 2I49A 3ILUB 1NNPA 5JTYB 1PBQA 3TCFA 3TQWA 3IX1A 1IXIA 4R9GA 4GVOA 1B7HA 2V93A 2F35A 2A5TA 1D3KA 3KJTA 2X7QA 4QHQA 3H06B 4QSEA 3WAFA 2I3WA 1MPBA 4BDQA 3Q28A 4H5GA 2VOZA 3H03A 2AL4A 4G4PA 3ZKLA 3OEMA 4KYEA 4K3FA 5A5XA 1R6ZA 1P1WA 1N3WA 3V89B 4DIGA 2A5TB 4JDFA 3QUJA 4YICA 1B4ZA 1OQHA 3DP8A 1I6BA 1HSJA 3OXNA 2QS3A 1S50A 3OOAA 5I58A 5H8SA 3EHTA 3ODBA 2FA7A 1B2HA 1L5TA 5A5XB 3GXAA 4F1VA 1ZBMA 1JVYA 3S4UA 4RPOA 4NWCA 1SDXA 3T9XB 3K6XA 3MC2A 1FQEA 3T66A 4IO3A 3KN3A 1PB8A 3M3LA 4RK9A 4DZ1A 1OLAA 1Y3QA 5TP9A 1NMUA 4LZ8A 2OBGA 3N6UA 2Q88A 2XXQA 4R6KA 1FQCA 4GL0A 1IEJA 4YKIA 2DWAA 3CVGA 1POTA 1MXXA 1B05A 3C9HA 2HXWA 5TP9B 3KGCA 4HCYA 2H98A 1Z7ME 4ELPA 5HM4B 1CE2A 3PGFA 2Y7PA 1Y20A 4QRZA 4GIZA 3IJXB 4OTEA 4X48A 4PP0A 1B9JA 4LZ7A 2DOJA 2RC9A 2PX1A 1B40A 2XXUA 3PUYE 1A55A 1H43A 1URDA 4THIA 3PPOA 1S7YA 4PFUA 3R26A 2W7YA 4XXUA 2I0BA 2V3UA 5DVFA 1Y3PA 2E0SA 1URSA 1Y9UA 3FVKA 4P0GA 3K01A 4L17A 4NE4A 3G3FA 2CMOA 1HSEA 3TODA 3SERA 4QFPA 3M3FA 4OERA 1P1UA 4F3BA 5FHOA 3M3KA 2XHDA 1HSLA 3E13X 3TAJA 3N6TA 1QUKA 4JXIA 3MVZA 1SW4A 2HEUA 5CMMA 1PC3A 3QXMA 3U93A 4XKNA 4KD5A 2OWTA 2V3QA 3H6VA 1M5EA 4U1OA 3VV5A 5HPQA 3IJOB 2RINA 3KN8A 4YAHX 4OHNA 3SESA 2RCAA 2FYIA 1II5A 4F1UA 5FTHA 3RUMA 4BDNA 2QMXA 3I5OA 3UP9A 3PPQA 4OFJA 2XXXA 3S2VA 1B4HA 1OMPA 2ZMBA 2F7BA 3H4ZA 3TYHA 1B3FA 4N6PA 3I3VA 1ZU0A 1NNFA 3IB2A 2UVJA 3LBSA 1H76A 1EH3A 1DSNA 4Q30B 3RT6B 1B1XA 1M5BA 4G8MA 1NKXA 1B5JA 1MXYA 5CC2A 2UVGA 4GRKA 3EPEA 2QS4A 1MPCA 3HHGA 5EHMA 4RK2A 5DEXA 2XXHA 3EHUA 3BKIB 2XD3A 1GR2A 3QSLA 3H6TA 3HV1A 3MP8A 4EQ9A 3FASA 3RPWA 4JB7A 4DXCA 1SW2A 3THIA 2XD2A 2QPQA 4DE8A 1LLSA 1H3DA 4R2BA 4HW8A 1XVXA 1RYOA 3O28A 1US4A 3S9EA 1JW1A 3ILTB 3CG1A 1MG1A 3K1PA 5CI5A 3FXUA 1NFTA 2NXOA 3SETA 1MH3A 3IL1B 3P7IA 2XX8A 2ZXTA 3LR1A 3FATA 4OEVA 3GBAA 2QL3A 1O7TA 1NNKA 1ZMGA 2DVCA 3KSJA 1LCTA 2R71A 2QJEA 3SEYA 3U8QA 3KEIA 5JEIA 1B46A 3QAXA 3GZGA 2F5XA 2FNCA 3PD8A 1O63A 3UIFA 4IGRA 1FTKA 2Z8EA 4JSOA 2QS1A 4PETA 4DCXA 1B32A 1LAGE 1B7ZA 4I62A 3MP6A 5KZTA 4Z0IA 5DVIA 4NF8A 3CFLA 4YB5A 2NOOA 3HCQA 2H25A 3PU5A 2VD2A 3IO6A 1BP5A 4EDPA 3OSQA 2P1SA 1OIBA 2DS9A 2VGQA 5AA1A 3G7WA 1PB7A 3CR9A 3TTRA 3C31A 3OMBA 4NF8B 3EF7A 3K6UA 4ESWA 4EXKA 5KCJA 1Q1KA 3UORA 5F7VA 2VHAA 4F31B 1MQJA 4FJPA 1EZOA 4OEUA 3TCHA 1QVSA 5CMKA 5ICQA 5KCJB 4MLVA 1VSOA 1T0KA 4H65A 4H6DA 3O2AA 5CMCA 3H6WA 2DSFA 2D5WA 3TQLA 1B3GA 3PMWA 3VLUA 1D9YA 2OJTA 1VFDA 2XXTA 1B51A 1Y4CA 1QULA 3TFLA 2O7UA 2V25A 1ZIUA 4UA8A 2G29A 3DELB 3VXCA 1VR5A 4WEDA 3E4RA 3H7MA 4GLIA 4XKPA 4M4GA 1B3EA 3VLWA 1NH7A 3TPAA 3T9VA 3KBRA 1PBPA 4H5FA 1OVBA 2ZNUA 4JSDA 4OFOA 4WXJA 4O3AA 4I8CA 3K02A 3T9UA 4E0WA 1JW4A 4ISUA 1OVTA 3FJMA 2VP1A 2O6AA 1D9VA 3I6VA 4MLQA 1FTLA 1B6HA 1LB8A 1MY2A 1JQFA 3IO4A 2RC7A 1ATGA 1DMBA 3CFXA 3O6IA 3C4MA 1MM6A 1MY1A 1FTJA 3W15C 3FIRA 1FCKA 3GLBA 4YKKA 4YZZA 5L9SA 5TPAA 4R72A 5H8HA 2O84X 2O51A 5DT6A 1LBBA 3OO9A 4H8JA 3W9WA 2Y7KA 3SEWA 2REJA 3OD7A 3MVWA 5ISUA 4MBPA 2DXRA 2Y7IA 4LQ2A 3PV0E 2REGA 1MQDA 3FD3A 1OQGA 5TPAB 1TFDA 2YLNA 3KOTA 2M8CA 5H8HB 4NF4A 3WAEA 3D4CA
chains in the Genus database with same CATH superfamily
2OZZA 1LBXA 2HAVA 5I58B 1UIVA 4BDLA 3MVXA 2NWJA 2DWHA 4MAGA 1SBPA 3TTLA 2WYPA 2HQ0A 5CRYA 4KCCA 2CZLA 4TOZA 3IOVA 4GF8A 2PFZA 3FXBA 1N76A 4NF4B 4R6YA 3U92A 3IK6B 2PCRA 4R2FA 3OSRA 4R75A 1IIWA 5HBCA 5I2KA 4IB2A 3RQTA 4P1EA 1FBEA 3K0VA 3PMVA 2Y5KA 3O66A 3G3HA 2Q8MA 4P47A 3MWBA 5I59A 4FBPA 2R9JA 1EZPA 3VFJA 2THIA 3VVFA 3MZBA 5I2KB 1FBFA 4M1VA 2FBPA 3FUZA 4POXA 1URGA 3ZS6A 2OCUA 2CZIA 2XWKA 3BIHA 5I57A 2PYYA 4I3EA 3VLVA 3DP4A 5I59B 2DE4A 1IUDA 1N0TA 1SYIA 4HCWA 5ET6A 2P3NA 3KBZA 1ZKBA 4OVTA 1I6AA 2XXIA 4NTLA 1TT1A 3TCGA 1MY4A 4KPTA 4H67A 3EKIA 2B3FA 5H8QA 3E9XA 2H4IA 4ZEBA 1I6QA 1LBWA 4HE2A 1RDYA 1UTHA 5L9MA 1MQGA 4FATA 2Q2CA 2Q8JA 3FGSA 2NVUB 4RJZA 3UA8A 2XXPA 3SEXA 1EYJA 3Q29A 5I3SA 4OZ9A 3SEUA 3T0JA 5H8QB 4MIJA 3BIGA 1LB9A 4I9DA 4IY5A 1UTHB 3MZ9A 4H45A 4Q5TA 1FSAA 3W9VA 2OK2A 1B3LA 4PDDA 4X9TA 2F7AA 4GXSB 1MXVA 4QFOA 3TTKA 4OA4A 1A8FA 1IMDA 2WYKA 4E0XA 4O8MA 4BDOA 1FQAA 4PE5B 3T22A 4EXLA 5F1QA 2PT1A 4UACA 3F11A 2P0SA 4MNCA 4X04A 4NX1A 3VE1B 5EQ7A 4GOTA 1IZ1A 3KZGA 4JWXA 5EYHA 4EQBA 1SI1A 3M8UA 1N3XA 1MY3A 1NNTA 3HO7A 3QIMA 2E1SA 3FV1A 2PVUA 1K9YA 5LDZA 2HCAA 3ONMA 1NV2A 4FEBA 3MP1A 5AA4A 4ZE9A 2DP8A 3U1OA 1XC1A 3IB0A 4LVQA 3TUSA 1B1HA 3T1BA 3CSBA 1US5A 1FPFA 1EYKA 1RYXA 3U94A 3PPRA 2DDKA 5A5LA 4I3YA 1RKMA 4GWXA 4GBWA 4F19A 2UVIA 4PBQA 5AA4B 1GTKA 4LONB 1AIVA 3LUYA 1SQYA 2OWZA 3ROJA 2BJJX 1YCJA 3FVGA 4GL8A 4YKJA 2ZYNA 1IMFA 3CG3A 2OWSA 2ZYKA 3KN7A 5K2XA 4HTGA 3CI8A 5EHSA 3GBBA 4YKPA 3KC0A 4F18A 5DEXB 1MS7A 1UQWA 3O29A 4AS5A 1PDAA 1S9TA 2G93A 3C34A 4GWZA 2F7CA 1VFEA 3T93B 1QKBA 3HFUA 4MNPA 1H45A 1Z7NE 5CBRA 3CFZA 1FTMA 4DI3D 4IGTA 1J1NA 4YB6A 3ECRA 2UYFA 1LGBC 1DTGA 5FTIA 4U21A 1A99A 1USYH 1EYIA 5EQAA 2AL5A 2IA4A 3PUWE 3OELA 4EUOA 4F2OA 5LTCA 3JV9A 4U1ZA 1MM7A 4BDRA 3TTMA 2H9BA 3BFTA 2XWIA 4F2QA 2O69A 5BUUA 3D1RA 2Q2AA 1SVXB 4C1TA 3ZKKA 1B7UA 1K9ZA 3VDFA 2PT2A 2DWJA 2O68A 1BTJA 1CNQA 1DTZA 4DCYA 3A3CA 1IITA 5IGAA 4IO4A 5AA3A 4AB5A 3B7DA 4AS4A 1JP4A 1M5DA 4N13A 2ONRA 5I56A 1B52A 3LSXA 1G0IA 3FVOA 4Q0CA 1TWYA 5H8NA 4G77A 4NWDA 2QRYA 2XXVA 4IO6A 4ELQA 4O3CA 4U22A 2F6PA 3K6VA 2XXYA 1ZTYA 5I56B 2UYEA 4X1BA 3T96B 3B6WA 3GYYA 4RY1A 4R6HA 5H8NB 4O3BA 1YXIA 4HS7A 3G3IA 3K1NA 1O64A 1MDP1 5I84A 1A54A 1N84A 3O6HA 4GD5A 3OENA 4POWA 1NH8A 3C35A 4AQ4A 1ANFA 1IMCA 2ONKE 4N6DA 2NUVA 3UK4A 5DTBA 2I48A 3V8XB 3RY3A 4R74A 4U4SA 1EZ9A 3A09A 2F34A 1WODA 4XTCQ 5AA2A 1M5FA 2PBWA 3MAMA 4LATA 3FXQA 3FZVA 1SW1A 4JVIA 4OWDA 2HFBA 3K4UA 4NN3A 1LFHA 3RLFE 5KDTA 4MNIA 2F3BA 4N6KA 4OENA 1LAHE 3H6UA 3O6GA 2P2AA 3CRBA 4LUBA 2R6GE 1WVJA 1B3HA 1XVYA 3LSWA 4NG7A 1I69A 2OX3A 3N26A 2ZZWA 1QW0A 3SZPA 2H99A 3C32A 5B7DA 1NUYA 4R9FA 5KDTB 3KG2A 4MFIA 4OVJA 3RGYA 4EF2A 1R1NA 2F36A 2GH9A 1GGGA 3IOWA 5FHMA 1NV6A 4TQUQ 1IXCA 4ELOA 3IOUA 4QFNA 3KOSA 2KLFA 1FPEA 2D21A 1DPPA 1FQBA 3MPKA 1DCUA 5FHNA 4PFYA 2XXRA 4MH5A 2DVZA 3TDJA 4F29A 1OLCA 1MPDA 3RNNA 1TFAA 4QSCA 5EYFA 1PB9A 2DWIA 3CSGA 2O7IA 1QJMA 1NI9A 2HXRA 3OO8A 3OO7A 1FBCA 4U23A 2I4CA 3QYTA 5B70A 1QGXA 4IO7A 4N8YA 1JW5A 4LQ5A 3Q25A 2O1LA 1YAEA 2B4MA 1WDNA 3FJGA 1N7XA 4PFBA 4P8BA 3ZSFA 2HZKA 4G61A 4N91A 4QSDA 2I0CA 5F24A 1CB6A 1QUIA 1LBCA 3TELA 1B5IA 2HHMA 4RYAA 3MYUA 2B3BA 2Z22A 4LN5A 1SYHA 4AB6A 2DYXA 2XWVA 3EN3A 2JJKA 1MXUA 4OFLA 1VE4A 1MQIA 4X1DA 2Y7RA 3QMFA 1USYE 4NAPA 2XX7A 4F1YA 4N07A 3IFCA 2ZYMA 4PQJA 3K2DA 3QUFA 4ELRA 5AA2D 4LA9A 1FRPA 1GV8A 3Q27A 3SKPA 2ESNA 2ZNTA 1MXZA 4FORA 1YTVA 4C0RA 1XT8A 4IR8A 3IOTA 4ZEIA 3MUQA 1BIYA 4ECFA 4ZE8A 1MY0A 4ZDMA 4QFLA 2VD3A 1P1QA 2V84A 3O97A 4OMBA 1XS5A 4PAKA 1POY1 2ZZXA 4N15A 5H8FA 3H3GA 4R73A 3N94A 3K6WA 3L6HA 2A5SA 1AOVA 4EQ7A 3V83A 4NF6A 3PPPA 3VVEA 1FW0A 2B65A 2XXWA 3IB1A 2AYSA 1B0HA 3BFUA 2F8DA 4RXLA 4OETA 5H8FB 1QUJA 5ET7A 5EYGA 4XKRA 2ABHA 4NEDA 1NUWA 2V3TA 4BDMA 4EF1A 3PMXA 1FJ9A 2WKYA 3HHFA 3LUZA 4NF6B 1FJ6A 1LSTA 1Q35A 2DQVA 4P11A 4LZ5A 2OLBA 4JWOA 4G8HA 1NV1A 2YPNA 1XOCA 5CM6A 4XF5A 1R9QA 3A3UA 1MXWA 2P3VA 4RA1A 4ZZEA 3MBPA 4ZEKA 3MJNA 1FPIA 4NF0A 2Z8DA 3MW0A 1IXGA 5ICTA 5I57B 2Y7WA 3ISPA 1MQHA 4GXAA 2DE2A 3MQ9A 3U72A 1R9LA 1JEVA 1D4NA 1LFIA 1INPA 2I6EA 3C33A 3LC8A 4PFIA 3FJ7A 3G3GA 2WEFA 5IKBA 2X7PA 2UVHA 1FQFA 4KI0E 1SW5A 1Y4TA 4DDDA 4MCOA 4H0WA 3S9NC 4JWYA 3USDA 4DXUA 1LAFE 3SEVA 5CBSA 4IY6A 1XHYA 1Y1ZA 2GHBA 3O9PA 4PFWA 3L6GA 4O7IA 4G8NA 2UXAA 5TU0A 1JEUA 5BWJA 5J1DA 5IAIA 4ZECA 2F97A 1LFGA 1SI0A 3KC1A 1B0LA 3IORA 5K2YA 4GWUA 3TKDA 1PEBA 3N5LA 4IO5A 1SD3A 4YMBA 4QFKA 2RC8A 3K00A 3V5AA 4F3SA 4DXBA 4GWYA 2QVRA 4ZEFA 4BLAA 2RF1A 4OANA 5I2NA 4F22A 3MZ1A 1P1NA 5CMBA 3FV2A 3G3KA 3HSTA 5ITOA 2RKMA 1H44A 4FE8A 4GWSA 2D3IA 4F39A 2HZLA 2ZNSA 4F3PA 3SDFA 4ZS9A 2FHYA 1BKAA 2QS2A 4DLDA 4HXVA 5I2NB 4G68C 3HPIA 4Q8RA 1KA0A 2Q89A 4WKMA 2QMWA 2Y84A 4ZEDA 4FIMA 4OYVA 1NL5A 3PUZE 4KR5A 4F3GA 3OO6A 4YB7A 4HE1A 1FQDA 3U65A 3KSXA 3VVDA 1NV0A 4GQOA 4XIGQ 3AXFA 2I58A 4NQ8A 1NV3A 3R7XA 3PPNA 4GWOA 4XKQA 3PUXE 4U4XA 4MF3A 4KHZE 1B5HA 4TLLB 4GFRA 3IR1A 1TXFA 4I1DA 2ANJA 1AH5A 4KYDA 2I3VA 1Y1MA 1A8EA 1DPEA 1AWBA 1B58A 2Q9TA 1JETA 4ESXA 3G3JA 4OXVA 1P1OA 2F78A 4TLMB 4PDHA 1AL3A 3S9MC 1EU8A 1JVXA 3CIJA 5L9OA 2QFLA 4H8IA 2AIXA 3UGWA 2HAUA 3KJ7A 4U2RA 1FTOA 2X26A 3KFMA 4YMAA 3TZAA 1IXHA 4G68A 4GWWA 1FPLA 3R6UA 3D4GA 4KYSA 2F6GA 1ELJA 4XFEA 4KQPA 4PC9A 1D9QA 4O7MA 4FECA 3HN0A 1DK4A 3K1MA 5ET8A 3FVNA 4JBZA 3RN8A 1MDQA 1Q9DA 3EQ1A 4LP2B 3DM0A 1JNFA 4G68B 3VXBA 1FPGA 2GFEA 3IAZA 4N4UA 4RNSA 2GRVA 1GVCA 1QKAA 2ALUA 4FEDA 2XX9A 3QK6A 4ONYA 3RT8A 4ND9A 3PD9A 1IQ7A 3Q26A 5ELVA 5DYHA 2QSXA 1ZLQA 3DLNA 3UN6A 2GHAA 3T9HB 2CZHA 4OESA 3EHSA 2Z8FA 2ONSA 2H5YA 2DE3A 4P0IA 4PBHA 3RPLA 2YJPA 3PTYA 1KZ8A 1UTBA 3PUVE 5LOMA 2O1MA 3JYRA 1N7WA 1ZJLA 4YU0A 4H1XA 4WEPA 3B8BA 3C36A 1AMFA 1M5CA 3RTFB 3S9LC 2LAOA 3RPLB 5IM2A 1FPKA 1UTBB 4NHBA 4IO2A 3TTNA 3B6TA 4Z7EA 1F9BA 2PMSA 5AE4A 2PFYA 1UIUA 1NV4A 1BLFA 3LSLA 5AA2B 3B6QA 3OEKA 4NGUA 2ZYOA 1G0HA 4ZZAA 5ITPA 2I4BA 2KR0A 4NF5A 1Y3NA 4KCDA 4NMYA 4MMPA 1MH4A 3BBRA 2Z23A 4P56A 2QVUA 1A40A 1LBYA 2RCBA 4G2ZA 3MPLA 5IZ3A 3RTWB 4PFTA 4NF5B 3TEPA 3TMGA 2DXYA 4RPNA 1MRPA 5J16A 4PTKA 4KFQA 2WX9A 3MSTA 4C1UA 3E3KA 5IZ3B 1DOTA 5L8DA 1A7LA 3JZJA 1YPNA 4QF9A 5M2VA 1KWHA 3DP6A 5JTYA 2IEEA 3FXRA 1P99A 5JK4A 4OQOA 4QXDA 1N04A 5DVJA 1LAXA 3MVYA 1LCFA 1SPIA 3LSFB 4FAJA 1NV5A 2I49A 3ILUB 1NNPA 2BJIA 5JTYB 1PBQA 3TCFA 4GBVA 3TQWA 3IX1A 1IXIA 4R9GA 4GVOA 2L5VA 1B7HA 4H46A 2V93A 2F35A 1KA1A 1FTAA 4PF8A 1FBHA 2A5TA 1D3KA 3KJTA 2X7QA 4QHQA 3H06B 4QSEA 3WAFA 2I3WA 2CZKA 1MPBA 4PFRA 4BDQA 3Q28A 4H5GA 4QBAA 2VOZA 3H03A 2AL4A 4OVPA 4G4PA 3ZKLA 3OEMA 4KYEA 4K3FA 5A5XA 1R6ZA 1P1WA 1N3WA 3V89B 4DIGA 2A5TB 4JDFA 4I40A 3QUJA 4YICA 1B4ZA 1OQHA 3DP8A 1I6BA 1HSJA 3OXNA 2QS3A 1S50A 3OOAA 5I58A 3A29A 5H8SA 2ZZVA 3EHTA 3ODBA 2FA7A 1B2HA 1L5TA 4OVQA 5A5XB 3GXAA 5IZ1A 1ZBMA 4F1VA 1JVYA 2R8TA 1XI6A 3S4UA 4RPOA 4NWCA 1SDXA 3T9XB 2V4CA 3K6XA 3MC2A 1FQEA 3T66A 3E79A 4IO3A 3KN3A 1PB8A 3M3LA 4RK9A 4DZ1A 1OLAA 1Y3QA 4DI4B 5TP9A 1NMUA 4LZ8A 2OBGA 1YZ0A 3N6UA 2Q88A 2XXQA 4X8RA 4P3LA 4R6KA 1FQCA 4GL0A 1IEJA 4YKIA 2DWAA 1NV7A 3CVGA 1POTA 1MXXA 1B05A 3C9HA 2HXWA 5TP9B 2XWOA 3KGCA 4HCYA 2H98A 2KQZA 1Z7ME 4ELPA 2VPNA 5HM4B 1CE2A 3PGFA 2Y7PA 1Y20A 4QRZA 4GIZA 3IJXB 4OTEA 4X48A 4PP0A 1B9JA 4LZ7A 2DOJA 2RC9A 2PX1A 1B40A 2XXUA 3PUYE 1DBZA 1A55A 1H43A 1FPDA 1BK4A 1URDA 4THIA 2VT5A 2XXKA 5ESYA 3PPOA 5ET5A 1S7YA 1IMAA 4PFUA 3R26A 2W7YA 4XXUA 2WBDA 2I0BA 2V3UA 5DVFA 1Y3PA 2E0SA 1URSA 1Y9UA 3FVKA 4P0GA 3K01A 4L17A 4NE4A 3G3FA 2CMOA 4GX6A 1HSEA 3TODA 3SERA 4QFPA 3M3FA 4OERA 1P1UA 4F3BA 3IFAA 5FHOA 3M3KA 2XHDA 4MX6A 4PGNA 1HSLA 3E13X 3TAJA 3N6TA 1QUKA 4OVSA 4JXIA 3MVZA 1VDWA 1FBPA 1SW4A 2HEUA 2B4LA 3RYDA 5I7IA 5CMMA 1PC3A 3QXMA 3U93A 4XKNA 4KD5A 2CEYA 2OWTA 2WBBA 2V3QA 3H6VA 1M5EA 4U1OA 3VV5A 5HPQA 3IJOB 2RINA 3KN8A 4YAHX 4OHNA 3SESA 2RCAA 2FVZA 2FYIA 1II5A 4F1UA 5FTHA 3RUMA 4BDNA 2QMXA 3I5OA 3UP9A 2FIXA 3PPQA 4OFJA 2XXXA 3S2VA 1B4HA 1OMPA 2ZMBA 4UABA 2F7BA 3H4ZA 3TYHA 3LV0A 1B3FA 4N6PA 3I3VA 1ZU0A 1NNFA 3IB2A 2UVJA 1IMBA 3LBSA 1H76A 1EH3A 1DSNA 4Q30B 3RT6B 1B1XA 1M5BA 4G8MA 1NKXA 1B5JA 1MXYA 5CC2A 2QVVA 2UVGA 4GRKA 3EPEA 2QS4A 1MPCA 3HHGA 5EHMA 4RK2A 5DEXA 2XXHA 3EHUA 3BKIB 2GQ1A 2XD3A 1GR2A 3QSLA 3H6TA 3HV1A 3MP8A 2F3DA 4EQ9A 3FASA 3RPWA 4JB7A 4DXCA 1SW2A 3THIA 2XD2A 2QPQA 4DE8A 3B50A 1LLSA 1H3DA 4R2BA 4HW8A 2HPGA 1XVXA 1RYOA 1NUZA 3O28A 1US4A 3S9EA 1JW1A 3ILTB 3CG1A 1MG1A 3K1PA 5CI5A 3FXUA 1NFTA 2NXOA 3SETA 1MH3A 5EQ8A 4GX3A 3IL1B 4MEVA 4O94A 3P7IA 1YYZA 2XX8A 2ZXTA 3LR1A 3FATA 4OEVA 1FPBA 3GBAA 2QL3A 1O7TA 1NNKA 5T3JA 1ZMGA 2DVCA 1RDXA 3KSJA 1LCTA 3E78A 5I5PA 2R71A 2QJEA 3SEYA 3U8QA 3KEIA 5JEIA 1B46A 3QAXA 3GZGA 2F5XA 2FNCA 3PD8A 1O63A 2VPOA 1IMEA 3UIFA 4IGRA 1FTKA 2Z8EA 4JSOA 2QS1A 4PETA 4DCXA 1B32A 1LAGE 1B7ZA 4I62A 3MP6A 5KZTA 4Z0IA 2MKZA 4KXPA 5DVIA 4NF8A 3CFLA 5IZZA 4YB5A 2NOOA 3HCQA 2H25A 3PU5A 2VD2A 3IO6A 1BP5A 4EDPA 1LEVA 3OSQA 2P1SA 1OIBA 2DS9A 2VGQA 4JVCA 5AA1A 3G7WA 1PB7A 3CR9A 3TTRA 3C31A 2XA5A 3OMBA 4NF8B 3EF7A 3K6UA 4ESWA 4EXKA 3CHGA 5KCJA 2Q74A 1Q1KA 4P9KA 3UORA 5F7VA 2VHAA 4F31B 4FJPA 1MQJA 1EZOA 4OEUA 3TCHA 4PE3A 1QVSA 4N8GA 5CMKA 5ICQA 5KCJB 4MLVA 4PAFA 1VSOA 1T0KA 4H65A 4H6DA 3O2AA 5CMCA 3H6WA 2DSFA 2D5WA 3TQLA 1B3GA 3PMWA 3VLUA 4PCDA 1D9YA 2OJTA 1VFDA 5DW8A 2XXTA 1B51A 1Y4CA 1QULA 3TFLA 4GX4A 2O7UA 2V25A 1ZIUA 4UA8A 2G29A 3DELB 4OVRA 3VXCA 1VR5A 4WEDA 3E4RA 1FBDA 3H7MA 4GLIA 4XKPA 4M4GA 1B3EA 2CEXA 2FIEA 3VLWA 1NH7A 3TPAA 3T9VA 3KBRA 5FBPA 1PBPA 4H5FA 1LBVA 4N81A 1OVBA 2ZNUA 4JSDA 4OFOA 4WXJA 4O3AA 4I8CA 4MJOA 3K02A 3T9UA 4E0WA 1JW4A 4ISUA 3FBPA 1OVTA 3FJMA 4PF6A 2VP1A 2O6AA 1D9VA 3I6VA 4MLQA 1FTLA 1B6HA 4HE0A 1LB8A 1FPJA 1MY2A 1JQFA 3IO4A 2RC7A 1ATGA 1FBGA 1DMBA 3CFXA 3O6IA 3C4MA 1MM6A 4JVDA 1MY1A 1FTJA 3W15C 3FIRA 1FCKA 3GLBA 2Y5LA 4YKKA 1LBZA 4YZZA 5L9SA 5TPAA 4N17A 4R72A 5H8HA 2O84X 2O51A 5DT6A 1LBBA 3OO9A 4PAIA 4H8JA 1RDZA 2Y7KA 3SEWA 3W9WA 2REJA 3OD7A 1NUXA 4P1LA 3MVWA 5ISUA 4MBPA 2DXRA 2Y7IA 4LQ2A 3PV0E 2REGA 1MQDA 5EQ9A 4PGPA 3FD3A 1OQGA 5TPAB 1TFDA 2YLNA 3KOTA 2M8CA 5H8HB 4XEQA 4NF4A 3WAEA 3NOHA 4MHFA 3D4CA
chains in the Genus database with same CATH topology
2OZZA 2HAVA 5I58B 1UIVA 4BDLA 3MVXA 2NWJA 2DWHA 1SBPA 3TTLA 2HQ0A 5CRYA 4KCCA 2CZLA 4TOZA 3IOVA 4GF8A 1N76A 4NF4B 4R6YA 3U92A 3IK6B 4R2FA 3OSRA 4R75A 1IIWA 5HBCA 5I2KA 4IB2A 3RQTA 3K0VA 3PMVA 3O66A 3G3HA 3MWBA 5I59A 2R9JA 1EZPA 3VFJA 2THIA 3VVFA 3MZBA 5I2KB 4M1VA 3FUZA 4POXA 1URGA 3ZS6A 2OCUA 5I57A 2PYYA 3VLVA 3DP4A 5I59B 2DE4A 1IUDA 1N0TA 1SYIA 4HCWA 1ZKBA 1I6AA 2XXIA 4NTLA 1TT1A 3TCGA 1MY4A 4KPTA 4H67A 2B3FA 5H8QA 3E9XA 2H4IA 4ZEBA 1I6QA 1UTHA 5L9MA 1MQGA 4FATA 2Q2CA 2Q8JA 3FGSA 2NVUB 4RJZA 3UA8A 2XXPA 3SEXA 3Q29A 4OZ9A 3SEUA 5H8QB 1LB9A 4I9DA 4IY5A 1UTHB 3MZ9A 4Q5TA 3W9VA 2OK2A 1B3LA 4X9TA 2F7AA 4GXSB 1MXVA 4QFOA 3TTKA 1A8FA 4E0XA 4BDOA 1FQAA 4PE5B 3T22A 4EXLA 5F1QA 2PT1A 4UACA 3F11A 2P0SA 3VE1B 4GOTA 1IZ1A 3KZGA 4JWXA 4EQBA 1SI1A 3M8UA 1N3XA 1MY3A 1NNTA 3HO7A 3QIMA 2E1SA 3FV1A 2PVUA 2HCAA 3ONMA 4FEBA 3MP1A 5AA4A 4ZE9A 2DP8A 3U1OA 1XC1A 3IB0A 4LVQA 3TUSA 1B1HA 3CSBA 1US5A 1RYXA 3U94A 3PPRA 1RKMA 4F19A 2UVIA 5AA4B 1GTKA 4LONB 1AIVA 3LUYA 1SQYA 2BJJX 1YCJA 3FVGA 4GL8A 4YKJA 2ZYNA 3CG3A 2OWSA 2ZYKA 3KN7A 5K2XA 4HTGA 3CI8A 5EHSA 3GBBA 4YKPA 4F18A 5DEXB 1MS7A 1UQWA 3O29A 1PDAA 1S9TA 2G93A 3C34A 3T93B 2F7CA 1VFEA 1QKBA 1H45A 1Z7NE 5CBRA 3CFZA 1FTMA 4IGTA 1J1NA 4YB6A 3ECRA 2UYFA 1LGBC 1DTGA 5FTIA 4U21A 1A99A 1USYH 2AL5A 2IA4A 3PUWE 3OELA 4EUOA 4F2OA 3JV9A 4U1ZA 1MM7A 4BDRA 3TTMA 2H9BA 3BFTA 4F2QA 2O69A 5BUUA 2Q2AA 1SVXB 4C1TA 3ZKKA 1B7UA 3VDFA 2PT2A 2DWJA 2O68A 1BTJA 1DTZA 4DCYA 3A3CA 1IITA 4IO4A 5AA3A 4AB5A 3B7DA 4N13A 1M5DA 2ONRA 5I56A 1B52A 3LSXA 3FVOA 4Q0CA 1TWYA 5H8NA 4G77A 4NWDA 2QRYA 2XXVA 4IO6A 4ELQA 4O3CA 4U22A 2F6PA 3K6VA 2XXYA 1ZTYA 5I56B 2UYEA 4X1BA 3T96B 3B6WA 4RY1A 4R6HA 5H8NB 4O3BA 4HS7A 3G3IA 3K1NA 1MDP1 1O64A 5I84A 1A54A 1N84A 3O6HA 4GD5A 3OENA 4POWA 1NH8A 3C35A 4AQ4A 1ANFA 2ONKE 2NUVA 3UK4A 5DTBA 2I48A 3V8XB 3RY3A 4R74A 4U4SA 1EZ9A 3A09A 2F34A 1WODA 4XTCQ 5AA2A 1M5FA 2PBWA 3MAMA 4LATA 3FXQA 3FZVA 1SW1A 4OWDA 2HFBA 3K4UA 1LFHA 3RLFE 5KDTA 4OENA 1LAHE 3H6UA 3O6GA 2P2AA 3CRBA 4LUBA 2R6GE 1WVJA 1B3HA 1XVYA 3LSWA 1I69A 3N26A 1QW0A 2H99A 3C32A 5B7DA 4R9FA 5KDTB 3KG2A 4MFIA 4OVJA 3RGYA 4EF2A 1R1NA 2F36A 2GH9A 1GGGA 3IOWA 5FHMA 4TQUQ 1IXCA 4ELOA 3IOUA 4QFNA 3KOSA 2KLFA 2D21A 1DPPA 1FQBA 3MPKA 5FHNA 4PFYA 2XXRA 4MH5A 2DVZA 3TDJA 4F29A 1OLCA 1MPDA 3RNNA 1TFAA 4QSCA 5EYFA 1PB9A 2DWIA 3CSGA 2O7IA 1QJMA 3OO8A 3OO7A 4U23A 2I4CA 3QYTA 5B70A 4IO7A 1JW5A 4LQ5A 3Q25A 2O1LA 1YAEA 1WDNA 3FJGA 1N7XA 3ZSFA 2HZKA 4QSDA 2I0CA 1CB6A 1QUIA 1LBCA 3TELA 1B5IA 4RYAA 2B3BA 2Z22A 1SYHA 4AB6A 2DYXA 3EN3A 1MXUA 4OFLA 1VE4A 1MQIA 4X1DA 2Y7RA 1USYE 2XX7A 4F1YA 4N07A 2ZYMA 4PQJA 3K2DA 3QUFA 4ELRA 5AA2D 4LA9A 1GV8A 3Q27A 3SKPA 2ESNA 2ZNTA 1MXZA 4FORA 1YTVA 4C0RA 1XT8A 3IOTA 4ZEIA 3MUQA 1BIYA 4ECFA 4ZE8A 1MY0A 4ZDMA 4QFLA 2VD3A 1P1QA 2V84A 3O97A 4OMBA 1XS5A 1POY1 5H8FA 3H3GA 4R73A 3N94A 3K6WA 3L6HA 2A5SA 1AOVA 4EQ7A 3V83A 4NF6A 3PPPA 3VVEA 1FW0A 2B65A 2XXWA 3IB1A 2AYSA 1B0HA 3BFUA 2F8DA 4RXLA 4OETA 5H8FB 1QUJA 4XKRA 2ABHA 4NEDA 2V3TA 4BDMA 4EF1A 3PMXA 2WKYA 3HHFA 4NF6B 1LSTA 1Q35A 2DQVA 4P11A 4LZ5A 2OLBA 4JWOA 4G8HA 2YPNA 1XOCA 5CM6A 1R9QA 3A3UA 1MXWA 4RA1A 4ZZEA 3MBPA 4ZEKA 3MJNA 2Z8DA 3MW0A 1IXGA 5ICTA 5I57B 2Y7WA 1MQHA 4GXAA 2DE2A 3MQ9A 3U72A 1R9LA 1JEVA 1D4NA 1LFIA 2I6EA 3C33A 3LC8A 3FJ7A 3G3GA 5IKBA 2X7PA 2UVHA 1FQFA 4KI0E 1SW5A 1Y4TA 4DDDA 4H0WA 3S9NC 4JWYA 3USDA 4DXUA 1LAFE 3SEVA 5CBSA 4IY6A 1XHYA 1Y1ZA 2GHBA 3O9PA 4PFWA 3L6GA 4G8NA 2UXAA 5TU0A 1JEUA 5BWJA 5J1DA 5IAIA 4ZECA 2F97A 1LFGA 1SI0A 1B0LA 3IORA 5K2YA 3TKDA 1PEBA 3N5LA 4IO5A 1SD3A 4YMBA 4QFKA 2RC8A 3K00A 3V5AA 4F3SA 4DXBA 4ZEFA 4BLAA 2RF1A 5I2NA 4F22A 3MZ1A 1P1NA 5CMBA 3FV2A 3G3KA 3HSTA 5ITOA 2RKMA 1H44A 4FE8A 4F39A 2D3IA 2HZLA 2ZNSA 4F3PA 3SDFA 4ZS9A 1BKAA 2QS2A 4DLDA 5I2NB 4G68C 3HPIA 4Q8RA 2Q89A 4WKMA 2QMWA 2Y84A 4ZEDA 4FIMA 4OYVA 1NL5A 3PUZE 4KR5A 4F3GA 3OO6A 4YB7A 1FQDA 3KSXA 3VVDA 4GQOA 4XIGQ 3AXFA 2I58A 3R7XA 3PPNA 4GWOA 4XKQA 3PUXE 4U4XA 4MF3A 4KHZE 1B5HA 4TLLB 4GFRA 3IR1A 1TXFA 4I1DA 2ANJA 1AH5A 4KYDA 2I3VA 1Y1MA 1A8EA 1DPEA 1B58A 2Q9TA 1JETA 4ESXA 3G3JA 4OXVA 1P1OA 2F78A 4TLMB 1AL3A 3S9MC 1EU8A 1JVXA 3CIJA 5L9OA 4H8IA 2AIXA 3UGWA 2HAUA 3KJ7A 4U2RA 1FTOA 2X26A 3KFMA 4YMAA 3TZAA 1IXHA 4G68A 3R6UA 3D4GA 4KYSA 2F6GA 1ELJA 4KQPA 4FECA 3HN0A 3K1MA 3FVNA 4JBZA 3RN8A 1MDQA 3EQ1A 4LP2B 3DM0A 1JNFA 4G68B 3VXBA 2GFEA 3IAZA 4RNSA 2GRVA 1GVCA 1QKAA 2ALUA 4FEDA 2XX9A 3QK6A 4ONYA 3RT8A 4ND9A 3PD9A 1IQ7A 3Q26A 5ELVA 5DYHA 2QSXA 1ZLQA 3DLNA 3UN6A 2GHAA 3T9HB 4OESA 3EHSA 2Z8FA 2ONSA 2H5YA 2DE3A 4P0IA 2YJPA 1UTBA 3PUVE 5LOMA 2O1MA 3JYRA 1N7WA 1ZJLA 4YU0A 4H1XA 4WEPA 3C36A 1AMFA 1M5CA 3RTFB 3S9LC 2LAOA 1UTBB 4IO2A 3TTNA 3B6TA 4Z7EA 1F9BA 2PMSA 5AE4A 1UIUA 5AA2B 1BLFA 3LSLA 3B6QA 3OEKA 2ZYOA 4ZZAA 5ITPA 2I4BA 4NF5A 1Y3NA 4KCDA 4NMYA 1MH4A 3BBRA 2Z23A 1A40A 2RCBA 4G2ZA 3MPLA 3RTWB 4PFTA 4NF5B 3TEPA 3TMGA 2DXYA 4RPNA 1MRPA 4KFQA 4C1UA 3E3KA 1DOTA 5L8DA 1A7LA 3JZJA 1YPNA 4QF9A 5M2VA 1KWHA 3DP6A 5JTYA 2IEEA 3FXRA 1P99A 5JK4A 4OQOA 1N04A 5DVJA 1LAXA 3MVYA 1LCFA 3LSFB 4FAJA 2I49A 3ILUB 1NNPA 5JTYB 1PBQA 3TCFA 3TQWA 3IX1A 1IXIA 4R9GA 4GVOA 1B7HA 2V93A 2F35A 2A5TA 1D3KA 3KJTA 2X7QA 4QHQA 3H06B 4QSEA 3WAFA 2I3WA 1MPBA 4BDQA 3Q28A 4H5GA 2VOZA 3H03A 2AL4A 4G4PA 3ZKLA 3OEMA 4KYEA 4K3FA 5A5XA 1R6ZA 1P1WA 1N3WA 3V89B 4DIGA 2A5TB 4JDFA 3QUJA 4YICA 1B4ZA 1OQHA 3DP8A 1I6BA 1HSJA 3OXNA 2QS3A 1S50A 3OOAA 5I58A 5H8SA 3EHTA 3ODBA 2FA7A 1B2HA 1L5TA 5A5XB 3GXAA 4F1VA 1ZBMA 1JVYA 3S4UA 4RPOA 4NWCA 1SDXA 3T9XB 3K6XA 3MC2A 1FQEA 3T66A 4IO3A 3KN3A 1PB8A 3M3LA 4RK9A 4DZ1A 1OLAA 1Y3QA 5TP9A 1NMUA 4LZ8A 2OBGA 3N6UA 2Q88A 2XXQA 4R6KA 1FQCA 4GL0A 1IEJA 4YKIA 2DWAA 3CVGA 1POTA 1MXXA 1B05A 3C9HA 2HXWA 5TP9B 3KGCA 4HCYA 2H98A 1Z7ME 4ELPA 5HM4B 1CE2A 3PGFA 2Y7PA 1Y20A 4QRZA 4GIZA 3IJXB 4OTEA 4X48A 4PP0A 1B9JA 4LZ7A 2DOJA 2RC9A 2PX1A 1B40A 2XXUA 3PUYE 1A55A 1H43A 1URDA 4THIA 3PPOA 1S7YA 4PFUA 3R26A 2W7YA 4XXUA 2I0BA 2V3UA 5DVFA 1Y3PA 2E0SA 1URSA 1Y9UA 3FVKA 4P0GA 3K01A 4L17A 4NE4A 3G3FA 2CMOA 1HSEA 3TODA 3SERA 4QFPA 3M3FA 4OERA 1P1UA 4F3BA 5FHOA 3M3KA 2XHDA 1HSLA 3E13X 3TAJA 3N6TA 1QUKA 4JXIA 3MVZA 1SW4A 2HEUA 5CMMA 1PC3A 3QXMA 3U93A 4XKNA 4KD5A 2OWTA 2V3QA 3H6VA 1M5EA 4U1OA 3VV5A 5HPQA 3IJOB 2RINA 3KN8A 4YAHX 4OHNA 3SESA 2RCAA 2FYIA 1II5A 4F1UA 5FTHA 3RUMA 4BDNA 2QMXA 3I5OA 3UP9A 3PPQA 4OFJA 2XXXA 3S2VA 1B4HA 1OMPA 2ZMBA 2F7BA 3H4ZA 3TYHA 1B3FA 4N6PA 3I3VA 1ZU0A 1NNFA 3IB2A 2UVJA 3LBSA 1H76A 1EH3A 1DSNA 4Q30B 3RT6B 1B1XA 1M5BA 4G8MA 1NKXA 1B5JA 1MXYA 5CC2A 2UVGA 4GRKA 3EPEA 2QS4A 1MPCA 3HHGA 5EHMA 4RK2A 5DEXA 2XXHA 3EHUA 3BKIB 2XD3A 1GR2A 3QSLA 3H6TA 3HV1A 3MP8A 4EQ9A 3FASA 3RPWA 4JB7A 4DXCA 1SW2A 3THIA 2XD2A 2QPQA 4DE8A 1LLSA 1H3DA 4R2BA 4HW8A 1XVXA 1RYOA 3O28A 1US4A 3S9EA 1JW1A 3ILTB 3CG1A 1MG1A 3K1PA 5CI5A 3FXUA 1NFTA 2NXOA 3SETA 1MH3A 3IL1B 3P7IA 2XX8A 2ZXTA 3LR1A 3FATA 4OEVA 3GBAA 2QL3A 1O7TA 1NNKA 1ZMGA 2DVCA 3KSJA 1LCTA 2R71A 2QJEA 3SEYA 3U8QA 3KEIA 5JEIA 1B46A 3QAXA 3GZGA 2F5XA 2FNCA 3PD8A 1O63A 3UIFA 4IGRA 1FTKA 2Z8EA 4JSOA 2QS1A 4PETA 4DCXA 1B32A 1LAGE 1B7ZA 4I62A 3MP6A 5KZTA 4Z0IA 5DVIA 4NF8A 3CFLA 4YB5A 2NOOA 3HCQA 2H25A 3PU5A 2VD2A 3IO6A 1BP5A 4EDPA 3OSQA 2P1SA 1OIBA 2DS9A 2VGQA 5AA1A 3G7WA 1PB7A 3CR9A 3TTRA 3C31A 3OMBA 4NF8B 3EF7A 3K6UA 4ESWA 4EXKA 5KCJA 1Q1KA 3UORA 5F7VA 2VHAA 4F31B 1MQJA 4FJPA 1EZOA 4OEUA 3TCHA 1QVSA 5CMKA 5ICQA 5KCJB 4MLVA 1VSOA 1T0KA 4H65A 4H6DA 3O2AA 5CMCA 3H6WA 2DSFA 2D5WA 3TQLA 1B3GA 3PMWA 3VLUA 1D9YA 2OJTA 1VFDA 2XXTA 1B51A 1Y4CA 1QULA 3TFLA 2O7UA 2V25A 1ZIUA 4UA8A 2G29A 3DELB 3VXCA 1VR5A 4WEDA 3E4RA 3H7MA 4GLIA 4XKPA 4M4GA 1B3EA 3VLWA 1NH7A 3TPAA 3T9VA 3KBRA 1PBPA 4H5FA 1OVBA 2ZNUA 4JSDA 4OFOA 4WXJA 4O3AA 4I8CA 3K02A 3T9UA 4E0WA 1JW4A 4ISUA 1OVTA 3FJMA 2VP1A 2O6AA 1D9VA 3I6VA 4MLQA 1FTLA 1B6HA 1LB8A 1MY2A 1JQFA 3IO4A 2RC7A 1ATGA 1DMBA 3CFXA 3O6IA 3C4MA 1MM6A 1MY1A 1FTJA 3W15C 3FIRA 1FCKA 3GLBA 4YKKA 4YZZA 5L9SA 5TPAA 4R72A 5H8HA 2O84X 2O51A 5DT6A 1LBBA 3OO9A 4H8JA 3W9WA 2Y7KA 3SEWA 2REJA 3OD7A 3MVWA 5ISUA 4MBPA 2DXRA 2Y7IA 4LQ2A 3PV0E 2REGA 1MQDA 3FD3A 1OQGA 5TPAB 1TFDA 2YLNA 3KOTA 2M8CA 5H8HB 4NF4A 3WAEA 3D4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZZ A;  2HAV A;  5I58 B;  1UIV A;  4BDL A;  3MVX A;  2NWJ A;  2DWH A;  1SBP A;  3TTL A;  2HQ0 A;  5CRY A;  4KCC A;  2CZL A;  4TOZ A;  3IOV A;  4GF8 A;  1N76 A;  4NF4 B;  4R6Y A;  3U92 A;  3IK6 B;  4R2F A;  3OSR A;  4R75 A;  1IIW A;  5HBC A;  5I2K A;  4IB2 A;  3RQT A;  3K0V A;  3PMV A;  3O66 A;  3G3H A;  3MWB A;  5I59 A;  2R9J A;  1EZP A;  3VFJ A;  2THI A;  3VVF A;  3MZB A;  5I2K B;  4M1V A;  3FUZ A;  4POX A;  1URG A;  3ZS6 A;  2OCU A;  5I57 A;  2PYY A;  3VLV A;  3DP4 A;  5I59 B;  2DE4 A;  1IUD A;  1N0T A;  1SYI A;  4HCW A;  1ZKB A;  1I6A A;  2XXI A;  4NTL A;  1TT1 A;  3TCG A;  1MY4 A;  4KPT A;  4H67 A;  2B3F A;  5H8Q A;  3E9X A;  2H4I A;  4ZEB A;  1I6Q A;  1UTH A;  5L9M A;  1MQG A;  4FAT A;  2Q2C A;  2Q8J A;  3FGS A;  2NVU B;  4RJZ A;  3UA8 A;  2XXP A;  3SEX A;  3Q29 A;  4OZ9 A;  3SEU A;  5H8Q B;  1LB9 A;  4I9D A;  4IY5 A;  1UTH B;  3MZ9 A;  4Q5T A;  3W9V A;  2OK2 A;  1B3L A;  4X9T A;  2F7A A;  4GXS B;  1MXV A;  4QFO A;  3TTK A;  1A8F A;  4E0X A;  4BDO A;  1FQA A;  4PE5 B;  3T22 A;  4EXL A;  5F1Q A;  2PT1 A;  4UAC A;  3F11 A;  2P0S A;  3VE1 B;  4GOT A;  1IZ1 A;  3KZG A;  4JWX A;  4EQB A;  1SI1 A;  3M8U A;  1N3X A;  1MY3 A;  1NNT A;  3HO7 A;  3QIM A;  2E1S A;  3FV1 A;  2PVU A;  2HCA A;  3ONM A;  4FEB A;  3MP1 A;  5AA4 A;  4ZE9 A;  2DP8 A;  3U1O A;  1XC1 A;  3IB0 A;  4LVQ A;  3TUS A;  1B1H A;  3CSB A;  1US5 A;  1RYX A;  3U94 A;  3PPR A;  1RKM A;  4F19 A;  2UVI A;  5AA4 B;  1GTK A;  4LON B;  1AIV A;  3LUY A;  1SQY A;  2BJJ X;  1YCJ A;  3FVG A;  4GL8 A;  4YKJ A;  2ZYN A;  3CG3 A;  2OWS A;  2ZYK A;  3KN7 A;  5K2X A;  4HTG A;  3CI8 A;  5EHS A;  3GBB A;  4YKP A;  4F18 A;  5DEX B;  1MS7 A;  1UQW A;  3O29 A;  1PDA A;  1S9T A;  2G93 A;  3C34 A;  3T93 B;  2F7C A;  1VFE A;  1QKB A;  1H45 A;  1Z7N E;  5CBR A;  3CFZ A;  1FTM A;  4IGT A;  1J1N A;  4YB6 A;  3ECR A;  2UYF A;  1LGB C;  1DTG A;  5FTI A;  4U21 A;  1A99 A;  1USY H;  2AL5 A;  2IA4 A;  3PUW E;  3OEL A;  4EUO A;  4F2O A;  3JV9 A;  4U1Z A;  1MM7 A;  4BDR A;  3TTM A;  2H9B A;  3BFT A;  4F2Q A;  2O69 A;  5BUU A;  2Q2A A;  1SVX B;  4C1T A;  3ZKK A;  1B7U A;  3VDF A;  2PT2 A;  2DWJ A;  2O68 A;  1BTJ A;  1DTZ A;  4DCY A;  3A3C A;  1IIT A;  4IO4 A;  5AA3 A;  4AB5 A;  3B7D A;  4N13 A;  1M5D A;  2ONR A;  5I56 A;  1B52 A;  3LSX A;  3FVO A;  4Q0C A;  1TWY A;  5H8N A;  4G77 A;  4NWD A;  2QRY A;  2XXV A;  4IO6 A;  4ELQ A;  4O3C A;  4U22 A;  2F6P A;  3K6V A;  2XXY A;  1ZTY A;  5I56 B;  2UYE A;  4X1B A;  3T96 B;  3B6W A;  4RY1 A;  4R6H A;  5H8N B;  4O3B A;  4HS7 A;  3G3I A;  3K1N A;  1MDP 1;  1O64 A;  5I84 A;  1A54 A;  1N84 A;  3O6H A;  4GD5 A;  3OEN A;  4POW A;  1NH8 A;  3C35 A;  4AQ4 A;  1ANF A;  2ONK E;  2NUV A;  3UK4 A;  5DTB A;  2I48 A;  3V8X B;  3RY3 A;  4R74 A;  4U4S A;  1EZ9 A;  3A09 A;  2F34 A;  1WOD A;  4XTC Q;  5AA2 A;  1M5F A;  2PBW A;  3MAM A;  4LAT A;  3FXQ A;  3FZV A;  1SW1 A;  4OWD A;  2HFB A;  3K4U A;  1LFH A;  3RLF E;  5KDT A;  4OEN A;  1LAH E;  3H6U A;  3O6G A;  2P2A A;  3CRB A;  4LUB A;  2R6G E;  1WVJ A;  1B3H A;  1XVY A;  3LSW A;  1I69 A;  3N26 A;  1QW0 A;  2H99 A;  3C32 A;  5B7D A;  4R9F A;  5KDT B;  3KG2 A;  4MFI A;  4OVJ A;  3RGY A;  4EF2 A;  1R1N A;  2F36 A;  2GH9 A;  1GGG A;  3IOW A;  5FHM A;  4TQU Q;  1IXC A;  4ELO A;  3IOU A;  4QFN A;  3KOS A;  2KLF A;  2D21 A;  1DPP A;  1FQB A;  3MPK A;  5FHN A;  4PFY A;  2XXR A;  4MH5 A;  2DVZ A;  3TDJ A;  4F29 A;  1OLC A;  1MPD A;  3RNN A;  1TFA A;  4QSC A;  5EYF A;  1PB9 A;  2DWI A;  3CSG A;  2O7I A;  1QJM A;  3OO8 A;  3OO7 A;  4U23 A;  2I4C A;  3QYT A;  5B70 A;  4IO7 A;  1JW5 A;  4LQ5 A;  3Q25 A;  2O1L A;  1YAE A;  1WDN A;  3FJG A;  1N7X A;  3ZSF A;  2HZK A;  4QSD A;  2I0C A;  1CB6 A;  1QUI A;  1LBC A;  3TEL A;  1B5I A;  4RYA A;  2B3B A;  2Z22 A;  1SYH A;  4AB6 A;  2DYX A;  3EN3 A;  1MXU A;  4OFL A;  1VE4 A;  1MQI A;  4X1D A;  2Y7R A;  1USY E;  2XX7 A;  4F1Y A;  4N07 A;  2ZYM A;  4PQJ A;  3K2D A;  3QUF A;  4ELR A;  5AA2 D;  4LA9 A;  1GV8 A;  3Q27 A;  3SKP A;  2ESN A;  2ZNT A;  1MXZ A;  4FOR A;  1YTV A;  4C0R A;  1XT8 A;  3IOT A;  4ZEI A;  3MUQ A;  1BIY A;  4ECF A;  4ZE8 A;  1MY0 A;  4ZDM A;  4QFL A;  2VD3 A;  1P1Q A;  2V84 A;  3O97 A;  4OMB A;  1XS5 A;  1POY 1;  5H8F A;  3H3G A;  4R73 A;  3N94 A;  3K6W A;  3L6H A;  2A5S A;  1AOV A;  4EQ7 A;  3V83 A;  4NF6 A;  3PPP A;  3VVE A;  1FW0 A;  2B65 A;  2XXW A;  3IB1 A;  2AYS A;  1B0H A;  3BFU A;  2F8D A;  4RXL A;  4OET A;  5H8F B;  1QUJ A;  4XKR A;  2ABH A;  4NED A;  2V3T A;  4BDM A;  4EF1 A;  3PMX A;  2WKY A;  3HHF A;  4NF6 B;  1LST A;  1Q35 A;  2DQV A;  4P11 A;  4LZ5 A;  2OLB A;  4JWO A;  4G8H A;  2YPN A;  1XOC A;  5CM6 A;  1R9Q A;  3A3U A;  1MXW A;  4RA1 A;  4ZZE A;  3MBP A;  4ZEK A;  3MJN A;  2Z8D A;  3MW0 A;  1IXG A;  5ICT A;  5I57 B;  2Y7W A;  1MQH A;  4GXA A;  2DE2 A;  3MQ9 A;  3U72 A;  1R9L A;  1JEV A;  1D4N A;  1LFI A;  2I6E A;  3C33 A;  3LC8 A;  3FJ7 A;  3G3G A;  5IKB A;  2X7P A;  2UVH A;  1FQF A;  4KI0 E;  1SW5 A;  1Y4T A;  4DDD A;  4H0W A;  3S9N C;  4JWY A;  3USD A;  4DXU A;  1LAF E;  3SEV A;  5CBS A;  4IY6 A;  1XHY A;  1Y1Z A;  2GHB A;  3O9P A;  4PFW A;  3L6G A;  4G8N A;  2UXA A;  5TU0 A;  1JEU A;  5BWJ A;  5J1D A;  5IAI A;  4ZEC A;  2F97 A;  1LFG A;  1SI0 A;  1B0L A;  3IOR A;  5K2Y A;  3TKD A;  1PEB A;  3N5L A;  4IO5 A;  1SD3 A;  4YMB A;  4QFK A;  2RC8 A;  3K00 A;  3V5A A;  4F3S A;  4DXB A;  4ZEF A;  4BLA A;  2RF1 A;  5I2N A;  4F22 A;  3MZ1 A;  1P1N A;  5CMB A;  3FV2 A;  3G3K A;  3HST A;  5ITO A;  2RKM A;  1H44 A;  4FE8 A;  4F39 A;  2D3I A;  2HZL A;  2ZNS A;  4F3P A;  3SDF A;  4ZS9 A;  1BKA A;  2QS2 A;  4DLD A;  5I2N B;  4G68 C;  3HPI A;  4Q8R A;  2Q89 A;  4WKM A;  2QMW A;  2Y84 A;  4ZED A;  4FIM A;  4OYV A;  1NL5 A;  3PUZ E;  4KR5 A;  4F3G A;  3OO6 A;  4YB7 A;  1FQD A;  3KSX A;  3VVD A;  4GQO A;  4XIG Q;  3AXF A;  2I58 A;  3R7X A;  3PPN A;  4GWO A;  4XKQ A;  3PUX E;  4U4X A;  4MF3 A;  4KHZ E;  1B5H A;  4TLL B;  4GFR A;  3IR1 A;  1TXF A;  4I1D A;  2ANJ A;  1AH5 A;  4KYD A;  2I3V A;  1Y1M A;  1A8E A;  1DPE A;  1B58 A;  2Q9T A;  1JET A;  4ESX A;  3G3J A;  4OXV A;  1P1O A;  2F78 A;  4TLM B;  1AL3 A;  3S9M C;  1EU8 A;  1JVX A;  3CIJ A;  5L9O A;  4H8I A;  2AIX A;  3UGW A;  2HAU A;  3KJ7 A;  4U2R A;  1FTO A;  2X26 A;  3KFM A;  4YMA A;  3TZA A;  1IXH A;  4G68 A;  3R6U A;  3D4G A;  4KYS A;  2F6G A;  1ELJ A;  4KQP A;  4FEC A;  3HN0 A;  3K1M A;  3FVN A;  4JBZ A;  3RN8 A;  1MDQ A;  3EQ1 A;  4LP2 B;  3DM0 A;  1JNF A;  4G68 B;  3VXB A;  2GFE A;  3IAZ A;  4RNS A;  2GRV A;  1GVC A;  1QKA A;  2ALU A;  4FED A;  2XX9 A;  3QK6 A;  4ONY A;  3RT8 A;  4ND9 A;  3PD9 A;  1IQ7 A;  3Q26 A;  5ELV A;  5DYH A;  2QSX A;  1ZLQ A;  3DLN A;  3UN6 A;  2GHA A;  3T9H B;  4OES A;  3EHS A;  2Z8F A;  2ONS A;  2H5Y A;  2DE3 A;  4P0I A;  2YJP A;  1UTB A;  3PUV E;  5LOM A;  2O1M A;  3JYR A;  1N7W A;  1ZJL A;  4YU0 A;  4H1X A;  4WEP A;  3C36 A;  1AMF A;  1M5C A;  3RTF B;  3S9L C;  2LAO A;  1UTB B;  4IO2 A;  3TTN A;  3B6T A;  4Z7E A;  1F9B A;  2PMS A;  5AE4 A;  1UIU A;  5AA2 B;  1BLF A;  3LSL A;  3B6Q A;  3OEK A;  2ZYO A;  4ZZA A;  5ITP A;  2I4B A;  4NF5 A;  1Y3N A;  4KCD A;  4NMY A;  1MH4 A;  3BBR A;  2Z23 A;  1A40 A;  2RCB A;  4G2Z A;  3MPL A;  3RTW B;  4PFT A;  4NF5 B;  3TEP A;  3TMG A;  2DXY A;  4RPN A;  1MRP A;  4KFQ A;  4C1U A;  3E3K A;  1DOT A;  5L8D A;  1A7L A;  3JZJ A;  1YPN A;  4QF9 A;  5M2V A;  1KWH A;  3DP6 A;  5JTY A;  2IEE A;  3FXR A;  1P99 A;  5JK4 A;  4OQO A;  1N04 A;  5DVJ A;  1LAX A;  3MVY A;  1LCF A;  3LSF B;  4FAJ A;  2I49 A;  3ILU B;  1NNP A;  5JTY B;  1PBQ A;  3TCF A;  3TQW A;  3IX1 A;  1IXI A;  4R9G A;  4GVO A;  1B7H A;  2V93 A;  2F35 A;  2A5T A;  1D3K A;  3KJT A;  2X7Q A;  4QHQ A;  3H06 B;  4QSE A;  3WAF A;  2I3W A;  1MPB A;  4BDQ A;  3Q28 A;  4H5G A;  2VOZ A;  3H03 A;  2AL4 A;  4G4P A;  3ZKL A;  3OEM A;  4KYE A;  4K3F A;  5A5X A;  1R6Z A;  1P1W A;  1N3W A;  3V89 B;  4DIG A;  2A5T B;  4JDF A;  3QUJ A;  4YIC A;  1B4Z A;  1OQH A;  3DP8 A;  1I6B A;  1HSJ A;  3OXN A;  2QS3 A;  1S50 A;  3OOA A;  5I58 A;  5H8S A;  3EHT A;  3ODB A;  2FA7 A;  1B2H A;  1L5T A;  5A5X B;  3GXA A;  4F1V A;  1ZBM A;  1JVY A;  3S4U A;  4RPO A;  4NWC A;  1SDX A;  3T9X B;  3K6X A;  3MC2 A;  1FQE A;  3T66 A;  4IO3 A;  3KN3 A;  1PB8 A;  3M3L A;  4RK9 A;  4DZ1 A;  1OLA A;  1Y3Q A;  5TP9 A;  1NMU A;  4LZ8 A;  2OBG A;  3N6U A;  2Q88 A;  2XXQ A;  4R6K A;  1FQC A;  4GL0 A;  1IEJ A;  4YKI A;  2DWA A;  3CVG A;  1POT A;  1MXX A;  1B05 A;  3C9H A;  2HXW A;  5TP9 B;  3KGC A;  4HCY A;  2H98 A;  1Z7M E;  4ELP A;  5HM4 B;  1CE2 A;  3PGF A;  2Y7P A;  1Y20 A;  4QRZ A;  4GIZ A;  3IJX B;  4OTE A;  4X48 A;  4PP0 A;  1B9J A;  4LZ7 A;  2DOJ A;  2RC9 A;  2PX1 A;  1B40 A;  2XXU A;  3PUY E;  1A55 A;  1H43 A;  1URD A;  4THI A;  3PPO A;  1S7Y A;  4PFU A;  3R26 A;  2W7Y A;  4XXU A;  2I0B A;  2V3U A;  5DVF A;  1Y3P A;  2E0S A;  1URS A;  1Y9U A;  3FVK A;  4P0G A;  3K01 A;  4L17 A;  4NE4 A;  3G3F A;  2CMO A;  1HSE A;  3TOD A;  3SER A;  4QFP A;  3M3F A;  4OER A;  1P1U A;  4F3B A;  5FHO A;  3M3K A;  2XHD A;  1HSL A;  3E13 X;  3TAJ A;  3N6T A;  1QUK A;  4JXI A;  3MVZ A;  1SW4 A;  2HEU A;  5CMM A;  1PC3 A;  3QXM A;  3U93 A;  4XKN A;  4KD5 A;  2OWT A;  2V3Q A;  3H6V A;  1M5E A;  4U1O A;  3VV5 A;  5HPQ A;  3IJO B;  2RIN A;  3KN8 A;  4YAH X;  4OHN A;  3SES A;  2RCA A;  2FYI A;  1II5 A;  4F1U A;  5FTH A;  3RUM A;  4BDN A;  2QMX A;  3I5O A;  3UP9 A;  3PPQ A;  4OFJ A;  2XXX A;  3S2V A;  1B4H A;  1OMP A;  2ZMB A;  2F7B A;  3H4Z A;  3TYH A;  1B3F A;  4N6P A;  3I3V A;  1ZU0 A;  1NNF A;  3IB2 A;  2UVJ A;  3LBS A;  1H76 A;  1EH3 A;  1DSN A;  4Q30 B;  3RT6 B;  1B1X A;  1M5B A;  4G8M A;  1NKX A;  1B5J A;  1MXY A;  5CC2 A;  2UVG A;  4GRK A;  3EPE A;  2QS4 A;  1MPC A;  3HHG A;  5EHM A;  4RK2 A;  5DEX A;  2XXH A;  3EHU A;  3BKI B;  2XD3 A;  1GR2 A;  3QSL A;  3H6T A;  3HV1 A;  3MP8 A;  4EQ9 A;  3FAS A;  3RPW A;  4JB7 A;  4DXC A;  1SW2 A;  3THI A;  2XD2 A;  2QPQ A;  4DE8 A;  1LLS A;  1H3D A;  4R2B A;  4HW8 A;  1XVX A;  1RYO A;  3O28 A;  1US4 A;  3S9E A;  1JW1 A;  3ILT B;  3CG1 A;  1MG1 A;  3K1P A;  5CI5 A;  3FXU A;  1NFT A;  2NXO A;  3SET A;  1MH3 A;  3IL1 B;  3P7I A;  2XX8 A;  2ZXT A;  3LR1 A;  3FAT A;  4OEV A;  3GBA A;  2QL3 A;  1O7T A;  1NNK A;  1ZMG A;  2DVC A;  3KSJ A;  1LCT A;  2R71 A;  2QJE A;  3SEY A;  3U8Q A;  3KEI A;  5JEI A;  1B46 A;  3QAX A;  3GZG A;  2F5X A;  2FNC A;  3PD8 A;  1O63 A;  3UIF A;  4IGR A;  1FTK A;  2Z8E A;  4JSO A;  2QS1 A;  4PET A;  4DCX A;  1B32 A;  1LAG E;  1B7Z A;  4I62 A;  3MP6 A;  5KZT A;  4Z0I A;  5DVI A;  4NF8 A;  3CFL A;  4YB5 A;  2NOO A;  3HCQ A;  2H25 A;  3PU5 A;  2VD2 A;  3IO6 A;  1BP5 A;  4EDP A;  3OSQ A;  2P1S A;  1OIB A;  2DS9 A;  2VGQ A;  5AA1 A;  3G7W A;  1PB7 A;  3CR9 A;  3TTR A;  3C31 A;  3OMB A;  4NF8 B;  3EF7 A;  3K6U A;  4ESW A;  4EXK A;  5KCJ A;  1Q1K A;  3UOR A;  5F7V A;  2VHA A;  4F31 B;  1MQJ A;  4FJP A;  1EZO A;  4OEU A;  3TCH A;  1QVS A;  5CMK A;  5ICQ A;  5KCJ B;  4MLV A;  1VSO A;  1T0K A;  4H65 A;  4H6D A;  3O2A A;  5CMC A;  3H6W A;  2DSF A;  2D5W A;  3TQL A;  1B3G A;  3PMW A;  3VLU A;  1D9Y A;  2OJT A;  1VFD A;  2XXT A;  1B51 A;  1Y4C A;  1QUL A;  3TFL A;  2O7U A;  2V25 A;  1ZIU A;  4UA8 A;  2G29 A;  3DEL B;  3VXC A;  1VR5 A;  4WED A;  3E4R A;  3H7M A;  4GLI A;  4XKP A;  4M4G A;  1B3E A;  3VLW A;  1NH7 A;  3TPA A;  3T9V A;  3KBR A;  1PBP A;  4H5F A;  1OVB A;  2ZNU A;  4JSD A;  4OFO A;  4WXJ A;  4O3A A;  4I8C A;  3K02 A;  3T9U A;  4E0W A;  1JW4 A;  4ISU A;  1OVT A;  3FJM A;  2VP1 A;  2O6A A;  1D9V A;  3I6V A;  4MLQ A;  1FTL A;  1B6H A;  1LB8 A;  1MY2 A;  1JQF A;  3IO4 A;  2RC7 A;  1ATG A;  1DMB A;  3CFX A;  3O6I A;  3C4M A;  1MM6 A;  1MY1 A;  1FTJ A;  3W15 C;  3FIR A;  1FCK A;  3GLB A;  4YKK A;  4YZZ A;  5L9S A;  5TPA A;  4R72 A;  5H8H A;  2O84 X;  2O51 A;  5DT6 A;  1LBB A;  3OO9 A;  4H8J A;  3W9W A;  2Y7K A;  3SEW A;  2REJ A;  3OD7 A;  3MVW A;  5ISU A;  4MBP A;  2DXR A;  2Y7I A;  4LQ2 A;  3PV0 E;  2REG A;  1MQD A;  3FD3 A;  1OQG A;  5TPA B;  1TFD A;  2YLN A;  3KOT A;  2M8C A;  5H8H B;  4NF4 A;  3WAE A;  3D4C A; 
#chains in the Genus database with same CATH topology
 2OZZ A;  1LBX A;  2HAV A;  5I58 B;  1UIV A;  4BDL A;  3MVX A;  2NWJ A;  2DWH A;  4MAG A;  1SBP A;  3TTL A;  2WYP A;  2HQ0 A;  5CRY A;  4KCC A;  2CZL A;  4TOZ A;  3IOV A;  4GF8 A;  2PFZ A;  3FXB A;  1N76 A;  4NF4 B;  4R6Y A;  3U92 A;  3IK6 B;  2PCR A;  4R2F A;  3OSR A;  4R75 A;  1IIW A;  5HBC A;  5I2K A;  4IB2 A;  3RQT A;  4P1E A;  1FBE A;  3K0V A;  3PMV A;  2Y5K A;  3O66 A;  3G3H A;  2Q8M A;  4P47 A;  3MWB A;  5I59 A;  4FBP A;  2R9J A;  1EZP A;  3VFJ A;  2THI A;  3VVF A;  3MZB A;  5I2K B;  1FBF A;  4M1V A;  2FBP A;  3FUZ A;  4POX A;  1URG A;  3ZS6 A;  2OCU A;  2CZI A;  2XWK A;  3BIH A;  5I57 A;  2PYY A;  4I3E A;  3VLV A;  3DP4 A;  5I59 B;  2DE4 A;  1IUD A;  1N0T A;  1SYI A;  4HCW A;  5ET6 A;  2P3N A;  3KBZ A;  1ZKB A;  4OVT A;  1I6A A;  2XXI A;  4NTL A;  1TT1 A;  3TCG A;  1MY4 A;  4KPT A;  4H67 A;  3EKI A;  2B3F A;  5H8Q A;  3E9X A;  2H4I A;  4ZEB A;  1I6Q A;  1LBW A;  4HE2 A;  1RDY A;  1UTH A;  5L9M A;  1MQG A;  4FAT A;  2Q2C A;  2Q8J A;  3FGS A;  2NVU B;  4RJZ A;  3UA8 A;  2XXP A;  3SEX A;  1EYJ A;  3Q29 A;  5I3S A;  4OZ9 A;  3SEU A;  3T0J A;  5H8Q B;  4MIJ A;  3BIG A;  1LB9 A;  4I9D A;  4IY5 A;  1UTH B;  3MZ9 A;  4H45 A;  4Q5T A;  1FSA A;  3W9V A;  2OK2 A;  1B3L A;  4PDD A;  4X9T A;  2F7A A;  4GXS B;  1MXV A;  4QFO A;  3TTK A;  4OA4 A;  1A8F A;  1IMD A;  2WYK A;  4E0X A;  4O8M A;  4BDO A;  1FQA A;  4PE5 B;  3T22 A;  4EXL A;  5F1Q A;  2PT1 A;  4UAC A;  3F11 A;  2P0S A;  4MNC A;  4X04 A;  4NX1 A;  3VE1 B;  5EQ7 A;  4GOT A;  1IZ1 A;  3KZG A;  4JWX A;  5EYH A;  4EQB A;  1SI1 A;  3M8U A;  1N3X A;  1MY3 A;  1NNT A;  3HO7 A;  3QIM A;  2E1S A;  3FV1 A;  2PVU A;  1K9Y A;  5LDZ A;  2HCA A;  3ONM A;  1NV2 A;  4FEB A;  3MP1 A;  5AA4 A;  4ZE9 A;  2DP8 A;  3U1O A;  1XC1 A;  3IB0 A;  4LVQ A;  3TUS A;  1B1H A;  3T1B A;  3CSB A;  1US5 A;  1FPF A;  1EYK A;  1RYX A;  3U94 A;  3PPR A;  2DDK A;  5A5L A;  4I3Y A;  1RKM A;  4GWX A;  4GBW A;  4F19 A;  2UVI A;  4PBQ A;  5AA4 B;  1GTK A;  4LON B;  1AIV A;  3LUY A;  1SQY A;  2OWZ A;  3ROJ A;  2BJJ X;  1YCJ A;  3FVG A;  4GL8 A;  4YKJ A;  2ZYN A;  1IMF A;  3CG3 A;  2OWS A;  2ZYK A;  3KN7 A;  5K2X A;  4HTG A;  3CI8 A;  5EHS A;  3GBB A;  4YKP A;  3KC0 A;  4F18 A;  5DEX B;  1MS7 A;  1UQW A;  3O29 A;  4AS5 A;  1PDA A;  1S9T A;  2G93 A;  3C34 A;  4GWZ A;  2F7C A;  1VFE A;  3T93 B;  1QKB A;  3HFU A;  4MNP A;  1H45 A;  1Z7N E;  5CBR A;  3CFZ A;  1FTM A;  4DI3 D;  4IGT A;  1J1N A;  4YB6 A;  3ECR A;  2UYF A;  1LGB C;  1DTG A;  5FTI A;  4U21 A;  1A99 A;  1USY H;  1EYI A;  5EQA A;  2AL5 A;  2IA4 A;  3PUW E;  3OEL A;  4EUO A;  4F2O A;  5LTC A;  3JV9 A;  4U1Z A;  1MM7 A;  4BDR A;  3TTM A;  2H9B A;  3BFT A;  2XWI A;  4F2Q A;  2O69 A;  5BUU A;  3D1R A;  2Q2A A;  1SVX B;  4C1T A;  3ZKK A;  1B7U A;  1K9Z A;  3VDF A;  2PT2 A;  2DWJ A;  2O68 A;  1BTJ A;  1CNQ A;  1DTZ A;  4DCY A;  3A3C A;  1IIT A;  5IGA A;  4IO4 A;  5AA3 A;  4AB5 A;  3B7D A;  4AS4 A;  1JP4 A;  1M5D A;  4N13 A;  2ONR A;  5I56 A;  1B52 A;  3LSX A;  1G0I A;  3FVO A;  4Q0C A;  1TWY A;  5H8N A;  4G77 A;  4NWD A;  2QRY A;  2XXV A;  4IO6 A;  4ELQ A;  4O3C A;  4U22 A;  2F6P A;  3K6V A;  2XXY A;  1ZTY A;  5I56 B;  2UYE A;  4X1B A;  3T96 B;  3B6W A;  3GYY A;  4RY1 A;  4R6H A;  5H8N B;  4O3B A;  1YXI A;  4HS7 A;  3G3I A;  3K1N A;  1O64 A;  1MDP 1;  5I84 A;  1A54 A;  1N84 A;  3O6H A;  4GD5 A;  3OEN A;  4POW A;  1NH8 A;  3C35 A;  4AQ4 A;  1ANF A;  1IMC A;  2ONK E;  4N6D A;  2NUV A;  3UK4 A;  5DTB A;  2I48 A;  3V8X B;  3RY3 A;  4R74 A;  4U4S A;  1EZ9 A;  3A09 A;  2F34 A;  1WOD A;  4XTC Q;  5AA2 A;  1M5F A;  2PBW A;  3MAM A;  4LAT A;  3FXQ A;  3FZV A;  1SW1 A;  4JVI A;  4OWD A;  2HFB A;  3K4U A;  4NN3 A;  1LFH A;  3RLF E;  5KDT A;  4MNI A;  2F3B A;  4N6K A;  4OEN A;  1LAH E;  3H6U A;  3O6G A;  2P2A A;  3CRB A;  4LUB A;  2R6G E;  1WVJ A;  1B3H A;  1XVY A;  3LSW A;  4NG7 A;  1I69 A;  2OX3 A;  3N26 A;  2ZZW A;  1QW0 A;  3SZP A;  2H99 A;  3C32 A;  5B7D A;  1NUY A;  4R9F A;  5KDT B;  3KG2 A;  4MFI A;  4OVJ A;  3RGY A;  4EF2 A;  1R1N A;  2F36 A;  2GH9 A;  1GGG A;  3IOW A;  5FHM A;  1NV6 A;  4TQU Q;  1IXC A;  4ELO A;  3IOU A;  4QFN A;  3KOS A;  2KLF A;  1FPE A;  2D21 A;  1DPP A;  1FQB A;  3MPK A;  1DCU A;  5FHN A;  4PFY A;  2XXR A;  4MH5 A;  2DVZ A;  3TDJ A;  4F29 A;  1OLC A;  1MPD A;  3RNN A;  1TFA A;  4QSC A;  5EYF A;  1PB9 A;  2DWI A;  3CSG A;  2O7I A;  1QJM A;  1NI9 A;  2HXR A;  3OO8 A;  3OO7 A;  1FBC A;  4U23 A;  2I4C A;  3QYT A;  5B70 A;  1QGX A;  4IO7 A;  4N8Y A;  1JW5 A;  4LQ5 A;  3Q25 A;  2O1L A;  1YAE A;  2B4M A;  1WDN A;  3FJG A;  1N7X A;  4PFB A;  4P8B A;  3ZSF A;  2HZK A;  4G61 A;  4N91 A;  4QSD A;  2I0C A;  5F24 A;  1CB6 A;  1QUI A;  1LBC A;  3TEL A;  1B5I A;  2HHM A;  4RYA A;  3MYU A;  2B3B A;  2Z22 A;  4LN5 A;  1SYH A;  4AB6 A;  2DYX A;  2XWV A;  3EN3 A;  2JJK A;  1MXU A;  4OFL A;  1VE4 A;  1MQI A;  4X1D A;  2Y7R A;  3QMF A;  1USY E;  4NAP A;  2XX7 A;  4F1Y A;  4N07 A;  3IFC A;  2ZYM A;  4PQJ A;  3K2D A;  3QUF A;  4ELR A;  5AA2 D;  4LA9 A;  1FRP A;  1GV8 A;  3Q27 A;  3SKP A;  2ESN A;  2ZNT A;  1MXZ A;  4FOR A;  1YTV A;  4C0R A;  1XT8 A;  4IR8 A;  3IOT A;  4ZEI A;  3MUQ A;  1BIY A;  4ECF A;  4ZE8 A;  1MY0 A;  4ZDM A;  4QFL A;  2VD3 A;  1P1Q A;  2V84 A;  3O97 A;  4OMB A;  1XS5 A;  4PAK A;  1POY 1;  2ZZX A;  4N15 A;  5H8F A;  3H3G A;  4R73 A;  3N94 A;  3K6W A;  3L6H A;  2A5S A;  1AOV A;  4EQ7 A;  3V83 A;  4NF6 A;  3PPP A;  3VVE A;  1FW0 A;  2B65 A;  2XXW A;  3IB1 A;  2AYS A;  1B0H A;  3BFU A;  2F8D A;  4RXL A;  4OET A;  5H8F B;  1QUJ A;  5ET7 A;  5EYG A;  4XKR A;  2ABH A;  4NED A;  1NUW A;  2V3T A;  4BDM A;  4EF1 A;  3PMX A;  1FJ9 A;  2WKY A;  3HHF A;  3LUZ A;  4NF6 B;  1FJ6 A;  1LST A;  1Q35 A;  2DQV A;  4P11 A;  4LZ5 A;  2OLB A;  4JWO A;  4G8H A;  1NV1 A;  2YPN A;  1XOC A;  5CM6 A;  4XF5 A;  1R9Q A;  3A3U A;  1MXW A;  2P3V A;  4RA1 A;  4ZZE A;  3MBP A;  4ZEK A;  3MJN A;  1FPI A;  4NF0 A;  2Z8D A;  3MW0 A;  1IXG A;  5ICT A;  5I57 B;  2Y7W A;  3ISP A;  1MQH A;  4GXA A;  2DE2 A;  3MQ9 A;  3U72 A;  1R9L A;  1JEV A;  1D4N A;  1LFI A;  1INP A;  2I6E A;  3C33 A;  3LC8 A;  4PFI A;  3FJ7 A;  3G3G A;  2WEF A;  5IKB A;  2X7P A;  2UVH A;  1FQF A;  4KI0 E;  1SW5 A;  1Y4T A;  4DDD A;  4MCO A;  4H0W A;  3S9N C;  4JWY A;  3USD A;  4DXU A;  1LAF E;  3SEV A;  5CBS A;  4IY6 A;  1XHY A;  1Y1Z A;  2GHB A;  3O9P A;  4PFW A;  3L6G A;  4O7I A;  4G8N A;  2UXA A;  5TU0 A;  1JEU A;  5BWJ A;  5J1D A;  5IAI A;  4ZEC A;  2F97 A;  1LFG A;  1SI0 A;  3KC1 A;  1B0L A;  3IOR A;  5K2Y A;  4GWU A;  3TKD A;  1PEB A;  3N5L A;  4IO5 A;  1SD3 A;  4YMB A;  4QFK A;  2RC8 A;  3K00 A;  3V5A A;  4F3S A;  4DXB A;  4GWY A;  2QVR A;  4ZEF A;  4BLA A;  2RF1 A;  4OAN A;  5I2N A;  4F22 A;  3MZ1 A;  1P1N A;  5CMB A;  3FV2 A;  3G3K A;  3HST A;  5ITO A;  2RKM A;  1H44 A;  4FE8 A;  4GWS A;  2D3I A;  4F39 A;  2HZL A;  2ZNS A;  4F3P A;  3SDF A;  4ZS9 A;  2FHY A;  1BKA A;  2QS2 A;  4DLD A;  4HXV A;  5I2N B;  4G68 C;  3HPI A;  4Q8R A;  1KA0 A;  2Q89 A;  4WKM A;  2QMW A;  2Y84 A;  4ZED A;  4FIM A;  4OYV A;  1NL5 A;  3PUZ E;  4KR5 A;  4F3G A;  3OO6 A;  4YB7 A;  4HE1 A;  1FQD A;  3U65 A;  3KSX A;  3VVD A;  1NV0 A;  4GQO A;  4XIG Q;  3AXF A;  2I58 A;  4NQ8 A;  1NV3 A;  3R7X A;  3PPN A;  4GWO A;  4XKQ A;  3PUX E;  4U4X A;  4MF3 A;  4KHZ E;  1B5H A;  4TLL B;  4GFR A;  3IR1 A;  1TXF A;  4I1D A;  2ANJ A;  1AH5 A;  4KYD A;  2I3V A;  1Y1M A;  1A8E A;  1DPE A;  1AWB A;  1B58 A;  2Q9T A;  1JET A;  4ESX A;  3G3J A;  4OXV A;  1P1O A;  2F78 A;  4TLM B;  4PDH A;  1AL3 A;  3S9M C;  1EU8 A;  1JVX A;  3CIJ A;  5L9O A;  2QFL A;  4H8I A;  2AIX A;  3UGW A;  2HAU A;  3KJ7 A;  4U2R A;  1FTO A;  2X26 A;  3KFM A;  4YMA A;  3TZA A;  1IXH A;  4G68 A;  4GWW A;  1FPL A;  3R6U A;  3D4G A;  4KYS A;  2F6G A;  1ELJ A;  4XFE A;  4KQP A;  4PC9 A;  1D9Q A;  4O7M A;  4FEC A;  3HN0 A;  1DK4 A;  3K1M A;  5ET8 A;  3FVN A;  4JBZ A;  3RN8 A;  1MDQ A;  1Q9D A;  3EQ1 A;  4LP2 B;  3DM0 A;  1JNF A;  4G68 B;  3VXB A;  1FPG A;  2GFE A;  3IAZ A;  4N4U A;  4RNS A;  2GRV A;  1GVC A;  1QKA A;  2ALU A;  4FED A;  2XX9 A;  3QK6 A;  4ONY A;  3RT8 A;  4ND9 A;  3PD9 A;  1IQ7 A;  3Q26 A;  5ELV A;  5DYH A;  2QSX A;  1ZLQ A;  3DLN A;  3UN6 A;  2GHA A;  3T9H B;  2CZH A;  4OES A;  3EHS A;  2Z8F A;  2ONS A;  2H5Y A;  2DE3 A;  4P0I A;  4PBH A;  3RPL A;  2YJP A;  3PTY A;  1KZ8 A;  1UTB A;  3PUV E;  5LOM A;  2O1M A;  3JYR A;  1N7W A;  1ZJL A;  4YU0 A;  4H1X A;  4WEP A;  3B8B A;  3C36 A;  1AMF A;  1M5C A;  3RTF B;  3S9L C;  2LAO A;  3RPL B;  5IM2 A;  1FPK A;  1UTB B;  4NHB A;  4IO2 A;  3TTN A;  3B6T A;  4Z7E A;  1F9B A;  2PMS A;  5AE4 A;  2PFY A;  1UIU A;  1NV4 A;  1BLF A;  3LSL A;  5AA2 B;  3B6Q A;  3OEK A;  4NGU A;  2ZYO A;  1G0H A;  4ZZA A;  5ITP A;  2I4B A;  2KR0 A;  4NF5 A;  1Y3N A;  4KCD A;  4NMY A;  4MMP A;  1MH4 A;  3BBR A;  2Z23 A;  4P56 A;  2QVU A;  1A40 A;  1LBY A;  2RCB A;  4G2Z A;  3MPL A;  5IZ3 A;  3RTW B;  4PFT A;  4NF5 B;  3TEP A;  3TMG A;  2DXY A;  4RPN A;  1MRP A;  5J16 A;  4PTK A;  4KFQ A;  2WX9 A;  3MST A;  4C1U A;  3E3K A;  5IZ3 B;  1DOT A;  5L8D A;  1A7L A;  3JZJ A;  1YPN A;  4QF9 A;  5M2V A;  1KWH A;  3DP6 A;  5JTY A;  2IEE A;  3FXR A;  1P99 A;  5JK4 A;  4OQO A;  4QXD A;  1N04 A;  5DVJ A;  1LAX A;  3MVY A;  1LCF A;  1SPI A;  3LSF B;  4FAJ A;  1NV5 A;  2I49 A;  3ILU B;  1NNP A;  2BJI A;  5JTY B;  1PBQ A;  3TCF A;  4GBV A;  3TQW A;  3IX1 A;  1IXI A;  4R9G A;  4GVO A;  2L5V A;  1B7H A;  4H46 A;  2V93 A;  2F35 A;  1KA1 A;  1FTA A;  4PF8 A;  1FBH A;  2A5T A;  1D3K A;  3KJT A;  2X7Q A;  4QHQ A;  3H06 B;  4QSE A;  3WAF A;  2I3W A;  2CZK A;  1MPB A;  4PFR A;  4BDQ A;  3Q28 A;  4H5G A;  4QBA A;  2VOZ A;  3H03 A;  2AL4 A;  4OVP A;  4G4P A;  3ZKL A;  3OEM A;  4KYE A;  4K3F A;  5A5X A;  1R6Z A;  1P1W A;  1N3W A;  3V89 B;  4DIG A;  2A5T B;  4JDF A;  4I40 A;  3QUJ A;  4YIC A;  1B4Z A;  1OQH A;  3DP8 A;  1I6B A;  1HSJ A;  3OXN A;  2QS3 A;  1S50 A;  3OOA A;  5I58 A;  3A29 A;  5H8S A;  2ZZV A;  3EHT A;  3ODB A;  2FA7 A;  1B2H A;  1L5T A;  4OVQ A;  5A5X B;  3GXA A;  5IZ1 A;  1ZBM A;  4F1V A;  1JVY A;  2R8T A;  1XI6 A;  3S4U A;  4RPO A;  4NWC A;  1SDX A;  3T9X B;  2V4C A;  3K6X A;  3MC2 A;  1FQE A;  3T66 A;  3E79 A;  4IO3 A;  3KN3 A;  1PB8 A;  3M3L A;  4RK9 A;  4DZ1 A;  1OLA A;  1Y3Q A;  4DI4 B;  5TP9 A;  1NMU A;  4LZ8 A;  2OBG A;  1YZ0 A;  3N6U A;  2Q88 A;  2XXQ A;  4X8R A;  4P3L A;  4R6K A;  1FQC A;  4GL0 A;  1IEJ A;  4YKI A;  2DWA A;  1NV7 A;  3CVG A;  1POT A;  1MXX A;  1B05 A;  3C9H A;  2HXW A;  5TP9 B;  2XWO A;  3KGC A;  4HCY A;  2H98 A;  2KQZ A;  1Z7M E;  4ELP A;  2VPN A;  5HM4 B;  1CE2 A;  3PGF A;  2Y7P A;  1Y20 A;  4QRZ A;  4GIZ A;  3IJX B;  4OTE A;  4X48 A;  4PP0 A;  1B9J A;  4LZ7 A;  2DOJ A;  2RC9 A;  2PX1 A;  1B40 A;  2XXU A;  3PUY E;  1DBZ A;  1A55 A;  1H43 A;  1FPD A;  1BK4 A;  1URD A;  4THI A;  2VT5 A;  2XXK A;  5ESY A;  3PPO A;  5ET5 A;  1S7Y A;  1IMA A;  4PFU A;  3R26 A;  2W7Y A;  4XXU A;  2WBD A;  2I0B A;  2V3U A;  5DVF A;  1Y3P A;  2E0S A;  1URS A;  1Y9U A;  3FVK A;  4P0G A;  3K01 A;  4L17 A;  4NE4 A;  3G3F A;  2CMO A;  4GX6 A;  1HSE A;  3TOD A;  3SER A;  4QFP A;  3M3F A;  4OER A;  1P1U A;  4F3B A;  3IFA A;  5FHO A;  3M3K A;  2XHD A;  4MX6 A;  4PGN A;  1HSL A;  3E13 X;  3TAJ A;  3N6T A;  1QUK A;  4OVS A;  4JXI A;  3MVZ A;  1VDW A;  1FBP A;  1SW4 A;  2HEU A;  2B4L A;  3RYD A;  5I7I A;  5CMM A;  1PC3 A;  3QXM A;  3U93 A;  4XKN A;  4KD5 A;  2CEY A;  2OWT A;  2WBB A;  2V3Q A;  3H6V A;  1M5E A;  4U1O A;  3VV5 A;  5HPQ A;  3IJO B;  2RIN A;  3KN8 A;  4YAH X;  4OHN A;  3SES A;  2RCA A;  2FVZ A;  2FYI A;  1II5 A;  4F1U A;  5FTH A;  3RUM A;  4BDN A;  2QMX A;  3I5O A;  3UP9 A;  2FIX A;  3PPQ A;  4OFJ A;  2XXX A;  3S2V A;  1B4H A;  1OMP A;  2ZMB A;  4UAB A;  2F7B A;  3H4Z A;  3TYH A;  3LV0 A;  1B3F A;  4N6P A;  3I3V A;  1ZU0 A;  1NNF A;  3IB2 A;  2UVJ A;  1IMB A;  3LBS A;  1H76 A;  1EH3 A;  1DSN A;  4Q30 B;  3RT6 B;  1B1X A;  1M5B A;  4G8M A;  1NKX A;  1B5J A;  1MXY A;  5CC2 A;  2QVV A;  2UVG A;  4GRK A;  3EPE A;  2QS4 A;  1MPC A;  3HHG A;  5EHM A;  4RK2 A;  5DEX A;  2XXH A;  3EHU A;  3BKI B;  2GQ1 A;  2XD3 A;  1GR2 A;  3QSL A;  3H6T A;  3HV1 A;  3MP8 A;  2F3D A;  4EQ9 A;  3FAS A;  3RPW A;  4JB7 A;  4DXC A;  1SW2 A;  3THI A;  2XD2 A;  2QPQ A;  4DE8 A;  3B50 A;  1LLS A;  1H3D A;  4R2B A;  4HW8 A;  2HPG A;  1XVX A;  1RYO A;  1NUZ A;  3O28 A;  1US4 A;  3S9E A;  1JW1 A;  3ILT B;  3CG1 A;  1MG1 A;  3K1P A;  5CI5 A;  3FXU A;  1NFT A;  2NXO A;  3SET A;  1MH3 A;  5EQ8 A;  4GX3 A;  3IL1 B;  4MEV A;  4O94 A;  3P7I A;  1YYZ A;  2XX8 A;  2ZXT A;  3LR1 A;  3FAT A;  4OEV A;  1FPB A;  3GBA A;  2QL3 A;  1O7T A;  1NNK A;  5T3J A;  1ZMG A;  2DVC A;  1RDX A;  3KSJ A;  1LCT A;  3E78 A;  5I5P A;  2R71 A;  2QJE A;  3SEY A;  3U8Q A;  3KEI A;  5JEI A;  1B46 A;  3QAX A;  3GZG A;  2F5X A;  2FNC A;  3PD8 A;  1O63 A;  2VPO A;  1IME A;  3UIF A;  4IGR A;  1FTK A;  2Z8E A;  4JSO A;  2QS1 A;  4PET A;  4DCX A;  1B32 A;  1LAG E;  1B7Z A;  4I62 A;  3MP6 A;  5KZT A;  4Z0I A;  2MKZ A;  4KXP A;  5DVI A;  4NF8 A;  3CFL A;  5IZZ A;  4YB5 A;  2NOO A;  3HCQ A;  2H25 A;  3PU5 A;  2VD2 A;  3IO6 A;  1BP5 A;  4EDP A;  1LEV A;  3OSQ A;  2P1S A;  1OIB A;  2DS9 A;  2VGQ A;  4JVC A;  5AA1 A;  3G7W A;  1PB7 A;  3CR9 A;  3TTR A;  3C31 A;  2XA5 A;  3OMB A;  4NF8 B;  3EF7 A;  3K6U A;  4ESW A;  4EXK A;  3CHG A;  5KCJ A;  2Q74 A;  1Q1K A;  4P9K A;  3UOR A;  5F7V A;  2VHA A;  4F31 B;  4FJP A;  1MQJ A;  1EZO A;  4OEU A;  3TCH A;  4PE3 A;  1QVS A;  4N8G A;  5CMK A;  5ICQ A;  5KCJ B;  4MLV A;  4PAF A;  1VSO A;  1T0K A;  4H65 A;  4H6D A;  3O2A A;  5CMC A;  3H6W A;  2DSF A;  2D5W A;  3TQL A;  1B3G A;  3PMW A;  3VLU A;  4PCD A;  1D9Y A;  2OJT A;  1VFD A;  5DW8 A;  2XXT A;  1B51 A;  1Y4C A;  1QUL A;  3TFL A;  4GX4 A;  2O7U A;  2V25 A;  1ZIU A;  4UA8 A;  2G29 A;  3DEL B;  4OVR A;  3VXC A;  1VR5 A;  4WED A;  3E4R A;  1FBD A;  3H7M A;  4GLI A;  4XKP A;  4M4G A;  1B3E A;  2CEX A;  2FIE A;  3VLW A;  1NH7 A;  3TPA A;  3T9V A;  3KBR A;  5FBP A;  1PBP A;  4H5F A;  1LBV A;  4N81 A;  1OVB A;  2ZNU A;  4JSD A;  4OFO A;  4WXJ A;  4O3A A;  4I8C A;  4MJO A;  3K02 A;  3T9U A;  4E0W A;  1JW4 A;  4ISU A;  3FBP A;  1OVT A;  3FJM A;  4PF6 A;  2VP1 A;  2O6A A;  1D9V A;  3I6V A;  4MLQ A;  1FTL A;  1B6H A;  4HE0 A;  1LB8 A;  1FPJ A;  1MY2 A;  1JQF A;  3IO4 A;  2RC7 A;  1ATG A;  1FBG A;  1DMB A;  3CFX A;  3O6I A;  3C4M A;  1MM6 A;  4JVD A;  1MY1 A;  1FTJ A;  3W15 C;  3FIR A;  1FCK A;  3GLB A;  2Y5L A;  4YKK A;  1LBZ A;  4YZZ A;  5L9S A;  5TPA A;  4N17 A;  4R72 A;  5H8H A;  2O84 X;  2O51 A;  5DT6 A;  1LBB A;  3OO9 A;  4PAI A;  4H8J A;  1RDZ A;  2Y7K A;  3SEW A;  3W9W A;  2REJ A;  3OD7 A;  1NUX A;  4P1L A;  3MVW A;  5ISU A;  4MBP A;  2DXR A;  2Y7I A;  4LQ2 A;  3PV0 E;  2REG A;  1MQD A;  5EQ9 A;  4PGP A;  3FD3 A;  1OQG A;  5TPA B;  1TFD A;  2YLN A;  3KOT A;  2M8C A;  5H8H B;  4XEQ A;  4NF4 A;  3WAE A;  3NOH A;  4MHF A;  3D4C A; 
#chains in the Genus database with same CATH homology
 2OZZ A;  2HAV A;  5I58 B;  1UIV A;  4BDL A;  3MVX A;  2NWJ A;  2DWH A;  1SBP A;  3TTL A;  2HQ0 A;  5CRY A;  4KCC A;  2CZL A;  4TOZ A;  3IOV A;  4GF8 A;  1N76 A;  4NF4 B;  4R6Y A;  3U92 A;  3IK6 B;  4R2F A;  3OSR A;  4R75 A;  1IIW A;  5HBC A;  5I2K A;  4IB2 A;  3RQT A;  3K0V A;  3PMV A;  3O66 A;  3G3H A;  3MWB A;  5I59 A;  2R9J A;  1EZP A;  3VFJ A;  2THI A;  3VVF A;  3MZB A;  5I2K B;  4M1V A;  3FUZ A;  4POX A;  1URG A;  3ZS6 A;  2OCU A;  5I57 A;  2PYY A;  3VLV A;  3DP4 A;  5I59 B;  2DE4 A;  1IUD A;  1N0T A;  1SYI A;  4HCW A;  1ZKB A;  1I6A A;  2XXI A;  4NTL A;  1TT1 A;  3TCG A;  1MY4 A;  4KPT A;  4H67 A;  2B3F A;  5H8Q A;  3E9X A;  2H4I A;  4ZEB A;  1I6Q A;  1UTH A;  5L9M A;  1MQG A;  4FAT A;  2Q2C A;  2Q8J A;  3FGS A;  2NVU B;  4RJZ A;  3UA8 A;  2XXP A;  3SEX A;  3Q29 A;  4OZ9 A;  3SEU A;  5H8Q B;  1LB9 A;  4I9D A;  4IY5 A;  1UTH B;  3MZ9 A;  4Q5T A;  3W9V A;  2OK2 A;  1B3L A;  4X9T A;  2F7A A;  4GXS B;  1MXV A;  4QFO A;  3TTK A;  1A8F A;  4E0X A;  4BDO A;  1FQA A;  4PE5 B;  3T22 A;  4EXL A;  5F1Q A;  2PT1 A;  4UAC A;  3F11 A;  2P0S A;  3VE1 B;  4GOT A;  1IZ1 A;  3KZG A;  4JWX A;  4EQB A;  1SI1 A;  3M8U A;  1N3X A;  1MY3 A;  1NNT A;  3HO7 A;  3QIM A;  2E1S A;  3FV1 A;  2PVU A;  2HCA A;  3ONM A;  4FEB A;  3MP1 A;  5AA4 A;  4ZE9 A;  2DP8 A;  3U1O A;  1XC1 A;  3IB0 A;  4LVQ A;  3TUS A;  1B1H A;  3CSB A;  1US5 A;  1RYX A;  3U94 A;  3PPR A;  1RKM A;  4F19 A;  2UVI A;  5AA4 B;  1GTK A;  4LON B;  1AIV A;  3LUY A;  1SQY A;  2BJJ X;  1YCJ A;  3FVG A;  4GL8 A;  4YKJ A;  2ZYN A;  3CG3 A;  2OWS A;  2ZYK A;  3KN7 A;  5K2X A;  4HTG A;  3CI8 A;  5EHS A;  3GBB A;  4YKP A;  4F18 A;  5DEX B;  1MS7 A;  1UQW A;  3O29 A;  1PDA A;  1S9T A;  2G93 A;  3C34 A;  3T93 B;  2F7C A;  1VFE A;  1QKB A;  1H45 A;  1Z7N E;  5CBR A;  3CFZ A;  1FTM A;  4IGT A;  1J1N A;  4YB6 A;  3ECR A;  2UYF A;  1LGB C;  1DTG A;  5FTI A;  4U21 A;  1A99 A;  1USY H;  2AL5 A;  2IA4 A;  3PUW E;  3OEL A;  4EUO A;  4F2O A;  3JV9 A;  4U1Z A;  1MM7 A;  4BDR A;  3TTM A;  2H9B A;  3BFT A;  4F2Q A;  2O69 A;  5BUU A;  2Q2A A;  1SVX B;  4C1T A;  3ZKK A;  1B7U A;  3VDF A;  2PT2 A;  2DWJ A;  2O68 A;  1BTJ A;  1DTZ A;  4DCY A;  3A3C A;  1IIT A;  4IO4 A;  5AA3 A;  4AB5 A;  3B7D A;  4N13 A;  1M5D A;  2ONR A;  5I56 A;  1B52 A;  3LSX A;  3FVO A;  4Q0C A;  1TWY A;  5H8N A;  4G77 A;  4NWD A;  2QRY A;  2XXV A;  4IO6 A;  4ELQ A;  4O3C A;  4U22 A;  2F6P A;  3K6V A;  2XXY A;  1ZTY A;  5I56 B;  2UYE A;  4X1B A;  3T96 B;  3B6W A;  4RY1 A;  4R6H A;  5H8N B;  4O3B A;  4HS7 A;  3G3I A;  3K1N A;  1MDP 1;  1O64 A;  5I84 A;  1A54 A;  1N84 A;  3O6H A;  4GD5 A;  3OEN A;  4POW A;  1NH8 A;  3C35 A;  4AQ4 A;  1ANF A;  2ONK E;  2NUV A;  3UK4 A;  5DTB A;  2I48 A;  3V8X B;  3RY3 A;  4R74 A;  4U4S A;  1EZ9 A;  3A09 A;  2F34 A;  1WOD A;  4XTC Q;  5AA2 A;  1M5F A;  2PBW A;  3MAM A;  4LAT A;  3FXQ A;  3FZV A;  1SW1 A;  4OWD A;  2HFB A;  3K4U A;  1LFH A;  3RLF E;  5KDT A;  4OEN A;  1LAH E;  3H6U A;  3O6G A;  2P2A A;  3CRB A;  4LUB A;  2R6G E;  1WVJ A;  1B3H A;  1XVY A;  3LSW A;  1I69 A;  3N26 A;  1QW0 A;  2H99 A;  3C32 A;  5B7D A;  4R9F A;  5KDT B;  3KG2 A;  4MFI A;  4OVJ A;  3RGY A;  4EF2 A;  1R1N A;  2F36 A;  2GH9 A;  1GGG A;  3IOW A;  5FHM A;  4TQU Q;  1IXC A;  4ELO A;  3IOU A;  4QFN A;  3KOS A;  2KLF A;  2D21 A;  1DPP A;  1FQB A;  3MPK A;  5FHN A;  4PFY A;  2XXR A;  4MH5 A;  2DVZ A;  3TDJ A;  4F29 A;  1OLC A;  1MPD A;  3RNN A;  1TFA A;  4QSC A;  5EYF A;  1PB9 A;  2DWI A;  3CSG A;  2O7I A;  1QJM A;  3OO8 A;  3OO7 A;  4U23 A;  2I4C A;  3QYT A;  5B70 A;  4IO7 A;  1JW5 A;  4LQ5 A;  3Q25 A;  2O1L A;  1YAE A;  1WDN A;  3FJG A;  1N7X A;  3ZSF A;  2HZK A;  4QSD A;  2I0C A;  1CB6 A;  1QUI A;  1LBC A;  3TEL A;  1B5I A;  4RYA A;  2B3B A;  2Z22 A;  1SYH A;  4AB6 A;  2DYX A;  3EN3 A;  1MXU A;  4OFL A;  1VE4 A;  1MQI A;  4X1D A;  2Y7R A;  1USY E;  2XX7 A;  4F1Y A;  4N07 A;  2ZYM A;  4PQJ A;  3K2D A;  3QUF A;  4ELR A;  5AA2 D;  4LA9 A;  1GV8 A;  3Q27 A;  3SKP A;  2ESN A;  2ZNT A;  1MXZ A;  4FOR A;  1YTV A;  4C0R A;  1XT8 A;  3IOT A;  4ZEI A;  3MUQ A;  1BIY A;  4ECF A;  4ZE8 A;  1MY0 A;  4ZDM A;  4QFL A;  2VD3 A;  1P1Q A;  2V84 A;  3O97 A;  4OMB A;  1XS5 A;  1POY 1;  5H8F A;  3H3G A;  4R73 A;  3N94 A;  3K6W A;  3L6H A;  2A5S A;  1AOV A;  4EQ7 A;  3V83 A;  4NF6 A;  3PPP A;  3VVE A;  1FW0 A;  2B65 A;  2XXW A;  3IB1 A;  2AYS A;  1B0H A;  3BFU A;  2F8D A;  4RXL A;  4OET A;  5H8F B;  1QUJ A;  4XKR A;  2ABH A;  4NED A;  2V3T A;  4BDM A;  4EF1 A;  3PMX A;  2WKY A;  3HHF A;  4NF6 B;  1LST A;  1Q35 A;  2DQV A;  4P11 A;  4LZ5 A;  2OLB A;  4JWO A;  4G8H A;  2YPN A;  1XOC A;  5CM6 A;  1R9Q A;  3A3U A;  1MXW A;  4RA1 A;  4ZZE A;  3MBP A;  4ZEK A;  3MJN A;  2Z8D A;  3MW0 A;  1IXG A;  5ICT A;  5I57 B;  2Y7W A;  1MQH A;  4GXA A;  2DE2 A;  3MQ9 A;  3U72 A;  1R9L A;  1JEV A;  1D4N A;  1LFI A;  2I6E A;  3C33 A;  3LC8 A;  3FJ7 A;  3G3G A;  5IKB A;  2X7P A;  2UVH A;  1FQF A;  4KI0 E;  1SW5 A;  1Y4T A;  4DDD A;  4H0W A;  3S9N C;  4JWY A;  3USD A;  4DXU A;  1LAF E;  3SEV A;  5CBS A;  4IY6 A;  1XHY A;  1Y1Z A;  2GHB A;  3O9P A;  4PFW A;  3L6G A;  4G8N A;  2UXA A;  5TU0 A;  1JEU A;  5BWJ A;  5J1D A;  5IAI A;  4ZEC A;  2F97 A;  1LFG A;  1SI0 A;  1B0L A;  3IOR A;  5K2Y A;  3TKD A;  1PEB A;  3N5L A;  4IO5 A;  1SD3 A;  4YMB A;  4QFK A;  2RC8 A;  3K00 A;  3V5A A;  4F3S A;  4DXB A;  4ZEF A;  4BLA A;  2RF1 A;  5I2N A;  4F22 A;  3MZ1 A;  1P1N A;  5CMB A;  3FV2 A;  3G3K A;  3HST A;  5ITO A;  2RKM A;  1H44 A;  4FE8 A;  4F39 A;  2D3I A;  2HZL A;  2ZNS A;  4F3P A;  3SDF A;  4ZS9 A;  1BKA A;  2QS2 A;  4DLD A;  5I2N B;  4G68 C;  3HPI A;  4Q8R A;  2Q89 A;  4WKM A;  2QMW A;  2Y84 A;  4ZED A;  4FIM A;  4OYV A;  1NL5 A;  3PUZ E;  4KR5 A;  4F3G A;  3OO6 A;  4YB7 A;  1FQD A;  3KSX A;  3VVD A;  4GQO A;  4XIG Q;  3AXF A;  2I58 A;  3R7X A;  3PPN A;  4GWO A;  4XKQ A;  3PUX E;  4U4X A;  4MF3 A;  4KHZ E;  1B5H A;  4TLL B;  4GFR A;  3IR1 A;  1TXF A;  4I1D A;  2ANJ A;  1AH5 A;  4KYD A;  2I3V A;  1Y1M A;  1A8E A;  1DPE A;  1B58 A;  2Q9T A;  1JET A;  4ESX A;  3G3J A;  4OXV A;  1P1O A;  2F78 A;  4TLM B;  1AL3 A;  3S9M C;  1EU8 A;  1JVX A;  3CIJ A;  5L9O A;  4H8I A;  2AIX A;  3UGW A;  2HAU A;  3KJ7 A;  4U2R A;  1FTO A;  2X26 A;  3KFM A;  4YMA A;  3TZA A;  1IXH A;  4G68 A;  3R6U A;  3D4G A;  4KYS A;  2F6G A;  1ELJ A;  4KQP A;  4FEC A;  3HN0 A;  3K1M A;  3FVN A;  4JBZ A;  3RN8 A;  1MDQ A;  3EQ1 A;  4LP2 B;  3DM0 A;  1JNF A;  4G68 B;  3VXB A;  2GFE A;  3IAZ A;  4RNS A;  2GRV A;  1GVC A;  1QKA A;  2ALU A;  4FED A;  2XX9 A;  3QK6 A;  4ONY A;  3RT8 A;  4ND9 A;  3PD9 A;  1IQ7 A;  3Q26 A;  5ELV A;  5DYH A;  2QSX A;  1ZLQ A;  3DLN A;  3UN6 A;  2GHA A;  3T9H B;  4OES A;  3EHS A;  2Z8F A;  2ONS A;  2H5Y A;  2DE3 A;  4P0I A;  2YJP A;  1UTB A;  3PUV E;  5LOM A;  2O1M A;  3JYR A;  1N7W A;  1ZJL A;  4YU0 A;  4H1X A;  4WEP A;  3C36 A;  1AMF A;  1M5C A;  3RTF B;  3S9L C;  2LAO A;  1UTB B;  4IO2 A;  3TTN A;  3B6T A;  4Z7E A;  1F9B A;  2PMS A;  5AE4 A;  1UIU A;  5AA2 B;  1BLF A;  3LSL A;  3B6Q A;  3OEK A;  2ZYO A;  4ZZA A;  5ITP A;  2I4B A;  4NF5 A;  1Y3N A;  4KCD A;  4NMY A;  1MH4 A;  3BBR A;  2Z23 A;  1A40 A;  2RCB A;  4G2Z A;  3MPL A;  3RTW B;  4PFT A;  4NF5 B;  3TEP A;  3TMG A;  2DXY A;  4RPN A;  1MRP A;  4KFQ A;  4C1U A;  3E3K A;  1DOT A;  5L8D A;  1A7L A;  3JZJ A;  1YPN A;  4QF9 A;  5M2V A;  1KWH A;  3DP6 A;  5JTY A;  2IEE A;  3FXR A;  1P99 A;  5JK4 A;  4OQO A;  1N04 A;  5DVJ A;  1LAX A;  3MVY A;  1LCF A;  3LSF B;  4FAJ A;  2I49 A;  3ILU B;  1NNP A;  5JTY B;  1PBQ A;  3TCF A;  3TQW A;  3IX1 A;  1IXI A;  4R9G A;  4GVO A;  1B7H A;  2V93 A;  2F35 A;  2A5T A;  1D3K A;  3KJT A;  2X7Q A;  4QHQ A;  3H06 B;  4QSE A;  3WAF A;  2I3W A;  1MPB A;  4BDQ A;  3Q28 A;  4H5G A;  2VOZ A;  3H03 A;  2AL4 A;  4G4P A;  3ZKL A;  3OEM A;  4KYE A;  4K3F A;  5A5X A;  1R6Z A;  1P1W A;  1N3W A;  3V89 B;  4DIG A;  2A5T B;  4JDF A;  3QUJ A;  4YIC A;  1B4Z A;  1OQH A;  3DP8 A;  1I6B A;  1HSJ A;  3OXN A;  2QS3 A;  1S50 A;  3OOA A;  5I58 A;  5H8S A;  3EHT A;  3ODB A;  2FA7 A;  1B2H A;  1L5T A;  5A5X B;  3GXA A;  4F1V A;  1ZBM A;  1JVY A;  3S4U A;  4RPO A;  4NWC A;  1SDX A;  3T9X B;  3K6X A;  3MC2 A;  1FQE A;  3T66 A;  4IO3 A;  3KN3 A;  1PB8 A;  3M3L A;  4RK9 A;  4DZ1 A;  1OLA A;  1Y3Q A;  5TP9 A;  1NMU A;  4LZ8 A;  2OBG A;  3N6U A;  2Q88 A;  2XXQ A;  4R6K A;  1FQC A;  4GL0 A;  1IEJ A;  4YKI A;  2DWA A;  3CVG A;  1POT A;  1MXX A;  1B05 A;  3C9H A;  2HXW A;  5TP9 B;  3KGC A;  4HCY A;  2H98 A;  1Z7M E;  4ELP A;  5HM4 B;  1CE2 A;  3PGF A;  2Y7P A;  1Y20 A;  4QRZ A;  4GIZ A;  3IJX B;  4OTE A;  4X48 A;  4PP0 A;  1B9J A;  4LZ7 A;  2DOJ A;  2RC9 A;  2PX1 A;  1B40 A;  2XXU A;  3PUY E;  1A55 A;  1H43 A;  1URD A;  4THI A;  3PPO A;  1S7Y A;  4PFU A;  3R26 A;  2W7Y A;  4XXU A;  2I0B A;  2V3U A;  5DVF A;  1Y3P A;  2E0S A;  1URS A;  1Y9U A;  3FVK A;  4P0G A;  3K01 A;  4L17 A;  4NE4 A;  3G3F A;  2CMO A;  1HSE A;  3TOD A;  3SER A;  4QFP A;  3M3F A;  4OER A;  1P1U A;  4F3B A;  5FHO A;  3M3K A;  2XHD A;  1HSL A;  3E13 X;  3TAJ A;  3N6T A;  1QUK A;  4JXI A;  3MVZ A;  1SW4 A;  2HEU A;  5CMM A;  1PC3 A;  3QXM A;  3U93 A;  4XKN A;  4KD5 A;  2OWT A;  2V3Q A;  3H6V A;  1M5E A;  4U1O A;  3VV5 A;  5HPQ A;  3IJO B;  2RIN A;  3KN8 A;  4YAH X;  4OHN A;  3SES A;  2RCA A;  2FYI A;  1II5 A;  4F1U A;  5FTH A;  3RUM A;  4BDN A;  2QMX A;  3I5O A;  3UP9 A;  3PPQ A;  4OFJ A;  2XXX A;  3S2V A;  1B4H A;  1OMP A;  2ZMB A;  2F7B A;  3H4Z A;  3TYH A;  1B3F A;  4N6P A;  3I3V A;  1ZU0 A;  1NNF A;  3IB2 A;  2UVJ A;  3LBS A;  1H76 A;  1EH3 A;  1DSN A;  4Q30 B;  3RT6 B;  1B1X A;  1M5B A;  4G8M A;  1NKX A;  1B5J A;  1MXY A;  5CC2 A;  2UVG A;  4GRK A;  3EPE A;  2QS4 A;  1MPC A;  3HHG A;  5EHM A;  4RK2 A;  5DEX A;  2XXH A;  3EHU A;  3BKI B;  2XD3 A;  1GR2 A;  3QSL A;  3H6T A;  3HV1 A;  3MP8 A;  4EQ9 A;  3FAS A;  3RPW A;  4JB7 A;  4DXC A;  1SW2 A;  3THI A;  2XD2 A;  2QPQ A;  4DE8 A;  1LLS A;  1H3D A;  4R2B A;  4HW8 A;  1XVX A;  1RYO A;  3O28 A;  1US4 A;  3S9E A;  1JW1 A;  3ILT B;  3CG1 A;  1MG1 A;  3K1P A;  5CI5 A;  3FXU A;  1NFT A;  2NXO A;  3SET A;  1MH3 A;  3IL1 B;  3P7I A;  2XX8 A;  2ZXT A;  3LR1 A;  3FAT A;  4OEV A;  3GBA A;  2QL3 A;  1O7T A;  1NNK A;  1ZMG A;  2DVC A;  3KSJ A;  1LCT A;  2R71 A;  2QJE A;  3SEY A;  3U8Q A;  3KEI A;  5JEI A;  1B46 A;  3QAX A;  3GZG A;  2F5X A;  2FNC A;  3PD8 A;  1O63 A;  3UIF A;  4IGR A;  1FTK A;  2Z8E A;  4JSO A;  2QS1 A;  4PET A;  4DCX A;  1B32 A;  1LAG E;  1B7Z A;  4I62 A;  3MP6 A;  5KZT A;  4Z0I A;  5DVI A;  4NF8 A;  3CFL A;  4YB5 A;  2NOO A;  3HCQ A;  2H25 A;  3PU5 A;  2VD2 A;  3IO6 A;  1BP5 A;  4EDP A;  3OSQ A;  2P1S A;  1OIB A;  2DS9 A;  2VGQ A;  5AA1 A;  3G7W A;  1PB7 A;  3CR9 A;  3TTR A;  3C31 A;  3OMB A;  4NF8 B;  3EF7 A;  3K6U A;  4ESW A;  4EXK A;  5KCJ A;  1Q1K A;  3UOR A;  5F7V A;  2VHA A;  4F31 B;  1MQJ A;  4FJP A;  1EZO A;  4OEU A;  3TCH A;  1QVS A;  5CMK A;  5ICQ A;  5KCJ B;  4MLV A;  1VSO A;  1T0K A;  4H65 A;  4H6D A;  3O2A A;  5CMC A;  3H6W A;  2DSF A;  2D5W A;  3TQL A;  1B3G A;  3PMW A;  3VLU A;  1D9Y A;  2OJT A;  1VFD A;  2XXT A;  1B51 A;  1Y4C A;  1QUL A;  3TFL A;  2O7U A;  2V25 A;  1ZIU A;  4UA8 A;  2G29 A;  3DEL B;  3VXC A;  1VR5 A;  4WED A;  3E4R A;  3H7M A;  4GLI A;  4XKP A;  4M4G A;  1B3E A;  3VLW A;  1NH7 A;  3TPA A;  3T9V A;  3KBR A;  1PBP A;  4H5F A;  1OVB A;  2ZNU A;  4JSD A;  4OFO A;  4WXJ A;  4O3A A;  4I8C A;  3K02 A;  3T9U A;  4E0W A;  1JW4 A;  4ISU A;  1OVT A;  3FJM A;  2VP1 A;  2O6A A;  1D9V A;  3I6V A;  4MLQ A;  1FTL A;  1B6H A;  1LB8 A;  1MY2 A;  1JQF A;  3IO4 A;  2RC7 A;  1ATG A;  1DMB A;  3CFX A;  3O6I A;  3C4M A;  1MM6 A;  1MY1 A;  1FTJ A;  3W15 C;  3FIR A;  1FCK A;  3GLB A;  4YKK A;  4YZZ A;  5L9S A;  5TPA A;  4R72 A;  5H8H A;  2O84 X;  2O51 A;  5DT6 A;  1LBB A;  3OO9 A;  4H8J A;  3W9W A;  2Y7K A;  3SEW A;  2REJ A;  3OD7 A;  3MVW A;  5ISU A;  4MBP A;  2DXR A;  2Y7I A;  4LQ2 A;  3PV0 E;  2REG A;  1MQD A;  3FD3 A;  1OQG A;  5TPA B;  1TFD A;  2YLN A;  3KOT A;  2M8C A;  5H8H B;  4NF4 A;  3WAE A;  3D4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...