5I56A

Agonist-bound glun1/glun2a agonist binding domains with tcn201
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
286
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, receptor
molecule keywords Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ion
publication title Structural Basis for Negative Allosteric Modulation of GluN2A-Containing NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 81
structure length 286
sequence length 288
ec nomenclature
pdb deposition date 2016-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5i56A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5i56A02
5CMBA 3UK4A 4LUBA 4QFNA 5KDTA 1GV8A 3FVOA 3HHFA 5HBCA 3L6GA 3T9VA 2RINA 2IEEA 3DLNA 4EQ7A 5IKBA 4JB7A 3VLVA 2ZYOA 1UIVA 3RUMA 2THIA 4ECFA 1I6AA 5L9SA 1FTLA 4R75A 2XXPA 1IXHA 1MXYA 3JV9A 4G68C 2V84A 4KPTA 1JNFA 4UACA 3KN3A 3TCHA 4HS7A 5ITPA 1N0TA 4LATA 2D21A 1B3LA 4DDDA 3SERA 2RC9A 4GLIA 5AA4B 1BTJA 2XXRA 3Q27A 5ELVA 3OXNA 3TQWA 3R26A 4MLQA 5CC2A 4ESWA 3CVGA 2DQVA 1JW5A 2H99A 2GH9A 1F9BA 3U1OA 5CMMA 3MQ9A 3VXCA 1LFHA 1SQYA 2O69A 1VR5A 1II5A 3SEUA 4OFJA 2A5SA 2QS1A 3IOTA 3C34A 2Q88A 4M1VA 2HXWA 2X7PA 1B5JA 3U92A 5H8FB 2AL5A 2Q89A 3H6TA 3OSQA 1Y9UA 5TU0A 3MP8A 4LVQA 3MBPA 1POTA 1A54A 3K2DA 3ODBA 4ZECA 3TZAA 3VXBA 1QW0A 1NKXA 4EF1A 3OO9A 5H8QB 3S9NC 4RNSA 4EUOA 4Q0CA 3W9VA 4QFPA 4R74A 3VFJA 3O6HA 3OSRA 4PFYA 3TEPA 1SVXB 5DYHA 4XKRA 2M8CA 3USDA 1AOVA 4ZDMA 4NTLA 3SEVA 2DXYA 3HCQA 2P2AA 4YKPA 5I56A 2DP8A 2O1MA 5CRYA 1UIUA 4U23A 3ONMA 4N6PA 2QSXA 2OJTA 3TTRA 2DVZA 2Y7IA 1M5EA 1QVSA 2HCAA 3GZGA 1AL3A 4IY5A 3I3VA 1Y1MA 3IR1A 4EXLA 2QS2A 2H9BA 4OFLA 1D9VA 5DEXA 4ZEIA 1OMPA 4F3GA 1B32A 2V25A 3HPIA 1P1NA 3KEIA 4F18A 5TPAB 3KOTA 3CSBA 2HFBA 2BJJX 1LAGE 4LZ5A 4O3AA 1MM7A 4GFRA 1OLCA 1XVXA 1OQHA 5HPQA 4GRKA 5KCJB 1AH5A 2NOOA 2R6GE 4HCWA 1OQGA 3IOVA 3IK6B 1JW1A 2DXRA 1SYHA 3VV5A 1B9JA 5CMKA 2X26A 2VD2A 1FQDA 4JDFA 4G4PA 2ONSA 2DVCA 1MPBA 2XX7A 4R72A 1B40A 3CRBA 1I69A 2O6AA 1A55A 1P1QA 2FYIA 3FXQA 4G68A 1UQWA 1MXVA 1DPEA 3K6VA 4H5FA 1R1NA 3JZJA 1P1UA 4ZEFA 2VGQA 4JWOA 3PU5A 1MH4A 2A5TB 2R9JA 1H3DA 3QSLA 1LBBA 1A99A 2XXVA 1LBCA 3IOWA 3N6TA 3TMGA 1NFTA 2E1SA 5IAIA 3QXMA 4KD5A 3LSWA 3UGWA 1B1HA 4RY1A 4F1YA 4EXKA 4JBZA 1HSJA 3EHSA 3I6VA 1B1XA 4WEDA 1P99A 2NWJA 3TKDA 3PUZE 5M2VA 3KJTA 2O7IA 4PP0A 1GTKA 4QSDA 2Z22A 2O51A 4HW8A 3M3LA 4ONYA 1A8EA 4R9FA 4G2ZA 5ICQA 1ZBMA 3IJXB 1N3XA 2D5WA 2F36A 1XS5A 4G77A 2LAOA 1MXXA 2XXIA 4F3SA 1EZOA 1XC1A 2NUVA 2Q9TA 1NH8A 3W9WA 1D4NA 2ALUA 1OVTA 3S4UA 1LAFE 2F6GA 1H44A 2I3VA 2DWHA 3QUJA 2UXAA 5AA2A 3G3GA 3O97A 3KZGA 3SESA 3OD7A 4KI0E 2YLNA 1XHYA 2I48A 2XX9A 5K2YA 4NMYA 4F31B 2I3WA 3LUYA 5I58B 1JEVA 2P1SA 1B7HA 4JXIA 1P1OA 5CBSA 2OBGA 5L9OA 1M5BA 4MH5A 2Y7PA 2H5YA 4IY6A 2YJPA 1UTHA 4IO2A 2VD3A 4JSDA 3BKIB 4MBPA 4BDLA 1GVCA 3DELB 2DOJA 4QRZA 3EQ1A 3ZS6A 2F34A 2V93A 2H98A 1YAEA 1WDNA 4QFKA 1J1NA 1LSTA 4P11A 3GBBA 4WKMA 3R6UA 3KN8A 4F3PA 1D3KA 1KWHA 1IXIA 2Y7WA 1JW4A 4OVJA 4DCXA 2QL3A 3MW0A 1DTGA 5TP9A 1SW1A 1VE4A 2G93A 3VVDA 4YAHX 1BP5A 4H0WA 1TXFA 4RK2A 3SKPA 3U93A 1T0KA 3K02A 4H67A 4BLAA 1QUJA 4ND9A 3ZSFA 4NEDA 3WAFA 4POWA 1DSNA 4X9TA 3CFLA 2VOZA 1UTBB 1QKAA 1MY2A 1QKBA 4NE4A 1BLFA 4PE5B 3RNNA 1FQFA 2V3UA 5BWJA 1SBPA 4DIGA 3KFMA 1SI0A 4L17A 3C4MA 1MXZA 1IUDA 5H8HA 1US4A 2HZLA 2PBWA 3G3KA 4G8HA 2DS9A 1MY0A 4Q8RA 2F78A 4JWYA 4GOTA 4YU0A 1B2HA 3UP9A 1RYOA 3PUYE 4XXUA 1US5A 4FEDA 1ZIUA 3MZ1A 1DOTA 2HZKA 3O6GA 2X7QA 3IO4A 1LCFA 5CMCA 4GXSB 4GL0A 1AIVA 4K3FA 5I56B 3LSLA 4YB6A 3FXUA 3KSJA 3MVXA 4NF4A 1D9YA 3OELA 5EHSA 3G7WA 3RQTA 1DMBA 3LSFB 3UORA 3O28A 4LA9A 3TTMA 1ANFA 2RF1A 1OLAA 1FW0A 5FHNA 3N94A 3Q28A 3QYTA 3CFXA 3VVFA 3T93B 2Z8DA 3TPAA 4JWXA 2UYEA 4GWOA 1AMFA 5DEXB 4R9GA 2REGA 1RKMA 4IO5A 4DE8A 2Z23A 3FJ7A 3KG2A 4IB2A 1PBPA 2E0SA 1M5CA 4THIA 1ZU0A 5F7VA 3E3KA 3CG1A 1Y3PA 2DWIA 5I84A 4PFUA 2PT2A 5I59A 4Q5TA 3K6WA 4XKNA 3FZVA 3K0VA 1MG1A 4POXA 3PV0E 5A5XB 2O68A 3OO8A 1Z7ME 2DE4A 1FTMA 1ZKBA 4DZ1A 2QJEA 1MDQA 3TUSA 3C35A 4R6KA 1P1WA 4F1VA 1Q35A 3EHTA 1ZMGA 4C1UA 3K01A 2ONKE 3PUVE 2G29A 1GGGA 2PT1A 4U1OA 4FE8A 4G68B 5I2KA 1YCJA 2PYYA 3HHGA 5HM4B 1B3HA 4KYEA 1S7YA 1PEBA 2RCAA 4ZEDA 3QUFA 3VVEA 3FVKA 5JTYB 4LZ7A 2ZMBA 2Y7RA 4QFOA 5DVJA 2DE2A 3Q26A 3K00A 3FASA 2Y7KA 4OYVA 2FNCA 2I49A 3RT8A 2AYSA 1JQFA 2UYFA 3B6TA 2NVUB 4F2OA 4I8CA 3PPPA 1WVJA 4OETA 2Y84A 1SD3A 4LZ8A 1USYE 1LFIA 4PFTA 4OHNA 1HSLA 4GL8A 2H25A 4XKQA 1YPNA 3M3KA 1I6BA 1LGBC 1MQDA 3EPEA 4YKKA 5CM6A 1N7XA 3A3CA 5B7DA 1NNPA 4ZE9A 2F7BA 5EYFA 2HQ0A 3SEWA 3RGYA 2OWTA 3EHUA 3PPQA 2OWSA 4DLDA 3H3GA 2ZYMA 5K2XA 4F22A 1B52A 1B0LA 2RC8A 3D4GA 1IEJA 2CZLA 3U72A 3CR9A 2VP1A 3RY3A 1CE2A 1URDA 4E0XA 3FV2A 4YMBA 5B70A 3N6UA 3KJ7A 4KCDA 2F7CA 3H7MA 1N3WA 1SW2A 2XXQA 2V3TA 1TFDA 4FJPA 3TQLA 1BIYA 1VFEA 1ZTYA 3C31A 5DVFA 2I6EA 2XXXA 4KFQA 1QJMA 3ZKKA 1B5IA 2HAVA 2O84X 3FVNA 3MVWA 3TFLA 2F97A 2XD2A 3A09A 1O7TA 3PMWA 4GD5A 4F39A 3BFTA 2PX1A 3FV1A 4U2RA 3U94A 1VSOA 4E0WA 3JYRA 2F7AA 1TT1A 2QMWA 4F29A 4ZEBA 1UTHB 2HAUA 5DVIA 4P0IA 5JK4A 3TTNA 4KCCA 4NF8A 4NF6B 4FATA 5KZTA 1Y3NA 3ILTB 3K6UA 3IOUA 4TOZA 4WXJA 3MJNA 4NWCA 4EQ9A 3TTKA 3QIMA 1IQ7A 5ISUA 1USYH 1SDXA 3KGCA 4YB5A 1B58A 3K1PA 4GIZA 1Y4TA 3TCFA 5AA1A 1NMUA 4LONB 4G8MA 4H6DA 5LOMA 1SYIA 1NL5A 3MWBA 3KOSA 5TP9B 4ESXA 2RC7A 3V8XB 1B51A 1WODA 2QPQA 2WKYA 2Q8JA 3FGSA 1JVXA 1MXUA 3QK6A 4IO4A 2F6PA 4P0GA 3TELA 1DPPA 3THIA 1MPDA 1B46A 2H4IA 2OCUA 4IO7A 1FQAA 3ECRA 2GFEA 1FTJA 2QS3A 3B6QA 5H8HB 3OO7A 3Q25A 4FIMA 3V83A 3V5AA 5FHMA 1MS7A 2KLFA 3T22A 5I57A 5KDTB 4BDOA 5H8SA 3IO6A 3G3IA 2ZNTA 4OXVA 5FHOA 2DSFA 3PPNA 3AXFA 3TTLA 3CFZA 3PPRA 4H8IA 3RTWB 3HSTA 4X48A 2XXWA 3WAEA 3K4UA 3FJGA 2OLBA 3DP6A 1B3GA 1Y20A 3MVYA 1NNKA 1L5TA 4NF4B 4QHQA 3H6WA 4RPNA 3N26A 3IX1A 1FQBA 3C9HA 4C0RA 4OMBA 4GVOA 1JEUA 3QAXA 3C32A 3C33A 4DXBA 3MZ9A 1MDP1 2AIXA 5L8DA 4OERA 1LB9A 2PMSA 1R6ZA 3Q29A 4JSOA 1FCKA 2REJA 4FORA 2D3IA 2CMOA 1A7LA 4TLLB 3SETA 3MP1A 3IJOB 3T96B 3MUQA 2PVUA 3T66A 5FTHA 5I59B 1N04A 2XXHA 1H76A 1LB8A 3C36A 1Z7NE 4XKPA 1N84A 4U4XA 1HSEA 4HTGA 4OTEA 4WEPA 2ZNUA 2Z8EA 4OWDA 1N76A 3PPOA 3LC8A 4I1DA 1MH3A 3UN6A 3H03A 1A8FA 5I2KB 2XD3A 5ITOA 3TYHA 3S2VA 4R2FA 1DTZA 4YZZA 1B5HA 5ICTA 3H06B 4U22A 3GBAA 3FIRA 3S9EA 1MY3A 3BBRA 4NF5A 1IITA 3RT6B 4O3BA 2UVIA 2IA4A 3CG3A 4OFOA 4Z7EA 4YB7A 3KBRA 3T9HB 4HCYA 5H8NA 3RPWA 3E9XA 1N7WA 2B65A 1ZJLA 3TODA 2QS4A 1XOCA 4ELPA 1RYXA 2O7UA 2GHBA 3EF7A 4FECA 4ZS9A 4QF9A 5JEIA 2ZYKA 4R6HA 1EH3A 2YPNA 3K1NA 3GLBA 1UTBA 5I2NA 3CI8A 1XT8A 3R7XA 4H5GA 3HV1A 4X1DA 5DT6A 3S9LC 3FJMA 1PB9A 5EHMA 2XXUA 1MQHA 1B3FA 4R6YA 4PQJA 1OIBA 3O6IA 2F8DA 1B4ZA 4F3BA 2P0SA 1MQGA 1IXGA 2OK2A 1PB8A 4DXCA 4IGTA 3T9XB 4N07A 1B7UA 3LBSA 4F1UA 1MPCA 2B3FA 2W7YA 1MQJA 4H1XA 5CBRA 4KYDA 3MC2A 4PETA 3VLWA 2QMXA 5AA4A 1TFAA 1URSA 3I5OA 1MM6A 1TWYA 2I0BA 3LR1A 2DYXA 1H45A 3FUZA 2B3BA 1QUKA 3H4ZA 4H8JA 3O29A 3FVGA 1B05A 4YMAA 3P7IA 4Z0IA 3BFUA 4I9DA 3MP6A 3VLUA 3O66A 3G3HA 3TDJA 1S9TA 1ATGA 3KN7A 1ZLQA 4H65A 1I6QA 3MAMA 4YKIA 4IO3A 5H8FA 3D4CA 3DP8A 4QSCA 3HN0A 3RTFB 2DWAA 1LAXA 5L9MA 1MXWA 2UVJA 2RKMA 4NF8B 4ZZAA 2Q2CA 2F35A 3G3JA 4ZE8A 4LP2B 3VDFA 3L6HA 4KYSA 4GXAA 3TCGA 3A3UA 3SEYA 3UIFA 2ZXTA 3TAJA 5BUUA 3IAZA 1MQIA 5H8QA 3W15C 2ABHA 1B0HA 1R9LA 1JETA 4OZ9A 1Q1KA 5A5XA 3OEMA 1SW5A 2AL4A 4OESA 4PFWA 4XIGQ 4RK9A 2XX8A 4GQOA 3SEXA 4DCYA 1LFGA 2ONRA 4TQUQ 1Y4CA 2F5XA 3OENA 3PMXA 2I0CA 5AA2B 2GRVA 3M8UA 2VHAA 2DE3A 4LQ5A 1O64A 2I58A 2FA7A 3K1MA 1PC3A 5JTYA 1S50A 4MLVA 4UA8A 1A40A 3VE1B 3LSXA 1SI1A 5DTBA 2ZYNA 3EN3A 4LQ2A 4YICA 4KR5A 4U1ZA 2RCBA 5I57B 2I4BA 4YKJA 1B3EA 4ELRA 2V3QA 1MRPA 4RA1A 4F2QA 1EZ9A 3FD3A 4Q30B 3IB0A 5TPAA 3PUXE 2HEUA 1IZ1A 3O9PA 1PB7A 3HO7A 1H43A 3U8QA 4OQOA 2GHAA 1QULA 2UVHA 1FQEA 5KCJA 3IB2A 1EU8A 3DM0A 3G3FA 3OEKA 3GXAA 1LAHE 4AB5A 3FATA 3KSXA 4TLMB 1PDAA 4ELOA 4DXUA 4R73A 1NH7A 3K6XA 3RLFE 2Z8FA 4BDQA 1B6HA 3T9UA 3CSGA 1B7ZA 4I62A 2QRYA 4ZZEA 4MF3A 1IIWA 2ZNSA 4NWDA 3MPKA 3PUWE 4BDNA 4X1BA 1PBQA 3FXRA 1FTKA 1OVBA 2A5TA 1M5FA 4KHZE 4OEVA 5J1DA 2XXTA 1FQCA 4ZEKA 4EQBA 5F1QA 4KQPA 4OENA 1SW4A 1MY1A 3V89B 1JVYA 1R9QA 3E13X 3H6UA 2ESNA 5AE4A 4EDPA 3MZBA 2NXOA 5FTIA 1FTOA 1XVYA 2UVGA 5AA3A 4O3CA 4FAJA 4N13A 4AQ4A 3OOAA 2O1LA 4IGRA 5CI5A 3S9MC 3MPLA 3OMBA 1URGA 4M4GA 4XTCQ 3PD8A 1YTVA 4MFIA 4NF6A 4OEUA 4RYAA 1Y3QA 2I4CA 3O2AA 4GF8A 1CB6A 3OO6A 3CIJA 4ISUA 1BKAA 3DP4A 4C1TA 1O63A 1Y1ZA 1NNTA 3E4RA 1EZPA 4U21A 3SDFA 4FEBA 3B6WA 4NF5B 2Q2AA 2DWJA 4G8NA 3N5LA 3MVZA 4IO6A 4R2BA 1LLSA 2R71A 5AA2D 1IXCA 1POY1 3RN8A 3PGFA 4U4SA 4ELQA 5H8NB 3ILUB 4QFLA 3ZKLA 3IB1A 3M3FA 1ELJA 4BDMA 1B4HA 4BDRA 4EF2A 3IL1B 4QSEA 4RPOA 3IORA 1VFDA 1LCTA 3UA8A 1QUIA 2XHDA 3H6VA 2OZZA 1GR2A 2ANJA 5I58A 1NNFA 4RXLA 5I2NB 4AB6A 1M5DA 4RJZA 3F11A 4F19A 1MY4A 3PMVA 3B7DA 2XXYA 3PD9A
chains in the Genus database with same CATH superfamily
4N15A 5CMBA 3UK4A 4LUBA 2F3BA 4QFNA 5KDTA 1GV8A 3FVOA 3HHFA 4OVSA 5HBCA 3L6GA 3T9VA 4MNCA 2RINA 1FBGA 2IEEA 3DLNA 4EQ7A 5IKBA 4JB7A 3VLVA 2ZYOA 1UIVA 3RUMA 2THIA 4ECFA 1FSAA 1FPKA 1I6AA 5L9SA 1FTLA 4R75A 2XXPA 1IXHA 1MXYA 3JV9A 4G68C 2V84A 4KPTA 1JNFA 4UACA 3KN3A 3TCHA 2Y5LA 4HS7A 5ITPA 1N0TA 4LATA 2D21A 1B3LA 4PGNA 4DDDA 3SERA 1RDZA 2RC9A 4GLIA 5AA4B 1BTJA 2XXRA 3Q27A 1FBPA 4HE2A 5ELVA 3OXNA 3TQWA 3R26A 4MLQA 5CC2A 4ESWA 3CVGA 2DQVA 1JW5A 1NUYA 1DCUA 2H99A 2GH9A 1F9BA 3U1OA 5CMMA 3MQ9A 1IMAA 3VXCA 1LFHA 1AWBA 1SQYA 2O69A 4N6KA 5ET5A 1VR5A 1LBYA 1II5A 2ZZXA 3SEUA 1LEVA 4MX6A 4OFJA 2A5SA 2QS1A 3IOTA 3C34A 2Q88A 4M1VA 1LBVA 2HXWA 2X7PA 1B5JA 3U92A 5H8FB 2AL5A 2Q89A 3H6TA 3OSQA 2P3NA 4GWSA 1Y9UA 4PFIA 1RDYA 5TU0A 3MP8A 4LVQA 3MBPA 1POTA 1A54A 3K2DA 3ODBA 4ZECA 3TZAA 2XWIA 3VXBA 1QW0A 1NKXA 4EF1A 3OO9A 5H8QB 4MMPA 3S9NC 4RNSA 4EUOA 4Q0CA 3W9VA 4QFPA 4R74A 3IFCA 4GWXA 3VFJA 3O6HA 3OSRA 4PFYA 3TEPA 1SVXB 5IM2A 5DYHA 4XKRA 2M8CA 3USDA 2WYKA 1AOVA 1EYIA 4ZDMA 4NTLA 2DXYA 3HCQA 4YKPA 2P2AA 3SEVA 5I56A 2DP8A 2O1MA 5CRYA 1UIUA 4U23A 1LBZA 4JVIA 5IZZA 1KA1A 3ONMA 4N6PA 2QSXA 2OJTA 3TTRA 2DVZA 5EQ7A 3HFUA 2CZIA 2Y7IA 1M5EA 1QVSA 2HCAA 3GZGA 1AL3A 4IY5A 3I3VA 1FPBA 1Y1MA 3IR1A 4EXLA 2QS2A 2H9BA 4H45A 4OFLA 1D9VA 5DEXA 4ZEIA 1OMPA 4F3GA 1B32A 2V25A 3HPIA 1P1NA 4MJOA 3KEIA 4F18A 5TPAB 3KOTA 3CSBA 2HFBA 2BJJX 1LAGE 1LBWA 4LZ5A 4O3AA 1MM7A 1NI9A 4GFRA 1OLCA 1XVXA 1OQHA 5HPQA 4GRKA 2HXRA 5KCJB 1AH5A 2NOOA 2WYPA 2R6GE 4HCWA 1OQGA 3IOVA 3IK6B 1JW1A 2DXRA 1SYHA 3VV5A 1B9JA 5CMKA 2PFZA 2X26A 4P47A 2VD2A 1FQDA 4JDFA 4G4PA 2ONSA 2DVCA 1MPBA 2XX7A 4R72A 1B40A 4XFEA 3CRBA 1I69A 2O6AA 1A55A 1P1QA 1DK4A 2FYIA 3FXQA 3FBPA 4G68A 1UQWA 1MXVA 1FPLA 1DPEA 3K6VA 4H5FA 1NV4A 1R1NA 3JZJA 4NF0A 1P1UA 1FBCA 5DW8A 4ZEFA 4AS5A 2VGQA 4JWOA 3PU5A 4PAIA 1MH4A 2A5TB 2R9JA 1H3DA 4QXDA 3QSLA 1LBBA 1A99A 2XXVA 1LBCA 3IOWA 3N6TA 2GQ1A 3TMGA 1NFTA 2WEFA 2E1SA 5IAIA 3QXMA 4KD5A 3LSWA 3UGWA 1B1HA 4HXVA 4RY1A 5IZ3B 4F1YA 3GYYA 4EXKA 4JBZA 1HSJA 3EHSA 3I6VA 1B1XA 4WEDA 1P99A 2NWJA 5ET8A 4GWWA 3TKDA 3PUZE 5M2VA 3KJTA 1D9QA 2O7IA 4PP0A 1GTKA 4N17A 4QSDA 4NX1A 2DDKA 2Z22A 2O51A 4HW8A 3M3LA 4PDHA 4ONYA 1A8EA 4R9FA 4G2ZA 5ICQA 1ZBMA 3IJXB 1N3XA 2D5WA 2F36A 1XS5A 4G77A 2LAOA 1MXXA 2XXIA 4F3SA 1EZOA 1FPDA 4MIJA 1XC1A 2NUVA 2Q9TA 3RPLB 1NH8A 3W9WA 1D4NA 2ALUA 1OVTA 3S4UA 1LAFE 2F6GA 1H44A 2I3VA 2DWHA 3QUJA 2UXAA 5AA2A 3G3GA 3KBZA 3O97A 3KZGA 4I3YA 3SESA 3OD7A 4KI0E 2YLNA 1XHYA 2I48A 2XX9A 5K2YA 4NMYA 4F31B 2I3WA 3LUYA 5I58B 1FJ9A 1JEVA 2P1SA 1B7HA 4JXIA 1P1OA 4AS4A 2FIXA 5CBSA 2OBGA 5L9OA 1M5BA 4MH5A 2Y7PA 1Q9DA 2H5YA 4IY6A 1YYZA 2YJPA 2XWVA 1FPIA 1UTHA 4IO2A 2VD3A 4JSDA 3BKIB 4MBPA 4BDLA 4O94A 1GVCA 3DELB 2DOJA 4QRZA 3EQ1A 3ZS6A 2F34A 2V93A 2QVVA 1RDXA 2H98A 1YAEA 1WDNA 4QFKA 1NV3A 1J1NA 4NN3A 1LSTA 4P11A 3GBBA 4WKMA 3R6UA 3KN8A 4F3PA 1D3KA 1KWHA 1IXIA 3RYDA 4GWUA 2Y7WA 1JW4A 4OVJA 4DCXA 2QL3A 3MW0A 1DTGA 5TP9A 1SW1A 1VE4A 2G93A 3VVDA 4YAHX 1BP5A 4H0WA 1TXFA 4RK2A 3SKPA 3U93A 5J16A 1T0KA 3K02A 4H67A 4BLAA 1QUJA 4ND9A 3ZSFA 1SPIA 4NEDA 3WAFA 4POWA 1DSNA 4X9TA 2JJKA 3CFLA 2VOZA 1UTBB 1QKAA 1MY2A 1QKBA 4NE4A 1BLFA 4PE5B 3RNNA 1FQFA 2V3UA 5BWJA 1SBPA 4DIGA 3KFMA 1SI0A 4L17A 2XXKA 3C4MA 1MXZA 1IUDA 5H8HA 1US4A 3E78A 2HZLA 4PC9A 2PBWA 3G3KA 3MSTA 4G8HA 2DS9A 1MY0A 4MEVA 3LV0A 4Q8RA 2F78A 4JWYA 4GOTA 4YU0A 1B2HA 3UP9A 4MAGA 1RYOA 1NUWA 4PBHA 4X04A 3PUYE 4XXUA 1US5A 1CNQA 1ZIUA 4FEDA 3MZ1A 4HE1A 1DOTA 2HZKA 3O6GA 5EQAA 2X7QA 3IO4A 1LCFA 3CHGA 5CMCA 4GXSB 4GL0A 1AIVA 4K3FA 5I56B 3LSLA 4YB6A 3FXUA 3KSJA 1QGXA 4P8BA 3MVXA 4NF4A 1D9YA 3OELA 5EHSA 3G7WA 3RQTA 1DMBA 3LSFB 3UORA 1IMCA 3O28A 4LA9A 3TTMA 1IMFA 4N91A 1ANFA 2RF1A 1OLAA 1FW0A 5FHNA 3N94A 3Q28A 3QYTA 3CFXA 3VVFA 1NUXA 3SZPA 3T93B 2Z8DA 3TPAA 4JWXA 2UYEA 4GWOA 4N8YA 4N8GA 1AMFA 5DEXB 4R9GA 2QFLA 4P9KA 1INPA 2REGA 1RKMA 4IO5A 4DE8A 2Z23A 4PF8A 3FJ7A 3KG2A 4IB2A 1PBPA 2E0SA 1M5CA 4THIA 1ZU0A 5F7VA 3KC1A 3E3KA 3CG1A 1Y3PA 2WX9A 5I5PA 5ET7A 4FBPA 2DWIA 5I84A 4PFUA 2PT2A 5I59A 4Q5TA 3K6WA 4XKNA 3FZVA 3PTYA 3K0VA 3KC0A 1MG1A 4POXA 3PV0E 5A5XB 2O68A 3OO8A 1Z7ME 1NV0A 2DE4A 1FTMA 1ZKBA 2QJEA 4DZ1A 1MDQA 3TUSA 3C35A 2F3DA 4R6KA 4PE3A 1P1WA 4F1VA 1Q35A 3EHTA 1ZMGA 2VPNA 4C1UA 3K01A 2ZZWA 2ONKE 2R8TA 3PUVE 2G29A 1GGGA 2PT1A 4U1OA 4FE8A 4G68B 4O7MA 5I2KA 1YCJA 1NV5A 2PYYA 3HHGA 5HM4B 1B3HA 1BK4A 4KYEA 4XEQA 1S7YA 1PEBA 2RCAA 4ZEDA 3QUFA 3VVEA 3FVKA 5JTYB 4LZ7A 2ZMBA 1K9ZA 2Y7RA 4QFOA 5DVJA 2DE2A 3Q26A 3K00A 3FASA 2Y7KA 4OYVA 3T1BA 2FNCA 2I49A 3RT8A 2AYSA 1JQFA 2UYFA 4P3LA 3B6TA 2NVUB 4F2OA 4I8CA 3PPPA 1WVJA 4OETA 2Y84A 1SD3A 4LZ8A 1USYE 1LFIA 4PFTA 4OHNA 1HSLA 4GL8A 2H25A 4XKQA 1KA0A 1YPNA 3M3KA 1I6BA 1LGBC 1MQDA 3EPEA 4YKKA 5CM6A 1N7XA 2FHYA 3A3CA 5B7DA 1LBXA 4DI3D 1NNPA 4ZE9A 4PBQA 2F7BA 5EYFA 2HQ0A 3SEWA 3RGYA 2OWTA 2CZHA 3EHUA 3PPQA 4P1EA 2OWSA 4DLDA 3H3GA 4QBAA 2ZYMA 1KZ8A 5K2XA 4F22A 1B52A 4O7IA 1B0LA 2RC8A 3D4GA 1IEJA 2CZLA 3U72A 3CR9A 2VP1A 3RY3A 2Q74A 1CE2A 1URDA 4E0XA 3FV2A 4YMBA 5B70A 3N6UA 3KJ7A 4KCDA 2F7CA 3H7MA 1N3WA 1SW2A 1IMEA 2XXQA 4NAPA 2V3TA 1TFDA 4FJPA 3TQLA 1FPJA 1BIYA 1VFEA 1ZTYA 3C31A 5DVFA 2I6EA 2XXXA 4KFQA 1QJMA 3ZKKA 1B5IA 1K9YA 2HAVA 2O84X 3FVNA 3MVWA 3TFLA 2F97A 2XD2A 3A09A 1DBZA 1O7TA 3PMWA 4GD5A 4F39A 3BFTA 1FPFA 2PX1A 3FV1A 4U2RA 3U94A 4N4UA 1VSOA 2KR0A 4E0WA 3JYRA 2F7AA 1TT1A 2QMWA 1NV7A 4F29A 4ZEBA 3ROJA 2B4MA 1UTHB 2HAUA 5DVIA 4JVCA 4P0IA 5JK4A 3TTNA 4KCCA 4NF8A 4NF6B 4FATA 5KZTA 1Y3NA 4N81A 3ILTB 3K6UA 4GWYA 5A5LA 3IOUA 3LUZA 4TOZA 4WXJA 3MJNA 4NWCA 4EQ9A 3QMFA 3TTKA 3QIMA 1IQ7A 5ISUA 1USYH 1SDXA 3KGCA 1FBHA 4YB5A 4X8RA 1B58A 3K1PA 4GIZA 1Y4TA 2L5VA 5EYHA 5AA1A 3TCFA 5EYGA 1NMUA 4LONB 2VPOA 4G8MA 4H6DA 2P3VA 5LOMA 1SYIA 1NL5A 3MWBA 3KOSA 5TP9B 4ESXA 2RC7A 3V8XB 1B51A 1WODA 2QPQA 2B4LA 2HPGA 2WKYA 2Q8JA 3FGSA 1JVXA 5ET6A 1MXUA 3QK6A 4IO4A 2F6PA 4P0GA 3TELA 1DPPA 3THIA 1MPDA 1FRPA 1B46A 2H4IA 2OCUA 4IO7A 1FQAA 3ECRA 1JP4A 2GFEA 1FTJA 2QS3A 3B6QA 5H8HB 3OO7A 3Q25A 4GWZA 4FIMA 3V83A 2CEYA 3V5AA 5FHMA 1MS7A 2KLFA 3T22A 5I57A 5KDTB 3B8BA 4BDOA 5H8SA 5I7IA 2Y5KA 1YZ0A 3IO6A 5IZ3A 3G3IA 2ZNTA 4OXVA 5FHOA 2DSFA 3PPNA 3FXBA 3AXFA 3TTLA 3CFZA 3PPRA 4H8IA 3RTWB 3HSTA 4N6DA 1XI6A 4X48A 2XXWA 3WAEA 3K4UA 3FJGA 2OLBA 4H46A 3DP6A 1B3GA 1Y20A 1FBDA 1FPEA 5FBPA 3MVYA 1NNKA 1L5TA 4NF4B 4QHQA 3H6WA 4I3EA 3N26A 4RPNA 3IX1A 1FQBA 3C9HA 4C0RA 4OMBA 4GVOA 1JEUA 3QAXA 4PAFA 3A29A 2XWKA 1FBEA 3C32A 3C33A 4DXBA 3MZ9A 1MDP1 2AIXA 2ZZVA 4GX4A 4PCDA 5L8DA 4HE0A 3MYUA 4OERA 1LB9A 2PMSA 4GX6A 1R6ZA 3Q29A 2WBDA 4JSOA 4NG7A 1FCKA 2REJA 4FORA 2D3IA 2CMOA 1A7LA 2OWZA 3ISPA 4TLLB 3SETA 3MP1A 3IJOB 3T96B 3MUQA 1FPGA 2PVUA 4NHBA 3T66A 5FTHA 5I59B 1N04A 2KQZA 4GX3A 2XXHA 4OVQA 1H76A 1LB8A 3C36A 1EYJA 1Z7NE 5IGAA 4XKPA 4DI4B 1N84A 4U4XA 1HSEA 4HTGA 2Q8MA 4OTEA 5EQ9A 4WEPA 2ZNUA 2Z8EA 4OWDA 1N76A 3PPOA 3LC8A 4I40A 4I1DA 1MH3A 3UN6A 3H03A 1A8FA 1NV1A 1EYKA 5I2KB 2XD3A 5ITOA 3TYHA 3S2VA 4R2FA 1DTZA 4YZZA 1B5HA 5ICTA 3H06B 1NV6A 4U22A 3GBAA 3FIRA 3S9EA 1MY3A 3BBRA 4GBVA 4NF5A 1IITA 3RT6B 5T3JA 4O3BA 2UVIA 2IA4A 3CG3A 4OFOA 4Z7EA 4YB7A 2FIEA 3KBRA 3T9HB 4HCYA 5H8NA 3RPWA 3E9XA 1N7WA 4NQ8A 2B65A 4O8MA 1ZJLA 3TODA 2QS4A 3E79A 1XOCA 4ELPA 1RYXA 2O7UA 2GHBA 3EF7A 4FECA 4ZS9A 4QF9A 5JEIA 2ZYKA 4R6HA 1EH3A 2YPNA 3K1NA 3GLBA 1UTBA 4MHFA 3IFAA 5I2NA 3CI8A 1XT8A 3R7XA 4H5GA 3HV1A 4X1DA 5DT6A 3S9LC 3FJMA 2QVUA 1PB9A 5EHMA 2XXUA 1MQHA 1B3FA 4R6YA 4PQJA 1OIBA 1IMDA 3O6IA 1NUZA 2F8DA 1B4ZA 4F3BA 2P0SA 1MQGA 1IXGA 4MNPA 2OK2A 1PB8A 2XWOA 4DXCA 4IGTA 3T9XB 4N07A 1B7UA 3LBSA 4F1UA 1MPCA 2B3FA 2W7YA 1MQJA 4H1XA 5CBRA 4KYDA 3MC2A 1FJ6A 4PETA 3VLWA 2QMXA 5AA4A 1TFAA 1URSA 3I5OA 1MM6A 1TWYA 2I0BA 3LR1A 5LTCA 2V4CA 2DYXA 1H45A 3FUZA 2B3BA 1QUKA 3H4ZA 4H8JA 3O29A 3FVGA 1B05A 4YMAA 3P7IA 4Z0IA 3BFUA 4I9DA 3MP6A 3VLUA 3O66A 3G3HA 3TDJA 1S9TA 1ATGA 3KN7A 1ZLQA 4H65A 1I6QA 3MAMA 4YKIA 4IO3A 2MKZA 4PFRA 5H8FA 3D4CA 3DP8A 1G0IA 4QSCA 3HN0A 3RTFB 2DWAA 1LAXA 5L9MA 1MXWA 2UVJA 2RKMA 4NF8B 4ZZAA 2Q2CA 2F35A 3G3JA 4ZE8A 4LP2B 3VDFA 3L6HA 4KYSA 4GXAA 1NV2A 3A3UA 3TCGA 3SEYA 3UIFA 2ZXTA 3TAJA 5BUUA 2WBBA 3IAZA 1MQIA 2FVZA 5H8QA 3W15C 2ABHA 1B0HA 1R9LA 1JETA 4OZ9A 3U65A 1Q1KA 5A5XA 3OEMA 1SW5A 2AL4A 4OESA 4PFWA 4XIGQ 4RK9A 2XX8A 4GQOA 3SEXA 4DCYA 1LFGA 3NOHA 2ONRA 4TQUQ 4OVPA 1Y4CA 5ESYA 2F5XA 3OENA 3PMXA 2CZKA 2I0CA 1VDWA 5AA2B 2GRVA 3M8UA 3T0JA 2VHAA 2DE3A 4LQ5A 1O64A 5LDZA 1FTAA 2I58A 2FA7A 3K1MA 1PC3A 4UABA 5JTYA 1S50A 4MLVA 3BIGA 2QVRA 4UA8A 1A40A 3VE1B 3LSXA 1SI1A 5DTBA 2ZYNA 3EN3A 4PDDA 4PF6A 4IR8A 4LQ2A 4YICA 4KR5A 4PAKA 4U1ZA 2RCBA 5I57B 2I4BA 4YKJA 1B3EA 4ELRA 2V3QA 1MRPA 2FBPA 4RA1A 4F2QA 1EZ9A 3FD3A 1YXIA 4Q30B 3IB0A 5TPAA 3PUXE 2VT5A 2HEUA 3BIHA 1IZ1A 3O9PA 1PB7A 3HO7A 1H43A 3U8QA 4OQOA 2GHAA 1QULA 2UVHA 5F24A 1FQEA 5KCJA 1G0HA 3IB2A 1EU8A 3DM0A 3G3FA 3OEKA 3GXAA 1LAHE 4AB5A 3FATA 3KSXA 4TLMB 4OA4A 1PDAA 4ELOA 4DXUA 4R73A 1NH7A 3K6XA 3RLFE 2Z8FA 4BDQA 3D1RA 1B6HA 3T9UA 3CSGA 1B7ZA 2PFYA 5EQ8A 4I62A 2QRYA 4OVTA 4PFBA 4ZZEA 4MF3A 4P1LA 1IIWA 2ZNSA 4NWDA 3MPKA 5I3SA 4LN5A 3PUWE 4BDNA 4X1BA 1PBQA 3FXRA 1FTKA 1OVBA 2A5TA 1M5FA 4KHZE 4OEVA 5J1DA 2XXTA 1FQCA 4ZEKA 4EQBA 4PGPA 5F1QA 4KQPA 4OENA 1SW4A 4NGUA 2BJIA 1FBFA 1MY1A 1JVYA 3V89B 1R9QA 3E13X 3H6UA 2ESNA 5AE4A 4EDPA 3MZBA 2NXOA 4OVRA 5FTIA 1FTOA 1XVYA 2UVGA 5AA3A 4O3CA 4FAJA 2XA5A 4N13A 4AQ4A 3OOAA 2O1LA 4IGRA 5CI5A 3S9MC 4XF5A 3MPLA 3OMBA 1URGA 4M4GA 4XTCQ 3PD8A 1YTVA 4MFIA 4NF6A 4OEUA 4MNIA 4RYAA 1Y3QA 2I4CA 3B50A 3O2AA 4GF8A 1CB6A 3OO6A 3CIJA 4ISUA 1BKAA 3DP4A 4C1TA 4JVDA 1O63A 1Y1ZA 4MCOA 2PCRA 1NNTA 3E4RA 1EZPA 4PTKA 3EKIA 4U21A 3SDFA 4FEBA 4GBWA 3B6WA 4KXPA 3RPLA 4NF5B 2Q2AA 2DWJA 4G8NA 3N5LA 5IZ1A 3MVZA 4IO6A 4R2BA 1LLSA 2R71A 5AA2D 1IXCA 1POY1 3RN8A 3PGFA 4G61A 4U4SA 4ELQA 2HHMA 5H8NB 3ILUB 4QFLA 3ZKLA 3IB1A 3M3FA 1ELJA 4BDMA 1B4HA 4BDRA 4EF2A 3IL1B 4QSEA 4RPOA 3IORA 2CEXA 1VFDA 1LCTA 3UA8A 1QUIA 2XHDA 3H6VA 2OZZA 1GR2A 1IMBA 2ANJA 5I58A 2OX3A 1NNFA 4RXLA 5I2NB 4AB6A 1M5DA 4RJZA 3F11A 4F19A 1MY4A 3PMVA 3B7DA 2XXYA 4OANA 3PD9A 4P56A
chains in the Genus database with same CATH topology
5CMBA 3UK4A 4LUBA 4QFNA 5KDTA 1GV8A 3FVOA 3HHFA 5HBCA 3L6GA 3T9VA 2RINA 2IEEA 3DLNA 4EQ7A 5IKBA 4JB7A 3VLVA 2ZYOA 1UIVA 3RUMA 2THIA 4ECFA 1I6AA 5L9SA 1FTLA 4R75A 2XXPA 1IXHA 1MXYA 3JV9A 4G68C 2V84A 4KPTA 1JNFA 4UACA 3KN3A 3TCHA 4HS7A 5ITPA 1N0TA 4LATA 2D21A 1B3LA 4DDDA 3SERA 2RC9A 4GLIA 5AA4B 1BTJA 2XXRA 3Q27A 5ELVA 3OXNA 3TQWA 3R26A 4MLQA 5CC2A 4ESWA 3CVGA 2DQVA 1JW5A 2H99A 2GH9A 1F9BA 3U1OA 5CMMA 3MQ9A 3VXCA 1LFHA 1SQYA 2O69A 1VR5A 1II5A 3SEUA 4OFJA 2A5SA 2QS1A 3IOTA 3C34A 2Q88A 4M1VA 2HXWA 2X7PA 1B5JA 3U92A 5H8FB 2AL5A 2Q89A 3H6TA 3OSQA 1Y9UA 5TU0A 3MP8A 4LVQA 3MBPA 1POTA 1A54A 3K2DA 3ODBA 4ZECA 3TZAA 3VXBA 1QW0A 1NKXA 4EF1A 3OO9A 5H8QB 3S9NC 4RNSA 4EUOA 4Q0CA 3W9VA 4QFPA 4R74A 3VFJA 3O6HA 3OSRA 4PFYA 3TEPA 1SVXB 5DYHA 4XKRA 2M8CA 3USDA 1AOVA 4ZDMA 4NTLA 3SEVA 2DXYA 3HCQA 2P2AA 4YKPA 5I56A 2DP8A 2O1MA 5CRYA 1UIUA 4U23A 3ONMA 4N6PA 2QSXA 2OJTA 3TTRA 2DVZA 2Y7IA 1M5EA 1QVSA 2HCAA 3GZGA 1AL3A 4IY5A 3I3VA 1Y1MA 3IR1A 4EXLA 2QS2A 2H9BA 4OFLA 1D9VA 5DEXA 4ZEIA 1OMPA 4F3GA 1B32A 2V25A 3HPIA 1P1NA 3KEIA 4F18A 5TPAB 3KOTA 3CSBA 2HFBA 2BJJX 1LAGE 4LZ5A 4O3AA 1MM7A 4GFRA 1OLCA 1XVXA 1OQHA 5HPQA 4GRKA 5KCJB 1AH5A 2NOOA 2R6GE 4HCWA 1OQGA 3IOVA 3IK6B 1JW1A 2DXRA 1SYHA 3VV5A 1B9JA 5CMKA 2X26A 2VD2A 1FQDA 4JDFA 4G4PA 2ONSA 2DVCA 1MPBA 2XX7A 4R72A 1B40A 3CRBA 1I69A 2O6AA 1A55A 1P1QA 2FYIA 3FXQA 4G68A 1UQWA 1MXVA 1DPEA 3K6VA 4H5FA 1R1NA 3JZJA 1P1UA 4ZEFA 2VGQA 4JWOA 3PU5A 1MH4A 2A5TB 2R9JA 1H3DA 3QSLA 1LBBA 1A99A 2XXVA 1LBCA 3IOWA 3N6TA 3TMGA 1NFTA 2E1SA 5IAIA 3QXMA 4KD5A 3LSWA 3UGWA 1B1HA 4RY1A 4F1YA 4EXKA 4JBZA 1HSJA 3EHSA 3I6VA 1B1XA 4WEDA 1P99A 2NWJA 3TKDA 3PUZE 5M2VA 3KJTA 2O7IA 4PP0A 1GTKA 4QSDA 2Z22A 2O51A 4HW8A 3M3LA 4ONYA 1A8EA 4R9FA 4G2ZA 5ICQA 1ZBMA 3IJXB 1N3XA 2D5WA 2F36A 1XS5A 4G77A 2LAOA 1MXXA 2XXIA 4F3SA 1EZOA 1XC1A 2NUVA 2Q9TA 1NH8A 3W9WA 1D4NA 2ALUA 1OVTA 3S4UA 1LAFE 2F6GA 1H44A 2I3VA 2DWHA 3QUJA 2UXAA 5AA2A 3G3GA 3O97A 3KZGA 3SESA 3OD7A 4KI0E 2YLNA 1XHYA 2I48A 2XX9A 5K2YA 4NMYA 4F31B 2I3WA 3LUYA 5I58B 1JEVA 2P1SA 1B7HA 4JXIA 1P1OA 5CBSA 2OBGA 5L9OA 1M5BA 4MH5A 2Y7PA 2H5YA 4IY6A 2YJPA 1UTHA 4IO2A 2VD3A 4JSDA 3BKIB 4MBPA 4BDLA 1GVCA 3DELB 2DOJA 4QRZA 3EQ1A 3ZS6A 2F34A 2V93A 2H98A 1YAEA 1WDNA 4QFKA 1J1NA 1LSTA 4P11A 3GBBA 4WKMA 3R6UA 3KN8A 4F3PA 1D3KA 1KWHA 1IXIA 2Y7WA 1JW4A 4OVJA 4DCXA 2QL3A 3MW0A 1DTGA 5TP9A 1SW1A 1VE4A 2G93A 3VVDA 4YAHX 1BP5A 4H0WA 1TXFA 4RK2A 3SKPA 3U93A 1T0KA 3K02A 4H67A 4BLAA 1QUJA 4ND9A 3ZSFA 4NEDA 3WAFA 4POWA 1DSNA 4X9TA 3CFLA 2VOZA 1UTBB 1QKAA 1MY2A 1QKBA 4NE4A 1BLFA 4PE5B 3RNNA 1FQFA 2V3UA 5BWJA 1SBPA 4DIGA 3KFMA 1SI0A 4L17A 3C4MA 1MXZA 1IUDA 5H8HA 1US4A 2HZLA 2PBWA 3G3KA 4G8HA 2DS9A 1MY0A 4Q8RA 2F78A 4JWYA 4GOTA 4YU0A 1B2HA 3UP9A 1RYOA 3PUYE 4XXUA 1US5A 4FEDA 1ZIUA 3MZ1A 1DOTA 2HZKA 3O6GA 2X7QA 3IO4A 1LCFA 5CMCA 4GXSB 4GL0A 1AIVA 4K3FA 5I56B 3LSLA 4YB6A 3FXUA 3KSJA 3MVXA 4NF4A 1D9YA 3OELA 5EHSA 3G7WA 3RQTA 1DMBA 3LSFB 3UORA 3O28A 4LA9A 3TTMA 1ANFA 2RF1A 1OLAA 1FW0A 5FHNA 3N94A 3Q28A 3QYTA 3CFXA 3VVFA 3T93B 2Z8DA 3TPAA 4JWXA 2UYEA 4GWOA 1AMFA 5DEXB 4R9GA 2REGA 1RKMA 4IO5A 4DE8A 2Z23A 3FJ7A 3KG2A 4IB2A 1PBPA 2E0SA 1M5CA 4THIA 1ZU0A 5F7VA 3E3KA 3CG1A 1Y3PA 2DWIA 5I84A 4PFUA 2PT2A 5I59A 4Q5TA 3K6WA 4XKNA 3FZVA 3K0VA 1MG1A 4POXA 3PV0E 5A5XB 2O68A 3OO8A 1Z7ME 2DE4A 1FTMA 1ZKBA 4DZ1A 2QJEA 1MDQA 3TUSA 3C35A 4R6KA 1P1WA 4F1VA 1Q35A 3EHTA 1ZMGA 4C1UA 3K01A 2ONKE 3PUVE 2G29A 1GGGA 2PT1A 4U1OA 4FE8A 4G68B 5I2KA 1YCJA 2PYYA 3HHGA 5HM4B 1B3HA 4KYEA 1S7YA 1PEBA 2RCAA 4ZEDA 3QUFA 3VVEA 3FVKA 5JTYB 4LZ7A 2ZMBA 2Y7RA 4QFOA 5DVJA 2DE2A 3Q26A 3K00A 3FASA 2Y7KA 4OYVA 2FNCA 2I49A 3RT8A 2AYSA 1JQFA 2UYFA 3B6TA 2NVUB 4F2OA 4I8CA 3PPPA 1WVJA 4OETA 2Y84A 1SD3A 4LZ8A 1USYE 1LFIA 4PFTA 4OHNA 1HSLA 4GL8A 2H25A 4XKQA 1YPNA 3M3KA 1I6BA 1LGBC 1MQDA 3EPEA 4YKKA 5CM6A 1N7XA 3A3CA 5B7DA 1NNPA 4ZE9A 2F7BA 5EYFA 2HQ0A 3SEWA 3RGYA 2OWTA 3EHUA 3PPQA 2OWSA 4DLDA 3H3GA 2ZYMA 5K2XA 4F22A 1B52A 1B0LA 2RC8A 3D4GA 1IEJA 2CZLA 3U72A 3CR9A 2VP1A 3RY3A 1CE2A 1URDA 4E0XA 3FV2A 4YMBA 5B70A 3N6UA 3KJ7A 4KCDA 2F7CA 3H7MA 1N3WA 1SW2A 2XXQA 2V3TA 1TFDA 4FJPA 3TQLA 1BIYA 1VFEA 1ZTYA 3C31A 5DVFA 2I6EA 2XXXA 4KFQA 1QJMA 3ZKKA 1B5IA 2HAVA 2O84X 3FVNA 3MVWA 3TFLA 2F97A 2XD2A 3A09A 1O7TA 3PMWA 4GD5A 4F39A 3BFTA 2PX1A 3FV1A 4U2RA 3U94A 1VSOA 4E0WA 3JYRA 2F7AA 1TT1A 2QMWA 4F29A 4ZEBA 1UTHB 2HAUA 5DVIA 4P0IA 5JK4A 3TTNA 4KCCA 4NF8A 4NF6B 4FATA 5KZTA 1Y3NA 3ILTB 3K6UA 3IOUA 4TOZA 4WXJA 3MJNA 4NWCA 4EQ9A 3TTKA 3QIMA 1IQ7A 5ISUA 1USYH 1SDXA 3KGCA 4YB5A 1B58A 3K1PA 4GIZA 1Y4TA 3TCFA 5AA1A 1NMUA 4LONB 4G8MA 4H6DA 5LOMA 1SYIA 1NL5A 3MWBA 3KOSA 5TP9B 4ESXA 2RC7A 3V8XB 1B51A 1WODA 2QPQA 2WKYA 2Q8JA 3FGSA 1JVXA 1MXUA 3QK6A 4IO4A 2F6PA 4P0GA 3TELA 1DPPA 3THIA 1MPDA 1B46A 2H4IA 2OCUA 4IO7A 1FQAA 3ECRA 2GFEA 1FTJA 2QS3A 3B6QA 5H8HB 3OO7A 3Q25A 4FIMA 3V83A 3V5AA 5FHMA 1MS7A 2KLFA 3T22A 5I57A 5KDTB 4BDOA 5H8SA 3IO6A 3G3IA 2ZNTA 4OXVA 5FHOA 2DSFA 3PPNA 3AXFA 3TTLA 3CFZA 3PPRA 4H8IA 3RTWB 3HSTA 4X48A 2XXWA 3WAEA 3K4UA 3FJGA 2OLBA 3DP6A 1B3GA 1Y20A 3MVYA 1NNKA 1L5TA 4NF4B 4QHQA 3H6WA 4RPNA 3N26A 3IX1A 1FQBA 3C9HA 4C0RA 4OMBA 4GVOA 1JEUA 3QAXA 3C32A 3C33A 4DXBA 3MZ9A 1MDP1 2AIXA 5L8DA 4OERA 1LB9A 2PMSA 1R6ZA 3Q29A 4JSOA 1FCKA 2REJA 4FORA 2D3IA 2CMOA 1A7LA 4TLLB 3SETA 3MP1A 3IJOB 3T96B 3MUQA 2PVUA 3T66A 5FTHA 5I59B 1N04A 2XXHA 1H76A 1LB8A 3C36A 1Z7NE 4XKPA 1N84A 4U4XA 1HSEA 4HTGA 4OTEA 4WEPA 2ZNUA 2Z8EA 4OWDA 1N76A 3PPOA 3LC8A 4I1DA 1MH3A 3UN6A 3H03A 1A8FA 5I2KB 2XD3A 5ITOA 3TYHA 3S2VA 4R2FA 1DTZA 4YZZA 1B5HA 5ICTA 3H06B 4U22A 3GBAA 3FIRA 3S9EA 1MY3A 3BBRA 4NF5A 1IITA 3RT6B 4O3BA 2UVIA 2IA4A 3CG3A 4OFOA 4Z7EA 4YB7A 3KBRA 3T9HB 4HCYA 5H8NA 3RPWA 3E9XA 1N7WA 2B65A 1ZJLA 3TODA 2QS4A 1XOCA 4ELPA 1RYXA 2O7UA 2GHBA 3EF7A 4FECA 4ZS9A 4QF9A 5JEIA 2ZYKA 4R6HA 1EH3A 2YPNA 3K1NA 3GLBA 1UTBA 5I2NA 3CI8A 1XT8A 3R7XA 4H5GA 3HV1A 4X1DA 5DT6A 3S9LC 3FJMA 1PB9A 5EHMA 2XXUA 1MQHA 1B3FA 4R6YA 4PQJA 1OIBA 3O6IA 2F8DA 1B4ZA 4F3BA 2P0SA 1MQGA 1IXGA 2OK2A 1PB8A 4DXCA 4IGTA 3T9XB 4N07A 1B7UA 3LBSA 4F1UA 1MPCA 2B3FA 2W7YA 1MQJA 4H1XA 5CBRA 4KYDA 3MC2A 4PETA 3VLWA 2QMXA 5AA4A 1TFAA 1URSA 3I5OA 1MM6A 1TWYA 2I0BA 3LR1A 2DYXA 1H45A 3FUZA 2B3BA 1QUKA 3H4ZA 4H8JA 3O29A 3FVGA 1B05A 4YMAA 3P7IA 4Z0IA 3BFUA 4I9DA 3MP6A 3VLUA 3O66A 3G3HA 3TDJA 1S9TA 1ATGA 3KN7A 1ZLQA 4H65A 1I6QA 3MAMA 4YKIA 4IO3A 5H8FA 3D4CA 3DP8A 4QSCA 3HN0A 3RTFB 2DWAA 1LAXA 5L9MA 1MXWA 2UVJA 2RKMA 4NF8B 4ZZAA 2Q2CA 2F35A 3G3JA 4ZE8A 4LP2B 3VDFA 3L6HA 4KYSA 4GXAA 3TCGA 3A3UA 3SEYA 3UIFA 2ZXTA 3TAJA 5BUUA 3IAZA 1MQIA 5H8QA 3W15C 2ABHA 1B0HA 1R9LA 1JETA 4OZ9A 1Q1KA 5A5XA 3OEMA 1SW5A 2AL4A 4OESA 4PFWA 4XIGQ 4RK9A 2XX8A 4GQOA 3SEXA 4DCYA 1LFGA 2ONRA 4TQUQ 1Y4CA 2F5XA 3OENA 3PMXA 2I0CA 5AA2B 2GRVA 3M8UA 2VHAA 2DE3A 4LQ5A 1O64A 2I58A 2FA7A 3K1MA 1PC3A 5JTYA 1S50A 4MLVA 4UA8A 1A40A 3VE1B 3LSXA 1SI1A 5DTBA 2ZYNA 3EN3A 4LQ2A 4YICA 4KR5A 4U1ZA 2RCBA 5I57B 2I4BA 4YKJA 1B3EA 4ELRA 2V3QA 1MRPA 4RA1A 4F2QA 1EZ9A 3FD3A 4Q30B 3IB0A 5TPAA 3PUXE 2HEUA 1IZ1A 3O9PA 1PB7A 3HO7A 1H43A 3U8QA 4OQOA 2GHAA 1QULA 2UVHA 1FQEA 5KCJA 3IB2A 1EU8A 3DM0A 3G3FA 3OEKA 3GXAA 1LAHE 4AB5A 3FATA 3KSXA 4TLMB 1PDAA 4ELOA 4DXUA 4R73A 1NH7A 3K6XA 3RLFE 2Z8FA 4BDQA 1B6HA 3T9UA 3CSGA 1B7ZA 4I62A 2QRYA 4ZZEA 4MF3A 1IIWA 2ZNSA 4NWDA 3MPKA 3PUWE 4BDNA 4X1BA 1PBQA 3FXRA 1FTKA 1OVBA 2A5TA 1M5FA 4KHZE 4OEVA 5J1DA 2XXTA 1FQCA 4ZEKA 4EQBA 5F1QA 4KQPA 4OENA 1SW4A 1MY1A 3V89B 1JVYA 1R9QA 3E13X 3H6UA 2ESNA 5AE4A 4EDPA 3MZBA 2NXOA 5FTIA 1FTOA 1XVYA 2UVGA 5AA3A 4O3CA 4FAJA 4N13A 4AQ4A 3OOAA 2O1LA 4IGRA 5CI5A 3S9MC 3MPLA 3OMBA 1URGA 4M4GA 4XTCQ 3PD8A 1YTVA 4MFIA 4NF6A 4OEUA 4RYAA 1Y3QA 2I4CA 3O2AA 4GF8A 1CB6A 3OO6A 3CIJA 4ISUA 1BKAA 3DP4A 4C1TA 1O63A 1Y1ZA 1NNTA 3E4RA 1EZPA 4U21A 3SDFA 4FEBA 3B6WA 4NF5B 2Q2AA 2DWJA 4G8NA 3N5LA 3MVZA 4IO6A 4R2BA 1LLSA 2R71A 5AA2D 1IXCA 1POY1 3RN8A 3PGFA 4U4SA 4ELQA 5H8NB 3ILUB 4QFLA 3ZKLA 3IB1A 3M3FA 1ELJA 4BDMA 1B4HA 4BDRA 4EF2A 3IL1B 4QSEA 4RPOA 3IORA 1VFDA 1LCTA 3UA8A 1QUIA 2XHDA 3H6VA 2OZZA 1GR2A 2ANJA 5I58A 1NNFA 4RXLA 5I2NB 4AB6A 1M5DA 4RJZA 3F11A 4F19A 1MY4A 3PMVA 3B7DA 2XXYA 3PD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMB A;  3UK4 A;  4LUB A;  4QFN A;  5KDT A;  1GV8 A;  3FVO A;  3HHF A;  5HBC A;  3L6G A;  3T9V A;  2RIN A;  2IEE A;  3DLN A;  4EQ7 A;  5IKB A;  4JB7 A;  3VLV A;  2ZYO A;  1UIV A;  3RUM A;  2THI A;  4ECF A;  1I6A A;  5L9S A;  1FTL A;  4R75 A;  2XXP A;  1IXH A;  1MXY A;  3JV9 A;  4G68 C;  2V84 A;  4KPT A;  1JNF A;  4UAC A;  3KN3 A;  3TCH A;  4HS7 A;  5ITP A;  1N0T A;  4LAT A;  2D21 A;  1B3L A;  4DDD A;  3SER A;  2RC9 A;  4GLI A;  5AA4 B;  1BTJ A;  2XXR A;  3Q27 A;  5ELV A;  3OXN A;  3TQW A;  3R26 A;  4MLQ A;  5CC2 A;  4ESW A;  3CVG A;  2DQV A;  1JW5 A;  2H99 A;  2GH9 A;  1F9B A;  3U1O A;  5CMM A;  3MQ9 A;  3VXC A;  1LFH A;  1SQY A;  2O69 A;  1VR5 A;  1II5 A;  3SEU A;  4OFJ A;  2A5S A;  2QS1 A;  3IOT A;  3C34 A;  2Q88 A;  4M1V A;  2HXW A;  2X7P A;  1B5J A;  3U92 A;  5H8F B;  2AL5 A;  2Q89 A;  3H6T A;  3OSQ A;  1Y9U A;  5TU0 A;  3MP8 A;  4LVQ A;  3MBP A;  1POT A;  1A54 A;  3K2D A;  3ODB A;  4ZEC A;  3TZA A;  3VXB A;  1QW0 A;  1NKX A;  4EF1 A;  3OO9 A;  5H8Q B;  3S9N C;  4RNS A;  4EUO A;  4Q0C A;  3W9V A;  4QFP A;  4R74 A;  3VFJ A;  3O6H A;  3OSR A;  4PFY A;  3TEP A;  1SVX B;  5DYH A;  4XKR A;  2M8C A;  3USD A;  1AOV A;  4ZDM A;  4NTL A;  3SEV A;  2DXY A;  3HCQ A;  2P2A A;  4YKP A;  5I56 A;  2DP8 A;  2O1M A;  5CRY A;  1UIU A;  4U23 A;  3ONM A;  4N6P A;  2QSX A;  2OJT A;  3TTR A;  2DVZ A;  2Y7I A;  1M5E A;  1QVS A;  2HCA A;  3GZG A;  1AL3 A;  4IY5 A;  3I3V A;  1Y1M A;  3IR1 A;  4EXL A;  2QS2 A;  2H9B A;  4OFL A;  1D9V A;  5DEX A;  4ZEI A;  1OMP A;  4F3G A;  1B32 A;  2V25 A;  3HPI A;  1P1N A;  3KEI A;  4F18 A;  5TPA B;  3KOT A;  3CSB A;  2HFB A;  2BJJ X;  1LAG E;  4LZ5 A;  4O3A A;  1MM7 A;  4GFR A;  1OLC A;  1XVX A;  1OQH A;  5HPQ A;  4GRK A;  5KCJ B;  1AH5 A;  2NOO A;  2R6G E;  4HCW A;  1OQG A;  3IOV A;  3IK6 B;  1JW1 A;  2DXR A;  1SYH A;  3VV5 A;  1B9J A;  5CMK A;  2X26 A;  2VD2 A;  1FQD A;  4JDF A;  4G4P A;  2ONS A;  2DVC A;  1MPB A;  2XX7 A;  4R72 A;  1B40 A;  3CRB A;  1I69 A;  2O6A A;  1A55 A;  1P1Q A;  2FYI A;  3FXQ A;  4G68 A;  1UQW A;  1MXV A;  1DPE A;  3K6V A;  4H5F A;  1R1N A;  3JZJ A;  1P1U A;  4ZEF A;  2VGQ A;  4JWO A;  3PU5 A;  1MH4 A;  2A5T B;  2R9J A;  1H3D A;  3QSL A;  1LBB A;  1A99 A;  2XXV A;  1LBC A;  3IOW A;  3N6T A;  3TMG A;  1NFT A;  2E1S A;  5IAI A;  3QXM A;  4KD5 A;  3LSW A;  3UGW A;  1B1H A;  4RY1 A;  4F1Y A;  4EXK A;  4JBZ A;  1HSJ A;  3EHS A;  3I6V A;  1B1X A;  4WED A;  1P99 A;  2NWJ A;  3TKD A;  3PUZ E;  5M2V A;  3KJT A;  2O7I A;  4PP0 A;  1GTK A;  4QSD A;  2Z22 A;  2O51 A;  4HW8 A;  3M3L A;  4ONY A;  1A8E A;  4R9F A;  4G2Z A;  5ICQ A;  1ZBM A;  3IJX B;  1N3X A;  2D5W A;  2F36 A;  1XS5 A;  4G77 A;  2LAO A;  1MXX A;  2XXI A;  4F3S A;  1EZO A;  1XC1 A;  2NUV A;  2Q9T A;  1NH8 A;  3W9W A;  1D4N A;  2ALU A;  1OVT A;  3S4U A;  1LAF E;  2F6G A;  1H44 A;  2I3V A;  2DWH A;  3QUJ A;  2UXA A;  5AA2 A;  3G3G A;  3O97 A;  3KZG A;  3SES A;  3OD7 A;  4KI0 E;  2YLN A;  1XHY A;  2I48 A;  2XX9 A;  5K2Y A;  4NMY A;  4F31 B;  2I3W A;  3LUY A;  5I58 B;  1JEV A;  2P1S A;  1B7H A;  4JXI A;  1P1O A;  5CBS A;  2OBG A;  5L9O A;  1M5B A;  4MH5 A;  2Y7P A;  2H5Y A;  4IY6 A;  2YJP A;  1UTH A;  4IO2 A;  2VD3 A;  4JSD A;  3BKI B;  4MBP A;  4BDL A;  1GVC A;  3DEL B;  2DOJ A;  4QRZ A;  3EQ1 A;  3ZS6 A;  2F34 A;  2V93 A;  2H98 A;  1YAE A;  1WDN A;  4QFK A;  1J1N A;  1LST A;  4P11 A;  3GBB A;  4WKM A;  3R6U A;  3KN8 A;  4F3P A;  1D3K A;  1KWH A;  1IXI A;  2Y7W A;  1JW4 A;  4OVJ A;  4DCX A;  2QL3 A;  3MW0 A;  1DTG A;  5TP9 A;  1SW1 A;  1VE4 A;  2G93 A;  3VVD A;  4YAH X;  1BP5 A;  4H0W A;  1TXF A;  4RK2 A;  3SKP A;  3U93 A;  1T0K A;  3K02 A;  4H67 A;  4BLA A;  1QUJ A;  4ND9 A;  3ZSF A;  4NED A;  3WAF A;  4POW A;  1DSN A;  4X9T A;  3CFL A;  2VOZ A;  1UTB B;  1QKA A;  1MY2 A;  1QKB A;  4NE4 A;  1BLF A;  4PE5 B;  3RNN A;  1FQF A;  2V3U A;  5BWJ A;  1SBP A;  4DIG A;  3KFM A;  1SI0 A;  4L17 A;  3C4M A;  1MXZ A;  1IUD A;  5H8H A;  1US4 A;  2HZL A;  2PBW A;  3G3K A;  4G8H A;  2DS9 A;  1MY0 A;  4Q8R A;  2F78 A;  4JWY A;  4GOT A;  4YU0 A;  1B2H A;  3UP9 A;  1RYO A;  3PUY E;  4XXU A;  1US5 A;  4FED A;  1ZIU A;  3MZ1 A;  1DOT A;  2HZK A;  3O6G A;  2X7Q A;  3IO4 A;  1LCF A;  5CMC A;  4GXS B;  4GL0 A;  1AIV A;  4K3F A;  5I56 B;  3LSL A;  4YB6 A;  3FXU A;  3KSJ A;  3MVX A;  4NF4 A;  1D9Y A;  3OEL A;  5EHS A;  3G7W A;  3RQT A;  1DMB A;  3LSF B;  3UOR A;  3O28 A;  4LA9 A;  3TTM A;  1ANF A;  2RF1 A;  1OLA A;  1FW0 A;  5FHN A;  3N94 A;  3Q28 A;  3QYT A;  3CFX A;  3VVF A;  3T93 B;  2Z8D A;  3TPA A;  4JWX A;  2UYE A;  4GWO A;  1AMF A;  5DEX B;  4R9G A;  2REG A;  1RKM A;  4IO5 A;  4DE8 A;  2Z23 A;  3FJ7 A;  3KG2 A;  4IB2 A;  1PBP A;  2E0S A;  1M5C A;  4THI A;  1ZU0 A;  5F7V A;  3E3K A;  3CG1 A;  1Y3P A;  2DWI A;  5I84 A;  4PFU A;  2PT2 A;  5I59 A;  4Q5T A;  3K6W A;  4XKN A;  3FZV A;  3K0V A;  1MG1 A;  4POX A;  3PV0 E;  5A5X B;  2O68 A;  3OO8 A;  1Z7M E;  2DE4 A;  1FTM A;  1ZKB A;  4DZ1 A;  2QJE A;  1MDQ A;  3TUS A;  3C35 A;  4R6K A;  1P1W A;  4F1V A;  1Q35 A;  3EHT A;  1ZMG A;  4C1U A;  3K01 A;  2ONK E;  3PUV E;  2G29 A;  1GGG A;  2PT1 A;  4U1O A;  4FE8 A;  4G68 B;  5I2K A;  1YCJ A;  2PYY A;  3HHG A;  5HM4 B;  1B3H A;  4KYE A;  1S7Y A;  1PEB A;  2RCA A;  4ZED A;  3QUF A;  3VVE A;  3FVK A;  5JTY B;  4LZ7 A;  2ZMB A;  2Y7R A;  4QFO A;  5DVJ A;  2DE2 A;  3Q26 A;  3K00 A;  3FAS A;  2Y7K A;  4OYV A;  2FNC A;  2I49 A;  3RT8 A;  2AYS A;  1JQF A;  2UYF A;  3B6T A;  2NVU B;  4F2O A;  4I8C A;  3PPP A;  1WVJ A;  4OET A;  2Y84 A;  1SD3 A;  4LZ8 A;  1USY E;  1LFI A;  4PFT A;  4OHN A;  1HSL A;  4GL8 A;  2H25 A;  4XKQ A;  1YPN A;  3M3K A;  1I6B A;  1LGB C;  1MQD A;  3EPE A;  4YKK A;  5CM6 A;  1N7X A;  3A3C A;  5B7D A;  1NNP A;  4ZE9 A;  2F7B A;  5EYF A;  2HQ0 A;  3SEW A;  3RGY A;  2OWT A;  3EHU A;  3PPQ A;  2OWS A;  4DLD A;  3H3G A;  2ZYM A;  5K2X A;  4F22 A;  1B52 A;  1B0L A;  2RC8 A;  3D4G A;  1IEJ A;  2CZL A;  3U72 A;  3CR9 A;  2VP1 A;  3RY3 A;  1CE2 A;  1URD A;  4E0X A;  3FV2 A;  4YMB A;  5B70 A;  3N6U A;  3KJ7 A;  4KCD A;  2F7C A;  3H7M A;  1N3W A;  1SW2 A;  2XXQ A;  2V3T A;  1TFD A;  4FJP A;  3TQL A;  1BIY A;  1VFE A;  1ZTY A;  3C31 A;  5DVF A;  2I6E A;  2XXX A;  4KFQ A;  1QJM A;  3ZKK A;  1B5I A;  2HAV A;  2O84 X;  3FVN A;  3MVW A;  3TFL A;  2F97 A;  2XD2 A;  3A09 A;  1O7T A;  3PMW A;  4GD5 A;  4F39 A;  3BFT A;  2PX1 A;  3FV1 A;  4U2R A;  3U94 A;  1VSO A;  4E0W A;  3JYR A;  2F7A A;  1TT1 A;  2QMW A;  4F29 A;  4ZEB A;  1UTH B;  2HAU A;  5DVI A;  4P0I A;  5JK4 A;  3TTN A;  4KCC A;  4NF8 A;  4NF6 B;  4FAT A;  5KZT A;  1Y3N A;  3ILT B;  3K6U A;  3IOU A;  4TOZ A;  4WXJ A;  3MJN A;  4NWC A;  4EQ9 A;  3TTK A;  3QIM A;  1IQ7 A;  5ISU A;  1USY H;  1SDX A;  3KGC A;  4YB5 A;  1B58 A;  3K1P A;  4GIZ A;  1Y4T A;  3TCF A;  5AA1 A;  1NMU A;  4LON B;  4G8M A;  4H6D A;  5LOM A;  1SYI A;  1NL5 A;  3MWB A;  3KOS A;  5TP9 B;  4ESX A;  2RC7 A;  3V8X B;  1B51 A;  1WOD A;  2QPQ A;  2WKY A;  2Q8J A;  3FGS A;  1JVX A;  1MXU A;  3QK6 A;  4IO4 A;  2F6P A;  4P0G A;  3TEL A;  1DPP A;  3THI A;  1MPD A;  1B46 A;  2H4I A;  2OCU A;  4IO7 A;  1FQA A;  3ECR A;  2GFE A;  1FTJ A;  2QS3 A;  3B6Q A;  5H8H B;  3OO7 A;  3Q25 A;  4FIM A;  3V83 A;  3V5A A;  5FHM A;  1MS7 A;  2KLF A;  3T22 A;  5I57 A;  5KDT B;  4BDO A;  5H8S A;  3IO6 A;  3G3I A;  2ZNT A;  4OXV A;  5FHO A;  2DSF A;  3PPN A;  3AXF A;  3TTL A;  3CFZ A;  3PPR A;  4H8I A;  3RTW B;  3HST A;  4X48 A;  2XXW A;  3WAE A;  3K4U A;  3FJG A;  2OLB A;  3DP6 A;  1B3G A;  1Y20 A;  3MVY A;  1NNK A;  1L5T A;  4NF4 B;  4QHQ A;  3H6W A;  4RPN A;  3N26 A;  3IX1 A;  1FQB A;  3C9H A;  4C0R A;  4OMB A;  4GVO A;  1JEU A;  3QAX A;  3C32 A;  3C33 A;  4DXB A;  3MZ9 A;  1MDP 1;  2AIX A;  5L8D A;  4OER A;  1LB9 A;  2PMS A;  1R6Z A;  3Q29 A;  4JSO A;  1FCK A;  2REJ A;  4FOR A;  2D3I A;  2CMO A;  1A7L A;  4TLL B;  3SET A;  3MP1 A;  3IJO B;  3T96 B;  3MUQ A;  2PVU A;  3T66 A;  5FTH A;  5I59 B;  1N04 A;  2XXH A;  1H76 A;  1LB8 A;  3C36 A;  1Z7N E;  4XKP A;  1N84 A;  4U4X A;  1HSE A;  4HTG A;  4OTE A;  4WEP A;  2ZNU A;  2Z8E A;  4OWD A;  1N76 A;  3PPO A;  3LC8 A;  4I1D A;  1MH3 A;  3UN6 A;  3H03 A;  1A8F A;  5I2K B;  2XD3 A;  5ITO A;  3TYH A;  3S2V A;  4R2F A;  1DTZ A;  4YZZ A;  1B5H A;  5ICT A;  3H06 B;  4U22 A;  3GBA A;  3FIR A;  3S9E A;  1MY3 A;  3BBR A;  4NF5 A;  1IIT A;  3RT6 B;  4O3B A;  2UVI A;  2IA4 A;  3CG3 A;  4OFO A;  4Z7E A;  4YB7 A;  3KBR A;  3T9H B;  4HCY A;  5H8N A;  3RPW A;  3E9X A;  1N7W A;  2B65 A;  1ZJL A;  3TOD A;  2QS4 A;  1XOC A;  4ELP A;  1RYX A;  2O7U A;  2GHB A;  3EF7 A;  4FEC A;  4ZS9 A;  4QF9 A;  5JEI A;  2ZYK A;  4R6H A;  1EH3 A;  2YPN A;  3K1N A;  3GLB A;  1UTB A;  5I2N A;  3CI8 A;  1XT8 A;  3R7X A;  4H5G A;  3HV1 A;  4X1D A;  5DT6 A;  3S9L C;  3FJM A;  1PB9 A;  5EHM A;  2XXU A;  1MQH A;  1B3F A;  4R6Y A;  4PQJ A;  1OIB A;  3O6I A;  2F8D A;  1B4Z A;  4F3B A;  2P0S A;  1MQG A;  1IXG A;  2OK2 A;  1PB8 A;  4DXC A;  4IGT A;  3T9X B;  4N07 A;  1B7U A;  3LBS A;  4F1U A;  1MPC A;  2B3F A;  2W7Y A;  1MQJ A;  4H1X A;  5CBR A;  4KYD A;  3MC2 A;  4PET A;  3VLW A;  2QMX A;  5AA4 A;  1TFA A;  1URS A;  3I5O A;  1MM6 A;  1TWY A;  2I0B A;  3LR1 A;  2DYX A;  1H45 A;  3FUZ A;  2B3B A;  1QUK A;  3H4Z A;  4H8J A;  3O29 A;  3FVG A;  1B05 A;  4YMA A;  3P7I A;  4Z0I A;  3BFU A;  4I9D A;  3MP6 A;  3VLU A;  3O66 A;  3G3H A;  3TDJ A;  1S9T A;  1ATG A;  3KN7 A;  1ZLQ A;  4H65 A;  1I6Q A;  3MAM A;  4YKI A;  4IO3 A;  5H8F A;  3D4C A;  3DP8 A;  4QSC A;  3HN0 A;  3RTF B;  2DWA A;  1LAX A;  5L9M A;  1MXW A;  2UVJ A;  2RKM A;  4NF8 B;  4ZZA A;  2Q2C A;  2F35 A;  3G3J A;  4ZE8 A;  4LP2 B;  3VDF A;  3L6H A;  4KYS A;  4GXA A;  3TCG A;  3A3U A;  3SEY A;  3UIF A;  2ZXT A;  3TAJ A;  5BUU A;  3IAZ A;  1MQI A;  5H8Q A;  3W15 C;  2ABH A;  1B0H A;  1R9L A;  1JET A;  4OZ9 A;  1Q1K A;  5A5X A;  3OEM A;  1SW5 A;  2AL4 A;  4OES A;  4PFW A;  4XIG Q;  4RK9 A;  2XX8 A;  4GQO A;  3SEX A;  4DCY A;  1LFG A;  2ONR A;  4TQU Q;  1Y4C A;  2F5X A;  3OEN A;  3PMX A;  2I0C A;  5AA2 B;  2GRV A;  3M8U A;  2VHA A;  2DE3 A;  4LQ5 A;  1O64 A;  2I58 A;  2FA7 A;  3K1M A;  1PC3 A;  5JTY A;  1S50 A;  4MLV A;  4UA8 A;  1A40 A;  3VE1 B;  3LSX A;  1SI1 A;  5DTB A;  2ZYN A;  3EN3 A;  4LQ2 A;  4YIC A;  4KR5 A;  4U1Z A;  2RCB A;  5I57 B;  2I4B A;  4YKJ A;  1B3E A;  4ELR A;  2V3Q A;  1MRP A;  4RA1 A;  4F2Q A;  1EZ9 A;  3FD3 A;  4Q30 B;  3IB0 A;  5TPA A;  3PUX E;  2HEU A;  1IZ1 A;  3O9P A;  1PB7 A;  3HO7 A;  1H43 A;  3U8Q A;  4OQO A;  2GHA A;  1QUL A;  2UVH A;  1FQE A;  5KCJ A;  3IB2 A;  1EU8 A;  3DM0 A;  3G3F A;  3OEK A;  3GXA A;  1LAH E;  4AB5 A;  3FAT A;  3KSX A;  4TLM B;  1PDA A;  4ELO A;  4DXU A;  4R73 A;  1NH7 A;  3K6X A;  3RLF E;  2Z8F A;  4BDQ A;  1B6H A;  3T9U A;  3CSG A;  1B7Z A;  4I62 A;  2QRY A;  4ZZE A;  4MF3 A;  1IIW A;  2ZNS A;  4NWD A;  3MPK A;  3PUW E;  4BDN A;  4X1B A;  1PBQ A;  3FXR A;  1FTK A;  1OVB A;  2A5T A;  1M5F A;  4KHZ E;  4OEV A;  5J1D A;  2XXT A;  1FQC A;  4ZEK A;  4EQB A;  5F1Q A;  4KQP A;  4OEN A;  1SW4 A;  1MY1 A;  3V89 B;  1JVY A;  1R9Q A;  3E13 X;  3H6U A;  2ESN A;  5AE4 A;  4EDP A;  3MZB A;  2NXO A;  5FTI A;  1FTO A;  1XVY A;  2UVG A;  5AA3 A;  4O3C A;  4FAJ A;  4N13 A;  4AQ4 A;  3OOA A;  2O1L A;  4IGR A;  5CI5 A;  3S9M C;  3MPL A;  3OMB A;  1URG A;  4M4G A;  4XTC Q;  3PD8 A;  1YTV A;  4MFI A;  4NF6 A;  4OEU A;  4RYA A;  1Y3Q A;  2I4C A;  3O2A A;  4GF8 A;  1CB6 A;  3OO6 A;  3CIJ A;  4ISU A;  1BKA A;  3DP4 A;  4C1T A;  1O63 A;  1Y1Z A;  1NNT A;  3E4R A;  1EZP A;  4U21 A;  3SDF A;  4FEB A;  3B6W A;  4NF5 B;  2Q2A A;  2DWJ A;  4G8N A;  3N5L A;  3MVZ A;  4IO6 A;  4R2B A;  1LLS A;  2R71 A;  5AA2 D;  1IXC A;  1POY 1;  3RN8 A;  3PGF A;  4U4S A;  4ELQ A;  5H8N B;  3ILU B;  4QFL A;  3ZKL A;  3IB1 A;  3M3F A;  1ELJ A;  4BDM A;  1B4H A;  4BDR A;  4EF2 A;  3IL1 B;  4QSE A;  4RPO A;  3IOR A;  1VFD A;  1LCT A;  3UA8 A;  1QUI A;  2XHD A;  3H6V A;  2OZZ A;  1GR2 A;  2ANJ A;  5I58 A;  1NNF A;  4RXL A;  5I2N B;  4AB6 A;  1M5D A;  4RJZ A;  3F11 A;  4F19 A;  1MY4 A;  3PMV A;  3B7D A;  2XXY A;  3PD9 A; 
#chains in the Genus database with same CATH topology
 4N15 A;  5CMB A;  3UK4 A;  4LUB A;  2F3B A;  4QFN A;  5KDT A;  1GV8 A;  3FVO A;  3HHF A;  4OVS A;  5HBC A;  3L6G A;  3T9V A;  4MNC A;  2RIN A;  1FBG A;  2IEE A;  3DLN A;  4EQ7 A;  5IKB A;  4JB7 A;  3VLV A;  2ZYO A;  1UIV A;  3RUM A;  2THI A;  4ECF A;  1FSA A;  1FPK A;  1I6A A;  5L9S A;  1FTL A;  4R75 A;  2XXP A;  1IXH A;  1MXY A;  3JV9 A;  4G68 C;  2V84 A;  4KPT A;  1JNF A;  4UAC A;  3KN3 A;  3TCH A;  2Y5L A;  4HS7 A;  5ITP A;  1N0T A;  4LAT A;  2D21 A;  1B3L A;  4PGN A;  4DDD A;  3SER A;  1RDZ A;  2RC9 A;  4GLI A;  5AA4 B;  1BTJ A;  2XXR A;  3Q27 A;  1FBP A;  4HE2 A;  5ELV A;  3OXN A;  3TQW A;  3R26 A;  4MLQ A;  5CC2 A;  4ESW A;  3CVG A;  2DQV A;  1JW5 A;  1NUY A;  1DCU A;  2H99 A;  2GH9 A;  1F9B A;  3U1O A;  5CMM A;  3MQ9 A;  1IMA A;  3VXC A;  1LFH A;  1AWB A;  1SQY A;  2O69 A;  4N6K A;  5ET5 A;  1VR5 A;  1LBY A;  1II5 A;  2ZZX A;  3SEU A;  1LEV A;  4MX6 A;  4OFJ A;  2A5S A;  2QS1 A;  3IOT A;  3C34 A;  2Q88 A;  4M1V A;  1LBV A;  2HXW A;  2X7P A;  1B5J A;  3U92 A;  5H8F B;  2AL5 A;  2Q89 A;  3H6T A;  3OSQ A;  2P3N A;  4GWS A;  1Y9U A;  4PFI A;  1RDY A;  5TU0 A;  3MP8 A;  4LVQ A;  3MBP A;  1POT A;  1A54 A;  3K2D A;  3ODB A;  4ZEC A;  3TZA A;  2XWI A;  3VXB A;  1QW0 A;  1NKX A;  4EF1 A;  3OO9 A;  5H8Q B;  4MMP A;  3S9N C;  4RNS A;  4EUO A;  4Q0C A;  3W9V A;  4QFP A;  4R74 A;  3IFC A;  4GWX A;  3VFJ A;  3O6H A;  3OSR A;  4PFY A;  3TEP A;  1SVX B;  5IM2 A;  5DYH A;  4XKR A;  2M8C A;  3USD A;  2WYK A;  1AOV A;  1EYI A;  4ZDM A;  4NTL A;  2DXY A;  3HCQ A;  4YKP A;  2P2A A;  3SEV A;  5I56 A;  2DP8 A;  2O1M A;  5CRY A;  1UIU A;  4U23 A;  1LBZ A;  4JVI A;  5IZZ A;  1KA1 A;  3ONM A;  4N6P A;  2QSX A;  2OJT A;  3TTR A;  2DVZ A;  5EQ7 A;  3HFU A;  2CZI A;  2Y7I A;  1M5E A;  1QVS A;  2HCA A;  3GZG A;  1AL3 A;  4IY5 A;  3I3V A;  1FPB A;  1Y1M A;  3IR1 A;  4EXL A;  2QS2 A;  2H9B A;  4H45 A;  4OFL A;  1D9V A;  5DEX A;  4ZEI A;  1OMP A;  4F3G A;  1B32 A;  2V25 A;  3HPI A;  1P1N A;  4MJO A;  3KEI A;  4F18 A;  5TPA B;  3KOT A;  3CSB A;  2HFB A;  2BJJ X;  1LAG E;  1LBW A;  4LZ5 A;  4O3A A;  1MM7 A;  1NI9 A;  4GFR A;  1OLC A;  1XVX A;  1OQH A;  5HPQ A;  4GRK A;  2HXR A;  5KCJ B;  1AH5 A;  2NOO A;  2WYP A;  2R6G E;  4HCW A;  1OQG A;  3IOV A;  3IK6 B;  1JW1 A;  2DXR A;  1SYH A;  3VV5 A;  1B9J A;  5CMK A;  2PFZ A;  2X26 A;  4P47 A;  2VD2 A;  1FQD A;  4JDF A;  4G4P A;  2ONS A;  2DVC A;  1MPB A;  2XX7 A;  4R72 A;  1B40 A;  4XFE A;  3CRB A;  1I69 A;  2O6A A;  1A55 A;  1P1Q A;  1DK4 A;  2FYI A;  3FXQ A;  3FBP A;  4G68 A;  1UQW A;  1MXV A;  1FPL A;  1DPE A;  3K6V A;  4H5F A;  1NV4 A;  1R1N A;  3JZJ A;  4NF0 A;  1P1U A;  1FBC A;  5DW8 A;  4ZEF A;  4AS5 A;  2VGQ A;  4JWO A;  3PU5 A;  4PAI A;  1MH4 A;  2A5T B;  2R9J A;  1H3D A;  4QXD A;  3QSL A;  1LBB A;  1A99 A;  2XXV A;  1LBC A;  3IOW A;  3N6T A;  2GQ1 A;  3TMG A;  1NFT A;  2WEF A;  2E1S A;  5IAI A;  3QXM A;  4KD5 A;  3LSW A;  3UGW A;  1B1H A;  4HXV A;  4RY1 A;  5IZ3 B;  4F1Y A;  3GYY A;  4EXK A;  4JBZ A;  1HSJ A;  3EHS A;  3I6V A;  1B1X A;  4WED A;  1P99 A;  2NWJ A;  5ET8 A;  4GWW A;  3TKD A;  3PUZ E;  5M2V A;  3KJT A;  1D9Q A;  2O7I A;  4PP0 A;  1GTK A;  4N17 A;  4QSD A;  4NX1 A;  2DDK A;  2Z22 A;  2O51 A;  4HW8 A;  3M3L A;  4PDH A;  4ONY A;  1A8E A;  4R9F A;  4G2Z A;  5ICQ A;  1ZBM A;  3IJX B;  1N3X A;  2D5W A;  2F36 A;  1XS5 A;  4G77 A;  2LAO A;  1MXX A;  2XXI A;  4F3S A;  1EZO A;  1FPD A;  4MIJ A;  1XC1 A;  2NUV A;  2Q9T A;  3RPL B;  1NH8 A;  3W9W A;  1D4N A;  2ALU A;  1OVT A;  3S4U A;  1LAF E;  2F6G A;  1H44 A;  2I3V A;  2DWH A;  3QUJ A;  2UXA A;  5AA2 A;  3G3G A;  3KBZ A;  3O97 A;  3KZG A;  4I3Y A;  3SES A;  3OD7 A;  4KI0 E;  2YLN A;  1XHY A;  2I48 A;  2XX9 A;  5K2Y A;  4NMY A;  4F31 B;  2I3W A;  3LUY A;  5I58 B;  1FJ9 A;  1JEV A;  2P1S A;  1B7H A;  4JXI A;  1P1O A;  4AS4 A;  2FIX A;  5CBS A;  2OBG A;  5L9O A;  1M5B A;  4MH5 A;  2Y7P A;  1Q9D A;  2H5Y A;  4IY6 A;  1YYZ A;  2YJP A;  2XWV A;  1FPI A;  1UTH A;  4IO2 A;  2VD3 A;  4JSD A;  3BKI B;  4MBP A;  4BDL A;  4O94 A;  1GVC A;  3DEL B;  2DOJ A;  4QRZ A;  3EQ1 A;  3ZS6 A;  2F34 A;  2V93 A;  2QVV A;  1RDX A;  2H98 A;  1YAE A;  1WDN A;  4QFK A;  1NV3 A;  1J1N A;  4NN3 A;  1LST A;  4P11 A;  3GBB A;  4WKM A;  3R6U A;  3KN8 A;  4F3P A;  1D3K A;  1KWH A;  1IXI A;  3RYD A;  4GWU A;  2Y7W A;  1JW4 A;  4OVJ A;  4DCX A;  2QL3 A;  3MW0 A;  1DTG A;  5TP9 A;  1SW1 A;  1VE4 A;  2G93 A;  3VVD A;  4YAH X;  1BP5 A;  4H0W A;  1TXF A;  4RK2 A;  3SKP A;  3U93 A;  5J16 A;  1T0K A;  3K02 A;  4H67 A;  4BLA A;  1QUJ A;  4ND9 A;  3ZSF A;  1SPI A;  4NED A;  3WAF A;  4POW A;  1DSN A;  4X9T A;  2JJK A;  3CFL A;  2VOZ A;  1UTB B;  1QKA A;  1MY2 A;  1QKB A;  4NE4 A;  1BLF A;  4PE5 B;  3RNN A;  1FQF A;  2V3U A;  5BWJ A;  1SBP A;  4DIG A;  3KFM A;  1SI0 A;  4L17 A;  2XXK A;  3C4M A;  1MXZ A;  1IUD A;  5H8H A;  1US4 A;  3E78 A;  2HZL A;  4PC9 A;  2PBW A;  3G3K A;  3MST A;  4G8H A;  2DS9 A;  1MY0 A;  4MEV A;  3LV0 A;  4Q8R A;  2F78 A;  4JWY A;  4GOT A;  4YU0 A;  1B2H A;  3UP9 A;  4MAG A;  1RYO A;  1NUW A;  4PBH A;  4X04 A;  3PUY E;  4XXU A;  1US5 A;  1CNQ A;  1ZIU A;  4FED A;  3MZ1 A;  4HE1 A;  1DOT A;  2HZK A;  3O6G A;  5EQA A;  2X7Q A;  3IO4 A;  1LCF A;  3CHG A;  5CMC A;  4GXS B;  4GL0 A;  1AIV A;  4K3F A;  5I56 B;  3LSL A;  4YB6 A;  3FXU A;  3KSJ A;  1QGX A;  4P8B A;  3MVX A;  4NF4 A;  1D9Y A;  3OEL A;  5EHS A;  3G7W A;  3RQT A;  1DMB A;  3LSF B;  3UOR A;  1IMC A;  3O28 A;  4LA9 A;  3TTM A;  1IMF A;  4N91 A;  1ANF A;  2RF1 A;  1OLA A;  1FW0 A;  5FHN A;  3N94 A;  3Q28 A;  3QYT A;  3CFX A;  3VVF A;  1NUX A;  3SZP A;  3T93 B;  2Z8D A;  3TPA A;  4JWX A;  2UYE A;  4GWO A;  4N8Y A;  4N8G A;  1AMF A;  5DEX B;  4R9G A;  2QFL A;  4P9K A;  1INP A;  2REG A;  1RKM A;  4IO5 A;  4DE8 A;  2Z23 A;  4PF8 A;  3FJ7 A;  3KG2 A;  4IB2 A;  1PBP A;  2E0S A;  1M5C A;  4THI A;  1ZU0 A;  5F7V A;  3KC1 A;  3E3K A;  3CG1 A;  1Y3P A;  2WX9 A;  5I5P A;  5ET7 A;  4FBP A;  2DWI A;  5I84 A;  4PFU A;  2PT2 A;  5I59 A;  4Q5T A;  3K6W A;  4XKN A;  3FZV A;  3PTY A;  3K0V A;  3KC0 A;  1MG1 A;  4POX A;  3PV0 E;  5A5X B;  2O68 A;  3OO8 A;  1Z7M E;  1NV0 A;  2DE4 A;  1FTM A;  1ZKB A;  2QJE A;  4DZ1 A;  1MDQ A;  3TUS A;  3C35 A;  2F3D A;  4R6K A;  4PE3 A;  1P1W A;  4F1V A;  1Q35 A;  3EHT A;  1ZMG A;  2VPN A;  4C1U A;  3K01 A;  2ZZW A;  2ONK E;  2R8T A;  3PUV E;  2G29 A;  1GGG A;  2PT1 A;  4U1O A;  4FE8 A;  4G68 B;  4O7M A;  5I2K A;  1YCJ A;  1NV5 A;  2PYY A;  3HHG A;  5HM4 B;  1B3H A;  1BK4 A;  4KYE A;  4XEQ A;  1S7Y A;  1PEB A;  2RCA A;  4ZED A;  3QUF A;  3VVE A;  3FVK A;  5JTY B;  4LZ7 A;  2ZMB A;  1K9Z A;  2Y7R A;  4QFO A;  5DVJ A;  2DE2 A;  3Q26 A;  3K00 A;  3FAS A;  2Y7K A;  4OYV A;  3T1B A;  2FNC A;  2I49 A;  3RT8 A;  2AYS A;  1JQF A;  2UYF A;  4P3L A;  3B6T A;  2NVU B;  4F2O A;  4I8C A;  3PPP A;  1WVJ A;  4OET A;  2Y84 A;  1SD3 A;  4LZ8 A;  1USY E;  1LFI A;  4PFT A;  4OHN A;  1HSL A;  4GL8 A;  2H25 A;  4XKQ A;  1KA0 A;  1YPN A;  3M3K A;  1I6B A;  1LGB C;  1MQD A;  3EPE A;  4YKK A;  5CM6 A;  1N7X A;  2FHY A;  3A3C A;  5B7D A;  1LBX A;  4DI3 D;  1NNP A;  4ZE9 A;  4PBQ A;  2F7B A;  5EYF A;  2HQ0 A;  3SEW A;  3RGY A;  2OWT A;  2CZH A;  3EHU A;  3PPQ A;  4P1E A;  2OWS A;  4DLD A;  3H3G A;  4QBA A;  2ZYM A;  1KZ8 A;  5K2X A;  4F22 A;  1B52 A;  4O7I A;  1B0L A;  2RC8 A;  3D4G A;  1IEJ A;  2CZL A;  3U72 A;  3CR9 A;  2VP1 A;  3RY3 A;  2Q74 A;  1CE2 A;  1URD A;  4E0X A;  3FV2 A;  4YMB A;  5B70 A;  3N6U A;  3KJ7 A;  4KCD A;  2F7C A;  3H7M A;  1N3W A;  1SW2 A;  1IME A;  2XXQ A;  4NAP A;  2V3T A;  1TFD A;  4FJP A;  3TQL A;  1FPJ A;  1BIY A;  1VFE A;  1ZTY A;  3C31 A;  5DVF A;  2I6E A;  2XXX A;  4KFQ A;  1QJM A;  3ZKK A;  1B5I A;  1K9Y A;  2HAV A;  2O84 X;  3FVN A;  3MVW A;  3TFL A;  2F97 A;  2XD2 A;  3A09 A;  1DBZ A;  1O7T A;  3PMW A;  4GD5 A;  4F39 A;  3BFT A;  1FPF A;  2PX1 A;  3FV1 A;  4U2R A;  3U94 A;  4N4U A;  1VSO A;  2KR0 A;  4E0W A;  3JYR A;  2F7A A;  1TT1 A;  2QMW A;  1NV7 A;  4F29 A;  4ZEB A;  3ROJ A;  2B4M A;  1UTH B;  2HAU A;  5DVI A;  4JVC A;  4P0I A;  5JK4 A;  3TTN A;  4KCC A;  4NF8 A;  4NF6 B;  4FAT A;  5KZT A;  1Y3N A;  4N81 A;  3ILT B;  3K6U A;  4GWY A;  5A5L A;  3IOU A;  3LUZ A;  4TOZ A;  4WXJ A;  3MJN A;  4NWC A;  4EQ9 A;  3QMF A;  3TTK A;  3QIM A;  1IQ7 A;  5ISU A;  1USY H;  1SDX A;  3KGC A;  1FBH A;  4YB5 A;  4X8R A;  1B58 A;  3K1P A;  4GIZ A;  1Y4T A;  2L5V A;  5EYH A;  5AA1 A;  3TCF A;  5EYG A;  1NMU A;  4LON B;  2VPO A;  4G8M A;  4H6D A;  2P3V A;  5LOM A;  1SYI A;  1NL5 A;  3MWB A;  3KOS A;  5TP9 B;  4ESX A;  2RC7 A;  3V8X B;  1B51 A;  1WOD A;  2QPQ A;  2B4L A;  2HPG A;  2WKY A;  2Q8J A;  3FGS A;  1JVX A;  5ET6 A;  1MXU A;  3QK6 A;  4IO4 A;  2F6P A;  4P0G A;  3TEL A;  1DPP A;  3THI A;  1MPD A;  1FRP A;  1B46 A;  2H4I A;  2OCU A;  4IO7 A;  1FQA A;  3ECR A;  1JP4 A;  2GFE A;  1FTJ A;  2QS3 A;  3B6Q A;  5H8H B;  3OO7 A;  3Q25 A;  4GWZ A;  4FIM A;  3V83 A;  2CEY A;  3V5A A;  5FHM A;  1MS7 A;  2KLF A;  3T22 A;  5I57 A;  5KDT B;  3B8B A;  4BDO A;  5H8S A;  5I7I A;  2Y5K A;  1YZ0 A;  3IO6 A;  5IZ3 A;  3G3I A;  2ZNT A;  4OXV A;  5FHO A;  2DSF A;  3PPN A;  3FXB A;  3AXF A;  3TTL A;  3CFZ A;  3PPR A;  4H8I A;  3RTW B;  3HST A;  4N6D A;  1XI6 A;  4X48 A;  2XXW A;  3WAE A;  3K4U A;  3FJG A;  2OLB A;  4H46 A;  3DP6 A;  1B3G A;  1Y20 A;  1FBD A;  1FPE A;  5FBP A;  3MVY A;  1NNK A;  1L5T A;  4NF4 B;  4QHQ A;  3H6W A;  4I3E A;  3N26 A;  4RPN A;  3IX1 A;  1FQB A;  3C9H A;  4C0R A;  4OMB A;  4GVO A;  1JEU A;  3QAX A;  4PAF A;  3A29 A;  2XWK A;  1FBE A;  3C32 A;  3C33 A;  4DXB A;  3MZ9 A;  1MDP 1;  2AIX A;  2ZZV A;  4GX4 A;  4PCD A;  5L8D A;  4HE0 A;  3MYU A;  4OER A;  1LB9 A;  2PMS A;  4GX6 A;  1R6Z A;  3Q29 A;  2WBD A;  4JSO A;  4NG7 A;  1FCK A;  2REJ A;  4FOR A;  2D3I A;  2CMO A;  1A7L A;  2OWZ A;  3ISP A;  4TLL B;  3SET A;  3MP1 A;  3IJO B;  3T96 B;  3MUQ A;  1FPG A;  2PVU A;  4NHB A;  3T66 A;  5FTH A;  5I59 B;  1N04 A;  2KQZ A;  4GX3 A;  2XXH A;  4OVQ A;  1H76 A;  1LB8 A;  3C36 A;  1EYJ A;  1Z7N E;  5IGA A;  4XKP A;  4DI4 B;  1N84 A;  4U4X A;  1HSE A;  4HTG A;  2Q8M A;  4OTE A;  5EQ9 A;  4WEP A;  2ZNU A;  2Z8E A;  4OWD A;  1N76 A;  3PPO A;  3LC8 A;  4I40 A;  4I1D A;  1MH3 A;  3UN6 A;  3H03 A;  1A8F A;  1NV1 A;  1EYK A;  5I2K B;  2XD3 A;  5ITO A;  3TYH A;  3S2V A;  4R2F A;  1DTZ A;  4YZZ A;  1B5H A;  5ICT A;  3H06 B;  1NV6 A;  4U22 A;  3GBA A;  3FIR A;  3S9E A;  1MY3 A;  3BBR A;  4GBV A;  4NF5 A;  1IIT A;  3RT6 B;  5T3J A;  4O3B A;  2UVI A;  2IA4 A;  3CG3 A;  4OFO A;  4Z7E A;  4YB7 A;  2FIE A;  3KBR A;  3T9H B;  4HCY A;  5H8N A;  3RPW A;  3E9X A;  1N7W A;  4NQ8 A;  2B65 A;  4O8M A;  1ZJL A;  3TOD A;  2QS4 A;  3E79 A;  1XOC A;  4ELP A;  1RYX A;  2O7U A;  2GHB A;  3EF7 A;  4FEC A;  4ZS9 A;  4QF9 A;  5JEI A;  2ZYK A;  4R6H A;  1EH3 A;  2YPN A;  3K1N A;  3GLB A;  1UTB A;  4MHF A;  3IFA A;  5I2N A;  3CI8 A;  1XT8 A;  3R7X A;  4H5G A;  3HV1 A;  4X1D A;  5DT6 A;  3S9L C;  3FJM A;  2QVU A;  1PB9 A;  5EHM A;  2XXU A;  1MQH A;  1B3F A;  4R6Y A;  4PQJ A;  1OIB A;  1IMD A;  3O6I A;  1NUZ A;  2F8D A;  1B4Z A;  4F3B A;  2P0S A;  1MQG A;  1IXG A;  4MNP A;  2OK2 A;  1PB8 A;  2XWO A;  4DXC A;  4IGT A;  3T9X B;  4N07 A;  1B7U A;  3LBS A;  4F1U A;  1MPC A;  2B3F A;  2W7Y A;  1MQJ A;  4H1X A;  5CBR A;  4KYD A;  3MC2 A;  1FJ6 A;  4PET A;  3VLW A;  2QMX A;  5AA4 A;  1TFA A;  1URS A;  3I5O A;  1MM6 A;  1TWY A;  2I0B A;  3LR1 A;  5LTC A;  2V4C A;  2DYX A;  1H45 A;  3FUZ A;  2B3B A;  1QUK A;  3H4Z A;  4H8J A;  3O29 A;  3FVG A;  1B05 A;  4YMA A;  3P7I A;  4Z0I A;  3BFU A;  4I9D A;  3MP6 A;  3VLU A;  3O66 A;  3G3H A;  3TDJ A;  1S9T A;  1ATG A;  3KN7 A;  1ZLQ A;  4H65 A;  1I6Q A;  3MAM A;  4YKI A;  4IO3 A;  2MKZ A;  4PFR A;  5H8F A;  3D4C A;  3DP8 A;  1G0I A;  4QSC A;  3HN0 A;  3RTF B;  2DWA A;  1LAX A;  5L9M A;  1MXW A;  2UVJ A;  2RKM A;  4NF8 B;  4ZZA A;  2Q2C A;  2F35 A;  3G3J A;  4ZE8 A;  4LP2 B;  3VDF A;  3L6H A;  4KYS A;  4GXA A;  1NV2 A;  3A3U A;  3TCG A;  3SEY A;  3UIF A;  2ZXT A;  3TAJ A;  5BUU A;  2WBB A;  3IAZ A;  1MQI A;  2FVZ A;  5H8Q A;  3W15 C;  2ABH A;  1B0H A;  1R9L A;  1JET A;  4OZ9 A;  3U65 A;  1Q1K A;  5A5X A;  3OEM A;  1SW5 A;  2AL4 A;  4OES A;  4PFW A;  4XIG Q;  4RK9 A;  2XX8 A;  4GQO A;  3SEX A;  4DCY A;  1LFG A;  3NOH A;  2ONR A;  4TQU Q;  4OVP A;  1Y4C A;  5ESY A;  2F5X A;  3OEN A;  3PMX A;  2CZK A;  2I0C A;  1VDW A;  5AA2 B;  2GRV A;  3M8U A;  3T0J A;  2VHA A;  2DE3 A;  4LQ5 A;  1O64 A;  5LDZ A;  1FTA A;  2I58 A;  2FA7 A;  3K1M A;  1PC3 A;  4UAB A;  5JTY A;  1S50 A;  4MLV A;  3BIG A;  2QVR A;  4UA8 A;  1A40 A;  3VE1 B;  3LSX A;  1SI1 A;  5DTB A;  2ZYN A;  3EN3 A;  4PDD A;  4PF6 A;  4IR8 A;  4LQ2 A;  4YIC A;  4KR5 A;  4PAK A;  4U1Z A;  2RCB A;  5I57 B;  2I4B A;  4YKJ A;  1B3E A;  4ELR A;  2V3Q A;  1MRP A;  2FBP A;  4RA1 A;  4F2Q A;  1EZ9 A;  3FD3 A;  1YXI A;  4Q30 B;  3IB0 A;  5TPA A;  3PUX E;  2VT5 A;  2HEU A;  3BIH A;  1IZ1 A;  3O9P A;  1PB7 A;  3HO7 A;  1H43 A;  3U8Q A;  4OQO A;  2GHA A;  1QUL A;  2UVH A;  5F24 A;  1FQE A;  5KCJ A;  1G0H A;  3IB2 A;  1EU8 A;  3DM0 A;  3G3F A;  3OEK A;  3GXA A;  1LAH E;  4AB5 A;  3FAT A;  3KSX A;  4TLM B;  4OA4 A;  1PDA A;  4ELO A;  4DXU A;  4R73 A;  1NH7 A;  3K6X A;  3RLF E;  2Z8F A;  4BDQ A;  3D1R A;  1B6H A;  3T9U A;  3CSG A;  1B7Z A;  2PFY A;  5EQ8 A;  4I62 A;  2QRY A;  4OVT A;  4PFB A;  4ZZE A;  4MF3 A;  4P1L A;  1IIW A;  2ZNS A;  4NWD A;  3MPK A;  5I3S A;  4LN5 A;  3PUW E;  4BDN A;  4X1B A;  1PBQ A;  3FXR A;  1FTK A;  1OVB A;  2A5T A;  1M5F A;  4KHZ E;  4OEV A;  5J1D A;  2XXT A;  1FQC A;  4ZEK A;  4EQB A;  4PGP A;  5F1Q A;  4KQP A;  4OEN A;  1SW4 A;  4NGU A;  2BJI A;  1FBF A;  1MY1 A;  1JVY A;  3V89 B;  1R9Q A;  3E13 X;  3H6U A;  2ESN A;  5AE4 A;  4EDP A;  3MZB A;  2NXO A;  4OVR A;  5FTI A;  1FTO A;  1XVY A;  2UVG A;  5AA3 A;  4O3C A;  4FAJ A;  2XA5 A;  4N13 A;  4AQ4 A;  3OOA A;  2O1L A;  4IGR A;  5CI5 A;  3S9M C;  4XF5 A;  3MPL A;  3OMB A;  1URG A;  4M4G A;  4XTC Q;  3PD8 A;  1YTV A;  4MFI A;  4NF6 A;  4OEU A;  4MNI A;  4RYA A;  1Y3Q A;  2I4C A;  3B50 A;  3O2A A;  4GF8 A;  1CB6 A;  3OO6 A;  3CIJ A;  4ISU A;  1BKA A;  3DP4 A;  4C1T A;  4JVD A;  1O63 A;  1Y1Z A;  4MCO A;  2PCR A;  1NNT A;  3E4R A;  1EZP A;  4PTK A;  3EKI A;  4U21 A;  3SDF A;  4FEB A;  4GBW A;  3B6W A;  4KXP A;  3RPL A;  4NF5 B;  2Q2A A;  2DWJ A;  4G8N A;  3N5L A;  5IZ1 A;  3MVZ A;  4IO6 A;  4R2B A;  1LLS A;  2R71 A;  5AA2 D;  1IXC A;  1POY 1;  3RN8 A;  3PGF A;  4G61 A;  4U4S A;  4ELQ A;  2HHM A;  5H8N B;  3ILU B;  4QFL A;  3ZKL A;  3IB1 A;  3M3F A;  1ELJ A;  4BDM A;  1B4H A;  4BDR A;  4EF2 A;  3IL1 B;  4QSE A;  4RPO A;  3IOR A;  2CEX A;  1VFD A;  1LCT A;  3UA8 A;  1QUI A;  2XHD A;  3H6V A;  2OZZ A;  1GR2 A;  1IMB A;  2ANJ A;  5I58 A;  2OX3 A;  1NNF A;  4RXL A;  5I2N B;  4AB6 A;  1M5D A;  4RJZ A;  3F11 A;  4F19 A;  1MY4 A;  3PMV A;  3B7D A;  2XXY A;  4OAN A;  3PD9 A;  4P56 A; 
#chains in the Genus database with same CATH homology
 5CMB A;  3UK4 A;  4LUB A;  4QFN A;  5KDT A;  1GV8 A;  3FVO A;  3HHF A;  5HBC A;  3L6G A;  3T9V A;  2RIN A;  2IEE A;  3DLN A;  4EQ7 A;  5IKB A;  4JB7 A;  3VLV A;  2ZYO A;  1UIV A;  3RUM A;  2THI A;  4ECF A;  1I6A A;  5L9S A;  1FTL A;  4R75 A;  2XXP A;  1IXH A;  1MXY A;  3JV9 A;  4G68 C;  2V84 A;  4KPT A;  1JNF A;  4UAC A;  3KN3 A;  3TCH A;  4HS7 A;  5ITP A;  1N0T A;  4LAT A;  2D21 A;  1B3L A;  4DDD A;  3SER A;  2RC9 A;  4GLI A;  5AA4 B;  1BTJ A;  2XXR A;  3Q27 A;  5ELV A;  3OXN A;  3TQW A;  3R26 A;  4MLQ A;  5CC2 A;  4ESW A;  3CVG A;  2DQV A;  1JW5 A;  2H99 A;  2GH9 A;  1F9B A;  3U1O A;  5CMM A;  3MQ9 A;  3VXC A;  1LFH A;  1SQY A;  2O69 A;  1VR5 A;  1II5 A;  3SEU A;  4OFJ A;  2A5S A;  2QS1 A;  3IOT A;  3C34 A;  2Q88 A;  4M1V A;  2HXW A;  2X7P A;  1B5J A;  3U92 A;  5H8F B;  2AL5 A;  2Q89 A;  3H6T A;  3OSQ A;  1Y9U A;  5TU0 A;  3MP8 A;  4LVQ A;  3MBP A;  1POT A;  1A54 A;  3K2D A;  3ODB A;  4ZEC A;  3TZA A;  3VXB A;  1QW0 A;  1NKX A;  4EF1 A;  3OO9 A;  5H8Q B;  3S9N C;  4RNS A;  4EUO A;  4Q0C A;  3W9V A;  4QFP A;  4R74 A;  3VFJ A;  3O6H A;  3OSR A;  4PFY A;  3TEP A;  1SVX B;  5DYH A;  4XKR A;  2M8C A;  3USD A;  1AOV A;  4ZDM A;  4NTL A;  3SEV A;  2DXY A;  3HCQ A;  2P2A A;  4YKP A;  5I56 A;  2DP8 A;  2O1M A;  5CRY A;  1UIU A;  4U23 A;  3ONM A;  4N6P A;  2QSX A;  2OJT A;  3TTR A;  2DVZ A;  2Y7I A;  1M5E A;  1QVS A;  2HCA A;  3GZG A;  1AL3 A;  4IY5 A;  3I3V A;  1Y1M A;  3IR1 A;  4EXL A;  2QS2 A;  2H9B A;  4OFL A;  1D9V A;  5DEX A;  4ZEI A;  1OMP A;  4F3G A;  1B32 A;  2V25 A;  3HPI A;  1P1N A;  3KEI A;  4F18 A;  5TPA B;  3KOT A;  3CSB A;  2HFB A;  2BJJ X;  1LAG E;  4LZ5 A;  4O3A A;  1MM7 A;  4GFR A;  1OLC A;  1XVX A;  1OQH A;  5HPQ A;  4GRK A;  5KCJ B;  1AH5 A;  2NOO A;  2R6G E;  4HCW A;  1OQG A;  3IOV A;  3IK6 B;  1JW1 A;  2DXR A;  1SYH A;  3VV5 A;  1B9J A;  5CMK A;  2X26 A;  2VD2 A;  1FQD A;  4JDF A;  4G4P A;  2ONS A;  2DVC A;  1MPB A;  2XX7 A;  4R72 A;  1B40 A;  3CRB A;  1I69 A;  2O6A A;  1A55 A;  1P1Q A;  2FYI A;  3FXQ A;  4G68 A;  1UQW A;  1MXV A;  1DPE A;  3K6V A;  4H5F A;  1R1N A;  3JZJ A;  1P1U A;  4ZEF A;  2VGQ A;  4JWO A;  3PU5 A;  1MH4 A;  2A5T B;  2R9J A;  1H3D A;  3QSL A;  1LBB A;  1A99 A;  2XXV A;  1LBC A;  3IOW A;  3N6T A;  3TMG A;  1NFT A;  2E1S A;  5IAI A;  3QXM A;  4KD5 A;  3LSW A;  3UGW A;  1B1H A;  4RY1 A;  4F1Y A;  4EXK A;  4JBZ A;  1HSJ A;  3EHS A;  3I6V A;  1B1X A;  4WED A;  1P99 A;  2NWJ A;  3TKD A;  3PUZ E;  5M2V A;  3KJT A;  2O7I A;  4PP0 A;  1GTK A;  4QSD A;  2Z22 A;  2O51 A;  4HW8 A;  3M3L A;  4ONY A;  1A8E A;  4R9F A;  4G2Z A;  5ICQ A;  1ZBM A;  3IJX B;  1N3X A;  2D5W A;  2F36 A;  1XS5 A;  4G77 A;  2LAO A;  1MXX A;  2XXI A;  4F3S A;  1EZO A;  1XC1 A;  2NUV A;  2Q9T A;  1NH8 A;  3W9W A;  1D4N A;  2ALU A;  1OVT A;  3S4U A;  1LAF E;  2F6G A;  1H44 A;  2I3V A;  2DWH A;  3QUJ A;  2UXA A;  5AA2 A;  3G3G A;  3O97 A;  3KZG A;  3SES A;  3OD7 A;  4KI0 E;  2YLN A;  1XHY A;  2I48 A;  2XX9 A;  5K2Y A;  4NMY A;  4F31 B;  2I3W A;  3LUY A;  5I58 B;  1JEV A;  2P1S A;  1B7H A;  4JXI A;  1P1O A;  5CBS A;  2OBG A;  5L9O A;  1M5B A;  4MH5 A;  2Y7P A;  2H5Y A;  4IY6 A;  2YJP A;  1UTH A;  4IO2 A;  2VD3 A;  4JSD A;  3BKI B;  4MBP A;  4BDL A;  1GVC A;  3DEL B;  2DOJ A;  4QRZ A;  3EQ1 A;  3ZS6 A;  2F34 A;  2V93 A;  2H98 A;  1YAE A;  1WDN A;  4QFK A;  1J1N A;  1LST A;  4P11 A;  3GBB A;  4WKM A;  3R6U A;  3KN8 A;  4F3P A;  1D3K A;  1KWH A;  1IXI A;  2Y7W A;  1JW4 A;  4OVJ A;  4DCX A;  2QL3 A;  3MW0 A;  1DTG A;  5TP9 A;  1SW1 A;  1VE4 A;  2G93 A;  3VVD A;  4YAH X;  1BP5 A;  4H0W A;  1TXF A;  4RK2 A;  3SKP A;  3U93 A;  1T0K A;  3K02 A;  4H67 A;  4BLA A;  1QUJ A;  4ND9 A;  3ZSF A;  4NED A;  3WAF A;  4POW A;  1DSN A;  4X9T A;  3CFL A;  2VOZ A;  1UTB B;  1QKA A;  1MY2 A;  1QKB A;  4NE4 A;  1BLF A;  4PE5 B;  3RNN A;  1FQF A;  2V3U A;  5BWJ A;  1SBP A;  4DIG A;  3KFM A;  1SI0 A;  4L17 A;  3C4M A;  1MXZ A;  1IUD A;  5H8H A;  1US4 A;  2HZL A;  2PBW A;  3G3K A;  4G8H A;  2DS9 A;  1MY0 A;  4Q8R A;  2F78 A;  4JWY A;  4GOT A;  4YU0 A;  1B2H A;  3UP9 A;  1RYO A;  3PUY E;  4XXU A;  1US5 A;  4FED A;  1ZIU A;  3MZ1 A;  1DOT A;  2HZK A;  3O6G A;  2X7Q A;  3IO4 A;  1LCF A;  5CMC A;  4GXS B;  4GL0 A;  1AIV A;  4K3F A;  5I56 B;  3LSL A;  4YB6 A;  3FXU A;  3KSJ A;  3MVX A;  4NF4 A;  1D9Y A;  3OEL A;  5EHS A;  3G7W A;  3RQT A;  1DMB A;  3LSF B;  3UOR A;  3O28 A;  4LA9 A;  3TTM A;  1ANF A;  2RF1 A;  1OLA A;  1FW0 A;  5FHN A;  3N94 A;  3Q28 A;  3QYT A;  3CFX A;  3VVF A;  3T93 B;  2Z8D A;  3TPA A;  4JWX A;  2UYE A;  4GWO A;  1AMF A;  5DEX B;  4R9G A;  2REG A;  1RKM A;  4IO5 A;  4DE8 A;  2Z23 A;  3FJ7 A;  3KG2 A;  4IB2 A;  1PBP A;  2E0S A;  1M5C A;  4THI A;  1ZU0 A;  5F7V A;  3E3K A;  3CG1 A;  1Y3P A;  2DWI A;  5I84 A;  4PFU A;  2PT2 A;  5I59 A;  4Q5T A;  3K6W A;  4XKN A;  3FZV A;  3K0V A;  1MG1 A;  4POX A;  3PV0 E;  5A5X B;  2O68 A;  3OO8 A;  1Z7M E;  2DE4 A;  1FTM A;  1ZKB A;  4DZ1 A;  2QJE A;  1MDQ A;  3TUS A;  3C35 A;  4R6K A;  1P1W A;  4F1V A;  1Q35 A;  3EHT A;  1ZMG A;  4C1U A;  3K01 A;  2ONK E;  3PUV E;  2G29 A;  1GGG A;  2PT1 A;  4U1O A;  4FE8 A;  4G68 B;  5I2K A;  1YCJ A;  2PYY A;  3HHG A;  5HM4 B;  1B3H A;  4KYE A;  1S7Y A;  1PEB A;  2RCA A;  4ZED A;  3QUF A;  3VVE A;  3FVK A;  5JTY B;  4LZ7 A;  2ZMB A;  2Y7R A;  4QFO A;  5DVJ A;  2DE2 A;  3Q26 A;  3K00 A;  3FAS A;  2Y7K A;  4OYV A;  2FNC A;  2I49 A;  3RT8 A;  2AYS A;  1JQF A;  2UYF A;  3B6T A;  2NVU B;  4F2O A;  4I8C A;  3PPP A;  1WVJ A;  4OET A;  2Y84 A;  1SD3 A;  4LZ8 A;  1USY E;  1LFI A;  4PFT A;  4OHN A;  1HSL A;  4GL8 A;  2H25 A;  4XKQ A;  1YPN A;  3M3K A;  1I6B A;  1LGB C;  1MQD A;  3EPE A;  4YKK A;  5CM6 A;  1N7X A;  3A3C A;  5B7D A;  1NNP A;  4ZE9 A;  2F7B A;  5EYF A;  2HQ0 A;  3SEW A;  3RGY A;  2OWT A;  3EHU A;  3PPQ A;  2OWS A;  4DLD A;  3H3G A;  2ZYM A;  5K2X A;  4F22 A;  1B52 A;  1B0L A;  2RC8 A;  3D4G A;  1IEJ A;  2CZL A;  3U72 A;  3CR9 A;  2VP1 A;  3RY3 A;  1CE2 A;  1URD A;  4E0X A;  3FV2 A;  4YMB A;  5B70 A;  3N6U A;  3KJ7 A;  4KCD A;  2F7C A;  3H7M A;  1N3W A;  1SW2 A;  2XXQ A;  2V3T A;  1TFD A;  4FJP A;  3TQL A;  1BIY A;  1VFE A;  1ZTY A;  3C31 A;  5DVF A;  2I6E A;  2XXX A;  4KFQ A;  1QJM A;  3ZKK A;  1B5I A;  2HAV A;  2O84 X;  3FVN A;  3MVW A;  3TFL A;  2F97 A;  2XD2 A;  3A09 A;  1O7T A;  3PMW A;  4GD5 A;  4F39 A;  3BFT A;  2PX1 A;  3FV1 A;  4U2R A;  3U94 A;  1VSO A;  4E0W A;  3JYR A;  2F7A A;  1TT1 A;  2QMW A;  4F29 A;  4ZEB A;  1UTH B;  2HAU A;  5DVI A;  4P0I A;  5JK4 A;  3TTN A;  4KCC A;  4NF8 A;  4NF6 B;  4FAT A;  5KZT A;  1Y3N A;  3ILT B;  3K6U A;  3IOU A;  4TOZ A;  4WXJ A;  3MJN A;  4NWC A;  4EQ9 A;  3TTK A;  3QIM A;  1IQ7 A;  5ISU A;  1USY H;  1SDX A;  3KGC A;  4YB5 A;  1B58 A;  3K1P A;  4GIZ A;  1Y4T A;  3TCF A;  5AA1 A;  1NMU A;  4LON B;  4G8M A;  4H6D A;  5LOM A;  1SYI A;  1NL5 A;  3MWB A;  3KOS A;  5TP9 B;  4ESX A;  2RC7 A;  3V8X B;  1B51 A;  1WOD A;  2QPQ A;  2WKY A;  2Q8J A;  3FGS A;  1JVX A;  1MXU A;  3QK6 A;  4IO4 A;  2F6P A;  4P0G A;  3TEL A;  1DPP A;  3THI A;  1MPD A;  1B46 A;  2H4I A;  2OCU A;  4IO7 A;  1FQA A;  3ECR A;  2GFE A;  1FTJ A;  2QS3 A;  3B6Q A;  5H8H B;  3OO7 A;  3Q25 A;  4FIM A;  3V83 A;  3V5A A;  5FHM A;  1MS7 A;  2KLF A;  3T22 A;  5I57 A;  5KDT B;  4BDO A;  5H8S A;  3IO6 A;  3G3I A;  2ZNT A;  4OXV A;  5FHO A;  2DSF A;  3PPN A;  3AXF A;  3TTL A;  3CFZ A;  3PPR A;  4H8I A;  3RTW B;  3HST A;  4X48 A;  2XXW A;  3WAE A;  3K4U A;  3FJG A;  2OLB A;  3DP6 A;  1B3G A;  1Y20 A;  3MVY A;  1NNK A;  1L5T A;  4NF4 B;  4QHQ A;  3H6W A;  4RPN A;  3N26 A;  3IX1 A;  1FQB A;  3C9H A;  4C0R A;  4OMB A;  4GVO A;  1JEU A;  3QAX A;  3C32 A;  3C33 A;  4DXB A;  3MZ9 A;  1MDP 1;  2AIX A;  5L8D A;  4OER A;  1LB9 A;  2PMS A;  1R6Z A;  3Q29 A;  4JSO A;  1FCK A;  2REJ A;  4FOR A;  2D3I A;  2CMO A;  1A7L A;  4TLL B;  3SET A;  3MP1 A;  3IJO B;  3T96 B;  3MUQ A;  2PVU A;  3T66 A;  5FTH A;  5I59 B;  1N04 A;  2XXH A;  1H76 A;  1LB8 A;  3C36 A;  1Z7N E;  4XKP A;  1N84 A;  4U4X A;  1HSE A;  4HTG A;  4OTE A;  4WEP A;  2ZNU A;  2Z8E A;  4OWD A;  1N76 A;  3PPO A;  3LC8 A;  4I1D A;  1MH3 A;  3UN6 A;  3H03 A;  1A8F A;  5I2K B;  2XD3 A;  5ITO A;  3TYH A;  3S2V A;  4R2F A;  1DTZ A;  4YZZ A;  1B5H A;  5ICT A;  3H06 B;  4U22 A;  3GBA A;  3FIR A;  3S9E A;  1MY3 A;  3BBR A;  4NF5 A;  1IIT A;  3RT6 B;  4O3B A;  2UVI A;  2IA4 A;  3CG3 A;  4OFO A;  4Z7E A;  4YB7 A;  3KBR A;  3T9H B;  4HCY A;  5H8N A;  3RPW A;  3E9X A;  1N7W A;  2B65 A;  1ZJL A;  3TOD A;  2QS4 A;  1XOC A;  4ELP A;  1RYX A;  2O7U A;  2GHB A;  3EF7 A;  4FEC A;  4ZS9 A;  4QF9 A;  5JEI A;  2ZYK A;  4R6H A;  1EH3 A;  2YPN A;  3K1N A;  3GLB A;  1UTB A;  5I2N A;  3CI8 A;  1XT8 A;  3R7X A;  4H5G A;  3HV1 A;  4X1D A;  5DT6 A;  3S9L C;  3FJM A;  1PB9 A;  5EHM A;  2XXU A;  1MQH A;  1B3F A;  4R6Y A;  4PQJ A;  1OIB A;  3O6I A;  2F8D A;  1B4Z A;  4F3B A;  2P0S A;  1MQG A;  1IXG A;  2OK2 A;  1PB8 A;  4DXC A;  4IGT A;  3T9X B;  4N07 A;  1B7U A;  3LBS A;  4F1U A;  1MPC A;  2B3F A;  2W7Y A;  1MQJ A;  4H1X A;  5CBR A;  4KYD A;  3MC2 A;  4PET A;  3VLW A;  2QMX A;  5AA4 A;  1TFA A;  1URS A;  3I5O A;  1MM6 A;  1TWY A;  2I0B A;  3LR1 A;  2DYX A;  1H45 A;  3FUZ A;  2B3B A;  1QUK A;  3H4Z A;  4H8J A;  3O29 A;  3FVG A;  1B05 A;  4YMA A;  3P7I A;  4Z0I A;  3BFU A;  4I9D A;  3MP6 A;  3VLU A;  3O66 A;  3G3H A;  3TDJ A;  1S9T A;  1ATG A;  3KN7 A;  1ZLQ A;  4H65 A;  1I6Q A;  3MAM A;  4YKI A;  4IO3 A;  5H8F A;  3D4C A;  3DP8 A;  4QSC A;  3HN0 A;  3RTF B;  2DWA A;  1LAX A;  5L9M A;  1MXW A;  2UVJ A;  2RKM A;  4NF8 B;  4ZZA A;  2Q2C A;  2F35 A;  3G3J A;  4ZE8 A;  4LP2 B;  3VDF A;  3L6H A;  4KYS A;  4GXA A;  3TCG A;  3A3U A;  3SEY A;  3UIF A;  2ZXT A;  3TAJ A;  5BUU A;  3IAZ A;  1MQI A;  5H8Q A;  3W15 C;  2ABH A;  1B0H A;  1R9L A;  1JET A;  4OZ9 A;  1Q1K A;  5A5X A;  3OEM A;  1SW5 A;  2AL4 A;  4OES A;  4PFW A;  4XIG Q;  4RK9 A;  2XX8 A;  4GQO A;  3SEX A;  4DCY A;  1LFG A;  2ONR A;  4TQU Q;  1Y4C A;  2F5X A;  3OEN A;  3PMX A;  2I0C A;  5AA2 B;  2GRV A;  3M8U A;  2VHA A;  2DE3 A;  4LQ5 A;  1O64 A;  2I58 A;  2FA7 A;  3K1M A;  1PC3 A;  5JTY A;  1S50 A;  4MLV A;  4UA8 A;  1A40 A;  3VE1 B;  3LSX A;  1SI1 A;  5DTB A;  2ZYN A;  3EN3 A;  4LQ2 A;  4YIC A;  4KR5 A;  4U1Z A;  2RCB A;  5I57 B;  2I4B A;  4YKJ A;  1B3E A;  4ELR A;  2V3Q A;  1MRP A;  4RA1 A;  4F2Q A;  1EZ9 A;  3FD3 A;  4Q30 B;  3IB0 A;  5TPA A;  3PUX E;  2HEU A;  1IZ1 A;  3O9P A;  1PB7 A;  3HO7 A;  1H43 A;  3U8Q A;  4OQO A;  2GHA A;  1QUL A;  2UVH A;  1FQE A;  5KCJ A;  3IB2 A;  1EU8 A;  3DM0 A;  3G3F A;  3OEK A;  3GXA A;  1LAH E;  4AB5 A;  3FAT A;  3KSX A;  4TLM B;  1PDA A;  4ELO A;  4DXU A;  4R73 A;  1NH7 A;  3K6X A;  3RLF E;  2Z8F A;  4BDQ A;  1B6H A;  3T9U A;  3CSG A;  1B7Z A;  4I62 A;  2QRY A;  4ZZE A;  4MF3 A;  1IIW A;  2ZNS A;  4NWD A;  3MPK A;  3PUW E;  4BDN A;  4X1B A;  1PBQ A;  3FXR A;  1FTK A;  1OVB A;  2A5T A;  1M5F A;  4KHZ E;  4OEV A;  5J1D A;  2XXT A;  1FQC A;  4ZEK A;  4EQB A;  5F1Q A;  4KQP A;  4OEN A;  1SW4 A;  1MY1 A;  3V89 B;  1JVY A;  1R9Q A;  3E13 X;  3H6U A;  2ESN A;  5AE4 A;  4EDP A;  3MZB A;  2NXO A;  5FTI A;  1FTO A;  1XVY A;  2UVG A;  5AA3 A;  4O3C A;  4FAJ A;  4N13 A;  4AQ4 A;  3OOA A;  2O1L A;  4IGR A;  5CI5 A;  3S9M C;  3MPL A;  3OMB A;  1URG A;  4M4G A;  4XTC Q;  3PD8 A;  1YTV A;  4MFI A;  4NF6 A;  4OEU A;  4RYA A;  1Y3Q A;  2I4C A;  3O2A A;  4GF8 A;  1CB6 A;  3OO6 A;  3CIJ A;  4ISU A;  1BKA A;  3DP4 A;  4C1T A;  1O63 A;  1Y1Z A;  1NNT A;  3E4R A;  1EZP A;  4U21 A;  3SDF A;  4FEB A;  3B6W A;  4NF5 B;  2Q2A A;  2DWJ A;  4G8N A;  3N5L A;  3MVZ A;  4IO6 A;  4R2B A;  1LLS A;  2R71 A;  5AA2 D;  1IXC A;  1POY 1;  3RN8 A;  3PGF A;  4U4S A;  4ELQ A;  5H8N B;  3ILU B;  4QFL A;  3ZKL A;  3IB1 A;  3M3F A;  1ELJ A;  4BDM A;  1B4H A;  4BDR A;  4EF2 A;  3IL1 B;  4QSE A;  4RPO A;  3IOR A;  1VFD A;  1LCT A;  3UA8 A;  1QUI A;  2XHD A;  3H6V A;  2OZZ A;  1GR2 A;  2ANJ A;  5I58 A;  1NNF A;  4RXL A;  5I2N B;  4AB6 A;  1M5D A;  4RJZ A;  3F11 A;  4F19 A;  1MY4 A;  3PMV A;  3B7D A;  2XXY A;  3PD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...