3KBRA

The crystal structure of cyclohexadienyl dehydratase precursor from pseudomonas aeruginosa pa01
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
231
Chain Sequence
ESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEARFQTLEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKADLMMTDAIEARLQSRLHPELCAVHPQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRMEHWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclohexadienyl dehydratase
publication title The crystal structure of cyclohexadienyl dehydratase precursor from Pseudomonas aeruginosa PA01
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 75
structure length 231
sequence length 232
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kbrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kbrA02
3EF7A 3LSWA 5H8HA 4YMBA 3HPIA 2UVGA 1IZ1A 4PQJA 4C0RA 4RJZA 3ODBA 2RC9A 2ZYKA 1FTJA 3IOVA 1DSNA 1P1QA 4GF8A 3Q26A 4G77A 4G68C 3K6VA 2ONRA 3TPAA 5DTBA 3PD9A 4NWDA 1B1XA 4DXCA 3UORA 4NE4A 2ZNTA 3O29A 3BFTA 3OO6A 3QYTA 3UA8A 1B40A 1A99A 2NVUB 3W9VA 1POY1 3MQ9A 3U93A 1JW1A 1M5EA 3C33A 4JSDA 3IAZA 4YMAA 5ITPA 4ZDMA 3BFUA 2GHBA 1TXFA 2DYXA 2CZLA 3RPWA 2VOZA 4XTCQ 2V84A 3GBBA 4WEDA 2HAUA 1Y4CA 4F1UA 1B9JA 1N04A 2I58A 3K6WA 1VR5A 3U8QA 1H3DA 3OO9A 4NMYA 4QFLA 5F1QA 1YCJA 2OBGA 3B6WA 4G8HA 4RK2A 3FVGA 2QRYA 4F3BA 4BDQA 3LSXA 1MXUA 1MH3A 3IB1A 1B0HA 5KZTA 1XVYA 5H8NA 1LFHA 3MC2A 1PDAA 5AA2A 2BJJX 1P1UA 2D3IA 4JBZA 3KSJA 3O6HA 4XXUA 3M3FA 4LUBA 3RT6B 4F3SA 2QS1A 2OWTA 3KN7A 3DM0A 1XVXA 2IEEA 3VDFA 1UQWA 3HSTA 3K1PA 4GWOA 4M1VA 4IO4A 4OXVA 4MBPA 3PV0E 4F1VA 3G3IA 4EXLA 2PYYA 1P1OA 4NEDA 4IO6A 2PX1A 4NF5A 3JV9A 3LC8A 1M5FA 4YU0A 4EF2A 3S9LC 1BTJA 1SVXB 3VLUA 4LQ2A 4P0IA 4XKQA 1BKAA 1QKBA 1USYE 3QUFA 2RCBA 1ZKBA 3KOSA 3T9XB 2DXRA 1MXZA 1B7HA 3FIRA 5AA2D 2I0BA 1MQDA 3SEUA 5AA4B 4ECFA 2ZMBA 3ECRA 2CMOA 1I69A 1NNKA 2UVHA 2HAVA 2NXOA 2VGQA 2A5TB 3MPKA 2XXVA 3GLBA 2V93A 5L9MA 2F7BA 1B7ZA 1MH4A 3T9VA 4FATA 5CMKA 4R6YA 1ZJLA 3E4RA 2AIXA 2G93A 5B70A 1VE4A 4KYSA 3VVEA 3T9UA 3S2VA 4Q8RA 2H98A 3CVGA 4IO7A 5F7VA 1FQAA 3MZ1A 2UXAA 4JWXA 4P11A 1JVYA 4ZZAA 1MDQA 5HPQA 3K01A 4EQ7A 2H5YA 5TPAA 3SEXA 3CFZA 2ZNSA 3K00A 3QUJA 5AA1A 1B0LA 1LCTA 2ONKE 4FIMA 1LCFA 1SBPA 2XXWA 5I59A 2AL5A 5I2KB 1XS5A 3H6VA 3T22A 1FQDA 4HW8A 1PB7A 3SKPA 4QFOA 3CI8A 3FZVA 3JYRA 4JDFA 1BP5A 1SQYA 5JEIA 4OQOA 4JWYA 3N6TA 4RK9A 4R75A 1DPEA 2XXYA 4LZ7A 5I58B 1WVJA 2M8CA 4LVQA 2O7UA 4ELOA 3TTKA 2ZYOA 5I2NB 2DP8A 1LAGE 4U23A 2DS9A 2QS4A 1B7UA 4YB5A 1OLCA 4EQ9A 4I1DA 1ZMGA 1JVXA 3R26A 4FE8A 2E1SA 2P0SA 4FJPA 1O63A 4H8IA 3PPQA 2O7IA 2UVJA 2PVUA 1QUKA 2Z8EA 4RXLA 4PE5B 4G68B 3TZAA 1Z7ME 1MXVA 2Z22A 4HS7A 1N84A 1JW4A 1B4ZA 2DWIA 4F22A 5HM4B 2QMXA 4OVJA 3EN3A 1TWYA 2V3UA 3VVFA 1Y1MA 1A8FA 2XX8A 5ITOA 3ILTB 2F6GA 1Y3NA 4OEVA 2F7CA 4BDRA 2XD2A 1UTBB 3IOTA 3FXUA 3TMGA 1NFTA 4R72A 3WAEA 4ONYA 1SW4A 4UA8A 1WDNA 1ZIUA 3S9MC 1URSA 2ALUA 3H4ZA 4RY1A 3G3FA 2V3TA 4NWCA 1N3XA 3O6IA 2ANJA 2DXYA 1GV8A 4OERA 1LSTA 1FTKA 3DELB 3IOUA 3ONMA 4QFPA 1URGA 5H8FA 3UP9A 1ELJA 1I6QA 1Y3QA 3G3JA 1URDA 2REJA 4RYAA 2P2AA 4IY6A 3CG1A 4NF6A 2F78A 4KD5A 3EHTA 3K6XA 3OO7A 5TP9A 4F19A 4OEUA 1LAFE 4DXUA 1R1NA 3KN3A 3H7MA 2XXTA 2DWAA 4DCYA 3RTWB 5J1DA 4WXJA 1FQEA 4ZECA 2H99A 2XD3A 3L6HA 1OLAA 3S4UA 2AYSA 2V3QA 4XKNA 1NNFA 4ELPA 3AXFA 3MAMA 1B58A 5ICTA 4KCCA 4GL0A 2I0CA 3CIJA 4E0XA 2FNCA 5TU0A 1IIWA 1MDP1 1HSLA 3C36A 4G8MA 4DDDA 3VVDA 1LBCA 3IK6B 3K4UA 3L6GA 5FTIA 2F35A 3V89B 4H1XA 2VD2A 5LOMA 2XHDA 3K6UA 4FECA 3QSLA 5L9OA 2Z8DA 3F11A 3O9PA 1B46A 3THIA 1ZTYA 3N5LA 1JETA 2NUVA 1FQFA 1MQGA 1JEVA 3W9WA 1FTLA 3OSRA 4G4PA 3MVWA 4MLQA 3R7XA 3K1MA 1LFGA 4POXA 5DEXA 5H8SA 5ICQA 4LZ8A 3GBAA 4IO2A 4I62A 4KR5A 3KZGA 3TYHA 5FHMA 4GXSB 1QJMA 4WKMA 1FTMA 3D4CA 1Y20A 2DOJA 2RCAA 3GZGA 2NWJA 3KJ7A 2PT1A 3KJTA 5BUUA 2RKMA 1SI1A 1YAEA 4UACA 2GH9A 5CBSA 3FVNA 4GIZA 3JZJA 3WAFA 1QKAA 3TQLA 4ND9A 1JQFA 3VFJA 4E0WA 2UVIA 3K0VA 1PBPA 1FTOA 3LSFB 1FQCA 2D5WA 3UIFA 2OCUA 1B32A 5DYHA 5CMBA 3PU5A 5H8QB 3MZBA 1IEJA 4R6KA 5EHMA 4F3GA 4KCDA 4PP0A 4R2FA 2X26A 3VLWA 3VLVA 2H9BA 1AMFA 1RKMA 3PPOA 3RY3A 3MZ9A 4DIGA 1SW5A 4R6HA 3PUZE 4LATA 3Q29A 1P99A 2A5SA 3Q27A 2DWHA 3FVKA 1PEBA 1USYH 5AA4A 4U2RA 1WODA 4F3PA 3O97A 1A8EA 3HHGA 2X7QA 1AL3A 2A5TA 4ZEDA 3OELA 4R9FA 1QUIA 3OXNA 2Y7PA 2QS2A 4ZS9A 3C4MA 3TQWA 1XT8A 3CSBA 1B52A 5KDTB 4G8NA 1TT1A 5CMCA 3O6GA 5DT6A 1IXHA 1EZPA 3SERA 3TUSA 3FGSA 2OK2A 3W15C 3FUZA 1NNPA 4THIA 2PMSA 4YB7A 2R71A 1SYHA 1QW0A 2OLBA 4F29A 1FQBA 1QVSA 2XXQA 3VXBA 2LAOA 2O68A 1POTA 1LB9A 2XX9A 4ELQA 3A3UA 2HZKA 4U22A 2OZZA 4I8CA 5I2KA 3IB2A 1NNTA 3QIMA 3IORA 3TODA 5I56B 1ANFA 4KI0E 2OWSA 3PMWA 3FD3A 3H03A 1GGGA 4X48A 2VHAA 1B3EA 1B3HA 3FV1A 3O2AA 3CR9A 2ZNUA 4BDMA 3R6UA 3PD8A 1IXCA 5I58A 4YKKA 3H6WA 1H44A 1I6AA 4NF8B 1VFEA 4YKIA 5I2NA 3G3HA 4KQPA 1MPCA 4X9TA 2RF1A 2HFBA 1ZBMA 5BWJA 3FV2A 3IX1A 2F8DA 4C1UA 1MXWA 4XKPA 2ZYMA 2UYEA 1Y3PA 1Y9UA 4R9GA 2H25A 5L8DA 2QSXA 1D3KA 1SD3A 3PUYE 4GFRA 1M5BA 4G68A 3SEWA 4F2QA 5A5XB 3DP6A 1N76A 4ZZEA 1B3FA 2HCAA 1EU8A 3SESA 3MP1A 4AB5A 1UIUA 2O1LA 1SDXA 1MS7A 1I6BA 1Q1KA 1UTBA 1R9QA 4O3BA 3TCFA 3DP8A 2O69A 4F1YA 4DZ1A 2F97A 2R9JA 2B3BA 4OHNA 4YICA 5CBRA 5K2XA 2Q88A 2RC7A 1MXXA 4XIGQ 4QHQA 1DOTA 4C1TA 1N7WA 1AIVA 3VXCA 1Y4TA 1VFDA 2F34A 2O51A 1LGBC 3FXQA 4H65A 1DTZA 2ABHA 2GHAA 5DVJA 1B05A 2DE2A 2FYIA 2YPNA 3M3LA 4KYDA 1NMUA 5FHNA 2Z23A 3PUVE 4N07A 2HQ0A 3KN8A 3HN0A 4QSDA 2P1SA 1B3LA 4HTGA 3G7WA 3EHSA 4PFYA 3A09A 3PPPA 5AE4A 3OMBA 4BDNA 2XX7A 4FEBA 3S9NC 2QS3A 4OESA 1LB8A 4IB2A 2WKYA 1IUDA 1R6ZA 1SW2A 4HCYA 4IGRA 4GXAA 4RNSA 1H76A 2Z8FA 1MY4A 4PETA 4IO3A 2HZLA 3ILUB 4GL8A 4YB6A 2ONSA 3UK4A 4L17A 1D9VA 3OO8A 4DE8A 4PFUA 2Q2AA 1JNFA 1US4A 5AA3A 3EQ1A 1EZOA 3EPEA 4TOZA 5HBCA 4MH5A 4AQ4A 3V83A 4N6PA 4DCXA 4OFOA 2E0SA 3SETA 1BLFA 3PPRA 4NF4B 4YZZA 1DMBA 4U1OA 3TTRA 4YKPA 3C35A 1GR2A 1B5IA 3K02A 4ISUA 3G3KA 3T66A 1SW1A 1LAXA 5IKBA 1B5JA 1UTHB 2DWJA 2GFEA 4XKRA 1FW0A 2XXIA 3FJ7A 4JXIA 4U1ZA 4X1BA 2Y7RA 3CSGA 4ELRA 1GTKA 3OEMA 1N3WA 5EHSA 4U21A 2UYFA 3USDA 3IO6A 1PC3A 5CMMA 3O66A 3DP4A 3LUYA 3RLFE 5I57B 1S7YA 3EHUA 4LONB 1NL5A 1ZLQA 4OFLA 3U1OA 5KCJB 1RYOA 1II5A 2QPQA 4F31B 2DSFA 1B4HA 1XHYA 3MBPA 2IA4A 4ZEKA 4KPTA 1D9YA 1S50A 1OQHA 2YLNA 3HHFA 2I4CA 4P0GA 3IO4A 1CB6A 1D4NA 5CC2A 5H8QA 1OVBA 4EUOA 3TTNA 3LSLA 1A7LA 1R9LA 5ELVA 3FATA 1RYXA 1P1WA 3RUMA 3BBRA 2HXWA 3QXMA 4QRZA 2V25A 1M5CA 3M3KA 4MFIA 3CFLA 1IITA 1OVTA 3K2DA 4KHZE 1LLSA 4FEDA 4EQBA 4BDOA 3KG2A 3MP8A 2I48A 5FTHA 3IL1B 1P1NA 2I3WA 1Y1ZA 4MF3A 5DVIA 1XOCA 3E13X 1OIBA 1ZU0A 3KFMA 1A54A 1QULA 5JTYB 1TFDA 4RA1A 4GLIA 2DVCA 5KDTA 2NOOA 5H8HB 3UGWA 3KEIA 1MY0A 3LBSA 3H06B 3LR1A 1UIVA 1B51A 3E3KA 1MXYA 3MVXA 3PUXE 2DQVA 3P7IA 4IO5A 3MP6A 4ESWA 2DE4A 4H5GA 4OTEA 3BKIB 2Y7KA 3RNNA 4BDLA 4ZEFA 1NKXA 1Z7NE 1MQHA 4EXKA 1IXGA 1MY3A 3TCHA 4NTLA 2QJEA 2R6GE 1KWHA 1FCKA 5DEXB 1LAHE 4N13A 4OFJA 4F39A 5I56A 4QSEA 3U72A 4EDPA 1MPDA 1YTVA 2RINA 3RTFB 3B6TA 3I3VA 2F7AA 4NF8A 3V5AA 3DLNA 1BIYA 1A55A 4QF9A 3OEKA 1AH5A 2F6PA 4OMBA 3T9HB 4JSOA 2GRVA 4H67A 4GD5A 3SEVA 3K1NA 4MLVA 2VD3A 4F18A 4OZ9A 5CM6A 3MVYA 4YAHX 4DXBA 3OD7A 1N7XA 3TEPA 2XXPA 1OMPA 2XXRA 1QUJA 4IY5A 1IQ7A 3IJOB 5H8NB 3KGCA 3MWBA 5A5XA 3RT8A 2ESNA 5AA2B 4K3FA 3A3CA 3FXRA 1F9BA 1MQJA 1DPPA 2H4IA 4YKJA 4Z0IA 2KLFA 3PUWE 4O3CA 1VSOA 3ZKKA 3TELA 2I6EA 3TDJA 3N94A 3TTMA 4GVOA 3D4GA 3M8UA 4R2BA 3FJGA 4WEPA 5JK4A 2YJPA 2QL3A 3TFLA 1GVCA 1PB8A 3HV1A 2PT2A 1B1HA 3H6UA 4Q30B 3UN6A 3OSQA 3MVZA 3MW0A 4NF5B 1SI0A 2I3VA 4U4XA 5CRYA 1JW5A 3OENA 4LA9A 4OENA 1AOVA 3IOWA 2THIA 2Q9TA 1SYIA 2F36A 3PMVA 4AB6A 4PFWA 3CG3A 4LZ5A 4HCWA 3C32A 3FASA 3IR1A 4TQUQ 1B2HA 2W7YA 1MPBA 2Q8JA 3B7DA 5ISUA 3H3GA 3IJXB 2G29A 2B3FA 3TKDA 1PBQA 3GXAA 3MUQA 3MJNA 1MM7A 3QK6A 4OWDA 1MM6A 2D21A 5FHOA 4KFQA 1B6HA 4IGTA 2B65A 4DLDA 5B7DA 1L5TA 4ESXA 4H0WA 4H6DA 4Q5TA 4RPOA 3C31A 4GOTA 3PGFA 4GQOA 3T93B 2DVZA 4ZE8A 1HSEA 1O64A 4LP2B 1H43A 4RPNA 5TPAB 3C34A 2Y84A 4OETA 4OYVA 4O3AA 1PB9A 1H45A 3KSXA 3N26A 1LFIA 1MQIA 1MG1A 4Z7EA 3KBRA 3ZSFA 1M5DA 3CFXA 3FVOA 5I59B 2HEUA 2Y7IA 2I49A 5M2VA 2ZYNA 3B6QA 5K2YA 3G3GA 4G2ZA 2Q2CA 2OJTA 3H6TA 1XC1A 4NF4A 4I9DA 1N0TA 4LQ5A 2XXHA 3C9HA 4ZE9A 3SEYA 3MPLA 2O84X 5DVFA 1IXIA 1NH8A 3PMXA 3PPNA 4F2OA 5IAIA 4R74A 1UTHA 3V8XB 1B5HA 3OOAA 2F5XA 4M4GA 4U4SA 1CE2A 3CRBA 4JWOA 4POWA 4TLLB 2O1MA 3VE1B 3O28A 1US5A 2DE3A 1HSJA 4BLAA 3TTLA 2PBWA 3T96B 4ZEIA 2XXXA 3N6UA 1O7TA 4PFTA 5CI5A 5I57A 4GRKA 1JEUA 2ZXTA 2QMWA 3Q25A 4R73A 5KCJA 3E9XA 3VV5A 4H5FA 3I6VA 1EH3A 1DTGA 5EYFA 1OQGA 3U94A 1J1NA 3TCGA 4Q0CA 4TLMB 1ATGA 4EF1A 3ZKLA 4JB7A 3FJMA 2RC8A 1B3GA 3TAJA 1T0KA 2AL4A 5L9SA 1EZ9A 4H8JA 2FA7A 2VP1A 1Q35A 3I5OA 3QAXA 2I4BA 4QFKA 2X7PA 3RGYA 4ZEBA 1MY1A 1S9TA 2REGA 3KOTA 4QFNA 5H8FB 3RN8A 1NH7A 2XXUA 4FORA 3U92A 3S9EA 4KYEA 1YPNA 4X1DA 2O6AA 4FAJA 3ZS6A 4NF6B 2Y7WA 3IB0A 1A40A 5I84A 3HCQA 3HO7A 1MY2A 1TFAA 4QSCA 1LBBA 2Q89A 5TP9B 3SDFA 3RQTA 1MRPA 5JTYA 3Q28A
chains in the Genus database with same CATH superfamily
3EF7A 3LSWA 4PDDA 5H8HA 2MKZA 4OA4A 4YMBA 1KZ8A 3HPIA 4I40A 2UVGA 1IZ1A 4PQJA 4N6DA 4C0RA 4RJZA 3ODBA 2RC9A 2ZYKA 1FTJA 3IOVA 1DSNA 1P1QA 4GF8A 2ZZVA 3Q26A 4G77A 4G68C 3K6VA 2ONRA 3TPAA 5DTBA 3PD9A 4NWDA 1B1XA 4DXCA 3UORA 4NE4A 2ZNTA 3LV0A 2PFZA 3O29A 3BFTA 4MCOA 3OO6A 3QYTA 2WYKA 3UA8A 1B40A 1A99A 4GX3A 2NVUB 4G61A 5ESYA 1IMDA 3W9VA 1POY1 3MQ9A 5F24A 3U93A 1JW1A 1M5EA 3C33A 4JSDA 2Q74A 3IAZA 4YMAA 5ITPA 4ZDMA 3BFUA 2GHBA 1TXFA 2DYXA 2CZLA 3B8BA 3RPWA 2VOZA 4XTCQ 2V84A 3GBBA 4WEDA 4OVSA 2FVZA 1Y4CA 2HAUA 4F1UA 1FPKA 1B9JA 4PF6A 1N04A 2I58A 3K6WA 3BIGA 4PAIA 1VR5A 3U8QA 1H3DA 3OO9A 4NMYA 4QFLA 4DI4B 5F1QA 1YCJA 4NF0A 2OBGA 3B6WA 4G8HA 4RK2A 3FVGA 2QRYA 4F3BA 4BDQA 3LSXA 1MXUA 1MH3A 3IB1A 3ROJA 1B0HA 5KZTA 1XVYA 1FBFA 5H8NA 1LFHA 3MC2A 4XFEA 1PDAA 3T1BA 5AA2A 2BJJX 1P1UA 2D3IA 4JBZA 3KSJA 4X8RA 3O6HA 4XXUA 3M3FA 4LUBA 3RT6B 2QS1A 2OWTA 4F3SA 3KN7A 3DM0A 1XVXA 4HE2A 2IEEA 4NQ8A 3VDFA 1UQWA 3HSTA 3K1PA 4GWOA 4M1VA 4IO4A 4OXVA 4MBPA 3PV0E 4F1VA 2P3NA 1RDZA 3G3IA 4EXLA 2PYYA 1P1OA 4NEDA 2B4LA 4IO6A 2PX1A 4NF5A 3JV9A 1FBDA 5IZ3A 1DK4A 3KC1A 3LC8A 1M5FA 4YU0A 4EF2A 3S9LC 1BTJA 1SVXB 5LTCA 3MSTA 3VLUA 4LQ2A 4P0IA 4XKQA 1BKAA 1QKBA 1USYE 3QUFA 2RCBA 1ZKBA 3KOSA 3T9XB 2DXRA 1MXZA 2PFYA 1B7HA 3FIRA 5AA2D 2I0BA 1MQDA 3SEUA 5AA4B 4ECFA 2ZMBA 2B4MA 4NAPA 1K9ZA 3ECRA 2CMOA 4MMPA 1I69A 1IMFA 1NNKA 2UVHA 2HAVA 2NXOA 2VGQA 2A5TB 3MPKA 2XXVA 3GLBA 2V93A 5L9MA 2F7BA 4O94A 4PDHA 1B7ZA 1MH4A 3T9VA 1FBGA 4P56A 2R8TA 4FATA 5CMKA 2FBPA 4R6YA 1ZJLA 3E4RA 2AIXA 2G93A 5B70A 1VE4A 4KYSA 3VVEA 1YZ0A 3T9UA 4LN5A 3S2VA 4Q8RA 1FBPA 2H98A 3CVGA 4IO7A 5F7VA 1FQAA 3MZ1A 2UXAA 4JWXA 4P11A 1JVYA 4ZZAA 1MDQA 5HPQA 3K01A 4EQ7A 2H5YA 2F3DA 5TPAA 3SEXA 3CFZA 2ZNSA 3K00A 3QUJA 4MEVA 5AA1A 1B0LA 1LCTA 2ONKE 4FIMA 1LCFA 5EYHA 1SBPA 2XXWA 5I59A 2JJKA 2AL5A 5I2KB 1XS5A 2PCRA 3H6VA 1LBYA 3T22A 1FQDA 4HW8A 1PB7A 4QFOA 3SKPA 3CI8A 3FZVA 3JYRA 4JDFA 1BP5A 1SQYA 5JEIA 4OQOA 4JWYA 4N8YA 1RDXA 3N6TA 4N81A 4RK9A 4R75A 2WYPA 1DPEA 2XXYA 1Q9DA 4LZ7A 5I58B 1WVJA 2BJIA 2M8CA 4LVQA 2O7UA 3E79A 4ELOA 3TTKA 2ZYOA 5I2NB 2QVRA 2DP8A 1LAGE 4U23A 2DS9A 2QS4A 1B7UA 4YB5A 1OLCA 4EQ9A 4I1DA 1ZMGA 1JVXA 5FBPA 3R26A 4FE8A 2E1SA 2P0SA 1FBCA 4FJPA 4NX1A 1O63A 4H8IA 3PPQA 2O7IA 4MJOA 2UVJA 2PVUA 1QUKA 2Z8EA 4RXLA 4PE5B 4G68B 3TZAA 1Z7ME 4GBWA 1MXVA 2Z22A 4HS7A 2WX9A 1N84A 1JW4A 1B4ZA 2DWIA 3T0JA 4F22A 5HM4B 2QMXA 4OVJA 3EN3A 1NUWA 1TWYA 2V3UA 3VVFA 1Y1MA 1A8FA 2XX8A 5ITOA 3ILTB 2F6GA 2HPGA 1Y3NA 4OEVA 2F7CA 4BDRA 2XD2A 1UTBB 3IOTA 3FXUA 3TMGA 1NFTA 2Y5KA 4R72A 3WAEA 4ONYA 1SW4A 4UA8A 1WDNA 1ZIUA 3S9MC 1URSA 5ET6A 2ALUA 1QGXA 3H4ZA 4RY1A 3G3FA 2V3TA 4NWCA 1N3XA 3O6IA 2ANJA 4NHBA 2DXYA 1SPIA 1GV8A 4MIJA 4OERA 1LSTA 1FTKA 3DELB 3IOUA 3ONMA 4QFPA 1URGA 5H8FA 3UP9A 1ELJA 1I6QA 1Y3QA 4PFIA 4N91A 3G3JA 4OANA 1URDA 2REJA 4RYAA 2P2AA 4IY6A 5T3JA 1FTAA 3RPLA 3CG1A 4NF6A 2F78A 4KD5A 3EHTA 3ISPA 3K6XA 3OO7A 5TP9A 4F19A 4MNPA 4OEUA 1LAFE 2WBDA 4DXUA 1R1NA 3KN3A 3H7MA 2XXTA 2DWAA 4DCYA 3RTWB 5J1DA 4WXJA 1FQEA 4ZECA 2H99A 5IZZA 2XD3A 3L6HA 5EQ9A 1OLAA 3S4UA 2AYSA 2V3QA 3D1RA 4XKNA 1NNFA 1LBXA 4ELPA 2L5VA 3AXFA 3MAMA 4NN3A 1B58A 5ICTA 4KCCA 4GL0A 2I0CA 3CIJA 4E0XA 2FNCA 5TU0A 1IIWA 1LBWA 1MDP1 1HSLA 3GYYA 3C36A 4G8MA 4DDDA 3VVDA 1LBCA 2CZIA 3IK6B 3K4UA 3L6GA 2VPNA 5FTIA 2F35A 3V89B 4H1XA 2VD2A 5LOMA 4H46A 2XHDA 4OVRA 3K6UA 4FECA 3QSLA 5L9OA 2Z8DA 1XI6A 3F11A 3O9PA 1B46A 4O7MA 3THIA 1YXIA 1ZTYA 3N5LA 1JETA 2NUVA 1FQFA 1MQGA 1JEVA 4FBPA 3W9WA 1FTLA 3OSRA 4G4PA 1D9QA 3MVWA 4MLQA 3R7XA 3K1MA 4XF5A 5J16A 1LFGA 4POXA 5DEXA 1K9YA 5H8SA 5ICQA 3CHGA 4LZ8A 3GBAA 4IO2A 4I62A 4KR5A 3KZGA 3TYHA 5FHMA 4GXSB 1QJMA 4WKMA 2F3BA 1FTMA 3D4CA 1Y20A 2DOJA 2RCAA 3GZGA 1KA1A 2NWJA 3KJ7A 2PT1A 3KJTA 5BUUA 2RKMA 1SI1A 1YAEA 4UACA 2GH9A 5CBSA 3FVNA 4GIZA 3JZJA 3WAFA 1QKAA 3TQLA 4ND9A 1JQFA 1LEVA 3VFJA 4JVCA 4E0WA 2UVIA 3K0VA 1PBPA 1FTOA 3LSFB 4OVQA 1FQCA 2D5WA 3UIFA 2OCUA 1B32A 5DYHA 5CMBA 3PU5A 5H8QB 3MZBA 4XEQA 1IEJA 4R6KA 5EHMA 4F3GA 4KCDA 4PP0A 4R2FA 2X26A 3VLWA 3VLVA 1NV2A 3PTYA 2H9BA 1AMFA 1RKMA 3PPOA 3RY3A 1EYKA 4X04A 3MZ9A 4DIGA 2FIEA 1SW5A 4R6HA 3PUZE 1NV5A 4LATA 3Q29A 1P99A 2A5SA 4MNIA 3Q27A 2DWHA 3FVKA 1PEBA 1USYH 5AA4A 4U2RA 2OWZA 1WODA 4F3PA 3O97A 1A8EA 3HHGA 2X7QA 1AL3A 2A5TA 4ZEDA 3OELA 4R9FA 4I3YA 1QUIA 3OXNA 2Y7PA 2QS2A 1JP4A 4ZS9A 3C4MA 3TQWA 1XT8A 3CSBA 1FBHA 1B52A 5KDTB 4G8NA 5I3SA 1TT1A 3O6GA 5CMCA 5I7IA 5DT6A 1IXHA 5I5PA 1EZPA 3SERA 3TUSA 3FGSA 2OK2A 3W15C 3FUZA 1NNPA 4THIA 2PMSA 4YB7A 1LBZA 2R71A 1SYHA 1QW0A 2OLBA 4F29A 1FQBA 1QVSA 2XWKA 2XXQA 3VXBA 2LAOA 4I3EA 2O68A 1POTA 1LB9A 2XX9A 3LUZA 4ELQA 3A3UA 2HZKA 4U22A 2OZZA 4I8CA 5I2KA 3IB2A 1NNTA 3QIMA 3IORA 3TODA 5I56B 1ANFA 4KI0E 2OWSA 3PMWA 3FD3A 3FXBA 3H03A 1GGGA 4X48A 2VHAA 1B3EA 1B3HA 3FV1A 3O2AA 3CR9A 2ZNUA 4BDMA 3R6UA 3PD8A 1IXCA 5I58A 4YKKA 3H6WA 1H44A 1I6AA 4NF8B 1VFEA 4YKIA 5I2NA 3G3HA 4KQPA 1MPCA 4N8GA 4X9TA 2RF1A 4PGNA 2HFBA 1ZBMA 5BWJA 3FV2A 3IX1A 1NV7A 2F8DA 4C1UA 1MXWA 1IMBA 4XKPA 2ZYMA 2UYEA 1Y3PA 1Y9UA 1FJ9A 4R9GA 2H25A 4O8MA 1NUZA 1FBEA 5L8DA 2QSXA 5IM2A 1D3KA 1SD3A 4N17A 3PUYE 4GFRA 2V4CA 1M5BA 4G68A 3SEWA 4F2QA 5A5XB 3DP6A 1N76A 4ZZEA 1B3FA 2HCAA 1EU8A 3SESA 3MP1A 4AB5A 4PBQA 1UIUA 2O1LA 1SDXA 1FSAA 1MS7A 1I6BA 1Q1KA 1UTBA 1R9QA 4O3BA 3TCFA 3DP8A 1IMCA 4PE3A 2O69A 4F1YA 4GWZA 4DZ1A 2F97A 2R9JA 2B3BA 4OHNA 4YICA 5CBRA 5K2XA 2Q88A 2RC7A 1MXXA 4XIGQ 4QHQA 1DOTA 3QMFA 1IMAA 4C1TA 1N7WA 1FPJA 1AIVA 3VXCA 1Y4TA 1VFDA 2F34A 2O51A 1LGBC 3FXQA 4H65A 1DTZA 2ABHA 2GHAA 1INPA 5DVJA 1B05A 2DE2A 2FYIA 4AS5A 2YPNA 3M3LA 4KYDA 1NMUA 5FHNA 2Z23A 1YYZA 3PUVE 4N07A 2HQ0A 1DCUA 3KN8A 4QBAA 4UABA 3HN0A 4QSDA 2P1SA 1B3LA 4HTGA 3G7WA 3EHSA 4PFYA 1FPEA 3A09A 3PPPA 4P1LA 5AE4A 3OMBA 4BDNA 3KC0A 2XX7A 4FEBA 1NV1A 3S9NC 4PTKA 2QS3A 4OESA 4GWXA 1LB8A 4IB2A 4P3LA 1EYJA 2WKYA 1IUDA 1R6ZA 1SW2A 4HCYA 4IGRA 4GXAA 4RNSA 1H76A 2Z8FA 1MY4A 4PETA 4DI3D 4IO3A 2HZLA 3ILUB 4GL8A 4YB6A 2ONSA 5LDZA 3UK4A 4L17A 1D9VA 3OO8A 1NI9A 5ET5A 4DE8A 4PFUA 2Q2AA 1JNFA 2XWOA 1US4A 5AA3A 3EQ1A 1EZOA 1CNQA 3EPEA 4TOZA 5HBCA 4MH5A 4AQ4A 3V83A 4N6PA 4DCXA 4OFOA 2E0SA 4PF8A 3SETA 2CEYA 1BLFA 2CEXA 3MYUA 3PPRA 4NF4B 4YZZA 1DMBA 4U1OA 4H45A 3TTRA 4YKPA 3C35A 1GR2A 1B5IA 3K02A 4ISUA 4P9KA 4IR8A 3G3KA 3T66A 1SW1A 1LAXA 5IKBA 1B5JA 1UTHB 2DWJA 2GFEA 4XKRA 1FW0A 2XXIA 3FJ7A 4JXIA 4U1ZA 4X1BA 2Y7RA 3CSGA 4ELRA 5IGAA 1GTKA 3B50A 3OEMA 1N3WA 5EHSA 4U21A 2UYFA 4GWWA 3USDA 4P1EA 1G0IA 3IO6A 1PC3A 5CMMA 3O66A 3DP4A 3LUYA 3RLFE 5I57B 1S7YA 1G0HA 3EHUA 4PCDA 3FBPA 4LONB 4KXPA 4PAFA 1NL5A 1ZLQA 4OFLA 3U1OA 5KCJB 1RYOA 1II5A 2QPQA 4F31B 2QVVA 3RYDA 2DSFA 1B4HA 1XHYA 3IFAA 3MBPA 2IA4A 4ZEKA 4KPTA 2XWVA 1D9YA 1S50A 1OQHA 2YLNA 3HHFA 4PC9A 2I4CA 4P0GA 3IO4A 1CB6A 1D4NA 5CC2A 5H8QA 1OVBA 4GX4A 1FPIA 4EUOA 3TTNA 3LSLA 1A7LA 1R9LA 5ELVA 2P3VA 3FATA 1RYXA 1P1WA 3RUMA 1NUYA 3BBRA 2HXWA 3QXMA 4QRZA 2V25A 1M5CA 3M3KA 4MFIA 3CFLA 1IITA 1OVTA 3K2DA 2Q8MA 4KHZE 2KR0A 1LLSA 4FEDA 4PGPA 4EQBA 4BDOA 4GX6A 3KG2A 3MP8A 2I48A 5FTHA 3IL1B 4PFRA 1P1NA 2I3WA 1Y1ZA 4MF3A 5DVIA 1XOCA 3E13X 1OIBA 1ZU0A 3KFMA 4AS4A 1A54A 1QULA 5JTYB 5ET8A 1TFDA 4RA1A 4GLIA 2DVCA 5KDTA 2NOOA 5H8HB 3UGWA 3KEIA 1MY0A 3LBSA 3H06B 3LR1A 1UIVA 1B51A 1FPLA 3E3KA 1MXYA 3MVXA 4OVTA 3PUXE 2DQVA 3P7IA 4IO5A 3MP6A 2CZKA 4ESWA 2DE4A 4H5GA 4OTEA 3BKIB 2Y7KA 3RNNA 4BDLA 4ZEFA 1NKXA 1AWBA 1Z7NE 1MQHA 1LBVA 4MHFA 4EXKA 4NG7A 1IXGA 1MY3A 3TCHA 1FPDA 4NTLA 2QJEA 3HFUA 2R6GE 1KWHA 1FCKA 5DEXB 1LAHE 4N13A 4OFJA 5EQ7A 4F39A 3KBZA 5I56A 1IMEA 4QSEA 3U72A 4EDPA 1MPDA 1YTVA 2RINA 4N15A 3RTFB 1FRPA 3B6TA 4N4UA 4GBVA 1FPGA 5EQ8A 3I3VA 4QXDA 2F7AA 4NF8A 3V5AA 3DLNA 1BIYA 1A55A 2QVUA 4QF9A 5IZ1A 3OEKA 1AH5A 2F6PA 4OMBA 3T9HB 4N6KA 4JSOA 2GRVA 2HXRA 1NV3A 4H67A 4GD5A 3SEVA 3K1NA 4MLVA 2VD3A 4F18A 4OZ9A 5CM6A 2ZZXA 3MVYA 4YAHX 4DXBA 1NV4A 3OD7A 1N7XA 3TEPA 2XXPA 1NUXA 1OMPA 2XXRA 1QUJA 4IY5A 1IQ7A 3IJOB 4JVDA 5H8NB 3KGCA 3MWBA 5A5XA 3RT8A 2ESNA 5AA2B 2XA5A 4K3FA 3A3CA 3FXRA 1F9BA 1MQJA 1DPPA 2H4IA 4YKJA 4Z0IA 2KLFA 3PUWE 4O3CA 1VSOA 5DW8A 3ZKKA 3TELA 2I6EA 3TDJA 2ZZWA 3N94A 3TTMA 4GVOA 3D4GA 3M8UA 3A29A 4R2BA 3FJGA 4WEPA 5JK4A 2YJPA 2QL3A 3TFLA 1GVCA 1PB8A 3HV1A 1DBZA 2PT2A 1B1HA 3SZPA 2XWIA 3H6UA 4Q30B 1NV0A 3UN6A 3OSQA 3MVZA 3MW0A 4NF5B 2HHMA 1SI0A 1RDYA 2I3VA 4U4XA 5IZ3B 5CRYA 1JW5A 3OENA 4LA9A 4OENA 1AOVA 2OX3A 3IOWA 2THIA 2Q9TA 1SYIA 2KQZA 2F36A 3PMVA 4AB6A 4PFWA 4LZ5A 2DDKA 3CG3A 4HCWA 3C32A 3FASA 3IR1A 4TQUQ 1B2HA 5EYGA 2W7YA 1MPBA 2Q8JA 3B7DA 5ISUA 3H3GA 3IJXB 1NV6A 2GQ1A 4PAKA 2G29A 2B3FA 3TKDA 3BIHA 1PBQA 2FHYA 3GXAA 3MUQA 4PBHA 1EYIA 3MJNA 1MM7A 2WEFA 3QK6A 4OWDA 1MM6A 2D21A 5FHOA 4KFQA 1B6HA 4IGTA 2B65A 4HE0A 4DLDA 5B7DA 1L5TA 4ESXA 4H0WA 4H6DA 4Q5TA 4RPOA 4MX6A 3C31A 4GOTA 3PGFA 4GQOA 3T93B 2DVZA 4ZE8A 1HSEA 1O64A 4LP2B 1H43A 4RPNA 5A5LA 5TPAB 3C34A 2Y84A 4OETA 4OYVA 4O3AA 1PB9A 1H45A 3KSXA 3N26A 1LFIA 1MQIA 4JVIA 1MG1A 4Z7EA 3KBRA 3ZSFA 1M5DA 3CFXA 4GWUA 1FJ6A 3FVOA 5I59B 2HEUA 2Y7IA 2I49A 5M2VA 2ZYNA 3B6QA 5K2YA 4NGUA 3EKIA 3G3GA 4G2ZA 2Q2CA 2OJTA 3H6TA 1XC1A 4MAGA 4NF4A 1FPFA 4I9DA 1N0TA 4LQ5A 2XXHA 3C9HA 2QFLA 4ZE9A 3SEYA 3MPLA 2O84X 5DVFA 1IXIA 1NH8A 2CZHA 3PMXA 3PPNA 4F2OA 5IAIA 4R74A 1UTHA 3V8XB 1B5HA 3OOAA 2F5XA 4M4GA 4U4SA 4P8BA 1CE2A 1VDWA 5EQAA 3CRBA 4JWOA 4POWA 4TLLB 4P47A 2O1MA 1BK4A 3VE1B 3O28A 1US5A 2DE3A 1HSJA 2WBBA 4BLAA 3TTLA 3U65A 2PBWA 3T96B 4ZEIA 2XXXA 3N6UA 1O7TA 4PFTA 5CI5A 5I57A 4GRKA 3E78A 1JEUA 1KA0A 4OVPA 2ZXTA 2Y5LA 2QMWA 3Q25A 4R73A 2VPOA 5KCJA 3E9XA 3VV5A 4H5FA 3I6VA 1EH3A 1DTGA 5EYFA 1OQGA 2XXKA 3U94A 3IFCA 1J1NA 3TCGA 4Q0CA 4TLMB 1ATGA 4EF1A 4O7IA 3ZKLA 4JB7A 3FJMA 2RC8A 1B3GA 3NOHA 3TAJA 1T0KA 2AL4A 5L9SA 1EZ9A 4H8JA 4HE1A 2FA7A 4PFBA 2VP1A 1Q35A 3I5OA 3QAXA 2I4BA 4QFKA 2X7PA 3RGYA 2VT5A 5ET7A 4ZEBA 1MY1A 1S9TA 2REGA 3KOTA 4QFNA 5H8FB 3RN8A 1NH7A 2XXUA 4FORA 4GWSA 3U92A 3S9EA 4GWYA 4KYEA 1YPNA 4X1DA 2O6AA 1FPBA 3RPLB 4FAJA 3ZS6A 4MNCA 4NF6B 2Y7WA 3IB0A 2FIXA 4HXVA 1A40A 5I84A 3HCQA 3HO7A 1MY2A 1TFAA 4QSCA 1LBBA 2Q89A 5TP9B 3SDFA 3RQTA 1MRPA 5JTYA 3Q28A
chains in the Genus database with same CATH topology
3EF7A 3LSWA 5H8HA 4YMBA 3HPIA 2UVGA 1IZ1A 4PQJA 4C0RA 4RJZA 3ODBA 2RC9A 2ZYKA 1FTJA 3IOVA 1DSNA 1P1QA 4GF8A 3Q26A 4G77A 4G68C 3K6VA 2ONRA 3TPAA 5DTBA 3PD9A 4NWDA 1B1XA 4DXCA 3UORA 4NE4A 2ZNTA 3O29A 3BFTA 3OO6A 3QYTA 3UA8A 1B40A 1A99A 2NVUB 3W9VA 1POY1 3MQ9A 3U93A 1JW1A 1M5EA 3C33A 4JSDA 3IAZA 4YMAA 5ITPA 4ZDMA 3BFUA 2GHBA 1TXFA 2DYXA 2CZLA 3RPWA 2VOZA 4XTCQ 2V84A 3GBBA 4WEDA 2HAUA 1Y4CA 4F1UA 1B9JA 1N04A 2I58A 3K6WA 1VR5A 3U8QA 1H3DA 3OO9A 4NMYA 4QFLA 5F1QA 1YCJA 2OBGA 3B6WA 4G8HA 4RK2A 3FVGA 2QRYA 4F3BA 4BDQA 3LSXA 1MXUA 1MH3A 3IB1A 1B0HA 5KZTA 1XVYA 5H8NA 1LFHA 3MC2A 1PDAA 5AA2A 2BJJX 1P1UA 2D3IA 4JBZA 3KSJA 3O6HA 4XXUA 3M3FA 4LUBA 3RT6B 4F3SA 2QS1A 2OWTA 3KN7A 3DM0A 1XVXA 2IEEA 3VDFA 1UQWA 3HSTA 3K1PA 4GWOA 4M1VA 4IO4A 4OXVA 4MBPA 3PV0E 4F1VA 3G3IA 4EXLA 2PYYA 1P1OA 4NEDA 4IO6A 2PX1A 4NF5A 3JV9A 3LC8A 1M5FA 4YU0A 4EF2A 3S9LC 1BTJA 1SVXB 3VLUA 4LQ2A 4P0IA 4XKQA 1BKAA 1QKBA 1USYE 3QUFA 2RCBA 1ZKBA 3KOSA 3T9XB 2DXRA 1MXZA 1B7HA 3FIRA 5AA2D 2I0BA 1MQDA 3SEUA 5AA4B 4ECFA 2ZMBA 3ECRA 2CMOA 1I69A 1NNKA 2UVHA 2HAVA 2NXOA 2VGQA 2A5TB 3MPKA 2XXVA 3GLBA 2V93A 5L9MA 2F7BA 1B7ZA 1MH4A 3T9VA 4FATA 5CMKA 4R6YA 1ZJLA 3E4RA 2AIXA 2G93A 5B70A 1VE4A 4KYSA 3VVEA 3T9UA 3S2VA 4Q8RA 2H98A 3CVGA 4IO7A 5F7VA 1FQAA 3MZ1A 2UXAA 4JWXA 4P11A 1JVYA 4ZZAA 1MDQA 5HPQA 3K01A 4EQ7A 2H5YA 5TPAA 3SEXA 3CFZA 2ZNSA 3K00A 3QUJA 5AA1A 1B0LA 1LCTA 2ONKE 4FIMA 1LCFA 1SBPA 2XXWA 5I59A 2AL5A 5I2KB 1XS5A 3H6VA 3T22A 1FQDA 4HW8A 1PB7A 3SKPA 4QFOA 3CI8A 3FZVA 3JYRA 4JDFA 1BP5A 1SQYA 5JEIA 4OQOA 4JWYA 3N6TA 4RK9A 4R75A 1DPEA 2XXYA 4LZ7A 5I58B 1WVJA 2M8CA 4LVQA 2O7UA 4ELOA 3TTKA 2ZYOA 5I2NB 2DP8A 1LAGE 4U23A 2DS9A 2QS4A 1B7UA 4YB5A 1OLCA 4EQ9A 4I1DA 1ZMGA 1JVXA 3R26A 4FE8A 2E1SA 2P0SA 4FJPA 1O63A 4H8IA 3PPQA 2O7IA 2UVJA 2PVUA 1QUKA 2Z8EA 4RXLA 4PE5B 4G68B 3TZAA 1Z7ME 1MXVA 2Z22A 4HS7A 1N84A 1JW4A 1B4ZA 2DWIA 4F22A 5HM4B 2QMXA 4OVJA 3EN3A 1TWYA 2V3UA 3VVFA 1Y1MA 1A8FA 2XX8A 5ITOA 3ILTB 2F6GA 1Y3NA 4OEVA 2F7CA 4BDRA 2XD2A 1UTBB 3IOTA 3FXUA 3TMGA 1NFTA 4R72A 3WAEA 4ONYA 1SW4A 4UA8A 1WDNA 1ZIUA 3S9MC 1URSA 2ALUA 3H4ZA 4RY1A 3G3FA 2V3TA 4NWCA 1N3XA 3O6IA 2ANJA 2DXYA 1GV8A 4OERA 1LSTA 1FTKA 3DELB 3IOUA 3ONMA 4QFPA 1URGA 5H8FA 3UP9A 1ELJA 1I6QA 1Y3QA 3G3JA 1URDA 2REJA 4RYAA 2P2AA 4IY6A 3CG1A 4NF6A 2F78A 4KD5A 3EHTA 3K6XA 3OO7A 5TP9A 4F19A 4OEUA 1LAFE 4DXUA 1R1NA 3KN3A 3H7MA 2XXTA 2DWAA 4DCYA 3RTWB 5J1DA 4WXJA 1FQEA 4ZECA 2H99A 2XD3A 3L6HA 1OLAA 3S4UA 2AYSA 2V3QA 4XKNA 1NNFA 4ELPA 3AXFA 3MAMA 1B58A 5ICTA 4KCCA 4GL0A 2I0CA 3CIJA 4E0XA 2FNCA 5TU0A 1IIWA 1MDP1 1HSLA 3C36A 4G8MA 4DDDA 3VVDA 1LBCA 3IK6B 3K4UA 3L6GA 5FTIA 2F35A 3V89B 4H1XA 2VD2A 5LOMA 2XHDA 3K6UA 4FECA 3QSLA 5L9OA 2Z8DA 3F11A 3O9PA 1B46A 3THIA 1ZTYA 3N5LA 1JETA 2NUVA 1FQFA 1MQGA 1JEVA 3W9WA 1FTLA 3OSRA 4G4PA 3MVWA 4MLQA 3R7XA 3K1MA 1LFGA 4POXA 5DEXA 5H8SA 5ICQA 4LZ8A 3GBAA 4IO2A 4I62A 4KR5A 3KZGA 3TYHA 5FHMA 4GXSB 1QJMA 4WKMA 1FTMA 3D4CA 1Y20A 2DOJA 2RCAA 3GZGA 2NWJA 3KJ7A 2PT1A 3KJTA 5BUUA 2RKMA 1SI1A 1YAEA 4UACA 2GH9A 5CBSA 3FVNA 4GIZA 3JZJA 3WAFA 1QKAA 3TQLA 4ND9A 1JQFA 3VFJA 4E0WA 2UVIA 3K0VA 1PBPA 1FTOA 3LSFB 1FQCA 2D5WA 3UIFA 2OCUA 1B32A 5DYHA 5CMBA 3PU5A 5H8QB 3MZBA 1IEJA 4R6KA 5EHMA 4F3GA 4KCDA 4PP0A 4R2FA 2X26A 3VLWA 3VLVA 2H9BA 1AMFA 1RKMA 3PPOA 3RY3A 3MZ9A 4DIGA 1SW5A 4R6HA 3PUZE 4LATA 3Q29A 1P99A 2A5SA 3Q27A 2DWHA 3FVKA 1PEBA 1USYH 5AA4A 4U2RA 1WODA 4F3PA 3O97A 1A8EA 3HHGA 2X7QA 1AL3A 2A5TA 4ZEDA 3OELA 4R9FA 1QUIA 3OXNA 2Y7PA 2QS2A 4ZS9A 3C4MA 3TQWA 1XT8A 3CSBA 1B52A 5KDTB 4G8NA 1TT1A 5CMCA 3O6GA 5DT6A 1IXHA 1EZPA 3SERA 3TUSA 3FGSA 2OK2A 3W15C 3FUZA 1NNPA 4THIA 2PMSA 4YB7A 2R71A 1SYHA 1QW0A 2OLBA 4F29A 1FQBA 1QVSA 2XXQA 3VXBA 2LAOA 2O68A 1POTA 1LB9A 2XX9A 4ELQA 3A3UA 2HZKA 4U22A 2OZZA 4I8CA 5I2KA 3IB2A 1NNTA 3QIMA 3IORA 3TODA 5I56B 1ANFA 4KI0E 2OWSA 3PMWA 3FD3A 3H03A 1GGGA 4X48A 2VHAA 1B3EA 1B3HA 3FV1A 3O2AA 3CR9A 2ZNUA 4BDMA 3R6UA 3PD8A 1IXCA 5I58A 4YKKA 3H6WA 1H44A 1I6AA 4NF8B 1VFEA 4YKIA 5I2NA 3G3HA 4KQPA 1MPCA 4X9TA 2RF1A 2HFBA 1ZBMA 5BWJA 3FV2A 3IX1A 2F8DA 4C1UA 1MXWA 4XKPA 2ZYMA 2UYEA 1Y3PA 1Y9UA 4R9GA 2H25A 5L8DA 2QSXA 1D3KA 1SD3A 3PUYE 4GFRA 1M5BA 4G68A 3SEWA 4F2QA 5A5XB 3DP6A 1N76A 4ZZEA 1B3FA 2HCAA 1EU8A 3SESA 3MP1A 4AB5A 1UIUA 2O1LA 1SDXA 1MS7A 1I6BA 1Q1KA 1UTBA 1R9QA 4O3BA 3TCFA 3DP8A 2O69A 4F1YA 4DZ1A 2F97A 2R9JA 2B3BA 4OHNA 4YICA 5CBRA 5K2XA 2Q88A 2RC7A 1MXXA 4XIGQ 4QHQA 1DOTA 4C1TA 1N7WA 1AIVA 3VXCA 1Y4TA 1VFDA 2F34A 2O51A 1LGBC 3FXQA 4H65A 1DTZA 2ABHA 2GHAA 5DVJA 1B05A 2DE2A 2FYIA 2YPNA 3M3LA 4KYDA 1NMUA 5FHNA 2Z23A 3PUVE 4N07A 2HQ0A 3KN8A 3HN0A 4QSDA 2P1SA 1B3LA 4HTGA 3G7WA 3EHSA 4PFYA 3A09A 3PPPA 5AE4A 3OMBA 4BDNA 2XX7A 4FEBA 3S9NC 2QS3A 4OESA 1LB8A 4IB2A 2WKYA 1IUDA 1R6ZA 1SW2A 4HCYA 4IGRA 4GXAA 4RNSA 1H76A 2Z8FA 1MY4A 4PETA 4IO3A 2HZLA 3ILUB 4GL8A 4YB6A 2ONSA 3UK4A 4L17A 1D9VA 3OO8A 4DE8A 4PFUA 2Q2AA 1JNFA 1US4A 5AA3A 3EQ1A 1EZOA 3EPEA 4TOZA 5HBCA 4MH5A 4AQ4A 3V83A 4N6PA 4DCXA 4OFOA 2E0SA 3SETA 1BLFA 3PPRA 4NF4B 4YZZA 1DMBA 4U1OA 3TTRA 4YKPA 3C35A 1GR2A 1B5IA 3K02A 4ISUA 3G3KA 3T66A 1SW1A 1LAXA 5IKBA 1B5JA 1UTHB 2DWJA 2GFEA 4XKRA 1FW0A 2XXIA 3FJ7A 4JXIA 4U1ZA 4X1BA 2Y7RA 3CSGA 4ELRA 1GTKA 3OEMA 1N3WA 5EHSA 4U21A 2UYFA 3USDA 3IO6A 1PC3A 5CMMA 3O66A 3DP4A 3LUYA 3RLFE 5I57B 1S7YA 3EHUA 4LONB 1NL5A 1ZLQA 4OFLA 3U1OA 5KCJB 1RYOA 1II5A 2QPQA 4F31B 2DSFA 1B4HA 1XHYA 3MBPA 2IA4A 4ZEKA 4KPTA 1D9YA 1S50A 1OQHA 2YLNA 3HHFA 2I4CA 4P0GA 3IO4A 1CB6A 1D4NA 5CC2A 5H8QA 1OVBA 4EUOA 3TTNA 3LSLA 1A7LA 1R9LA 5ELVA 3FATA 1RYXA 1P1WA 3RUMA 3BBRA 2HXWA 3QXMA 4QRZA 2V25A 1M5CA 3M3KA 4MFIA 3CFLA 1IITA 1OVTA 3K2DA 4KHZE 1LLSA 4FEDA 4EQBA 4BDOA 3KG2A 3MP8A 2I48A 5FTHA 3IL1B 1P1NA 2I3WA 1Y1ZA 4MF3A 5DVIA 1XOCA 3E13X 1OIBA 1ZU0A 3KFMA 1A54A 1QULA 5JTYB 1TFDA 4RA1A 4GLIA 2DVCA 5KDTA 2NOOA 5H8HB 3UGWA 3KEIA 1MY0A 3LBSA 3H06B 3LR1A 1UIVA 1B51A 3E3KA 1MXYA 3MVXA 3PUXE 2DQVA 3P7IA 4IO5A 3MP6A 4ESWA 2DE4A 4H5GA 4OTEA 3BKIB 2Y7KA 3RNNA 4BDLA 4ZEFA 1NKXA 1Z7NE 1MQHA 4EXKA 1IXGA 1MY3A 3TCHA 4NTLA 2QJEA 2R6GE 1KWHA 1FCKA 5DEXB 1LAHE 4N13A 4OFJA 4F39A 5I56A 4QSEA 3U72A 4EDPA 1MPDA 1YTVA 2RINA 3RTFB 3B6TA 3I3VA 2F7AA 4NF8A 3V5AA 3DLNA 1BIYA 1A55A 4QF9A 3OEKA 1AH5A 2F6PA 4OMBA 3T9HB 4JSOA 2GRVA 4H67A 4GD5A 3SEVA 3K1NA 4MLVA 2VD3A 4F18A 4OZ9A 5CM6A 3MVYA 4YAHX 4DXBA 3OD7A 1N7XA 3TEPA 2XXPA 1OMPA 2XXRA 1QUJA 4IY5A 1IQ7A 3IJOB 5H8NB 3KGCA 3MWBA 5A5XA 3RT8A 2ESNA 5AA2B 4K3FA 3A3CA 3FXRA 1F9BA 1MQJA 1DPPA 2H4IA 4YKJA 4Z0IA 2KLFA 3PUWE 4O3CA 1VSOA 3ZKKA 3TELA 2I6EA 3TDJA 3N94A 3TTMA 4GVOA 3D4GA 3M8UA 4R2BA 3FJGA 4WEPA 5JK4A 2YJPA 2QL3A 3TFLA 1GVCA 1PB8A 3HV1A 2PT2A 1B1HA 3H6UA 4Q30B 3UN6A 3OSQA 3MVZA 3MW0A 4NF5B 1SI0A 2I3VA 4U4XA 5CRYA 1JW5A 3OENA 4LA9A 4OENA 1AOVA 3IOWA 2THIA 2Q9TA 1SYIA 2F36A 3PMVA 4AB6A 4PFWA 3CG3A 4LZ5A 4HCWA 3C32A 3FASA 3IR1A 4TQUQ 1B2HA 2W7YA 1MPBA 2Q8JA 3B7DA 5ISUA 3H3GA 3IJXB 2G29A 2B3FA 3TKDA 1PBQA 3GXAA 3MUQA 3MJNA 1MM7A 3QK6A 4OWDA 1MM6A 2D21A 5FHOA 4KFQA 1B6HA 4IGTA 2B65A 4DLDA 5B7DA 1L5TA 4ESXA 4H0WA 4H6DA 4Q5TA 4RPOA 3C31A 4GOTA 3PGFA 4GQOA 3T93B 2DVZA 4ZE8A 1HSEA 1O64A 4LP2B 1H43A 4RPNA 5TPAB 3C34A 2Y84A 4OETA 4OYVA 4O3AA 1PB9A 1H45A 3KSXA 3N26A 1LFIA 1MQIA 1MG1A 4Z7EA 3KBRA 3ZSFA 1M5DA 3CFXA 3FVOA 5I59B 2HEUA 2Y7IA 2I49A 5M2VA 2ZYNA 3B6QA 5K2YA 3G3GA 4G2ZA 2Q2CA 2OJTA 3H6TA 1XC1A 4NF4A 4I9DA 1N0TA 4LQ5A 2XXHA 3C9HA 4ZE9A 3SEYA 3MPLA 2O84X 5DVFA 1IXIA 1NH8A 3PMXA 3PPNA 4F2OA 5IAIA 4R74A 1UTHA 3V8XB 1B5HA 3OOAA 2F5XA 4M4GA 4U4SA 1CE2A 3CRBA 4JWOA 4POWA 4TLLB 2O1MA 3VE1B 3O28A 1US5A 2DE3A 1HSJA 4BLAA 3TTLA 2PBWA 3T96B 4ZEIA 2XXXA 3N6UA 1O7TA 4PFTA 5CI5A 5I57A 4GRKA 1JEUA 2ZXTA 2QMWA 3Q25A 4R73A 5KCJA 3E9XA 3VV5A 4H5FA 3I6VA 1EH3A 1DTGA 5EYFA 1OQGA 3U94A 1J1NA 3TCGA 4Q0CA 4TLMB 1ATGA 4EF1A 3ZKLA 4JB7A 3FJMA 2RC8A 1B3GA 3TAJA 1T0KA 2AL4A 5L9SA 1EZ9A 4H8JA 2FA7A 2VP1A 1Q35A 3I5OA 3QAXA 2I4BA 4QFKA 2X7PA 3RGYA 4ZEBA 1MY1A 1S9TA 2REGA 3KOTA 4QFNA 5H8FB 3RN8A 1NH7A 2XXUA 4FORA 3U92A 3S9EA 4KYEA 1YPNA 4X1DA 2O6AA 4FAJA 3ZS6A 4NF6B 2Y7WA 3IB0A 1A40A 5I84A 3HCQA 3HO7A 1MY2A 1TFAA 4QSCA 1LBBA 2Q89A 5TP9B 3SDFA 3RQTA 1MRPA 5JTYA 3Q28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EF7 A;  3LSW A;  5H8H A;  4YMB A;  3HPI A;  2UVG A;  1IZ1 A;  4PQJ A;  4C0R A;  4RJZ A;  3ODB A;  2RC9 A;  2ZYK A;  1FTJ A;  3IOV A;  1DSN A;  1P1Q A;  4GF8 A;  3Q26 A;  4G77 A;  4G68 C;  3K6V A;  2ONR A;  3TPA A;  5DTB A;  3PD9 A;  4NWD A;  1B1X A;  4DXC A;  3UOR A;  4NE4 A;  2ZNT A;  3O29 A;  3BFT A;  3OO6 A;  3QYT A;  3UA8 A;  1B40 A;  1A99 A;  2NVU B;  3W9V A;  1POY 1;  3MQ9 A;  3U93 A;  1JW1 A;  1M5E A;  3C33 A;  4JSD A;  3IAZ A;  4YMA A;  5ITP A;  4ZDM A;  3BFU A;  2GHB A;  1TXF A;  2DYX A;  2CZL A;  3RPW A;  2VOZ A;  4XTC Q;  2V84 A;  3GBB A;  4WED A;  2HAU A;  1Y4C A;  4F1U A;  1B9J A;  1N04 A;  2I58 A;  3K6W A;  1VR5 A;  3U8Q A;  1H3D A;  3OO9 A;  4NMY A;  4QFL A;  5F1Q A;  1YCJ A;  2OBG A;  3B6W A;  4G8H A;  4RK2 A;  3FVG A;  2QRY A;  4F3B A;  4BDQ A;  3LSX A;  1MXU A;  1MH3 A;  3IB1 A;  1B0H A;  5KZT A;  1XVY A;  5H8N A;  1LFH A;  3MC2 A;  1PDA A;  5AA2 A;  2BJJ X;  1P1U A;  2D3I A;  4JBZ A;  3KSJ A;  3O6H A;  4XXU A;  3M3F A;  4LUB A;  3RT6 B;  4F3S A;  2QS1 A;  2OWT A;  3KN7 A;  3DM0 A;  1XVX A;  2IEE A;  3VDF A;  1UQW A;  3HST A;  3K1P A;  4GWO A;  4M1V A;  4IO4 A;  4OXV A;  4MBP A;  3PV0 E;  4F1V A;  3G3I A;  4EXL A;  2PYY A;  1P1O A;  4NED A;  4IO6 A;  2PX1 A;  4NF5 A;  3JV9 A;  3LC8 A;  1M5F A;  4YU0 A;  4EF2 A;  3S9L C;  1BTJ A;  1SVX B;  3VLU A;  4LQ2 A;  4P0I A;  4XKQ A;  1BKA A;  1QKB A;  1USY E;  3QUF A;  2RCB A;  1ZKB A;  3KOS A;  3T9X B;  2DXR A;  1MXZ A;  1B7H A;  3FIR A;  5AA2 D;  2I0B A;  1MQD A;  3SEU A;  5AA4 B;  4ECF A;  2ZMB A;  3ECR A;  2CMO A;  1I69 A;  1NNK A;  2UVH A;  2HAV A;  2NXO A;  2VGQ A;  2A5T B;  3MPK A;  2XXV A;  3GLB A;  2V93 A;  5L9M A;  2F7B A;  1B7Z A;  1MH4 A;  3T9V A;  4FAT A;  5CMK A;  4R6Y A;  1ZJL A;  3E4R A;  2AIX A;  2G93 A;  5B70 A;  1VE4 A;  4KYS A;  3VVE A;  3T9U A;  3S2V A;  4Q8R A;  2H98 A;  3CVG A;  4IO7 A;  5F7V A;  1FQA A;  3MZ1 A;  2UXA A;  4JWX A;  4P11 A;  1JVY A;  4ZZA A;  1MDQ A;  5HPQ A;  3K01 A;  4EQ7 A;  2H5Y A;  5TPA A;  3SEX A;  3CFZ A;  2ZNS A;  3K00 A;  3QUJ A;  5AA1 A;  1B0L A;  1LCT A;  2ONK E;  4FIM A;  1LCF A;  1SBP A;  2XXW A;  5I59 A;  2AL5 A;  5I2K B;  1XS5 A;  3H6V A;  3T22 A;  1FQD A;  4HW8 A;  1PB7 A;  3SKP A;  4QFO A;  3CI8 A;  3FZV A;  3JYR A;  4JDF A;  1BP5 A;  1SQY A;  5JEI A;  4OQO A;  4JWY A;  3N6T A;  4RK9 A;  4R75 A;  1DPE A;  2XXY A;  4LZ7 A;  5I58 B;  1WVJ A;  2M8C A;  4LVQ A;  2O7U A;  4ELO A;  3TTK A;  2ZYO A;  5I2N B;  2DP8 A;  1LAG E;  4U23 A;  2DS9 A;  2QS4 A;  1B7U A;  4YB5 A;  1OLC A;  4EQ9 A;  4I1D A;  1ZMG A;  1JVX A;  3R26 A;  4FE8 A;  2E1S A;  2P0S A;  4FJP A;  1O63 A;  4H8I A;  3PPQ A;  2O7I A;  2UVJ A;  2PVU A;  1QUK A;  2Z8E A;  4RXL A;  4PE5 B;  4G68 B;  3TZA A;  1Z7M E;  1MXV A;  2Z22 A;  4HS7 A;  1N84 A;  1JW4 A;  1B4Z A;  2DWI A;  4F22 A;  5HM4 B;  2QMX A;  4OVJ A;  3EN3 A;  1TWY A;  2V3U A;  3VVF A;  1Y1M A;  1A8F A;  2XX8 A;  5ITO A;  3ILT B;  2F6G A;  1Y3N A;  4OEV A;  2F7C A;  4BDR A;  2XD2 A;  1UTB B;  3IOT A;  3FXU A;  3TMG A;  1NFT A;  4R72 A;  3WAE A;  4ONY A;  1SW4 A;  4UA8 A;  1WDN A;  1ZIU A;  3S9M C;  1URS A;  2ALU A;  3H4Z A;  4RY1 A;  3G3F A;  2V3T A;  4NWC A;  1N3X A;  3O6I A;  2ANJ A;  2DXY A;  1GV8 A;  4OER A;  1LST A;  1FTK A;  3DEL B;  3IOU A;  3ONM A;  4QFP A;  1URG A;  5H8F A;  3UP9 A;  1ELJ A;  1I6Q A;  1Y3Q A;  3G3J A;  1URD A;  2REJ A;  4RYA A;  2P2A A;  4IY6 A;  3CG1 A;  4NF6 A;  2F78 A;  4KD5 A;  3EHT A;  3K6X A;  3OO7 A;  5TP9 A;  4F19 A;  4OEU A;  1LAF E;  4DXU A;  1R1N A;  3KN3 A;  3H7M A;  2XXT A;  2DWA A;  4DCY A;  3RTW B;  5J1D A;  4WXJ A;  1FQE A;  4ZEC A;  2H99 A;  2XD3 A;  3L6H A;  1OLA A;  3S4U A;  2AYS A;  2V3Q A;  4XKN A;  1NNF A;  4ELP A;  3AXF A;  3MAM A;  1B58 A;  5ICT A;  4KCC A;  4GL0 A;  2I0C A;  3CIJ A;  4E0X A;  2FNC A;  5TU0 A;  1IIW A;  1MDP 1;  1HSL A;  3C36 A;  4G8M A;  4DDD A;  3VVD A;  1LBC A;  3IK6 B;  3K4U A;  3L6G A;  5FTI A;  2F35 A;  3V89 B;  4H1X A;  2VD2 A;  5LOM A;  2XHD A;  3K6U A;  4FEC A;  3QSL A;  5L9O A;  2Z8D A;  3F11 A;  3O9P A;  1B46 A;  3THI A;  1ZTY A;  3N5L A;  1JET A;  2NUV A;  1FQF A;  1MQG A;  1JEV A;  3W9W A;  1FTL A;  3OSR A;  4G4P A;  3MVW A;  4MLQ A;  3R7X A;  3K1M A;  1LFG A;  4POX A;  5DEX A;  5H8S A;  5ICQ A;  4LZ8 A;  3GBA A;  4IO2 A;  4I62 A;  4KR5 A;  3KZG A;  3TYH A;  5FHM A;  4GXS B;  1QJM A;  4WKM A;  1FTM A;  3D4C A;  1Y20 A;  2DOJ A;  2RCA A;  3GZG A;  2NWJ A;  3KJ7 A;  2PT1 A;  3KJT A;  5BUU A;  2RKM A;  1SI1 A;  1YAE A;  4UAC A;  2GH9 A;  5CBS A;  3FVN A;  4GIZ A;  3JZJ A;  3WAF A;  1QKA A;  3TQL A;  4ND9 A;  1JQF A;  3VFJ A;  4E0W A;  2UVI A;  3K0V A;  1PBP A;  1FTO A;  3LSF B;  1FQC A;  2D5W A;  3UIF A;  2OCU A;  1B32 A;  5DYH A;  5CMB A;  3PU5 A;  5H8Q B;  3MZB A;  1IEJ A;  4R6K A;  5EHM A;  4F3G A;  4KCD A;  4PP0 A;  4R2F A;  2X26 A;  3VLW A;  3VLV A;  2H9B A;  1AMF A;  1RKM A;  3PPO A;  3RY3 A;  3MZ9 A;  4DIG A;  1SW5 A;  4R6H A;  3PUZ E;  4LAT A;  3Q29 A;  1P99 A;  2A5S A;  3Q27 A;  2DWH A;  3FVK A;  1PEB A;  1USY H;  5AA4 A;  4U2R A;  1WOD A;  4F3P A;  3O97 A;  1A8E A;  3HHG A;  2X7Q A;  1AL3 A;  2A5T A;  4ZED A;  3OEL A;  4R9F A;  1QUI A;  3OXN A;  2Y7P A;  2QS2 A;  4ZS9 A;  3C4M A;  3TQW A;  1XT8 A;  3CSB A;  1B52 A;  5KDT B;  4G8N A;  1TT1 A;  5CMC A;  3O6G A;  5DT6 A;  1IXH A;  1EZP A;  3SER A;  3TUS A;  3FGS A;  2OK2 A;  3W15 C;  3FUZ A;  1NNP A;  4THI A;  2PMS A;  4YB7 A;  2R71 A;  1SYH A;  1QW0 A;  2OLB A;  4F29 A;  1FQB A;  1QVS A;  2XXQ A;  3VXB A;  2LAO A;  2O68 A;  1POT A;  1LB9 A;  2XX9 A;  4ELQ A;  3A3U A;  2HZK A;  4U22 A;  2OZZ A;  4I8C A;  5I2K A;  3IB2 A;  1NNT A;  3QIM A;  3IOR A;  3TOD A;  5I56 B;  1ANF A;  4KI0 E;  2OWS A;  3PMW A;  3FD3 A;  3H03 A;  1GGG A;  4X48 A;  2VHA A;  1B3E A;  1B3H A;  3FV1 A;  3O2A A;  3CR9 A;  2ZNU A;  4BDM A;  3R6U A;  3PD8 A;  1IXC A;  5I58 A;  4YKK A;  3H6W A;  1H44 A;  1I6A A;  4NF8 B;  1VFE A;  4YKI A;  5I2N A;  3G3H A;  4KQP A;  1MPC A;  4X9T A;  2RF1 A;  2HFB A;  1ZBM A;  5BWJ A;  3FV2 A;  3IX1 A;  2F8D A;  4C1U A;  1MXW A;  4XKP A;  2ZYM A;  2UYE A;  1Y3P A;  1Y9U A;  4R9G A;  2H25 A;  5L8D A;  2QSX A;  1D3K A;  1SD3 A;  3PUY E;  4GFR A;  1M5B A;  4G68 A;  3SEW A;  4F2Q A;  5A5X B;  3DP6 A;  1N76 A;  4ZZE A;  1B3F A;  2HCA A;  1EU8 A;  3SES A;  3MP1 A;  4AB5 A;  1UIU A;  2O1L A;  1SDX A;  1MS7 A;  1I6B A;  1Q1K A;  1UTB A;  1R9Q A;  4O3B A;  3TCF A;  3DP8 A;  2O69 A;  4F1Y A;  4DZ1 A;  2F97 A;  2R9J A;  2B3B A;  4OHN A;  4YIC A;  5CBR A;  5K2X A;  2Q88 A;  2RC7 A;  1MXX A;  4XIG Q;  4QHQ A;  1DOT A;  4C1T A;  1N7W A;  1AIV A;  3VXC A;  1Y4T A;  1VFD A;  2F34 A;  2O51 A;  1LGB C;  3FXQ A;  4H65 A;  1DTZ A;  2ABH A;  2GHA A;  5DVJ A;  1B05 A;  2DE2 A;  2FYI A;  2YPN A;  3M3L A;  4KYD A;  1NMU A;  5FHN A;  2Z23 A;  3PUV E;  4N07 A;  2HQ0 A;  3KN8 A;  3HN0 A;  4QSD A;  2P1S A;  1B3L A;  4HTG A;  3G7W A;  3EHS A;  4PFY A;  3A09 A;  3PPP A;  5AE4 A;  3OMB A;  4BDN A;  2XX7 A;  4FEB A;  3S9N C;  2QS3 A;  4OES A;  1LB8 A;  4IB2 A;  2WKY A;  1IUD A;  1R6Z A;  1SW2 A;  4HCY A;  4IGR A;  4GXA A;  4RNS A;  1H76 A;  2Z8F A;  1MY4 A;  4PET A;  4IO3 A;  2HZL A;  3ILU B;  4GL8 A;  4YB6 A;  2ONS A;  3UK4 A;  4L17 A;  1D9V A;  3OO8 A;  4DE8 A;  4PFU A;  2Q2A A;  1JNF A;  1US4 A;  5AA3 A;  3EQ1 A;  1EZO A;  3EPE A;  4TOZ A;  5HBC A;  4MH5 A;  4AQ4 A;  3V83 A;  4N6P A;  4DCX A;  4OFO A;  2E0S A;  3SET A;  1BLF A;  3PPR A;  4NF4 B;  4YZZ A;  1DMB A;  4U1O A;  3TTR A;  4YKP A;  3C35 A;  1GR2 A;  1B5I A;  3K02 A;  4ISU A;  3G3K A;  3T66 A;  1SW1 A;  1LAX A;  5IKB A;  1B5J A;  1UTH B;  2DWJ A;  2GFE A;  4XKR A;  1FW0 A;  2XXI A;  3FJ7 A;  4JXI A;  4U1Z A;  4X1B A;  2Y7R A;  3CSG A;  4ELR A;  1GTK A;  3OEM A;  1N3W A;  5EHS A;  4U21 A;  2UYF A;  3USD A;  3IO6 A;  1PC3 A;  5CMM A;  3O66 A;  3DP4 A;  3LUY A;  3RLF E;  5I57 B;  1S7Y A;  3EHU A;  4LON B;  1NL5 A;  1ZLQ A;  4OFL A;  3U1O A;  5KCJ B;  1RYO A;  1II5 A;  2QPQ A;  4F31 B;  2DSF A;  1B4H A;  1XHY A;  3MBP A;  2IA4 A;  4ZEK A;  4KPT A;  1D9Y A;  1S50 A;  1OQH A;  2YLN A;  3HHF A;  2I4C A;  4P0G A;  3IO4 A;  1CB6 A;  1D4N A;  5CC2 A;  5H8Q A;  1OVB A;  4EUO A;  3TTN A;  3LSL A;  1A7L A;  1R9L A;  5ELV A;  3FAT A;  1RYX A;  1P1W A;  3RUM A;  3BBR A;  2HXW A;  3QXM A;  4QRZ A;  2V25 A;  1M5C A;  3M3K A;  4MFI A;  3CFL A;  1IIT A;  1OVT A;  3K2D A;  4KHZ E;  1LLS A;  4FED A;  4EQB A;  4BDO A;  3KG2 A;  3MP8 A;  2I48 A;  5FTH A;  3IL1 B;  1P1N A;  2I3W A;  1Y1Z A;  4MF3 A;  5DVI A;  1XOC A;  3E13 X;  1OIB A;  1ZU0 A;  3KFM A;  1A54 A;  1QUL A;  5JTY B;  1TFD A;  4RA1 A;  4GLI A;  2DVC A;  5KDT A;  2NOO A;  5H8H B;  3UGW A;  3KEI A;  1MY0 A;  3LBS A;  3H06 B;  3LR1 A;  1UIV A;  1B51 A;  3E3K A;  1MXY A;  3MVX A;  3PUX E;  2DQV A;  3P7I A;  4IO5 A;  3MP6 A;  4ESW A;  2DE4 A;  4H5G A;  4OTE A;  3BKI B;  2Y7K A;  3RNN A;  4BDL A;  4ZEF A;  1NKX A;  1Z7N E;  1MQH A;  4EXK A;  1IXG A;  1MY3 A;  3TCH A;  4NTL A;  2QJE A;  2R6G E;  1KWH A;  1FCK A;  5DEX B;  1LAH E;  4N13 A;  4OFJ A;  4F39 A;  5I56 A;  4QSE A;  3U72 A;  4EDP A;  1MPD A;  1YTV A;  2RIN A;  3RTF B;  3B6T A;  3I3V A;  2F7A A;  4NF8 A;  3V5A A;  3DLN A;  1BIY A;  1A55 A;  4QF9 A;  3OEK A;  1AH5 A;  2F6P A;  4OMB A;  3T9H B;  4JSO A;  2GRV A;  4H67 A;  4GD5 A;  3SEV A;  3K1N A;  4MLV A;  2VD3 A;  4F18 A;  4OZ9 A;  5CM6 A;  3MVY A;  4YAH X;  4DXB A;  3OD7 A;  1N7X A;  3TEP A;  2XXP A;  1OMP A;  2XXR A;  1QUJ A;  4IY5 A;  1IQ7 A;  3IJO B;  5H8N B;  3KGC A;  3MWB A;  5A5X A;  3RT8 A;  2ESN A;  5AA2 B;  4K3F A;  3A3C A;  3FXR A;  1F9B A;  1MQJ A;  1DPP A;  2H4I A;  4YKJ A;  4Z0I A;  2KLF A;  3PUW E;  4O3C A;  1VSO A;  3ZKK A;  3TEL A;  2I6E A;  3TDJ A;  3N94 A;  3TTM A;  4GVO A;  3D4G A;  3M8U A;  4R2B A;  3FJG A;  4WEP A;  5JK4 A;  2YJP A;  2QL3 A;  3TFL A;  1GVC A;  1PB8 A;  3HV1 A;  2PT2 A;  1B1H A;  3H6U A;  4Q30 B;  3UN6 A;  3OSQ A;  3MVZ A;  3MW0 A;  4NF5 B;  1SI0 A;  2I3V A;  4U4X A;  5CRY A;  1JW5 A;  3OEN A;  4LA9 A;  4OEN A;  1AOV A;  3IOW A;  2THI A;  2Q9T A;  1SYI A;  2F36 A;  3PMV A;  4AB6 A;  4PFW A;  3CG3 A;  4LZ5 A;  4HCW A;  3C32 A;  3FAS A;  3IR1 A;  4TQU Q;  1B2H A;  2W7Y A;  1MPB A;  2Q8J A;  3B7D A;  5ISU A;  3H3G A;  3IJX B;  2G29 A;  2B3F A;  3TKD A;  1PBQ A;  3GXA A;  3MUQ A;  3MJN A;  1MM7 A;  3QK6 A;  4OWD A;  1MM6 A;  2D21 A;  5FHO A;  4KFQ A;  1B6H A;  4IGT A;  2B65 A;  4DLD A;  5B7D A;  1L5T A;  4ESX A;  4H0W A;  4H6D A;  4Q5T A;  4RPO A;  3C31 A;  4GOT A;  3PGF A;  4GQO A;  3T93 B;  2DVZ A;  4ZE8 A;  1HSE A;  1O64 A;  4LP2 B;  1H43 A;  4RPN A;  5TPA B;  3C34 A;  2Y84 A;  4OET A;  4OYV A;  4O3A A;  1PB9 A;  1H45 A;  3KSX A;  3N26 A;  1LFI A;  1MQI A;  1MG1 A;  4Z7E A;  3KBR A;  3ZSF A;  1M5D A;  3CFX A;  3FVO A;  5I59 B;  2HEU A;  2Y7I A;  2I49 A;  5M2V A;  2ZYN A;  3B6Q A;  5K2Y A;  3G3G A;  4G2Z A;  2Q2C A;  2OJT A;  3H6T A;  1XC1 A;  4NF4 A;  4I9D A;  1N0T A;  4LQ5 A;  2XXH A;  3C9H A;  4ZE9 A;  3SEY A;  3MPL A;  2O84 X;  5DVF A;  1IXI A;  1NH8 A;  3PMX A;  3PPN A;  4F2O A;  5IAI A;  4R74 A;  1UTH A;  3V8X B;  1B5H A;  3OOA A;  2F5X A;  4M4G A;  4U4S A;  1CE2 A;  3CRB A;  4JWO A;  4POW A;  4TLL B;  2O1M A;  3VE1 B;  3O28 A;  1US5 A;  2DE3 A;  1HSJ A;  4BLA A;  3TTL A;  2PBW A;  3T96 B;  4ZEI A;  2XXX A;  3N6U A;  1O7T A;  4PFT A;  5CI5 A;  5I57 A;  4GRK A;  1JEU A;  2ZXT A;  2QMW A;  3Q25 A;  4R73 A;  5KCJ A;  3E9X A;  3VV5 A;  4H5F A;  3I6V A;  1EH3 A;  1DTG A;  5EYF A;  1OQG A;  3U94 A;  1J1N A;  3TCG A;  4Q0C A;  4TLM B;  1ATG A;  4EF1 A;  3ZKL A;  4JB7 A;  3FJM A;  2RC8 A;  1B3G A;  3TAJ A;  1T0K A;  2AL4 A;  5L9S A;  1EZ9 A;  4H8J A;  2FA7 A;  2VP1 A;  1Q35 A;  3I5O A;  3QAX A;  2I4B A;  4QFK A;  2X7P A;  3RGY A;  4ZEB A;  1MY1 A;  1S9T A;  2REG A;  3KOT A;  4QFN A;  5H8F B;  3RN8 A;  1NH7 A;  2XXU A;  4FOR A;  3U92 A;  3S9E A;  4KYE A;  1YPN A;  4X1D A;  2O6A A;  4FAJ A;  3ZS6 A;  4NF6 B;  2Y7W A;  3IB0 A;  1A40 A;  5I84 A;  3HCQ A;  3HO7 A;  1MY2 A;  1TFA A;  4QSC A;  1LBB A;  2Q89 A;  5TP9 B;  3SDF A;  3RQT A;  1MRP A;  5JTY A;  3Q28 A; 
#chains in the Genus database with same CATH topology
 3EF7 A;  3LSW A;  4PDD A;  5H8H A;  2MKZ A;  4OA4 A;  4YMB A;  1KZ8 A;  3HPI A;  4I40 A;  2UVG A;  1IZ1 A;  4PQJ A;  4N6D A;  4C0R A;  4RJZ A;  3ODB A;  2RC9 A;  2ZYK A;  1FTJ A;  3IOV A;  1DSN A;  1P1Q A;  4GF8 A;  2ZZV A;  3Q26 A;  4G77 A;  4G68 C;  3K6V A;  2ONR A;  3TPA A;  5DTB A;  3PD9 A;  4NWD A;  1B1X A;  4DXC A;  3UOR A;  4NE4 A;  2ZNT A;  3LV0 A;  2PFZ A;  3O29 A;  3BFT A;  4MCO A;  3OO6 A;  3QYT A;  2WYK A;  3UA8 A;  1B40 A;  1A99 A;  4GX3 A;  2NVU B;  4G61 A;  5ESY A;  1IMD A;  3W9V A;  1POY 1;  3MQ9 A;  5F24 A;  3U93 A;  1JW1 A;  1M5E A;  3C33 A;  4JSD A;  2Q74 A;  3IAZ A;  4YMA A;  5ITP A;  4ZDM A;  3BFU A;  2GHB A;  1TXF A;  2DYX A;  2CZL A;  3B8B A;  3RPW A;  2VOZ A;  4XTC Q;  2V84 A;  3GBB A;  4WED A;  4OVS A;  2FVZ A;  1Y4C A;  2HAU A;  4F1U A;  1FPK A;  1B9J A;  4PF6 A;  1N04 A;  2I58 A;  3K6W A;  3BIG A;  4PAI A;  1VR5 A;  3U8Q A;  1H3D A;  3OO9 A;  4NMY A;  4QFL A;  4DI4 B;  5F1Q A;  1YCJ A;  4NF0 A;  2OBG A;  3B6W A;  4G8H A;  4RK2 A;  3FVG A;  2QRY A;  4F3B A;  4BDQ A;  3LSX A;  1MXU A;  1MH3 A;  3IB1 A;  3ROJ A;  1B0H A;  5KZT A;  1XVY A;  1FBF A;  5H8N A;  1LFH A;  3MC2 A;  4XFE A;  1PDA A;  3T1B A;  5AA2 A;  2BJJ X;  1P1U A;  2D3I A;  4JBZ A;  3KSJ A;  4X8R A;  3O6H A;  4XXU A;  3M3F A;  4LUB A;  3RT6 B;  2QS1 A;  2OWT A;  4F3S A;  3KN7 A;  3DM0 A;  1XVX A;  4HE2 A;  2IEE A;  4NQ8 A;  3VDF A;  1UQW A;  3HST A;  3K1P A;  4GWO A;  4M1V A;  4IO4 A;  4OXV A;  4MBP A;  3PV0 E;  4F1V A;  2P3N A;  1RDZ A;  3G3I A;  4EXL A;  2PYY A;  1P1O A;  4NED A;  2B4L A;  4IO6 A;  2PX1 A;  4NF5 A;  3JV9 A;  1FBD A;  5IZ3 A;  1DK4 A;  3KC1 A;  3LC8 A;  1M5F A;  4YU0 A;  4EF2 A;  3S9L C;  1BTJ A;  1SVX B;  5LTC A;  3MST A;  3VLU A;  4LQ2 A;  4P0I A;  4XKQ A;  1BKA A;  1QKB A;  1USY E;  3QUF A;  2RCB A;  1ZKB A;  3KOS A;  3T9X B;  2DXR A;  1MXZ A;  2PFY A;  1B7H A;  3FIR A;  5AA2 D;  2I0B A;  1MQD A;  3SEU A;  5AA4 B;  4ECF A;  2ZMB A;  2B4M A;  4NAP A;  1K9Z A;  3ECR A;  2CMO A;  4MMP A;  1I69 A;  1IMF A;  1NNK A;  2UVH A;  2HAV A;  2NXO A;  2VGQ A;  2A5T B;  3MPK A;  2XXV A;  3GLB A;  2V93 A;  5L9M A;  2F7B A;  4O94 A;  4PDH A;  1B7Z A;  1MH4 A;  3T9V A;  1FBG A;  4P56 A;  2R8T A;  4FAT A;  5CMK A;  2FBP A;  4R6Y A;  1ZJL A;  3E4R A;  2AIX A;  2G93 A;  5B70 A;  1VE4 A;  4KYS A;  3VVE A;  1YZ0 A;  3T9U A;  4LN5 A;  3S2V A;  4Q8R A;  1FBP A;  2H98 A;  3CVG A;  4IO7 A;  5F7V A;  1FQA A;  3MZ1 A;  2UXA A;  4JWX A;  4P11 A;  1JVY A;  4ZZA A;  1MDQ A;  5HPQ A;  3K01 A;  4EQ7 A;  2H5Y A;  2F3D A;  5TPA A;  3SEX A;  3CFZ A;  2ZNS A;  3K00 A;  3QUJ A;  4MEV A;  5AA1 A;  1B0L A;  1LCT A;  2ONK E;  4FIM A;  1LCF A;  5EYH A;  1SBP A;  2XXW A;  5I59 A;  2JJK A;  2AL5 A;  5I2K B;  1XS5 A;  2PCR A;  3H6V A;  1LBY A;  3T22 A;  1FQD A;  4HW8 A;  1PB7 A;  4QFO A;  3SKP A;  3CI8 A;  3FZV A;  3JYR A;  4JDF A;  1BP5 A;  1SQY A;  5JEI A;  4OQO A;  4JWY A;  4N8Y A;  1RDX A;  3N6T A;  4N81 A;  4RK9 A;  4R75 A;  2WYP A;  1DPE A;  2XXY A;  1Q9D A;  4LZ7 A;  5I58 B;  1WVJ A;  2BJI A;  2M8C A;  4LVQ A;  2O7U A;  3E79 A;  4ELO A;  3TTK A;  2ZYO A;  5I2N B;  2QVR A;  2DP8 A;  1LAG E;  4U23 A;  2DS9 A;  2QS4 A;  1B7U A;  4YB5 A;  1OLC A;  4EQ9 A;  4I1D A;  1ZMG A;  1JVX A;  5FBP A;  3R26 A;  4FE8 A;  2E1S A;  2P0S A;  1FBC A;  4FJP A;  4NX1 A;  1O63 A;  4H8I A;  3PPQ A;  2O7I A;  4MJO A;  2UVJ A;  2PVU A;  1QUK A;  2Z8E A;  4RXL A;  4PE5 B;  4G68 B;  3TZA A;  1Z7M E;  4GBW A;  1MXV A;  2Z22 A;  4HS7 A;  2WX9 A;  1N84 A;  1JW4 A;  1B4Z A;  2DWI A;  3T0J A;  4F22 A;  5HM4 B;  2QMX A;  4OVJ A;  3EN3 A;  1NUW A;  1TWY A;  2V3U A;  3VVF A;  1Y1M A;  1A8F A;  2XX8 A;  5ITO A;  3ILT B;  2F6G A;  2HPG A;  1Y3N A;  4OEV A;  2F7C A;  4BDR A;  2XD2 A;  1UTB B;  3IOT A;  3FXU A;  3TMG A;  1NFT A;  2Y5K A;  4R72 A;  3WAE A;  4ONY A;  1SW4 A;  4UA8 A;  1WDN A;  1ZIU A;  3S9M C;  1URS A;  5ET6 A;  2ALU A;  1QGX A;  3H4Z A;  4RY1 A;  3G3F A;  2V3T A;  4NWC A;  1N3X A;  3O6I A;  2ANJ A;  4NHB A;  2DXY A;  1SPI A;  1GV8 A;  4MIJ A;  4OER A;  1LST A;  1FTK A;  3DEL B;  3IOU A;  3ONM A;  4QFP A;  1URG A;  5H8F A;  3UP9 A;  1ELJ A;  1I6Q A;  1Y3Q A;  4PFI A;  4N91 A;  3G3J A;  4OAN A;  1URD A;  2REJ A;  4RYA A;  2P2A A;  4IY6 A;  5T3J A;  1FTA A;  3RPL A;  3CG1 A;  4NF6 A;  2F78 A;  4KD5 A;  3EHT A;  3ISP A;  3K6X A;  3OO7 A;  5TP9 A;  4F19 A;  4MNP A;  4OEU A;  1LAF E;  2WBD A;  4DXU A;  1R1N A;  3KN3 A;  3H7M A;  2XXT A;  2DWA A;  4DCY A;  3RTW B;  5J1D A;  4WXJ A;  1FQE A;  4ZEC A;  2H99 A;  5IZZ A;  2XD3 A;  3L6H A;  5EQ9 A;  1OLA A;  3S4U A;  2AYS A;  2V3Q A;  3D1R A;  4XKN A;  1NNF A;  1LBX A;  4ELP A;  2L5V A;  3AXF A;  3MAM A;  4NN3 A;  1B58 A;  5ICT A;  4KCC A;  4GL0 A;  2I0C A;  3CIJ A;  4E0X A;  2FNC A;  5TU0 A;  1IIW A;  1LBW A;  1MDP 1;  1HSL A;  3GYY A;  3C36 A;  4G8M A;  4DDD A;  3VVD A;  1LBC A;  2CZI A;  3IK6 B;  3K4U A;  3L6G A;  2VPN A;  5FTI A;  2F35 A;  3V89 B;  4H1X A;  2VD2 A;  5LOM A;  4H46 A;  2XHD A;  4OVR A;  3K6U A;  4FEC A;  3QSL A;  5L9O A;  2Z8D A;  1XI6 A;  3F11 A;  3O9P A;  1B46 A;  4O7M A;  3THI A;  1YXI A;  1ZTY A;  3N5L A;  1JET A;  2NUV A;  1FQF A;  1MQG A;  1JEV A;  4FBP A;  3W9W A;  1FTL A;  3OSR A;  4G4P A;  1D9Q A;  3MVW A;  4MLQ A;  3R7X A;  3K1M A;  4XF5 A;  5J16 A;  1LFG A;  4POX A;  5DEX A;  1K9Y A;  5H8S A;  5ICQ A;  3CHG A;  4LZ8 A;  3GBA A;  4IO2 A;  4I62 A;  4KR5 A;  3KZG A;  3TYH A;  5FHM A;  4GXS B;  1QJM A;  4WKM A;  2F3B A;  1FTM A;  3D4C A;  1Y20 A;  2DOJ A;  2RCA A;  3GZG A;  1KA1 A;  2NWJ A;  3KJ7 A;  2PT1 A;  3KJT A;  5BUU A;  2RKM A;  1SI1 A;  1YAE A;  4UAC A;  2GH9 A;  5CBS A;  3FVN A;  4GIZ A;  3JZJ A;  3WAF A;  1QKA A;  3TQL A;  4ND9 A;  1JQF A;  1LEV A;  3VFJ A;  4JVC A;  4E0W A;  2UVI A;  3K0V A;  1PBP A;  1FTO A;  3LSF B;  4OVQ A;  1FQC A;  2D5W A;  3UIF A;  2OCU A;  1B32 A;  5DYH A;  5CMB A;  3PU5 A;  5H8Q B;  3MZB A;  4XEQ A;  1IEJ A;  4R6K A;  5EHM A;  4F3G A;  4KCD A;  4PP0 A;  4R2F A;  2X26 A;  3VLW A;  3VLV A;  1NV2 A;  3PTY A;  2H9B A;  1AMF A;  1RKM A;  3PPO A;  3RY3 A;  1EYK A;  4X04 A;  3MZ9 A;  4DIG A;  2FIE A;  1SW5 A;  4R6H A;  3PUZ E;  1NV5 A;  4LAT A;  3Q29 A;  1P99 A;  2A5S A;  4MNI A;  3Q27 A;  2DWH A;  3FVK A;  1PEB A;  1USY H;  5AA4 A;  4U2R A;  2OWZ A;  1WOD A;  4F3P A;  3O97 A;  1A8E A;  3HHG A;  2X7Q A;  1AL3 A;  2A5T A;  4ZED A;  3OEL A;  4R9F A;  4I3Y A;  1QUI A;  3OXN A;  2Y7P A;  2QS2 A;  1JP4 A;  4ZS9 A;  3C4M A;  3TQW A;  1XT8 A;  3CSB A;  1FBH A;  1B52 A;  5KDT B;  4G8N A;  5I3S A;  1TT1 A;  3O6G A;  5CMC A;  5I7I A;  5DT6 A;  1IXH A;  5I5P A;  1EZP A;  3SER A;  3TUS A;  3FGS A;  2OK2 A;  3W15 C;  3FUZ A;  1NNP A;  4THI A;  2PMS A;  4YB7 A;  1LBZ A;  2R71 A;  1SYH A;  1QW0 A;  2OLB A;  4F29 A;  1FQB A;  1QVS A;  2XWK A;  2XXQ A;  3VXB A;  2LAO A;  4I3E A;  2O68 A;  1POT A;  1LB9 A;  2XX9 A;  3LUZ A;  4ELQ A;  3A3U A;  2HZK A;  4U22 A;  2OZZ A;  4I8C A;  5I2K A;  3IB2 A;  1NNT A;  3QIM A;  3IOR A;  3TOD A;  5I56 B;  1ANF A;  4KI0 E;  2OWS A;  3PMW A;  3FD3 A;  3FXB A;  3H03 A;  1GGG A;  4X48 A;  2VHA A;  1B3E A;  1B3H A;  3FV1 A;  3O2A A;  3CR9 A;  2ZNU A;  4BDM A;  3R6U A;  3PD8 A;  1IXC A;  5I58 A;  4YKK A;  3H6W A;  1H44 A;  1I6A A;  4NF8 B;  1VFE A;  4YKI A;  5I2N A;  3G3H A;  4KQP A;  1MPC A;  4N8G A;  4X9T A;  2RF1 A;  4PGN A;  2HFB A;  1ZBM A;  5BWJ A;  3FV2 A;  3IX1 A;  1NV7 A;  2F8D A;  4C1U A;  1MXW A;  1IMB A;  4XKP A;  2ZYM A;  2UYE A;  1Y3P A;  1Y9U A;  1FJ9 A;  4R9G A;  2H25 A;  4O8M A;  1NUZ A;  1FBE A;  5L8D A;  2QSX A;  5IM2 A;  1D3K A;  1SD3 A;  4N17 A;  3PUY E;  4GFR A;  2V4C A;  1M5B A;  4G68 A;  3SEW A;  4F2Q A;  5A5X B;  3DP6 A;  1N76 A;  4ZZE A;  1B3F A;  2HCA A;  1EU8 A;  3SES A;  3MP1 A;  4AB5 A;  4PBQ A;  1UIU A;  2O1L A;  1SDX A;  1FSA A;  1MS7 A;  1I6B A;  1Q1K A;  1UTB A;  1R9Q A;  4O3B A;  3TCF A;  3DP8 A;  1IMC A;  4PE3 A;  2O69 A;  4F1Y A;  4GWZ A;  4DZ1 A;  2F97 A;  2R9J A;  2B3B A;  4OHN A;  4YIC A;  5CBR A;  5K2X A;  2Q88 A;  2RC7 A;  1MXX A;  4XIG Q;  4QHQ A;  1DOT A;  3QMF A;  1IMA A;  4C1T A;  1N7W A;  1FPJ A;  1AIV A;  3VXC A;  1Y4T A;  1VFD A;  2F34 A;  2O51 A;  1LGB C;  3FXQ A;  4H65 A;  1DTZ A;  2ABH A;  2GHA A;  1INP A;  5DVJ A;  1B05 A;  2DE2 A;  2FYI A;  4AS5 A;  2YPN A;  3M3L A;  4KYD A;  1NMU A;  5FHN A;  2Z23 A;  1YYZ A;  3PUV E;  4N07 A;  2HQ0 A;  1DCU A;  3KN8 A;  4QBA A;  4UAB A;  3HN0 A;  4QSD A;  2P1S A;  1B3L A;  4HTG A;  3G7W A;  3EHS A;  4PFY A;  1FPE A;  3A09 A;  3PPP A;  4P1L A;  5AE4 A;  3OMB A;  4BDN A;  3KC0 A;  2XX7 A;  4FEB A;  1NV1 A;  3S9N C;  4PTK A;  2QS3 A;  4OES A;  4GWX A;  1LB8 A;  4IB2 A;  4P3L A;  1EYJ A;  2WKY A;  1IUD A;  1R6Z A;  1SW2 A;  4HCY A;  4IGR A;  4GXA A;  4RNS A;  1H76 A;  2Z8F A;  1MY4 A;  4PET A;  4DI3 D;  4IO3 A;  2HZL A;  3ILU B;  4GL8 A;  4YB6 A;  2ONS A;  5LDZ A;  3UK4 A;  4L17 A;  1D9V A;  3OO8 A;  1NI9 A;  5ET5 A;  4DE8 A;  4PFU A;  2Q2A A;  1JNF A;  2XWO A;  1US4 A;  5AA3 A;  3EQ1 A;  1EZO A;  1CNQ A;  3EPE A;  4TOZ A;  5HBC A;  4MH5 A;  4AQ4 A;  3V83 A;  4N6P A;  4DCX A;  4OFO A;  2E0S A;  4PF8 A;  3SET A;  2CEY A;  1BLF A;  2CEX A;  3MYU A;  3PPR A;  4NF4 B;  4YZZ A;  1DMB A;  4U1O A;  4H45 A;  3TTR A;  4YKP A;  3C35 A;  1GR2 A;  1B5I A;  3K02 A;  4ISU A;  4P9K A;  4IR8 A;  3G3K A;  3T66 A;  1SW1 A;  1LAX A;  5IKB A;  1B5J A;  1UTH B;  2DWJ A;  2GFE A;  4XKR A;  1FW0 A;  2XXI A;  3FJ7 A;  4JXI A;  4U1Z A;  4X1B A;  2Y7R A;  3CSG A;  4ELR A;  5IGA A;  1GTK A;  3B50 A;  3OEM A;  1N3W A;  5EHS A;  4U21 A;  2UYF A;  4GWW A;  3USD A;  4P1E A;  1G0I A;  3IO6 A;  1PC3 A;  5CMM A;  3O66 A;  3DP4 A;  3LUY A;  3RLF E;  5I57 B;  1S7Y A;  1G0H A;  3EHU A;  4PCD A;  3FBP A;  4LON B;  4KXP A;  4PAF A;  1NL5 A;  1ZLQ A;  4OFL A;  3U1O A;  5KCJ B;  1RYO A;  1II5 A;  2QPQ A;  4F31 B;  2QVV A;  3RYD A;  2DSF A;  1B4H A;  1XHY A;  3IFA A;  3MBP A;  2IA4 A;  4ZEK A;  4KPT A;  2XWV A;  1D9Y A;  1S50 A;  1OQH A;  2YLN A;  3HHF A;  4PC9 A;  2I4C A;  4P0G A;  3IO4 A;  1CB6 A;  1D4N A;  5CC2 A;  5H8Q A;  1OVB A;  4GX4 A;  1FPI A;  4EUO A;  3TTN A;  3LSL A;  1A7L A;  1R9L A;  5ELV A;  2P3V A;  3FAT A;  1RYX A;  1P1W A;  3RUM A;  1NUY A;  3BBR A;  2HXW A;  3QXM A;  4QRZ A;  2V25 A;  1M5C A;  3M3K A;  4MFI A;  3CFL A;  1IIT A;  1OVT A;  3K2D A;  2Q8M A;  4KHZ E;  2KR0 A;  1LLS A;  4FED A;  4PGP A;  4EQB A;  4BDO A;  4GX6 A;  3KG2 A;  3MP8 A;  2I48 A;  5FTH A;  3IL1 B;  4PFR A;  1P1N A;  2I3W A;  1Y1Z A;  4MF3 A;  5DVI A;  1XOC A;  3E13 X;  1OIB A;  1ZU0 A;  3KFM A;  4AS4 A;  1A54 A;  1QUL A;  5JTY B;  5ET8 A;  1TFD A;  4RA1 A;  4GLI A;  2DVC A;  5KDT A;  2NOO A;  5H8H B;  3UGW A;  3KEI A;  1MY0 A;  3LBS A;  3H06 B;  3LR1 A;  1UIV A;  1B51 A;  1FPL A;  3E3K A;  1MXY A;  3MVX A;  4OVT A;  3PUX E;  2DQV A;  3P7I A;  4IO5 A;  3MP6 A;  2CZK A;  4ESW A;  2DE4 A;  4H5G A;  4OTE A;  3BKI B;  2Y7K A;  3RNN A;  4BDL A;  4ZEF A;  1NKX A;  1AWB A;  1Z7N E;  1MQH A;  1LBV A;  4MHF A;  4EXK A;  4NG7 A;  1IXG A;  1MY3 A;  3TCH A;  1FPD A;  4NTL A;  2QJE A;  3HFU A;  2R6G E;  1KWH A;  1FCK A;  5DEX B;  1LAH E;  4N13 A;  4OFJ A;  5EQ7 A;  4F39 A;  3KBZ A;  5I56 A;  1IME A;  4QSE A;  3U72 A;  4EDP A;  1MPD A;  1YTV A;  2RIN A;  4N15 A;  3RTF B;  1FRP A;  3B6T A;  4N4U A;  4GBV A;  1FPG A;  5EQ8 A;  3I3V A;  4QXD A;  2F7A A;  4NF8 A;  3V5A A;  3DLN A;  1BIY A;  1A55 A;  2QVU A;  4QF9 A;  5IZ1 A;  3OEK A;  1AH5 A;  2F6P A;  4OMB A;  3T9H B;  4N6K A;  4JSO A;  2GRV A;  2HXR A;  1NV3 A;  4H67 A;  4GD5 A;  3SEV A;  3K1N A;  4MLV A;  2VD3 A;  4F18 A;  4OZ9 A;  5CM6 A;  2ZZX A;  3MVY A;  4YAH X;  4DXB A;  1NV4 A;  3OD7 A;  1N7X A;  3TEP A;  2XXP A;  1NUX A;  1OMP A;  2XXR A;  1QUJ A;  4IY5 A;  1IQ7 A;  3IJO B;  4JVD A;  5H8N B;  3KGC A;  3MWB A;  5A5X A;  3RT8 A;  2ESN A;  5AA2 B;  2XA5 A;  4K3F A;  3A3C A;  3FXR A;  1F9B A;  1MQJ A;  1DPP A;  2H4I A;  4YKJ A;  4Z0I A;  2KLF A;  3PUW E;  4O3C A;  1VSO A;  5DW8 A;  3ZKK A;  3TEL A;  2I6E A;  3TDJ A;  2ZZW A;  3N94 A;  3TTM A;  4GVO A;  3D4G A;  3M8U A;  3A29 A;  4R2B A;  3FJG A;  4WEP A;  5JK4 A;  2YJP A;  2QL3 A;  3TFL A;  1GVC A;  1PB8 A;  3HV1 A;  1DBZ A;  2PT2 A;  1B1H A;  3SZP A;  2XWI A;  3H6U A;  4Q30 B;  1NV0 A;  3UN6 A;  3OSQ A;  3MVZ A;  3MW0 A;  4NF5 B;  2HHM A;  1SI0 A;  1RDY A;  2I3V A;  4U4X A;  5IZ3 B;  5CRY A;  1JW5 A;  3OEN A;  4LA9 A;  4OEN A;  1AOV A;  2OX3 A;  3IOW A;  2THI A;  2Q9T A;  1SYI A;  2KQZ A;  2F36 A;  3PMV A;  4AB6 A;  4PFW A;  4LZ5 A;  2DDK A;  3CG3 A;  4HCW A;  3C32 A;  3FAS A;  3IR1 A;  4TQU Q;  1B2H A;  5EYG A;  2W7Y A;  1MPB A;  2Q8J A;  3B7D A;  5ISU A;  3H3G A;  3IJX B;  1NV6 A;  2GQ1 A;  4PAK A;  2G29 A;  2B3F A;  3TKD A;  3BIH A;  1PBQ A;  2FHY A;  3GXA A;  3MUQ A;  4PBH A;  1EYI A;  3MJN A;  1MM7 A;  2WEF A;  3QK6 A;  4OWD A;  1MM6 A;  2D21 A;  5FHO A;  4KFQ A;  1B6H A;  4IGT A;  2B65 A;  4HE0 A;  4DLD A;  5B7D A;  1L5T A;  4ESX A;  4H0W A;  4H6D A;  4Q5T A;  4RPO A;  4MX6 A;  3C31 A;  4GOT A;  3PGF A;  4GQO A;  3T93 B;  2DVZ A;  4ZE8 A;  1HSE A;  1O64 A;  4LP2 B;  1H43 A;  4RPN A;  5A5L A;  5TPA B;  3C34 A;  2Y84 A;  4OET A;  4OYV A;  4O3A A;  1PB9 A;  1H45 A;  3KSX A;  3N26 A;  1LFI A;  1MQI A;  4JVI A;  1MG1 A;  4Z7E A;  3KBR A;  3ZSF A;  1M5D A;  3CFX A;  4GWU A;  1FJ6 A;  3FVO A;  5I59 B;  2HEU A;  2Y7I A;  2I49 A;  5M2V A;  2ZYN A;  3B6Q A;  5K2Y A;  4NGU A;  3EKI A;  3G3G A;  4G2Z A;  2Q2C A;  2OJT A;  3H6T A;  1XC1 A;  4MAG A;  4NF4 A;  1FPF A;  4I9D A;  1N0T A;  4LQ5 A;  2XXH A;  3C9H A;  2QFL A;  4ZE9 A;  3SEY A;  3MPL A;  2O84 X;  5DVF A;  1IXI A;  1NH8 A;  2CZH A;  3PMX A;  3PPN A;  4F2O A;  5IAI A;  4R74 A;  1UTH A;  3V8X B;  1B5H A;  3OOA A;  2F5X A;  4M4G A;  4U4S A;  4P8B A;  1CE2 A;  1VDW A;  5EQA A;  3CRB A;  4JWO A;  4POW A;  4TLL B;  4P47 A;  2O1M A;  1BK4 A;  3VE1 B;  3O28 A;  1US5 A;  2DE3 A;  1HSJ A;  2WBB A;  4BLA A;  3TTL A;  3U65 A;  2PBW A;  3T96 B;  4ZEI A;  2XXX A;  3N6U A;  1O7T A;  4PFT A;  5CI5 A;  5I57 A;  4GRK A;  3E78 A;  1JEU A;  1KA0 A;  4OVP A;  2ZXT A;  2Y5L A;  2QMW A;  3Q25 A;  4R73 A;  2VPO A;  5KCJ A;  3E9X A;  3VV5 A;  4H5F A;  3I6V A;  1EH3 A;  1DTG A;  5EYF A;  1OQG A;  2XXK A;  3U94 A;  3IFC A;  1J1N A;  3TCG A;  4Q0C A;  4TLM B;  1ATG A;  4EF1 A;  4O7I A;  3ZKL A;  4JB7 A;  3FJM A;  2RC8 A;  1B3G A;  3NOH A;  3TAJ A;  1T0K A;  2AL4 A;  5L9S A;  1EZ9 A;  4H8J A;  4HE1 A;  2FA7 A;  4PFB A;  2VP1 A;  1Q35 A;  3I5O A;  3QAX A;  2I4B A;  4QFK A;  2X7P A;  3RGY A;  2VT5 A;  5ET7 A;  4ZEB A;  1MY1 A;  1S9T A;  2REG A;  3KOT A;  4QFN A;  5H8F B;  3RN8 A;  1NH7 A;  2XXU A;  4FOR A;  4GWS A;  3U92 A;  3S9E A;  4GWY A;  4KYE A;  1YPN A;  4X1D A;  2O6A A;  1FPB A;  3RPL B;  4FAJ A;  3ZS6 A;  4MNC A;  4NF6 B;  2Y7W A;  3IB0 A;  2FIX A;  4HXV A;  1A40 A;  5I84 A;  3HCQ A;  3HO7 A;  1MY2 A;  1TFA A;  4QSC A;  1LBB A;  2Q89 A;  5TP9 B;  3SDF A;  3RQT A;  1MRP A;  5JTY A;  3Q28 A; 
#chains in the Genus database with same CATH homology
 3EF7 A;  3LSW A;  5H8H A;  4YMB A;  3HPI A;  2UVG A;  1IZ1 A;  4PQJ A;  4C0R A;  4RJZ A;  3ODB A;  2RC9 A;  2ZYK A;  1FTJ A;  3IOV A;  1DSN A;  1P1Q A;  4GF8 A;  3Q26 A;  4G77 A;  4G68 C;  3K6V A;  2ONR A;  3TPA A;  5DTB A;  3PD9 A;  4NWD A;  1B1X A;  4DXC A;  3UOR A;  4NE4 A;  2ZNT A;  3O29 A;  3BFT A;  3OO6 A;  3QYT A;  3UA8 A;  1B40 A;  1A99 A;  2NVU B;  3W9V A;  1POY 1;  3MQ9 A;  3U93 A;  1JW1 A;  1M5E A;  3C33 A;  4JSD A;  3IAZ A;  4YMA A;  5ITP A;  4ZDM A;  3BFU A;  2GHB A;  1TXF A;  2DYX A;  2CZL A;  3RPW A;  2VOZ A;  4XTC Q;  2V84 A;  3GBB A;  4WED A;  2HAU A;  1Y4C A;  4F1U A;  1B9J A;  1N04 A;  2I58 A;  3K6W A;  1VR5 A;  3U8Q A;  1H3D A;  3OO9 A;  4NMY A;  4QFL A;  5F1Q A;  1YCJ A;  2OBG A;  3B6W A;  4G8H A;  4RK2 A;  3FVG A;  2QRY A;  4F3B A;  4BDQ A;  3LSX A;  1MXU A;  1MH3 A;  3IB1 A;  1B0H A;  5KZT A;  1XVY A;  5H8N A;  1LFH A;  3MC2 A;  1PDA A;  5AA2 A;  2BJJ X;  1P1U A;  2D3I A;  4JBZ A;  3KSJ A;  3O6H A;  4XXU A;  3M3F A;  4LUB A;  3RT6 B;  4F3S A;  2QS1 A;  2OWT A;  3KN7 A;  3DM0 A;  1XVX A;  2IEE A;  3VDF A;  1UQW A;  3HST A;  3K1P A;  4GWO A;  4M1V A;  4IO4 A;  4OXV A;  4MBP A;  3PV0 E;  4F1V A;  3G3I A;  4EXL A;  2PYY A;  1P1O A;  4NED A;  4IO6 A;  2PX1 A;  4NF5 A;  3JV9 A;  3LC8 A;  1M5F A;  4YU0 A;  4EF2 A;  3S9L C;  1BTJ A;  1SVX B;  3VLU A;  4LQ2 A;  4P0I A;  4XKQ A;  1BKA A;  1QKB A;  1USY E;  3QUF A;  2RCB A;  1ZKB A;  3KOS A;  3T9X B;  2DXR A;  1MXZ A;  1B7H A;  3FIR A;  5AA2 D;  2I0B A;  1MQD A;  3SEU A;  5AA4 B;  4ECF A;  2ZMB A;  3ECR A;  2CMO A;  1I69 A;  1NNK A;  2UVH A;  2HAV A;  2NXO A;  2VGQ A;  2A5T B;  3MPK A;  2XXV A;  3GLB A;  2V93 A;  5L9M A;  2F7B A;  1B7Z A;  1MH4 A;  3T9V A;  4FAT A;  5CMK A;  4R6Y A;  1ZJL A;  3E4R A;  2AIX A;  2G93 A;  5B70 A;  1VE4 A;  4KYS A;  3VVE A;  3T9U A;  3S2V A;  4Q8R A;  2H98 A;  3CVG A;  4IO7 A;  5F7V A;  1FQA A;  3MZ1 A;  2UXA A;  4JWX A;  4P11 A;  1JVY A;  4ZZA A;  1MDQ A;  5HPQ A;  3K01 A;  4EQ7 A;  2H5Y A;  5TPA A;  3SEX A;  3CFZ A;  2ZNS A;  3K00 A;  3QUJ A;  5AA1 A;  1B0L A;  1LCT A;  2ONK E;  4FIM A;  1LCF A;  1SBP A;  2XXW A;  5I59 A;  2AL5 A;  5I2K B;  1XS5 A;  3H6V A;  3T22 A;  1FQD A;  4HW8 A;  1PB7 A;  3SKP A;  4QFO A;  3CI8 A;  3FZV A;  3JYR A;  4JDF A;  1BP5 A;  1SQY A;  5JEI A;  4OQO A;  4JWY A;  3N6T A;  4RK9 A;  4R75 A;  1DPE A;  2XXY A;  4LZ7 A;  5I58 B;  1WVJ A;  2M8C A;  4LVQ A;  2O7U A;  4ELO A;  3TTK A;  2ZYO A;  5I2N B;  2DP8 A;  1LAG E;  4U23 A;  2DS9 A;  2QS4 A;  1B7U A;  4YB5 A;  1OLC A;  4EQ9 A;  4I1D A;  1ZMG A;  1JVX A;  3R26 A;  4FE8 A;  2E1S A;  2P0S A;  4FJP A;  1O63 A;  4H8I A;  3PPQ A;  2O7I A;  2UVJ A;  2PVU A;  1QUK A;  2Z8E A;  4RXL A;  4PE5 B;  4G68 B;  3TZA A;  1Z7M E;  1MXV A;  2Z22 A;  4HS7 A;  1N84 A;  1JW4 A;  1B4Z A;  2DWI A;  4F22 A;  5HM4 B;  2QMX A;  4OVJ A;  3EN3 A;  1TWY A;  2V3U A;  3VVF A;  1Y1M A;  1A8F A;  2XX8 A;  5ITO A;  3ILT B;  2F6G A;  1Y3N A;  4OEV A;  2F7C A;  4BDR A;  2XD2 A;  1UTB B;  3IOT A;  3FXU A;  3TMG A;  1NFT A;  4R72 A;  3WAE A;  4ONY A;  1SW4 A;  4UA8 A;  1WDN A;  1ZIU A;  3S9M C;  1URS A;  2ALU A;  3H4Z A;  4RY1 A;  3G3F A;  2V3T A;  4NWC A;  1N3X A;  3O6I A;  2ANJ A;  2DXY A;  1GV8 A;  4OER A;  1LST A;  1FTK A;  3DEL B;  3IOU A;  3ONM A;  4QFP A;  1URG A;  5H8F A;  3UP9 A;  1ELJ A;  1I6Q A;  1Y3Q A;  3G3J A;  1URD A;  2REJ A;  4RYA A;  2P2A A;  4IY6 A;  3CG1 A;  4NF6 A;  2F78 A;  4KD5 A;  3EHT A;  3K6X A;  3OO7 A;  5TP9 A;  4F19 A;  4OEU A;  1LAF E;  4DXU A;  1R1N A;  3KN3 A;  3H7M A;  2XXT A;  2DWA A;  4DCY A;  3RTW B;  5J1D A;  4WXJ A;  1FQE A;  4ZEC A;  2H99 A;  2XD3 A;  3L6H A;  1OLA A;  3S4U A;  2AYS A;  2V3Q A;  4XKN A;  1NNF A;  4ELP A;  3AXF A;  3MAM A;  1B58 A;  5ICT A;  4KCC A;  4GL0 A;  2I0C A;  3CIJ A;  4E0X A;  2FNC A;  5TU0 A;  1IIW A;  1MDP 1;  1HSL A;  3C36 A;  4G8M A;  4DDD A;  3VVD A;  1LBC A;  3IK6 B;  3K4U A;  3L6G A;  5FTI A;  2F35 A;  3V89 B;  4H1X A;  2VD2 A;  5LOM A;  2XHD A;  3K6U A;  4FEC A;  3QSL A;  5L9O A;  2Z8D A;  3F11 A;  3O9P A;  1B46 A;  3THI A;  1ZTY A;  3N5L A;  1JET A;  2NUV A;  1FQF A;  1MQG A;  1JEV A;  3W9W A;  1FTL A;  3OSR A;  4G4P A;  3MVW A;  4MLQ A;  3R7X A;  3K1M A;  1LFG A;  4POX A;  5DEX A;  5H8S A;  5ICQ A;  4LZ8 A;  3GBA A;  4IO2 A;  4I62 A;  4KR5 A;  3KZG A;  3TYH A;  5FHM A;  4GXS B;  1QJM A;  4WKM A;  1FTM A;  3D4C A;  1Y20 A;  2DOJ A;  2RCA A;  3GZG A;  2NWJ A;  3KJ7 A;  2PT1 A;  3KJT A;  5BUU A;  2RKM A;  1SI1 A;  1YAE A;  4UAC A;  2GH9 A;  5CBS A;  3FVN A;  4GIZ A;  3JZJ A;  3WAF A;  1QKA A;  3TQL A;  4ND9 A;  1JQF A;  3VFJ A;  4E0W A;  2UVI A;  3K0V A;  1PBP A;  1FTO A;  3LSF B;  1FQC A;  2D5W A;  3UIF A;  2OCU A;  1B32 A;  5DYH A;  5CMB A;  3PU5 A;  5H8Q B;  3MZB A;  1IEJ A;  4R6K A;  5EHM A;  4F3G A;  4KCD A;  4PP0 A;  4R2F A;  2X26 A;  3VLW A;  3VLV A;  2H9B A;  1AMF A;  1RKM A;  3PPO A;  3RY3 A;  3MZ9 A;  4DIG A;  1SW5 A;  4R6H A;  3PUZ E;  4LAT A;  3Q29 A;  1P99 A;  2A5S A;  3Q27 A;  2DWH A;  3FVK A;  1PEB A;  1USY H;  5AA4 A;  4U2R A;  1WOD A;  4F3P A;  3O97 A;  1A8E A;  3HHG A;  2X7Q A;  1AL3 A;  2A5T A;  4ZED A;  3OEL A;  4R9F A;  1QUI A;  3OXN A;  2Y7P A;  2QS2 A;  4ZS9 A;  3C4M A;  3TQW A;  1XT8 A;  3CSB A;  1B52 A;  5KDT B;  4G8N A;  1TT1 A;  5CMC A;  3O6G A;  5DT6 A;  1IXH A;  1EZP A;  3SER A;  3TUS A;  3FGS A;  2OK2 A;  3W15 C;  3FUZ A;  1NNP A;  4THI A;  2PMS A;  4YB7 A;  2R71 A;  1SYH A;  1QW0 A;  2OLB A;  4F29 A;  1FQB A;  1QVS A;  2XXQ A;  3VXB A;  2LAO A;  2O68 A;  1POT A;  1LB9 A;  2XX9 A;  4ELQ A;  3A3U A;  2HZK A;  4U22 A;  2OZZ A;  4I8C A;  5I2K A;  3IB2 A;  1NNT A;  3QIM A;  3IOR A;  3TOD A;  5I56 B;  1ANF A;  4KI0 E;  2OWS A;  3PMW A;  3FD3 A;  3H03 A;  1GGG A;  4X48 A;  2VHA A;  1B3E A;  1B3H A;  3FV1 A;  3O2A A;  3CR9 A;  2ZNU A;  4BDM A;  3R6U A;  3PD8 A;  1IXC A;  5I58 A;  4YKK A;  3H6W A;  1H44 A;  1I6A A;  4NF8 B;  1VFE A;  4YKI A;  5I2N A;  3G3H A;  4KQP A;  1MPC A;  4X9T A;  2RF1 A;  2HFB A;  1ZBM A;  5BWJ A;  3FV2 A;  3IX1 A;  2F8D A;  4C1U A;  1MXW A;  4XKP A;  2ZYM A;  2UYE A;  1Y3P A;  1Y9U A;  4R9G A;  2H25 A;  5L8D A;  2QSX A;  1D3K A;  1SD3 A;  3PUY E;  4GFR A;  1M5B A;  4G68 A;  3SEW A;  4F2Q A;  5A5X B;  3DP6 A;  1N76 A;  4ZZE A;  1B3F A;  2HCA A;  1EU8 A;  3SES A;  3MP1 A;  4AB5 A;  1UIU A;  2O1L A;  1SDX A;  1MS7 A;  1I6B A;  1Q1K A;  1UTB A;  1R9Q A;  4O3B A;  3TCF A;  3DP8 A;  2O69 A;  4F1Y A;  4DZ1 A;  2F97 A;  2R9J A;  2B3B A;  4OHN A;  4YIC A;  5CBR A;  5K2X A;  2Q88 A;  2RC7 A;  1MXX A;  4XIG Q;  4QHQ A;  1DOT A;  4C1T A;  1N7W A;  1AIV A;  3VXC A;  1Y4T A;  1VFD A;  2F34 A;  2O51 A;  1LGB C;  3FXQ A;  4H65 A;  1DTZ A;  2ABH A;  2GHA A;  5DVJ A;  1B05 A;  2DE2 A;  2FYI A;  2YPN A;  3M3L A;  4KYD A;  1NMU A;  5FHN A;  2Z23 A;  3PUV E;  4N07 A;  2HQ0 A;  3KN8 A;  3HN0 A;  4QSD A;  2P1S A;  1B3L A;  4HTG A;  3G7W A;  3EHS A;  4PFY A;  3A09 A;  3PPP A;  5AE4 A;  3OMB A;  4BDN A;  2XX7 A;  4FEB A;  3S9N C;  2QS3 A;  4OES A;  1LB8 A;  4IB2 A;  2WKY A;  1IUD A;  1R6Z A;  1SW2 A;  4HCY A;  4IGR A;  4GXA A;  4RNS A;  1H76 A;  2Z8F A;  1MY4 A;  4PET A;  4IO3 A;  2HZL A;  3ILU B;  4GL8 A;  4YB6 A;  2ONS A;  3UK4 A;  4L17 A;  1D9V A;  3OO8 A;  4DE8 A;  4PFU A;  2Q2A A;  1JNF A;  1US4 A;  5AA3 A;  3EQ1 A;  1EZO A;  3EPE A;  4TOZ A;  5HBC A;  4MH5 A;  4AQ4 A;  3V83 A;  4N6P A;  4DCX A;  4OFO A;  2E0S A;  3SET A;  1BLF A;  3PPR A;  4NF4 B;  4YZZ A;  1DMB A;  4U1O A;  3TTR A;  4YKP A;  3C35 A;  1GR2 A;  1B5I A;  3K02 A;  4ISU A;  3G3K A;  3T66 A;  1SW1 A;  1LAX A;  5IKB A;  1B5J A;  1UTH B;  2DWJ A;  2GFE A;  4XKR A;  1FW0 A;  2XXI A;  3FJ7 A;  4JXI A;  4U1Z A;  4X1B A;  2Y7R A;  3CSG A;  4ELR A;  1GTK A;  3OEM A;  1N3W A;  5EHS A;  4U21 A;  2UYF A;  3USD A;  3IO6 A;  1PC3 A;  5CMM A;  3O66 A;  3DP4 A;  3LUY A;  3RLF E;  5I57 B;  1S7Y A;  3EHU A;  4LON B;  1NL5 A;  1ZLQ A;  4OFL A;  3U1O A;  5KCJ B;  1RYO A;  1II5 A;  2QPQ A;  4F31 B;  2DSF A;  1B4H A;  1XHY A;  3MBP A;  2IA4 A;  4ZEK A;  4KPT A;  1D9Y A;  1S50 A;  1OQH A;  2YLN A;  3HHF A;  2I4C A;  4P0G A;  3IO4 A;  1CB6 A;  1D4N A;  5CC2 A;  5H8Q A;  1OVB A;  4EUO A;  3TTN A;  3LSL A;  1A7L A;  1R9L A;  5ELV A;  3FAT A;  1RYX A;  1P1W A;  3RUM A;  3BBR A;  2HXW A;  3QXM A;  4QRZ A;  2V25 A;  1M5C A;  3M3K A;  4MFI A;  3CFL A;  1IIT A;  1OVT A;  3K2D A;  4KHZ E;  1LLS A;  4FED A;  4EQB A;  4BDO A;  3KG2 A;  3MP8 A;  2I48 A;  5FTH A;  3IL1 B;  1P1N A;  2I3W A;  1Y1Z A;  4MF3 A;  5DVI A;  1XOC A;  3E13 X;  1OIB A;  1ZU0 A;  3KFM A;  1A54 A;  1QUL A;  5JTY B;  1TFD A;  4RA1 A;  4GLI A;  2DVC A;  5KDT A;  2NOO A;  5H8H B;  3UGW A;  3KEI A;  1MY0 A;  3LBS A;  3H06 B;  3LR1 A;  1UIV A;  1B51 A;  3E3K A;  1MXY A;  3MVX A;  3PUX E;  2DQV A;  3P7I A;  4IO5 A;  3MP6 A;  4ESW A;  2DE4 A;  4H5G A;  4OTE A;  3BKI B;  2Y7K A;  3RNN A;  4BDL A;  4ZEF A;  1NKX A;  1Z7N E;  1MQH A;  4EXK A;  1IXG A;  1MY3 A;  3TCH A;  4NTL A;  2QJE A;  2R6G E;  1KWH A;  1FCK A;  5DEX B;  1LAH E;  4N13 A;  4OFJ A;  4F39 A;  5I56 A;  4QSE A;  3U72 A;  4EDP A;  1MPD A;  1YTV A;  2RIN A;  3RTF B;  3B6T A;  3I3V A;  2F7A A;  4NF8 A;  3V5A A;  3DLN A;  1BIY A;  1A55 A;  4QF9 A;  3OEK A;  1AH5 A;  2F6P A;  4OMB A;  3T9H B;  4JSO A;  2GRV A;  4H67 A;  4GD5 A;  3SEV A;  3K1N A;  4MLV A;  2VD3 A;  4F18 A;  4OZ9 A;  5CM6 A;  3MVY A;  4YAH X;  4DXB A;  3OD7 A;  1N7X A;  3TEP A;  2XXP A;  1OMP A;  2XXR A;  1QUJ A;  4IY5 A;  1IQ7 A;  3IJO B;  5H8N B;  3KGC A;  3MWB A;  5A5X A;  3RT8 A;  2ESN A;  5AA2 B;  4K3F A;  3A3C A;  3FXR A;  1F9B A;  1MQJ A;  1DPP A;  2H4I A;  4YKJ A;  4Z0I A;  2KLF A;  3PUW E;  4O3C A;  1VSO A;  3ZKK A;  3TEL A;  2I6E A;  3TDJ A;  3N94 A;  3TTM A;  4GVO A;  3D4G A;  3M8U A;  4R2B A;  3FJG A;  4WEP A;  5JK4 A;  2YJP A;  2QL3 A;  3TFL A;  1GVC A;  1PB8 A;  3HV1 A;  2PT2 A;  1B1H A;  3H6U A;  4Q30 B;  3UN6 A;  3OSQ A;  3MVZ A;  3MW0 A;  4NF5 B;  1SI0 A;  2I3V A;  4U4X A;  5CRY A;  1JW5 A;  3OEN A;  4LA9 A;  4OEN A;  1AOV A;  3IOW A;  2THI A;  2Q9T A;  1SYI A;  2F36 A;  3PMV A;  4AB6 A;  4PFW A;  3CG3 A;  4LZ5 A;  4HCW A;  3C32 A;  3FAS A;  3IR1 A;  4TQU Q;  1B2H A;  2W7Y A;  1MPB A;  2Q8J A;  3B7D A;  5ISU A;  3H3G A;  3IJX B;  2G29 A;  2B3F A;  3TKD A;  1PBQ A;  3GXA A;  3MUQ A;  3MJN A;  1MM7 A;  3QK6 A;  4OWD A;  1MM6 A;  2D21 A;  5FHO A;  4KFQ A;  1B6H A;  4IGT A;  2B65 A;  4DLD A;  5B7D A;  1L5T A;  4ESX A;  4H0W A;  4H6D A;  4Q5T A;  4RPO A;  3C31 A;  4GOT A;  3PGF A;  4GQO A;  3T93 B;  2DVZ A;  4ZE8 A;  1HSE A;  1O64 A;  4LP2 B;  1H43 A;  4RPN A;  5TPA B;  3C34 A;  2Y84 A;  4OET A;  4OYV A;  4O3A A;  1PB9 A;  1H45 A;  3KSX A;  3N26 A;  1LFI A;  1MQI A;  1MG1 A;  4Z7E A;  3KBR A;  3ZSF A;  1M5D A;  3CFX A;  3FVO A;  5I59 B;  2HEU A;  2Y7I A;  2I49 A;  5M2V A;  2ZYN A;  3B6Q A;  5K2Y A;  3G3G A;  4G2Z A;  2Q2C A;  2OJT A;  3H6T A;  1XC1 A;  4NF4 A;  4I9D A;  1N0T A;  4LQ5 A;  2XXH A;  3C9H A;  4ZE9 A;  3SEY A;  3MPL A;  2O84 X;  5DVF A;  1IXI A;  1NH8 A;  3PMX A;  3PPN A;  4F2O A;  5IAI A;  4R74 A;  1UTH A;  3V8X B;  1B5H A;  3OOA A;  2F5X A;  4M4G A;  4U4S A;  1CE2 A;  3CRB A;  4JWO A;  4POW A;  4TLL B;  2O1M A;  3VE1 B;  3O28 A;  1US5 A;  2DE3 A;  1HSJ A;  4BLA A;  3TTL A;  2PBW A;  3T96 B;  4ZEI A;  2XXX A;  3N6U A;  1O7T A;  4PFT A;  5CI5 A;  5I57 A;  4GRK A;  1JEU A;  2ZXT A;  2QMW A;  3Q25 A;  4R73 A;  5KCJ A;  3E9X A;  3VV5 A;  4H5F A;  3I6V A;  1EH3 A;  1DTG A;  5EYF A;  1OQG A;  3U94 A;  1J1N A;  3TCG A;  4Q0C A;  4TLM B;  1ATG A;  4EF1 A;  3ZKL A;  4JB7 A;  3FJM A;  2RC8 A;  1B3G A;  3TAJ A;  1T0K A;  2AL4 A;  5L9S A;  1EZ9 A;  4H8J A;  2FA7 A;  2VP1 A;  1Q35 A;  3I5O A;  3QAX A;  2I4B A;  4QFK A;  2X7P A;  3RGY A;  4ZEB A;  1MY1 A;  1S9T A;  2REG A;  3KOT A;  4QFN A;  5H8F B;  3RN8 A;  1NH7 A;  2XXU A;  4FOR A;  3U92 A;  3S9E A;  4KYE A;  1YPN A;  4X1D A;  2O6A A;  4FAJ A;  3ZS6 A;  4NF6 B;  2Y7W A;  3IB0 A;  1A40 A;  5I84 A;  3HCQ A;  3HO7 A;  1MY2 A;  1TFA A;  4QSC A;  1LBB A;  2Q89 A;  5TP9 B;  3SDF A;  3RQT A;  1MRP A;  5JTY A;  3Q28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...