3KBRA

The crystal structure of cyclohexadienyl dehydratase precursor from pseudomonas aeruginosa pa01
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
231
Chain Sequence
ESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEARFQTLEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKADLMMTDAIEARLQSRLHPELCAVHPQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRMEHWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Cyclohexadienyl dehydratase
publication title The crystal structure of cyclohexadienyl dehydratase precursor from Pseudomonas aeruginosa PA01
rcsb
source organism Pseudomonas aeruginosa
total genus 75
structure length 231
sequence length 232
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kbrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kbrA02
5CMCA 1ZBMA 4H8IA 1B4ZA 3WAFA 4LUBA 3C36A 4F29A 4PP0A 4N07A 5CMBA 1MXUA 3HSTA 3PMXA 2GH9A 1VFDA 4DXUA 1B46A 4R73A 1Y1ZA 2G29A 2ANJA 1SBPA 1Y4CA 2XXQA 4NF6B 5AA2A 4JB7A 3U92A 3H03A 1AL3A 3OELA 1R1NA 4KFQA 5H8FA 3ILTB 3RN8A 2R6GE 2W7YA 1L5TA 2Q8JA 3B6QA 3CSGA 5I2KB 2XXRA 4ECFA 3TTRA 1UIVA 4C1UA 3U94A 3CFLA 3H4ZA 3S9NC 1BTJA 4Z7EA 1TFDA 4EUOA 2O7UA 1HSLA 1Y3PA 2OJTA 3TTKA 4OVJA 3PUXE 4XKQA 4PE5B 3LSXA 3V89B 2D21A 3DP6A 5CBSA 3BKIB 4BDLA 1D3KA 5L9OA 1B4HA 1J1NA 4KCDA 2DP8A 4OENA 4NF5A 1QUJA 3RNNA 2QPQA 2Y7RA 1USYE 1M5EA 3IK6B 3T9HB 1A40A 4YKPA 4K3FA 1MS7A 3FVGA 4EXLA 3MZ9A 1S9TA 1JNFA 3H6UA 1ZLQA 1DTZA 5BWJA 4GD5A 4ZECA 3OO8A 1XS5A 3IORA 5KDTB 1R6ZA 3GLBA 1B32A 1EH3A 3S9LC 4EXKA 1B2HA 4DXBA 2I6EA 2QS4A 3L6GA 1B5HA 4FIMA 3HN0A 5AA3A 1OVBA 2F7AA 3E13X 4HCWA 1MXYA 4FE8A 3D4CA 4GXAA 1IIWA 4QHQA 4EDPA 2IEEA 1MY1A 2F8DA 4U1OA 1LCTA 4NF8A 4F1YA 1B0HA 4O3BA 2REGA 2QJEA 1XVXA 1AMFA 1URDA 3SETA 3SESA 3T9XB 1MY3A 1LFGA 1OQHA 4DXCA 1MRPA 1FTKA 1SVXB 1TT1A 3UA8A 2Z8FA 3ECRA 4E0XA 2DOJA 3F11A 3K0VA 4IO2A 3IJXB 4YB7A 2VD2A 4F2QA 4OEVA 3PUVE 4Q0CA 1JVXA 2QRYA 2VD3A 3OO6A 3B6WA 5CM6A 4MBPA 1P1QA 4KYDA 4C0RA 4YKIA 5CI5A 4X48A 4OQOA 1HSJA 4YZZA 3IL1B 1MY4A 3QUJA 3FUZA 1OLCA 3G3FA 5EHMA 5DT6A 4U4SA 1I69A 3IOUA 1KWHA 1SYIA 3GBBA 5H8QB 4GRKA 3MPLA 3HCQA 1OIBA 3TCGA 3UP9A 4YKKA 4WEPA 3A09A 4R6YA 1XVYA 2WKYA 3U93A 1UTBB 4MH5A 1H3DA 3OXNA 3QAXA 4XKRA 4R2BA 4HS7A 5DYHA 1WVJA 3G3IA 4OWDA 1P99A 1MG1A 3IOTA 4F3PA 3OSRA 5L9MA 3N26A 4QSDA 2Y7IA 2Q89A 4BDMA 4JDFA 1RKMA 3O6GA 3JV9A 3LBSA 5AA2D 3OENA 1DSNA 4F3GA 2V3QA 3KSJA 4RA1A 2X7PA 4F31B 3MZ1A 2B65A 5A5XB 2YLNA 4QFNA 3W9VA 4U1ZA 3DP8A 1QUKA 4X1BA 4GQOA 2XXPA 1PC3A 1N3XA 3MVXA 4GVOA 2Q2CA 3FV1A 4NF4B 1DMBA 1UTHA 4DCXA 3O66A 1A7LA 4DE8A 4ELQA 2RC8A 3PPPA 2R9JA 4OFJA 4F2OA 1N7WA 2F7BA 4LATA 1N0TA 2A5SA 3QK6A 3MPKA 5FHNA 3OO9A 3VVFA 3UK4A 3C32A 3H3GA 1FQEA 2AL5A 2AYSA 4H5FA 3SEYA 3UGWA 2I4CA 2GHAA 1ZMGA 2NOOA 1QJMA 4F3BA 3PMWA 5F1QA 1LFHA 2HZKA 5HPQA 3PUYE 3PU5A 4U4XA 2ESNA 4MLVA 5FHOA 2Z23A 4F39A 2ABHA 2PVUA 2XX9A 4R6KA 2ZYKA 4IO6A 3RQTA 3D4GA 3I3VA 4PFUA 2XXYA 2UVJA 2AIXA 2P2AA 2DWAA 4M1VA 1MQJA 5H8HA 4GL8A 4LP2B 1Y9UA 3MW0A 5DVJA 1IXGA 3DP4A 3QIMA 3K4UA 4LVQA 5CRYA 1CE2A 4XTCQ 3K1MA 3BFUA 4Q8RA 4IY5A 1YAEA 4DCYA 5CBRA 2OK2A 4H5GA 4ZZAA 3USDA 4THIA 5TPAB 1Y1MA 2OWTA 1MY2A 1MY0A 3CFZA 3THIA 1FQCA 1P1OA 3OD7A 3K01A 3S4UA 4RNSA 3KOSA 4NF8B 3WAEA 5ISUA 2DE2A 5I57A 1AIVA 4IO5A 3OEMA 4ELPA 4GIZA 1POY1 4QFPA 3TYHA 4F3SA 2VP1A 3OOAA 2HAVA 4NE4A 4ZEFA 4KQPA 2HEUA 2ONKE 3MZBA 4QSCA 4TQUQ 4M4GA 4G68B 1MH3A 3LSWA 5ICQA 1B9JA 2DS9A 3TCFA 3TTLA 4RK9A 2QS3A 3Q27A 1MXVA 3E3KA 3O2AA 5EHSA 2H4IA 1FQAA 3FVNA 5AA4A 5AE4A 3HHGA 1B3LA 2NWJA 4I9DA 4WKMA 3CSBA 1XHYA 1MDP1 2QSXA 1ZTYA 3IB2A 4OFOA 3QYTA 1FQDA 1BIYA 3A3CA 1I6BA 2DWJA 4QF9A 1LGBC 2ZYNA 2HAUA 1YPNA 4GF8A 3MP6A 4BDNA 3A3UA 4F19A 1H44A 4RYAA 2F97A 2P1SA 2F6PA 3DM0A 2OWSA 1S7YA 4MLQA 4C1TA 1Y3QA 5CMKA 2BJJX 1NFTA 1FTLA 2Z22A 3KZGA 3O28A 2ZXTA 1B05A 4AQ4A 5F7VA 3E4RA 3MC2A 1JEUA 1LFIA 2H99A 3TDJA 2I0CA 4LZ7A 4Z0IA 2NVUB 2Y7KA 3FXQA 1PB7A 5HM4B 2Z8DA 5I84A 4ZEBA 2D5WA 5JTYB 4OXVA 2ALUA 1LLSA 4EQ9A 1B6HA 1Z7NE 1B7HA 3L6HA 3TEPA 2ZYMA 4G2ZA 4F1VA 4KYEA 1US4A 3R7XA 3B6TA 1PB8A 4RJZA 4L17A 3IB1A 1QKAA 3FXRA 2R71A 4RPOA 4H0WA 3PUWE 2I48A 1EZOA 2E0SA 1MXWA 4IO4A 4BDRA 4KHZE 3V83A 2B3BA 2VHAA 3W15C 3PPQA 3R26A 2XX8A 4NMYA 2F36A 5JEIA 3VLWA 3LSFB 3FXUA 3IB0A 1D9VA 1MQDA 2I49A 2M8CA 2QS2A 2XXIA 3IOWA 5I2NA 3GXAA 4FEDA 4RXLA 2F5XA 3TKDA 3VLUA 3TELA 3TZAA 3VVEA 4H65A 1M5CA 2O84X 4WXJA 3RTWB 4R75A 3MJNA 1US5A 2RC7A 1XC1A 2NXOA 2XD2A 5DVFA 1I6AA 2DSFA 2A5TA 3HV1A 3PPRA 1JETA 5DEXA 2CMOA 1P1WA 1FQBA 2PYYA 4R6HA 4G8MA 3EHSA 3ZS6A 3JZJA 2QMWA 2X26A 2ZMBA 4YMAA 3V8XB 1WODA 3CG1A 1OLAA 2D3IA 5B70A 1USYH 2XXTA 3K6WA 3I6VA 4EQ7A 3CI8A 4OERA 5H8HB 3C4MA 1R9LA 1B0LA 1ZJLA 5B7DA 1SI1A 4U2RA 4G77A 4TLLB 1H76A 1HSEA 4GXSB 2E1SA 4NEDA 3RPWA 3EN3A 4LQ2A 1M5BA 2H9BA 3K00A 3FASA 4YU0A 1TWYA 1MDQA 1A55A 3B7DA 3ZKLA 1ANFA 2QL3A 3PPNA 4IB2A 2RCBA 2GFEA 1A99A 1NNKA 5TU0A 4POXA 3TAJA 3TQLA 3C33A 1N04A 3I5OA 4KD5A 2OZZA 4PFTA 1NNTA 5BUUA 3MVWA 4KR5A 1B7UA 4BDOA 1SW4A 1ATGA 5ITPA 1GTKA 5H8NA 5FHMA 3M3KA 4G68C 3H06B 2PMSA 3M8UA 3KG2A 5K2XA 2YPNA 2UVGA 5DTBA 4RPNA 4RY1A 3EF7A 2DQVA 4U21A 1YTVA 3V5AA 2HQ0A 4HW8A 3OMBA 4PFYA 5AA4B 5I56A 2Q2AA 2B3FA 3RY3A 3TFLA 1GGGA 1M5DA 1N3WA 2V25A 1A54A 4ND9A 5I58A 1LSTA 5I2KA 2ONRA 4OEUA 3N5LA 2XXHA 4LZ5A 1NNPA 3TUSA 2HZLA 4XXUA 3Q25A 4H1XA 5AA2B 1NL5A 1Y3NA 3FV2A 3G3KA 5H8FB 2DWHA 3KSXA 3RGYA 2AL4A 1OVTA 3BFTA 5L8DA 1PEBA 4I62A 4DLDA 1QUIA 4I8CA 1MQGA 5JK4A 2RC9A 3E9XA 2O7IA 2F78A 1B52A 4GFRA 2YJPA 2XXXA 3T93B 4R9FA 3U72A 3IX1A 3CIJA 1VR5A 2VOZA 1LCFA 1LB8A 2RCAA 3T22A 4IY6A 4JBZA 1OMPA 5EYFA 3S9MC 2Q88A 3IAZA 1JW4A 4QFOA 4FAJA 4BDQA 4ZS9A 3HPIA 4NF5B 2RKMA 3N6UA 4YAHX 4YICA 4EF2A 4Q30B 3FJGA 4UACA 2Z8EA 2V93A 4OZ9A 5IKBA 5KDTA 4MF3A 3FVOA 5IAIA 1S50A 3G3GA 3Q26A 1POTA 3SEVA 3BBRA 1ZIUA 3KN8A 3W9WA 5I59A 5I2NB 3DLNA 2I3WA 2QS1A 5K2YA 5KZTA 3EHTA 3FJMA 1AH5A 2P0SA 4LONB 1Y20A 1GVCA 2A5TB 1B5IA 3ODBA 3S2VA 5DEXB 4EQBA 2DXRA 1B51A 4ELOA 5ITOA 1SW1A 4LA9A 3C9HA 3PV0E 3IO4A 4NWDA 3QUFA 4G4PA 3MQ9A 5KCJA 3CG3A 1SW2A 2Q9TA 3K6VA 3Q29A 1NH7A 4KI0E 4LZ8A 3O29A 3MVZA 4G8HA 3KEIA 4OYVA 4QRZA 4H6DA 4F18A 1Q35A 2GHBA 5CMMA 3VV5A 3FD3A 3RLFE 1O7TA 1N76A 3T9UA 4YB6A 4ZEDA 5LOMA 3SERA 1VE4A 2IA4A 3OEKA 4GWOA 1BLFA 3H6WA 3MBPA 4G8NA 4ZE8A 2DYXA 1B7ZA 1UTBA 2OBGA 3EPEA 4YB5A 1EZPA 3OO7A 2H25A 2KLFA 2HFBA 1NKXA 4ZEKA 3O9PA 4O3AA 2UYEA 3KFMA 3RTFB 5H8NB 4Q5TA 2ZNSA 1JVYA 4OFLA 2ZYOA 4ZE9A 2F7CA 4POWA 4FORA 1D9YA 2RF1A 3VLVA 3K6UA 4TLMB 4DDDA 4KYSA 3RT6B 4R74A 2DXYA 5AA1A 3LUYA 1MXXA 2XHDA 1EU8A 2O69A 4E0WA 5I56B 2O1LA 3PUZE 4X1DA 1M5FA 5A5XA 2V3UA 4R2FA 5I58B 3O6HA 1PB9A 2GRVA 5TP9A 2H5YA 2F6GA 1URSA 3FIRA 1P1UA 2V84A 1FQFA 3ZKKA 1DTGA 4RK2A 1RYOA 3IJOB 4NF4A 1SDXA 4MFIA 3KN3A 3P7IA 4KPTA 4NWCA 3LR1A 3T9VA 1UQWA 2XXUA 1TFAA 3G7WA 1EZ9A 4H67A 3MWBA 1Q1KA 1F9BA 2UVHA 1MH4A 2XD3A 4GOTA 1UIUA 1MQIA 3FJ7A 1D4NA 1B58A 3M3LA 4N13A 5H8SA 1UTHB 3C35A 4EF1A 3SDFA 4FJPA 2Y84A 4IGTA 3VVDA 4N6PA 1Z7ME 5L9SA 3PD9A 3N94A 3HO7A 1A8EA 1R9QA 1ZKBA 3MUQA 3TCHA 1B3FA 4R9GA 3PGFA 3VXBA 1IZ1A 3R6UA 1I6QA 1JEVA 3MP8A 1B3EA 1CB6A 1IITA 1T0KA 2I58A 3T66A 3O97A 1FTMA 1AOVA 3G3HA 4OHNA 2THIA 4JWYA 4P0GA 4XKNA 4FATA 3C31A 1LAFE 1URGA 1IQ7A 5ICTA 4IGRA 3G3JA 1BP5A 1TXFA 3TTMA 2PT1A 5I59B 2F35A 1WDNA 3PD8A 5TPAA 3SEWA 2UXAA 4JWOA 4NTLA 2FA7A 1XOCA 2X7QA 2V3TA 1VSOA 4OTEA 3H7MA 2FNCA 1SD3A 4ZDMA 4U22A 4ZZEA 1IXCA 3MAMA 1FCKA 3IOVA 1XT8A 4LQ5A 4YKJA 1VFEA 3GZGA 3KOTA 2DVCA 1NH8A 1LAGE 3U8QA 5KCJB 1H43A 2ONSA 1MXZA 5I57B 1LB9A 3ILUB 4G68A 4ELRA 1P1NA 5M2VA 1YCJA 5FTHA 3TPAA 4DZ1A 1NMUA 3N6TA 3EQ1A 3C34A 2HCAA 4PETA 3M3FA 3VE1B 5ELVA 2NUVA 3MVYA 4F22A 4PFWA 1GR2A 2OCUA 4IO7A 2UVIA 2O6AA 4TOZA 4QFLA 1B1XA 3SEUA 2PBWA 1PDAA 4YMBA 4X9TA 2ZNUA 4ZEIA 1FTOA 2O68A 3RUMA 2HXWA 3FVKA 1Y4TA 1GV8A 1MPBA 3ZSFA 1OQGA 4IO3A 4JWXA 2DE3A 4NF6A 1IEJA 4OETA 1MM6A 3QSLA 5HBCA 1IXIA 4FECA 1DPPA 2VGQA 3HHFA 1B3GA 1B3HA 3H6TA 2REJA 3MP1A 5J1DA 3RT8A 2Y7PA 2I3VA 3FZVA 4QFKA 1H45A 4O3CA 2FYIA 1MPDA 1JW1A 3O6IA 1SI0A 1ZU0A 1N84A 3LSLA 3GBAA 3DELB 3VXCA 4I1DA 5JTYA 1MQHA 3SEXA 2DE4A 3AXFA 5TP9B 2OLBA 3VDFA 1JW5A 1IXHA 1SQYA 1A8FA 2CZLA 2PX1A 3TTNA 4QSEA 5DVIA 1MPCA 1QVSA 3PMVA 3VFJA 1LBBA 2DVZA 3JYRA 4ESWA 3S9EA 1DPEA 1BKAA 3KGCA 4HTGA 3Q28A 3PPOA 2G93A 2DWIA 3K1PA 1II5A 2O1MA 4XKPA 5FTIA 1O64A 3CR9A 3LC8A 1RYXA 4AB5A 2I4BA 1QW0A 2XX7A 4JSDA 3CFXA 1QKBA 3KJ7A 2Y7WA 1IUDA 3UORA 3CVGA 3KBRA 4PQJA 1O63A 3IR1A 3K1NA 1FW0A 2XXVA 4HCYA 3T96B 4AB6A 4UA8A 3K02A 3FGSA 3EHUA 4U23A 4ESXA 3QXMA 2F34A 4F1UA 3TMGA 4H8JA 4JXIA 2QMXA 4OESA 3TQWA 2UYFA 1LBCA 3IO6A 1LAXA 1QULA 1FTJA 4BLAA 2LAOA 4GLIA 1N7XA 4OMBA 3CRBA 1MM7A 4GL0A 3K6XA 1SW5A 4R72A 3K2DA 3UN6A 3TODA 3UIFA 2ZNTA 1B40A 3ONMA 4XIGQ 1PBQA 1DOTA 4KCCA 1JQFA 3OSQA 4ONYA 2O51A 1B5JA 1LAHE 1ELJA 1NNFA 3SKPA 2RINA 2H98A 5H8QA 2XXWA 5CC2A 2I0BA 4P11A 3FATA 4WEDA 1B1HA 1PBPA 4ISUA 3U1OA 4FEBA 3H6VA 4DIGA 3KN7A 4JSOA 3KJTA 4P0IA 1SYHA 2PT2A
chains in the Genus database with same CATH superfamily
5CMCA 1ZBMA 4H8IA 1B4ZA 1KZ8A 3QMFA 2WX9A 3WAFA 4LUBA 3C36A 4F29A 4PP0A 4N07A 5CMBA 2GQ1A 1MXUA 2QVRA 3HSTA 3PMXA 2GH9A 1VFDA 4DXUA 1B46A 4R73A 1Y1ZA 3MSTA 2G29A 4MX6A 2QVVA 2ANJA 1SBPA 1Y4CA 1FBEA 2XXQA 4NF6B 5AA2A 4JB7A 3U92A 3H03A 1AL3A 3OELA 1R1NA 4KFQA 5H8FA 3ILTB 3RN8A 2R6GE 4PBHA 2W7YA 4GWYA 1L5TA 2Q8JA 3B6QA 4PC9A 3CSGA 5I2KB 1FPKA 2XXRA 4ECFA 3TTRA 1UIVA 4C1UA 3U94A 3CFLA 3H4ZA 5ET7A 3S9NC 1BTJA 4Z7EA 1TFDA 4EUOA 2O7UA 1HSLA 1Y3PA 2OJTA 3TTKA 4OVJA 3PUXE 4GWZA 4XKQA 4P1LA 4PE5B 3LSXA 3V89B 2D21A 3DP6A 3KC0A 5CBSA 1Q9DA 3BKIB 2FBPA 4BDLA 1D3KA 5L9OA 1B4HA 1J1NA 4KCDA 1FJ9A 2DP8A 4OENA 4NF5A 1QUJA 3RNNA 2QPQA 2Y7RA 1USYE 1M5EA 3IK6B 3T9HB 3FXBA 1A40A 4YKPA 4MMPA 4K3FA 1FPDA 2HHMA 1MS7A 3FVGA 4UABA 1YXIA 4EXLA 3MZ9A 1S9TA 1JNFA 3H6UA 4I3EA 1ZLQA 1NUWA 1DTZA 5BWJA 4GD5A 4ZECA 3OO8A 1XS5A 3IORA 5KDTB 1R6ZA 5ET5A 3GLBA 1B32A 1EH3A 3S9LC 4EXKA 1B2HA 4DXBA 2I6EA 2QS4A 3L6GA 2P3VA 1B5HA 4FIMA 3HN0A 5AA3A 5EQAA 1OVBA 2F7AA 3E13X 4HCWA 1EYKA 1MXYA 4FE8A 3D4CA 4GXAA 1IIWA 4QHQA 4EDPA 1QGXA 2IEEA 1MY1A 2F8DA 4U1OA 4MNPA 2QVUA 1LCTA 4NF8A 4F1YA 1B0HA 4O3BA 5J16A 2REGA 2QJEA 2XA5A 1XVXA 1AMFA 1RDYA 1URDA 3SETA 3SESA 3T9XB 1MY3A 1LFGA 1OQHA 4DXCA 1MRPA 4N8GA 1FTKA 1SVXB 1TT1A 3UA8A 2Z8FA 3ECRA 4E0XA 2DOJA 3F11A 3K0VA 4IO2A 3IJXB 4YB7A 2VD2A 4F2QA 4G61A 4OEVA 3PUVE 4Q0CA 1JVXA 2QRYA 2PFZA 2VD3A 3OO6A 3B6WA 2XWOA 5CM6A 4MBPA 1P1QA 4KYDA 4C0RA 4YKIA 5CI5A 4X48A 4OQOA 1HSJA 4YZZA 3IL1B 1MY4A 4O7MA 3QUJA 3FUZA 1OLCA 3G3FA 5EHMA 5DT6A 4U4SA 1FSAA 1I69A 4PF8A 3IOUA 1KWHA 1SYIA 3GBBA 5H8QB 4GRKA 3MPLA 3HCQA 1OIBA 3TCGA 3UP9A 4YKKA 4WEPA 3A09A 4R6YA 1XVYA 2WKYA 1NV7A 3U93A 1UTBB 4MH5A 1H3DA 3OXNA 3QAXA 4XKRA 4R2BA 4HS7A 5DYHA 1WVJA 3G3IA 4OWDA 1P99A 1MG1A 4P47A 3IOTA 4F3PA 3OSRA 5L9MA 3N26A 4QSDA 2Y7IA 2Q89A 4BDMA 4JDFA 1RKMA 3O6GA 3JV9A 3LBSA 5AA2D 2CZHA 3OENA 1DSNA 4F3GA 2V3QA 2OX3A 3KSJA 4RA1A 2X7PA 4F31B 3MZ1A 2B65A 4NF0A 5A5XB 2YLNA 4QFNA 2CEYA 3W9VA 4U1ZA 3DP8A 1QUKA 4PGNA 5DW8A 4X1BA 4GQOA 2XXPA 1PC3A 1N3XA 3MVXA 1IMEA 4GVOA 1CNQA 2Q2CA 3FV1A 4NF4B 4N81A 2DDKA 1DMBA 1UTHA 4PBQA 4OVRA 4DCXA 3O66A 1A7LA 5ESYA 1FPIA 4DE8A 4ELQA 2RC8A 3PPPA 1BK4A 2R9JA 4OFJA 4F2OA 2WEFA 1N7WA 2F7BA 4LATA 3MYUA 1N0TA 2A5SA 3QK6A 3MPKA 3B8BA 5FHNA 1EYJA 4OVPA 3OO9A 3D1RA 3VVFA 3UK4A 3C32A 4GX4A 3H3GA 1FQEA 2AL5A 2AYSA 4H5FA 3SEYA 3UGWA 2I4CA 2GHAA 1ZMGA 2NOOA 1QJMA 4F3BA 3PMWA 5F1QA 1IMDA 4NGUA 1LFHA 2HZKA 5HPQA 3PUYE 1LBZA 3PU5A 4U4XA 2ESNA 4LN5A 4MLVA 5FHOA 2Z23A 4F39A 2ABHA 2PVUA 4MHFA 2XX9A 4R6KA 2ZYKA 4IO6A 3RQTA 2KQZA 3D4GA 3I3VA 1K9ZA 4PFUA 2XXYA 2UVJA 2AIXA 2P2AA 2DWAA 4M1VA 1MQJA 5H8HA 4GL8A 4LP2B 1Y9UA 3MW0A 5DVJA 1IXGA 3DP4A 3QIMA 3K4UA 4LVQA 5CRYA 5ET8A 3BIHA 1CE2A 4XTCQ 3K1MA 3BFUA 4Q8RA 4IY5A 1YAEA 4DCYA 5CBRA 2OK2A 4H5GA 4H46A 1FBDA 4ZZAA 3USDA 4THIA 1FPFA 5TPAB 1Y1MA 2OWTA 1MY2A 1MY0A 3CFZA 3THIA 1FQCA 1P1OA 3OD7A 5IZ3A 3K01A 2R8TA 3S4UA 4RNSA 3KOSA 4NF8B 4GBVA 3WAEA 5ISUA 2DE2A 3KC1A 5I57A 1AIVA 4IO5A 3RPLB 3OEMA 3A29A 4ELPA 4GIZA 1POY1 4QFPA 3TYHA 4F3SA 2VP1A 3OOAA 2HAVA 4NE4A 4ZEFA 4KQPA 2HEUA 2ONKE 3MZBA 4QSCA 4TQUQ 4M4GA 2B4LA 4G68B 3E78A 1MH3A 3LSWA 5ICQA 1B9JA 2DS9A 3TCFA 3TTLA 4RK9A 2QS3A 3Q27A 5LTCA 1MXVA 3E3KA 3O2AA 5EHSA 2H4IA 1FQAA 3FVNA 5AA4A 4OVSA 5AE4A 3T0JA 3HHGA 5F24A 1B3LA 2NWJA 4I9DA 4WKMA 3CSBA 1XHYA 1MDP1 4MAGA 2QSXA 1ZTYA 3IB2A 4OFOA 4PF6A 1NUYA 3QYTA 1FQDA 1BIYA 4OA4A 3A3CA 1I6BA 2DWJA 4QF9A 1LGBC 2BJIA 4XF5A 2ZYNA 2HAUA 1G0IA 1YPNA 4GF8A 3MP6A 4OVQA 4BDNA 3A3UA 4NG7A 4F19A 4GX3A 1H44A 4RYAA 2F97A 2P1SA 2F6PA 3DM0A 2OWSA 1S7YA 4MLQA 4C1TA 1Y3QA 5CMKA 1XI6A 2BJJX 1NFTA 1FTLA 3O28A 2Z22A 3KZGA 2JJKA 2ZXTA 2WYPA 1B05A 4AQ4A 5F7VA 3E4RA 3MC2A 1FBHA 1JEUA 1LFIA 2H99A 3TDJA 2I0CA 4LZ7A 4Z0IA 2NVUB 2Y7KA 3FXQA 1PB7A 5HM4B 2Z8DA 5I84A 4ZEBA 2D5WA 5JTYB 4OXVA 2ALUA 1LLSA 2PCRA 4EQ9A 3BIGA 1B6HA 1Z7NE 1B7HA 3L6HA 3TEPA 2ZYMA 4G2ZA 4F1VA 3U65A 4KYEA 1US4A 3R7XA 3B6TA 1PB8A 4RJZA 4L17A 4P56A 3IB1A 1QKAA 3FXRA 2R71A 4RPOA 4H0WA 3PUWE 2I48A 2FVZA 2E0SA 1EZOA 1MXWA 4IO4A 4BDRA 4KHZE 3V83A 2B3BA 2VHAA 3W15C 3PPQA 2XWKA 3R26A 2XX8A 4NMYA 2F36A 5JEIA 3RYDA 3VLWA 3LSFB 3FXUA 3IB0A 1D9VA 1MQDA 5EYHA 2I49A 2M8CA 2QS2A 2XXIA 3IOWA 5I2NA 3GXAA 4FEDA 4RXLA 2F5XA 3TKDA 4XFEA 3TELA 3VLUA 3TZAA 3VVEA 4H65A 1M5CA 2O84X 4WXJA 3RTWB 4R75A 3MJNA 1US5A 2RC7A 1XC1A 2NXOA 2XD2A 5DVFA 1I6AA 1SPIA 2DSFA 2A5TA 3HV1A 3PPRA 1JETA 5DEXA 2CMOA 1P1WA 1FQBA 2HPGA 2PYYA 4R6HA 1IMAA 4G8MA 3EHSA 3ZS6A 3JZJA 4P8BA 2QMWA 2X26A 4MCOA 2ZMBA 4YMAA 3V8XB 1WODA 3CG1A 1OLAA 2D3IA 5B70A 1USYH 2XXTA 3K6WA 3I6VA 4EQ7A 3CI8A 4OERA 5H8HB 3C4MA 4GX6A 1R9LA 1B0LA 1ZJLA 5B7DA 1SI1A 4OANA 4U2RA 4MEVA 4G77A 4TLLB 1H76A 1HSEA 4GXSB 2E1SA 4NEDA 3RPWA 3EN3A 1NV0A 4LQ2A 1M5BA 2P3NA 2H9BA 3K00A 4PTKA 3FASA 4YU0A 1TWYA 1MDQA 1A55A 3B7DA 3ZKLA 1ANFA 2QL3A 3PPNA 4IB2A 2RCBA 4O8MA 2GFEA 1A99A 1NNKA 5TU0A 4POXA 3TAJA 3TQLA 3C33A 1N04A 3I5OA 4KD5A 2OZZA 4PFTA 1NNTA 5BUUA 3MVWA 4KR5A 1B7UA 1YZ0A 2V4CA 4BDOA 1SW4A 1ATGA 5ITPA 1FPGA 1GTKA 5H8NA 5FHMA 3M3KA 4G68C 3H06B 2PMSA 3M8UA 5I5PA 3KG2A 5K2XA 2YPNA 1FPBA 4N6DA 2UVGA 5DTBA 4RPNA 4RY1A 3EF7A 2DQVA 4U21A 1YTVA 3V5AA 2HQ0A 4HW8A 3OMBA 4PFYA 5AA4B 5I56A 1NUXA 2Q2AA 2B3FA 3RY3A 3TFLA 1GGGA 1M5DA 1N3WA 2V25A 2PFYA 1A54A 1INPA 2HXRA 4ND9A 2Q74A 3PTYA 5I58A 1LSTA 5I2KA 2ONRA 2VT5A 4OEUA 3N5LA 2XXHA 4LZ5A 1KA0A 1NNPA 2Y5LA 3TUSA 2HZLA 4XXUA 1LBVA 3Q25A 2FIXA 4H1XA 5AA2B 1NL5A 1LBYA 1Y3NA 3FV2A 3G3KA 5H8FB 2DWHA 3KSXA 3RGYA 2AL4A 1OVTA 3BFTA 5L8DA 5IM2A 1PEBA 4I62A 1FBGA 4DLDA 1QUIA 4I8CA 1MQGA 4HE1A 5JK4A 2RC9A 3E9XA 2O7IA 2F78A 1B52A 4AS5A 4GFRA 4N4UA 1NV3A 4IR8A 2XWVA 2YJPA 2XXXA 3T93B 5LDZA 4R9FA 5T3JA 3U72A 2OWZA 3IX1A 3CIJA 1VR5A 2VOZA 1LCFA 1LB8A 3EKIA 2RCAA 3T22A 4IY6A 4JBZA 1OMPA 5EYFA 3SZPA 2Q88A 3S9MC 3IAZA 1JW4A 4QFOA 4P1EA 1NV6A 4FAJA 2CZIA 4BDQA 4ZS9A 5I7IA 3HPIA 4NF5B 2RKMA 3N6UA 4YAHX 4YICA 5EQ8A 4EF2A 1YYZA 4Q30B 5EQ7A 3FJGA 4UACA 2Z8EA 2V93A 4OZ9A 5IKBA 5KDTA 4O7IA 4MF3A 3FVOA 2VPOA 5IAIA 1S50A 3G3GA 3Q26A 1POTA 3SEVA 3BBRA 1ZIUA 3KN8A 3W9WA 5I59A 5I2NB 3DLNA 2I3WA 2QS1A 3ROJA 5K2YA 5KZTA 3EHTA 3FJMA 4MNIA 1AH5A 5ET6A 2P0SA 4LONB 1Y20A 1KA1A 2FHYA 4NHBA 1GVCA 5I3SA 2A5TB 1B5IA 3ODBA 3S2VA 3ISPA 5DEXB 4EQBA 4N8YA 2DXRA 1B51A 4ELOA 5ITOA 1SW1A 4LA9A 3C9HA 3CHGA 3PV0E 3LV0A 3IO4A 4NWDA 1DBZA 4QXDA 3QUFA 4G4PA 3MQ9A 4I40A 5KCJA 3CG3A 1K9YA 4P9KA 1SW2A 2Q9TA 3K6VA 3Q29A 1NH7A 4KI0E 2Q8MA 4LZ8A 1FPJA 4MIJA 3O29A 3MVZA 4G8HA 3KEIA 4OYVA 4QRZA 4H6DA 1IMFA 3B50A 3IFAA 4F18A 1Q35A 2GHBA 5CMMA 3VV5A 3FD3A 3RLFE 1O7TA 1N76A 3T9UA 4YB6A 1RDZA 4ZEDA 5LOMA 3SERA 1VE4A 2IA4A 3OEKA 4GWOA 1BLFA 3H6WA 3MBPA 4G8NA 4ZE8A 2DYXA 1B7ZA 1UTBA 4GWXA 2OBGA 3EPEA 4YB5A 1EZPA 3OO7A 3KBZA 2H25A 2KLFA 2HFBA 1NKXA 4ZEKA 3O9PA 4O3AA 2UYEA 4PCDA 4DI4B 3KFMA 4DI3D 3RTFB 5H8NB 4Q5TA 2ZNSA 1JVYA 4NQ8A 4OFLA 2ZZXA 1FRPA 2ZYOA 4ZE9A 2F7CA 4POWA 4FORA 1D9YA 2KR0A 5A5LA 2RF1A 3VLVA 3K6UA 2CEXA 4TLMB 4DDDA 4KYSA 3RT6B 4R74A 2DXYA 5AA1A 4KXPA 3LUYA 4NAPA 1MXXA 2XHDA 1EU8A 2O69A 4E0WA 5I56B 2O1LA 3PUZE 4X1DA 1M5FA 5A5XA 2V3UA 4R2FA 5I58B 3O6HA 1PB9A 2GRVA 5TP9A 2VPNA 2H5YA 2F6GA 1URSA 3FIRA 1P1UA 2V84A 2WBDA 1FQFA 3ZKKA 4RK2A 1DTGA 4PAIA 1RYOA 3IJOB 4NF4A 1FPLA 1SDXA 4MFIA 4N6KA 4FBPA 3KN3A 3P7IA 4KPTA 4NWCA 3LR1A 3T9VA 1UQWA 2MKZA 2XXUA 1TFAA 3G7WA 1EZ9A 4H67A 3MWBA 1Q1KA 1F9BA 2UVHA 1MH4A 2XD3A 2FIEA 4GOTA 1UIUA 1MQIA 3FJ7A 1D4NA 1B58A 3M3LA 4N13A 5H8SA 1UTHB 3C35A 4GWSA 1FTAA 3SDFA 4FJPA 4EF1A 2Y84A 4IGTA 3VVDA 1NV4A 4N6PA 1Z7ME 5L9SA 3PD9A 3N94A 3HO7A 4XEQA 4MJOA 1A8EA 1R9QA 1ZKBA 1RDXA 3MUQA 3TCHA 1B3FA 4R9GA 4PDHA 3PGFA 3VXBA 1IZ1A 3T1BA 1FPEA 3R6UA 1I6QA 1JEVA 3MP8A 4HE0A 1B3EA 1CB6A 1IITA 1T0KA 2I58A 3T66A 3O97A 1FTMA 1AOVA 3E79A 3G3HA 4OHNA 2THIA 4JWYA 4P0GA 4XKNA 4FATA 3C31A 1LAFE 1URGA 1IQ7A 1NV1A 5ICTA 4IGRA 3G3JA 3NOHA 1BP5A 1TXFA 4HXVA 3TTMA 4MNCA 2PT1A 5I59B 2F35A 3GYYA 1WDNA 3PD8A 4PAKA 5TPAA 3SEWA 2UXAA 4JWOA 4NTLA 2FA7A 1XOCA 2X7QA 4O94A 1NV2A 2V3TA 1VSOA 3RPLA 4OTEA 3H7MA 2FNCA 1SD3A 4ZDMA 1NUZA 4U22A 4PE3A 4ZZEA 1IXCA 3MAMA 5IZ1A 1FCKA 3IOVA 1XT8A 4LQ5A 4JVDA 4YKJA 1VFEA 4HE2A 3GZGA 3KOTA 2DVCA 1NH8A 5IZ3B 1LAGE 1D9QA 2F3BA 3U8QA 5KCJB 1H43A 4OVTA 2ONSA 1MXZA 5I57B 4QBAA 1LB9A 3ILUB 4G68A 4ELRA 1P1NA 1AWBA 5M2VA 1YCJA 5FTHA 3TPAA 4DZ1A 1NMUA 1FJ6A 3N6TA 4AS4A 3EQ1A 3C34A 2QFLA 2HCAA 4PETA 3M3FA 3VE1B 5ELVA 2NUVA 3MVYA 4F22A 4PFWA 1GR2A 2OCUA 4IO7A 2UVIA 2O6AA 4TOZA 4QFLA 1B1XA 3SEUA 2PBWA 1PDAA 2ZZVA 4YMBA 4X9TA 2ZNUA 4ZEIA 1FTOA 4X04A 2O68A 3RUMA 4GWWA 1FBFA 2ZZWA 2HXWA 3FVKA 1Y4TA 1GV8A 4H45A 1MPBA 3ZSFA 1OQGA 5IGAA 4IO3A 4JWXA 2DE3A 4NF6A 1IEJA 4OETA 1MM6A 3QSLA 3IFCA 5HBCA 1IXIA 4X8RA 4FECA 1DPPA 2VGQA 3HHFA 1B3GA 1B3HA 3H6TA 2REJA 1NI9A 3MP1A 5J1DA 4PGPA 3RT8A 2Y7PA 2I3VA 3FZVA 4QFKA 5FBPA 4NX1A 1H45A 4O3CA 2FYIA 1MPDA 1JW1A 3O6IA 1SI0A 1ZU0A 1N84A 4JVIA 4PFBA 3LSLA 4GWUA 3GBAA 3DELB 3FBPA 3VXCA 4I1DA 5JTYA 1MQHA 3SEXA 2DE4A 4I3YA 4PFRA 4N17A 1FBCA 3AXFA 5TP9B 2OLBA 3VDFA 5EQ9A 4PDDA 1JW5A 4GBWA 1IXHA 1SQYA 1A8FA 2CZLA 2PX1A 4P3LA 3TTNA 4QSEA 5DVIA 1MPCA 1DCUA 1QVSA 1LBXA 3PMVA 2XWIA 4PFIA 3VFJA 1LBBA 2DVZA 3JYRA 4ESWA 3S9EA 2CZKA 1BKAA 1DPEA 3KGCA 4HTGA 3Q28A 3PPOA 2G93A 2DWIA 3K1PA 1II5A 2O1MA 4XKPA 5FTIA 1G0HA 1O64A 2WYKA 3CR9A 3LC8A 1RYXA 4JVCA 4AB5A 2I4BA 1QW0A 2XX7A 4N15A 4JSDA 1EYIA 3CFXA 1QKBA 3KJ7A 2Y7WA 1IUDA 3UORA 3CVGA 3KBRA 4PQJA 1O63A 4N91A 2XXKA 3IR1A 2WBBA 3K1NA 1FW0A 3HFUA 2F3DA 2XXVA 4HCYA 1NV5A 4PAFA 3T96B 4AB6A 4UA8A 1LBWA 3K02A 3FGSA 3EHUA 4U23A 4ESXA 3QXMA 2F34A 5IZZA 4F1UA 1VDWA 3TMGA 4H8JA 4JXIA 2QMXA 4OESA 3TQWA 2UYFA 1LBCA 3IO6A 1LAXA 1QULA 1FTJA 4BLAA 2LAOA 4GLIA 1N7XA 4OMBA 3CRBA 1MM7A 4GL0A 3K6XA 1SW5A 4R72A 3K2DA 3UN6A 3TODA 3UIFA 2ZNTA 1B40A 3ONMA 4NN3A 4XIGQ 1FBPA 1LEVA 1PBQA 5EYGA 1DOTA 4KCCA 1JQFA 3LUZA 1IMBA 3OSQA 4ONYA 2O51A 1B5JA 1LAHE 1ELJA 2Y5KA 1NNFA 1DK4A 3SKPA 2RINA 2H98A 5H8QA 2XXWA 5CC2A 2L5VA 1IMCA 2I0BA 1JP4A 4P11A 3FATA 4WEDA 1B1HA 1PBPA 4ISUA 3U1OA 4FEBA 3H6VA 4DIGA 3KN7A 4JSOA 3KJTA 4P0IA 1SYHA 2PT2A 2B4MA
chains in the Genus database with same CATH topology
5CMCA 1ZBMA 4H8IA 1B4ZA 3WAFA 4LUBA 3C36A 4F29A 4PP0A 4N07A 5CMBA 1MXUA 3HSTA 3PMXA 2GH9A 1VFDA 4DXUA 1B46A 4R73A 1Y1ZA 2G29A 2ANJA 1SBPA 1Y4CA 2XXQA 4NF6B 5AA2A 4JB7A 3U92A 3H03A 1AL3A 3OELA 1R1NA 4KFQA 5H8FA 3ILTB 3RN8A 2R6GE 2W7YA 1L5TA 2Q8JA 3B6QA 3CSGA 5I2KB 2XXRA 4ECFA 3TTRA 1UIVA 4C1UA 3U94A 3CFLA 3H4ZA 3S9NC 1BTJA 4Z7EA 1TFDA 4EUOA 2O7UA 1HSLA 1Y3PA 2OJTA 3TTKA 4OVJA 3PUXE 4XKQA 4PE5B 3LSXA 3V89B 2D21A 3DP6A 5CBSA 3BKIB 4BDLA 1D3KA 5L9OA 1B4HA 1J1NA 4KCDA 2DP8A 4OENA 4NF5A 1QUJA 3RNNA 2QPQA 2Y7RA 1USYE 1M5EA 3IK6B 3T9HB 1A40A 4YKPA 4K3FA 1MS7A 3FVGA 4EXLA 3MZ9A 1S9TA 1JNFA 3H6UA 1ZLQA 1DTZA 5BWJA 4GD5A 4ZECA 3OO8A 1XS5A 3IORA 5KDTB 1R6ZA 3GLBA 1B32A 1EH3A 3S9LC 4EXKA 1B2HA 4DXBA 2I6EA 2QS4A 3L6GA 1B5HA 4FIMA 3HN0A 5AA3A 1OVBA 2F7AA 3E13X 4HCWA 1MXYA 4FE8A 3D4CA 4GXAA 1IIWA 4QHQA 4EDPA 2IEEA 1MY1A 2F8DA 4U1OA 1LCTA 4NF8A 4F1YA 1B0HA 4O3BA 2REGA 2QJEA 1XVXA 1AMFA 1URDA 3SETA 3SESA 3T9XB 1MY3A 1LFGA 1OQHA 4DXCA 1MRPA 1FTKA 1SVXB 1TT1A 3UA8A 2Z8FA 3ECRA 4E0XA 2DOJA 3F11A 3K0VA 4IO2A 3IJXB 4YB7A 2VD2A 4F2QA 4OEVA 3PUVE 4Q0CA 1JVXA 2QRYA 2VD3A 3OO6A 3B6WA 5CM6A 4MBPA 1P1QA 4KYDA 4C0RA 4YKIA 5CI5A 4X48A 4OQOA 1HSJA 4YZZA 3IL1B 1MY4A 3QUJA 3FUZA 1OLCA 3G3FA 5EHMA 5DT6A 4U4SA 1I69A 3IOUA 1KWHA 1SYIA 3GBBA 5H8QB 4GRKA 3MPLA 3HCQA 1OIBA 3TCGA 3UP9A 4YKKA 4WEPA 3A09A 4R6YA 1XVYA 2WKYA 3U93A 1UTBB 4MH5A 1H3DA 3OXNA 3QAXA 4XKRA 4R2BA 4HS7A 5DYHA 1WVJA 3G3IA 4OWDA 1P99A 1MG1A 3IOTA 4F3PA 3OSRA 5L9MA 3N26A 4QSDA 2Y7IA 2Q89A 4BDMA 4JDFA 1RKMA 3O6GA 3JV9A 3LBSA 5AA2D 3OENA 1DSNA 4F3GA 2V3QA 3KSJA 4RA1A 2X7PA 4F31B 3MZ1A 2B65A 5A5XB 2YLNA 4QFNA 3W9VA 4U1ZA 3DP8A 1QUKA 4X1BA 4GQOA 2XXPA 1PC3A 1N3XA 3MVXA 4GVOA 2Q2CA 3FV1A 4NF4B 1DMBA 1UTHA 4DCXA 3O66A 1A7LA 4DE8A 4ELQA 2RC8A 3PPPA 2R9JA 4OFJA 4F2OA 1N7WA 2F7BA 4LATA 1N0TA 2A5SA 3QK6A 3MPKA 5FHNA 3OO9A 3VVFA 3UK4A 3C32A 3H3GA 1FQEA 2AL5A 2AYSA 4H5FA 3SEYA 3UGWA 2I4CA 2GHAA 1ZMGA 2NOOA 1QJMA 4F3BA 3PMWA 5F1QA 1LFHA 2HZKA 5HPQA 3PUYE 3PU5A 4U4XA 2ESNA 4MLVA 5FHOA 2Z23A 4F39A 2ABHA 2PVUA 2XX9A 4R6KA 2ZYKA 4IO6A 3RQTA 3D4GA 3I3VA 4PFUA 2XXYA 2UVJA 2AIXA 2P2AA 2DWAA 4M1VA 1MQJA 5H8HA 4GL8A 4LP2B 1Y9UA 3MW0A 5DVJA 1IXGA 3DP4A 3QIMA 3K4UA 4LVQA 5CRYA 1CE2A 4XTCQ 3K1MA 3BFUA 4Q8RA 4IY5A 1YAEA 4DCYA 5CBRA 2OK2A 4H5GA 4ZZAA 3USDA 4THIA 5TPAB 1Y1MA 2OWTA 1MY2A 1MY0A 3CFZA 3THIA 1FQCA 1P1OA 3OD7A 3K01A 3S4UA 4RNSA 3KOSA 4NF8B 3WAEA 5ISUA 2DE2A 5I57A 1AIVA 4IO5A 3OEMA 4ELPA 4GIZA 1POY1 4QFPA 3TYHA 4F3SA 2VP1A 3OOAA 2HAVA 4NE4A 4ZEFA 4KQPA 2HEUA 2ONKE 3MZBA 4QSCA 4TQUQ 4M4GA 4G68B 1MH3A 3LSWA 5ICQA 1B9JA 2DS9A 3TCFA 3TTLA 4RK9A 2QS3A 3Q27A 1MXVA 3E3KA 3O2AA 5EHSA 2H4IA 1FQAA 3FVNA 5AA4A 5AE4A 3HHGA 1B3LA 2NWJA 4I9DA 4WKMA 3CSBA 1XHYA 1MDP1 2QSXA 1ZTYA 3IB2A 4OFOA 3QYTA 1FQDA 1BIYA 3A3CA 1I6BA 2DWJA 4QF9A 1LGBC 2ZYNA 2HAUA 1YPNA 4GF8A 3MP6A 4BDNA 3A3UA 4F19A 1H44A 4RYAA 2F97A 2P1SA 2F6PA 3DM0A 2OWSA 1S7YA 4MLQA 4C1TA 1Y3QA 5CMKA 2BJJX 1NFTA 1FTLA 2Z22A 3KZGA 3O28A 2ZXTA 1B05A 4AQ4A 5F7VA 3E4RA 3MC2A 1JEUA 1LFIA 2H99A 3TDJA 2I0CA 4LZ7A 4Z0IA 2NVUB 2Y7KA 3FXQA 1PB7A 5HM4B 2Z8DA 5I84A 4ZEBA 2D5WA 5JTYB 4OXVA 2ALUA 1LLSA 4EQ9A 1B6HA 1Z7NE 1B7HA 3L6HA 3TEPA 2ZYMA 4G2ZA 4F1VA 4KYEA 1US4A 3R7XA 3B6TA 1PB8A 4RJZA 4L17A 3IB1A 1QKAA 3FXRA 2R71A 4RPOA 4H0WA 3PUWE 2I48A 1EZOA 2E0SA 1MXWA 4IO4A 4BDRA 4KHZE 3V83A 2B3BA 2VHAA 3W15C 3PPQA 3R26A 2XX8A 4NMYA 2F36A 5JEIA 3VLWA 3LSFB 3FXUA 3IB0A 1D9VA 1MQDA 2I49A 2M8CA 2QS2A 2XXIA 3IOWA 5I2NA 3GXAA 4FEDA 4RXLA 2F5XA 3TKDA 3VLUA 3TELA 3TZAA 3VVEA 4H65A 1M5CA 2O84X 4WXJA 3RTWB 4R75A 3MJNA 1US5A 2RC7A 1XC1A 2NXOA 2XD2A 5DVFA 1I6AA 2DSFA 2A5TA 3HV1A 3PPRA 1JETA 5DEXA 2CMOA 1P1WA 1FQBA 2PYYA 4R6HA 4G8MA 3EHSA 3ZS6A 3JZJA 2QMWA 2X26A 2ZMBA 4YMAA 3V8XB 1WODA 3CG1A 1OLAA 2D3IA 5B70A 1USYH 2XXTA 3K6WA 3I6VA 4EQ7A 3CI8A 4OERA 5H8HB 3C4MA 1R9LA 1B0LA 1ZJLA 5B7DA 1SI1A 4U2RA 4G77A 4TLLB 1H76A 1HSEA 4GXSB 2E1SA 4NEDA 3RPWA 3EN3A 4LQ2A 1M5BA 2H9BA 3K00A 3FASA 4YU0A 1TWYA 1MDQA 1A55A 3B7DA 3ZKLA 1ANFA 2QL3A 3PPNA 4IB2A 2RCBA 2GFEA 1A99A 1NNKA 5TU0A 4POXA 3TAJA 3TQLA 3C33A 1N04A 3I5OA 4KD5A 2OZZA 4PFTA 1NNTA 5BUUA 3MVWA 4KR5A 1B7UA 4BDOA 1SW4A 1ATGA 5ITPA 1GTKA 5H8NA 5FHMA 3M3KA 4G68C 3H06B 2PMSA 3M8UA 3KG2A 5K2XA 2YPNA 2UVGA 5DTBA 4RPNA 4RY1A 3EF7A 2DQVA 4U21A 1YTVA 3V5AA 2HQ0A 4HW8A 3OMBA 4PFYA 5AA4B 5I56A 2Q2AA 2B3FA 3RY3A 3TFLA 1GGGA 1M5DA 1N3WA 2V25A 1A54A 4ND9A 5I58A 1LSTA 5I2KA 2ONRA 4OEUA 3N5LA 2XXHA 4LZ5A 1NNPA 3TUSA 2HZLA 4XXUA 3Q25A 4H1XA 5AA2B 1NL5A 1Y3NA 3FV2A 3G3KA 5H8FB 2DWHA 3KSXA 3RGYA 2AL4A 1OVTA 3BFTA 5L8DA 1PEBA 4I62A 4DLDA 1QUIA 4I8CA 1MQGA 5JK4A 2RC9A 3E9XA 2O7IA 2F78A 1B52A 4GFRA 2YJPA 2XXXA 3T93B 4R9FA 3U72A 3IX1A 3CIJA 1VR5A 2VOZA 1LCFA 1LB8A 2RCAA 3T22A 4IY6A 4JBZA 1OMPA 5EYFA 3S9MC 2Q88A 3IAZA 1JW4A 4QFOA 4FAJA 4BDQA 4ZS9A 3HPIA 4NF5B 2RKMA 3N6UA 4YAHX 4YICA 4EF2A 4Q30B 3FJGA 4UACA 2Z8EA 2V93A 4OZ9A 5IKBA 5KDTA 4MF3A 3FVOA 5IAIA 1S50A 3G3GA 3Q26A 1POTA 3SEVA 3BBRA 1ZIUA 3KN8A 3W9WA 5I59A 5I2NB 3DLNA 2I3WA 2QS1A 5K2YA 5KZTA 3EHTA 3FJMA 1AH5A 2P0SA 4LONB 1Y20A 1GVCA 2A5TB 1B5IA 3ODBA 3S2VA 5DEXB 4EQBA 2DXRA 1B51A 4ELOA 5ITOA 1SW1A 4LA9A 3C9HA 3PV0E 3IO4A 4NWDA 3QUFA 4G4PA 3MQ9A 5KCJA 3CG3A 1SW2A 2Q9TA 3K6VA 3Q29A 1NH7A 4KI0E 4LZ8A 3O29A 3MVZA 4G8HA 3KEIA 4OYVA 4QRZA 4H6DA 4F18A 1Q35A 2GHBA 5CMMA 3VV5A 3FD3A 3RLFE 1O7TA 1N76A 3T9UA 4YB6A 4ZEDA 5LOMA 3SERA 1VE4A 2IA4A 3OEKA 4GWOA 1BLFA 3H6WA 3MBPA 4G8NA 4ZE8A 2DYXA 1B7ZA 1UTBA 2OBGA 3EPEA 4YB5A 1EZPA 3OO7A 2H25A 2KLFA 2HFBA 1NKXA 4ZEKA 3O9PA 4O3AA 2UYEA 3KFMA 3RTFB 5H8NB 4Q5TA 2ZNSA 1JVYA 4OFLA 2ZYOA 4ZE9A 2F7CA 4POWA 4FORA 1D9YA 2RF1A 3VLVA 3K6UA 4TLMB 4DDDA 4KYSA 3RT6B 4R74A 2DXYA 5AA1A 3LUYA 1MXXA 2XHDA 1EU8A 2O69A 4E0WA 5I56B 2O1LA 3PUZE 4X1DA 1M5FA 5A5XA 2V3UA 4R2FA 5I58B 3O6HA 1PB9A 2GRVA 5TP9A 2H5YA 2F6GA 1URSA 3FIRA 1P1UA 2V84A 1FQFA 3ZKKA 1DTGA 4RK2A 1RYOA 3IJOB 4NF4A 1SDXA 4MFIA 3KN3A 3P7IA 4KPTA 4NWCA 3LR1A 3T9VA 1UQWA 2XXUA 1TFAA 3G7WA 1EZ9A 4H67A 3MWBA 1Q1KA 1F9BA 2UVHA 1MH4A 2XD3A 4GOTA 1UIUA 1MQIA 3FJ7A 1D4NA 1B58A 3M3LA 4N13A 5H8SA 1UTHB 3C35A 4EF1A 3SDFA 4FJPA 2Y84A 4IGTA 3VVDA 4N6PA 1Z7ME 5L9SA 3PD9A 3N94A 3HO7A 1A8EA 1R9QA 1ZKBA 3MUQA 3TCHA 1B3FA 4R9GA 3PGFA 3VXBA 1IZ1A 3R6UA 1I6QA 1JEVA 3MP8A 1B3EA 1CB6A 1IITA 1T0KA 2I58A 3T66A 3O97A 1FTMA 1AOVA 3G3HA 4OHNA 2THIA 4JWYA 4P0GA 4XKNA 4FATA 3C31A 1LAFE 1URGA 1IQ7A 5ICTA 4IGRA 3G3JA 1BP5A 1TXFA 3TTMA 2PT1A 5I59B 2F35A 1WDNA 3PD8A 5TPAA 3SEWA 2UXAA 4JWOA 4NTLA 2FA7A 1XOCA 2X7QA 2V3TA 1VSOA 4OTEA 3H7MA 2FNCA 1SD3A 4ZDMA 4U22A 4ZZEA 1IXCA 3MAMA 1FCKA 3IOVA 1XT8A 4LQ5A 4YKJA 1VFEA 3GZGA 3KOTA 2DVCA 1NH8A 1LAGE 3U8QA 5KCJB 1H43A 2ONSA 1MXZA 5I57B 1LB9A 3ILUB 4G68A 4ELRA 1P1NA 5M2VA 1YCJA 5FTHA 3TPAA 4DZ1A 1NMUA 3N6TA 3EQ1A 3C34A 2HCAA 4PETA 3M3FA 3VE1B 5ELVA 2NUVA 3MVYA 4F22A 4PFWA 1GR2A 2OCUA 4IO7A 2UVIA 2O6AA 4TOZA 4QFLA 1B1XA 3SEUA 2PBWA 1PDAA 4YMBA 4X9TA 2ZNUA 4ZEIA 1FTOA 2O68A 3RUMA 2HXWA 3FVKA 1Y4TA 1GV8A 1MPBA 3ZSFA 1OQGA 4IO3A 4JWXA 2DE3A 4NF6A 1IEJA 4OETA 1MM6A 3QSLA 5HBCA 1IXIA 4FECA 1DPPA 2VGQA 3HHFA 1B3GA 1B3HA 3H6TA 2REJA 3MP1A 5J1DA 3RT8A 2Y7PA 2I3VA 3FZVA 4QFKA 1H45A 4O3CA 2FYIA 1MPDA 1JW1A 3O6IA 1SI0A 1ZU0A 1N84A 3LSLA 3GBAA 3DELB 3VXCA 4I1DA 5JTYA 1MQHA 3SEXA 2DE4A 3AXFA 5TP9B 2OLBA 3VDFA 1JW5A 1IXHA 1SQYA 1A8FA 2CZLA 2PX1A 3TTNA 4QSEA 5DVIA 1MPCA 1QVSA 3PMVA 3VFJA 1LBBA 2DVZA 3JYRA 4ESWA 3S9EA 1DPEA 1BKAA 3KGCA 4HTGA 3Q28A 3PPOA 2G93A 2DWIA 3K1PA 1II5A 2O1MA 4XKPA 5FTIA 1O64A 3CR9A 3LC8A 1RYXA 4AB5A 2I4BA 1QW0A 2XX7A 4JSDA 3CFXA 1QKBA 3KJ7A 2Y7WA 1IUDA 3UORA 3CVGA 3KBRA 4PQJA 1O63A 3IR1A 3K1NA 1FW0A 2XXVA 4HCYA 3T96B 4AB6A 4UA8A 3K02A 3FGSA 3EHUA 4U23A 4ESXA 3QXMA 2F34A 4F1UA 3TMGA 4H8JA 4JXIA 2QMXA 4OESA 3TQWA 2UYFA 1LBCA 3IO6A 1LAXA 1QULA 1FTJA 4BLAA 2LAOA 4GLIA 1N7XA 4OMBA 3CRBA 1MM7A 4GL0A 3K6XA 1SW5A 4R72A 3K2DA 3UN6A 3TODA 3UIFA 2ZNTA 1B40A 3ONMA 4XIGQ 1PBQA 1DOTA 4KCCA 1JQFA 3OSQA 4ONYA 2O51A 1B5JA 1LAHE 1ELJA 1NNFA 3SKPA 2RINA 2H98A 5H8QA 2XXWA 5CC2A 2I0BA 4P11A 3FATA 4WEDA 1B1HA 1PBPA 4ISUA 3U1OA 4FEBA 3H6VA 4DIGA 3KN7A 4JSOA 3KJTA 4P0IA 1SYHA 2PT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMC A;  1ZBM A;  4H8I A;  1B4Z A;  3WAF A;  4LUB A;  3C36 A;  4F29 A;  4PP0 A;  4N07 A;  5CMB A;  1MXU A;  3HST A;  3PMX A;  2GH9 A;  1VFD A;  4DXU A;  1B46 A;  4R73 A;  1Y1Z A;  2G29 A;  2ANJ A;  1SBP A;  1Y4C A;  2XXQ A;  4NF6 B;  5AA2 A;  4JB7 A;  3U92 A;  3H03 A;  1AL3 A;  3OEL A;  1R1N A;  4KFQ A;  5H8F A;  3ILT B;  3RN8 A;  2R6G E;  2W7Y A;  1L5T A;  2Q8J A;  3B6Q A;  3CSG A;  5I2K B;  2XXR A;  4ECF A;  3TTR A;  1UIV A;  4C1U A;  3U94 A;  3CFL A;  3H4Z A;  3S9N C;  1BTJ A;  4Z7E A;  1TFD A;  4EUO A;  2O7U A;  1HSL A;  1Y3P A;  2OJT A;  3TTK A;  4OVJ A;  3PUX E;  4XKQ A;  4PE5 B;  3LSX A;  3V89 B;  2D21 A;  3DP6 A;  5CBS A;  3BKI B;  4BDL A;  1D3K A;  5L9O A;  1B4H A;  1J1N A;  4KCD A;  2DP8 A;  4OEN A;  4NF5 A;  1QUJ A;  3RNN A;  2QPQ A;  2Y7R A;  1USY E;  1M5E A;  3IK6 B;  3T9H B;  1A40 A;  4YKP A;  4K3F A;  1MS7 A;  3FVG A;  4EXL A;  3MZ9 A;  1S9T A;  1JNF A;  3H6U A;  1ZLQ A;  1DTZ A;  5BWJ A;  4GD5 A;  4ZEC A;  3OO8 A;  1XS5 A;  3IOR A;  5KDT B;  1R6Z A;  3GLB A;  1B32 A;  1EH3 A;  3S9L C;  4EXK A;  1B2H A;  4DXB A;  2I6E A;  2QS4 A;  3L6G A;  1B5H A;  4FIM A;  3HN0 A;  5AA3 A;  1OVB A;  2F7A A;  3E13 X;  4HCW A;  1MXY A;  4FE8 A;  3D4C A;  4GXA A;  1IIW A;  4QHQ A;  4EDP A;  2IEE A;  1MY1 A;  2F8D A;  4U1O A;  1LCT A;  4NF8 A;  4F1Y A;  1B0H A;  4O3B A;  2REG A;  2QJE A;  1XVX A;  1AMF A;  1URD A;  3SET A;  3SES A;  3T9X B;  1MY3 A;  1LFG A;  1OQH A;  4DXC A;  1MRP A;  1FTK A;  1SVX B;  1TT1 A;  3UA8 A;  2Z8F A;  3ECR A;  4E0X A;  2DOJ A;  3F11 A;  3K0V A;  4IO2 A;  3IJX B;  4YB7 A;  2VD2 A;  4F2Q A;  4OEV A;  3PUV E;  4Q0C A;  1JVX A;  2QRY A;  2VD3 A;  3OO6 A;  3B6W A;  5CM6 A;  4MBP A;  1P1Q A;  4KYD A;  4C0R A;  4YKI A;  5CI5 A;  4X48 A;  4OQO A;  1HSJ A;  4YZZ A;  3IL1 B;  1MY4 A;  3QUJ A;  3FUZ A;  1OLC A;  3G3F A;  5EHM A;  5DT6 A;  4U4S A;  1I69 A;  3IOU A;  1KWH A;  1SYI A;  3GBB A;  5H8Q B;  4GRK A;  3MPL A;  3HCQ A;  1OIB A;  3TCG A;  3UP9 A;  4YKK A;  4WEP A;  3A09 A;  4R6Y A;  1XVY A;  2WKY A;  3U93 A;  1UTB B;  4MH5 A;  1H3D A;  3OXN A;  3QAX A;  4XKR A;  4R2B A;  4HS7 A;  5DYH A;  1WVJ A;  3G3I A;  4OWD A;  1P99 A;  1MG1 A;  3IOT A;  4F3P A;  3OSR A;  5L9M A;  3N26 A;  4QSD A;  2Y7I A;  2Q89 A;  4BDM A;  4JDF A;  1RKM A;  3O6G A;  3JV9 A;  3LBS A;  5AA2 D;  3OEN A;  1DSN A;  4F3G A;  2V3Q A;  3KSJ A;  4RA1 A;  2X7P A;  4F31 B;  3MZ1 A;  2B65 A;  5A5X B;  2YLN A;  4QFN A;  3W9V A;  4U1Z A;  3DP8 A;  1QUK A;  4X1B A;  4GQO A;  2XXP A;  1PC3 A;  1N3X A;  3MVX A;  4GVO A;  2Q2C A;  3FV1 A;  4NF4 B;  1DMB A;  1UTH A;  4DCX A;  3O66 A;  1A7L A;  4DE8 A;  4ELQ A;  2RC8 A;  3PPP A;  2R9J A;  4OFJ A;  4F2O A;  1N7W A;  2F7B A;  4LAT A;  1N0T A;  2A5S A;  3QK6 A;  3MPK A;  5FHN A;  3OO9 A;  3VVF A;  3UK4 A;  3C32 A;  3H3G A;  1FQE A;  2AL5 A;  2AYS A;  4H5F A;  3SEY A;  3UGW A;  2I4C A;  2GHA A;  1ZMG A;  2NOO A;  1QJM A;  4F3B A;  3PMW A;  5F1Q A;  1LFH A;  2HZK A;  5HPQ A;  3PUY E;  3PU5 A;  4U4X A;  2ESN A;  4MLV A;  5FHO A;  2Z23 A;  4F39 A;  2ABH A;  2PVU A;  2XX9 A;  4R6K A;  2ZYK A;  4IO6 A;  3RQT A;  3D4G A;  3I3V A;  4PFU A;  2XXY A;  2UVJ A;  2AIX A;  2P2A A;  2DWA A;  4M1V A;  1MQJ A;  5H8H A;  4GL8 A;  4LP2 B;  1Y9U A;  3MW0 A;  5DVJ A;  1IXG A;  3DP4 A;  3QIM A;  3K4U A;  4LVQ A;  5CRY A;  1CE2 A;  4XTC Q;  3K1M A;  3BFU A;  4Q8R A;  4IY5 A;  1YAE A;  4DCY A;  5CBR A;  2OK2 A;  4H5G A;  4ZZA A;  3USD A;  4THI A;  5TPA B;  1Y1M A;  2OWT A;  1MY2 A;  1MY0 A;  3CFZ A;  3THI A;  1FQC A;  1P1O A;  3OD7 A;  3K01 A;  3S4U A;  4RNS A;  3KOS A;  4NF8 B;  3WAE A;  5ISU A;  2DE2 A;  5I57 A;  1AIV A;  4IO5 A;  3OEM A;  4ELP A;  4GIZ A;  1POY 1;  4QFP A;  3TYH A;  4F3S A;  2VP1 A;  3OOA A;  2HAV A;  4NE4 A;  4ZEF A;  4KQP A;  2HEU A;  2ONK E;  3MZB A;  4QSC A;  4TQU Q;  4M4G A;  4G68 B;  1MH3 A;  3LSW A;  5ICQ A;  1B9J A;  2DS9 A;  3TCF A;  3TTL A;  4RK9 A;  2QS3 A;  3Q27 A;  1MXV A;  3E3K A;  3O2A A;  5EHS A;  2H4I A;  1FQA A;  3FVN A;  5AA4 A;  5AE4 A;  3HHG A;  1B3L A;  2NWJ A;  4I9D A;  4WKM A;  3CSB A;  1XHY A;  1MDP 1;  2QSX A;  1ZTY A;  3IB2 A;  4OFO A;  3QYT A;  1FQD A;  1BIY A;  3A3C A;  1I6B A;  2DWJ A;  4QF9 A;  1LGB C;  2ZYN A;  2HAU A;  1YPN A;  4GF8 A;  3MP6 A;  4BDN A;  3A3U A;  4F19 A;  1H44 A;  4RYA A;  2F97 A;  2P1S A;  2F6P A;  3DM0 A;  2OWS A;  1S7Y A;  4MLQ A;  4C1T A;  1Y3Q A;  5CMK A;  2BJJ X;  1NFT A;  1FTL A;  2Z22 A;  3KZG A;  3O28 A;  2ZXT A;  1B05 A;  4AQ4 A;  5F7V A;  3E4R A;  3MC2 A;  1JEU A;  1LFI A;  2H99 A;  3TDJ A;  2I0C A;  4LZ7 A;  4Z0I A;  2NVU B;  2Y7K A;  3FXQ A;  1PB7 A;  5HM4 B;  2Z8D A;  5I84 A;  4ZEB A;  2D5W A;  5JTY B;  4OXV A;  2ALU A;  1LLS A;  4EQ9 A;  1B6H A;  1Z7N E;  1B7H A;  3L6H A;  3TEP A;  2ZYM A;  4G2Z A;  4F1V A;  4KYE A;  1US4 A;  3R7X A;  3B6T A;  1PB8 A;  4RJZ A;  4L17 A;  3IB1 A;  1QKA A;  3FXR A;  2R71 A;  4RPO A;  4H0W A;  3PUW E;  2I48 A;  1EZO A;  2E0S A;  1MXW A;  4IO4 A;  4BDR A;  4KHZ E;  3V83 A;  2B3B A;  2VHA A;  3W15 C;  3PPQ A;  3R26 A;  2XX8 A;  4NMY A;  2F36 A;  5JEI A;  3VLW A;  3LSF B;  3FXU A;  3IB0 A;  1D9V A;  1MQD A;  2I49 A;  2M8C A;  2QS2 A;  2XXI A;  3IOW A;  5I2N A;  3GXA A;  4FED A;  4RXL A;  2F5X A;  3TKD A;  3VLU A;  3TEL A;  3TZA A;  3VVE A;  4H65 A;  1M5C A;  2O84 X;  4WXJ A;  3RTW B;  4R75 A;  3MJN A;  1US5 A;  2RC7 A;  1XC1 A;  2NXO A;  2XD2 A;  5DVF A;  1I6A A;  2DSF A;  2A5T A;  3HV1 A;  3PPR A;  1JET A;  5DEX A;  2CMO A;  1P1W A;  1FQB A;  2PYY A;  4R6H A;  4G8M A;  3EHS A;  3ZS6 A;  3JZJ A;  2QMW A;  2X26 A;  2ZMB A;  4YMA A;  3V8X B;  1WOD A;  3CG1 A;  1OLA A;  2D3I A;  5B70 A;  1USY H;  2XXT A;  3K6W A;  3I6V A;  4EQ7 A;  3CI8 A;  4OER A;  5H8H B;  3C4M A;  1R9L A;  1B0L A;  1ZJL A;  5B7D A;  1SI1 A;  4U2R A;  4G77 A;  4TLL B;  1H76 A;  1HSE A;  4GXS B;  2E1S A;  4NED A;  3RPW A;  3EN3 A;  4LQ2 A;  1M5B A;  2H9B A;  3K00 A;  3FAS A;  4YU0 A;  1TWY A;  1MDQ A;  1A55 A;  3B7D A;  3ZKL A;  1ANF A;  2QL3 A;  3PPN A;  4IB2 A;  2RCB A;  2GFE A;  1A99 A;  1NNK A;  5TU0 A;  4POX A;  3TAJ A;  3TQL A;  3C33 A;  1N04 A;  3I5O A;  4KD5 A;  2OZZ A;  4PFT A;  1NNT A;  5BUU A;  3MVW A;  4KR5 A;  1B7U A;  4BDO A;  1SW4 A;  1ATG A;  5ITP A;  1GTK A;  5H8N A;  5FHM A;  3M3K A;  4G68 C;  3H06 B;  2PMS A;  3M8U A;  3KG2 A;  5K2X A;  2YPN A;  2UVG A;  5DTB A;  4RPN A;  4RY1 A;  3EF7 A;  2DQV A;  4U21 A;  1YTV A;  3V5A A;  2HQ0 A;  4HW8 A;  3OMB A;  4PFY A;  5AA4 B;  5I56 A;  2Q2A A;  2B3F A;  3RY3 A;  3TFL A;  1GGG A;  1M5D A;  1N3W A;  2V25 A;  1A54 A;  4ND9 A;  5I58 A;  1LST A;  5I2K A;  2ONR A;  4OEU A;  3N5L A;  2XXH A;  4LZ5 A;  1NNP A;  3TUS A;  2HZL A;  4XXU A;  3Q25 A;  4H1X A;  5AA2 B;  1NL5 A;  1Y3N A;  3FV2 A;  3G3K A;  5H8F B;  2DWH A;  3KSX A;  3RGY A;  2AL4 A;  1OVT A;  3BFT A;  5L8D A;  1PEB A;  4I62 A;  4DLD A;  1QUI A;  4I8C A;  1MQG A;  5JK4 A;  2RC9 A;  3E9X A;  2O7I A;  2F78 A;  1B52 A;  4GFR A;  2YJP A;  2XXX A;  3T93 B;  4R9F A;  3U72 A;  3IX1 A;  3CIJ A;  1VR5 A;  2VOZ A;  1LCF A;  1LB8 A;  2RCA A;  3T22 A;  4IY6 A;  4JBZ A;  1OMP A;  5EYF A;  3S9M C;  2Q88 A;  3IAZ A;  1JW4 A;  4QFO A;  4FAJ A;  4BDQ A;  4ZS9 A;  3HPI A;  4NF5 B;  2RKM A;  3N6U A;  4YAH X;  4YIC A;  4EF2 A;  4Q30 B;  3FJG A;  4UAC A;  2Z8E A;  2V93 A;  4OZ9 A;  5IKB A;  5KDT A;  4MF3 A;  3FVO A;  5IAI A;  1S50 A;  3G3G A;  3Q26 A;  1POT A;  3SEV A;  3BBR A;  1ZIU A;  3KN8 A;  3W9W A;  5I59 A;  5I2N B;  3DLN A;  2I3W A;  2QS1 A;  5K2Y A;  5KZT A;  3EHT A;  3FJM A;  1AH5 A;  2P0S A;  4LON B;  1Y20 A;  1GVC A;  2A5T B;  1B5I A;  3ODB A;  3S2V A;  5DEX B;  4EQB A;  2DXR A;  1B51 A;  4ELO A;  5ITO A;  1SW1 A;  4LA9 A;  3C9H A;  3PV0 E;  3IO4 A;  4NWD A;  3QUF A;  4G4P A;  3MQ9 A;  5KCJ A;  3CG3 A;  1SW2 A;  2Q9T A;  3K6V A;  3Q29 A;  1NH7 A;  4KI0 E;  4LZ8 A;  3O29 A;  3MVZ A;  4G8H A;  3KEI A;  4OYV A;  4QRZ A;  4H6D A;  4F18 A;  1Q35 A;  2GHB A;  5CMM A;  3VV5 A;  3FD3 A;  3RLF E;  1O7T A;  1N76 A;  3T9U A;  4YB6 A;  4ZED A;  5LOM A;  3SER A;  1VE4 A;  2IA4 A;  3OEK A;  4GWO A;  1BLF A;  3H6W A;  3MBP A;  4G8N A;  4ZE8 A;  2DYX A;  1B7Z A;  1UTB A;  2OBG A;  3EPE A;  4YB5 A;  1EZP A;  3OO7 A;  2H25 A;  2KLF A;  2HFB A;  1NKX A;  4ZEK A;  3O9P A;  4O3A A;  2UYE A;  3KFM A;  3RTF B;  5H8N B;  4Q5T A;  2ZNS A;  1JVY A;  4OFL A;  2ZYO A;  4ZE9 A;  2F7C A;  4POW A;  4FOR A;  1D9Y A;  2RF1 A;  3VLV A;  3K6U A;  4TLM B;  4DDD A;  4KYS A;  3RT6 B;  4R74 A;  2DXY A;  5AA1 A;  3LUY A;  1MXX A;  2XHD A;  1EU8 A;  2O69 A;  4E0W A;  5I56 B;  2O1L A;  3PUZ E;  4X1D A;  1M5F A;  5A5X A;  2V3U A;  4R2F A;  5I58 B;  3O6H A;  1PB9 A;  2GRV A;  5TP9 A;  2H5Y A;  2F6G A;  1URS A;  3FIR A;  1P1U A;  2V84 A;  1FQF A;  3ZKK A;  1DTG A;  4RK2 A;  1RYO A;  3IJO B;  4NF4 A;  1SDX A;  4MFI A;  3KN3 A;  3P7I A;  4KPT A;  4NWC A;  3LR1 A;  3T9V A;  1UQW A;  2XXU A;  1TFA A;  3G7W A;  1EZ9 A;  4H67 A;  3MWB A;  1Q1K A;  1F9B A;  2UVH A;  1MH4 A;  2XD3 A;  4GOT A;  1UIU A;  1MQI A;  3FJ7 A;  1D4N A;  1B58 A;  3M3L A;  4N13 A;  5H8S A;  1UTH B;  3C35 A;  4EF1 A;  3SDF A;  4FJP A;  2Y84 A;  4IGT A;  3VVD A;  4N6P A;  1Z7M E;  5L9S A;  3PD9 A;  3N94 A;  3HO7 A;  1A8E A;  1R9Q A;  1ZKB A;  3MUQ A;  3TCH A;  1B3F A;  4R9G A;  3PGF A;  3VXB A;  1IZ1 A;  3R6U A;  1I6Q A;  1JEV A;  3MP8 A;  1B3E A;  1CB6 A;  1IIT A;  1T0K A;  2I58 A;  3T66 A;  3O97 A;  1FTM A;  1AOV A;  3G3H A;  4OHN A;  2THI A;  4JWY A;  4P0G A;  4XKN A;  4FAT A;  3C31 A;  1LAF E;  1URG A;  1IQ7 A;  5ICT A;  4IGR A;  3G3J A;  1BP5 A;  1TXF A;  3TTM A;  2PT1 A;  5I59 B;  2F35 A;  1WDN A;  3PD8 A;  5TPA A;  3SEW A;  2UXA A;  4JWO A;  4NTL A;  2FA7 A;  1XOC A;  2X7Q A;  2V3T A;  1VSO A;  4OTE A;  3H7M A;  2FNC A;  1SD3 A;  4ZDM A;  4U22 A;  4ZZE A;  1IXC A;  3MAM A;  1FCK A;  3IOV A;  1XT8 A;  4LQ5 A;  4YKJ A;  1VFE A;  3GZG A;  3KOT A;  2DVC A;  1NH8 A;  1LAG E;  3U8Q A;  5KCJ B;  1H43 A;  2ONS A;  1MXZ A;  5I57 B;  1LB9 A;  3ILU B;  4G68 A;  4ELR A;  1P1N A;  5M2V A;  1YCJ A;  5FTH A;  3TPA A;  4DZ1 A;  1NMU A;  3N6T A;  3EQ1 A;  3C34 A;  2HCA A;  4PET A;  3M3F A;  3VE1 B;  5ELV A;  2NUV A;  3MVY A;  4F22 A;  4PFW A;  1GR2 A;  2OCU A;  4IO7 A;  2UVI A;  2O6A A;  4TOZ A;  4QFL A;  1B1X A;  3SEU A;  2PBW A;  1PDA A;  4YMB A;  4X9T A;  2ZNU A;  4ZEI A;  1FTO A;  2O68 A;  3RUM A;  2HXW A;  3FVK A;  1Y4T A;  1GV8 A;  1MPB A;  3ZSF A;  1OQG A;  4IO3 A;  4JWX A;  2DE3 A;  4NF6 A;  1IEJ A;  4OET A;  1MM6 A;  3QSL A;  5HBC A;  1IXI A;  4FEC A;  1DPP A;  2VGQ A;  3HHF A;  1B3G A;  1B3H A;  3H6T A;  2REJ A;  3MP1 A;  5J1D A;  3RT8 A;  2Y7P A;  2I3V A;  3FZV A;  4QFK A;  1H45 A;  4O3C A;  2FYI A;  1MPD A;  1JW1 A;  3O6I A;  1SI0 A;  1ZU0 A;  1N84 A;  3LSL A;  3GBA A;  3DEL B;  3VXC A;  4I1D A;  5JTY A;  1MQH A;  3SEX A;  2DE4 A;  3AXF A;  5TP9 B;  2OLB A;  3VDF A;  1JW5 A;  1IXH A;  1SQY A;  1A8F A;  2CZL A;  2PX1 A;  3TTN A;  4QSE A;  5DVI A;  1MPC A;  1QVS A;  3PMV A;  3VFJ A;  1LBB A;  2DVZ A;  3JYR A;  4ESW A;  3S9E A;  1DPE A;  1BKA A;  3KGC A;  4HTG A;  3Q28 A;  3PPO A;  2G93 A;  2DWI A;  3K1P A;  1II5 A;  2O1M A;  4XKP A;  5FTI A;  1O64 A;  3CR9 A;  3LC8 A;  1RYX A;  4AB5 A;  2I4B A;  1QW0 A;  2XX7 A;  4JSD A;  3CFX A;  1QKB A;  3KJ7 A;  2Y7W A;  1IUD A;  3UOR A;  3CVG A;  3KBR A;  4PQJ A;  1O63 A;  3IR1 A;  3K1N A;  1FW0 A;  2XXV A;  4HCY A;  3T96 B;  4AB6 A;  4UA8 A;  3K02 A;  3FGS A;  3EHU A;  4U23 A;  4ESX A;  3QXM A;  2F34 A;  4F1U A;  3TMG A;  4H8J A;  4JXI A;  2QMX A;  4OES A;  3TQW A;  2UYF A;  1LBC A;  3IO6 A;  1LAX A;  1QUL A;  1FTJ A;  4BLA A;  2LAO A;  4GLI A;  1N7X A;  4OMB A;  3CRB A;  1MM7 A;  4GL0 A;  3K6X A;  1SW5 A;  4R72 A;  3K2D A;  3UN6 A;  3TOD A;  3UIF A;  2ZNT A;  1B40 A;  3ONM A;  4XIG Q;  1PBQ A;  1DOT A;  4KCC A;  1JQF A;  3OSQ A;  4ONY A;  2O51 A;  1B5J A;  1LAH E;  1ELJ A;  1NNF A;  3SKP A;  2RIN A;  2H98 A;  5H8Q A;  2XXW A;  5CC2 A;  2I0B A;  4P11 A;  3FAT A;  4WED A;  1B1H A;  1PBP A;  4ISU A;  3U1O A;  4FEB A;  3H6V A;  4DIG A;  3KN7 A;  4JSO A;  3KJT A;  4P0I A;  1SYH A;  2PT2 A; 
#chains in the Genus database with same CATH topology
 5CMC A;  1ZBM A;  4H8I A;  1B4Z A;  1KZ8 A;  3QMF A;  2WX9 A;  3WAF A;  4LUB A;  3C36 A;  4F29 A;  4PP0 A;  4N07 A;  5CMB A;  2GQ1 A;  1MXU A;  2QVR A;  3HST A;  3PMX A;  2GH9 A;  1VFD A;  4DXU A;  1B46 A;  4R73 A;  1Y1Z A;  3MST A;  2G29 A;  4MX6 A;  2QVV A;  2ANJ A;  1SBP A;  1Y4C A;  1FBE A;  2XXQ A;  4NF6 B;  5AA2 A;  4JB7 A;  3U92 A;  3H03 A;  1AL3 A;  3OEL A;  1R1N A;  4KFQ A;  5H8F A;  3ILT B;  3RN8 A;  2R6G E;  4PBH A;  2W7Y A;  4GWY A;  1L5T A;  2Q8J A;  3B6Q A;  4PC9 A;  3CSG A;  5I2K B;  1FPK A;  2XXR A;  4ECF A;  3TTR A;  1UIV A;  4C1U A;  3U94 A;  3CFL A;  3H4Z A;  5ET7 A;  3S9N C;  1BTJ A;  4Z7E A;  1TFD A;  4EUO A;  2O7U A;  1HSL A;  1Y3P A;  2OJT A;  3TTK A;  4OVJ A;  3PUX E;  4GWZ A;  4XKQ A;  4P1L A;  4PE5 B;  3LSX A;  3V89 B;  2D21 A;  3DP6 A;  3KC0 A;  5CBS A;  1Q9D A;  3BKI B;  2FBP A;  4BDL A;  1D3K A;  5L9O A;  1B4H A;  1J1N A;  4KCD A;  1FJ9 A;  2DP8 A;  4OEN A;  4NF5 A;  1QUJ A;  3RNN A;  2QPQ A;  2Y7R A;  1USY E;  1M5E A;  3IK6 B;  3T9H B;  3FXB A;  1A40 A;  4YKP A;  4MMP A;  4K3F A;  1FPD A;  2HHM A;  1MS7 A;  3FVG A;  4UAB A;  1YXI A;  4EXL A;  3MZ9 A;  1S9T A;  1JNF A;  3H6U A;  4I3E A;  1ZLQ A;  1NUW A;  1DTZ A;  5BWJ A;  4GD5 A;  4ZEC A;  3OO8 A;  1XS5 A;  3IOR A;  5KDT B;  1R6Z A;  5ET5 A;  3GLB A;  1B32 A;  1EH3 A;  3S9L C;  4EXK A;  1B2H A;  4DXB A;  2I6E A;  2QS4 A;  3L6G A;  2P3V A;  1B5H A;  4FIM A;  3HN0 A;  5AA3 A;  5EQA A;  1OVB A;  2F7A A;  3E13 X;  4HCW A;  1EYK A;  1MXY A;  4FE8 A;  3D4C A;  4GXA A;  1IIW A;  4QHQ A;  4EDP A;  1QGX A;  2IEE A;  1MY1 A;  2F8D A;  4U1O A;  4MNP A;  2QVU A;  1LCT A;  4NF8 A;  4F1Y A;  1B0H A;  4O3B A;  5J16 A;  2REG A;  2QJE A;  2XA5 A;  1XVX A;  1AMF A;  1RDY A;  1URD A;  3SET A;  3SES A;  3T9X B;  1MY3 A;  1LFG A;  1OQH A;  4DXC A;  1MRP A;  4N8G A;  1FTK A;  1SVX B;  1TT1 A;  3UA8 A;  2Z8F A;  3ECR A;  4E0X A;  2DOJ A;  3F11 A;  3K0V A;  4IO2 A;  3IJX B;  4YB7 A;  2VD2 A;  4F2Q A;  4G61 A;  4OEV A;  3PUV E;  4Q0C A;  1JVX A;  2QRY A;  2PFZ A;  2VD3 A;  3OO6 A;  3B6W A;  2XWO A;  5CM6 A;  4MBP A;  1P1Q A;  4KYD A;  4C0R A;  4YKI A;  5CI5 A;  4X48 A;  4OQO A;  1HSJ A;  4YZZ A;  3IL1 B;  1MY4 A;  4O7M A;  3QUJ A;  3FUZ A;  1OLC A;  3G3F A;  5EHM A;  5DT6 A;  4U4S A;  1FSA A;  1I69 A;  4PF8 A;  3IOU A;  1KWH A;  1SYI A;  3GBB A;  5H8Q B;  4GRK A;  3MPL A;  3HCQ A;  1OIB A;  3TCG A;  3UP9 A;  4YKK A;  4WEP A;  3A09 A;  4R6Y A;  1XVY A;  2WKY A;  1NV7 A;  3U93 A;  1UTB B;  4MH5 A;  1H3D A;  3OXN A;  3QAX A;  4XKR A;  4R2B A;  4HS7 A;  5DYH A;  1WVJ A;  3G3I A;  4OWD A;  1P99 A;  1MG1 A;  4P47 A;  3IOT A;  4F3P A;  3OSR A;  5L9M A;  3N26 A;  4QSD A;  2Y7I A;  2Q89 A;  4BDM A;  4JDF A;  1RKM A;  3O6G A;  3JV9 A;  3LBS A;  5AA2 D;  2CZH A;  3OEN A;  1DSN A;  4F3G A;  2V3Q A;  2OX3 A;  3KSJ A;  4RA1 A;  2X7P A;  4F31 B;  3MZ1 A;  2B65 A;  4NF0 A;  5A5X B;  2YLN A;  4QFN A;  2CEY A;  3W9V A;  4U1Z A;  3DP8 A;  1QUK A;  4PGN A;  5DW8 A;  4X1B A;  4GQO A;  2XXP A;  1PC3 A;  1N3X A;  3MVX A;  1IME A;  4GVO A;  1CNQ A;  2Q2C A;  3FV1 A;  4NF4 B;  4N81 A;  2DDK A;  1DMB A;  1UTH A;  4PBQ A;  4OVR A;  4DCX A;  3O66 A;  1A7L A;  5ESY A;  1FPI A;  4DE8 A;  4ELQ A;  2RC8 A;  3PPP A;  1BK4 A;  2R9J A;  4OFJ A;  4F2O A;  2WEF A;  1N7W A;  2F7B A;  4LAT A;  3MYU A;  1N0T A;  2A5S A;  3QK6 A;  3MPK A;  3B8B A;  5FHN A;  1EYJ A;  4OVP A;  3OO9 A;  3D1R A;  3VVF A;  3UK4 A;  3C32 A;  4GX4 A;  3H3G A;  1FQE A;  2AL5 A;  2AYS A;  4H5F A;  3SEY A;  3UGW A;  2I4C A;  2GHA A;  1ZMG A;  2NOO A;  1QJM A;  4F3B A;  3PMW A;  5F1Q A;  1IMD A;  4NGU A;  1LFH A;  2HZK A;  5HPQ A;  3PUY E;  1LBZ A;  3PU5 A;  4U4X A;  2ESN A;  4LN5 A;  4MLV A;  5FHO A;  2Z23 A;  4F39 A;  2ABH A;  2PVU A;  4MHF A;  2XX9 A;  4R6K A;  2ZYK A;  4IO6 A;  3RQT A;  2KQZ A;  3D4G A;  3I3V A;  1K9Z A;  4PFU A;  2XXY A;  2UVJ A;  2AIX A;  2P2A A;  2DWA A;  4M1V A;  1MQJ A;  5H8H A;  4GL8 A;  4LP2 B;  1Y9U A;  3MW0 A;  5DVJ A;  1IXG A;  3DP4 A;  3QIM A;  3K4U A;  4LVQ A;  5CRY A;  5ET8 A;  3BIH A;  1CE2 A;  4XTC Q;  3K1M A;  3BFU A;  4Q8R A;  4IY5 A;  1YAE A;  4DCY A;  5CBR A;  2OK2 A;  4H5G A;  4H46 A;  1FBD A;  4ZZA A;  3USD A;  4THI A;  1FPF A;  5TPA B;  1Y1M A;  2OWT A;  1MY2 A;  1MY0 A;  3CFZ A;  3THI A;  1FQC A;  1P1O A;  3OD7 A;  5IZ3 A;  3K01 A;  2R8T A;  3S4U A;  4RNS A;  3KOS A;  4NF8 B;  4GBV A;  3WAE A;  5ISU A;  2DE2 A;  3KC1 A;  5I57 A;  1AIV A;  4IO5 A;  3RPL B;  3OEM A;  3A29 A;  4ELP A;  4GIZ A;  1POY 1;  4QFP A;  3TYH A;  4F3S A;  2VP1 A;  3OOA A;  2HAV A;  4NE4 A;  4ZEF A;  4KQP A;  2HEU A;  2ONK E;  3MZB A;  4QSC A;  4TQU Q;  4M4G A;  2B4L A;  4G68 B;  3E78 A;  1MH3 A;  3LSW A;  5ICQ A;  1B9J A;  2DS9 A;  3TCF A;  3TTL A;  4RK9 A;  2QS3 A;  3Q27 A;  5LTC A;  1MXV A;  3E3K A;  3O2A A;  5EHS A;  2H4I A;  1FQA A;  3FVN A;  5AA4 A;  4OVS A;  5AE4 A;  3T0J A;  3HHG A;  5F24 A;  1B3L A;  2NWJ A;  4I9D A;  4WKM A;  3CSB A;  1XHY A;  1MDP 1;  4MAG A;  2QSX A;  1ZTY A;  3IB2 A;  4OFO A;  4PF6 A;  1NUY A;  3QYT A;  1FQD A;  1BIY A;  4OA4 A;  3A3C A;  1I6B A;  2DWJ A;  4QF9 A;  1LGB C;  2BJI A;  4XF5 A;  2ZYN A;  2HAU A;  1G0I A;  1YPN A;  4GF8 A;  3MP6 A;  4OVQ A;  4BDN A;  3A3U A;  4NG7 A;  4F19 A;  4GX3 A;  1H44 A;  4RYA A;  2F97 A;  2P1S A;  2F6P A;  3DM0 A;  2OWS A;  1S7Y A;  4MLQ A;  4C1T A;  1Y3Q A;  5CMK A;  1XI6 A;  2BJJ X;  1NFT A;  1FTL A;  3O28 A;  2Z22 A;  3KZG A;  2JJK A;  2ZXT A;  2WYP A;  1B05 A;  4AQ4 A;  5F7V A;  3E4R A;  3MC2 A;  1FBH A;  1JEU A;  1LFI A;  2H99 A;  3TDJ A;  2I0C A;  4LZ7 A;  4Z0I A;  2NVU B;  2Y7K A;  3FXQ A;  1PB7 A;  5HM4 B;  2Z8D A;  5I84 A;  4ZEB A;  2D5W A;  5JTY B;  4OXV A;  2ALU A;  1LLS A;  2PCR A;  4EQ9 A;  3BIG A;  1B6H A;  1Z7N E;  1B7H A;  3L6H A;  3TEP A;  2ZYM A;  4G2Z A;  4F1V A;  3U65 A;  4KYE A;  1US4 A;  3R7X A;  3B6T A;  1PB8 A;  4RJZ A;  4L17 A;  4P56 A;  3IB1 A;  1QKA A;  3FXR A;  2R71 A;  4RPO A;  4H0W A;  3PUW E;  2I48 A;  2FVZ A;  2E0S A;  1EZO A;  1MXW A;  4IO4 A;  4BDR A;  4KHZ E;  3V83 A;  2B3B A;  2VHA A;  3W15 C;  3PPQ A;  2XWK A;  3R26 A;  2XX8 A;  4NMY A;  2F36 A;  5JEI A;  3RYD A;  3VLW A;  3LSF B;  3FXU A;  3IB0 A;  1D9V A;  1MQD A;  5EYH A;  2I49 A;  2M8C A;  2QS2 A;  2XXI A;  3IOW A;  5I2N A;  3GXA A;  4FED A;  4RXL A;  2F5X A;  3TKD A;  4XFE A;  3TEL A;  3VLU A;  3TZA A;  3VVE A;  4H65 A;  1M5C A;  2O84 X;  4WXJ A;  3RTW B;  4R75 A;  3MJN A;  1US5 A;  2RC7 A;  1XC1 A;  2NXO A;  2XD2 A;  5DVF A;  1I6A A;  1SPI A;  2DSF A;  2A5T A;  3HV1 A;  3PPR A;  1JET A;  5DEX A;  2CMO A;  1P1W A;  1FQB A;  2HPG A;  2PYY A;  4R6H A;  1IMA A;  4G8M A;  3EHS A;  3ZS6 A;  3JZJ A;  4P8B A;  2QMW A;  2X26 A;  4MCO A;  2ZMB A;  4YMA A;  3V8X B;  1WOD A;  3CG1 A;  1OLA A;  2D3I A;  5B70 A;  1USY H;  2XXT A;  3K6W A;  3I6V A;  4EQ7 A;  3CI8 A;  4OER A;  5H8H B;  3C4M A;  4GX6 A;  1R9L A;  1B0L A;  1ZJL A;  5B7D A;  1SI1 A;  4OAN A;  4U2R A;  4MEV A;  4G77 A;  4TLL B;  1H76 A;  1HSE A;  4GXS B;  2E1S A;  4NED A;  3RPW A;  3EN3 A;  1NV0 A;  4LQ2 A;  1M5B A;  2P3N A;  2H9B A;  3K00 A;  4PTK A;  3FAS A;  4YU0 A;  1TWY A;  1MDQ A;  1A55 A;  3B7D A;  3ZKL A;  1ANF A;  2QL3 A;  3PPN A;  4IB2 A;  2RCB A;  4O8M A;  2GFE A;  1A99 A;  1NNK A;  5TU0 A;  4POX A;  3TAJ A;  3TQL A;  3C33 A;  1N04 A;  3I5O A;  4KD5 A;  2OZZ A;  4PFT A;  1NNT A;  5BUU A;  3MVW A;  4KR5 A;  1B7U A;  1YZ0 A;  2V4C A;  4BDO A;  1SW4 A;  1ATG A;  5ITP A;  1FPG A;  1GTK A;  5H8N A;  5FHM A;  3M3K A;  4G68 C;  3H06 B;  2PMS A;  3M8U A;  5I5P A;  3KG2 A;  5K2X A;  2YPN A;  1FPB A;  4N6D A;  2UVG A;  5DTB A;  4RPN A;  4RY1 A;  3EF7 A;  2DQV A;  4U21 A;  1YTV A;  3V5A A;  2HQ0 A;  4HW8 A;  3OMB A;  4PFY A;  5AA4 B;  5I56 A;  1NUX A;  2Q2A A;  2B3F A;  3RY3 A;  3TFL A;  1GGG A;  1M5D A;  1N3W A;  2V25 A;  2PFY A;  1A54 A;  1INP A;  2HXR A;  4ND9 A;  2Q74 A;  3PTY A;  5I58 A;  1LST A;  5I2K A;  2ONR A;  2VT5 A;  4OEU A;  3N5L A;  2XXH A;  4LZ5 A;  1KA0 A;  1NNP A;  2Y5L A;  3TUS A;  2HZL A;  4XXU A;  1LBV A;  3Q25 A;  2FIX A;  4H1X A;  5AA2 B;  1NL5 A;  1LBY A;  1Y3N A;  3FV2 A;  3G3K A;  5H8F B;  2DWH A;  3KSX A;  3RGY A;  2AL4 A;  1OVT A;  3BFT A;  5L8D A;  5IM2 A;  1PEB A;  4I62 A;  1FBG A;  4DLD A;  1QUI A;  4I8C A;  1MQG A;  4HE1 A;  5JK4 A;  2RC9 A;  3E9X A;  2O7I A;  2F78 A;  1B52 A;  4AS5 A;  4GFR A;  4N4U A;  1NV3 A;  4IR8 A;  2XWV A;  2YJP A;  2XXX A;  3T93 B;  5LDZ A;  4R9F A;  5T3J A;  3U72 A;  2OWZ A;  3IX1 A;  3CIJ A;  1VR5 A;  2VOZ A;  1LCF A;  1LB8 A;  3EKI A;  2RCA A;  3T22 A;  4IY6 A;  4JBZ A;  1OMP A;  5EYF A;  3SZP A;  2Q88 A;  3S9M C;  3IAZ A;  1JW4 A;  4QFO A;  4P1E A;  1NV6 A;  4FAJ A;  2CZI A;  4BDQ A;  4ZS9 A;  5I7I A;  3HPI A;  4NF5 B;  2RKM A;  3N6U A;  4YAH X;  4YIC A;  5EQ8 A;  4EF2 A;  1YYZ A;  4Q30 B;  5EQ7 A;  3FJG A;  4UAC A;  2Z8E A;  2V93 A;  4OZ9 A;  5IKB A;  5KDT A;  4O7I A;  4MF3 A;  3FVO A;  2VPO A;  5IAI A;  1S50 A;  3G3G A;  3Q26 A;  1POT A;  3SEV A;  3BBR A;  1ZIU A;  3KN8 A;  3W9W A;  5I59 A;  5I2N B;  3DLN A;  2I3W A;  2QS1 A;  3ROJ A;  5K2Y A;  5KZT A;  3EHT A;  3FJM A;  4MNI A;  1AH5 A;  5ET6 A;  2P0S A;  4LON B;  1Y20 A;  1KA1 A;  2FHY A;  4NHB A;  1GVC A;  5I3S A;  2A5T B;  1B5I A;  3ODB A;  3S2V A;  3ISP A;  5DEX B;  4EQB A;  4N8Y A;  2DXR A;  1B51 A;  4ELO A;  5ITO A;  1SW1 A;  4LA9 A;  3C9H A;  3CHG A;  3PV0 E;  3LV0 A;  3IO4 A;  4NWD A;  1DBZ A;  4QXD A;  3QUF A;  4G4P A;  3MQ9 A;  4I40 A;  5KCJ A;  3CG3 A;  1K9Y A;  4P9K A;  1SW2 A;  2Q9T A;  3K6V A;  3Q29 A;  1NH7 A;  4KI0 E;  2Q8M A;  4LZ8 A;  1FPJ A;  4MIJ A;  3O29 A;  3MVZ A;  4G8H A;  3KEI A;  4OYV A;  4QRZ A;  4H6D A;  1IMF A;  3B50 A;  3IFA A;  4F18 A;  1Q35 A;  2GHB A;  5CMM A;  3VV5 A;  3FD3 A;  3RLF E;  1O7T A;  1N76 A;  3T9U A;  4YB6 A;  1RDZ A;  4ZED A;  5LOM A;  3SER A;  1VE4 A;  2IA4 A;  3OEK A;  4GWO A;  1BLF A;  3H6W A;  3MBP A;  4G8N A;  4ZE8 A;  2DYX A;  1B7Z A;  1UTB A;  4GWX A;  2OBG A;  3EPE A;  4YB5 A;  1EZP A;  3OO7 A;  3KBZ A;  2H25 A;  2KLF A;  2HFB A;  1NKX A;  4ZEK A;  3O9P A;  4O3A A;  2UYE A;  4PCD A;  4DI4 B;  3KFM A;  4DI3 D;  3RTF B;  5H8N B;  4Q5T A;  2ZNS A;  1JVY A;  4NQ8 A;  4OFL A;  2ZZX A;  1FRP A;  2ZYO A;  4ZE9 A;  2F7C A;  4POW A;  4FOR A;  1D9Y A;  2KR0 A;  5A5L A;  2RF1 A;  3VLV A;  3K6U A;  2CEX A;  4TLM B;  4DDD A;  4KYS A;  3RT6 B;  4R74 A;  2DXY A;  5AA1 A;  4KXP A;  3LUY A;  4NAP A;  1MXX A;  2XHD A;  1EU8 A;  2O69 A;  4E0W A;  5I56 B;  2O1L A;  3PUZ E;  4X1D A;  1M5F A;  5A5X A;  2V3U A;  4R2F A;  5I58 B;  3O6H A;  1PB9 A;  2GRV A;  5TP9 A;  2VPN A;  2H5Y A;  2F6G A;  1URS A;  3FIR A;  1P1U A;  2V84 A;  2WBD A;  1FQF A;  3ZKK A;  4RK2 A;  1DTG A;  4PAI A;  1RYO A;  3IJO B;  4NF4 A;  1FPL A;  1SDX A;  4MFI A;  4N6K A;  4FBP A;  3KN3 A;  3P7I A;  4KPT A;  4NWC A;  3LR1 A;  3T9V A;  1UQW A;  2MKZ A;  2XXU A;  1TFA A;  3G7W A;  1EZ9 A;  4H67 A;  3MWB A;  1Q1K A;  1F9B A;  2UVH A;  1MH4 A;  2XD3 A;  2FIE A;  4GOT A;  1UIU A;  1MQI A;  3FJ7 A;  1D4N A;  1B58 A;  3M3L A;  4N13 A;  5H8S A;  1UTH B;  3C35 A;  4GWS A;  1FTA A;  3SDF A;  4FJP A;  4EF1 A;  2Y84 A;  4IGT A;  3VVD A;  1NV4 A;  4N6P A;  1Z7M E;  5L9S A;  3PD9 A;  3N94 A;  3HO7 A;  4XEQ A;  4MJO A;  1A8E A;  1R9Q A;  1ZKB A;  1RDX A;  3MUQ A;  3TCH A;  1B3F A;  4R9G A;  4PDH A;  3PGF A;  3VXB A;  1IZ1 A;  3T1B A;  1FPE A;  3R6U A;  1I6Q A;  1JEV A;  3MP8 A;  4HE0 A;  1B3E A;  1CB6 A;  1IIT A;  1T0K A;  2I58 A;  3T66 A;  3O97 A;  1FTM A;  1AOV A;  3E79 A;  3G3H A;  4OHN A;  2THI A;  4JWY A;  4P0G A;  4XKN A;  4FAT A;  3C31 A;  1LAF E;  1URG A;  1IQ7 A;  1NV1 A;  5ICT A;  4IGR A;  3G3J A;  3NOH A;  1BP5 A;  1TXF A;  4HXV A;  3TTM A;  4MNC A;  2PT1 A;  5I59 B;  2F35 A;  3GYY A;  1WDN A;  3PD8 A;  4PAK A;  5TPA A;  3SEW A;  2UXA A;  4JWO A;  4NTL A;  2FA7 A;  1XOC A;  2X7Q A;  4O94 A;  1NV2 A;  2V3T A;  1VSO A;  3RPL A;  4OTE A;  3H7M A;  2FNC A;  1SD3 A;  4ZDM A;  1NUZ A;  4U22 A;  4PE3 A;  4ZZE A;  1IXC A;  3MAM A;  5IZ1 A;  1FCK A;  3IOV A;  1XT8 A;  4LQ5 A;  4JVD A;  4YKJ A;  1VFE A;  4HE2 A;  3GZG A;  3KOT A;  2DVC A;  1NH8 A;  5IZ3 B;  1LAG E;  1D9Q A;  2F3B A;  3U8Q A;  5KCJ B;  1H43 A;  4OVT A;  2ONS A;  1MXZ A;  5I57 B;  4QBA A;  1LB9 A;  3ILU B;  4G68 A;  4ELR A;  1P1N A;  1AWB A;  5M2V A;  1YCJ A;  5FTH A;  3TPA A;  4DZ1 A;  1NMU A;  1FJ6 A;  3N6T A;  4AS4 A;  3EQ1 A;  3C34 A;  2QFL A;  2HCA A;  4PET A;  3M3F A;  3VE1 B;  5ELV A;  2NUV A;  3MVY A;  4F22 A;  4PFW A;  1GR2 A;  2OCU A;  4IO7 A;  2UVI A;  2O6A A;  4TOZ A;  4QFL A;  1B1X A;  3SEU A;  2PBW A;  1PDA A;  2ZZV A;  4YMB A;  4X9T A;  2ZNU A;  4ZEI A;  1FTO A;  4X04 A;  2O68 A;  3RUM A;  4GWW A;  1FBF A;  2ZZW A;  2HXW A;  3FVK A;  1Y4T A;  1GV8 A;  4H45 A;  1MPB A;  3ZSF A;  1OQG A;  5IGA A;  4IO3 A;  4JWX A;  2DE3 A;  4NF6 A;  1IEJ A;  4OET A;  1MM6 A;  3QSL A;  3IFC A;  5HBC A;  1IXI A;  4X8R A;  4FEC A;  1DPP A;  2VGQ A;  3HHF A;  1B3G A;  1B3H A;  3H6T A;  2REJ A;  1NI9 A;  3MP1 A;  5J1D A;  4PGP A;  3RT8 A;  2Y7P A;  2I3V A;  3FZV A;  4QFK A;  5FBP A;  4NX1 A;  1H45 A;  4O3C A;  2FYI A;  1MPD A;  1JW1 A;  3O6I A;  1SI0 A;  1ZU0 A;  1N84 A;  4JVI A;  4PFB A;  3LSL A;  4GWU A;  3GBA A;  3DEL B;  3FBP A;  3VXC A;  4I1D A;  5JTY A;  1MQH A;  3SEX A;  2DE4 A;  4I3Y A;  4PFR A;  4N17 A;  1FBC A;  3AXF A;  5TP9 B;  2OLB A;  3VDF A;  5EQ9 A;  4PDD A;  1JW5 A;  4GBW A;  1IXH A;  1SQY A;  1A8F A;  2CZL A;  2PX1 A;  4P3L A;  3TTN A;  4QSE A;  5DVI A;  1MPC A;  1DCU A;  1QVS A;  1LBX A;  3PMV A;  2XWI A;  4PFI A;  3VFJ A;  1LBB A;  2DVZ A;  3JYR A;  4ESW A;  3S9E A;  2CZK A;  1BKA A;  1DPE A;  3KGC A;  4HTG A;  3Q28 A;  3PPO A;  2G93 A;  2DWI A;  3K1P A;  1II5 A;  2O1M A;  4XKP A;  5FTI A;  1G0H A;  1O64 A;  2WYK A;  3CR9 A;  3LC8 A;  1RYX A;  4JVC A;  4AB5 A;  2I4B A;  1QW0 A;  2XX7 A;  4N15 A;  4JSD A;  1EYI A;  3CFX A;  1QKB A;  3KJ7 A;  2Y7W A;  1IUD A;  3UOR A;  3CVG A;  3KBR A;  4PQJ A;  1O63 A;  4N91 A;  2XXK A;  3IR1 A;  2WBB A;  3K1N A;  1FW0 A;  3HFU A;  2F3D A;  2XXV A;  4HCY A;  1NV5 A;  4PAF A;  3T96 B;  4AB6 A;  4UA8 A;  1LBW A;  3K02 A;  3FGS A;  3EHU A;  4U23 A;  4ESX A;  3QXM A;  2F34 A;  5IZZ A;  4F1U A;  1VDW A;  3TMG A;  4H8J A;  4JXI A;  2QMX A;  4OES A;  3TQW A;  2UYF A;  1LBC A;  3IO6 A;  1LAX A;  1QUL A;  1FTJ A;  4BLA A;  2LAO A;  4GLI A;  1N7X A;  4OMB A;  3CRB A;  1MM7 A;  4GL0 A;  3K6X A;  1SW5 A;  4R72 A;  3K2D A;  3UN6 A;  3TOD A;  3UIF A;  2ZNT A;  1B40 A;  3ONM A;  4NN3 A;  4XIG Q;  1FBP A;  1LEV A;  1PBQ A;  5EYG A;  1DOT A;  4KCC A;  1JQF A;  3LUZ A;  1IMB A;  3OSQ A;  4ONY A;  2O51 A;  1B5J A;  1LAH E;  1ELJ A;  2Y5K A;  1NNF A;  1DK4 A;  3SKP A;  2RIN A;  2H98 A;  5H8Q A;  2XXW A;  5CC2 A;  2L5V A;  1IMC A;  2I0B A;  1JP4 A;  4P11 A;  3FAT A;  4WED A;  1B1H A;  1PBP A;  4ISU A;  3U1O A;  4FEB A;  3H6V A;  4DIG A;  3KN7 A;  4JSO A;  3KJT A;  4P0I A;  1SYH A;  2PT2 A;  2B4M A; 
#chains in the Genus database with same CATH homology
 5CMC A;  1ZBM A;  4H8I A;  1B4Z A;  3WAF A;  4LUB A;  3C36 A;  4F29 A;  4PP0 A;  4N07 A;  5CMB A;  1MXU A;  3HST A;  3PMX A;  2GH9 A;  1VFD A;  4DXU A;  1B46 A;  4R73 A;  1Y1Z A;  2G29 A;  2ANJ A;  1SBP A;  1Y4C A;  2XXQ A;  4NF6 B;  5AA2 A;  4JB7 A;  3U92 A;  3H03 A;  1AL3 A;  3OEL A;  1R1N A;  4KFQ A;  5H8F A;  3ILT B;  3RN8 A;  2R6G E;  2W7Y A;  1L5T A;  2Q8J A;  3B6Q A;  3CSG A;  5I2K B;  2XXR A;  4ECF A;  3TTR A;  1UIV A;  4C1U A;  3U94 A;  3CFL A;  3H4Z A;  3S9N C;  1BTJ A;  4Z7E A;  1TFD A;  4EUO A;  2O7U A;  1HSL A;  1Y3P A;  2OJT A;  3TTK A;  4OVJ A;  3PUX E;  4XKQ A;  4PE5 B;  3LSX A;  3V89 B;  2D21 A;  3DP6 A;  5CBS A;  3BKI B;  4BDL A;  1D3K A;  5L9O A;  1B4H A;  1J1N A;  4KCD A;  2DP8 A;  4OEN A;  4NF5 A;  1QUJ A;  3RNN A;  2QPQ A;  2Y7R A;  1USY E;  1M5E A;  3IK6 B;  3T9H B;  1A40 A;  4YKP A;  4K3F A;  1MS7 A;  3FVG A;  4EXL A;  3MZ9 A;  1S9T A;  1JNF A;  3H6U A;  1ZLQ A;  1DTZ A;  5BWJ A;  4GD5 A;  4ZEC A;  3OO8 A;  1XS5 A;  3IOR A;  5KDT B;  1R6Z A;  3GLB A;  1B32 A;  1EH3 A;  3S9L C;  4EXK A;  1B2H A;  4DXB A;  2I6E A;  2QS4 A;  3L6G A;  1B5H A;  4FIM A;  3HN0 A;  5AA3 A;  1OVB A;  2F7A A;  3E13 X;  4HCW A;  1MXY A;  4FE8 A;  3D4C A;  4GXA A;  1IIW A;  4QHQ A;  4EDP A;  2IEE A;  1MY1 A;  2F8D A;  4U1O A;  1LCT A;  4NF8 A;  4F1Y A;  1B0H A;  4O3B A;  2REG A;  2QJE A;  1XVX A;  1AMF A;  1URD A;  3SET A;  3SES A;  3T9X B;  1MY3 A;  1LFG A;  1OQH A;  4DXC A;  1MRP A;  1FTK A;  1SVX B;  1TT1 A;  3UA8 A;  2Z8F A;  3ECR A;  4E0X A;  2DOJ A;  3F11 A;  3K0V A;  4IO2 A;  3IJX B;  4YB7 A;  2VD2 A;  4F2Q A;  4OEV A;  3PUV E;  4Q0C A;  1JVX A;  2QRY A;  2VD3 A;  3OO6 A;  3B6W A;  5CM6 A;  4MBP A;  1P1Q A;  4KYD A;  4C0R A;  4YKI A;  5CI5 A;  4X48 A;  4OQO A;  1HSJ A;  4YZZ A;  3IL1 B;  1MY4 A;  3QUJ A;  3FUZ A;  1OLC A;  3G3F A;  5EHM A;  5DT6 A;  4U4S A;  1I69 A;  3IOU A;  1KWH A;  1SYI A;  3GBB A;  5H8Q B;  4GRK A;  3MPL A;  3HCQ A;  1OIB A;  3TCG A;  3UP9 A;  4YKK A;  4WEP A;  3A09 A;  4R6Y A;  1XVY A;  2WKY A;  3U93 A;  1UTB B;  4MH5 A;  1H3D A;  3OXN A;  3QAX A;  4XKR A;  4R2B A;  4HS7 A;  5DYH A;  1WVJ A;  3G3I A;  4OWD A;  1P99 A;  1MG1 A;  3IOT A;  4F3P A;  3OSR A;  5L9M A;  3N26 A;  4QSD A;  2Y7I A;  2Q89 A;  4BDM A;  4JDF A;  1RKM A;  3O6G A;  3JV9 A;  3LBS A;  5AA2 D;  3OEN A;  1DSN A;  4F3G A;  2V3Q A;  3KSJ A;  4RA1 A;  2X7P A;  4F31 B;  3MZ1 A;  2B65 A;  5A5X B;  2YLN A;  4QFN A;  3W9V A;  4U1Z A;  3DP8 A;  1QUK A;  4X1B A;  4GQO A;  2XXP A;  1PC3 A;  1N3X A;  3MVX A;  4GVO A;  2Q2C A;  3FV1 A;  4NF4 B;  1DMB A;  1UTH A;  4DCX A;  3O66 A;  1A7L A;  4DE8 A;  4ELQ A;  2RC8 A;  3PPP A;  2R9J A;  4OFJ A;  4F2O A;  1N7W A;  2F7B A;  4LAT A;  1N0T A;  2A5S A;  3QK6 A;  3MPK A;  5FHN A;  3OO9 A;  3VVF A;  3UK4 A;  3C32 A;  3H3G A;  1FQE A;  2AL5 A;  2AYS A;  4H5F A;  3SEY A;  3UGW A;  2I4C A;  2GHA A;  1ZMG A;  2NOO A;  1QJM A;  4F3B A;  3PMW A;  5F1Q A;  1LFH A;  2HZK A;  5HPQ A;  3PUY E;  3PU5 A;  4U4X A;  2ESN A;  4MLV A;  5FHO A;  2Z23 A;  4F39 A;  2ABH A;  2PVU A;  2XX9 A;  4R6K A;  2ZYK A;  4IO6 A;  3RQT A;  3D4G A;  3I3V A;  4PFU A;  2XXY A;  2UVJ A;  2AIX A;  2P2A A;  2DWA A;  4M1V A;  1MQJ A;  5H8H A;  4GL8 A;  4LP2 B;  1Y9U A;  3MW0 A;  5DVJ A;  1IXG A;  3DP4 A;  3QIM A;  3K4U A;  4LVQ A;  5CRY A;  1CE2 A;  4XTC Q;  3K1M A;  3BFU A;  4Q8R A;  4IY5 A;  1YAE A;  4DCY A;  5CBR A;  2OK2 A;  4H5G A;  4ZZA A;  3USD A;  4THI A;  5TPA B;  1Y1M A;  2OWT A;  1MY2 A;  1MY0 A;  3CFZ A;  3THI A;  1FQC A;  1P1O A;  3OD7 A;  3K01 A;  3S4U A;  4RNS A;  3KOS A;  4NF8 B;  3WAE A;  5ISU A;  2DE2 A;  5I57 A;  1AIV A;  4IO5 A;  3OEM A;  4ELP A;  4GIZ A;  1POY 1;  4QFP A;  3TYH A;  4F3S A;  2VP1 A;  3OOA A;  2HAV A;  4NE4 A;  4ZEF A;  4KQP A;  2HEU A;  2ONK E;  3MZB A;  4QSC A;  4TQU Q;  4M4G A;  4G68 B;  1MH3 A;  3LSW A;  5ICQ A;  1B9J A;  2DS9 A;  3TCF A;  3TTL A;  4RK9 A;  2QS3 A;  3Q27 A;  1MXV A;  3E3K A;  3O2A A;  5EHS A;  2H4I A;  1FQA A;  3FVN A;  5AA4 A;  5AE4 A;  3HHG A;  1B3L A;  2NWJ A;  4I9D A;  4WKM A;  3CSB A;  1XHY A;  1MDP 1;  2QSX A;  1ZTY A;  3IB2 A;  4OFO A;  3QYT A;  1FQD A;  1BIY A;  3A3C A;  1I6B A;  2DWJ A;  4QF9 A;  1LGB C;  2ZYN A;  2HAU A;  1YPN A;  4GF8 A;  3MP6 A;  4BDN A;  3A3U A;  4F19 A;  1H44 A;  4RYA A;  2F97 A;  2P1S A;  2F6P A;  3DM0 A;  2OWS A;  1S7Y A;  4MLQ A;  4C1T A;  1Y3Q A;  5CMK A;  2BJJ X;  1NFT A;  1FTL A;  2Z22 A;  3KZG A;  3O28 A;  2ZXT A;  1B05 A;  4AQ4 A;  5F7V A;  3E4R A;  3MC2 A;  1JEU A;  1LFI A;  2H99 A;  3TDJ A;  2I0C A;  4LZ7 A;  4Z0I A;  2NVU B;  2Y7K A;  3FXQ A;  1PB7 A;  5HM4 B;  2Z8D A;  5I84 A;  4ZEB A;  2D5W A;  5JTY B;  4OXV A;  2ALU A;  1LLS A;  4EQ9 A;  1B6H A;  1Z7N E;  1B7H A;  3L6H A;  3TEP A;  2ZYM A;  4G2Z A;  4F1V A;  4KYE A;  1US4 A;  3R7X A;  3B6T A;  1PB8 A;  4RJZ A;  4L17 A;  3IB1 A;  1QKA A;  3FXR A;  2R71 A;  4RPO A;  4H0W A;  3PUW E;  2I48 A;  1EZO A;  2E0S A;  1MXW A;  4IO4 A;  4BDR A;  4KHZ E;  3V83 A;  2B3B A;  2VHA A;  3W15 C;  3PPQ A;  3R26 A;  2XX8 A;  4NMY A;  2F36 A;  5JEI A;  3VLW A;  3LSF B;  3FXU A;  3IB0 A;  1D9V A;  1MQD A;  2I49 A;  2M8C A;  2QS2 A;  2XXI A;  3IOW A;  5I2N A;  3GXA A;  4FED A;  4RXL A;  2F5X A;  3TKD A;  3VLU A;  3TEL A;  3TZA A;  3VVE A;  4H65 A;  1M5C A;  2O84 X;  4WXJ A;  3RTW B;  4R75 A;  3MJN A;  1US5 A;  2RC7 A;  1XC1 A;  2NXO A;  2XD2 A;  5DVF A;  1I6A A;  2DSF A;  2A5T A;  3HV1 A;  3PPR A;  1JET A;  5DEX A;  2CMO A;  1P1W A;  1FQB A;  2PYY A;  4R6H A;  4G8M A;  3EHS A;  3ZS6 A;  3JZJ A;  2QMW A;  2X26 A;  2ZMB A;  4YMA A;  3V8X B;  1WOD A;  3CG1 A;  1OLA A;  2D3I A;  5B70 A;  1USY H;  2XXT A;  3K6W A;  3I6V A;  4EQ7 A;  3CI8 A;  4OER A;  5H8H B;  3C4M A;  1R9L A;  1B0L A;  1ZJL A;  5B7D A;  1SI1 A;  4U2R A;  4G77 A;  4TLL B;  1H76 A;  1HSE A;  4GXS B;  2E1S A;  4NED A;  3RPW A;  3EN3 A;  4LQ2 A;  1M5B A;  2H9B A;  3K00 A;  3FAS A;  4YU0 A;  1TWY A;  1MDQ A;  1A55 A;  3B7D A;  3ZKL A;  1ANF A;  2QL3 A;  3PPN A;  4IB2 A;  2RCB A;  2GFE A;  1A99 A;  1NNK A;  5TU0 A;  4POX A;  3TAJ A;  3TQL A;  3C33 A;  1N04 A;  3I5O A;  4KD5 A;  2OZZ A;  4PFT A;  1NNT A;  5BUU A;  3MVW A;  4KR5 A;  1B7U A;  4BDO A;  1SW4 A;  1ATG A;  5ITP A;  1GTK A;  5H8N A;  5FHM A;  3M3K A;  4G68 C;  3H06 B;  2PMS A;  3M8U A;  3KG2 A;  5K2X A;  2YPN A;  2UVG A;  5DTB A;  4RPN A;  4RY1 A;  3EF7 A;  2DQV A;  4U21 A;  1YTV A;  3V5A A;  2HQ0 A;  4HW8 A;  3OMB A;  4PFY A;  5AA4 B;  5I56 A;  2Q2A A;  2B3F A;  3RY3 A;  3TFL A;  1GGG A;  1M5D A;  1N3W A;  2V25 A;  1A54 A;  4ND9 A;  5I58 A;  1LST A;  5I2K A;  2ONR A;  4OEU A;  3N5L A;  2XXH A;  4LZ5 A;  1NNP A;  3TUS A;  2HZL A;  4XXU A;  3Q25 A;  4H1X A;  5AA2 B;  1NL5 A;  1Y3N A;  3FV2 A;  3G3K A;  5H8F B;  2DWH A;  3KSX A;  3RGY A;  2AL4 A;  1OVT A;  3BFT A;  5L8D A;  1PEB A;  4I62 A;  4DLD A;  1QUI A;  4I8C A;  1MQG A;  5JK4 A;  2RC9 A;  3E9X A;  2O7I A;  2F78 A;  1B52 A;  4GFR A;  2YJP A;  2XXX A;  3T93 B;  4R9F A;  3U72 A;  3IX1 A;  3CIJ A;  1VR5 A;  2VOZ A;  1LCF A;  1LB8 A;  2RCA A;  3T22 A;  4IY6 A;  4JBZ A;  1OMP A;  5EYF A;  3S9M C;  2Q88 A;  3IAZ A;  1JW4 A;  4QFO A;  4FAJ A;  4BDQ A;  4ZS9 A;  3HPI A;  4NF5 B;  2RKM A;  3N6U A;  4YAH X;  4YIC A;  4EF2 A;  4Q30 B;  3FJG A;  4UAC A;  2Z8E A;  2V93 A;  4OZ9 A;  5IKB A;  5KDT A;  4MF3 A;  3FVO A;  5IAI A;  1S50 A;  3G3G A;  3Q26 A;  1POT A;  3SEV A;  3BBR A;  1ZIU A;  3KN8 A;  3W9W A;  5I59 A;  5I2N B;  3DLN A;  2I3W A;  2QS1 A;  5K2Y A;  5KZT A;  3EHT A;  3FJM A;  1AH5 A;  2P0S A;  4LON B;  1Y20 A;  1GVC A;  2A5T B;  1B5I A;  3ODB A;  3S2V A;  5DEX B;  4EQB A;  2DXR A;  1B51 A;  4ELO A;  5ITO A;  1SW1 A;  4LA9 A;  3C9H A;  3PV0 E;  3IO4 A;  4NWD A;  3QUF A;  4G4P A;  3MQ9 A;  5KCJ A;  3CG3 A;  1SW2 A;  2Q9T A;  3K6V A;  3Q29 A;  1NH7 A;  4KI0 E;  4LZ8 A;  3O29 A;  3MVZ A;  4G8H A;  3KEI A;  4OYV A;  4QRZ A;  4H6D A;  4F18 A;  1Q35 A;  2GHB A;  5CMM A;  3VV5 A;  3FD3 A;  3RLF E;  1O7T A;  1N76 A;  3T9U A;  4YB6 A;  4ZED A;  5LOM A;  3SER A;  1VE4 A;  2IA4 A;  3OEK A;  4GWO A;  1BLF A;  3H6W A;  3MBP A;  4G8N A;  4ZE8 A;  2DYX A;  1B7Z A;  1UTB A;  2OBG A;  3EPE A;  4YB5 A;  1EZP A;  3OO7 A;  2H25 A;  2KLF A;  2HFB A;  1NKX A;  4ZEK A;  3O9P A;  4O3A A;  2UYE A;  3KFM A;  3RTF B;  5H8N B;  4Q5T A;  2ZNS A;  1JVY A;  4OFL A;  2ZYO A;  4ZE9 A;  2F7C A;  4POW A;  4FOR A;  1D9Y A;  2RF1 A;  3VLV A;  3K6U A;  4TLM B;  4DDD A;  4KYS A;  3RT6 B;  4R74 A;  2DXY A;  5AA1 A;  3LUY A;  1MXX A;  2XHD A;  1EU8 A;  2O69 A;  4E0W A;  5I56 B;  2O1L A;  3PUZ E;  4X1D A;  1M5F A;  5A5X A;  2V3U A;  4R2F A;  5I58 B;  3O6H A;  1PB9 A;  2GRV A;  5TP9 A;  2H5Y A;  2F6G A;  1URS A;  3FIR A;  1P1U A;  2V84 A;  1FQF A;  3ZKK A;  1DTG A;  4RK2 A;  1RYO A;  3IJO B;  4NF4 A;  1SDX A;  4MFI A;  3KN3 A;  3P7I A;  4KPT A;  4NWC A;  3LR1 A;  3T9V A;  1UQW A;  2XXU A;  1TFA A;  3G7W A;  1EZ9 A;  4H67 A;  3MWB A;  1Q1K A;  1F9B A;  2UVH A;  1MH4 A;  2XD3 A;  4GOT A;  1UIU A;  1MQI A;  3FJ7 A;  1D4N A;  1B58 A;  3M3L A;  4N13 A;  5H8S A;  1UTH B;  3C35 A;  4EF1 A;  3SDF A;  4FJP A;  2Y84 A;  4IGT A;  3VVD A;  4N6P A;  1Z7M E;  5L9S A;  3PD9 A;  3N94 A;  3HO7 A;  1A8E A;  1R9Q A;  1ZKB A;  3MUQ A;  3TCH A;  1B3F A;  4R9G A;  3PGF A;  3VXB A;  1IZ1 A;  3R6U A;  1I6Q A;  1JEV A;  3MP8 A;  1B3E A;  1CB6 A;  1IIT A;  1T0K A;  2I58 A;  3T66 A;  3O97 A;  1FTM A;  1AOV A;  3G3H A;  4OHN A;  2THI A;  4JWY A;  4P0G A;  4XKN A;  4FAT A;  3C31 A;  1LAF E;  1URG A;  1IQ7 A;  5ICT A;  4IGR A;  3G3J A;  1BP5 A;  1TXF A;  3TTM A;  2PT1 A;  5I59 B;  2F35 A;  1WDN A;  3PD8 A;  5TPA A;  3SEW A;  2UXA A;  4JWO A;  4NTL A;  2FA7 A;  1XOC A;  2X7Q A;  2V3T A;  1VSO A;  4OTE A;  3H7M A;  2FNC A;  1SD3 A;  4ZDM A;  4U22 A;  4ZZE A;  1IXC A;  3MAM A;  1FCK A;  3IOV A;  1XT8 A;  4LQ5 A;  4YKJ A;  1VFE A;  3GZG A;  3KOT A;  2DVC A;  1NH8 A;  1LAG E;  3U8Q A;  5KCJ B;  1H43 A;  2ONS A;  1MXZ A;  5I57 B;  1LB9 A;  3ILU B;  4G68 A;  4ELR A;  1P1N A;  5M2V A;  1YCJ A;  5FTH A;  3TPA A;  4DZ1 A;  1NMU A;  3N6T A;  3EQ1 A;  3C34 A;  2HCA A;  4PET A;  3M3F A;  3VE1 B;  5ELV A;  2NUV A;  3MVY A;  4F22 A;  4PFW A;  1GR2 A;  2OCU A;  4IO7 A;  2UVI A;  2O6A A;  4TOZ A;  4QFL A;  1B1X A;  3SEU A;  2PBW A;  1PDA A;  4YMB A;  4X9T A;  2ZNU A;  4ZEI A;  1FTO A;  2O68 A;  3RUM A;  2HXW A;  3FVK A;  1Y4T A;  1GV8 A;  1MPB A;  3ZSF A;  1OQG A;  4IO3 A;  4JWX A;  2DE3 A;  4NF6 A;  1IEJ A;  4OET A;  1MM6 A;  3QSL A;  5HBC A;  1IXI A;  4FEC A;  1DPP A;  2VGQ A;  3HHF A;  1B3G A;  1B3H A;  3H6T A;  2REJ A;  3MP1 A;  5J1D A;  3RT8 A;  2Y7P A;  2I3V A;  3FZV A;  4QFK A;  1H45 A;  4O3C A;  2FYI A;  1MPD A;  1JW1 A;  3O6I A;  1SI0 A;  1ZU0 A;  1N84 A;  3LSL A;  3GBA A;  3DEL B;  3VXC A;  4I1D A;  5JTY A;  1MQH A;  3SEX A;  2DE4 A;  3AXF A;  5TP9 B;  2OLB A;  3VDF A;  1JW5 A;  1IXH A;  1SQY A;  1A8F A;  2CZL A;  2PX1 A;  3TTN A;  4QSE A;  5DVI A;  1MPC A;  1QVS A;  3PMV A;  3VFJ A;  1LBB A;  2DVZ A;  3JYR A;  4ESW A;  3S9E A;  1DPE A;  1BKA A;  3KGC A;  4HTG A;  3Q28 A;  3PPO A;  2G93 A;  2DWI A;  3K1P A;  1II5 A;  2O1M A;  4XKP A;  5FTI A;  1O64 A;  3CR9 A;  3LC8 A;  1RYX A;  4AB5 A;  2I4B A;  1QW0 A;  2XX7 A;  4JSD A;  3CFX A;  1QKB A;  3KJ7 A;  2Y7W A;  1IUD A;  3UOR A;  3CVG A;  3KBR A;  4PQJ A;  1O63 A;  3IR1 A;  3K1N A;  1FW0 A;  2XXV A;  4HCY A;  3T96 B;  4AB6 A;  4UA8 A;  3K02 A;  3FGS A;  3EHU A;  4U23 A;  4ESX A;  3QXM A;  2F34 A;  4F1U A;  3TMG A;  4H8J A;  4JXI A;  2QMX A;  4OES A;  3TQW A;  2UYF A;  1LBC A;  3IO6 A;  1LAX A;  1QUL A;  1FTJ A;  4BLA A;  2LAO A;  4GLI A;  1N7X A;  4OMB A;  3CRB A;  1MM7 A;  4GL0 A;  3K6X A;  1SW5 A;  4R72 A;  3K2D A;  3UN6 A;  3TOD A;  3UIF A;  2ZNT A;  1B40 A;  3ONM A;  4XIG Q;  1PBQ A;  1DOT A;  4KCC A;  1JQF A;  3OSQ A;  4ONY A;  2O51 A;  1B5J A;  1LAH E;  1ELJ A;  1NNF A;  3SKP A;  2RIN A;  2H98 A;  5H8Q A;  2XXW A;  5CC2 A;  2I0B A;  4P11 A;  3FAT A;  4WED A;  1B1H A;  1PBP A;  4ISU A;  3U1O A;  4FEB A;  3H6V A;  4DIG A;  3KN7 A;  4JSO A;  3KJT A;  4P0I A;  1SYH A;  2PT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...