3KBRA

The crystal structure of cyclohexadienyl dehydratase precursor from pseudomonas aeruginosa pa01
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
231
Chain Sequence
ESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEARFQTLEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKADLMMTDAIEARLQSRLHPELCAVHPQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRMEHWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of cyclohexadienyl dehydratase precursor from Pseudomonas aeruginosa PA01
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
molecule keywords Cyclohexadienyl dehydratase
total genus 75
structure length 231
sequence length 232
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kbrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kbrA02
1CB6A 2PX1A 4NTLA 3EF7A 3I5OA 4IO6A 1S7YA 3T66A 3CSBA 3HV1A 2G29A 5H8FB 1SDXA 1A55A 1FW0A 4FE8A 2XXRA 5DTBA 2PT1A 5M2VA 1B3HA 3UK4A 5TU0A 3ZS6A 4EQ7A 2H99A 4H6DA 1R9QA 4NF8A 3C33A 5I2KB 3SDFA 3TFLA 1H3DA 3MZBA 5BWJA 2O84X 1MY2A 4OENA 1Y3NA 2XHDA 2DOJA 4R2FA 3HN0A 5ELVA 1AMFA 3SEWA 4FJPA 1P1UA 4IB2A 3OOAA 5DVIA 2REGA 3MVZA 4PFYA 5FHNA 1ZLQA 4QFKA 1IIWA 3R6UA 2O1MA 4OTEA 5CMMA 2DE3A 4EQBA 4NE4A 3Q26A 2F36A 4H8JA 4ONYA 2RC8A 3SKPA 1QKAA 1B4ZA 3HCQA 3OEMA 2QS1A 1A8FA 1RKMA 3EHUA 3OELA 3PUWE 2IEEA 1RYXA 3K1MA 4IO2A 4N07A 3LSXA 3SEUA 5AA4A 2O1LA 3T9UA 2OK2A 1SI0A 4QSCA 4FORA 3FIRA 4MLQA 4YZZA 3FGSA 1XC1A 3QYTA 1NL5A 1LCFA 3MAMA 3PMVA 5DT6A 5AE4A 2F35A 4RK9A 4RK2A 5I2NA 4MH5A 4OFOA 1TXFA 4RYAA 2OCUA 3K2DA 3P7IA 3KEIA 3QIMA 4HTGA 4MLVA 5AA3A 3B6QA 3KOSA 5KDTB 1POY1 4R72A 4X1DA 1FCKA 2GFEA 1LLSA 1MPBA 4RJZA 1OMPA 4XIGQ 4IO5A 2I49A 4XKRA 4PFTA 1Z7ME 3OENA 2DE4A 1UTHB 3M3FA 5K2XA 3FXQA 1JW1A 3O97A 5FHOA 4JBZA 4NF5B 2VHAA 4I62A 3TZAA 1Z7NE 2OBGA 5A5XB 3PPNA 3KN8A 1MRPA 4GD5A 3Q25A 2R71A 3V5AA 1R9LA 1BLFA 1D4NA 3RY3A 3H4ZA 4BDOA 4FAJA 2HZLA 3KG2A 1LAGE 3K01A 3IOTA 1BP5A 4FIMA 1I69A 1T0KA 1XVYA 3LUYA 1S50A 4X48A 5AA4B 1N3WA 1Y3PA 5FTHA 4L17A 3N26A 3C4MA 3QK6A 5FTIA 1R6ZA 3MZ1A 1IITA 2OZZA 3W9WA 4GOTA 4DIGA 3IO6A 3O6HA 3LC8A 3PGFA 2NXOA 3HO7A 4U23A 3G3JA 4Z0IA 3WAEA 3LSFB 4TLLB 2Z22A 3UGWA 4JWXA 3S9EA 1D3KA 3ZSFA 4C0RA 2UVHA 4FATA 1H45A 2X7QA 1QJMA 1JW4A 2XX7A 4NF8B 5TP9A 1A54A 3N6UA 3FD3A 2QS2A 1WVJA 3N94A 1EZOA 4YU0A 3G3FA 3TAJA 4FECA 1US4A 4H8IA 1LCTA 1Y4CA 3GZGA 2ONKE 1LGBC 3EHSA 2V3TA 5DEXA 5HBCA 3EQ1A 2VP1A 3TYHA 5IAIA 3TEPA 1PB9A 1B46A 1NNFA 3JV9A 4AB5A 3QSLA 3E9XA 1H76A 2HEUA 3FASA 3E13X 3K1PA 4MFIA 4RA1A 2DWIA 1B2HA 1YTVA 2DVZA 2RC7A 3O6IA 5F1QA 1L5TA 2O7UA 3CFXA 3KZGA 3EHTA 2AIXA 3LSLA 4H67A 1IXHA 3K4UA 4YMAA 3FVOA 1B0HA 1JEUA 2OJTA 2I48A 2O7IA 4G68C 3T9HB 4DXBA 1B5JA 1MXUA 1KWHA 3ZKKA 4R6HA 1NMUA 1AIVA 3O6GA 3Q29A 4GXAA 1MM6A 3OD7A 1JW5A 3OEKA 1SYIA 3TTKA 3G3GA 1B3LA 4ZEKA 1NNPA 3KJ7A 1B32A 4GIZA 2AL4A 4GFRA 4K3FA 4GVOA 3DELB 1B51A 2XXTA 1Q1KA 3K6VA 3O29A 1Y1ZA 1QW0A 2E0SA 2UVGA 5I56A 1M5BA 2XXPA 3K0VA 1SD3A 4O3CA 4F1YA 3A3CA 2ZNUA 1Q35A 3FJMA 3C35A 3R7XA 4KPTA 5IKBA 2NVUB 5L9SA 4BDLA 2Y7KA 2QSXA 5A5XA 2DE2A 3RN8A 2F5XA 1ANFA 2XXYA 1JQFA 2D21A 3I3VA 1EZ9A 4Z7EA 5ICTA 4DZ1A 5EHMA 5I58B 3TCFA 5ICQA 1JEVA 2Z8EA 1GGGA 2I4CA 3MUQA 2LAOA 1FQDA 2HCAA 1POTA 2DS9A 4NMYA 4ZZEA 2UVIA 1MH4A 3M3LA 3VFJA 2F6GA 1NH8A 3KSJA 3PD9A 4HS7A 1MDP1 2P0SA 4P0GA 1HSEA 4F3BA 3KFMA 3PD8A 3MP1A 3FATA 3HHFA 3MC2A 1LFHA 3T22A 2D5WA 4R9FA 4YB6A 3FV2A 2ANJA 2Y7WA 4FEBA 3IOUA 3OSQA 4GWOA 1QULA 4IGRA 4PQJA 1MQHA 4U1ZA 3KBRA 4F18A 3IK6B 1PBPA 2A5TA 2W7YA 4X1BA 4BDNA 1NFTA 1MXVA 1M5DA 1XT8A 3D4GA 1MH3A 4C1TA 2V93A 5KZTA 2H5YA 3U72A 2UYEA 2AL5A 4R6KA 5L9OA 5TP9B 5JTYA 5CMKA 2ZYOA 1FQCA 2A5SA 3PUXE 1IXGA 2IA4A 3PPQA 2VD3A 4ISUA 5L9MA 1P1OA 3GBBA 3S9NC 4R2BA 2YPNA 2Y7PA 5HPQA 2PBWA 1M5EA 3H6UA 2RC9A 3TELA 3DP6A 4JWYA 3CR9A 3WAFA 2F6PA 3B7DA 3S9LC 4KQPA 5CBRA 3OO6A 2Z8FA 5TPAB 1LB8A 3RQTA 4NF4B 4BDQA 3V83A 1OIBA 2XXIA 3FZVA 4KD5A 1OVTA 3PPPA 4R9GA 3TCGA 5KCJA 1O64A 1WODA 1UIUA 3F11A 5CM6A 1H44A 1URDA 4I8CA 1B5HA 1MXZA 1VSOA 2RINA 4UACA 3T9VA 2P2AA 2XX8A 1Y1MA 4F22A 5J1DA 2B3FA 4F2QA 2DVCA 4AB6A 4U2RA 1MPCA 1JETA 4OQOA 1US5A 4YKJA 4FEDA 4GXSB 4EDPA 3LBSA 2FNCA 3TCHA 2PYYA 4KYSA 2CMOA 1MQDA 2Q8JA 3M8UA 1MXXA 1USYH 4ZEIA 3G7WA 3V89B 2H9BA 2THIA 1PC3A 4LP2B 2Z23A 1B1XA 1SBPA 1MM7A 2QS4A 1SW4A 3Q28A 2F7CA 4ZDMA 3OO9A 3IL1B 4G8HA 2B65A 3DP8A 4NF5A 3RNNA 3VLUA 4F31B 2XXVA 5JTYB 1B9JA 1LBBA 3GLBA 3K1NA 1QVSA 3MP6A 1PB8A 5CI5A 1DPEA 3MBPA 4JXIA 5EYFA 4O3AA 4ZE8A 4I1DA 4LZ7A 2PVUA 1F9BA 2PMSA 1BTJA 1GV8A 1II5A 3JZJA 1URSA 1LAHE 2QL3A 5DYHA 1JNFA 5H8QA 4U21A 3FXRA 3SETA 4ELOA 3IB2A 4HCYA 4R73A 4POXA 5I59A 4R6YA 3HPIA 4NF6B 2HQ0A 3A3UA 4RPOA 4F1UA 1I6BA 1MPDA 1N84A 3LSWA 3MVXA 4GF8A 4TOZA 3TKDA 3TTMA 1R1NA 3H7MA 3RUMA 4LUBA 3U1OA 3FVGA 4NWDA 4XTCQ 2I3WA 4YKPA 3OO8A 1P1NA 3TQLA 3HSTA 3QUFA 5I2NB 2UVJA 4R74A 3PUYE 4UA8A 3VVEA 2Q9TA 2DXRA 5I59B 3IAZA 3IO4A 4OEUA 3MPKA 4H0WA 1HSJA 1AH5A 1QUJA 2OLBA 3DM0A 1MY3A 1OLAA 2Y7IA 3RTWB 4IO4A 2ZNSA 1YAEA 3BKIB 3RT8A 4BDMA 4NF4A 1B4HA 3IOVA 3TTLA 1TT1A 3PU5A 2I6EA 1MQGA 4PFUA 2DXYA 3O2AA 3O9PA 4QSDA 4OWDA 1OVBA 1LSTA 2H98A 2I0BA 1NKXA 3CI8A 2WKYA 3KOTA 3OXNA 2F78A 4IO7A 1Y20A 4Q5TA 4ZEDA 4P11A 4ZE9A 3K02A 3SESA 1MQJA 3QUJA 4Q8RA 4XKPA 3MZ9A 5B7DA 1ATGA 3PPRA 4OEVA 4DLDA 5AA1A 1H43A 2YLNA 1A7LA 1MXWA 2RCBA 2X26A 3QXMA 2KLFA 1FTJA 4JSDA 1IXCA 4YKIA 3USDA 4AQ4A 4G68B 1S9TA 4QHQA 2ESNA 2V84A 1FTLA 2RKMA 3CFZA 3DP4A 3FJGA 3H6TA 3ILUB 5AA2B 1N0TA 1DSNA 4U22A 3JYRA 3K6WA 3KN3A 2F97A 1MG1A 1NNTA 4G77A 4QRZA 5K2YA 3UP9A 5ITPA 3SEVA 3TODA 4ELPA 4OMBA 4THIA 1YPNA 3OSRA 1DMBA 2VOZA 4WKMA 5ISUA 4PE5B 3TQWA 1QUIA 3L6GA 1B3EA 1FQFA 2GHBA 4F3PA 3K6XA 3TMGA 1PEBA 3PMXA 4ECFA 4QFOA 4N13A 5I56B 4DDDA 1BKAA 1FTOA 4RXLA 2V3UA 3ECRA 1OQHA 3LR1A 4LONB 3VVFA 1JVXA 2R9JA 1B7HA 1Y4TA 3E4RA 3U93A 3RLFE 5I57A 3CIJA 1MQIA 1D9YA 1J1NA 3HHGA 5DVJA 3IX1A 1XHYA 3T93B 3TDJA 1XS5A 3QAXA 1I6AA 1ELJA 4QFNA 4DCXA 4TLMB 4HW8A 1B7ZA 1LAXA 2XXXA 4GL0A 2F7BA 4N6PA 3U94A 1B52A 2GHAA 1M5FA 1M5CA 3H03A 2ZNTA 3OO7A 5H8FA 2QMWA 4OFJA 5CMBA 1TFAA 1WDNA 1TFDA 2Q89A 4MF3A 5I2KA 2ZYKA 3K00A 4OVJA 4KYDA 3S4UA 4POWA 4YMBA 2F34A 4OZ9A 3PPOA 4KYEA 3W15C 1P99A 2O6AA 2UXAA 4IO3A 1PBQA 3VXBA 4F29A 4GRKA 1HSLA 1MY1A 2HAUA 1VE4A 2M8CA 3CVGA 3RTFB 1N7WA 3BBRA 2HAVA 3EN3A 4Q30B 1NNKA 4ZECA 3IJOB 1LBCA 3VE1B 4YB7A 4YKKA 5FHMA 1CE2A 2Q2CA 5B70A 1SI1A 4ND9A 2NUVA 1RYOA 4IY5A 3H06B 2GRVA 1UTHA 1FQEA 4GLIA 2VGQA 4KI0E 1Y9UA 2DWAA 2H4IA 1IQ7A 3MP8A 3MQ9A 4IGTA 3RGYA 4BDRA 3ONMA 1URGA 1N3XA 2AYSA 3IOWA 4OHNA 3TUSA 4I9DA 4DXUA 1B40A 1N04A 1IZ1A 4H5FA 4F1VA 1BIYA 4GQOA 5LOMA 2DWHA 3VV5A 2GH9A 1TWYA 1VFDA 3G3KA 1MY0A 2NOOA 2I3VA 3MWBA 5KCJB 5BUUA 3GBAA 2Y84A 3H3GA 1OQGA 4OESA 4E0WA 1LFIA 3KSXA 3EPEA 3UIFA 3O66A 1EZPA 2HZKA 2XD3A 2D3IA 5TPAA 3FV1A 3THIA 4DCYA 5I57B 5KDTA 1ZBMA 4NWCA 2ZMBA 3BFTA 1NH7A 3VVDA 5JEIA 2O69A 2XXWA 3MJNA 4G8MA 3ZKLA 1GTKA 4TQUQ 3UORA 4KFQA 3B6WA 3DLNA 4G8NA 4RPNA 1LFGA 2QPQA 1SVXB 1XOCA 4OXVA 5DVFA 4LQ5A 1GVCA 4ESXA 3MVWA 1UTBB 3KN7A 4XKNA 2REJA 1PDAA 1UQWA 4Q0CA 2Z8DA 4ELQA 4U4SA 4KCCA 4F2OA 3VLWA 1SYHA 1MY4A 2NWJA 3I6VA 3KJTA 3KGCA 2CZLA 1VFEA 2ALUA 3G3IA 4F3SA 3H6WA 3IB0A 4F3GA 3RPWA 1ZMGA 1A40A 1QUKA 4OFLA 4XXUA 4DE8A 5H8HA 1MS7A 1B1HA 3IR1A 4KHZE 3IB1A 4GL8A 4DXCA 3C9HA 2RF1A 4EUOA 3S9MC 1P1WA 2F8DA 3D4CA 3FJ7A 3PUZE 4RNSA 5H8QB 2XX9A 3O28A 1SW5A 2XXHA 4KR5A 4EXLA 3MPLA 3H6VA 3CG1A 1B5IA 1GR2A 4EF2A 4LZ5A 4F39A 1O7TA 3B6TA 4JSOA 2X7PA 2O68A 4QFPA 5CRYA 3S2VA 4R75A 5I84A 2HFBA 2I4BA 3A09A 3G3HA 4WEDA 5AA2A 5H8NB 2UYFA 2XD2A 3U8QA 4HCWA 1USYE 2QRYA 1B05A 1ZIUA 2I58A 3ODBA 4KCDA 4G2ZA 5H8SA 1B58A 4H5GA 3C32A 1LB9A 2Q2AA 2ZXTA 1FQAA 1ZKBA 1QKBA 2OWSA 4H1XA 4MBPA 3U92A 2HXWA 4ZEFA 1Y3QA 5DEXB 3Q27A 1N76A 2OWTA 4XKQA 4ESWA 2Y7RA 2I0CA 4H65A 1SW1A 4U1OA 5F7VA 4LQ2A 3SEXA 4PETA 3R26A 5CMCA 3TPAA 3UA8A 2P1SA 4E0XA 2YJPA 5JK4A 1EH3A 1IEJA 1SW2A 4LVQA 2ABHA 1FTKA 3AXFA 3VXCA 4M1VA 2E1SA 2ONRA 1ZU0A 2DP8A 4M4GA 4OYVA 3L6HA 1DTGA 2O51A 4ELRA 4LZ8A 5H8HB 1B3FA 2V3QA 3C31A 4NF6A 3CG3A 4WXJA 2XXQA 3CFLA 5I58A 3VDFA 2R6GE 3UN6A 1DOTA 3BFUA 1LAFE 2ONSA 3FVKA 4RY1A 4ZZAA 5L8DA 2QMXA 2B3BA 3TTRA 4EXKA 3T96B 4U4XA 1O63A 3MW0A 3N6TA 3T9XB 1B0LA 2F7AA 2V25A 4LA9A 5H8NA 1P1QA 3N5LA 1FQBA 3SERA 3FUZA 4QFLA 1UTBA 1ZTYA 1FTMA 2ZYMA 3CRBA 1N7XA 1IUDA 3E3KA 5AA2D 2H25A 2BJJX 1EU8A 4G68A 5ITOA 4EQ9A 5CBSA 3GXAA 3TTNA 1A8EA 2RCAA 3K6UA 4G4PA 4X9TA 4PFWA 4JDFA 1UIVA 2DQVA 3C36A 1SQYA 3CSGA 3OMBA 2DSFA 3PUVE 1AL3A 2DYXA 5EHSA 1A99A 5HM4B 2A5TB 1I6QA 1MDQA 2Q88A 3PMWA 4QSEA 4ZEBA 4EF1A 1D9VA 4P0IA 3VLVA 3ILTB 4NEDA 2XXUA 4C1UA 1ZJLA 1DTZA 4YAHX 3FXUA 2FYIA 3RT6B 1OLCA 1XVXA 3M3KA 1B7UA 5CC2A 1B3GA 1MXYA 4JB7A 4WEPA 3W9VA 2ZYNA 3V8XB 4OERA 4OETA 1JVYA 4BLAA 2FA7A 3SEYA 4QF9A 2VD2A 1PB7A 4IY6A 4JWOA 4O3BA 1IXIA 3PV0E 2QS3A 4F19A 2G93A 3MVYA 1VR5A 4YICA 1AOVA 4ZS9A 3IJXB 4PP0A 1B6HA 2PT2A 1YCJA 2QJEA 1DPPA 3C34A 3FVNA 4LATA 4YB5A 2DWJA 3IORA
chains in the Genus database with same CATH superfamily
1CB6A 3T66A 1S7YA 4G61A 1SDXA 4FE8A 3W15C 5DTBA 5M2VA 3UK4A 3ZS6A 5IZ1A 4EQ7A 2FVZA 4JVDA 3MZBA 4O94A 4GX4A 2XHDA 2DOJA 1AMFA 1IIWA 4OTEA 4EQBA 4O7IA 1QKAA 1RKMA 1RYXA 1EYJA 3SEUA 1SI0A 4QSCA 5EYHA 3MAMA 3PMVA 4PF8A 5I2NA 3KEIA 3B6QA 1POY1 1LLSA 4XIGQ 1NUXA 2DE4A 1UTHB 2ZZXA 1JW1A 4OVSA 2VHAA 4DI4B 3PPNA 3RY3A 3H4ZA 4FAJA 1SPIA 1LAGE 1I69A 1T0KA 4X48A 1S50A 5IZ3A 3N26A 3C4MA 3QK6A 3MZ1A 1KA1A 4DIGA 3IO6A 3PGFA 4C0RA 1JW4A 3N6UA 1FBGA 1WVJA 4YU0A 3TAJA 4FECA 1LBYA 1LGBC 5HBCA 5IAIA 3EQ1A 3TEPA 1B46A 3E9XA 4RA1A 5ESYA 2DWIA 2RC7A 3O6IA 3KZGA 3EHTA 2AIXA 3K4UA 4G68C 2O7IA 3ZKKA 1AIVA 1KWHA 3O6GA 3Q29A 1JW5A 3G3GA 1IMDA 3FXBA 4GFRA 1QW0A 2E0SA 4F1YA 2XXPA 2ZNUA 3FJMA 4KPTA 5A5XA 3RN8A 2XXYA 3I3VA 5ICQA 3VFJA 4C1TA 2UVIA 1MH4A 3PD9A 2P0SA 1FBFA 2CEYA 5FHNA 4GWOA 4U1ZA 1IMCA 1MQHA 4F18A 2V4CA 4NHBA 3IK6B 2A5TA 3RPLA 2H5YA 5JTYA 5CMKA 1IXGA 5L9MA 2Y7PA 5HPQA 4JWYA 3CR9A 2F6PA 3OO6A 5TPAB 4PFBA 1OIBA 4KD5A 3PPPA 1O64A 1WODA 3F11A 1H44A 4MNCA 1B5HA 1FPJA 4MCOA 4UACA 2DVCA 4AB6A 4U2RA 1G0HA 4OQOA 4YKJA 3LBSA 3TCHA 4KYSA 1MQDA 2Q8JA 2Q8MA 1NUYA 1USYH 4ZEIA 3V89B 1IMEA 1B1XA 1SBPA 2QS4A 4ZDMA 2F7CA 3IL1B 4F31B 4NF5A 2XXVA 3GLBA 3MP6A 2PVUA 2PMSA 2VPOA 1LAHE 2QL3A 5H8QA 3FXRA 5ET6A 5I59A 4MEVA 4NF6B 4F1UA 1N84A 3MVXA 1R1NA 3RUMA 4LUBA 4NWDA 4XTCQ 1P1NA 3HSTA 1LEVA 2DXRA 2XXKA 4OEUA 4H0WA 1LBZA 3MPKA 1AH5A 2OLBA 3DM0A 1MY3A 3RTWB 4BDMA 4NF4A 1NV7A 1TT1A 3PU5A 3EKIA 2I6EA 3O2AA 4OWDA 1OVBA 2I0BA 2F78A 4Q5TA 4P11A 4N6DA 3PPRA 4DLDA 1KA0A 2B4LA 4GX6A 2RCBA 4AQ4A 2V84A 1FTLA 3DP4A 3FJGA 4HE1A 4P3LA 3UP9A 1DMBA 2VOZA 3PTYA 3L6GA 3LUZA 4PDHA 4N13A 5I56B 1BKAA 4RXLA 2V3UA 4OVRA 4PAKA 1B7HA 4NGUA 4QBAA 3QAXA 1I6AA 1LAXA 2XXXA 2F7BA 4N6PA 1M5FA 1M5CA 3H03A 1TFAA 1YYZA 1WDNA 1TFDA 2Q89A 4E0WA 3PPOA 4GRKA 1HSLA 4KXPA 3RTFB 3VE1B 1RDZA 5FHMA 4ND9A 2MKZA 4KI0E 2DWAA 1URGA 2L5VA 4OHNA 3VV5A 1TWYA 3G3KA 3NOHA 3O66A 5I57B 3THIA 1ZBMA 3T1BA 1GTKA 4P9KA 3SZPA 4I3EA 4RPNA 4PDDA 1XOCA 4LQ5A 4ESXA 1PDAA 2OWZA 4U4SA 4N81A 2CZLA 1VFEA 2ALUA 4F3SA 3IB0A 1QUKA 4OFLA 4XXUA 4GL8A 2F8DA 3D4CA 3FJ7A 3PUZE 2XX9A 4EXLA 2HPGA 4KR5A 3MPLA 1B5IA 1GR2A 2WYPA 4JSOA 1XI6A 3A09A 5AA2A 5H8NB 4HCWA 1B05A 4KCDA 1FPEA 1INPA 1FQAA 1ZKBA 1QKBA 1Y3QA 1N76A 4XKQA 1FPBA 1SW1A 3TPAA 5CMCA 1IEJA 1SW2A 4LVQA 2ABHA 2HHMA 2ONRA 4LZ8A 1B3FA 4NF6A 2XXQA 3CFLA 1DOTA 4RY1A 3TTRA 5L8DA 2B3BA 5H8NA 5AA2B 3N5LA 1FQBA 3FUZA 4MIJA 1UTBA 1ZTYA 2JJKA 1N7XA 1EU8A 1A8EA 1UIVA 1SQYA 3OMBA 2DSFA 3PUVE 5EHSA 1I6QA 2A5TB 2Q88A 3RPLB 4P0IA 2PFYA 4C1UA 1DTZA 4YAHX 2FYIA 1XVXA 1MXYA 5ET5A 1PB7A 4IR8A 4O3BA 3PV0E 4F19A 4I40A 2QJEA 2PX1A 3EF7A 3CSBA 5J16A 1FW0A 2XXRA 2PT1A 1B3HA 2P3NA 2H99A 4H6DA 3SDFA 3C33A 4X04A 5BWJA 2O84X 3GYYA 1FBPA 4R2FA 3SEWA 4FJPA 3OOAA 1IMAA 2REGA 4PC9A 2O1MA 5CMMA 2DE3A 1KZ8A 2F36A 2RC8A 4GX3A 3OEMA 4GWZA 4N07A 5IM2A 3QYTA 1XC1A 5DT6A 4RK9A 4HTGA 1AOVA 5AA3A 3KOSA 4X1DA 2GFEA 1MPBA 3IFAA 4IO5A 2I49A 4PFTA 1Z7ME 3OENA 2XWKA 4JBZA 4NF5B 2OBGA 4GD5A 3V5AA 1D4NA 1BP5A 4JVCA 5IGAA 1FBDA 1N3WA 5FTHA 1IITA 2NXOA 3G3JA 3UGWA 3ZSFA 2QVRA 2UVHA 4PBHA 4NF8B 1A54A 3FD3A 3N94A 1EZOA 1US4A 3EHSA 1H76A 4MFIA 1YTVA 5F1QA 3LSLA 3MSTA 3FVOA 1B0HA 1JEUA 2I48A 3T9HB 4R6HA 1NMUA 1B3LA 2DDKA 4GVOA 3DELB 1Q1KA 3K0VA 1SD3A 4O3CA 3A3CA 4PFIA 3R7XA 2NVUB 5L9SA 4BDLA 2QSXA 1JQFA 2D21A 1EZ9A 4Z7EA 5ICTA 4DZ1A 5I58B 2Z8EA 1FQDA 4NMYA 5I59B 4P0GA 1MDP1 1NUZA 4F3BA 3PD8A 2QFLA 3HHFA 3T22A 2D5WA 4YB6A 2ANJA 2Y7WA 4FEBA 3IOUA 1PBPA 2CEXA 2W7YA 5KZTA 1MXVA 1K9ZA 1XT8A 1MH3A 5L9OA 2V93A 4PCDA 1FQCA 3PUXE 2IA4A 3S9NC 3E79A 2PBWA 3DP6A 3WAFA 4NG7A 2Z8FA 1LB8A 3FZVA 1URDA 4I8CA 1VSOA 2XX8A 1Y1MA 4F22A 4NF0A 1Q9DA 1US5A 4FEDA 4GXSB 1DK4A 4GWWA 1EYIA 4LP2B 1MM7A 4ZEDA 2WBBA 4G8HA 5JTYB 1LBBA 3K1NA 5EYFA 1DPEA 4ZE8A 1GV8A 1II5A 4OVTA 2XWIA 3SETA 1FBHA 3IB2A 2HQ0A 3A3UA 3FVGA 4YKPA 3OO8A 5I2NB 4UA8A 3VVEA 1QUJA 1OLAA 4IO4A 4HE0A 4NN3A 1B4HA 3IOVA 1MQGA 3O9PA 3CI8A 4N4UA 1MQJA 4Q8RA 1H43A 3USDA 3H6TA 3ILUB 3K6WA 4QRZA 3ISPA 2XA5A 4WKMA 4XFEA 5ISUA 2GHBA 1FQFA 3TMGA 4ECFA 1EYKA 3ECRA 3CIJA 3T93B 1J1NA 5DVJA 5F24A 4DCXA 1B7ZA 3U94A 1B52A 5H8FA 4PE3A 4MF3A 5I2KA 2ZYKA 3K00A 3S4UA 4YMBA 4OZ9A 4KYEA 3CVGA 3BBRA 4Q30B 1NNKA 2Q2CA 1RYOA 1UTHA 2VGQA 3MP8A 1IQ7A 3MQ9A 4IGTA 2AYSA 1IZ1A 4H5FA 5LOMA 1BIYA 2GH9A 4I3YA 1MY0A 2NOOA 3MWBA 4OESA 5TPAA 3FV1A 5KDTA 2KQZA 4GBWA 4OVPA 4KFQA 4P8BA 2CZHA 3B6WA 3DLNA 2PFZA 5DVFA 1GVCA 2REJA 1UQWA 4KCCA 3G3IA 3H6WA 4F3GA 3RPWA 1A40A 4KHZE 1B1HA 1LBVA 3IB1A 3C9HA 3S9MC 3H6VA 3CG1A 4F39A 4EF2A 4LZ5A 1O7TA 3B6TA 3S2VA 5I84A 2I4BA 3G3HA 2UYFA 2XD2A 1DBZA 1USYE 2QRYA 1ZIUA 1B58A 1QGXA 4H1XA 2HXWA 5DEXB 4H65A 4U1OA 4PETA 3KC0A 1EH3A 3AXFA 1ZU0A 3C31A 4WXJA 3UN6A 1LAFE 2ONSA 3FVKA 3T96B 4U4XA 1DCUA 1FTMA 2ZYMA 2BJJX 5ITOA 3GXAA 3TTNA 4G4PA 2WYKA 3C36A 1A99A 4ZEBA 4EF1A 1ZJLA 3RT6B 3FBPA 5CC2A 4JB7A 1JVYA 4QF9A 2VD2A 4N8YA 1IXIA 2QS3A 2G93A 4ZS9A 2PT2A 4LATA 2DWJA 4NTLA 5EQ7A 5H8FB 1D9QA 3RYDA 5TU0A 4NF8A 5I2KB 1MY2A 1Y3NA 5ELVA 1P1UA 5IZZA 3MVZA 4PFYA 3R6UA 3Q26A 3SKPA 5LTCA 3HCQA 2QS1A 1A8FA 4IO2A 3K1MA 3LSXA 2OK2A 3FIRA 4MLQA 1FPKA 3FGSA 4YZZA 5AE4A 2F35A 3U65A 4RK2A 4OFOA 2OCUA 3P7IA 5KDTB 1FPDA 1OMPA 3O97A 5FHOA 4I62A 1Z7NE 5A5XB 1MRPA 1R9LA 1RDXA 3K01A 3LUYA 1Y3PA 5FTIA 1R6ZA 2OZZA 3W9WA 4GOTA 1FJ9A 4U23A 3LC8A 4Z0IA 3WAEA 3LSFB 4TLLB 2Z22A 4FATA 4MAGA 2X7QA 1QJMA 2XX7A 4MMPA 1LCTA 2QVVA 3ROJA 5DEXA 3TYHA 2VP1A 1PB9A 1NNFA 3E13X 4X8RA 1L5TA 2DVZA 2O7UA 4H67A 1IXHA 1JP4A 2OJTA 4DXBA 1B5JA 1MXUA 1MM6A 3OD7A 3OEKA 4ZEKA 1NNPA 3KJ7A 2AL4A 4K3FA 3O29A 1Y1ZA 5I56A 1M5BA 1Q35A 2Y7KA 4GWYA 2DE2A 2F5XA 1ANFA 3HFUA 1GGGA 2I4CA 2KR0A 2HCAA 3BIGA 3M3LA 2F6GA 1NH8A 3KSJA 4HS7A 1HSEA 3KFMA 3MP1A 3MC2A 3FV2A 4IGRA 4PQJA 1QULA 3KBRA 4X1BA 1NFTA 3D4GA 2UYEA 4R6KA 5TP9B 2ZYOA 3PPQA 1M5EA 3H6UA 3TELA 2BJIA 3S9LC 4KQPA 5CBRA 4R9GA 3E78A 3LV0A 5J1DA 5A5LA 1MPCA 4LN5A 4EDPA 3KC1A 2PYYA 3M8UA 1MXXA 2WX9A 2H9BA 1PC3A 3OO9A 3RNNA 3VLUA 2HXRA 1K9YA 4N6KA 1QVSA 2Q74A 2PCRA 3MBPA 4JXIA 4LZ7A 1BTJA 1URSA 1JNFA 4U21A 4ELOA 4R73A 4POXA 4R6YA 3LSWA 3TTMA 4MX6A 3TKDA 3H7MA 3U1OA 2I3WA 3TQLA 3QUFA 4R74A 3PUYE 2Q9TA 3IAZA 3IO4A 1HSJA 2Y7IA 2ZNSA 3BKIB 3RT8A 3TTLA 4PFUA 2DXYA 4GBVA 4QSDA 2H98A 2WKYA 3KOTA 4IO7A 1Y20A 1LBWA 3D1RA 3QUJA 4N8GA 3MZ9A 4XKPA 4O7MA 1ATGA 4QXDA 2YLNA 1A7LA 2X26A 3QXMA 4JSDA 1IXCA 4YKIA 4G68B 4QHQA 2ESNA 1N0TA 1DSNA 3KN3A 1MG1A 3TODA 4ELPA 4THIA 1YPNA 3TQWA 1B3EA 3K6XA 1PEBA 4MHFA 1OQHA 3LR1A 4LONB 4MNIA 3VVFA 2R9JA 3U93A 1D9YA 1FRPA 1XS5A 4NQ8A 4GL0A 3QMFA 1NV5A 5T3JA 2ZNTA 2QMWA 5CMBA 4OVJA 4KYDA 4POWA 1P99A 2UXAA 4IO3A 3VXBA 1PBQA 4F29A 1FJ6A 2FIEA 2P3VA 1N7WA 1LBCA 4YKKA 1CE2A 5B70A 1SI1A 2NUVA 4IY5A 3H06B 1FQEA 3IOWA 2ZZVA 1B40A 4F1VA 4GQOA 1VFDA 1NV4A 2I3VA 5KCJB 3GBAA 2Y84A 3H3GA 1OQGA 5I5PA 3KSXA 3EPEA 2HZKA 2XD3A 2D3IA 5IZ3B 2ZMBA 5JEIA 1FPLA 2O69A 2XXWA 4P1EA 4G8NA 1BK4A 3MVWA 4ELQA 4F2OA 3VLWA 2NWJA 1SYHA 1MY4A 3KJTA 3IFCA 1FBEA 1IMFA 5EYGA 4DE8A 4EUOA 5K2XA 1P1WA 4RNSA 5H8QB 2XXHA 4AS5A 4QFPA 5CRYA 4WEDA 2VPNA 3B8BA 3U8QA 3ODBA 2I58A 4H5GA 2ZXTA 5ET7A 4MBPA 2OWSA 3U92A 2I0CA 5F7VA 3R26A 3UA8A 2P1SA 4E0XA 5JK4A 2E1SA 4M4GA 4OYVA 3L6HA 2O51A 2V3QA 3VDFA 4HXVA 2R6GE 1FBCA 4AS4A 4EXKA 4P1LA 4GWSA 1O63A 5I3SA 1B0LA 2V25A 3SERA 4QFLA 4NX1A 1IUDA 2WBDA 3E3KA 2H25A 5AA2D 4G68A 5CBSA 2RCAA 4X9TA 4PFWA 1AL3A 5HM4B 1MDQA 3PMWA 1D9VA 3VLVA 4PTKA 2XXUA 1OLCA 1B7UA 4WEPA 2ZYNA 4OERA 4PFRA 4BLAA 2B4MA 4NAPA 4N15A 3IJXB 1YCJA 1DPPA 3IORA 3I5OA 4IO6A 3HV1A 2G29A 1A55A 1R9QA 4OVQA 3TFLA 1H3DA 4OENA 3HN0A 1FPFA 4IB2A 5DVIA 2GQ1A 1ZLQA 4QFKA 2FHYA 4PBQA 1NI9A 2CZKA 4NE4A 4ONYA 4H8JA 4O8MA 1B4ZA 1VDWA 3PUWE 3EHUA 3OELA 2IEEA 5AA4A 2O1LA 2R8TA 3T9UA 4OA4A 4FORA 1NL5A 1LCFA 4P47A 4MH5A 4RYAA 1TXFA 1IMBA 3K2DA 3QIMA 4MLVA 4R72A 1FCKA 2Y5KA 3CHGA 4RJZA 4XKRA 3M3FA 3FXQA 3TZAA 1NV6A 5EQ9A 3KN8A 2F3BA 4JVIA 3Q25A 2R71A 1BLFA 3BIHA 4BDOA 2OX3A 2HZLA 3KG2A 4PF6A 3IOTA 4FIMA 1XVYA 5AA4B 4L17A 3O6HA 3HO7A 1NV1A 3S9EA 4JWXA 1D3KA 1YZ0A 1H45A 5TP9A 4N91A 2QS2A 3G3FA 4H8IA 1Y4CA 3GZGA 2ONKE 2V3TA 1CNQA 4AB5A 3JV9A 4UABA 3QSLA 2HEUA 3FASA 3K1PA 1B2HA 3CFXA 4YMAA 4GXAA 1SYIA 3TTKA 1B32A 4GIZA 2FBPA 5EQ8A 1B51A 2XXTA 3K6VA 2UVGA 3C35A 5IKBA 5EHMA 3TCFA 1JEVA 3MUQA 2LAOA 1POTA 2DS9A 4ZZEA 3FATA 4XF5A 1LFHA 4R9FA 3OSQA 4BDNA 1M5DA 3U72A 2AL5A 4XEQA 2A5SA 4ISUA 2VD3A 1P1OA 3GBBA 4R2BA 2YPNA 2RC9A 1FPIA 3B7DA 4BDQA 3RQTA 1FPGA 4NF4B 3V83A 4DI3D 2XXIA 2VT5A 3TCGA 1OVTA 5KCJA 1YXIA 1UIUA 5CM6A 5ET8A 2RINA 1MXZA 3T9VA 2P2AA 2B3FA 4F2QA 1JETA 2FNCA 2CMOA 2CZIA 3G7WA 2THIA 2Z23A 3Q28A 1SW4A 1G0IA 2B65A 3DP8A 1RDYA 1B9JA 1PB8A 5CI5A 4O3AA 4I1DA 1F9BA 3JZJA 5DYHA 4OANA 4HCYA 4RPOA 3HPIA 5LDZA 1I6BA 1MPDA 4GF8A 4TOZA 2UVJA 2XWVA 2FIXA 3MYUA 1YAEA 1LSTA 1NKXA 4HE2A 3OXNA 4ZE9A 3K02A 3SESA 2XWOA 5B7DA 4OEVA 5AA1A 1MXWA 2KLFA 1FTJA 1S9TA 2RKMA 3CFZA 1AWBA 3JYRA 4U22A 2F97A 1NNTA 5K2YA 4G77A 1NV2A 5ITPA 1NV3A 3SEVA 4OMBA 3OSRA 4PE5B 1QUIA 4F3PA 3PMXA 4FBPA 4QFOA 4DDDA 1FTOA 1JVXA 1Y4TA 3E4RA 3RLFE 5I57A 1MQIA 3HHGA 3TDJA 3IX1A 1XHYA 4PGPA 1ELJA 4QFNA 4TLMB 4HW8A 1LBXA 5EQAA 2GHAA 3OO7A 3A29A 4OFJA 2F34A 2O6AA 4PGNA 1MY1A 2HAUA 1VE4A 2M8CA 3VVDA 3EN3A 4ZECA 2HAVA 3IJOB 4N17A 4YB7A 2GRVA 4GLIA 4GWXA 4MJOA 1Y9UA 2H4IA 2QVUA 4BDRA 4MNPA 3RGYA 3ONMA 1N3XA 3TUSA 4I9DA 4DXUA 1N04A 2DWHA 5BUUA 1LFIA 3UIFA 1EZPA 4DCYA 4NWCA 3BFTA 1NH7A 4G8MA 3MJNA 3ZKLA 2F3DA 4TQUQ 3UORA 4PAFA 1LFGA 2QPQA 1SVXB 4OXVA 4XKNA 1UTBB 3KN7A 1NUWA 4Q0CA 2Z8DA 4P56A 3I6VA 3KGCA 5I7IA 3T0JA 1ZMGA 5H8HA 1MS7A 3IR1A 4DXCA 2RF1A 3O28A 1SW5A 3KBZA 2X7PA 2O68A 4R75A 5DW8A 2HFBA 5H8SA 4G2ZA 3C32A 1LB9A 2Q2AA 1FTAA 4ZEFA 3Q27A 2OWTA 4ESWA 2Y7RA 4LQ2A 3SEXA 2Y5LA 2YJPA 1FTKA 3VXCA 4M1VA 2DP8A 1DTGA 4ELRA 3B50A 1FSAA 5H8HB 3CG3A 5I58A 3BFUA 4ZZAA 2QMXA 2ZZWA 3MW0A 3N6TA 3T9XB 2F7AA 4LA9A 1P1QA 3CRBA 4H46A 2WEFA 4EQ9A 3K6UA 4JDFA 2DQVA 3CSGA 2DYXA 4QSEA 4PAIA 3ILTB 4NEDA 3FXUA 3M3KA 1B3GA 3W9VA 3V8XB 4OETA 2FA7A 3SEYA 4H45A 4IY6A 4JWOA 5FBPA 1NV0A 3MVYA 1VR5A 4YICA 4GWUA 4PP0A 1B6HA 4YB5A 3FVNA 3C34A
chains in the Genus database with same CATH topology
1CB6A 2PX1A 4NTLA 3EF7A 3I5OA 4IO6A 1S7YA 3T66A 3CSBA 3HV1A 2G29A 5H8FB 1SDXA 1A55A 1FW0A 4FE8A 2XXRA 5DTBA 2PT1A 5M2VA 1B3HA 3UK4A 5TU0A 3ZS6A 4EQ7A 2H99A 4H6DA 1R9QA 4NF8A 3C33A 5I2KB 3SDFA 3TFLA 1H3DA 3MZBA 5BWJA 2O84X 1MY2A 4OENA 1Y3NA 2XHDA 2DOJA 4R2FA 3HN0A 5ELVA 1AMFA 3SEWA 4FJPA 1P1UA 4IB2A 3OOAA 5DVIA 2REGA 3MVZA 4PFYA 5FHNA 1ZLQA 4QFKA 1IIWA 3R6UA 2O1MA 4OTEA 5CMMA 2DE3A 4EQBA 4NE4A 3Q26A 2F36A 4H8JA 4ONYA 2RC8A 3SKPA 1QKAA 1B4ZA 3HCQA 3OEMA 2QS1A 1A8FA 1RKMA 3EHUA 3OELA 3PUWE 2IEEA 1RYXA 3K1MA 4IO2A 4N07A 3LSXA 3SEUA 5AA4A 2O1LA 3T9UA 2OK2A 1SI0A 4QSCA 4FORA 3FIRA 4MLQA 4YZZA 3FGSA 1XC1A 3QYTA 1NL5A 1LCFA 3MAMA 3PMVA 5DT6A 5AE4A 2F35A 4RK9A 4RK2A 5I2NA 4MH5A 4OFOA 1TXFA 4RYAA 2OCUA 3K2DA 3P7IA 3KEIA 3QIMA 4HTGA 4MLVA 5AA3A 3B6QA 3KOSA 5KDTB 1POY1 4R72A 4X1DA 1FCKA 2GFEA 1LLSA 1MPBA 4RJZA 1OMPA 4XIGQ 4IO5A 2I49A 4XKRA 4PFTA 1Z7ME 3OENA 2DE4A 1UTHB 3M3FA 5K2XA 3FXQA 1JW1A 3O97A 5FHOA 4JBZA 4NF5B 2VHAA 4I62A 3TZAA 1Z7NE 2OBGA 5A5XB 3PPNA 3KN8A 1MRPA 4GD5A 3Q25A 2R71A 3V5AA 1R9LA 1BLFA 1D4NA 3RY3A 3H4ZA 4BDOA 4FAJA 2HZLA 3KG2A 1LAGE 3K01A 3IOTA 1BP5A 4FIMA 1I69A 1T0KA 1XVYA 3LUYA 1S50A 4X48A 5AA4B 1N3WA 1Y3PA 5FTHA 4L17A 3N26A 3C4MA 3QK6A 5FTIA 1R6ZA 3MZ1A 1IITA 2OZZA 3W9WA 4GOTA 4DIGA 3IO6A 3O6HA 3LC8A 3PGFA 2NXOA 3HO7A 4U23A 3G3JA 4Z0IA 3WAEA 3LSFB 4TLLB 2Z22A 3UGWA 4JWXA 3S9EA 1D3KA 3ZSFA 4C0RA 2UVHA 4FATA 1H45A 2X7QA 1QJMA 1JW4A 2XX7A 4NF8B 5TP9A 1A54A 3N6UA 3FD3A 2QS2A 1WVJA 3N94A 1EZOA 4YU0A 3G3FA 3TAJA 4FECA 1US4A 4H8IA 1LCTA 1Y4CA 3GZGA 2ONKE 1LGBC 3EHSA 2V3TA 5DEXA 5HBCA 3EQ1A 2VP1A 3TYHA 5IAIA 3TEPA 1PB9A 1B46A 1NNFA 3JV9A 4AB5A 3QSLA 3E9XA 1H76A 2HEUA 3FASA 3E13X 3K1PA 4MFIA 4RA1A 2DWIA 1B2HA 1YTVA 2DVZA 2RC7A 3O6IA 5F1QA 1L5TA 2O7UA 3CFXA 3KZGA 3EHTA 2AIXA 3LSLA 4H67A 1IXHA 3K4UA 4YMAA 3FVOA 1B0HA 1JEUA 2OJTA 2I48A 2O7IA 4G68C 3T9HB 4DXBA 1B5JA 1MXUA 1KWHA 3ZKKA 4R6HA 1NMUA 1AIVA 3O6GA 3Q29A 4GXAA 1MM6A 3OD7A 1JW5A 3OEKA 1SYIA 3TTKA 3G3GA 1B3LA 4ZEKA 1NNPA 3KJ7A 1B32A 4GIZA 2AL4A 4GFRA 4K3FA 4GVOA 3DELB 1B51A 2XXTA 1Q1KA 3K6VA 3O29A 1Y1ZA 1QW0A 2E0SA 2UVGA 5I56A 1M5BA 2XXPA 3K0VA 1SD3A 4O3CA 4F1YA 3A3CA 2ZNUA 1Q35A 3FJMA 3C35A 3R7XA 4KPTA 5IKBA 2NVUB 5L9SA 4BDLA 2Y7KA 2QSXA 5A5XA 2DE2A 3RN8A 2F5XA 1ANFA 2XXYA 1JQFA 2D21A 3I3VA 1EZ9A 4Z7EA 5ICTA 4DZ1A 5EHMA 5I58B 3TCFA 5ICQA 1JEVA 2Z8EA 1GGGA 2I4CA 3MUQA 2LAOA 1FQDA 2HCAA 1POTA 2DS9A 4NMYA 4ZZEA 2UVIA 1MH4A 3M3LA 3VFJA 2F6GA 1NH8A 3KSJA 3PD9A 4HS7A 1MDP1 2P0SA 4P0GA 1HSEA 4F3BA 3KFMA 3PD8A 3MP1A 3FATA 3HHFA 3MC2A 1LFHA 3T22A 2D5WA 4R9FA 4YB6A 3FV2A 2ANJA 2Y7WA 4FEBA 3IOUA 3OSQA 4GWOA 1QULA 4IGRA 4PQJA 1MQHA 4U1ZA 3KBRA 4F18A 3IK6B 1PBPA 2A5TA 2W7YA 4X1BA 4BDNA 1NFTA 1MXVA 1M5DA 1XT8A 3D4GA 1MH3A 4C1TA 2V93A 5KZTA 2H5YA 3U72A 2UYEA 2AL5A 4R6KA 5L9OA 5TP9B 5JTYA 5CMKA 2ZYOA 1FQCA 2A5SA 3PUXE 1IXGA 2IA4A 3PPQA 2VD3A 4ISUA 5L9MA 1P1OA 3GBBA 3S9NC 4R2BA 2YPNA 2Y7PA 5HPQA 2PBWA 1M5EA 3H6UA 2RC9A 3TELA 3DP6A 4JWYA 3CR9A 3WAFA 2F6PA 3B7DA 3S9LC 4KQPA 5CBRA 3OO6A 2Z8FA 5TPAB 1LB8A 3RQTA 4NF4B 4BDQA 3V83A 1OIBA 2XXIA 3FZVA 4KD5A 1OVTA 3PPPA 4R9GA 3TCGA 5KCJA 1O64A 1WODA 1UIUA 3F11A 5CM6A 1H44A 1URDA 4I8CA 1B5HA 1MXZA 1VSOA 2RINA 4UACA 3T9VA 2P2AA 2XX8A 1Y1MA 4F22A 5J1DA 2B3FA 4F2QA 2DVCA 4AB6A 4U2RA 1MPCA 1JETA 4OQOA 1US5A 4YKJA 4FEDA 4GXSB 4EDPA 3LBSA 2FNCA 3TCHA 2PYYA 4KYSA 2CMOA 1MQDA 2Q8JA 3M8UA 1MXXA 1USYH 4ZEIA 3G7WA 3V89B 2H9BA 2THIA 1PC3A 4LP2B 2Z23A 1B1XA 1SBPA 1MM7A 2QS4A 1SW4A 3Q28A 2F7CA 4ZDMA 3OO9A 3IL1B 4G8HA 2B65A 3DP8A 4NF5A 3RNNA 3VLUA 4F31B 2XXVA 5JTYB 1B9JA 1LBBA 3GLBA 3K1NA 1QVSA 3MP6A 1PB8A 5CI5A 1DPEA 3MBPA 4JXIA 5EYFA 4O3AA 4ZE8A 4I1DA 4LZ7A 2PVUA 1F9BA 2PMSA 1BTJA 1GV8A 1II5A 3JZJA 1URSA 1LAHE 2QL3A 5DYHA 1JNFA 5H8QA 4U21A 3FXRA 3SETA 4ELOA 3IB2A 4HCYA 4R73A 4POXA 5I59A 4R6YA 3HPIA 4NF6B 2HQ0A 3A3UA 4RPOA 4F1UA 1I6BA 1MPDA 1N84A 3LSWA 3MVXA 4GF8A 4TOZA 3TKDA 3TTMA 1R1NA 3H7MA 3RUMA 4LUBA 3U1OA 3FVGA 4NWDA 4XTCQ 2I3WA 4YKPA 3OO8A 1P1NA 3TQLA 3HSTA 3QUFA 5I2NB 2UVJA 4R74A 3PUYE 4UA8A 3VVEA 2Q9TA 2DXRA 5I59B 3IAZA 3IO4A 4OEUA 3MPKA 4H0WA 1HSJA 1AH5A 1QUJA 2OLBA 3DM0A 1MY3A 1OLAA 2Y7IA 3RTWB 4IO4A 2ZNSA 1YAEA 3BKIB 3RT8A 4BDMA 4NF4A 1B4HA 3IOVA 3TTLA 1TT1A 3PU5A 2I6EA 1MQGA 4PFUA 2DXYA 3O2AA 3O9PA 4QSDA 4OWDA 1OVBA 1LSTA 2H98A 2I0BA 1NKXA 3CI8A 2WKYA 3KOTA 3OXNA 2F78A 4IO7A 1Y20A 4Q5TA 4ZEDA 4P11A 4ZE9A 3K02A 3SESA 1MQJA 3QUJA 4Q8RA 4XKPA 3MZ9A 5B7DA 1ATGA 3PPRA 4OEVA 4DLDA 5AA1A 1H43A 2YLNA 1A7LA 1MXWA 2RCBA 2X26A 3QXMA 2KLFA 1FTJA 4JSDA 1IXCA 4YKIA 3USDA 4AQ4A 4G68B 1S9TA 4QHQA 2ESNA 2V84A 1FTLA 2RKMA 3CFZA 3DP4A 3FJGA 3H6TA 3ILUB 5AA2B 1N0TA 1DSNA 4U22A 3JYRA 3K6WA 3KN3A 2F97A 1MG1A 1NNTA 4G77A 4QRZA 5K2YA 3UP9A 5ITPA 3SEVA 3TODA 4ELPA 4OMBA 4THIA 1YPNA 3OSRA 1DMBA 2VOZA 4WKMA 5ISUA 4PE5B 3TQWA 1QUIA 3L6GA 1B3EA 1FQFA 2GHBA 4F3PA 3K6XA 3TMGA 1PEBA 3PMXA 4ECFA 4QFOA 4N13A 5I56B 4DDDA 1BKAA 1FTOA 4RXLA 2V3UA 3ECRA 1OQHA 3LR1A 4LONB 3VVFA 1JVXA 2R9JA 1B7HA 1Y4TA 3E4RA 3U93A 3RLFE 5I57A 3CIJA 1MQIA 1D9YA 1J1NA 3HHGA 5DVJA 3IX1A 1XHYA 3T93B 3TDJA 1XS5A 3QAXA 1I6AA 1ELJA 4QFNA 4DCXA 4TLMB 4HW8A 1B7ZA 1LAXA 2XXXA 4GL0A 2F7BA 4N6PA 3U94A 1B52A 2GHAA 1M5FA 1M5CA 3H03A 2ZNTA 3OO7A 5H8FA 2QMWA 4OFJA 5CMBA 1TFAA 1WDNA 1TFDA 2Q89A 4MF3A 5I2KA 2ZYKA 3K00A 4OVJA 4KYDA 3S4UA 4POWA 4YMBA 2F34A 4OZ9A 3PPOA 4KYEA 3W15C 1P99A 2O6AA 2UXAA 4IO3A 1PBQA 3VXBA 4F29A 4GRKA 1HSLA 1MY1A 2HAUA 1VE4A 2M8CA 3CVGA 3RTFB 1N7WA 3BBRA 2HAVA 3EN3A 4Q30B 1NNKA 4ZECA 3IJOB 1LBCA 3VE1B 4YB7A 4YKKA 5FHMA 1CE2A 2Q2CA 5B70A 1SI1A 4ND9A 2NUVA 1RYOA 4IY5A 3H06B 2GRVA 1UTHA 1FQEA 4GLIA 2VGQA 4KI0E 1Y9UA 2DWAA 2H4IA 1IQ7A 3MP8A 3MQ9A 4IGTA 3RGYA 4BDRA 3ONMA 1URGA 1N3XA 2AYSA 3IOWA 4OHNA 3TUSA 4I9DA 4DXUA 1B40A 1N04A 1IZ1A 4H5FA 4F1VA 1BIYA 4GQOA 5LOMA 2DWHA 3VV5A 2GH9A 1TWYA 1VFDA 3G3KA 1MY0A 2NOOA 2I3VA 3MWBA 5KCJB 5BUUA 3GBAA 2Y84A 3H3GA 1OQGA 4OESA 4E0WA 1LFIA 3KSXA 3EPEA 3UIFA 3O66A 1EZPA 2HZKA 2XD3A 2D3IA 5TPAA 3FV1A 3THIA 4DCYA 5I57B 5KDTA 1ZBMA 4NWCA 2ZMBA 3BFTA 1NH7A 3VVDA 5JEIA 2O69A 2XXWA 3MJNA 4G8MA 3ZKLA 1GTKA 4TQUQ 3UORA 4KFQA 3B6WA 3DLNA 4G8NA 4RPNA 1LFGA 2QPQA 1SVXB 1XOCA 4OXVA 5DVFA 4LQ5A 1GVCA 4ESXA 3MVWA 1UTBB 3KN7A 4XKNA 2REJA 1PDAA 1UQWA 4Q0CA 2Z8DA 4ELQA 4U4SA 4KCCA 4F2OA 3VLWA 1SYHA 1MY4A 2NWJA 3I6VA 3KJTA 3KGCA 2CZLA 1VFEA 2ALUA 3G3IA 4F3SA 3H6WA 3IB0A 4F3GA 3RPWA 1ZMGA 1A40A 1QUKA 4OFLA 4XXUA 4DE8A 5H8HA 1MS7A 1B1HA 3IR1A 4KHZE 3IB1A 4GL8A 4DXCA 3C9HA 2RF1A 4EUOA 3S9MC 1P1WA 2F8DA 3D4CA 3FJ7A 3PUZE 4RNSA 5H8QB 2XX9A 3O28A 1SW5A 2XXHA 4KR5A 4EXLA 3MPLA 3H6VA 3CG1A 1B5IA 1GR2A 4EF2A 4LZ5A 4F39A 1O7TA 3B6TA 4JSOA 2X7PA 2O68A 4QFPA 5CRYA 3S2VA 4R75A 5I84A 2HFBA 2I4BA 3A09A 3G3HA 4WEDA 5AA2A 5H8NB 2UYFA 2XD2A 3U8QA 4HCWA 1USYE 2QRYA 1B05A 1ZIUA 2I58A 3ODBA 4KCDA 4G2ZA 5H8SA 1B58A 4H5GA 3C32A 1LB9A 2Q2AA 2ZXTA 1FQAA 1ZKBA 1QKBA 2OWSA 4H1XA 4MBPA 3U92A 2HXWA 4ZEFA 1Y3QA 5DEXB 3Q27A 1N76A 2OWTA 4XKQA 4ESWA 2Y7RA 2I0CA 4H65A 1SW1A 4U1OA 5F7VA 4LQ2A 3SEXA 4PETA 3R26A 5CMCA 3TPAA 3UA8A 2P1SA 4E0XA 2YJPA 5JK4A 1EH3A 1IEJA 1SW2A 4LVQA 2ABHA 1FTKA 3AXFA 3VXCA 4M1VA 2E1SA 2ONRA 1ZU0A 2DP8A 4M4GA 4OYVA 3L6HA 1DTGA 2O51A 4ELRA 4LZ8A 5H8HB 1B3FA 2V3QA 3C31A 4NF6A 3CG3A 4WXJA 2XXQA 3CFLA 5I58A 3VDFA 2R6GE 3UN6A 1DOTA 3BFUA 1LAFE 2ONSA 3FVKA 4RY1A 4ZZAA 5L8DA 2QMXA 2B3BA 3TTRA 4EXKA 3T96B 4U4XA 1O63A 3MW0A 3N6TA 3T9XB 1B0LA 2F7AA 2V25A 4LA9A 5H8NA 1P1QA 3N5LA 1FQBA 3SERA 3FUZA 4QFLA 1UTBA 1ZTYA 1FTMA 2ZYMA 3CRBA 1N7XA 1IUDA 3E3KA 5AA2D 2H25A 2BJJX 1EU8A 4G68A 5ITOA 4EQ9A 5CBSA 3GXAA 3TTNA 1A8EA 2RCAA 3K6UA 4G4PA 4X9TA 4PFWA 4JDFA 1UIVA 2DQVA 3C36A 1SQYA 3CSGA 3OMBA 2DSFA 3PUVE 1AL3A 2DYXA 5EHSA 1A99A 5HM4B 2A5TB 1I6QA 1MDQA 2Q88A 3PMWA 4QSEA 4ZEBA 4EF1A 1D9VA 4P0IA 3VLVA 3ILTB 4NEDA 2XXUA 4C1UA 1ZJLA 1DTZA 4YAHX 3FXUA 2FYIA 3RT6B 1OLCA 1XVXA 3M3KA 1B7UA 5CC2A 1B3GA 1MXYA 4JB7A 4WEPA 3W9VA 2ZYNA 3V8XB 4OERA 4OETA 1JVYA 4BLAA 2FA7A 3SEYA 4QF9A 2VD2A 1PB7A 4IY6A 4JWOA 4O3BA 1IXIA 3PV0E 2QS3A 4F19A 2G93A 3MVYA 1VR5A 4YICA 1AOVA 4ZS9A 3IJXB 4PP0A 1B6HA 2PT2A 1YCJA 2QJEA 1DPPA 3C34A 3FVNA 4LATA 4YB5A 2DWJA 3IORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CB6 A;  2PX1 A;  4NTL A;  3EF7 A;  3I5O A;  4IO6 A;  1S7Y A;  3T66 A;  3CSB A;  3HV1 A;  2G29 A;  5H8F B;  1SDX A;  1A55 A;  1FW0 A;  4FE8 A;  2XXR A;  5DTB A;  2PT1 A;  5M2V A;  1B3H A;  3UK4 A;  5TU0 A;  3ZS6 A;  4EQ7 A;  2H99 A;  4H6D A;  1R9Q A;  4NF8 A;  3C33 A;  5I2K B;  3SDF A;  3TFL A;  1H3D A;  3MZB A;  5BWJ A;  2O84 X;  1MY2 A;  4OEN A;  1Y3N A;  2XHD A;  2DOJ A;  4R2F A;  3HN0 A;  5ELV A;  1AMF A;  3SEW A;  4FJP A;  1P1U A;  4IB2 A;  3OOA A;  5DVI A;  2REG A;  3MVZ A;  4PFY A;  5FHN A;  1ZLQ A;  4QFK A;  1IIW A;  3R6U A;  2O1M A;  4OTE A;  5CMM A;  2DE3 A;  4EQB A;  4NE4 A;  3Q26 A;  2F36 A;  4H8J A;  4ONY A;  2RC8 A;  3SKP A;  1QKA A;  1B4Z A;  3HCQ A;  3OEM A;  2QS1 A;  1A8F A;  1RKM A;  3EHU A;  3OEL A;  3PUW E;  2IEE A;  1RYX A;  3K1M A;  4IO2 A;  4N07 A;  3LSX A;  3SEU A;  5AA4 A;  2O1L A;  3T9U A;  2OK2 A;  1SI0 A;  4QSC A;  4FOR A;  3FIR A;  4MLQ A;  4YZZ A;  3FGS A;  1XC1 A;  3QYT A;  1NL5 A;  1LCF A;  3MAM A;  3PMV A;  5DT6 A;  5AE4 A;  2F35 A;  4RK9 A;  4RK2 A;  5I2N A;  4MH5 A;  4OFO A;  1TXF A;  4RYA A;  2OCU A;  3K2D A;  3P7I A;  3KEI A;  3QIM A;  4HTG A;  4MLV A;  5AA3 A;  3B6Q A;  3KOS A;  5KDT B;  1POY 1;  4R72 A;  4X1D A;  1FCK A;  2GFE A;  1LLS A;  1MPB A;  4RJZ A;  1OMP A;  4XIG Q;  4IO5 A;  2I49 A;  4XKR A;  4PFT A;  1Z7M E;  3OEN A;  2DE4 A;  1UTH B;  3M3F A;  5K2X A;  3FXQ A;  1JW1 A;  3O97 A;  5FHO A;  4JBZ A;  4NF5 B;  2VHA A;  4I62 A;  3TZA A;  1Z7N E;  2OBG A;  5A5X B;  3PPN A;  3KN8 A;  1MRP A;  4GD5 A;  3Q25 A;  2R71 A;  3V5A A;  1R9L A;  1BLF A;  1D4N A;  3RY3 A;  3H4Z A;  4BDO A;  4FAJ A;  2HZL A;  3KG2 A;  1LAG E;  3K01 A;  3IOT A;  1BP5 A;  4FIM A;  1I69 A;  1T0K A;  1XVY A;  3LUY A;  1S50 A;  4X48 A;  5AA4 B;  1N3W A;  1Y3P A;  5FTH A;  4L17 A;  3N26 A;  3C4M A;  3QK6 A;  5FTI A;  1R6Z A;  3MZ1 A;  1IIT A;  2OZZ A;  3W9W A;  4GOT A;  4DIG A;  3IO6 A;  3O6H A;  3LC8 A;  3PGF A;  2NXO A;  3HO7 A;  4U23 A;  3G3J A;  4Z0I A;  3WAE A;  3LSF B;  4TLL B;  2Z22 A;  3UGW A;  4JWX A;  3S9E A;  1D3K A;  3ZSF A;  4C0R A;  2UVH A;  4FAT A;  1H45 A;  2X7Q A;  1QJM A;  1JW4 A;  2XX7 A;  4NF8 B;  5TP9 A;  1A54 A;  3N6U A;  3FD3 A;  2QS2 A;  1WVJ A;  3N94 A;  1EZO A;  4YU0 A;  3G3F A;  3TAJ A;  4FEC A;  1US4 A;  4H8I A;  1LCT A;  1Y4C A;  3GZG A;  2ONK E;  1LGB C;  3EHS A;  2V3T A;  5DEX A;  5HBC A;  3EQ1 A;  2VP1 A;  3TYH A;  5IAI A;  3TEP A;  1PB9 A;  1B46 A;  1NNF A;  3JV9 A;  4AB5 A;  3QSL A;  3E9X A;  1H76 A;  2HEU A;  3FAS A;  3E13 X;  3K1P A;  4MFI A;  4RA1 A;  2DWI A;  1B2H A;  1YTV A;  2DVZ A;  2RC7 A;  3O6I A;  5F1Q A;  1L5T A;  2O7U A;  3CFX A;  3KZG A;  3EHT A;  2AIX A;  3LSL A;  4H67 A;  1IXH A;  3K4U A;  4YMA A;  3FVO A;  1B0H A;  1JEU A;  2OJT A;  2I48 A;  2O7I A;  4G68 C;  3T9H B;  4DXB A;  1B5J A;  1MXU A;  1KWH A;  3ZKK A;  4R6H A;  1NMU A;  1AIV A;  3O6G A;  3Q29 A;  4GXA A;  1MM6 A;  3OD7 A;  1JW5 A;  3OEK A;  1SYI A;  3TTK A;  3G3G A;  1B3L A;  4ZEK A;  1NNP A;  3KJ7 A;  1B32 A;  4GIZ A;  2AL4 A;  4GFR A;  4K3F A;  4GVO A;  3DEL B;  1B51 A;  2XXT A;  1Q1K A;  3K6V A;  3O29 A;  1Y1Z A;  1QW0 A;  2E0S A;  2UVG A;  5I56 A;  1M5B A;  2XXP A;  3K0V A;  1SD3 A;  4O3C A;  4F1Y A;  3A3C A;  2ZNU A;  1Q35 A;  3FJM A;  3C35 A;  3R7X A;  4KPT A;  5IKB A;  2NVU B;  5L9S A;  4BDL A;  2Y7K A;  2QSX A;  5A5X A;  2DE2 A;  3RN8 A;  2F5X A;  1ANF A;  2XXY A;  1JQF A;  2D21 A;  3I3V A;  1EZ9 A;  4Z7E A;  5ICT A;  4DZ1 A;  5EHM A;  5I58 B;  3TCF A;  5ICQ A;  1JEV A;  2Z8E A;  1GGG A;  2I4C A;  3MUQ A;  2LAO A;  1FQD A;  2HCA A;  1POT A;  2DS9 A;  4NMY A;  4ZZE A;  2UVI A;  1MH4 A;  3M3L A;  3VFJ A;  2F6G A;  1NH8 A;  3KSJ A;  3PD9 A;  4HS7 A;  1MDP 1;  2P0S A;  4P0G A;  1HSE A;  4F3B A;  3KFM A;  3PD8 A;  3MP1 A;  3FAT A;  3HHF A;  3MC2 A;  1LFH A;  3T22 A;  2D5W A;  4R9F A;  4YB6 A;  3FV2 A;  2ANJ A;  2Y7W A;  4FEB A;  3IOU A;  3OSQ A;  4GWO A;  1QUL A;  4IGR A;  4PQJ A;  1MQH A;  4U1Z A;  3KBR A;  4F18 A;  3IK6 B;  1PBP A;  2A5T A;  2W7Y A;  4X1B A;  4BDN A;  1NFT A;  1MXV A;  1M5D A;  1XT8 A;  3D4G A;  1MH3 A;  4C1T A;  2V93 A;  5KZT A;  2H5Y A;  3U72 A;  2UYE A;  2AL5 A;  4R6K A;  5L9O A;  5TP9 B;  5JTY A;  5CMK A;  2ZYO A;  1FQC A;  2A5S A;  3PUX E;  1IXG A;  2IA4 A;  3PPQ A;  2VD3 A;  4ISU A;  5L9M A;  1P1O A;  3GBB A;  3S9N C;  4R2B A;  2YPN A;  2Y7P A;  5HPQ A;  2PBW A;  1M5E A;  3H6U A;  2RC9 A;  3TEL A;  3DP6 A;  4JWY A;  3CR9 A;  3WAF A;  2F6P A;  3B7D A;  3S9L C;  4KQP A;  5CBR A;  3OO6 A;  2Z8F A;  5TPA B;  1LB8 A;  3RQT A;  4NF4 B;  4BDQ A;  3V83 A;  1OIB A;  2XXI A;  3FZV A;  4KD5 A;  1OVT A;  3PPP A;  4R9G A;  3TCG A;  5KCJ A;  1O64 A;  1WOD A;  1UIU A;  3F11 A;  5CM6 A;  1H44 A;  1URD A;  4I8C A;  1B5H A;  1MXZ A;  1VSO A;  2RIN A;  4UAC A;  3T9V A;  2P2A A;  2XX8 A;  1Y1M A;  4F22 A;  5J1D A;  2B3F A;  4F2Q A;  2DVC A;  4AB6 A;  4U2R A;  1MPC A;  1JET A;  4OQO A;  1US5 A;  4YKJ A;  4FED A;  4GXS B;  4EDP A;  3LBS A;  2FNC A;  3TCH A;  2PYY A;  4KYS A;  2CMO A;  1MQD A;  2Q8J A;  3M8U A;  1MXX A;  1USY H;  4ZEI A;  3G7W A;  3V89 B;  2H9B A;  2THI A;  1PC3 A;  4LP2 B;  2Z23 A;  1B1X A;  1SBP A;  1MM7 A;  2QS4 A;  1SW4 A;  3Q28 A;  2F7C A;  4ZDM A;  3OO9 A;  3IL1 B;  4G8H A;  2B65 A;  3DP8 A;  4NF5 A;  3RNN A;  3VLU A;  4F31 B;  2XXV A;  5JTY B;  1B9J A;  1LBB A;  3GLB A;  3K1N A;  1QVS A;  3MP6 A;  1PB8 A;  5CI5 A;  1DPE A;  3MBP A;  4JXI A;  5EYF A;  4O3A A;  4ZE8 A;  4I1D A;  4LZ7 A;  2PVU A;  1F9B A;  2PMS A;  1BTJ A;  1GV8 A;  1II5 A;  3JZJ A;  1URS A;  1LAH E;  2QL3 A;  5DYH A;  1JNF A;  5H8Q A;  4U21 A;  3FXR A;  3SET A;  4ELO A;  3IB2 A;  4HCY A;  4R73 A;  4POX A;  5I59 A;  4R6Y A;  3HPI A;  4NF6 B;  2HQ0 A;  3A3U A;  4RPO A;  4F1U A;  1I6B A;  1MPD A;  1N84 A;  3LSW A;  3MVX A;  4GF8 A;  4TOZ A;  3TKD A;  3TTM A;  1R1N A;  3H7M A;  3RUM A;  4LUB A;  3U1O A;  3FVG A;  4NWD A;  4XTC Q;  2I3W A;  4YKP A;  3OO8 A;  1P1N A;  3TQL A;  3HST A;  3QUF A;  5I2N B;  2UVJ A;  4R74 A;  3PUY E;  4UA8 A;  3VVE A;  2Q9T A;  2DXR A;  5I59 B;  3IAZ A;  3IO4 A;  4OEU A;  3MPK A;  4H0W A;  1HSJ A;  1AH5 A;  1QUJ A;  2OLB A;  3DM0 A;  1MY3 A;  1OLA A;  2Y7I A;  3RTW B;  4IO4 A;  2ZNS A;  1YAE A;  3BKI B;  3RT8 A;  4BDM A;  4NF4 A;  1B4H A;  3IOV A;  3TTL A;  1TT1 A;  3PU5 A;  2I6E A;  1MQG A;  4PFU A;  2DXY A;  3O2A A;  3O9P A;  4QSD A;  4OWD A;  1OVB A;  1LST A;  2H98 A;  2I0B A;  1NKX A;  3CI8 A;  2WKY A;  3KOT A;  3OXN A;  2F78 A;  4IO7 A;  1Y20 A;  4Q5T A;  4ZED A;  4P11 A;  4ZE9 A;  3K02 A;  3SES A;  1MQJ A;  3QUJ A;  4Q8R A;  4XKP A;  3MZ9 A;  5B7D A;  1ATG A;  3PPR A;  4OEV A;  4DLD A;  5AA1 A;  1H43 A;  2YLN A;  1A7L A;  1MXW A;  2RCB A;  2X26 A;  3QXM A;  2KLF A;  1FTJ A;  4JSD A;  1IXC A;  4YKI A;  3USD A;  4AQ4 A;  4G68 B;  1S9T A;  4QHQ A;  2ESN A;  2V84 A;  1FTL A;  2RKM A;  3CFZ A;  3DP4 A;  3FJG A;  3H6T A;  3ILU B;  5AA2 B;  1N0T A;  1DSN A;  4U22 A;  3JYR A;  3K6W A;  3KN3 A;  2F97 A;  1MG1 A;  1NNT A;  4G77 A;  4QRZ A;  5K2Y A;  3UP9 A;  5ITP A;  3SEV A;  3TOD A;  4ELP A;  4OMB A;  4THI A;  1YPN A;  3OSR A;  1DMB A;  2VOZ A;  4WKM A;  5ISU A;  4PE5 B;  3TQW A;  1QUI A;  3L6G A;  1B3E A;  1FQF A;  2GHB A;  4F3P A;  3K6X A;  3TMG A;  1PEB A;  3PMX A;  4ECF A;  4QFO A;  4N13 A;  5I56 B;  4DDD A;  1BKA A;  1FTO A;  4RXL A;  2V3U A;  3ECR A;  1OQH A;  3LR1 A;  4LON B;  3VVF A;  1JVX A;  2R9J A;  1B7H A;  1Y4T A;  3E4R A;  3U93 A;  3RLF E;  5I57 A;  3CIJ A;  1MQI A;  1D9Y A;  1J1N A;  3HHG A;  5DVJ A;  3IX1 A;  1XHY A;  3T93 B;  3TDJ A;  1XS5 A;  3QAX A;  1I6A A;  1ELJ A;  4QFN A;  4DCX A;  4TLM B;  4HW8 A;  1B7Z A;  1LAX A;  2XXX A;  4GL0 A;  2F7B A;  4N6P A;  3U94 A;  1B52 A;  2GHA A;  1M5F A;  1M5C A;  3H03 A;  2ZNT A;  3OO7 A;  5H8F A;  2QMW A;  4OFJ A;  5CMB A;  1TFA A;  1WDN A;  1TFD A;  2Q89 A;  4MF3 A;  5I2K A;  2ZYK A;  3K00 A;  4OVJ A;  4KYD A;  3S4U A;  4POW A;  4YMB A;  2F34 A;  4OZ9 A;  3PPO A;  4KYE A;  3W15 C;  1P99 A;  2O6A A;  2UXA A;  4IO3 A;  1PBQ A;  3VXB A;  4F29 A;  4GRK A;  1HSL A;  1MY1 A;  2HAU A;  1VE4 A;  2M8C A;  3CVG A;  3RTF B;  1N7W A;  3BBR A;  2HAV A;  3EN3 A;  4Q30 B;  1NNK A;  4ZEC A;  3IJO B;  1LBC A;  3VE1 B;  4YB7 A;  4YKK A;  5FHM A;  1CE2 A;  2Q2C A;  5B70 A;  1SI1 A;  4ND9 A;  2NUV A;  1RYO A;  4IY5 A;  3H06 B;  2GRV A;  1UTH A;  1FQE A;  4GLI A;  2VGQ A;  4KI0 E;  1Y9U A;  2DWA A;  2H4I A;  1IQ7 A;  3MP8 A;  3MQ9 A;  4IGT A;  3RGY A;  4BDR A;  3ONM A;  1URG A;  1N3X A;  2AYS A;  3IOW A;  4OHN A;  3TUS A;  4I9D A;  4DXU A;  1B40 A;  1N04 A;  1IZ1 A;  4H5F A;  4F1V A;  1BIY A;  4GQO A;  5LOM A;  2DWH A;  3VV5 A;  2GH9 A;  1TWY A;  1VFD A;  3G3K A;  1MY0 A;  2NOO A;  2I3V A;  3MWB A;  5KCJ B;  5BUU A;  3GBA A;  2Y84 A;  3H3G A;  1OQG A;  4OES A;  4E0W A;  1LFI A;  3KSX A;  3EPE A;  3UIF A;  3O66 A;  1EZP A;  2HZK A;  2XD3 A;  2D3I A;  5TPA A;  3FV1 A;  3THI A;  4DCY A;  5I57 B;  5KDT A;  1ZBM A;  4NWC A;  2ZMB A;  3BFT A;  1NH7 A;  3VVD A;  5JEI A;  2O69 A;  2XXW A;  3MJN A;  4G8M A;  3ZKL A;  1GTK A;  4TQU Q;  3UOR A;  4KFQ A;  3B6W A;  3DLN A;  4G8N A;  4RPN A;  1LFG A;  2QPQ A;  1SVX B;  1XOC A;  4OXV A;  5DVF A;  4LQ5 A;  1GVC A;  4ESX A;  3MVW A;  1UTB B;  3KN7 A;  4XKN A;  2REJ A;  1PDA A;  1UQW A;  4Q0C A;  2Z8D A;  4ELQ A;  4U4S A;  4KCC A;  4F2O A;  3VLW A;  1SYH A;  1MY4 A;  2NWJ A;  3I6V A;  3KJT A;  3KGC A;  2CZL A;  1VFE A;  2ALU A;  3G3I A;  4F3S A;  3H6W A;  3IB0 A;  4F3G A;  3RPW A;  1ZMG A;  1A40 A;  1QUK A;  4OFL A;  4XXU A;  4DE8 A;  5H8H A;  1MS7 A;  1B1H A;  3IR1 A;  4KHZ E;  3IB1 A;  4GL8 A;  4DXC A;  3C9H A;  2RF1 A;  4EUO A;  3S9M C;  1P1W A;  2F8D A;  3D4C A;  3FJ7 A;  3PUZ E;  4RNS A;  5H8Q B;  2XX9 A;  3O28 A;  1SW5 A;  2XXH A;  4KR5 A;  4EXL A;  3MPL A;  3H6V A;  3CG1 A;  1B5I A;  1GR2 A;  4EF2 A;  4LZ5 A;  4F39 A;  1O7T A;  3B6T A;  4JSO A;  2X7P A;  2O68 A;  4QFP A;  5CRY A;  3S2V A;  4R75 A;  5I84 A;  2HFB A;  2I4B A;  3A09 A;  3G3H A;  4WED A;  5AA2 A;  5H8N B;  2UYF A;  2XD2 A;  3U8Q A;  4HCW A;  1USY E;  2QRY A;  1B05 A;  1ZIU A;  2I58 A;  3ODB A;  4KCD A;  4G2Z A;  5H8S A;  1B58 A;  4H5G A;  3C32 A;  1LB9 A;  2Q2A A;  2ZXT A;  1FQA A;  1ZKB A;  1QKB A;  2OWS A;  4H1X A;  4MBP A;  3U92 A;  2HXW A;  4ZEF A;  1Y3Q A;  5DEX B;  3Q27 A;  1N76 A;  2OWT A;  4XKQ A;  4ESW A;  2Y7R A;  2I0C A;  4H65 A;  1SW1 A;  4U1O A;  5F7V A;  4LQ2 A;  3SEX A;  4PET A;  3R26 A;  5CMC A;  3TPA A;  3UA8 A;  2P1S A;  4E0X A;  2YJP A;  5JK4 A;  1EH3 A;  1IEJ A;  1SW2 A;  4LVQ A;  2ABH A;  1FTK A;  3AXF A;  3VXC A;  4M1V A;  2E1S A;  2ONR A;  1ZU0 A;  2DP8 A;  4M4G A;  4OYV A;  3L6H A;  1DTG A;  2O51 A;  4ELR A;  4LZ8 A;  5H8H B;  1B3F A;  2V3Q A;  3C31 A;  4NF6 A;  3CG3 A;  4WXJ A;  2XXQ A;  3CFL A;  5I58 A;  3VDF A;  2R6G E;  3UN6 A;  1DOT A;  3BFU A;  1LAF E;  2ONS A;  3FVK A;  4RY1 A;  4ZZA A;  5L8D A;  2QMX A;  2B3B A;  3TTR A;  4EXK A;  3T96 B;  4U4X A;  1O63 A;  3MW0 A;  3N6T A;  3T9X B;  1B0L A;  2F7A A;  2V25 A;  4LA9 A;  5H8N A;  1P1Q A;  3N5L A;  1FQB A;  3SER A;  3FUZ A;  4QFL A;  1UTB A;  1ZTY A;  1FTM A;  2ZYM A;  3CRB A;  1N7X A;  1IUD A;  3E3K A;  5AA2 D;  2H25 A;  2BJJ X;  1EU8 A;  4G68 A;  5ITO A;  4EQ9 A;  5CBS A;  3GXA A;  3TTN A;  1A8E A;  2RCA A;  3K6U A;  4G4P A;  4X9T A;  4PFW A;  4JDF A;  1UIV A;  2DQV A;  3C36 A;  1SQY A;  3CSG A;  3OMB A;  2DSF A;  3PUV E;  1AL3 A;  2DYX A;  5EHS A;  1A99 A;  5HM4 B;  2A5T B;  1I6Q A;  1MDQ A;  2Q88 A;  3PMW A;  4QSE A;  4ZEB A;  4EF1 A;  1D9V A;  4P0I A;  3VLV A;  3ILT B;  4NED A;  2XXU A;  4C1U A;  1ZJL A;  1DTZ A;  4YAH X;  3FXU A;  2FYI A;  3RT6 B;  1OLC A;  1XVX A;  3M3K A;  1B7U A;  5CC2 A;  1B3G A;  1MXY A;  4JB7 A;  4WEP A;  3W9V A;  2ZYN A;  3V8X B;  4OER A;  4OET A;  1JVY A;  4BLA A;  2FA7 A;  3SEY A;  4QF9 A;  2VD2 A;  1PB7 A;  4IY6 A;  4JWO A;  4O3B A;  1IXI A;  3PV0 E;  2QS3 A;  4F19 A;  2G93 A;  3MVY A;  1VR5 A;  4YIC A;  1AOV A;  4ZS9 A;  3IJX B;  4PP0 A;  1B6H A;  2PT2 A;  1YCJ A;  2QJE A;  1DPP A;  3C34 A;  3FVN A;  4LAT A;  4YB5 A;  2DWJ A;  3IOR A; 
#chains in the Genus database with same CATH topology
 1CB6 A;  3T66 A;  1S7Y A;  4G61 A;  1SDX A;  4FE8 A;  3W15 C;  5DTB A;  5M2V A;  3UK4 A;  3ZS6 A;  5IZ1 A;  4EQ7 A;  2FVZ A;  4JVD A;  3MZB A;  4O94 A;  4GX4 A;  2XHD A;  2DOJ A;  1AMF A;  1IIW A;  4OTE A;  4EQB A;  4O7I A;  1QKA A;  1RKM A;  1RYX A;  1EYJ A;  3SEU A;  1SI0 A;  4QSC A;  5EYH A;  3MAM A;  3PMV A;  4PF8 A;  5I2N A;  3KEI A;  3B6Q A;  1POY 1;  1LLS A;  4XIG Q;  1NUX A;  2DE4 A;  1UTH B;  2ZZX A;  1JW1 A;  4OVS A;  2VHA A;  4DI4 B;  3PPN A;  3RY3 A;  3H4Z A;  4FAJ A;  1SPI A;  1LAG E;  1I69 A;  1T0K A;  4X48 A;  1S50 A;  5IZ3 A;  3N26 A;  3C4M A;  3QK6 A;  3MZ1 A;  1KA1 A;  4DIG A;  3IO6 A;  3PGF A;  4C0R A;  1JW4 A;  3N6U A;  1FBG A;  1WVJ A;  4YU0 A;  3TAJ A;  4FEC A;  1LBY A;  1LGB C;  5HBC A;  5IAI A;  3EQ1 A;  3TEP A;  1B46 A;  3E9X A;  4RA1 A;  5ESY A;  2DWI A;  2RC7 A;  3O6I A;  3KZG A;  3EHT A;  2AIX A;  3K4U A;  4G68 C;  2O7I A;  3ZKK A;  1AIV A;  1KWH A;  3O6G A;  3Q29 A;  1JW5 A;  3G3G A;  1IMD A;  3FXB A;  4GFR A;  1QW0 A;  2E0S A;  4F1Y A;  2XXP A;  2ZNU A;  3FJM A;  4KPT A;  5A5X A;  3RN8 A;  2XXY A;  3I3V A;  5ICQ A;  3VFJ A;  4C1T A;  2UVI A;  1MH4 A;  3PD9 A;  2P0S A;  1FBF A;  2CEY A;  5FHN A;  4GWO A;  4U1Z A;  1IMC A;  1MQH A;  4F18 A;  2V4C A;  4NHB A;  3IK6 B;  2A5T A;  3RPL A;  2H5Y A;  5JTY A;  5CMK A;  1IXG A;  5L9M A;  2Y7P A;  5HPQ A;  4JWY A;  3CR9 A;  2F6P A;  3OO6 A;  5TPA B;  4PFB A;  1OIB A;  4KD5 A;  3PPP A;  1O64 A;  1WOD A;  3F11 A;  1H44 A;  4MNC A;  1B5H A;  1FPJ A;  4MCO A;  4UAC A;  2DVC A;  4AB6 A;  4U2R A;  1G0H A;  4OQO A;  4YKJ A;  3LBS A;  3TCH A;  4KYS A;  1MQD A;  2Q8J A;  2Q8M A;  1NUY A;  1USY H;  4ZEI A;  3V89 B;  1IME A;  1B1X A;  1SBP A;  2QS4 A;  4ZDM A;  2F7C A;  3IL1 B;  4F31 B;  4NF5 A;  2XXV A;  3GLB A;  3MP6 A;  2PVU A;  2PMS A;  2VPO A;  1LAH E;  2QL3 A;  5H8Q A;  3FXR A;  5ET6 A;  5I59 A;  4MEV A;  4NF6 B;  4F1U A;  1N84 A;  3MVX A;  1R1N A;  3RUM A;  4LUB A;  4NWD A;  4XTC Q;  1P1N A;  3HST A;  1LEV A;  2DXR A;  2XXK A;  4OEU A;  4H0W A;  1LBZ A;  3MPK A;  1AH5 A;  2OLB A;  3DM0 A;  1MY3 A;  3RTW B;  4BDM A;  4NF4 A;  1NV7 A;  1TT1 A;  3PU5 A;  3EKI A;  2I6E A;  3O2A A;  4OWD A;  1OVB A;  2I0B A;  2F78 A;  4Q5T A;  4P11 A;  4N6D A;  3PPR A;  4DLD A;  1KA0 A;  2B4L A;  4GX6 A;  2RCB A;  4AQ4 A;  2V84 A;  1FTL A;  3DP4 A;  3FJG A;  4HE1 A;  4P3L A;  3UP9 A;  1DMB A;  2VOZ A;  3PTY A;  3L6G A;  3LUZ A;  4PDH A;  4N13 A;  5I56 B;  1BKA A;  4RXL A;  2V3U A;  4OVR A;  4PAK A;  1B7H A;  4NGU A;  4QBA A;  3QAX A;  1I6A A;  1LAX A;  2XXX A;  2F7B A;  4N6P A;  1M5F A;  1M5C A;  3H03 A;  1TFA A;  1YYZ A;  1WDN A;  1TFD A;  2Q89 A;  4E0W A;  3PPO A;  4GRK A;  1HSL A;  4KXP A;  3RTF B;  3VE1 B;  1RDZ A;  5FHM A;  4ND9 A;  2MKZ A;  4KI0 E;  2DWA A;  1URG A;  2L5V A;  4OHN A;  3VV5 A;  1TWY A;  3G3K A;  3NOH A;  3O66 A;  5I57 B;  3THI A;  1ZBM A;  3T1B A;  1GTK A;  4P9K A;  3SZP A;  4I3E A;  4RPN A;  4PDD A;  1XOC A;  4LQ5 A;  4ESX A;  1PDA A;  2OWZ A;  4U4S A;  4N81 A;  2CZL A;  1VFE A;  2ALU A;  4F3S A;  3IB0 A;  1QUK A;  4OFL A;  4XXU A;  4GL8 A;  2F8D A;  3D4C A;  3FJ7 A;  3PUZ E;  2XX9 A;  4EXL A;  2HPG A;  4KR5 A;  3MPL A;  1B5I A;  1GR2 A;  2WYP A;  4JSO A;  1XI6 A;  3A09 A;  5AA2 A;  5H8N B;  4HCW A;  1B05 A;  4KCD A;  1FPE A;  1INP A;  1FQA A;  1ZKB A;  1QKB A;  1Y3Q A;  1N76 A;  4XKQ A;  1FPB A;  1SW1 A;  3TPA A;  5CMC A;  1IEJ A;  1SW2 A;  4LVQ A;  2ABH A;  2HHM A;  2ONR A;  4LZ8 A;  1B3F A;  4NF6 A;  2XXQ A;  3CFL A;  1DOT A;  4RY1 A;  3TTR A;  5L8D A;  2B3B A;  5H8N A;  5AA2 B;  3N5L A;  1FQB A;  3FUZ A;  4MIJ A;  1UTB A;  1ZTY A;  2JJK A;  1N7X A;  1EU8 A;  1A8E A;  1UIV A;  1SQY A;  3OMB A;  2DSF A;  3PUV E;  5EHS A;  1I6Q A;  2A5T B;  2Q88 A;  3RPL B;  4P0I A;  2PFY A;  4C1U A;  1DTZ A;  4YAH X;  2FYI A;  1XVX A;  1MXY A;  5ET5 A;  1PB7 A;  4IR8 A;  4O3B A;  3PV0 E;  4F19 A;  4I40 A;  2QJE A;  2PX1 A;  3EF7 A;  3CSB A;  5J16 A;  1FW0 A;  2XXR A;  2PT1 A;  1B3H A;  2P3N A;  2H99 A;  4H6D A;  3SDF A;  3C33 A;  4X04 A;  5BWJ A;  2O84 X;  3GYY A;  1FBP A;  4R2F A;  3SEW A;  4FJP A;  3OOA A;  1IMA A;  2REG A;  4PC9 A;  2O1M A;  5CMM A;  2DE3 A;  1KZ8 A;  2F36 A;  2RC8 A;  4GX3 A;  3OEM A;  4GWZ A;  4N07 A;  5IM2 A;  3QYT A;  1XC1 A;  5DT6 A;  4RK9 A;  4HTG A;  1AOV A;  5AA3 A;  3KOS A;  4X1D A;  2GFE A;  1MPB A;  3IFA A;  4IO5 A;  2I49 A;  4PFT A;  1Z7M E;  3OEN A;  2XWK A;  4JBZ A;  4NF5 B;  2OBG A;  4GD5 A;  3V5A A;  1D4N A;  1BP5 A;  4JVC A;  5IGA A;  1FBD A;  1N3W A;  5FTH A;  1IIT A;  2NXO A;  3G3J A;  3UGW A;  3ZSF A;  2QVR A;  2UVH A;  4PBH A;  4NF8 B;  1A54 A;  3FD3 A;  3N94 A;  1EZO A;  1US4 A;  3EHS A;  1H76 A;  4MFI A;  1YTV A;  5F1Q A;  3LSL A;  3MST A;  3FVO A;  1B0H A;  1JEU A;  2I48 A;  3T9H B;  4R6H A;  1NMU A;  1B3L A;  2DDK A;  4GVO A;  3DEL B;  1Q1K A;  3K0V A;  1SD3 A;  4O3C A;  3A3C A;  4PFI A;  3R7X A;  2NVU B;  5L9S A;  4BDL A;  2QSX A;  1JQF A;  2D21 A;  1EZ9 A;  4Z7E A;  5ICT A;  4DZ1 A;  5I58 B;  2Z8E A;  1FQD A;  4NMY A;  5I59 B;  4P0G A;  1MDP 1;  1NUZ A;  4F3B A;  3PD8 A;  2QFL A;  3HHF A;  3T22 A;  2D5W A;  4YB6 A;  2ANJ A;  2Y7W A;  4FEB A;  3IOU A;  1PBP A;  2CEX A;  2W7Y A;  5KZT A;  1MXV A;  1K9Z A;  1XT8 A;  1MH3 A;  5L9O A;  2V93 A;  4PCD A;  1FQC A;  3PUX E;  2IA4 A;  3S9N C;  3E79 A;  2PBW A;  3DP6 A;  3WAF A;  4NG7 A;  2Z8F A;  1LB8 A;  3FZV A;  1URD A;  4I8C A;  1VSO A;  2XX8 A;  1Y1M A;  4F22 A;  4NF0 A;  1Q9D A;  1US5 A;  4FED A;  4GXS B;  1DK4 A;  4GWW A;  1EYI A;  4LP2 B;  1MM7 A;  4ZED A;  2WBB A;  4G8H A;  5JTY B;  1LBB A;  3K1N A;  5EYF A;  1DPE A;  4ZE8 A;  1GV8 A;  1II5 A;  4OVT A;  2XWI A;  3SET A;  1FBH A;  3IB2 A;  2HQ0 A;  3A3U A;  3FVG A;  4YKP A;  3OO8 A;  5I2N B;  4UA8 A;  3VVE A;  1QUJ A;  1OLA A;  4IO4 A;  4HE0 A;  4NN3 A;  1B4H A;  3IOV A;  1MQG A;  3O9P A;  3CI8 A;  4N4U A;  1MQJ A;  4Q8R A;  1H43 A;  3USD A;  3H6T A;  3ILU B;  3K6W A;  4QRZ A;  3ISP A;  2XA5 A;  4WKM A;  4XFE A;  5ISU A;  2GHB A;  1FQF A;  3TMG A;  4ECF A;  1EYK A;  3ECR A;  3CIJ A;  3T93 B;  1J1N A;  5DVJ A;  5F24 A;  4DCX A;  1B7Z A;  3U94 A;  1B52 A;  5H8F A;  4PE3 A;  4MF3 A;  5I2K A;  2ZYK A;  3K00 A;  3S4U A;  4YMB A;  4OZ9 A;  4KYE A;  3CVG A;  3BBR A;  4Q30 B;  1NNK A;  2Q2C A;  1RYO A;  1UTH A;  2VGQ A;  3MP8 A;  1IQ7 A;  3MQ9 A;  4IGT A;  2AYS A;  1IZ1 A;  4H5F A;  5LOM A;  1BIY A;  2GH9 A;  4I3Y A;  1MY0 A;  2NOO A;  3MWB A;  4OES A;  5TPA A;  3FV1 A;  5KDT A;  2KQZ A;  4GBW A;  4OVP A;  4KFQ A;  4P8B A;  2CZH A;  3B6W A;  3DLN A;  2PFZ A;  5DVF A;  1GVC A;  2REJ A;  1UQW A;  4KCC A;  3G3I A;  3H6W A;  4F3G A;  3RPW A;  1A40 A;  4KHZ E;  1B1H A;  1LBV A;  3IB1 A;  3C9H A;  3S9M C;  3H6V A;  3CG1 A;  4F39 A;  4EF2 A;  4LZ5 A;  1O7T A;  3B6T A;  3S2V A;  5I84 A;  2I4B A;  3G3H A;  2UYF A;  2XD2 A;  1DBZ A;  1USY E;  2QRY A;  1ZIU A;  1B58 A;  1QGX A;  4H1X A;  2HXW A;  5DEX B;  4H65 A;  4U1O A;  4PET A;  3KC0 A;  1EH3 A;  3AXF A;  1ZU0 A;  3C31 A;  4WXJ A;  3UN6 A;  1LAF E;  2ONS A;  3FVK A;  3T96 B;  4U4X A;  1DCU A;  1FTM A;  2ZYM A;  2BJJ X;  5ITO A;  3GXA A;  3TTN A;  4G4P A;  2WYK A;  3C36 A;  1A99 A;  4ZEB A;  4EF1 A;  1ZJL A;  3RT6 B;  3FBP A;  5CC2 A;  4JB7 A;  1JVY A;  4QF9 A;  2VD2 A;  4N8Y A;  1IXI A;  2QS3 A;  2G93 A;  4ZS9 A;  2PT2 A;  4LAT A;  2DWJ A;  4NTL A;  5EQ7 A;  5H8F B;  1D9Q A;  3RYD A;  5TU0 A;  4NF8 A;  5I2K B;  1MY2 A;  1Y3N A;  5ELV A;  1P1U A;  5IZZ A;  3MVZ A;  4PFY A;  3R6U A;  3Q26 A;  3SKP A;  5LTC A;  3HCQ A;  2QS1 A;  1A8F A;  4IO2 A;  3K1M A;  3LSX A;  2OK2 A;  3FIR A;  4MLQ A;  1FPK A;  3FGS A;  4YZZ A;  5AE4 A;  2F35 A;  3U65 A;  4RK2 A;  4OFO A;  2OCU A;  3P7I A;  5KDT B;  1FPD A;  1OMP A;  3O97 A;  5FHO A;  4I62 A;  1Z7N E;  5A5X B;  1MRP A;  1R9L A;  1RDX A;  3K01 A;  3LUY A;  1Y3P A;  5FTI A;  1R6Z A;  2OZZ A;  3W9W A;  4GOT A;  1FJ9 A;  4U23 A;  3LC8 A;  4Z0I A;  3WAE A;  3LSF B;  4TLL B;  2Z22 A;  4FAT A;  4MAG A;  2X7Q A;  1QJM A;  2XX7 A;  4MMP A;  1LCT A;  2QVV A;  3ROJ A;  5DEX A;  3TYH A;  2VP1 A;  1PB9 A;  1NNF A;  3E13 X;  4X8R A;  1L5T A;  2DVZ A;  2O7U A;  4H67 A;  1IXH A;  1JP4 A;  2OJT A;  4DXB A;  1B5J A;  1MXU A;  1MM6 A;  3OD7 A;  3OEK A;  4ZEK A;  1NNP A;  3KJ7 A;  2AL4 A;  4K3F A;  3O29 A;  1Y1Z A;  5I56 A;  1M5B A;  1Q35 A;  2Y7K A;  4GWY A;  2DE2 A;  2F5X A;  1ANF A;  3HFU A;  1GGG A;  2I4C A;  2KR0 A;  2HCA A;  3BIG A;  3M3L A;  2F6G A;  1NH8 A;  3KSJ A;  4HS7 A;  1HSE A;  3KFM A;  3MP1 A;  3MC2 A;  3FV2 A;  4IGR A;  4PQJ A;  1QUL A;  3KBR A;  4X1B A;  1NFT A;  3D4G A;  2UYE A;  4R6K A;  5TP9 B;  2ZYO A;  3PPQ A;  1M5E A;  3H6U A;  3TEL A;  2BJI A;  3S9L C;  4KQP A;  5CBR A;  4R9G A;  3E78 A;  3LV0 A;  5J1D A;  5A5L A;  1MPC A;  4LN5 A;  4EDP A;  3KC1 A;  2PYY A;  3M8U A;  1MXX A;  2WX9 A;  2H9B A;  1PC3 A;  3OO9 A;  3RNN A;  3VLU A;  2HXR A;  1K9Y A;  4N6K A;  1QVS A;  2Q74 A;  2PCR A;  3MBP A;  4JXI A;  4LZ7 A;  1BTJ A;  1URS A;  1JNF A;  4U21 A;  4ELO A;  4R73 A;  4POX A;  4R6Y A;  3LSW A;  3TTM A;  4MX6 A;  3TKD A;  3H7M A;  3U1O A;  2I3W A;  3TQL A;  3QUF A;  4R74 A;  3PUY E;  2Q9T A;  3IAZ A;  3IO4 A;  1HSJ A;  2Y7I A;  2ZNS A;  3BKI B;  3RT8 A;  3TTL A;  4PFU A;  2DXY A;  4GBV A;  4QSD A;  2H98 A;  2WKY A;  3KOT A;  4IO7 A;  1Y20 A;  1LBW A;  3D1R A;  3QUJ A;  4N8G A;  3MZ9 A;  4XKP A;  4O7M A;  1ATG A;  4QXD A;  2YLN A;  1A7L A;  2X26 A;  3QXM A;  4JSD A;  1IXC A;  4YKI A;  4G68 B;  4QHQ A;  2ESN A;  1N0T A;  1DSN A;  3KN3 A;  1MG1 A;  3TOD A;  4ELP A;  4THI A;  1YPN A;  3TQW A;  1B3E A;  3K6X A;  1PEB A;  4MHF A;  1OQH A;  3LR1 A;  4LON B;  4MNI A;  3VVF A;  2R9J A;  3U93 A;  1D9Y A;  1FRP A;  1XS5 A;  4NQ8 A;  4GL0 A;  3QMF A;  1NV5 A;  5T3J A;  2ZNT A;  2QMW A;  5CMB A;  4OVJ A;  4KYD A;  4POW A;  1P99 A;  2UXA A;  4IO3 A;  3VXB A;  1PBQ A;  4F29 A;  1FJ6 A;  2FIE A;  2P3V A;  1N7W A;  1LBC A;  4YKK A;  1CE2 A;  5B70 A;  1SI1 A;  2NUV A;  4IY5 A;  3H06 B;  1FQE A;  3IOW A;  2ZZV A;  1B40 A;  4F1V A;  4GQO A;  1VFD A;  1NV4 A;  2I3V A;  5KCJ B;  3GBA A;  2Y84 A;  3H3G A;  1OQG A;  5I5P A;  3KSX A;  3EPE A;  2HZK A;  2XD3 A;  2D3I A;  5IZ3 B;  2ZMB A;  5JEI A;  1FPL A;  2O69 A;  2XXW A;  4P1E A;  4G8N A;  1BK4 A;  3MVW A;  4ELQ A;  4F2O A;  3VLW A;  2NWJ A;  1SYH A;  1MY4 A;  3KJT A;  3IFC A;  1FBE A;  1IMF A;  5EYG A;  4DE8 A;  4EUO A;  5K2X A;  1P1W A;  4RNS A;  5H8Q B;  2XXH A;  4AS5 A;  4QFP A;  5CRY A;  4WED A;  2VPN A;  3B8B A;  3U8Q A;  3ODB A;  2I58 A;  4H5G A;  2ZXT A;  5ET7 A;  4MBP A;  2OWS A;  3U92 A;  2I0C A;  5F7V A;  3R26 A;  3UA8 A;  2P1S A;  4E0X A;  5JK4 A;  2E1S A;  4M4G A;  4OYV A;  3L6H A;  2O51 A;  2V3Q A;  3VDF A;  4HXV A;  2R6G E;  1FBC A;  4AS4 A;  4EXK A;  4P1L A;  4GWS A;  1O63 A;  5I3S A;  1B0L A;  2V25 A;  3SER A;  4QFL A;  4NX1 A;  1IUD A;  2WBD A;  3E3K A;  2H25 A;  5AA2 D;  4G68 A;  5CBS A;  2RCA A;  4X9T A;  4PFW A;  1AL3 A;  5HM4 B;  1MDQ A;  3PMW A;  1D9V A;  3VLV A;  4PTK A;  2XXU A;  1OLC A;  1B7U A;  4WEP A;  2ZYN A;  4OER A;  4PFR A;  4BLA A;  2B4M A;  4NAP A;  4N15 A;  3IJX B;  1YCJ A;  1DPP A;  3IOR A;  3I5O A;  4IO6 A;  3HV1 A;  2G29 A;  1A55 A;  1R9Q A;  4OVQ A;  3TFL A;  1H3D A;  4OEN A;  3HN0 A;  1FPF A;  4IB2 A;  5DVI A;  2GQ1 A;  1ZLQ A;  4QFK A;  2FHY A;  4PBQ A;  1NI9 A;  2CZK A;  4NE4 A;  4ONY A;  4H8J A;  4O8M A;  1B4Z A;  1VDW A;  3PUW E;  3EHU A;  3OEL A;  2IEE A;  5AA4 A;  2O1L A;  2R8T A;  3T9U A;  4OA4 A;  4FOR A;  1NL5 A;  1LCF A;  4P47 A;  4MH5 A;  4RYA A;  1TXF A;  1IMB A;  3K2D A;  3QIM A;  4MLV A;  4R72 A;  1FCK A;  2Y5K A;  3CHG A;  4RJZ A;  4XKR A;  3M3F A;  3FXQ A;  3TZA A;  1NV6 A;  5EQ9 A;  3KN8 A;  2F3B A;  4JVI A;  3Q25 A;  2R71 A;  1BLF A;  3BIH A;  4BDO A;  2OX3 A;  2HZL A;  3KG2 A;  4PF6 A;  3IOT A;  4FIM A;  1XVY A;  5AA4 B;  4L17 A;  3O6H A;  3HO7 A;  1NV1 A;  3S9E A;  4JWX A;  1D3K A;  1YZ0 A;  1H45 A;  5TP9 A;  4N91 A;  2QS2 A;  3G3F A;  4H8I A;  1Y4C A;  3GZG A;  2ONK E;  2V3T A;  1CNQ A;  4AB5 A;  3JV9 A;  4UAB A;  3QSL A;  2HEU A;  3FAS A;  3K1P A;  1B2H A;  3CFX A;  4YMA A;  4GXA A;  1SYI A;  3TTK A;  1B32 A;  4GIZ A;  2FBP A;  5EQ8 A;  1B51 A;  2XXT A;  3K6V A;  2UVG A;  3C35 A;  5IKB A;  5EHM A;  3TCF A;  1JEV A;  3MUQ A;  2LAO A;  1POT A;  2DS9 A;  4ZZE A;  3FAT A;  4XF5 A;  1LFH A;  4R9F A;  3OSQ A;  4BDN A;  1M5D A;  3U72 A;  2AL5 A;  4XEQ A;  2A5S A;  4ISU A;  2VD3 A;  1P1O A;  3GBB A;  4R2B A;  2YPN A;  2RC9 A;  1FPI A;  3B7D A;  4BDQ A;  3RQT A;  1FPG A;  4NF4 B;  3V83 A;  4DI3 D;  2XXI A;  2VT5 A;  3TCG A;  1OVT A;  5KCJ A;  1YXI A;  1UIU A;  5CM6 A;  5ET8 A;  2RIN A;  1MXZ A;  3T9V A;  2P2A A;  2B3F A;  4F2Q A;  1JET A;  2FNC A;  2CMO A;  2CZI A;  3G7W A;  2THI A;  2Z23 A;  3Q28 A;  1SW4 A;  1G0I A;  2B65 A;  3DP8 A;  1RDY A;  1B9J A;  1PB8 A;  5CI5 A;  4O3A A;  4I1D A;  1F9B A;  3JZJ A;  5DYH A;  4OAN A;  4HCY A;  4RPO A;  3HPI A;  5LDZ A;  1I6B A;  1MPD A;  4GF8 A;  4TOZ A;  2UVJ A;  2XWV A;  2FIX A;  3MYU A;  1YAE A;  1LST A;  1NKX A;  4HE2 A;  3OXN A;  4ZE9 A;  3K02 A;  3SES A;  2XWO A;  5B7D A;  4OEV A;  5AA1 A;  1MXW A;  2KLF A;  1FTJ A;  1S9T A;  2RKM A;  3CFZ A;  1AWB A;  3JYR A;  4U22 A;  2F97 A;  1NNT A;  5K2Y A;  4G77 A;  1NV2 A;  5ITP A;  1NV3 A;  3SEV A;  4OMB A;  3OSR A;  4PE5 B;  1QUI A;  4F3P A;  3PMX A;  4FBP A;  4QFO A;  4DDD A;  1FTO A;  1JVX A;  1Y4T A;  3E4R A;  3RLF E;  5I57 A;  1MQI A;  3HHG A;  3TDJ A;  3IX1 A;  1XHY A;  4PGP A;  1ELJ A;  4QFN A;  4TLM B;  4HW8 A;  1LBX A;  5EQA A;  2GHA A;  3OO7 A;  3A29 A;  4OFJ A;  2F34 A;  2O6A A;  4PGN A;  1MY1 A;  2HAU A;  1VE4 A;  2M8C A;  3VVD A;  3EN3 A;  4ZEC A;  2HAV A;  3IJO B;  4N17 A;  4YB7 A;  2GRV A;  4GLI A;  4GWX A;  4MJO A;  1Y9U A;  2H4I A;  2QVU A;  4BDR A;  4MNP A;  3RGY A;  3ONM A;  1N3X A;  3TUS A;  4I9D A;  4DXU A;  1N04 A;  2DWH A;  5BUU A;  1LFI A;  3UIF A;  1EZP A;  4DCY A;  4NWC A;  3BFT A;  1NH7 A;  4G8M A;  3MJN A;  3ZKL A;  2F3D A;  4TQU Q;  3UOR A;  4PAF A;  1LFG A;  2QPQ A;  1SVX B;  4OXV A;  4XKN A;  1UTB B;  3KN7 A;  1NUW A;  4Q0C A;  2Z8D A;  4P56 A;  3I6V A;  3KGC A;  5I7I A;  3T0J A;  1ZMG A;  5H8H A;  1MS7 A;  3IR1 A;  4DXC A;  2RF1 A;  3O28 A;  1SW5 A;  3KBZ A;  2X7P A;  2O68 A;  4R75 A;  5DW8 A;  2HFB A;  5H8S A;  4G2Z A;  3C32 A;  1LB9 A;  2Q2A A;  1FTA A;  4ZEF A;  3Q27 A;  2OWT A;  4ESW A;  2Y7R A;  4LQ2 A;  3SEX A;  2Y5L A;  2YJP A;  1FTK A;  3VXC A;  4M1V A;  2DP8 A;  1DTG A;  4ELR A;  3B50 A;  1FSA A;  5H8H B;  3CG3 A;  5I58 A;  3BFU A;  4ZZA A;  2QMX A;  2ZZW A;  3MW0 A;  3N6T A;  3T9X B;  2F7A A;  4LA9 A;  1P1Q A;  3CRB A;  4H46 A;  2WEF A;  4EQ9 A;  3K6U A;  4JDF A;  2DQV A;  3CSG A;  2DYX A;  4QSE A;  4PAI A;  3ILT B;  4NED A;  3FXU A;  3M3K A;  1B3G A;  3W9V A;  3V8X B;  4OET A;  2FA7 A;  3SEY A;  4H45 A;  4IY6 A;  4JWO A;  5FBP A;  1NV0 A;  3MVY A;  1VR5 A;  4YIC A;  4GWU A;  4PP0 A;  1B6H A;  4YB5 A;  3FVN A;  3C34 A; 
#chains in the Genus database with same CATH homology
 1CB6 A;  2PX1 A;  4NTL A;  3EF7 A;  3I5O A;  4IO6 A;  1S7Y A;  3T66 A;  3CSB A;  3HV1 A;  2G29 A;  5H8F B;  1SDX A;  1A55 A;  1FW0 A;  4FE8 A;  2XXR A;  5DTB A;  2PT1 A;  5M2V A;  1B3H A;  3UK4 A;  5TU0 A;  3ZS6 A;  4EQ7 A;  2H99 A;  4H6D A;  1R9Q A;  4NF8 A;  3C33 A;  5I2K B;  3SDF A;  3TFL A;  1H3D A;  3MZB A;  5BWJ A;  2O84 X;  1MY2 A;  4OEN A;  1Y3N A;  2XHD A;  2DOJ A;  4R2F A;  3HN0 A;  5ELV A;  1AMF A;  3SEW A;  4FJP A;  1P1U A;  4IB2 A;  3OOA A;  5DVI A;  2REG A;  3MVZ A;  4PFY A;  5FHN A;  1ZLQ A;  4QFK A;  1IIW A;  3R6U A;  2O1M A;  4OTE A;  5CMM A;  2DE3 A;  4EQB A;  4NE4 A;  3Q26 A;  2F36 A;  4H8J A;  4ONY A;  2RC8 A;  3SKP A;  1QKA A;  1B4Z A;  3HCQ A;  3OEM A;  2QS1 A;  1A8F A;  1RKM A;  3EHU A;  3OEL A;  3PUW E;  2IEE A;  1RYX A;  3K1M A;  4IO2 A;  4N07 A;  3LSX A;  3SEU A;  5AA4 A;  2O1L A;  3T9U A;  2OK2 A;  1SI0 A;  4QSC A;  4FOR A;  3FIR A;  4MLQ A;  4YZZ A;  3FGS A;  1XC1 A;  3QYT A;  1NL5 A;  1LCF A;  3MAM A;  3PMV A;  5DT6 A;  5AE4 A;  2F35 A;  4RK9 A;  4RK2 A;  5I2N A;  4MH5 A;  4OFO A;  1TXF A;  4RYA A;  2OCU A;  3K2D A;  3P7I A;  3KEI A;  3QIM A;  4HTG A;  4MLV A;  5AA3 A;  3B6Q A;  3KOS A;  5KDT B;  1POY 1;  4R72 A;  4X1D A;  1FCK A;  2GFE A;  1LLS A;  1MPB A;  4RJZ A;  1OMP A;  4XIG Q;  4IO5 A;  2I49 A;  4XKR A;  4PFT A;  1Z7M E;  3OEN A;  2DE4 A;  1UTH B;  3M3F A;  5K2X A;  3FXQ A;  1JW1 A;  3O97 A;  5FHO A;  4JBZ A;  4NF5 B;  2VHA A;  4I62 A;  3TZA A;  1Z7N E;  2OBG A;  5A5X B;  3PPN A;  3KN8 A;  1MRP A;  4GD5 A;  3Q25 A;  2R71 A;  3V5A A;  1R9L A;  1BLF A;  1D4N A;  3RY3 A;  3H4Z A;  4BDO A;  4FAJ A;  2HZL A;  3KG2 A;  1LAG E;  3K01 A;  3IOT A;  1BP5 A;  4FIM A;  1I69 A;  1T0K A;  1XVY A;  3LUY A;  1S50 A;  4X48 A;  5AA4 B;  1N3W A;  1Y3P A;  5FTH A;  4L17 A;  3N26 A;  3C4M A;  3QK6 A;  5FTI A;  1R6Z A;  3MZ1 A;  1IIT A;  2OZZ A;  3W9W A;  4GOT A;  4DIG A;  3IO6 A;  3O6H A;  3LC8 A;  3PGF A;  2NXO A;  3HO7 A;  4U23 A;  3G3J A;  4Z0I A;  3WAE A;  3LSF B;  4TLL B;  2Z22 A;  3UGW A;  4JWX A;  3S9E A;  1D3K A;  3ZSF A;  4C0R A;  2UVH A;  4FAT A;  1H45 A;  2X7Q A;  1QJM A;  1JW4 A;  2XX7 A;  4NF8 B;  5TP9 A;  1A54 A;  3N6U A;  3FD3 A;  2QS2 A;  1WVJ A;  3N94 A;  1EZO A;  4YU0 A;  3G3F A;  3TAJ A;  4FEC A;  1US4 A;  4H8I A;  1LCT A;  1Y4C A;  3GZG A;  2ONK E;  1LGB C;  3EHS A;  2V3T A;  5DEX A;  5HBC A;  3EQ1 A;  2VP1 A;  3TYH A;  5IAI A;  3TEP A;  1PB9 A;  1B46 A;  1NNF A;  3JV9 A;  4AB5 A;  3QSL A;  3E9X A;  1H76 A;  2HEU A;  3FAS A;  3E13 X;  3K1P A;  4MFI A;  4RA1 A;  2DWI A;  1B2H A;  1YTV A;  2DVZ A;  2RC7 A;  3O6I A;  5F1Q A;  1L5T A;  2O7U A;  3CFX A;  3KZG A;  3EHT A;  2AIX A;  3LSL A;  4H67 A;  1IXH A;  3K4U A;  4YMA A;  3FVO A;  1B0H A;  1JEU A;  2OJT A;  2I48 A;  2O7I A;  4G68 C;  3T9H B;  4DXB A;  1B5J A;  1MXU A;  1KWH A;  3ZKK A;  4R6H A;  1NMU A;  1AIV A;  3O6G A;  3Q29 A;  4GXA A;  1MM6 A;  3OD7 A;  1JW5 A;  3OEK A;  1SYI A;  3TTK A;  3G3G A;  1B3L A;  4ZEK A;  1NNP A;  3KJ7 A;  1B32 A;  4GIZ A;  2AL4 A;  4GFR A;  4K3F A;  4GVO A;  3DEL B;  1B51 A;  2XXT A;  1Q1K A;  3K6V A;  3O29 A;  1Y1Z A;  1QW0 A;  2E0S A;  2UVG A;  5I56 A;  1M5B A;  2XXP A;  3K0V A;  1SD3 A;  4O3C A;  4F1Y A;  3A3C A;  2ZNU A;  1Q35 A;  3FJM A;  3C35 A;  3R7X A;  4KPT A;  5IKB A;  2NVU B;  5L9S A;  4BDL A;  2Y7K A;  2QSX A;  5A5X A;  2DE2 A;  3RN8 A;  2F5X A;  1ANF A;  2XXY A;  1JQF A;  2D21 A;  3I3V A;  1EZ9 A;  4Z7E A;  5ICT A;  4DZ1 A;  5EHM A;  5I58 B;  3TCF A;  5ICQ A;  1JEV A;  2Z8E A;  1GGG A;  2I4C A;  3MUQ A;  2LAO A;  1FQD A;  2HCA A;  1POT A;  2DS9 A;  4NMY A;  4ZZE A;  2UVI A;  1MH4 A;  3M3L A;  3VFJ A;  2F6G A;  1NH8 A;  3KSJ A;  3PD9 A;  4HS7 A;  1MDP 1;  2P0S A;  4P0G A;  1HSE A;  4F3B A;  3KFM A;  3PD8 A;  3MP1 A;  3FAT A;  3HHF A;  3MC2 A;  1LFH A;  3T22 A;  2D5W A;  4R9F A;  4YB6 A;  3FV2 A;  2ANJ A;  2Y7W A;  4FEB A;  3IOU A;  3OSQ A;  4GWO A;  1QUL A;  4IGR A;  4PQJ A;  1MQH A;  4U1Z A;  3KBR A;  4F18 A;  3IK6 B;  1PBP A;  2A5T A;  2W7Y A;  4X1B A;  4BDN A;  1NFT A;  1MXV A;  1M5D A;  1XT8 A;  3D4G A;  1MH3 A;  4C1T A;  2V93 A;  5KZT A;  2H5Y A;  3U72 A;  2UYE A;  2AL5 A;  4R6K A;  5L9O A;  5TP9 B;  5JTY A;  5CMK A;  2ZYO A;  1FQC A;  2A5S A;  3PUX E;  1IXG A;  2IA4 A;  3PPQ A;  2VD3 A;  4ISU A;  5L9M A;  1P1O A;  3GBB A;  3S9N C;  4R2B A;  2YPN A;  2Y7P A;  5HPQ A;  2PBW A;  1M5E A;  3H6U A;  2RC9 A;  3TEL A;  3DP6 A;  4JWY A;  3CR9 A;  3WAF A;  2F6P A;  3B7D A;  3S9L C;  4KQP A;  5CBR A;  3OO6 A;  2Z8F A;  5TPA B;  1LB8 A;  3RQT A;  4NF4 B;  4BDQ A;  3V83 A;  1OIB A;  2XXI A;  3FZV A;  4KD5 A;  1OVT A;  3PPP A;  4R9G A;  3TCG A;  5KCJ A;  1O64 A;  1WOD A;  1UIU A;  3F11 A;  5CM6 A;  1H44 A;  1URD A;  4I8C A;  1B5H A;  1MXZ A;  1VSO A;  2RIN A;  4UAC A;  3T9V A;  2P2A A;  2XX8 A;  1Y1M A;  4F22 A;  5J1D A;  2B3F A;  4F2Q A;  2DVC A;  4AB6 A;  4U2R A;  1MPC A;  1JET A;  4OQO A;  1US5 A;  4YKJ A;  4FED A;  4GXS B;  4EDP A;  3LBS A;  2FNC A;  3TCH A;  2PYY A;  4KYS A;  2CMO A;  1MQD A;  2Q8J A;  3M8U A;  1MXX A;  1USY H;  4ZEI A;  3G7W A;  3V89 B;  2H9B A;  2THI A;  1PC3 A;  4LP2 B;  2Z23 A;  1B1X A;  1SBP A;  1MM7 A;  2QS4 A;  1SW4 A;  3Q28 A;  2F7C A;  4ZDM A;  3OO9 A;  3IL1 B;  4G8H A;  2B65 A;  3DP8 A;  4NF5 A;  3RNN A;  3VLU A;  4F31 B;  2XXV A;  5JTY B;  1B9J A;  1LBB A;  3GLB A;  3K1N A;  1QVS A;  3MP6 A;  1PB8 A;  5CI5 A;  1DPE A;  3MBP A;  4JXI A;  5EYF A;  4O3A A;  4ZE8 A;  4I1D A;  4LZ7 A;  2PVU A;  1F9B A;  2PMS A;  1BTJ A;  1GV8 A;  1II5 A;  3JZJ A;  1URS A;  1LAH E;  2QL3 A;  5DYH A;  1JNF A;  5H8Q A;  4U21 A;  3FXR A;  3SET A;  4ELO A;  3IB2 A;  4HCY A;  4R73 A;  4POX A;  5I59 A;  4R6Y A;  3HPI A;  4NF6 B;  2HQ0 A;  3A3U A;  4RPO A;  4F1U A;  1I6B A;  1MPD A;  1N84 A;  3LSW A;  3MVX A;  4GF8 A;  4TOZ A;  3TKD A;  3TTM A;  1R1N A;  3H7M A;  3RUM A;  4LUB A;  3U1O A;  3FVG A;  4NWD A;  4XTC Q;  2I3W A;  4YKP A;  3OO8 A;  1P1N A;  3TQL A;  3HST A;  3QUF A;  5I2N B;  2UVJ A;  4R74 A;  3PUY E;  4UA8 A;  3VVE A;  2Q9T A;  2DXR A;  5I59 B;  3IAZ A;  3IO4 A;  4OEU A;  3MPK A;  4H0W A;  1HSJ A;  1AH5 A;  1QUJ A;  2OLB A;  3DM0 A;  1MY3 A;  1OLA A;  2Y7I A;  3RTW B;  4IO4 A;  2ZNS A;  1YAE A;  3BKI B;  3RT8 A;  4BDM A;  4NF4 A;  1B4H A;  3IOV A;  3TTL A;  1TT1 A;  3PU5 A;  2I6E A;  1MQG A;  4PFU A;  2DXY A;  3O2A A;  3O9P A;  4QSD A;  4OWD A;  1OVB A;  1LST A;  2H98 A;  2I0B A;  1NKX A;  3CI8 A;  2WKY A;  3KOT A;  3OXN A;  2F78 A;  4IO7 A;  1Y20 A;  4Q5T A;  4ZED A;  4P11 A;  4ZE9 A;  3K02 A;  3SES A;  1MQJ A;  3QUJ A;  4Q8R A;  4XKP A;  3MZ9 A;  5B7D A;  1ATG A;  3PPR A;  4OEV A;  4DLD A;  5AA1 A;  1H43 A;  2YLN A;  1A7L A;  1MXW A;  2RCB A;  2X26 A;  3QXM A;  2KLF A;  1FTJ A;  4JSD A;  1IXC A;  4YKI A;  3USD A;  4AQ4 A;  4G68 B;  1S9T A;  4QHQ A;  2ESN A;  2V84 A;  1FTL A;  2RKM A;  3CFZ A;  3DP4 A;  3FJG A;  3H6T A;  3ILU B;  5AA2 B;  1N0T A;  1DSN A;  4U22 A;  3JYR A;  3K6W A;  3KN3 A;  2F97 A;  1MG1 A;  1NNT A;  4G77 A;  4QRZ A;  5K2Y A;  3UP9 A;  5ITP A;  3SEV A;  3TOD A;  4ELP A;  4OMB A;  4THI A;  1YPN A;  3OSR A;  1DMB A;  2VOZ A;  4WKM A;  5ISU A;  4PE5 B;  3TQW A;  1QUI A;  3L6G A;  1B3E A;  1FQF A;  2GHB A;  4F3P A;  3K6X A;  3TMG A;  1PEB A;  3PMX A;  4ECF A;  4QFO A;  4N13 A;  5I56 B;  4DDD A;  1BKA A;  1FTO A;  4RXL A;  2V3U A;  3ECR A;  1OQH A;  3LR1 A;  4LON B;  3VVF A;  1JVX A;  2R9J A;  1B7H A;  1Y4T A;  3E4R A;  3U93 A;  3RLF E;  5I57 A;  3CIJ A;  1MQI A;  1D9Y A;  1J1N A;  3HHG A;  5DVJ A;  3IX1 A;  1XHY A;  3T93 B;  3TDJ A;  1XS5 A;  3QAX A;  1I6A A;  1ELJ A;  4QFN A;  4DCX A;  4TLM B;  4HW8 A;  1B7Z A;  1LAX A;  2XXX A;  4GL0 A;  2F7B A;  4N6P A;  3U94 A;  1B52 A;  2GHA A;  1M5F A;  1M5C A;  3H03 A;  2ZNT A;  3OO7 A;  5H8F A;  2QMW A;  4OFJ A;  5CMB A;  1TFA A;  1WDN A;  1TFD A;  2Q89 A;  4MF3 A;  5I2K A;  2ZYK A;  3K00 A;  4OVJ A;  4KYD A;  3S4U A;  4POW A;  4YMB A;  2F34 A;  4OZ9 A;  3PPO A;  4KYE A;  3W15 C;  1P99 A;  2O6A A;  2UXA A;  4IO3 A;  1PBQ A;  3VXB A;  4F29 A;  4GRK A;  1HSL A;  1MY1 A;  2HAU A;  1VE4 A;  2M8C A;  3CVG A;  3RTF B;  1N7W A;  3BBR A;  2HAV A;  3EN3 A;  4Q30 B;  1NNK A;  4ZEC A;  3IJO B;  1LBC A;  3VE1 B;  4YB7 A;  4YKK A;  5FHM A;  1CE2 A;  2Q2C A;  5B70 A;  1SI1 A;  4ND9 A;  2NUV A;  1RYO A;  4IY5 A;  3H06 B;  2GRV A;  1UTH A;  1FQE A;  4GLI A;  2VGQ A;  4KI0 E;  1Y9U A;  2DWA A;  2H4I A;  1IQ7 A;  3MP8 A;  3MQ9 A;  4IGT A;  3RGY A;  4BDR A;  3ONM A;  1URG A;  1N3X A;  2AYS A;  3IOW A;  4OHN A;  3TUS A;  4I9D A;  4DXU A;  1B40 A;  1N04 A;  1IZ1 A;  4H5F A;  4F1V A;  1BIY A;  4GQO A;  5LOM A;  2DWH A;  3VV5 A;  2GH9 A;  1TWY A;  1VFD A;  3G3K A;  1MY0 A;  2NOO A;  2I3V A;  3MWB A;  5KCJ B;  5BUU A;  3GBA A;  2Y84 A;  3H3G A;  1OQG A;  4OES A;  4E0W A;  1LFI A;  3KSX A;  3EPE A;  3UIF A;  3O66 A;  1EZP A;  2HZK A;  2XD3 A;  2D3I A;  5TPA A;  3FV1 A;  3THI A;  4DCY A;  5I57 B;  5KDT A;  1ZBM A;  4NWC A;  2ZMB A;  3BFT A;  1NH7 A;  3VVD A;  5JEI A;  2O69 A;  2XXW A;  3MJN A;  4G8M A;  3ZKL A;  1GTK A;  4TQU Q;  3UOR A;  4KFQ A;  3B6W A;  3DLN A;  4G8N A;  4RPN A;  1LFG A;  2QPQ A;  1SVX B;  1XOC A;  4OXV A;  5DVF A;  4LQ5 A;  1GVC A;  4ESX A;  3MVW A;  1UTB B;  3KN7 A;  4XKN A;  2REJ A;  1PDA A;  1UQW A;  4Q0C A;  2Z8D A;  4ELQ A;  4U4S A;  4KCC A;  4F2O A;  3VLW A;  1SYH A;  1MY4 A;  2NWJ A;  3I6V A;  3KJT A;  3KGC A;  2CZL A;  1VFE A;  2ALU A;  3G3I A;  4F3S A;  3H6W A;  3IB0 A;  4F3G A;  3RPW A;  1ZMG A;  1A40 A;  1QUK A;  4OFL A;  4XXU A;  4DE8 A;  5H8H A;  1MS7 A;  1B1H A;  3IR1 A;  4KHZ E;  3IB1 A;  4GL8 A;  4DXC A;  3C9H A;  2RF1 A;  4EUO A;  3S9M C;  1P1W A;  2F8D A;  3D4C A;  3FJ7 A;  3PUZ E;  4RNS A;  5H8Q B;  2XX9 A;  3O28 A;  1SW5 A;  2XXH A;  4KR5 A;  4EXL A;  3MPL A;  3H6V A;  3CG1 A;  1B5I A;  1GR2 A;  4EF2 A;  4LZ5 A;  4F39 A;  1O7T A;  3B6T A;  4JSO A;  2X7P A;  2O68 A;  4QFP A;  5CRY A;  3S2V A;  4R75 A;  5I84 A;  2HFB A;  2I4B A;  3A09 A;  3G3H A;  4WED A;  5AA2 A;  5H8N B;  2UYF A;  2XD2 A;  3U8Q A;  4HCW A;  1USY E;  2QRY A;  1B05 A;  1ZIU A;  2I58 A;  3ODB A;  4KCD A;  4G2Z A;  5H8S A;  1B58 A;  4H5G A;  3C32 A;  1LB9 A;  2Q2A A;  2ZXT A;  1FQA A;  1ZKB A;  1QKB A;  2OWS A;  4H1X A;  4MBP A;  3U92 A;  2HXW A;  4ZEF A;  1Y3Q A;  5DEX B;  3Q27 A;  1N76 A;  2OWT A;  4XKQ A;  4ESW A;  2Y7R A;  2I0C A;  4H65 A;  1SW1 A;  4U1O A;  5F7V A;  4LQ2 A;  3SEX A;  4PET A;  3R26 A;  5CMC A;  3TPA A;  3UA8 A;  2P1S A;  4E0X A;  2YJP A;  5JK4 A;  1EH3 A;  1IEJ A;  1SW2 A;  4LVQ A;  2ABH A;  1FTK A;  3AXF A;  3VXC A;  4M1V A;  2E1S A;  2ONR A;  1ZU0 A;  2DP8 A;  4M4G A;  4OYV A;  3L6H A;  1DTG A;  2O51 A;  4ELR A;  4LZ8 A;  5H8H B;  1B3F A;  2V3Q A;  3C31 A;  4NF6 A;  3CG3 A;  4WXJ A;  2XXQ A;  3CFL A;  5I58 A;  3VDF A;  2R6G E;  3UN6 A;  1DOT A;  3BFU A;  1LAF E;  2ONS A;  3FVK A;  4RY1 A;  4ZZA A;  5L8D A;  2QMX A;  2B3B A;  3TTR A;  4EXK A;  3T96 B;  4U4X A;  1O63 A;  3MW0 A;  3N6T A;  3T9X B;  1B0L A;  2F7A A;  2V25 A;  4LA9 A;  5H8N A;  1P1Q A;  3N5L A;  1FQB A;  3SER A;  3FUZ A;  4QFL A;  1UTB A;  1ZTY A;  1FTM A;  2ZYM A;  3CRB A;  1N7X A;  1IUD A;  3E3K A;  5AA2 D;  2H25 A;  2BJJ X;  1EU8 A;  4G68 A;  5ITO A;  4EQ9 A;  5CBS A;  3GXA A;  3TTN A;  1A8E A;  2RCA A;  3K6U A;  4G4P A;  4X9T A;  4PFW A;  4JDF A;  1UIV A;  2DQV A;  3C36 A;  1SQY A;  3CSG A;  3OMB A;  2DSF A;  3PUV E;  1AL3 A;  2DYX A;  5EHS A;  1A99 A;  5HM4 B;  2A5T B;  1I6Q A;  1MDQ A;  2Q88 A;  3PMW A;  4QSE A;  4ZEB A;  4EF1 A;  1D9V A;  4P0I A;  3VLV A;  3ILT B;  4NED A;  2XXU A;  4C1U A;  1ZJL A;  1DTZ A;  4YAH X;  3FXU A;  2FYI A;  3RT6 B;  1OLC A;  1XVX A;  3M3K A;  1B7U A;  5CC2 A;  1B3G A;  1MXY A;  4JB7 A;  4WEP A;  3W9V A;  2ZYN A;  3V8X B;  4OER A;  4OET A;  1JVY A;  4BLA A;  2FA7 A;  3SEY A;  4QF9 A;  2VD2 A;  1PB7 A;  4IY6 A;  4JWO A;  4O3B A;  1IXI A;  3PV0 E;  2QS3 A;  4F19 A;  2G93 A;  3MVY A;  1VR5 A;  4YIC A;  1AOV A;  4ZS9 A;  3IJX B;  4PP0 A;  1B6H A;  2PT2 A;  1YCJ A;  2QJE A;  1DPP A;  3C34 A;  3FVN A;  4LAT A;  4YB5 A;  2DWJ A;  3IOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...