2Z8FA

The galacto-n-biose-/lacto-n-biose i-binding protein (gl-bp) of the abc transporter from bifidobacterium longum in complex with lacto-n-tetraose
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
401
structure length
401
Chain Sequence
DDGGVVNITYMHRLPDSEGMTLVNDIVAKWNKQHPDIQVKATKFDGKASDMIKKLETDVKSGEAPDLAQVGYAELPEVFTKGLLQDVTQYAEQYKNDFASGPYSLVQVGGKAYGLPQDTGPLVYFYNKAEFEKLGITEIPQTADEFIAAAKTAAAAGKYIMSYQPDEAGNMISGLAGASGGWYKVKGDSWVVNTETDGSKATADFYQQLLDAKAATTNPRWDPSFDASIKDGSLIGTVAAAWEAPLFMTSSGGTGSGEWQVAQLGDWFGNAGKTGPDGGSAVAVLKNSKHPKEAMEFLDWFNTQVPDLVSQGLVPAATTEDAETPSEWSTFFGGQDIMKEFKTANNNMGDFTYMPGFSAVAAKMNETAAKATDGSGKVADIFSDAQTTSVDTLKNFGLSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galacto-N-biose/lacto-N-biose I transporter substrate-bindin
publication title Structural and thermodynamic analyses of solute-binding Protein from Bifidobacterium longum specific for core 1 disaccharide and lacto-N-biose I.
pubmed doi rcsb
source organism Bifidobacterium longum
total genus 146
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z8fA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z8fA02
1FW0A 2V25A 2Q2CA 1B1HA 1R9LA 1Z7NE 4R6YA 1M5CA 2I0CA 3ZKKA 1MY1A 4NWCA 5CMBA 4BLAA 5L9OA 4LP2B 4KI0E 4FORA 3FGSA 5B70A 3C9HA 1OLAA 4RPOA 4F3GA 3GXAA 5K2XA 5B7DA 2AYSA 3CFXA 4EF2A 5HM4B 5A5XA 2VOZA 1P1OA 4G68A 2Q9TA 2DYXA 5CI5A 5I58A 1SYIA 3DP8A 1FQFA 3CSBA 1QKBA 2ZXTA 3USDA 1MPBA 3O2AA 4AQ4A 1TT1A 5KCJA 4EQBA 4OXVA 4RK2A 3L6GA 4O3BA 3B7DA 4OFLA 2REJA 1A8EA 3U1OA 3PD9A 2ESNA 5TPAA 4GD5A 4PFYA 3H03A 1FCKA 1QUJA 1FQDA 4RPNA 2VD3A 1A8FA 4AB6A 3E3KA 4H1XA 1FQBA 3IL1B 5A5XB 2UVJA 4G68B 4QFKA 1BTJA 3G7WA 2Z8FA 1UIUA 4P0GA 2OK2A 2VP1A 5I58B 3ODBA 2DXRA 5I59A 1SDXA 3QIMA 4ZE9A 2XXXA 3R7XA 3VDFA 2HZLA 1D3KA 1XHYA 1PBPA 4IO3A 3SEYA 1DOTA 2PT2A 4IB2A 1EH3A 1A7LA 1DSNA 1NNKA 3IOVA 2Y7RA 3PUVE 3FUZA 3GLBA 2CZLA 3FXQA 4NF6A 4ND9A 1MM6A 1OIBA 3PMWA 1POY1 1B3GA 2THIA 5I56A 2PYYA 2XD3A 1URDA 1FQCA 1FQEA 4LVQA 5I59B 1SQYA 4M4GA 1MM7A 2HFBA 3M8UA 1GV8A 4G2ZA 4ZZAA 4RY1A 2F35A 4Z0IA 1MQJA 2Y84A 1XS5A 2XXRA 4OYVA 4BDRA 4F1UA 3H6UA 4QSCA 2Q89A 2Q88A 2F7BA 3K2DA 4GIZA 1QVSA 3D4GA 4X1DA 4C0RA 4QSDA 5L9MA 4I62A 2UYFA 5H8QA 1MY4A 2VHAA 1Y4CA 4YMBA 4MFIA 4NF6B 1IXGA 5I56B 5FTHA 3EN3A 1MQIA 1J1NA 1M5DA 4QRZA 2Q8JA 4H5FA 1VSOA 1EZ9A 2O69A 4ZEBA 3LSXA 1BKAA 2GHAA 4YZZA 2E1SA 3GZGA 2QS3A 3JV9A 3S9NC 4IO2A 3TPAA 1BP5A 3KN3A 3H4ZA 4Q0CA 3VLUA 1DPPA 4I9DA 3EHTA 3Q25A 5CMKA 1B0HA 4FEDA 4G4PA 1H43A 4TOZA 1FQAA 3PD8A 3FVGA 2HZKA 2RC9A 1VFDA 1P1WA 2A5SA 5AA2D 3MPLA 4LZ5A 3IOWA 1N04A 3K1NA 3PUYE 3O6HA 4UA8A 3RT8A 4R72A 2XXYA 3EHUA 2ONKE 4JSDA 3W15C 2ZYNA 4XTCQ 1L5TA 1FTLA 4H0WA 1IQ7A 4KR5A 4AB5A 4OQOA 3M3LA 2UXAA 1GR2A 3T9XB 4QFPA 4LA9A 3U92A 1B3EA 3VVDA 1USYH 1WVJA 3OOAA 4FECA 4OFJA 3S9EA 1PBQA 2G93A 1ZTYA 3SEWA 1TWYA 1WODA 4PFUA 3THIA 2ZYOA 1MXZA 1MY2A 2RCBA 3DELB 3TYHA 3K4UA 3UGWA 4M1VA 3IO4A 3E4RA 3O29A 4MLQA 3BBRA 1T0KA 2H5YA 5TP9A 1LLSA 3LR1A 4N6PA 1KWHA 3TTLA 4MBPA 3EF7A 3IAZA 2DSFA 3TQLA 1CE2A 4RXLA 3CRBA 4F2OA 5ISUA 3CFZA 3MJNA 5M2VA 4TLLB 2OJTA 1NNFA 4JWYA 1PDAA 4R2BA 4GQOA 1NNPA 4Q8RA 5CRYA 4DDDA 3O6GA 2I6EA 4IO7A 3ILTB 4ESWA 4Q5TA 3FXRA 3I5OA 3TTNA 1LCTA 5L9SA 5H8HB 3EQ1A 4QHQA 4C1TA 1A55A 2O1MA 2I49A 3K6XA 5TP9B 1PC3A 1OLCA 4Z7EA 4DXCA 1Y20A 1ZKBA 1AH5A 3KJ7A 3KJTA 4XKNA 1ANFA 4HCYA 3JYRA 1DTZA 3PMXA 2OWSA 1SW5A 4NE4A 3G3FA 4I8CA 2F7CA 1P1QA 1BIYA 2I4BA 3VLWA 3CI8A 2DE3A 1B6HA 1OQGA 1MXWA 2DQVA 4XKRA 4G8HA 4HTGA 3EHSA 4EXKA 3IB1A 1NH7A 3TDJA 1B5IA 1WDNA 2AIXA 4OWDA 3MAMA 3TFLA 2I3VA 3TEPA 2UVGA 3KZGA 1O64A 1MXXA 2E0SA 3N6UA 2IA4A 1B5JA 3E9XA 2YLNA 4MF3A 4EXLA 1Z7ME 2GRVA 4Q30B 3FVNA 1MH3A 1NKXA 4F18A 2W7YA 4LUBA 4XXUA 4MLVA 3G3KA 2F5XA 1QUKA 3TTMA 4U1OA 3T9HB 4PFTA 2Y7IA 4G77A 4YKKA 5FHNA 1IEJA 3VVEA 1PEBA 3W9WA 5I2KA 1QJMA 4C1UA 4R2FA 2RCAA 1SI1A 5I2NA 3TZAA 2QS2A 4RK9A 1SW2A 4F3BA 1TFAA 1SBPA 3N94A 3TCFA 1UQWA 2XX9A 4NWDA 1JW5A 3MP1A 4GWOA 3RUMA 3IOUA 4R9FA 4QFOA 5H8NA 5ICTA 2ONRA 3TAJA 2HAVA 2ZMBA 3IB0A 3KN8A 3OO8A 1O63A 4H6DA 5BWJA 1Y3QA 3KBRA 4NF4A 5ELVA 3ZS6A 4X9TA 1H44A 1MQDA 3V83A 2XX7A 3FZVA 1YAEA 2PBWA 2QPQA 4OVJA 4LZ8A 3T22A 3MW0A 1LAHE 4HS7A 3LSFB 4DIGA 3K0VA 3SDFA 3N6TA 5I2KB 3TKDA 3K6VA 1FTJA 1VR5A 2B65A 4POWA 1ELJA 1I6QA 1R9QA 3CIJA 2DE4A 2YPNA 3MWBA 4H8IA 2B3FA 5CM6A 2V3UA 3C33A 2VGQA 3DM0A 3UIFA 1HSEA 5H8NB 3H7MA 3VLVA 2D3IA 1NH8A 2I0BA 5KCJB 3HHGA 3MPKA 3O28A 2XXUA 4HW8A 4ZZEA 4NF4B 3FASA 3PU5A 3OEKA 2D21A 4GLIA 3BFUA 3I3VA 3PPNA 4EDPA 1LFIA 2Y7KA 3K02A 4YKIA 3UN6A 1B46A 5TPAB 3IO6A 2QS1A 4U4SA 3WAEA 2F8DA 3KFMA 1MQHA 3T9VA 2OLBA 1LCFA 4F1YA 1US5A 4KCDA 3RGYA 2DOJA 3OEMA 1MPCA 4R9GA 1URGA 4X48A 4IO4A 3PPRA 4U2RA 2FYIA 2OWTA 3PMVA 2XHDA 4DCXA 1ZMGA 2UYEA 3M3FA 3W9VA 4X1BA 4L17A 3MP8A 5AA3A 1D9VA 4KPTA 4NF8A 1OVTA 3O97A 3AXFA 3KN7A 4H67A 3CG1A 5ITPA 1NMUA 4EUOA 1O7TA 4K3FA 1SVXB 3HHFA 3TTRA 3N5LA 4NF5A 3TODA 1LAFE 4OMBA 1MDP1 4ZEKA 1XT8A 4ZEDA 3RLFE 2DWAA 5BUUA 4ECFA 2WKYA 1B3FA 3K1PA 4YICA 4ZEIA 3U72A 4FAJA 5H8FA 2HCAA 1UIVA 1LBBA 1PB9A 3G3HA 2F36A 1B7UA 3UK4A 1B5HA 3K6WA 3O6IA 4ELOA 1S7YA 4NF8B 1Y1ZA 4U1ZA 4F2QA 3RT6B 4IGTA 2PMSA 5DVIA 3VE1B 2DWIA 4U23A 5H8QB 3TUSA 2BJJX 3LUYA 2UVIA 1R6ZA 4QFLA 1LB9A 2XX8A 1JW1A 4NF5B 3FV2A 4KYSA 2ZYKA 4I1DA 4F19A 5EHSA 2XXTA 3ONMA 4GXAA 1D4NA 3MUQA 3MVWA 1LAGE 4E0XA 4KYDA 5H8FB 2Y7PA 4GF8A 5DYHA 2XXQA 5EYFA 1A54A 1B3HA 1MH4A 1TFDA 1F9BA 4H8JA 2QJEA 3SEXA 3K6UA 1IXCA 1MG1A 3SKPA 5I57A 2OBGA 4KHZE 1LFGA 4GOTA 5IAIA 4YKJA 1QKAA 1QW0A 5KDTA 3VXCA 2GH9A 5K2YA 2DVZA 3RPWA 3ECRA 2D5WA 4ISUA 3QXMA 4RYAA 2X7PA 2AL5A 5AE4A 4F29A 2XXIA 1IIWA 3FJGA 3IOTA 1SD3A 4JBZA 3PPPA 4R6HA 4BDOA 3RTWB 3O66A 1MY3A 3LBSA 2LAOA 3FVKA 4EQ7A 3RY3A 1MS7A 1QULA 4YAHX 1SW4A 2QMXA 2V3TA 3FV1A 2DVCA 1RKMA 1PB7A 1MXUA 1P1NA 4IGRA 5I57B 1IITA 1N84A 2ZYMA 1SI0A 3SESA 1Y4TA 4YKPA 3MVXA 1USYE 5DVFA 2XXWA 5KDTB 1POTA 3PPQA 3OO6A 3TCGA 2OZZA 4F22A 4FE8A 4PETA 4QF9A 2R6GE 5CBRA 3OXNA 2Z23A 1TXFA 3JZJA 1N76A 2NUVA 1ZIUA 1HSLA 1N7XA 2ABHA 3QUFA 3I6VA 1AIVA 2RKMA 4WXJA 4ZDMA 2PX1A 2OCUA 3TMGA 1I6BA 3KSXA 1YTVA 3QSLA 3O9PA 2O84X 3Q26A 4R73A 3C35A 4IY5A 5I84A 5ICQA 4F39A 3C32A 1ATGA 4F31B 1OVBA 3OSRA 3CG3A 2IEEA 4KCCA 5JTYA 4EF1A 4GXSB 3ZSFA 1B9JA 2Z22A 4OENA 3U93A 4LQ5A 4DLDA 4POXA 3IB2A 2DWHA 4E0WA 1AOVA 4OETA 4NTLA 1UTBA 1Q1KA 3MZ9A 3OO9A 4ZECA 4PP0A 1JEVA 4H5GA 4OERA 3C4MA 3OENA 1MXYA 5IKBA 1DTGA 2ZNUA 3C31A 2ONSA 4ESXA 2F6PA 5TU0A 3KG2A 4DXUA 3C36A 3FIRA 4GRKA 3PUWE 4PFWA 3IJOB 2I58A 2XD2A 2DP8A 4ZE8A 1H45A 3KSJA 4OHNA 3Q27A 5JTYB 3OELA 4TQUQ 2Z8EA 2REGA 4LATA 1I69A 1EZOA 4FIMA 1RYOA 4JWXA 4XKQA 1ZU0A 3T96B 4G68C 1UTBB 3TQWA 1PB8A 4YB6A 5CMMA 1MPDA 3VVFA 4R6KA 2H4IA 1EZPA 2UVHA 2H98A 3U94A 1MY0A 4OZ9A 3H06B 2I48A 1S9TA 3ILUB 1B3LA 4P11A 3B6WA 1OQHA 4GL0A 1D9YA 1FTMA 4RNSA 3SERA 4R75A 3QUJA 1JETA 2R9JA 3SETA 4FJPA 5I2NB 1GVCA 2RINA 1B7HA 3OSQA 4GVOA 3C34A 3IORA 2RC8A 4JWOA 5FTIA 1OMPA 3E13X 4KQPA 5AA4A 3T9UA 4IO5A 2I4CA 4F3PA 2CMOA 2ALUA 1VFEA 3G3IA 2M8CA 3VXBA 3MC2A 4HCWA 5EHMA 1NL5A 1H3DA 3H6TA 2QRYA 1Y3PA 3HO7A 3CFLA 5F7VA 5FHMA 2PT1A 1II5A 2Z8DA 1IZ1A 1B58A 3V5AA 3Q28A 2AL4A 2KLFA 4MH5A 1GGGA 2B3BA 1EU8A 3FJ7A 4ZEFA 3GBBA 5CC2A 1FTKA 3SEVA 2P0SA 2H9BA 2YJPA 3VV5A 1VE4A 4ZS9A 3MP6A 4FEBA 1Y1MA 1S50A 4RJZA 3H3GA 1FTOA 1N3WA 1US4A 2V84A 5DTBA 3R26A 4ELRA 1ZJLA 5AA4B 1A99A 4KD5A 5DEXA 4JSOA 1B4ZA 4BDNA 4DZ1A 2ZNSA 2F97A 3TELA 3CVGA 3WAFA 4U21A 2NOOA 3IK6B 3MZ1A 1GTKA 1LSTA 2DWJA 3MBPA 2V3QA 4G8NA 4UACA 3V8XB 1CB6A 2I3WA 2VD2A 5CMCA 3S2VA 2O7IA 3Q29A 4IO6A 3S9MC 4GL8A 4OFOA 4THIA 5L8DA 2G29A 1IUDA 1MQGA 2V93A 4P0IA 3TCHA 1M5FA 3S4UA 4LQ2A 1XC1A 1LB8A 3HPIA 2A5TA 2P2AA 3H6VA 2O6AA 1QUIA 4TLMB 5DEXB 4YB7A 3QYTA 3A3UA 3K00A 3KOSA 5LOMA 1B2HA 4N07A 3DP6A 1NNTA 2DE2A 3RNNA 3MZBA 4H65A 1XOCA 1B7ZA 4KFQA 4QSEA 4O3AA 1B51A 1B0LA 4N13A 5FHOA 4QFNA 3LC8A 3PUZE 3V89B 2NXOA 4RA1A 3L6HA 3R6UA 2HEUA 4OEVA 3ZKLA 2FNCA 4BDLA 4KYEA 2O51A 2PVUA 4BDQA 4BDMA 3BKIB 1N7WA 5ITOA 1JW4A 4WEPA 1H76A 4ELPA 3P7IA 5AA2A 2XXPA 1LFHA 4XIGQ 3N26A 3HV1A 2XXVA 1HSJA 2A5TB 2O7UA 4NEDA 2GFEA 1I6AA 2F6GA 1LBCA 3QAXA 3FVOA 3A09A 3FATA 3TTKA 3FD3A 2XXHA 5JK4A 3T66A 4F3SA 2R71A 4U22A 4YMAA 5JEIA 3OMBA 1AMFA 4G8MA 4JXIA 4U4XA 3VFJA 3BFTA 5DT6A 3HCQA 5J1DA 4YB5A 2HQ0A 4DCYA 4R74A 3PPOA 3MQ9A 1R1NA 3DP4A 1A40A 4O3CA 3KOTA 3EPEA 3HSTA 2QMWA 3RQTA 1MXVA 2X7QA 2X26A 2Y7WA 1ZLQA 5AA2B 3RN8A 3LSWA 4NMYA 1AL3A 4LONB 2FA7A 1B05A 4FATA 1JNFA 3UP9A 4WEDA 4ONYA 3S9LC 1N0TA 3QK6A 5KZTA 1UTHA 3GBAA 5H8HA 2P1SA 1BLFA 2H99A 2QSXA 1RYXA 4OEUA 3IX1A 4JDFA 1ZBMA 3HN0A 3SEUA 1B1XA 1B40A 1DMBA 2F34A 2ANJA 1SYHA 4GFRA 1LAXA 4OESA 2HAUA 1B32A 4DXBA 4IY6A 1IXIA 1NFTA 1P1UA 4XKPA 2NWJA 3UORA 1DPEA 3OD7A 3T93B 2Q2AA 4F1VA 3RTFB 5HBCA 1URSA 4YU0A 3B6QA 1M5BA 3CR9A 3U8QA 1JVYA 3IJXB 4PE5B 3PUXE 1XVYA 3K1MA 2QS4A 4JB7A 2NVUB 1Q35A 1UTHB 2F7AA 2ZNTA 1B4HA 2RC7A 2F78A 4DE8A 1Y3NA 1YCJA 3M3KA 3MVYA 1SW1A 3G3GA 2RF1A 3D4CA 1B52A 3LSLA 4ELQA 3KEIA 5HPQA 1LGBC 1JVXA 2HXWA 1MDQA 3FXUA 1IXHA 3B6TA 5CBSA 5DVJA 4LZ7A 4WKMA 3IR1A 5AA1A 1YPNA 3UA8A 2DS9A 2DXYA 3F11A 3CSGA 1JEUA 3FJMA 4EQ9A 5H8SA 4PQJA 1M5EA 3KGCA 2QL3A 1P99A 3OO7A 2O1LA 3PGFA 3H6WA 2O68A 3A3CA 1N3XA 3MVZA 4OTEA 1Y9UA 2H25A 3DLNA 1JQFA 1MRPA 3PV0E 5F1QA 2GHBA 3G3JA 3K01A 1XVXA
chains in the Genus database with same CATH superfamily
1FW0A 2V25A 2Q2CA 1NV5A 1B1HA 1R9LA 1SPIA 1Z7NE 4NGUA 4R6YA 1M5CA 2I0CA 1NV7A 3ZKKA 1MY1A 4NWCA 5CMBA 4BLAA 5L9OA 3A29A 4LP2B 4KI0E 4FORA 3FGSA 2R8TA 5B70A 3C9HA 1OLAA 4RPOA 4F3GA 3GXAA 5K2XA 5B7DA 2AYSA 3CFXA 4EF2A 1LBYA 2Y5KA 5HM4B 5A5XA 2VOZA 1P1OA 4G68A 2KQZA 4PGPA 2XXKA 2Q9TA 2DYXA 4NX1A 5CI5A 1NUZA 5I58A 1SYIA 3DP8A 1FQFA 3CSBA 1QKBA 2ZXTA 1FBEA 3USDA 1MPBA 3O2AA 4AQ4A 1TT1A 5KCJA 4EQBA 2L5VA 4OXVA 4RK2A 5ET8A 3L6GA 2PFZA 4O3BA 3B7DA 4OFLA 4PDHA 2REJA 1A8EA 4O7MA 3U1OA 3PD9A 2ESNA 5TPAA 4GD5A 4PFYA 3H03A 1FCKA 4H45A 1FPJA 1QUJA 1FQDA 4RPNA 2VD3A 2DDKA 1A8FA 4AB6A 3E3KA 4H1XA 1FQBA 3IL1B 5A5XB 2UVJA 4G68B 4QFKA 1BTJA 3G7WA 2Z8FA 1LEVA 1UIUA 4P0GA 2OK2A 2VP1A 4NHBA 5I58B 3ODBA 1FTAA 3IFCA 2DXRA 5I59A 1SDXA 4NG7A 3QIMA 4ZE9A 2XXXA 4MEVA 3R7XA 3VDFA 2HZLA 1D3KA 1XHYA 1FBGA 1PBPA 4IO3A 2QVRA 3SEYA 1DOTA 2PT2A 4IB2A 1EH3A 2HXRA 1XI6A 2CEXA 1A7LA 1DSNA 1NNKA 3U65A 3IOVA 2Y7RA 3PUVE 3FUZA 3GLBA 3E79A 2CZLA 3FXQA 4NF6A 4ND9A 1MM6A 1FSAA 1OIBA 3PMWA 1POY1 1B3GA 2THIA 5I56A 2PYYA 1FRPA 2XD3A 1URDA 1FQCA 1FQEA 4LVQA 5I59B 1SQYA 4GWXA 4M4GA 1MM7A 2HFBA 3M8UA 1GV8A 4G2ZA 4ZZAA 4RY1A 2F35A 4Z0IA 1MQJA 2Y84A 1XS5A 2XXRA 3B8BA 4OYVA 4BDRA 4F1UA 3H6UA 4QSCA 4JVCA 2Q89A 2Q88A 2F7BA 3K2DA 4GIZA 1QVSA 3D4GA 4X1DA 4GBVA 4C0RA 4QSDA 5L9MA 4I62A 2UYFA 5H8QA 1MY4A 2VHAA 1Y4CA 4YMBA 4MFIA 4NF6B 1IXGA 2P3VA 5I56B 5FTHA 3EN3A 1MQIA 1J1NA 1M5DA 1LBXA 4QRZA 2Q8JA 4N6DA 4H5FA 1VSOA 1EZ9A 2O69A 2WYKA 4ZEBA 3LSXA 1BKAA 2GHAA 4YZZA 2E1SA 1NV4A 2FIXA 3GZGA 2QS3A 3JV9A 3S9NC 4IO2A 3TPAA 1BP5A 3KN3A 3H4ZA 4Q0CA 3VLUA 1DPPA 4I9DA 2OX3A 1NV3A 3EHTA 3Q25A 5CMKA 1B0HA 4FEDA 4N8GA 4G4PA 1FPBA 1H43A 4TOZA 1FQAA 3PD8A 4QXDA 3FVGA 2HZKA 2RC9A 1BK4A 1VFDA 1P1WA 2A5SA 5AA2D 3MPLA 4LZ5A 3IOWA 1N04A 3K1NA 4GBWA 3PUYE 2CZIA 3O6HA 2XWVA 4UA8A 3RT8A 4R72A 2XXYA 3EHUA 2ONKE 4JSDA 3W15C 2ZYNA 4XTCQ 1L5TA 1FTLA 5IGAA 4H0WA 1IQ7A 4KR5A 4AB5A 4OQOA 4PTKA 3M3LA 2UXAA 1GR2A 3T9XB 4QFPA 4LA9A 3U92A 1B3EA 3VVDA 1USYH 1DBZA 1WVJA 4JVDA 3OOAA 4FECA 4OFJA 3S9EA 1PBQA 2G93A 1ZTYA 3SEWA 1TWYA 1WODA 4PFUA 3THIA 2ZYOA 1MXZA 1MY2A 2RCBA 4MNIA 3DELB 3TYHA 3K4UA 3UGWA 4P1LA 4M1VA 2F3DA 3IO4A 3E78A 3E4RA 3O29A 4MLQA 3BBRA 1T0KA 2H5YA 5TP9A 4PBHA 1LLSA 4H46A 3LR1A 4N6PA 1KWHA 3TTLA 4MBPA 3EF7A 4OVTA 3IAZA 2DSFA 3TQLA 1FBFA 1CE2A 4RXLA 3CRBA 4GWSA 4F2OA 1FBHA 4N15A 5ISUA 3CFZA 3MJNA 5FBPA 5M2VA 4TLLB 2OJTA 1NNFA 4JWYA 1PDAA 4R2BA 4MJOA 4GQOA 1NNPA 4Q8RA 4OANA 5CRYA 4DDDA 3O6GA 2I6EA 4IO7A 4N91A 3ILTB 3CHGA 3KBZA 4ESWA 2QVVA 4Q5TA 3FXRA 3I5OA 4X8RA 3TTNA 4MNPA 5EQ7A 1LCTA 5L9SA 5H8HB 3EQ1A 4QHQA 4C1TA 1A55A 2O1MA 2I49A 3K6XA 5TP9B 1PC3A 5I3SA 4N81A 1OLCA 4Z7EA 4OVPA 5LDZA 4DXCA 1Y20A 1ZKBA 1AH5A 3KJ7A 3RPLA 3KJTA 4XKNA 1ANFA 2XWIA 4GWZA 4HCYA 3JYRA 1DTZA 1EYIA 3PMXA 2OWSA 1SW5A 4NE4A 3LV0A 1FBCA 3G3FA 4I8CA 2F7CA 1P1QA 1BIYA 2I4BA 3VLWA 3CI8A 2DE3A 5IZ1A 1B6HA 1OQGA 1MXWA 2DQVA 4XKRA 1FPKA 2CZKA 4G8HA 1FBPA 4HTGA 4FBPA 3EHSA 4EXKA 3IB1A 1NH7A 3TDJA 4P56A 1LBWA 1B5IA 1WDNA 2AIXA 1YZ0A 4OWDA 5EQ9A 2CZHA 3MAMA 3TFLA 2I3VA 3TEPA 2UVGA 3KZGA 1O64A 1MXXA 2E0SA 3N6UA 2IA4A 1B5JA 3E9XA 2YLNA 4MF3A 4EXLA 5EYHA 1Z7ME 2GRVA 4Q30B 3FVNA 3RPLB 1MH3A 1NKXA 4F18A 4PAFA 3IFAA 2W7YA 4LUBA 4XXUA 4MLVA 3G3KA 2F5XA 1FPIA 4N6KA 1QUKA 3TTMA 3B50A 4U1OA 3T9HB 4PFTA 4PDDA 2Y7IA 4G77A 4YKKA 5FHNA 1IEJA 3VVEA 1PEBA 3W9WA 4KXPA 5I2KA 2Q74A 1QJMA 4C1UA 4OA4A 4R2FA 2RCAA 4LN5A 4N17A 1SI1A 1DCUA 5I2NA 3TZAA 4PFRA 2QS2A 4RK9A 1SW2A 4F3BA 4O7IA 1TFAA 1SBPA 1INPA 3N94A 3TCFA 1UQWA 2XX9A 4NWDA 1JW5A 2VPOA 3MP1A 4PCDA 4GWOA 3RUMA 3IOUA 4R9FA 4QFOA 5H8NA 1LBZA 5ICTA 2ONRA 3TAJA 2HAVA 2ZMBA 3IB0A 3QMFA 3KN8A 3OO8A 1O63A 4H6DA 5BWJA 1Y3QA 3KBRA 4NF4A 5ELVA 3ZS6A 4X9TA 1H44A 1MQDA 3V83A 2XX7A 3FZVA 1YAEA 2PBWA 2QPQA 4OVJA 4LZ8A 3T22A 2WYPA 1NV1A 3MW0A 3RYDA 1LAHE 2JJKA 4HS7A 3LSFB 4DIGA 3K0VA 3SDFA 3N6TA 5I2KB 3TKDA 3K6VA 1FTJA 1VR5A 2B65A 4POWA 1ELJA 1I6QA 1R9QA 4GWUA 3CIJA 1RDXA 2DE4A 2YPNA 3MWBA 4H8IA 2B3FA 5CM6A 2V3UA 3C33A 2VGQA 1D9QA 3DM0A 3UIFA 1HSEA 5H8NB 3H7MA 5ET7A 3VLVA 2D3IA 1NH8A 1FPGA 2I0BA 5KCJB 3HHGA 3MPKA 3O28A 2XXUA 4HW8A 4ZZEA 4NF4B 3FASA 3PU5A 3OEKA 2D21A 4GLIA 3BFUA 3I3VA 3PPNA 4EDPA 1LFIA 2Y7KA 1AWBA 3K02A 4YKIA 3UN6A 1B46A 5TPAB 3IO6A 2QS1A 4U4SA 3WAEA 2F8DA 3KFMA 3BIGA 1YYZA 1MQHA 3T9VA 4MIJA 2OLBA 1LCFA 4F1YA 1US5A 4KCDA 3RGYA 2DOJA 3OEMA 1MPCA 4HE1A 4R9GA 1URGA 4X48A 4IO4A 3PPRA 4U2RA 4HE2A 2FYIA 3SZPA 2OWTA 3PMVA 2Y5LA 4MCOA 5EQAA 2XHDA 4DCXA 1ZMGA 2UYEA 4NN3A 3M3FA 3W9VA 4X1BA 4L17A 3MP8A 4XEQA 5AA3A 1D9VA 4KPTA 4NF8A 1OVTA 3O97A 3AXFA 3KN7A 4H67A 3CG1A 2XA5A 4HXVA 5ITPA 1NMUA 4IR8A 4EUOA 1O7TA 4K3FA 1SVXB 3HHFA 3TTRA 3N5LA 4NF5A 3TODA 1LAFE 4OMBA 1MDP1 4ZEKA 1XT8A 4ZEDA 3RLFE 2DWAA 5BUUA 4ECFA 2WKYA 1B3FA 3K1PA 4YICA 4ZEIA 3U72A 4FAJA 5H8FA 2HCAA 1UIVA 1LBBA 1PB9A 3G3HA 2F36A 1B7UA 4PGNA 3UK4A 5ET5A 1B5HA 3K6WA 3O6IA 2B4MA 4ELOA 1S7YA 4NF8B 1Y1ZA 4U1ZA 4F2QA 2WBDA 3RT6B 4IGTA 2OWZA 4I40A 2FBPA 1YXIA 2PMSA 5DVIA 3VE1B 2DWIA 4U23A 5H8QB 3TUSA 2BJJX 3LUYA 1K9YA 4PF6A 2UVIA 1R6ZA 4QFLA 1LB9A 2XX8A 1JW1A 4NF5B 3FV2A 4KYSA 2ZYKA 4I1DA 4F19A 5EHSA 2XXTA 3ONMA 4GXAA 1D4NA 3MUQA 1FJ6A 3MVWA 1LAGE 2MKZA 4E0XA 5EQ8A 4MX6A 4KYDA 5H8FB 2Y7PA 4GF8A 5DYHA 2XXQA 1IMCA 5EYFA 1A54A 1B3HA 4JVIA 1MH4A 1TFDA 2FIEA 1F9BA 4H8JA 2PCRA 2QJEA 3SEXA 3K6UA 1IXCA 1MG1A 3SKPA 5I57A 2OBGA 4KHZE 1DK4A 1LFGA 4GOTA 5IAIA 4YKJA 1QKAA 1QW0A 5KDTA 4NAPA 3VXCA 2GH9A 5K2YA 2DVZA 3ISPA 3RPWA 2QVUA 3ECRA 2D5WA 1NUXA 4ISUA 3QXMA 1CNQA 4RYAA 2X7PA 2AL5A 5AE4A 4F29A 2XXIA 1IIWA 3FJGA 3IOTA 1SD3A 3FXBA 5T3JA 4JBZA 3PPPA 4R6HA 4BDOA 3RTWB 2FHYA 3O66A 1MY3A 3LBSA 2LAOA 3FVKA 4EQ7A 3RY3A 1MS7A 1QULA 4YAHX 1SW4A 4P47A 2QMXA 4N4UA 2V3TA 3FV1A 2DVCA 1RKMA 3BIHA 1PB7A 1MXUA 1P1NA 4IGRA 5I57B 1IITA 1N84A 2ZYMA 1SI0A 3SESA 1Y4TA 4P8BA 4YKPA 3MVXA 1USYE 5DVFA 3LUZA 2XXWA 1NV0A 5F24A 5KDTB 1POTA 3PPQA 3OO6A 4P3LA 3TCGA 2FVZA 2OZZA 4F22A 4FE8A 4PETA 1KA0A 4GX3A 4QF9A 2R6GE 5CBRA 3OXNA 1NV6A 2Z23A 1TXFA 3JZJA 1N76A 2NUVA 1ZIUA 1HSLA 1N7XA 3GYYA 2ABHA 3QUFA 3I6VA 1AIVA 2RKMA 4WXJA 4ZDMA 2PX1A 2OCUA 3TMGA 1NUYA 1I6BA 3KSXA 1YTVA 3QSLA 4AS4A 3O9PA 2O84X 3Q26A 4R73A 3C35A 4IY5A 5I84A 5ICQA 2ZZXA 4F39A 1QGXA 4P9KA 3C32A 1ATGA 4F31B 1OVBA 3OSRA 3CG3A 4PAKA 2IEEA 4KCCA 5JTYA 4EF1A 4GXSB 2F3BA 3ZSFA 1B9JA 2Z22A 4OENA 3U93A 4GWWA 3MYUA 1NI9A 4LQ5A 4DLDA 4POXA 2XWOA 3IB2A 2DWHA 4E0WA 1AOVA 1JP4A 5I5PA 4OETA 4NTLA 1UTBA 2WBBA 1Q1KA 3MZ9A 3OO9A 4ZECA 4PP0A 1JEVA 4H5GA 4MMPA 4OERA 3C4MA 3OENA 1MXYA 5IKBA 1DTGA 2ZNUA 3C31A 2ONSA 4ESXA 2F6PA 5TU0A 3KG2A 4DXUA 3C36A 3FIRA 3ROJA 4GRKA 3PUWE 4PFWA 4PFBA 3IJOB 2I58A 2XD2A 2DP8A 4ZE8A 1H45A 1RDYA 3KSJA 4OHNA 4OVQA 3Q27A 5JTYB 4G61A 3OELA 5I7IA 4TQUQ 2Z8EA 1FPLA 2REGA 4LATA 1I69A 5LTCA 1EZOA 4I3YA 4FIMA 1RYOA 4JWXA 4XKQA 1ZU0A 4P1EA 3T96B 4G68C 1UTBB 3TQWA 1PB8A 4X04A 4YB6A 5CMMA 1MPDA 3HFUA 3VVFA 4R6KA 2H4IA 1EZPA 2UVHA 2H98A 3U94A 5A5LA 1MY0A 2XWKA 4OZ9A 3H06B 5EYGA 2I48A 4NQ8A 4QBAA 1S9TA 3ILUB 1B3LA 4P11A 3B6WA 1OQHA 2WX9A 4GL0A 1D9YA 1FTMA 4RNSA 3SERA 4R75A 3QUJA 1JETA 2R9JA 3SETA 4FJPA 2P3NA 5I2NB 1GVCA 2RINA 1B7HA 3OSQA 4GVOA 3C34A 3IORA 2RC8A 4JWOA 5FTIA 1OMPA 1KA1A 1FPFA 3E13X 2Q8MA 1KZ8A 4KQPA 3PTYA 1Q9DA 3T9UA 4F3PA 4IO5A 2I4CA 5AA4A 1G0HA 2CMOA 2ALUA 1IMDA 1VFEA 3G3IA 2M8CA 3VXBA 3MC2A 4HCWA 4PFIA 5EHMA 1NL5A 2ZZWA 1H3DA 3EKIA 3H6TA 4PBQA 3NOHA 2QRYA 1Y3PA 3KC0A 3HO7A 4MNCA 3CFLA 5F7VA 5FHMA 2PT1A 1II5A 2Z8DA 1IZ1A 1B58A 3V5AA 3Q28A 2AL4A 2KLFA 4MH5A 1GGGA 2B3BA 2HHMA 2PFYA 1EU8A 3FJ7A 4OVRA 4ZEFA 3GBBA 5CC2A 1FTKA 3SEVA 2P0SA 2H9BA 4N8YA 5ESYA 2YJPA 3VV5A 1VE4A 4ZS9A 1FBDA 4GX6A 1G0IA 4XFEA 3MP6A 4FEBA 1Y1MA 1S50A 4RJZA 3H3GA 1FTOA 1N3WA 1US4A 2V84A 5DTBA 3R26A 4ELRA 1ZJLA 5AA4B 2CEYA 1A99A 4KD5A 5DEXA 4JSOA 1NUWA 1B4ZA 4BDNA 4DZ1A 2ZNSA 2F97A 3TELA 3CVGA 3WAFA 4U21A 2NOOA 3IK6B 3MZ1A 1FJ9A 4DI4B 1GTKA 1LSTA 2DWJA 3MBPA 2V3QA 4G8NA 4UACA 3V8XB 1CB6A 2I3WA 2VD2A 5CMCA 3S2VA 2O7IA 3Q29A 4IO6A 3S9MC 1FPEA 4GL8A 4OFOA 4THIA 5L8DA 4O8MA 2G29A 1IUDA 1MQGA 2V93A 4P0IA 4HE0A 3TCHA 1M5FA 3T1BA 3KC1A 1K9ZA 3S4UA 1IMBA 4LQ2A 1XC1A 1LB8A 3HPIA 2A5TA 2P2AA 3H6VA 2O6AA 1QUIA 4TLMB 5DEXB 4YB7A 3FBPA 3QYTA 3A3UA 3K00A 3KOSA 4PE3A 5LOMA 1NV2A 1B2HA 4N07A 2GQ1A 3DP6A 1NNTA 4MHFA 2DE2A 3RNNA 3MZBA 4H65A 1XOCA 1B7ZA 4KFQA 4QSEA 4O3AA 1B51A 1B0LA 4N13A 5FHOA 4QFNA 3LC8A 3PUZE 3V89B 1VDWA 2NXOA 4GWYA 4RA1A 3L6HA 3R6UA 2HEUA 4OEVA 2WEFA 3ZKLA 2FNCA 4BDLA 4KYEA 2O51A 2PVUA 4BDQA 4BDMA 2HPGA 3BKIB 1N7WA 5ITOA 1JW4A 4WEPA 1H76A 4ELPA 3P7IA 5AA2A 2XXPA 1LFHA 4XIGQ 3N26A 3HV1A 2XXVA 2KR0A 1HSJA 2A5TB 2O7UA 4NEDA 2GFEA 1I6AA 2F6GA 1LBCA 3QAXA 3FVOA 3A09A 3FATA 3TTKA 3FD3A 2XXHA 5JK4A 3T66A 4NF0A 4F3SA 2R71A 2VT5A 4U22A 4YMAA 5JEIA 3OMBA 1AMFA 5IM2A 4PAIA 4G8MA 4JXIA 4U4XA 5IZZA 3VFJA 3BFTA 5DT6A 5DW8A 3HCQA 2ZZVA 5J1DA 4YB5A 2HQ0A 4DCYA 4R74A 3PPOA 3MQ9A 1R1NA 3DP4A 1A40A 4O3CA 3KOTA 3EPEA 4I3EA 3HSTA 2QMWA 3RQTA 1IMFA 1MXVA 2X7QA 2X26A 2Y7WA 1ZLQA 5AA2B 3RN8A 3LSWA 4NMYA 1AL3A 4LONB 2FA7A 1B05A 1FPDA 4FATA 1JNFA 3UP9A 4WEDA 4ONYA 4DI3D 3S9LC 1N0TA 3QK6A 5KZTA 2V4CA 1UTHA 3GBAA 5H8HA 2P1SA 1BLFA 2H99A 2QSXA 1RYXA 4OEUA 3IX1A 4JDFA 1ZBMA 3HN0A 3SEUA 1B1XA 1B40A 1DMBA 2F34A 2ANJA 1SYHA 4GFRA 1LAXA 1RDZA 3MSTA 4OESA 2HAUA 5ET6A 1B32A 4DXBA 4IY6A 4GX4A 1IXIA 1NFTA 1P1UA 4XKPA 2NWJA 3UORA 1DPEA 3OD7A 3T93B 2Q2AA 4OVSA 4F1VA 3RTFB 5HBCA 1URSA 4YU0A 1LBVA 3B6QA 1M5BA 3CR9A 3U8QA 1JVYA 3IJXB 4PE5B 3PUXE 1XVYA 3K1MA 2QS4A 4JB7A 5IZ3A 2NVUB 1Q35A 1UTHB 4UABA 2F7AA 2ZNTA 1B4HA 2RC7A 1EYKA 2F78A 4DE8A 1Y3NA 5J16A 4PF8A 1YCJA 3D1RA 3M3KA 3MVYA 3T0JA 1SW1A 3G3GA 2RF1A 3D4CA 1B52A 3LSLA 4ELQA 2B4LA 3KEIA 5HPQA 1LGBC 1JVXA 2HXWA 1MDQA 3FXUA 1IXHA 4O94A 3B6TA 5CBSA 5DVJA 4AS5A 4LZ7A 4WKMA 3IR1A 4MAGA 1YPNA 5AA1A 2DS9A 2DXYA 3UA8A 3F11A 3CSGA 1IMAA 1JEUA 3FJMA 4PC9A 4XF5A 4EQ9A 5H8SA 4PQJA 1M5EA 3KGCA 2QL3A 1P99A 3OO7A 2O1LA 3PGFA 3H6WA 2O68A 3A3CA 1N3XA 3MVZA 4OTEA 2QFLA 1Y9UA 2BJIA 2H25A 3DLNA 1JQFA 5IZ3B 1MRPA 3PV0E 5F1QA 2VPNA 2GHBA 3G3JA 3K01A 1IMEA 1EYJA 1XVXA
chains in the Genus database with same CATH topology
1FW0A 2V25A 2Q2CA 1B1HA 1R9LA 1Z7NE 4R6YA 1M5CA 2I0CA 3ZKKA 1MY1A 4NWCA 5CMBA 4BLAA 5L9OA 4LP2B 4KI0E 4FORA 3FGSA 5B70A 3C9HA 1OLAA 4RPOA 4F3GA 3GXAA 5K2XA 5B7DA 2AYSA 3CFXA 4EF2A 5HM4B 5A5XA 2VOZA 1P1OA 4G68A 2Q9TA 2DYXA 5CI5A 5I58A 1SYIA 3DP8A 1FQFA 3CSBA 1QKBA 2ZXTA 3USDA 1MPBA 3O2AA 4AQ4A 1TT1A 5KCJA 4EQBA 4OXVA 4RK2A 3L6GA 4O3BA 3B7DA 4OFLA 2REJA 1A8EA 3U1OA 3PD9A 2ESNA 5TPAA 4GD5A 4PFYA 3H03A 1FCKA 1QUJA 1FQDA 4RPNA 2VD3A 1A8FA 4AB6A 3E3KA 4H1XA 1FQBA 3IL1B 5A5XB 2UVJA 4G68B 4QFKA 1BTJA 3G7WA 2Z8FA 1UIUA 4P0GA 2OK2A 2VP1A 5I58B 3ODBA 2DXRA 5I59A 1SDXA 3QIMA 4ZE9A 2XXXA 3R7XA 3VDFA 2HZLA 1D3KA 1XHYA 1PBPA 4IO3A 3SEYA 1DOTA 2PT2A 4IB2A 1EH3A 1A7LA 1DSNA 1NNKA 3IOVA 2Y7RA 3PUVE 3FUZA 3GLBA 2CZLA 3FXQA 4NF6A 4ND9A 1MM6A 1OIBA 3PMWA 1POY1 1B3GA 2THIA 5I56A 2PYYA 2XD3A 1URDA 1FQCA 1FQEA 4LVQA 5I59B 1SQYA 4M4GA 1MM7A 2HFBA 3M8UA 1GV8A 4G2ZA 4ZZAA 4RY1A 2F35A 4Z0IA 1MQJA 2Y84A 1XS5A 2XXRA 4OYVA 4BDRA 4F1UA 3H6UA 4QSCA 2Q89A 2Q88A 2F7BA 3K2DA 4GIZA 1QVSA 3D4GA 4X1DA 4C0RA 4QSDA 5L9MA 4I62A 2UYFA 5H8QA 1MY4A 2VHAA 1Y4CA 4YMBA 4MFIA 4NF6B 1IXGA 5I56B 5FTHA 3EN3A 1MQIA 1J1NA 1M5DA 4QRZA 2Q8JA 4H5FA 1VSOA 1EZ9A 2O69A 4ZEBA 3LSXA 1BKAA 2GHAA 4YZZA 2E1SA 3GZGA 2QS3A 3JV9A 3S9NC 4IO2A 3TPAA 1BP5A 3KN3A 3H4ZA 4Q0CA 3VLUA 1DPPA 4I9DA 3EHTA 3Q25A 5CMKA 1B0HA 4FEDA 4G4PA 1H43A 4TOZA 1FQAA 3PD8A 3FVGA 2HZKA 2RC9A 1VFDA 1P1WA 2A5SA 5AA2D 3MPLA 4LZ5A 3IOWA 1N04A 3K1NA 3PUYE 3O6HA 4UA8A 3RT8A 4R72A 2XXYA 3EHUA 2ONKE 4JSDA 3W15C 2ZYNA 4XTCQ 1L5TA 1FTLA 4H0WA 1IQ7A 4KR5A 4AB5A 4OQOA 3M3LA 2UXAA 1GR2A 3T9XB 4QFPA 4LA9A 3U92A 1B3EA 3VVDA 1USYH 1WVJA 3OOAA 4FECA 4OFJA 3S9EA 1PBQA 2G93A 1ZTYA 3SEWA 1TWYA 1WODA 4PFUA 3THIA 2ZYOA 1MXZA 1MY2A 2RCBA 3DELB 3TYHA 3K4UA 3UGWA 4M1VA 3IO4A 3E4RA 3O29A 4MLQA 3BBRA 1T0KA 2H5YA 5TP9A 1LLSA 3LR1A 4N6PA 1KWHA 3TTLA 4MBPA 3EF7A 3IAZA 2DSFA 3TQLA 1CE2A 4RXLA 3CRBA 4F2OA 5ISUA 3CFZA 3MJNA 5M2VA 4TLLB 2OJTA 1NNFA 4JWYA 1PDAA 4R2BA 4GQOA 1NNPA 4Q8RA 5CRYA 4DDDA 3O6GA 2I6EA 4IO7A 3ILTB 4ESWA 4Q5TA 3FXRA 3I5OA 3TTNA 1LCTA 5L9SA 5H8HB 3EQ1A 4QHQA 4C1TA 1A55A 2O1MA 2I49A 3K6XA 5TP9B 1PC3A 1OLCA 4Z7EA 4DXCA 1Y20A 1ZKBA 1AH5A 3KJ7A 3KJTA 4XKNA 1ANFA 4HCYA 3JYRA 1DTZA 3PMXA 2OWSA 1SW5A 4NE4A 3G3FA 4I8CA 2F7CA 1P1QA 1BIYA 2I4BA 3VLWA 3CI8A 2DE3A 1B6HA 1OQGA 1MXWA 2DQVA 4XKRA 4G8HA 4HTGA 3EHSA 4EXKA 3IB1A 1NH7A 3TDJA 1B5IA 1WDNA 2AIXA 4OWDA 3MAMA 3TFLA 2I3VA 3TEPA 2UVGA 3KZGA 1O64A 1MXXA 2E0SA 3N6UA 2IA4A 1B5JA 3E9XA 2YLNA 4MF3A 4EXLA 1Z7ME 2GRVA 4Q30B 3FVNA 1MH3A 1NKXA 4F18A 2W7YA 4LUBA 4XXUA 4MLVA 3G3KA 2F5XA 1QUKA 3TTMA 4U1OA 3T9HB 4PFTA 2Y7IA 4G77A 4YKKA 5FHNA 1IEJA 3VVEA 1PEBA 3W9WA 5I2KA 1QJMA 4C1UA 4R2FA 2RCAA 1SI1A 5I2NA 3TZAA 2QS2A 4RK9A 1SW2A 4F3BA 1TFAA 1SBPA 3N94A 3TCFA 1UQWA 2XX9A 4NWDA 1JW5A 3MP1A 4GWOA 3RUMA 3IOUA 4R9FA 4QFOA 5H8NA 5ICTA 2ONRA 3TAJA 2HAVA 2ZMBA 3IB0A 3KN8A 3OO8A 1O63A 4H6DA 5BWJA 1Y3QA 3KBRA 4NF4A 5ELVA 3ZS6A 4X9TA 1H44A 1MQDA 3V83A 2XX7A 3FZVA 1YAEA 2PBWA 2QPQA 4OVJA 4LZ8A 3T22A 3MW0A 1LAHE 4HS7A 3LSFB 4DIGA 3K0VA 3SDFA 3N6TA 5I2KB 3TKDA 3K6VA 1FTJA 1VR5A 2B65A 4POWA 1ELJA 1I6QA 1R9QA 3CIJA 2DE4A 2YPNA 3MWBA 4H8IA 2B3FA 5CM6A 2V3UA 3C33A 2VGQA 3DM0A 3UIFA 1HSEA 5H8NB 3H7MA 3VLVA 2D3IA 1NH8A 2I0BA 5KCJB 3HHGA 3MPKA 3O28A 2XXUA 4HW8A 4ZZEA 4NF4B 3FASA 3PU5A 3OEKA 2D21A 4GLIA 3BFUA 3I3VA 3PPNA 4EDPA 1LFIA 2Y7KA 3K02A 4YKIA 3UN6A 1B46A 5TPAB 3IO6A 2QS1A 4U4SA 3WAEA 2F8DA 3KFMA 1MQHA 3T9VA 2OLBA 1LCFA 4F1YA 1US5A 4KCDA 3RGYA 2DOJA 3OEMA 1MPCA 4R9GA 1URGA 4X48A 4IO4A 3PPRA 4U2RA 2FYIA 2OWTA 3PMVA 2XHDA 4DCXA 1ZMGA 2UYEA 3M3FA 3W9VA 4X1BA 4L17A 3MP8A 5AA3A 1D9VA 4KPTA 4NF8A 1OVTA 3O97A 3AXFA 3KN7A 4H67A 3CG1A 5ITPA 1NMUA 4EUOA 1O7TA 4K3FA 1SVXB 3HHFA 3TTRA 3N5LA 4NF5A 3TODA 1LAFE 4OMBA 1MDP1 4ZEKA 1XT8A 4ZEDA 3RLFE 2DWAA 5BUUA 4ECFA 2WKYA 1B3FA 3K1PA 4YICA 4ZEIA 3U72A 4FAJA 5H8FA 2HCAA 1UIVA 1LBBA 1PB9A 3G3HA 2F36A 1B7UA 3UK4A 1B5HA 3K6WA 3O6IA 4ELOA 1S7YA 4NF8B 1Y1ZA 4U1ZA 4F2QA 3RT6B 4IGTA 2PMSA 5DVIA 3VE1B 2DWIA 4U23A 5H8QB 3TUSA 2BJJX 3LUYA 2UVIA 1R6ZA 4QFLA 1LB9A 2XX8A 1JW1A 4NF5B 3FV2A 4KYSA 2ZYKA 4I1DA 4F19A 5EHSA 2XXTA 3ONMA 4GXAA 1D4NA 3MUQA 3MVWA 1LAGE 4E0XA 4KYDA 5H8FB 2Y7PA 4GF8A 5DYHA 2XXQA 5EYFA 1A54A 1B3HA 1MH4A 1TFDA 1F9BA 4H8JA 2QJEA 3SEXA 3K6UA 1IXCA 1MG1A 3SKPA 5I57A 2OBGA 4KHZE 1LFGA 4GOTA 5IAIA 4YKJA 1QKAA 1QW0A 5KDTA 3VXCA 2GH9A 5K2YA 2DVZA 3RPWA 3ECRA 2D5WA 4ISUA 3QXMA 4RYAA 2X7PA 2AL5A 5AE4A 4F29A 2XXIA 1IIWA 3FJGA 3IOTA 1SD3A 4JBZA 3PPPA 4R6HA 4BDOA 3RTWB 3O66A 1MY3A 3LBSA 2LAOA 3FVKA 4EQ7A 3RY3A 1MS7A 1QULA 4YAHX 1SW4A 2QMXA 2V3TA 3FV1A 2DVCA 1RKMA 1PB7A 1MXUA 1P1NA 4IGRA 5I57B 1IITA 1N84A 2ZYMA 1SI0A 3SESA 1Y4TA 4YKPA 3MVXA 1USYE 5DVFA 2XXWA 5KDTB 1POTA 3PPQA 3OO6A 3TCGA 2OZZA 4F22A 4FE8A 4PETA 4QF9A 2R6GE 5CBRA 3OXNA 2Z23A 1TXFA 3JZJA 1N76A 2NUVA 1ZIUA 1HSLA 1N7XA 2ABHA 3QUFA 3I6VA 1AIVA 2RKMA 4WXJA 4ZDMA 2PX1A 2OCUA 3TMGA 1I6BA 3KSXA 1YTVA 3QSLA 3O9PA 2O84X 3Q26A 4R73A 3C35A 4IY5A 5I84A 5ICQA 4F39A 3C32A 1ATGA 4F31B 1OVBA 3OSRA 3CG3A 2IEEA 4KCCA 5JTYA 4EF1A 4GXSB 3ZSFA 1B9JA 2Z22A 4OENA 3U93A 4LQ5A 4DLDA 4POXA 3IB2A 2DWHA 4E0WA 1AOVA 4OETA 4NTLA 1UTBA 1Q1KA 3MZ9A 3OO9A 4ZECA 4PP0A 1JEVA 4H5GA 4OERA 3C4MA 3OENA 1MXYA 5IKBA 1DTGA 2ZNUA 3C31A 2ONSA 4ESXA 2F6PA 5TU0A 3KG2A 4DXUA 3C36A 3FIRA 4GRKA 3PUWE 4PFWA 3IJOB 2I58A 2XD2A 2DP8A 4ZE8A 1H45A 3KSJA 4OHNA 3Q27A 5JTYB 3OELA 4TQUQ 2Z8EA 2REGA 4LATA 1I69A 1EZOA 4FIMA 1RYOA 4JWXA 4XKQA 1ZU0A 3T96B 4G68C 1UTBB 3TQWA 1PB8A 4YB6A 5CMMA 1MPDA 3VVFA 4R6KA 2H4IA 1EZPA 2UVHA 2H98A 3U94A 1MY0A 4OZ9A 3H06B 2I48A 1S9TA 3ILUB 1B3LA 4P11A 3B6WA 1OQHA 4GL0A 1D9YA 1FTMA 4RNSA 3SERA 4R75A 3QUJA 1JETA 2R9JA 3SETA 4FJPA 5I2NB 1GVCA 2RINA 1B7HA 3OSQA 4GVOA 3C34A 3IORA 2RC8A 4JWOA 5FTIA 1OMPA 3E13X 4KQPA 5AA4A 3T9UA 4IO5A 2I4CA 4F3PA 2CMOA 2ALUA 1VFEA 3G3IA 2M8CA 3VXBA 3MC2A 4HCWA 5EHMA 1NL5A 1H3DA 3H6TA 2QRYA 1Y3PA 3HO7A 3CFLA 5F7VA 5FHMA 2PT1A 1II5A 2Z8DA 1IZ1A 1B58A 3V5AA 3Q28A 2AL4A 2KLFA 4MH5A 1GGGA 2B3BA 1EU8A 3FJ7A 4ZEFA 3GBBA 5CC2A 1FTKA 3SEVA 2P0SA 2H9BA 2YJPA 3VV5A 1VE4A 4ZS9A 3MP6A 4FEBA 1Y1MA 1S50A 4RJZA 3H3GA 1FTOA 1N3WA 1US4A 2V84A 5DTBA 3R26A 4ELRA 1ZJLA 5AA4B 1A99A 4KD5A 5DEXA 4JSOA 1B4ZA 4BDNA 4DZ1A 2ZNSA 2F97A 3TELA 3CVGA 3WAFA 4U21A 2NOOA 3IK6B 3MZ1A 1GTKA 1LSTA 2DWJA 3MBPA 2V3QA 4G8NA 4UACA 3V8XB 1CB6A 2I3WA 2VD2A 5CMCA 3S2VA 2O7IA 3Q29A 4IO6A 3S9MC 4GL8A 4OFOA 4THIA 5L8DA 2G29A 1IUDA 1MQGA 2V93A 4P0IA 3TCHA 1M5FA 3S4UA 4LQ2A 1XC1A 1LB8A 3HPIA 2A5TA 2P2AA 3H6VA 2O6AA 1QUIA 4TLMB 5DEXB 4YB7A 3QYTA 3A3UA 3K00A 3KOSA 5LOMA 1B2HA 4N07A 3DP6A 1NNTA 2DE2A 3RNNA 3MZBA 4H65A 1XOCA 1B7ZA 4KFQA 4QSEA 4O3AA 1B51A 1B0LA 4N13A 5FHOA 4QFNA 3LC8A 3PUZE 3V89B 2NXOA 4RA1A 3L6HA 3R6UA 2HEUA 4OEVA 3ZKLA 2FNCA 4BDLA 4KYEA 2O51A 2PVUA 4BDQA 4BDMA 3BKIB 1N7WA 5ITOA 1JW4A 4WEPA 1H76A 4ELPA 3P7IA 5AA2A 2XXPA 1LFHA 4XIGQ 3N26A 3HV1A 2XXVA 1HSJA 2A5TB 2O7UA 4NEDA 2GFEA 1I6AA 2F6GA 1LBCA 3QAXA 3FVOA 3A09A 3FATA 3TTKA 3FD3A 2XXHA 5JK4A 3T66A 4F3SA 2R71A 4U22A 4YMAA 5JEIA 3OMBA 1AMFA 4G8MA 4JXIA 4U4XA 3VFJA 3BFTA 5DT6A 3HCQA 5J1DA 4YB5A 2HQ0A 4DCYA 4R74A 3PPOA 3MQ9A 1R1NA 3DP4A 1A40A 4O3CA 3KOTA 3EPEA 3HSTA 2QMWA 3RQTA 1MXVA 2X7QA 2X26A 2Y7WA 1ZLQA 5AA2B 3RN8A 3LSWA 4NMYA 1AL3A 4LONB 2FA7A 1B05A 4FATA 1JNFA 3UP9A 4WEDA 4ONYA 3S9LC 1N0TA 3QK6A 5KZTA 1UTHA 3GBAA 5H8HA 2P1SA 1BLFA 2H99A 2QSXA 1RYXA 4OEUA 3IX1A 4JDFA 1ZBMA 3HN0A 3SEUA 1B1XA 1B40A 1DMBA 2F34A 2ANJA 1SYHA 4GFRA 1LAXA 4OESA 2HAUA 1B32A 4DXBA 4IY6A 1IXIA 1NFTA 1P1UA 4XKPA 2NWJA 3UORA 1DPEA 3OD7A 3T93B 2Q2AA 4F1VA 3RTFB 5HBCA 1URSA 4YU0A 3B6QA 1M5BA 3CR9A 3U8QA 1JVYA 3IJXB 4PE5B 3PUXE 1XVYA 3K1MA 2QS4A 4JB7A 2NVUB 1Q35A 1UTHB 2F7AA 2ZNTA 1B4HA 2RC7A 2F78A 4DE8A 1Y3NA 1YCJA 3M3KA 3MVYA 1SW1A 3G3GA 2RF1A 3D4CA 1B52A 3LSLA 4ELQA 3KEIA 5HPQA 1LGBC 1JVXA 2HXWA 1MDQA 3FXUA 1IXHA 3B6TA 5CBSA 5DVJA 4LZ7A 4WKMA 3IR1A 5AA1A 1YPNA 3UA8A 2DS9A 2DXYA 3F11A 3CSGA 1JEUA 3FJMA 4EQ9A 5H8SA 4PQJA 1M5EA 3KGCA 2QL3A 1P99A 3OO7A 2O1LA 3PGFA 3H6WA 2O68A 3A3CA 1N3XA 3MVZA 4OTEA 1Y9UA 2H25A 3DLNA 1JQFA 1MRPA 3PV0E 5F1QA 2GHBA 3G3JA 3K01A 1XVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FW0 A;  2V25 A;  2Q2C A;  1B1H A;  1R9L A;  1Z7N E;  4R6Y A;  1M5C A;  2I0C A;  3ZKK A;  1MY1 A;  4NWC A;  5CMB A;  4BLA A;  5L9O A;  4LP2 B;  4KI0 E;  4FOR A;  3FGS A;  5B70 A;  3C9H A;  1OLA A;  4RPO A;  4F3G A;  3GXA A;  5K2X A;  5B7D A;  2AYS A;  3CFX A;  4EF2 A;  5HM4 B;  5A5X A;  2VOZ A;  1P1O A;  4G68 A;  2Q9T A;  2DYX A;  5CI5 A;  5I58 A;  1SYI A;  3DP8 A;  1FQF A;  3CSB A;  1QKB A;  2ZXT A;  3USD A;  1MPB A;  3O2A A;  4AQ4 A;  1TT1 A;  5KCJ A;  4EQB A;  4OXV A;  4RK2 A;  3L6G A;  4O3B A;  3B7D A;  4OFL A;  2REJ A;  1A8E A;  3U1O A;  3PD9 A;  2ESN A;  5TPA A;  4GD5 A;  4PFY A;  3H03 A;  1FCK A;  1QUJ A;  1FQD A;  4RPN A;  2VD3 A;  1A8F A;  4AB6 A;  3E3K A;  4H1X A;  1FQB A;  3IL1 B;  5A5X B;  2UVJ A;  4G68 B;  4QFK A;  1BTJ A;  3G7W A;  2Z8F A;  1UIU A;  4P0G A;  2OK2 A;  2VP1 A;  5I58 B;  3ODB A;  2DXR A;  5I59 A;  1SDX A;  3QIM A;  4ZE9 A;  2XXX A;  3R7X A;  3VDF A;  2HZL A;  1D3K A;  1XHY A;  1PBP A;  4IO3 A;  3SEY A;  1DOT A;  2PT2 A;  4IB2 A;  1EH3 A;  1A7L A;  1DSN A;  1NNK A;  3IOV A;  2Y7R A;  3PUV E;  3FUZ A;  3GLB A;  2CZL A;  3FXQ A;  4NF6 A;  4ND9 A;  1MM6 A;  1OIB A;  3PMW A;  1POY 1;  1B3G A;  2THI A;  5I56 A;  2PYY A;  2XD3 A;  1URD A;  1FQC A;  1FQE A;  4LVQ A;  5I59 B;  1SQY A;  4M4G A;  1MM7 A;  2HFB A;  3M8U A;  1GV8 A;  4G2Z A;  4ZZA A;  4RY1 A;  2F35 A;  4Z0I A;  1MQJ A;  2Y84 A;  1XS5 A;  2XXR A;  4OYV A;  4BDR A;  4F1U A;  3H6U A;  4QSC A;  2Q89 A;  2Q88 A;  2F7B A;  3K2D A;  4GIZ A;  1QVS A;  3D4G A;  4X1D A;  4C0R A;  4QSD A;  5L9M A;  4I62 A;  2UYF A;  5H8Q A;  1MY4 A;  2VHA A;  1Y4C A;  4YMB A;  4MFI A;  4NF6 B;  1IXG A;  5I56 B;  5FTH A;  3EN3 A;  1MQI A;  1J1N A;  1M5D A;  4QRZ A;  2Q8J A;  4H5F A;  1VSO A;  1EZ9 A;  2O69 A;  4ZEB A;  3LSX A;  1BKA A;  2GHA A;  4YZZ A;  2E1S A;  3GZG A;  2QS3 A;  3JV9 A;  3S9N C;  4IO2 A;  3TPA A;  1BP5 A;  3KN3 A;  3H4Z A;  4Q0C A;  3VLU A;  1DPP A;  4I9D A;  3EHT A;  3Q25 A;  5CMK A;  1B0H A;  4FED A;  4G4P A;  1H43 A;  4TOZ A;  1FQA A;  3PD8 A;  3FVG A;  2HZK A;  2RC9 A;  1VFD A;  1P1W A;  2A5S A;  5AA2 D;  3MPL A;  4LZ5 A;  3IOW A;  1N04 A;  3K1N A;  3PUY E;  3O6H A;  4UA8 A;  3RT8 A;  4R72 A;  2XXY A;  3EHU A;  2ONK E;  4JSD A;  3W15 C;  2ZYN A;  4XTC Q;  1L5T A;  1FTL A;  4H0W A;  1IQ7 A;  4KR5 A;  4AB5 A;  4OQO A;  3M3L A;  2UXA A;  1GR2 A;  3T9X B;  4QFP A;  4LA9 A;  3U92 A;  1B3E A;  3VVD A;  1USY H;  1WVJ A;  3OOA A;  4FEC A;  4OFJ A;  3S9E A;  1PBQ A;  2G93 A;  1ZTY A;  3SEW A;  1TWY A;  1WOD A;  4PFU A;  3THI A;  2ZYO A;  1MXZ A;  1MY2 A;  2RCB A;  3DEL B;  3TYH A;  3K4U A;  3UGW A;  4M1V A;  3IO4 A;  3E4R A;  3O29 A;  4MLQ A;  3BBR A;  1T0K A;  2H5Y A;  5TP9 A;  1LLS A;  3LR1 A;  4N6P A;  1KWH A;  3TTL A;  4MBP A;  3EF7 A;  3IAZ A;  2DSF A;  3TQL A;  1CE2 A;  4RXL A;  3CRB A;  4F2O A;  5ISU A;  3CFZ A;  3MJN A;  5M2V A;  4TLL B;  2OJT A;  1NNF A;  4JWY A;  1PDA A;  4R2B A;  4GQO A;  1NNP A;  4Q8R A;  5CRY A;  4DDD A;  3O6G A;  2I6E A;  4IO7 A;  3ILT B;  4ESW A;  4Q5T A;  3FXR A;  3I5O A;  3TTN A;  1LCT A;  5L9S A;  5H8H B;  3EQ1 A;  4QHQ A;  4C1T A;  1A55 A;  2O1M A;  2I49 A;  3K6X A;  5TP9 B;  1PC3 A;  1OLC A;  4Z7E A;  4DXC A;  1Y20 A;  1ZKB A;  1AH5 A;  3KJ7 A;  3KJT A;  4XKN A;  1ANF A;  4HCY A;  3JYR A;  1DTZ A;  3PMX A;  2OWS A;  1SW5 A;  4NE4 A;  3G3F A;  4I8C A;  2F7C A;  1P1Q A;  1BIY A;  2I4B A;  3VLW A;  3CI8 A;  2DE3 A;  1B6H A;  1OQG A;  1MXW A;  2DQV A;  4XKR A;  4G8H A;  4HTG A;  3EHS A;  4EXK A;  3IB1 A;  1NH7 A;  3TDJ A;  1B5I A;  1WDN A;  2AIX A;  4OWD A;  3MAM A;  3TFL A;  2I3V A;  3TEP A;  2UVG A;  3KZG A;  1O64 A;  1MXX A;  2E0S A;  3N6U A;  2IA4 A;  1B5J A;  3E9X A;  2YLN A;  4MF3 A;  4EXL A;  1Z7M E;  2GRV A;  4Q30 B;  3FVN A;  1MH3 A;  1NKX A;  4F18 A;  2W7Y A;  4LUB A;  4XXU A;  4MLV A;  3G3K A;  2F5X A;  1QUK A;  3TTM A;  4U1O A;  3T9H B;  4PFT A;  2Y7I A;  4G77 A;  4YKK A;  5FHN A;  1IEJ A;  3VVE A;  1PEB A;  3W9W A;  5I2K A;  1QJM A;  4C1U A;  4R2F A;  2RCA A;  1SI1 A;  5I2N A;  3TZA A;  2QS2 A;  4RK9 A;  1SW2 A;  4F3B A;  1TFA A;  1SBP A;  3N94 A;  3TCF A;  1UQW A;  2XX9 A;  4NWD A;  1JW5 A;  3MP1 A;  4GWO A;  3RUM A;  3IOU A;  4R9F A;  4QFO A;  5H8N A;  5ICT A;  2ONR A;  3TAJ A;  2HAV A;  2ZMB A;  3IB0 A;  3KN8 A;  3OO8 A;  1O63 A;  4H6D A;  5BWJ A;  1Y3Q A;  3KBR A;  4NF4 A;  5ELV A;  3ZS6 A;  4X9T A;  1H44 A;  1MQD A;  3V83 A;  2XX7 A;  3FZV A;  1YAE A;  2PBW A;  2QPQ A;  4OVJ A;  4LZ8 A;  3T22 A;  3MW0 A;  1LAH E;  4HS7 A;  3LSF B;  4DIG A;  3K0V A;  3SDF A;  3N6T A;  5I2K B;  3TKD A;  3K6V A;  1FTJ A;  1VR5 A;  2B65 A;  4POW A;  1ELJ A;  1I6Q A;  1R9Q A;  3CIJ A;  2DE4 A;  2YPN A;  3MWB A;  4H8I A;  2B3F A;  5CM6 A;  2V3U A;  3C33 A;  2VGQ A;  3DM0 A;  3UIF A;  1HSE A;  5H8N B;  3H7M A;  3VLV A;  2D3I A;  1NH8 A;  2I0B A;  5KCJ B;  3HHG A;  3MPK A;  3O28 A;  2XXU A;  4HW8 A;  4ZZE A;  4NF4 B;  3FAS A;  3PU5 A;  3OEK A;  2D21 A;  4GLI A;  3BFU A;  3I3V A;  3PPN A;  4EDP A;  1LFI A;  2Y7K A;  3K02 A;  4YKI A;  3UN6 A;  1B46 A;  5TPA B;  3IO6 A;  2QS1 A;  4U4S A;  3WAE A;  2F8D A;  3KFM A;  1MQH A;  3T9V A;  2OLB A;  1LCF A;  4F1Y A;  1US5 A;  4KCD A;  3RGY A;  2DOJ A;  3OEM A;  1MPC A;  4R9G A;  1URG A;  4X48 A;  4IO4 A;  3PPR A;  4U2R A;  2FYI A;  2OWT A;  3PMV A;  2XHD A;  4DCX A;  1ZMG A;  2UYE A;  3M3F A;  3W9V A;  4X1B A;  4L17 A;  3MP8 A;  5AA3 A;  1D9V A;  4KPT A;  4NF8 A;  1OVT A;  3O97 A;  3AXF A;  3KN7 A;  4H67 A;  3CG1 A;  5ITP A;  1NMU A;  4EUO A;  1O7T A;  4K3F A;  1SVX B;  3HHF A;  3TTR A;  3N5L A;  4NF5 A;  3TOD A;  1LAF E;  4OMB A;  1MDP 1;  4ZEK A;  1XT8 A;  4ZED A;  3RLF E;  2DWA A;  5BUU A;  4ECF A;  2WKY A;  1B3F A;  3K1P A;  4YIC A;  4ZEI A;  3U72 A;  4FAJ A;  5H8F A;  2HCA A;  1UIV A;  1LBB A;  1PB9 A;  3G3H A;  2F36 A;  1B7U A;  3UK4 A;  1B5H A;  3K6W A;  3O6I A;  4ELO A;  1S7Y A;  4NF8 B;  1Y1Z A;  4U1Z A;  4F2Q A;  3RT6 B;  4IGT A;  2PMS A;  5DVI A;  3VE1 B;  2DWI A;  4U23 A;  5H8Q B;  3TUS A;  2BJJ X;  3LUY A;  2UVI A;  1R6Z A;  4QFL A;  1LB9 A;  2XX8 A;  1JW1 A;  4NF5 B;  3FV2 A;  4KYS A;  2ZYK A;  4I1D A;  4F19 A;  5EHS A;  2XXT A;  3ONM A;  4GXA A;  1D4N A;  3MUQ A;  3MVW A;  1LAG E;  4E0X A;  4KYD A;  5H8F B;  2Y7P A;  4GF8 A;  5DYH A;  2XXQ A;  5EYF A;  1A54 A;  1B3H A;  1MH4 A;  1TFD A;  1F9B A;  4H8J A;  2QJE A;  3SEX A;  3K6U A;  1IXC A;  1MG1 A;  3SKP A;  5I57 A;  2OBG A;  4KHZ E;  1LFG A;  4GOT A;  5IAI A;  4YKJ A;  1QKA A;  1QW0 A;  5KDT A;  3VXC A;  2GH9 A;  5K2Y A;  2DVZ A;  3RPW A;  3ECR A;  2D5W A;  4ISU A;  3QXM A;  4RYA A;  2X7P A;  2AL5 A;  5AE4 A;  4F29 A;  2XXI A;  1IIW A;  3FJG A;  3IOT A;  1SD3 A;  4JBZ A;  3PPP A;  4R6H A;  4BDO A;  3RTW B;  3O66 A;  1MY3 A;  3LBS A;  2LAO A;  3FVK A;  4EQ7 A;  3RY3 A;  1MS7 A;  1QUL A;  4YAH X;  1SW4 A;  2QMX A;  2V3T A;  3FV1 A;  2DVC A;  1RKM A;  1PB7 A;  1MXU A;  1P1N A;  4IGR A;  5I57 B;  1IIT A;  1N84 A;  2ZYM A;  1SI0 A;  3SES A;  1Y4T A;  4YKP A;  3MVX A;  1USY E;  5DVF A;  2XXW A;  5KDT B;  1POT A;  3PPQ A;  3OO6 A;  3TCG A;  2OZZ A;  4F22 A;  4FE8 A;  4PET A;  4QF9 A;  2R6G E;  5CBR A;  3OXN A;  2Z23 A;  1TXF A;  3JZJ A;  1N76 A;  2NUV A;  1ZIU A;  1HSL A;  1N7X A;  2ABH A;  3QUF A;  3I6V A;  1AIV A;  2RKM A;  4WXJ A;  4ZDM A;  2PX1 A;  2OCU A;  3TMG A;  1I6B A;  3KSX A;  1YTV A;  3QSL A;  3O9P A;  2O84 X;  3Q26 A;  4R73 A;  3C35 A;  4IY5 A;  5I84 A;  5ICQ A;  4F39 A;  3C32 A;  1ATG A;  4F31 B;  1OVB A;  3OSR A;  3CG3 A;  2IEE A;  4KCC A;  5JTY A;  4EF1 A;  4GXS B;  3ZSF A;  1B9J A;  2Z22 A;  4OEN A;  3U93 A;  4LQ5 A;  4DLD A;  4POX A;  3IB2 A;  2DWH A;  4E0W A;  1AOV A;  4OET A;  4NTL A;  1UTB A;  1Q1K A;  3MZ9 A;  3OO9 A;  4ZEC A;  4PP0 A;  1JEV A;  4H5G A;  4OER A;  3C4M A;  3OEN A;  1MXY A;  5IKB A;  1DTG A;  2ZNU A;  3C31 A;  2ONS A;  4ESX A;  2F6P A;  5TU0 A;  3KG2 A;  4DXU A;  3C36 A;  3FIR A;  4GRK A;  3PUW E;  4PFW A;  3IJO B;  2I58 A;  2XD2 A;  2DP8 A;  4ZE8 A;  1H45 A;  3KSJ A;  4OHN A;  3Q27 A;  5JTY B;  3OEL A;  4TQU Q;  2Z8E A;  2REG A;  4LAT A;  1I69 A;  1EZO A;  4FIM A;  1RYO A;  4JWX A;  4XKQ A;  1ZU0 A;  3T96 B;  4G68 C;  1UTB B;  3TQW A;  1PB8 A;  4YB6 A;  5CMM A;  1MPD A;  3VVF A;  4R6K A;  2H4I A;  1EZP A;  2UVH A;  2H98 A;  3U94 A;  1MY0 A;  4OZ9 A;  3H06 B;  2I48 A;  1S9T A;  3ILU B;  1B3L A;  4P11 A;  3B6W A;  1OQH A;  4GL0 A;  1D9Y A;  1FTM A;  4RNS A;  3SER A;  4R75 A;  3QUJ A;  1JET A;  2R9J A;  3SET A;  4FJP A;  5I2N B;  1GVC A;  2RIN A;  1B7H A;  3OSQ A;  4GVO A;  3C34 A;  3IOR A;  2RC8 A;  4JWO A;  5FTI A;  1OMP A;  3E13 X;  4KQP A;  5AA4 A;  3T9U A;  4IO5 A;  2I4C A;  4F3P A;  2CMO A;  2ALU A;  1VFE A;  3G3I A;  2M8C A;  3VXB A;  3MC2 A;  4HCW A;  5EHM A;  1NL5 A;  1H3D A;  3H6T A;  2QRY A;  1Y3P A;  3HO7 A;  3CFL A;  5F7V A;  5FHM A;  2PT1 A;  1II5 A;  2Z8D A;  1IZ1 A;  1B58 A;  3V5A A;  3Q28 A;  2AL4 A;  2KLF A;  4MH5 A;  1GGG A;  2B3B A;  1EU8 A;  3FJ7 A;  4ZEF A;  3GBB A;  5CC2 A;  1FTK A;  3SEV A;  2P0S A;  2H9B A;  2YJP A;  3VV5 A;  1VE4 A;  4ZS9 A;  3MP6 A;  4FEB A;  1Y1M A;  1S50 A;  4RJZ A;  3H3G A;  1FTO A;  1N3W A;  1US4 A;  2V84 A;  5DTB A;  3R26 A;  4ELR A;  1ZJL A;  5AA4 B;  1A99 A;  4KD5 A;  5DEX A;  4JSO A;  1B4Z A;  4BDN A;  4DZ1 A;  2ZNS A;  2F97 A;  3TEL A;  3CVG A;  3WAF A;  4U21 A;  2NOO A;  3IK6 B;  3MZ1 A;  1GTK A;  1LST A;  2DWJ A;  3MBP A;  2V3Q A;  4G8N A;  4UAC A;  3V8X B;  1CB6 A;  2I3W A;  2VD2 A;  5CMC A;  3S2V A;  2O7I A;  3Q29 A;  4IO6 A;  3S9M C;  4GL8 A;  4OFO A;  4THI A;  5L8D A;  2G29 A;  1IUD A;  1MQG A;  2V93 A;  4P0I A;  3TCH A;  1M5F A;  3S4U A;  4LQ2 A;  1XC1 A;  1LB8 A;  3HPI A;  2A5T A;  2P2A A;  3H6V A;  2O6A A;  1QUI A;  4TLM B;  5DEX B;  4YB7 A;  3QYT A;  3A3U A;  3K00 A;  3KOS A;  5LOM A;  1B2H A;  4N07 A;  3DP6 A;  1NNT A;  2DE2 A;  3RNN A;  3MZB A;  4H65 A;  1XOC A;  1B7Z A;  4KFQ A;  4QSE A;  4O3A A;  1B51 A;  1B0L A;  4N13 A;  5FHO A;  4QFN A;  3LC8 A;  3PUZ E;  3V89 B;  2NXO A;  4RA1 A;  3L6H A;  3R6U A;  2HEU A;  4OEV A;  3ZKL A;  2FNC A;  4BDL A;  4KYE A;  2O51 A;  2PVU A;  4BDQ A;  4BDM A;  3BKI B;  1N7W A;  5ITO A;  1JW4 A;  4WEP A;  1H76 A;  4ELP A;  3P7I A;  5AA2 A;  2XXP A;  1LFH A;  4XIG Q;  3N26 A;  3HV1 A;  2XXV A;  1HSJ A;  2A5T B;  2O7U A;  4NED A;  2GFE A;  1I6A A;  2F6G A;  1LBC A;  3QAX A;  3FVO A;  3A09 A;  3FAT A;  3TTK A;  3FD3 A;  2XXH A;  5JK4 A;  3T66 A;  4F3S A;  2R71 A;  4U22 A;  4YMA A;  5JEI A;  3OMB A;  1AMF A;  4G8M A;  4JXI A;  4U4X A;  3VFJ A;  3BFT A;  5DT6 A;  3HCQ A;  5J1D A;  4YB5 A;  2HQ0 A;  4DCY A;  4R74 A;  3PPO A;  3MQ9 A;  1R1N A;  3DP4 A;  1A40 A;  4O3C A;  3KOT A;  3EPE A;  3HST A;  2QMW A;  3RQT A;  1MXV A;  2X7Q A;  2X26 A;  2Y7W A;  1ZLQ A;  5AA2 B;  3RN8 A;  3LSW A;  4NMY A;  1AL3 A;  4LON B;  2FA7 A;  1B05 A;  4FAT A;  1JNF A;  3UP9 A;  4WED A;  4ONY A;  3S9L C;  1N0T A;  3QK6 A;  5KZT A;  1UTH A;  3GBA A;  5H8H A;  2P1S A;  1BLF A;  2H99 A;  2QSX A;  1RYX A;  4OEU A;  3IX1 A;  4JDF A;  1ZBM A;  3HN0 A;  3SEU A;  1B1X A;  1B40 A;  1DMB A;  2F34 A;  2ANJ A;  1SYH A;  4GFR A;  1LAX A;  4OES A;  2HAU A;  1B32 A;  4DXB A;  4IY6 A;  1IXI A;  1NFT A;  1P1U A;  4XKP A;  2NWJ A;  3UOR A;  1DPE A;  3OD7 A;  3T93 B;  2Q2A A;  4F1V A;  3RTF B;  5HBC A;  1URS A;  4YU0 A;  3B6Q A;  1M5B A;  3CR9 A;  3U8Q A;  1JVY A;  3IJX B;  4PE5 B;  3PUX E;  1XVY A;  3K1M A;  2QS4 A;  4JB7 A;  2NVU B;  1Q35 A;  1UTH B;  2F7A A;  2ZNT A;  1B4H A;  2RC7 A;  2F78 A;  4DE8 A;  1Y3N A;  1YCJ A;  3M3K A;  3MVY A;  1SW1 A;  3G3G A;  2RF1 A;  3D4C A;  1B52 A;  3LSL A;  4ELQ A;  3KEI A;  5HPQ A;  1LGB C;  1JVX A;  2HXW A;  1MDQ A;  3FXU A;  1IXH A;  3B6T A;  5CBS A;  5DVJ A;  4LZ7 A;  4WKM A;  3IR1 A;  5AA1 A;  1YPN A;  3UA8 A;  2DS9 A;  2DXY A;  3F11 A;  3CSG A;  1JEU A;  3FJM A;  4EQ9 A;  5H8S A;  4PQJ A;  1M5E A;  3KGC A;  2QL3 A;  1P99 A;  3OO7 A;  2O1L A;  3PGF A;  3H6W A;  2O68 A;  3A3C A;  1N3X A;  3MVZ A;  4OTE A;  1Y9U A;  2H25 A;  3DLN A;  1JQF A;  1MRP A;  3PV0 E;  5F1Q A;  2GHB A;  3G3J A;  3K01 A;  1XVX A; 
#chains in the Genus database with same CATH topology
 1FW0 A;  2V25 A;  2Q2C A;  1NV5 A;  1B1H A;  1R9L A;  1SPI A;  1Z7N E;  4NGU A;  4R6Y A;  1M5C A;  2I0C A;  1NV7 A;  3ZKK A;  1MY1 A;  4NWC A;  5CMB A;  4BLA A;  5L9O A;  3A29 A;  4LP2 B;  4KI0 E;  4FOR A;  3FGS A;  2R8T A;  5B70 A;  3C9H A;  1OLA A;  4RPO A;  4F3G A;  3GXA A;  5K2X A;  5B7D A;  2AYS A;  3CFX A;  4EF2 A;  1LBY A;  2Y5K A;  5HM4 B;  5A5X A;  2VOZ A;  1P1O A;  4G68 A;  2KQZ A;  4PGP A;  2XXK A;  2Q9T A;  2DYX A;  4NX1 A;  5CI5 A;  1NUZ A;  5I58 A;  1SYI A;  3DP8 A;  1FQF A;  3CSB A;  1QKB A;  2ZXT A;  1FBE A;  3USD A;  1MPB A;  3O2A A;  4AQ4 A;  1TT1 A;  5KCJ A;  4EQB A;  2L5V A;  4OXV A;  4RK2 A;  5ET8 A;  3L6G A;  2PFZ A;  4O3B A;  3B7D A;  4OFL A;  4PDH A;  2REJ A;  1A8E A;  4O7M A;  3U1O A;  3PD9 A;  2ESN A;  5TPA A;  4GD5 A;  4PFY A;  3H03 A;  1FCK A;  4H45 A;  1FPJ A;  1QUJ A;  1FQD A;  4RPN A;  2VD3 A;  2DDK A;  1A8F A;  4AB6 A;  3E3K A;  4H1X A;  1FQB A;  3IL1 B;  5A5X B;  2UVJ A;  4G68 B;  4QFK A;  1BTJ A;  3G7W A;  2Z8F A;  1LEV A;  1UIU A;  4P0G A;  2OK2 A;  2VP1 A;  4NHB A;  5I58 B;  3ODB A;  1FTA A;  3IFC A;  2DXR A;  5I59 A;  1SDX A;  4NG7 A;  3QIM A;  4ZE9 A;  2XXX A;  4MEV A;  3R7X A;  3VDF A;  2HZL A;  1D3K A;  1XHY A;  1FBG A;  1PBP A;  4IO3 A;  2QVR A;  3SEY A;  1DOT A;  2PT2 A;  4IB2 A;  1EH3 A;  2HXR A;  1XI6 A;  2CEX A;  1A7L A;  1DSN A;  1NNK A;  3U65 A;  3IOV A;  2Y7R A;  3PUV E;  3FUZ A;  3GLB A;  3E79 A;  2CZL A;  3FXQ A;  4NF6 A;  4ND9 A;  1MM6 A;  1FSA A;  1OIB A;  3PMW A;  1POY 1;  1B3G A;  2THI A;  5I56 A;  2PYY A;  1FRP A;  2XD3 A;  1URD A;  1FQC A;  1FQE A;  4LVQ A;  5I59 B;  1SQY A;  4GWX A;  4M4G A;  1MM7 A;  2HFB A;  3M8U A;  1GV8 A;  4G2Z A;  4ZZA A;  4RY1 A;  2F35 A;  4Z0I A;  1MQJ A;  2Y84 A;  1XS5 A;  2XXR A;  3B8B A;  4OYV A;  4BDR A;  4F1U A;  3H6U A;  4QSC A;  4JVC A;  2Q89 A;  2Q88 A;  2F7B A;  3K2D A;  4GIZ A;  1QVS A;  3D4G A;  4X1D A;  4GBV A;  4C0R A;  4QSD A;  5L9M A;  4I62 A;  2UYF A;  5H8Q A;  1MY4 A;  2VHA A;  1Y4C A;  4YMB A;  4MFI A;  4NF6 B;  1IXG A;  2P3V A;  5I56 B;  5FTH A;  3EN3 A;  1MQI A;  1J1N A;  1M5D A;  1LBX A;  4QRZ A;  2Q8J A;  4N6D A;  4H5F A;  1VSO A;  1EZ9 A;  2O69 A;  2WYK A;  4ZEB A;  3LSX A;  1BKA A;  2GHA A;  4YZZ A;  2E1S A;  1NV4 A;  2FIX A;  3GZG A;  2QS3 A;  3JV9 A;  3S9N C;  4IO2 A;  3TPA A;  1BP5 A;  3KN3 A;  3H4Z A;  4Q0C A;  3VLU A;  1DPP A;  4I9D A;  2OX3 A;  1NV3 A;  3EHT A;  3Q25 A;  5CMK A;  1B0H A;  4FED A;  4N8G A;  4G4P A;  1FPB A;  1H43 A;  4TOZ A;  1FQA A;  3PD8 A;  4QXD A;  3FVG A;  2HZK A;  2RC9 A;  1BK4 A;  1VFD A;  1P1W A;  2A5S A;  5AA2 D;  3MPL A;  4LZ5 A;  3IOW A;  1N04 A;  3K1N A;  4GBW A;  3PUY E;  2CZI A;  3O6H A;  2XWV A;  4UA8 A;  3RT8 A;  4R72 A;  2XXY A;  3EHU A;  2ONK E;  4JSD A;  3W15 C;  2ZYN A;  4XTC Q;  1L5T A;  1FTL A;  5IGA A;  4H0W A;  1IQ7 A;  4KR5 A;  4AB5 A;  4OQO A;  4PTK A;  3M3L A;  2UXA A;  1GR2 A;  3T9X B;  4QFP A;  4LA9 A;  3U92 A;  1B3E A;  3VVD A;  1USY H;  1DBZ A;  1WVJ A;  4JVD A;  3OOA A;  4FEC A;  4OFJ A;  3S9E A;  1PBQ A;  2G93 A;  1ZTY A;  3SEW A;  1TWY A;  1WOD A;  4PFU A;  3THI A;  2ZYO A;  1MXZ A;  1MY2 A;  2RCB A;  4MNI A;  3DEL B;  3TYH A;  3K4U A;  3UGW A;  4P1L A;  4M1V A;  2F3D A;  3IO4 A;  3E78 A;  3E4R A;  3O29 A;  4MLQ A;  3BBR A;  1T0K A;  2H5Y A;  5TP9 A;  4PBH A;  1LLS A;  4H46 A;  3LR1 A;  4N6P A;  1KWH A;  3TTL A;  4MBP A;  3EF7 A;  4OVT A;  3IAZ A;  2DSF A;  3TQL A;  1FBF A;  1CE2 A;  4RXL A;  3CRB A;  4GWS A;  4F2O A;  1FBH A;  4N15 A;  5ISU A;  3CFZ A;  3MJN A;  5FBP A;  5M2V A;  4TLL B;  2OJT A;  1NNF A;  4JWY A;  1PDA A;  4R2B A;  4MJO A;  4GQO A;  1NNP A;  4Q8R A;  4OAN A;  5CRY A;  4DDD A;  3O6G A;  2I6E A;  4IO7 A;  4N91 A;  3ILT B;  3CHG A;  3KBZ A;  4ESW A;  2QVV A;  4Q5T A;  3FXR A;  3I5O A;  4X8R A;  3TTN A;  4MNP A;  5EQ7 A;  1LCT A;  5L9S A;  5H8H B;  3EQ1 A;  4QHQ A;  4C1T A;  1A55 A;  2O1M A;  2I49 A;  3K6X A;  5TP9 B;  1PC3 A;  5I3S A;  4N81 A;  1OLC A;  4Z7E A;  4OVP A;  5LDZ A;  4DXC A;  1Y20 A;  1ZKB A;  1AH5 A;  3KJ7 A;  3RPL A;  3KJT A;  4XKN A;  1ANF A;  2XWI A;  4GWZ A;  4HCY A;  3JYR A;  1DTZ A;  1EYI A;  3PMX A;  2OWS A;  1SW5 A;  4NE4 A;  3LV0 A;  1FBC A;  3G3F A;  4I8C A;  2F7C A;  1P1Q A;  1BIY A;  2I4B A;  3VLW A;  3CI8 A;  2DE3 A;  5IZ1 A;  1B6H A;  1OQG A;  1MXW A;  2DQV A;  4XKR A;  1FPK A;  2CZK A;  4G8H A;  1FBP A;  4HTG A;  4FBP A;  3EHS A;  4EXK A;  3IB1 A;  1NH7 A;  3TDJ A;  4P56 A;  1LBW A;  1B5I A;  1WDN A;  2AIX A;  1YZ0 A;  4OWD A;  5EQ9 A;  2CZH A;  3MAM A;  3TFL A;  2I3V A;  3TEP A;  2UVG A;  3KZG A;  1O64 A;  1MXX A;  2E0S A;  3N6U A;  2IA4 A;  1B5J A;  3E9X A;  2YLN A;  4MF3 A;  4EXL A;  5EYH A;  1Z7M E;  2GRV A;  4Q30 B;  3FVN A;  3RPL B;  1MH3 A;  1NKX A;  4F18 A;  4PAF A;  3IFA A;  2W7Y A;  4LUB A;  4XXU A;  4MLV A;  3G3K A;  2F5X A;  1FPI A;  4N6K A;  1QUK A;  3TTM A;  3B50 A;  4U1O A;  3T9H B;  4PFT A;  4PDD A;  2Y7I A;  4G77 A;  4YKK A;  5FHN A;  1IEJ A;  3VVE A;  1PEB A;  3W9W A;  4KXP A;  5I2K A;  2Q74 A;  1QJM A;  4C1U A;  4OA4 A;  4R2F A;  2RCA A;  4LN5 A;  4N17 A;  1SI1 A;  1DCU A;  5I2N A;  3TZA A;  4PFR A;  2QS2 A;  4RK9 A;  1SW2 A;  4F3B A;  4O7I A;  1TFA A;  1SBP A;  1INP A;  3N94 A;  3TCF A;  1UQW A;  2XX9 A;  4NWD A;  1JW5 A;  2VPO A;  3MP1 A;  4PCD A;  4GWO A;  3RUM A;  3IOU A;  4R9F A;  4QFO A;  5H8N A;  1LBZ A;  5ICT A;  2ONR A;  3TAJ A;  2HAV A;  2ZMB A;  3IB0 A;  3QMF A;  3KN8 A;  3OO8 A;  1O63 A;  4H6D A;  5BWJ A;  1Y3Q A;  3KBR A;  4NF4 A;  5ELV A;  3ZS6 A;  4X9T A;  1H44 A;  1MQD A;  3V83 A;  2XX7 A;  3FZV A;  1YAE A;  2PBW A;  2QPQ A;  4OVJ A;  4LZ8 A;  3T22 A;  2WYP A;  1NV1 A;  3MW0 A;  3RYD A;  1LAH E;  2JJK A;  4HS7 A;  3LSF B;  4DIG A;  3K0V A;  3SDF A;  3N6T A;  5I2K B;  3TKD A;  3K6V A;  1FTJ A;  1VR5 A;  2B65 A;  4POW A;  1ELJ A;  1I6Q A;  1R9Q A;  4GWU A;  3CIJ A;  1RDX A;  2DE4 A;  2YPN A;  3MWB A;  4H8I A;  2B3F A;  5CM6 A;  2V3U A;  3C33 A;  2VGQ A;  1D9Q A;  3DM0 A;  3UIF A;  1HSE A;  5H8N B;  3H7M A;  5ET7 A;  3VLV A;  2D3I A;  1NH8 A;  1FPG A;  2I0B A;  5KCJ B;  3HHG A;  3MPK A;  3O28 A;  2XXU A;  4HW8 A;  4ZZE A;  4NF4 B;  3FAS A;  3PU5 A;  3OEK A;  2D21 A;  4GLI A;  3BFU A;  3I3V A;  3PPN A;  4EDP A;  1LFI A;  2Y7K A;  1AWB A;  3K02 A;  4YKI A;  3UN6 A;  1B46 A;  5TPA B;  3IO6 A;  2QS1 A;  4U4S A;  3WAE A;  2F8D A;  3KFM A;  3BIG A;  1YYZ A;  1MQH A;  3T9V A;  4MIJ A;  2OLB A;  1LCF A;  4F1Y A;  1US5 A;  4KCD A;  3RGY A;  2DOJ A;  3OEM A;  1MPC A;  4HE1 A;  4R9G A;  1URG A;  4X48 A;  4IO4 A;  3PPR A;  4U2R A;  4HE2 A;  2FYI A;  3SZP A;  2OWT A;  3PMV A;  2Y5L A;  4MCO A;  5EQA A;  2XHD A;  4DCX A;  1ZMG A;  2UYE A;  4NN3 A;  3M3F A;  3W9V A;  4X1B A;  4L17 A;  3MP8 A;  4XEQ A;  5AA3 A;  1D9V A;  4KPT A;  4NF8 A;  1OVT A;  3O97 A;  3AXF A;  3KN7 A;  4H67 A;  3CG1 A;  2XA5 A;  4HXV A;  5ITP A;  1NMU A;  4IR8 A;  4EUO A;  1O7T A;  4K3F A;  1SVX B;  3HHF A;  3TTR A;  3N5L A;  4NF5 A;  3TOD A;  1LAF E;  4OMB A;  1MDP 1;  4ZEK A;  1XT8 A;  4ZED A;  3RLF E;  2DWA A;  5BUU A;  4ECF A;  2WKY A;  1B3F A;  3K1P A;  4YIC A;  4ZEI A;  3U72 A;  4FAJ A;  5H8F A;  2HCA A;  1UIV A;  1LBB A;  1PB9 A;  3G3H A;  2F36 A;  1B7U A;  4PGN A;  3UK4 A;  5ET5 A;  1B5H A;  3K6W A;  3O6I A;  2B4M A;  4ELO A;  1S7Y A;  4NF8 B;  1Y1Z A;  4U1Z A;  4F2Q A;  2WBD A;  3RT6 B;  4IGT A;  2OWZ A;  4I40 A;  2FBP A;  1YXI A;  2PMS A;  5DVI A;  3VE1 B;  2DWI A;  4U23 A;  5H8Q B;  3TUS A;  2BJJ X;  3LUY A;  1K9Y A;  4PF6 A;  2UVI A;  1R6Z A;  4QFL A;  1LB9 A;  2XX8 A;  1JW1 A;  4NF5 B;  3FV2 A;  4KYS A;  2ZYK A;  4I1D A;  4F19 A;  5EHS A;  2XXT A;  3ONM A;  4GXA A;  1D4N A;  3MUQ A;  1FJ6 A;  3MVW A;  1LAG E;  2MKZ A;  4E0X A;  5EQ8 A;  4MX6 A;  4KYD A;  5H8F B;  2Y7P A;  4GF8 A;  5DYH A;  2XXQ A;  1IMC A;  5EYF A;  1A54 A;  1B3H A;  4JVI A;  1MH4 A;  1TFD A;  2FIE A;  1F9B A;  4H8J A;  2PCR A;  2QJE A;  3SEX A;  3K6U A;  1IXC A;  1MG1 A;  3SKP A;  5I57 A;  2OBG A;  4KHZ E;  1DK4 A;  1LFG A;  4GOT A;  5IAI A;  4YKJ A;  1QKA A;  1QW0 A;  5KDT A;  4NAP A;  3VXC A;  2GH9 A;  5K2Y A;  2DVZ A;  3ISP A;  3RPW A;  2QVU A;  3ECR A;  2D5W A;  1NUX A;  4ISU A;  3QXM A;  1CNQ A;  4RYA A;  2X7P A;  2AL5 A;  5AE4 A;  4F29 A;  2XXI A;  1IIW A;  3FJG A;  3IOT A;  1SD3 A;  3FXB A;  5T3J A;  4JBZ A;  3PPP A;  4R6H A;  4BDO A;  3RTW B;  2FHY A;  3O66 A;  1MY3 A;  3LBS A;  2LAO A;  3FVK A;  4EQ7 A;  3RY3 A;  1MS7 A;  1QUL A;  4YAH X;  1SW4 A;  4P47 A;  2QMX A;  4N4U A;  2V3T A;  3FV1 A;  2DVC A;  1RKM A;  3BIH A;  1PB7 A;  1MXU A;  1P1N A;  4IGR A;  5I57 B;  1IIT A;  1N84 A;  2ZYM A;  1SI0 A;  3SES A;  1Y4T A;  4P8B A;  4YKP A;  3MVX A;  1USY E;  5DVF A;  3LUZ A;  2XXW A;  1NV0 A;  5F24 A;  5KDT B;  1POT A;  3PPQ A;  3OO6 A;  4P3L A;  3TCG A;  2FVZ A;  2OZZ A;  4F22 A;  4FE8 A;  4PET A;  1KA0 A;  4GX3 A;  4QF9 A;  2R6G E;  5CBR A;  3OXN A;  1NV6 A;  2Z23 A;  1TXF A;  3JZJ A;  1N76 A;  2NUV A;  1ZIU A;  1HSL A;  1N7X A;  3GYY A;  2ABH A;  3QUF A;  3I6V A;  1AIV A;  2RKM A;  4WXJ A;  4ZDM A;  2PX1 A;  2OCU A;  3TMG A;  1NUY A;  1I6B A;  3KSX A;  1YTV A;  3QSL A;  4AS4 A;  3O9P A;  2O84 X;  3Q26 A;  4R73 A;  3C35 A;  4IY5 A;  5I84 A;  5ICQ A;  2ZZX A;  4F39 A;  1QGX A;  4P9K A;  3C32 A;  1ATG A;  4F31 B;  1OVB A;  3OSR A;  3CG3 A;  4PAK A;  2IEE A;  4KCC A;  5JTY A;  4EF1 A;  4GXS B;  2F3B A;  3ZSF A;  1B9J A;  2Z22 A;  4OEN A;  3U93 A;  4GWW A;  3MYU A;  1NI9 A;  4LQ5 A;  4DLD A;  4POX A;  2XWO A;  3IB2 A;  2DWH A;  4E0W A;  1AOV A;  1JP4 A;  5I5P A;  4OET A;  4NTL A;  1UTB A;  2WBB A;  1Q1K A;  3MZ9 A;  3OO9 A;  4ZEC A;  4PP0 A;  1JEV A;  4H5G A;  4MMP A;  4OER A;  3C4M A;  3OEN A;  1MXY A;  5IKB A;  1DTG A;  2ZNU A;  3C31 A;  2ONS A;  4ESX A;  2F6P A;  5TU0 A;  3KG2 A;  4DXU A;  3C36 A;  3FIR A;  3ROJ A;  4GRK A;  3PUW E;  4PFW A;  4PFB A;  3IJO B;  2I58 A;  2XD2 A;  2DP8 A;  4ZE8 A;  1H45 A;  1RDY A;  3KSJ A;  4OHN A;  4OVQ A;  3Q27 A;  5JTY B;  4G61 A;  3OEL A;  5I7I A;  4TQU Q;  2Z8E A;  1FPL A;  2REG A;  4LAT A;  1I69 A;  5LTC A;  1EZO A;  4I3Y A;  4FIM A;  1RYO A;  4JWX A;  4XKQ A;  1ZU0 A;  4P1E A;  3T96 B;  4G68 C;  1UTB B;  3TQW A;  1PB8 A;  4X04 A;  4YB6 A;  5CMM A;  1MPD A;  3HFU A;  3VVF A;  4R6K A;  2H4I A;  1EZP A;  2UVH A;  2H98 A;  3U94 A;  5A5L A;  1MY0 A;  2XWK A;  4OZ9 A;  3H06 B;  5EYG A;  2I48 A;  4NQ8 A;  4QBA A;  1S9T A;  3ILU B;  1B3L A;  4P11 A;  3B6W A;  1OQH A;  2WX9 A;  4GL0 A;  1D9Y A;  1FTM A;  4RNS A;  3SER A;  4R75 A;  3QUJ A;  1JET A;  2R9J A;  3SET A;  4FJP A;  2P3N A;  5I2N B;  1GVC A;  2RIN A;  1B7H A;  3OSQ A;  4GVO A;  3C34 A;  3IOR A;  2RC8 A;  4JWO A;  5FTI A;  1OMP A;  1KA1 A;  1FPF A;  3E13 X;  2Q8M A;  1KZ8 A;  4KQP A;  3PTY A;  1Q9D A;  3T9U A;  4F3P A;  4IO5 A;  2I4C A;  5AA4 A;  1G0H A;  2CMO A;  2ALU A;  1IMD A;  1VFE A;  3G3I A;  2M8C A;  3VXB A;  3MC2 A;  4HCW A;  4PFI A;  5EHM A;  1NL5 A;  2ZZW A;  1H3D A;  3EKI A;  3H6T A;  4PBQ A;  3NOH A;  2QRY A;  1Y3P A;  3KC0 A;  3HO7 A;  4MNC A;  3CFL A;  5F7V A;  5FHM A;  2PT1 A;  1II5 A;  2Z8D A;  1IZ1 A;  1B58 A;  3V5A A;  3Q28 A;  2AL4 A;  2KLF A;  4MH5 A;  1GGG A;  2B3B A;  2HHM A;  2PFY A;  1EU8 A;  3FJ7 A;  4OVR A;  4ZEF A;  3GBB A;  5CC2 A;  1FTK A;  3SEV A;  2P0S A;  2H9B A;  4N8Y A;  5ESY A;  2YJP A;  3VV5 A;  1VE4 A;  4ZS9 A;  1FBD A;  4GX6 A;  1G0I A;  4XFE A;  3MP6 A;  4FEB A;  1Y1M A;  1S50 A;  4RJZ A;  3H3G A;  1FTO A;  1N3W A;  1US4 A;  2V84 A;  5DTB A;  3R26 A;  4ELR A;  1ZJL A;  5AA4 B;  2CEY A;  1A99 A;  4KD5 A;  5DEX A;  4JSO A;  1NUW A;  1B4Z A;  4BDN A;  4DZ1 A;  2ZNS A;  2F97 A;  3TEL A;  3CVG A;  3WAF A;  4U21 A;  2NOO A;  3IK6 B;  3MZ1 A;  1FJ9 A;  4DI4 B;  1GTK A;  1LST A;  2DWJ A;  3MBP A;  2V3Q A;  4G8N A;  4UAC A;  3V8X B;  1CB6 A;  2I3W A;  2VD2 A;  5CMC A;  3S2V A;  2O7I A;  3Q29 A;  4IO6 A;  3S9M C;  1FPE A;  4GL8 A;  4OFO A;  4THI A;  5L8D A;  4O8M A;  2G29 A;  1IUD A;  1MQG A;  2V93 A;  4P0I A;  4HE0 A;  3TCH A;  1M5F A;  3T1B A;  3KC1 A;  1K9Z A;  3S4U A;  1IMB A;  4LQ2 A;  1XC1 A;  1LB8 A;  3HPI A;  2A5T A;  2P2A A;  3H6V A;  2O6A A;  1QUI A;  4TLM B;  5DEX B;  4YB7 A;  3FBP A;  3QYT A;  3A3U A;  3K00 A;  3KOS A;  4PE3 A;  5LOM A;  1NV2 A;  1B2H A;  4N07 A;  2GQ1 A;  3DP6 A;  1NNT A;  4MHF A;  2DE2 A;  3RNN A;  3MZB A;  4H65 A;  1XOC A;  1B7Z A;  4KFQ A;  4QSE A;  4O3A A;  1B51 A;  1B0L A;  4N13 A;  5FHO A;  4QFN A;  3LC8 A;  3PUZ E;  3V89 B;  1VDW A;  2NXO A;  4GWY A;  4RA1 A;  3L6H A;  3R6U A;  2HEU A;  4OEV A;  2WEF A;  3ZKL A;  2FNC A;  4BDL A;  4KYE A;  2O51 A;  2PVU A;  4BDQ A;  4BDM A;  2HPG A;  3BKI B;  1N7W A;  5ITO A;  1JW4 A;  4WEP A;  1H76 A;  4ELP A;  3P7I A;  5AA2 A;  2XXP A;  1LFH A;  4XIG Q;  3N26 A;  3HV1 A;  2XXV A;  2KR0 A;  1HSJ A;  2A5T B;  2O7U A;  4NED A;  2GFE A;  1I6A A;  2F6G A;  1LBC A;  3QAX A;  3FVO A;  3A09 A;  3FAT A;  3TTK A;  3FD3 A;  2XXH A;  5JK4 A;  3T66 A;  4NF0 A;  4F3S A;  2R71 A;  2VT5 A;  4U22 A;  4YMA A;  5JEI A;  3OMB A;  1AMF A;  5IM2 A;  4PAI A;  4G8M A;  4JXI A;  4U4X A;  5IZZ A;  3VFJ A;  3BFT A;  5DT6 A;  5DW8 A;  3HCQ A;  2ZZV A;  5J1D A;  4YB5 A;  2HQ0 A;  4DCY A;  4R74 A;  3PPO A;  3MQ9 A;  1R1N A;  3DP4 A;  1A40 A;  4O3C A;  3KOT A;  3EPE A;  4I3E A;  3HST A;  2QMW A;  3RQT A;  1IMF A;  1MXV A;  2X7Q A;  2X26 A;  2Y7W A;  1ZLQ A;  5AA2 B;  3RN8 A;  3LSW A;  4NMY A;  1AL3 A;  4LON B;  2FA7 A;  1B05 A;  1FPD A;  4FAT A;  1JNF A;  3UP9 A;  4WED A;  4ONY A;  4DI3 D;  3S9L C;  1N0T A;  3QK6 A;  5KZT A;  2V4C A;  1UTH A;  3GBA A;  5H8H A;  2P1S A;  1BLF A;  2H99 A;  2QSX A;  1RYX A;  4OEU A;  3IX1 A;  4JDF A;  1ZBM A;  3HN0 A;  3SEU A;  1B1X A;  1B40 A;  1DMB A;  2F34 A;  2ANJ A;  1SYH A;  4GFR A;  1LAX A;  1RDZ A;  3MST A;  4OES A;  2HAU A;  5ET6 A;  1B32 A;  4DXB A;  4IY6 A;  4GX4 A;  1IXI A;  1NFT A;  1P1U A;  4XKP A;  2NWJ A;  3UOR A;  1DPE A;  3OD7 A;  3T93 B;  2Q2A A;  4OVS A;  4F1V A;  3RTF B;  5HBC A;  1URS A;  4YU0 A;  1LBV A;  3B6Q A;  1M5B A;  3CR9 A;  3U8Q A;  1JVY A;  3IJX B;  4PE5 B;  3PUX E;  1XVY A;  3K1M A;  2QS4 A;  4JB7 A;  5IZ3 A;  2NVU B;  1Q35 A;  1UTH B;  4UAB A;  2F7A A;  2ZNT A;  1B4H A;  2RC7 A;  1EYK A;  2F78 A;  4DE8 A;  1Y3N A;  5J16 A;  4PF8 A;  1YCJ A;  3D1R A;  3M3K A;  3MVY A;  3T0J A;  1SW1 A;  3G3G A;  2RF1 A;  3D4C A;  1B52 A;  3LSL A;  4ELQ A;  2B4L A;  3KEI A;  5HPQ A;  1LGB C;  1JVX A;  2HXW A;  1MDQ A;  3FXU A;  1IXH A;  4O94 A;  3B6T A;  5CBS A;  5DVJ A;  4AS5 A;  4LZ7 A;  4WKM A;  3IR1 A;  4MAG A;  1YPN A;  5AA1 A;  2DS9 A;  2DXY A;  3UA8 A;  3F11 A;  3CSG A;  1IMA A;  1JEU A;  3FJM A;  4PC9 A;  4XF5 A;  4EQ9 A;  5H8S A;  4PQJ A;  1M5E A;  3KGC A;  2QL3 A;  1P99 A;  3OO7 A;  2O1L A;  3PGF A;  3H6W A;  2O68 A;  3A3C A;  1N3X A;  3MVZ A;  4OTE A;  2QFL A;  1Y9U A;  2BJI A;  2H25 A;  3DLN A;  1JQF A;  5IZ3 B;  1MRP A;  3PV0 E;  5F1Q A;  2VPN A;  2GHB A;  3G3J A;  3K01 A;  1IME A;  1EYJ A;  1XVX A; 
#chains in the Genus database with same CATH homology
 1FW0 A;  2V25 A;  2Q2C A;  1B1H A;  1R9L A;  1Z7N E;  4R6Y A;  1M5C A;  2I0C A;  3ZKK A;  1MY1 A;  4NWC A;  5CMB A;  4BLA A;  5L9O A;  4LP2 B;  4KI0 E;  4FOR A;  3FGS A;  5B70 A;  3C9H A;  1OLA A;  4RPO A;  4F3G A;  3GXA A;  5K2X A;  5B7D A;  2AYS A;  3CFX A;  4EF2 A;  5HM4 B;  5A5X A;  2VOZ A;  1P1O A;  4G68 A;  2Q9T A;  2DYX A;  5CI5 A;  5I58 A;  1SYI A;  3DP8 A;  1FQF A;  3CSB A;  1QKB A;  2ZXT A;  3USD A;  1MPB A;  3O2A A;  4AQ4 A;  1TT1 A;  5KCJ A;  4EQB A;  4OXV A;  4RK2 A;  3L6G A;  4O3B A;  3B7D A;  4OFL A;  2REJ A;  1A8E A;  3U1O A;  3PD9 A;  2ESN A;  5TPA A;  4GD5 A;  4PFY A;  3H03 A;  1FCK A;  1QUJ A;  1FQD A;  4RPN A;  2VD3 A;  1A8F A;  4AB6 A;  3E3K A;  4H1X A;  1FQB A;  3IL1 B;  5A5X B;  2UVJ A;  4G68 B;  4QFK A;  1BTJ A;  3G7W A;  2Z8F A;  1UIU A;  4P0G A;  2OK2 A;  2VP1 A;  5I58 B;  3ODB A;  2DXR A;  5I59 A;  1SDX A;  3QIM A;  4ZE9 A;  2XXX A;  3R7X A;  3VDF A;  2HZL A;  1D3K A;  1XHY A;  1PBP A;  4IO3 A;  3SEY A;  1DOT A;  2PT2 A;  4IB2 A;  1EH3 A;  1A7L A;  1DSN A;  1NNK A;  3IOV A;  2Y7R A;  3PUV E;  3FUZ A;  3GLB A;  2CZL A;  3FXQ A;  4NF6 A;  4ND9 A;  1MM6 A;  1OIB A;  3PMW A;  1POY 1;  1B3G A;  2THI A;  5I56 A;  2PYY A;  2XD3 A;  1URD A;  1FQC A;  1FQE A;  4LVQ A;  5I59 B;  1SQY A;  4M4G A;  1MM7 A;  2HFB A;  3M8U A;  1GV8 A;  4G2Z A;  4ZZA A;  4RY1 A;  2F35 A;  4Z0I A;  1MQJ A;  2Y84 A;  1XS5 A;  2XXR A;  4OYV A;  4BDR A;  4F1U A;  3H6U A;  4QSC A;  2Q89 A;  2Q88 A;  2F7B A;  3K2D A;  4GIZ A;  1QVS A;  3D4G A;  4X1D A;  4C0R A;  4QSD A;  5L9M A;  4I62 A;  2UYF A;  5H8Q A;  1MY4 A;  2VHA A;  1Y4C A;  4YMB A;  4MFI A;  4NF6 B;  1IXG A;  5I56 B;  5FTH A;  3EN3 A;  1MQI A;  1J1N A;  1M5D A;  4QRZ A;  2Q8J A;  4H5F A;  1VSO A;  1EZ9 A;  2O69 A;  4ZEB A;  3LSX A;  1BKA A;  2GHA A;  4YZZ A;  2E1S A;  3GZG A;  2QS3 A;  3JV9 A;  3S9N C;  4IO2 A;  3TPA A;  1BP5 A;  3KN3 A;  3H4Z A;  4Q0C A;  3VLU A;  1DPP A;  4I9D A;  3EHT A;  3Q25 A;  5CMK A;  1B0H A;  4FED A;  4G4P A;  1H43 A;  4TOZ A;  1FQA A;  3PD8 A;  3FVG A;  2HZK A;  2RC9 A;  1VFD A;  1P1W A;  2A5S A;  5AA2 D;  3MPL A;  4LZ5 A;  3IOW A;  1N04 A;  3K1N A;  3PUY E;  3O6H A;  4UA8 A;  3RT8 A;  4R72 A;  2XXY A;  3EHU A;  2ONK E;  4JSD A;  3W15 C;  2ZYN A;  4XTC Q;  1L5T A;  1FTL A;  4H0W A;  1IQ7 A;  4KR5 A;  4AB5 A;  4OQO A;  3M3L A;  2UXA A;  1GR2 A;  3T9X B;  4QFP A;  4LA9 A;  3U92 A;  1B3E A;  3VVD A;  1USY H;  1WVJ A;  3OOA A;  4FEC A;  4OFJ A;  3S9E A;  1PBQ A;  2G93 A;  1ZTY A;  3SEW A;  1TWY A;  1WOD A;  4PFU A;  3THI A;  2ZYO A;  1MXZ A;  1MY2 A;  2RCB A;  3DEL B;  3TYH A;  3K4U A;  3UGW A;  4M1V A;  3IO4 A;  3E4R A;  3O29 A;  4MLQ A;  3BBR A;  1T0K A;  2H5Y A;  5TP9 A;  1LLS A;  3LR1 A;  4N6P A;  1KWH A;  3TTL A;  4MBP A;  3EF7 A;  3IAZ A;  2DSF A;  3TQL A;  1CE2 A;  4RXL A;  3CRB A;  4F2O A;  5ISU A;  3CFZ A;  3MJN A;  5M2V A;  4TLL B;  2OJT A;  1NNF A;  4JWY A;  1PDA A;  4R2B A;  4GQO A;  1NNP A;  4Q8R A;  5CRY A;  4DDD A;  3O6G A;  2I6E A;  4IO7 A;  3ILT B;  4ESW A;  4Q5T A;  3FXR A;  3I5O A;  3TTN A;  1LCT A;  5L9S A;  5H8H B;  3EQ1 A;  4QHQ A;  4C1T A;  1A55 A;  2O1M A;  2I49 A;  3K6X A;  5TP9 B;  1PC3 A;  1OLC A;  4Z7E A;  4DXC A;  1Y20 A;  1ZKB A;  1AH5 A;  3KJ7 A;  3KJT A;  4XKN A;  1ANF A;  4HCY A;  3JYR A;  1DTZ A;  3PMX A;  2OWS A;  1SW5 A;  4NE4 A;  3G3F A;  4I8C A;  2F7C A;  1P1Q A;  1BIY A;  2I4B A;  3VLW A;  3CI8 A;  2DE3 A;  1B6H A;  1OQG A;  1MXW A;  2DQV A;  4XKR A;  4G8H A;  4HTG A;  3EHS A;  4EXK A;  3IB1 A;  1NH7 A;  3TDJ A;  1B5I A;  1WDN A;  2AIX A;  4OWD A;  3MAM A;  3TFL A;  2I3V A;  3TEP A;  2UVG A;  3KZG A;  1O64 A;  1MXX A;  2E0S A;  3N6U A;  2IA4 A;  1B5J A;  3E9X A;  2YLN A;  4MF3 A;  4EXL A;  1Z7M E;  2GRV A;  4Q30 B;  3FVN A;  1MH3 A;  1NKX A;  4F18 A;  2W7Y A;  4LUB A;  4XXU A;  4MLV A;  3G3K A;  2F5X A;  1QUK A;  3TTM A;  4U1O A;  3T9H B;  4PFT A;  2Y7I A;  4G77 A;  4YKK A;  5FHN A;  1IEJ A;  3VVE A;  1PEB A;  3W9W A;  5I2K A;  1QJM A;  4C1U A;  4R2F A;  2RCA A;  1SI1 A;  5I2N A;  3TZA A;  2QS2 A;  4RK9 A;  1SW2 A;  4F3B A;  1TFA A;  1SBP A;  3N94 A;  3TCF A;  1UQW A;  2XX9 A;  4NWD A;  1JW5 A;  3MP1 A;  4GWO A;  3RUM A;  3IOU A;  4R9F A;  4QFO A;  5H8N A;  5ICT A;  2ONR A;  3TAJ A;  2HAV A;  2ZMB A;  3IB0 A;  3KN8 A;  3OO8 A;  1O63 A;  4H6D A;  5BWJ A;  1Y3Q A;  3KBR A;  4NF4 A;  5ELV A;  3ZS6 A;  4X9T A;  1H44 A;  1MQD A;  3V83 A;  2XX7 A;  3FZV A;  1YAE A;  2PBW A;  2QPQ A;  4OVJ A;  4LZ8 A;  3T22 A;  3MW0 A;  1LAH E;  4HS7 A;  3LSF B;  4DIG A;  3K0V A;  3SDF A;  3N6T A;  5I2K B;  3TKD A;  3K6V A;  1FTJ A;  1VR5 A;  2B65 A;  4POW A;  1ELJ A;  1I6Q A;  1R9Q A;  3CIJ A;  2DE4 A;  2YPN A;  3MWB A;  4H8I A;  2B3F A;  5CM6 A;  2V3U A;  3C33 A;  2VGQ A;  3DM0 A;  3UIF A;  1HSE A;  5H8N B;  3H7M A;  3VLV A;  2D3I A;  1NH8 A;  2I0B A;  5KCJ B;  3HHG A;  3MPK A;  3O28 A;  2XXU A;  4HW8 A;  4ZZE A;  4NF4 B;  3FAS A;  3PU5 A;  3OEK A;  2D21 A;  4GLI A;  3BFU A;  3I3V A;  3PPN A;  4EDP A;  1LFI A;  2Y7K A;  3K02 A;  4YKI A;  3UN6 A;  1B46 A;  5TPA B;  3IO6 A;  2QS1 A;  4U4S A;  3WAE A;  2F8D A;  3KFM A;  1MQH A;  3T9V A;  2OLB A;  1LCF A;  4F1Y A;  1US5 A;  4KCD A;  3RGY A;  2DOJ A;  3OEM A;  1MPC A;  4R9G A;  1URG A;  4X48 A;  4IO4 A;  3PPR A;  4U2R A;  2FYI A;  2OWT A;  3PMV A;  2XHD A;  4DCX A;  1ZMG A;  2UYE A;  3M3F A;  3W9V A;  4X1B A;  4L17 A;  3MP8 A;  5AA3 A;  1D9V A;  4KPT A;  4NF8 A;  1OVT A;  3O97 A;  3AXF A;  3KN7 A;  4H67 A;  3CG1 A;  5ITP A;  1NMU A;  4EUO A;  1O7T A;  4K3F A;  1SVX B;  3HHF A;  3TTR A;  3N5L A;  4NF5 A;  3TOD A;  1LAF E;  4OMB A;  1MDP 1;  4ZEK A;  1XT8 A;  4ZED A;  3RLF E;  2DWA A;  5BUU A;  4ECF A;  2WKY A;  1B3F A;  3K1P A;  4YIC A;  4ZEI A;  3U72 A;  4FAJ A;  5H8F A;  2HCA A;  1UIV A;  1LBB A;  1PB9 A;  3G3H A;  2F36 A;  1B7U A;  3UK4 A;  1B5H A;  3K6W A;  3O6I A;  4ELO A;  1S7Y A;  4NF8 B;  1Y1Z A;  4U1Z A;  4F2Q A;  3RT6 B;  4IGT A;  2PMS A;  5DVI A;  3VE1 B;  2DWI A;  4U23 A;  5H8Q B;  3TUS A;  2BJJ X;  3LUY A;  2UVI A;  1R6Z A;  4QFL A;  1LB9 A;  2XX8 A;  1JW1 A;  4NF5 B;  3FV2 A;  4KYS A;  2ZYK A;  4I1D A;  4F19 A;  5EHS A;  2XXT A;  3ONM A;  4GXA A;  1D4N A;  3MUQ A;  3MVW A;  1LAG E;  4E0X A;  4KYD A;  5H8F B;  2Y7P A;  4GF8 A;  5DYH A;  2XXQ A;  5EYF A;  1A54 A;  1B3H A;  1MH4 A;  1TFD A;  1F9B A;  4H8J A;  2QJE A;  3SEX A;  3K6U A;  1IXC A;  1MG1 A;  3SKP A;  5I57 A;  2OBG A;  4KHZ E;  1LFG A;  4GOT A;  5IAI A;  4YKJ A;  1QKA A;  1QW0 A;  5KDT A;  3VXC A;  2GH9 A;  5K2Y A;  2DVZ A;  3RPW A;  3ECR A;  2D5W A;  4ISU A;  3QXM A;  4RYA A;  2X7P A;  2AL5 A;  5AE4 A;  4F29 A;  2XXI A;  1IIW A;  3FJG A;  3IOT A;  1SD3 A;  4JBZ A;  3PPP A;  4R6H A;  4BDO A;  3RTW B;  3O66 A;  1MY3 A;  3LBS A;  2LAO A;  3FVK A;  4EQ7 A;  3RY3 A;  1MS7 A;  1QUL A;  4YAH X;  1SW4 A;  2QMX A;  2V3T A;  3FV1 A;  2DVC A;  1RKM A;  1PB7 A;  1MXU A;  1P1N A;  4IGR A;  5I57 B;  1IIT A;  1N84 A;  2ZYM A;  1SI0 A;  3SES A;  1Y4T A;  4YKP A;  3MVX A;  1USY E;  5DVF A;  2XXW A;  5KDT B;  1POT A;  3PPQ A;  3OO6 A;  3TCG A;  2OZZ A;  4F22 A;  4FE8 A;  4PET A;  4QF9 A;  2R6G E;  5CBR A;  3OXN A;  2Z23 A;  1TXF A;  3JZJ A;  1N76 A;  2NUV A;  1ZIU A;  1HSL A;  1N7X A;  2ABH A;  3QUF A;  3I6V A;  1AIV A;  2RKM A;  4WXJ A;  4ZDM A;  2PX1 A;  2OCU A;  3TMG A;  1I6B A;  3KSX A;  1YTV A;  3QSL A;  3O9P A;  2O84 X;  3Q26 A;  4R73 A;  3C35 A;  4IY5 A;  5I84 A;  5ICQ A;  4F39 A;  3C32 A;  1ATG A;  4F31 B;  1OVB A;  3OSR A;  3CG3 A;  2IEE A;  4KCC A;  5JTY A;  4EF1 A;  4GXS B;  3ZSF A;  1B9J A;  2Z22 A;  4OEN A;  3U93 A;  4LQ5 A;  4DLD A;  4POX A;  3IB2 A;  2DWH A;  4E0W A;  1AOV A;  4OET A;  4NTL A;  1UTB A;  1Q1K A;  3MZ9 A;  3OO9 A;  4ZEC A;  4PP0 A;  1JEV A;  4H5G A;  4OER A;  3C4M A;  3OEN A;  1MXY A;  5IKB A;  1DTG A;  2ZNU A;  3C31 A;  2ONS A;  4ESX A;  2F6P A;  5TU0 A;  3KG2 A;  4DXU A;  3C36 A;  3FIR A;  4GRK A;  3PUW E;  4PFW A;  3IJO B;  2I58 A;  2XD2 A;  2DP8 A;  4ZE8 A;  1H45 A;  3KSJ A;  4OHN A;  3Q27 A;  5JTY B;  3OEL A;  4TQU Q;  2Z8E A;  2REG A;  4LAT A;  1I69 A;  1EZO A;  4FIM A;  1RYO A;  4JWX A;  4XKQ A;  1ZU0 A;  3T96 B;  4G68 C;  1UTB B;  3TQW A;  1PB8 A;  4YB6 A;  5CMM A;  1MPD A;  3VVF A;  4R6K A;  2H4I A;  1EZP A;  2UVH A;  2H98 A;  3U94 A;  1MY0 A;  4OZ9 A;  3H06 B;  2I48 A;  1S9T A;  3ILU B;  1B3L A;  4P11 A;  3B6W A;  1OQH A;  4GL0 A;  1D9Y A;  1FTM A;  4RNS A;  3SER A;  4R75 A;  3QUJ A;  1JET A;  2R9J A;  3SET A;  4FJP A;  5I2N B;  1GVC A;  2RIN A;  1B7H A;  3OSQ A;  4GVO A;  3C34 A;  3IOR A;  2RC8 A;  4JWO A;  5FTI A;  1OMP A;  3E13 X;  4KQP A;  5AA4 A;  3T9U A;  4IO5 A;  2I4C A;  4F3P A;  2CMO A;  2ALU A;  1VFE A;  3G3I A;  2M8C A;  3VXB A;  3MC2 A;  4HCW A;  5EHM A;  1NL5 A;  1H3D A;  3H6T A;  2QRY A;  1Y3P A;  3HO7 A;  3CFL A;  5F7V A;  5FHM A;  2PT1 A;  1II5 A;  2Z8D A;  1IZ1 A;  1B58 A;  3V5A A;  3Q28 A;  2AL4 A;  2KLF A;  4MH5 A;  1GGG A;  2B3B A;  1EU8 A;  3FJ7 A;  4ZEF A;  3GBB A;  5CC2 A;  1FTK A;  3SEV A;  2P0S A;  2H9B A;  2YJP A;  3VV5 A;  1VE4 A;  4ZS9 A;  3MP6 A;  4FEB A;  1Y1M A;  1S50 A;  4RJZ A;  3H3G A;  1FTO A;  1N3W A;  1US4 A;  2V84 A;  5DTB A;  3R26 A;  4ELR A;  1ZJL A;  5AA4 B;  1A99 A;  4KD5 A;  5DEX A;  4JSO A;  1B4Z A;  4BDN A;  4DZ1 A;  2ZNS A;  2F97 A;  3TEL A;  3CVG A;  3WAF A;  4U21 A;  2NOO A;  3IK6 B;  3MZ1 A;  1GTK A;  1LST A;  2DWJ A;  3MBP A;  2V3Q A;  4G8N A;  4UAC A;  3V8X B;  1CB6 A;  2I3W A;  2VD2 A;  5CMC A;  3S2V A;  2O7I A;  3Q29 A;  4IO6 A;  3S9M C;  4GL8 A;  4OFO A;  4THI A;  5L8D A;  2G29 A;  1IUD A;  1MQG A;  2V93 A;  4P0I A;  3TCH A;  1M5F A;  3S4U A;  4LQ2 A;  1XC1 A;  1LB8 A;  3HPI A;  2A5T A;  2P2A A;  3H6V A;  2O6A A;  1QUI A;  4TLM B;  5DEX B;  4YB7 A;  3QYT A;  3A3U A;  3K00 A;  3KOS A;  5LOM A;  1B2H A;  4N07 A;  3DP6 A;  1NNT A;  2DE2 A;  3RNN A;  3MZB A;  4H65 A;  1XOC A;  1B7Z A;  4KFQ A;  4QSE A;  4O3A A;  1B51 A;  1B0L A;  4N13 A;  5FHO A;  4QFN A;  3LC8 A;  3PUZ E;  3V89 B;  2NXO A;  4RA1 A;  3L6H A;  3R6U A;  2HEU A;  4OEV A;  3ZKL A;  2FNC A;  4BDL A;  4KYE A;  2O51 A;  2PVU A;  4BDQ A;  4BDM A;  3BKI B;  1N7W A;  5ITO A;  1JW4 A;  4WEP A;  1H76 A;  4ELP A;  3P7I A;  5AA2 A;  2XXP A;  1LFH A;  4XIG Q;  3N26 A;  3HV1 A;  2XXV A;  1HSJ A;  2A5T B;  2O7U A;  4NED A;  2GFE A;  1I6A A;  2F6G A;  1LBC A;  3QAX A;  3FVO A;  3A09 A;  3FAT A;  3TTK A;  3FD3 A;  2XXH A;  5JK4 A;  3T66 A;  4F3S A;  2R71 A;  4U22 A;  4YMA A;  5JEI A;  3OMB A;  1AMF A;  4G8M A;  4JXI A;  4U4X A;  3VFJ A;  3BFT A;  5DT6 A;  3HCQ A;  5J1D A;  4YB5 A;  2HQ0 A;  4DCY A;  4R74 A;  3PPO A;  3MQ9 A;  1R1N A;  3DP4 A;  1A40 A;  4O3C A;  3KOT A;  3EPE A;  3HST A;  2QMW A;  3RQT A;  1MXV A;  2X7Q A;  2X26 A;  2Y7W A;  1ZLQ A;  5AA2 B;  3RN8 A;  3LSW A;  4NMY A;  1AL3 A;  4LON B;  2FA7 A;  1B05 A;  4FAT A;  1JNF A;  3UP9 A;  4WED A;  4ONY A;  3S9L C;  1N0T A;  3QK6 A;  5KZT A;  1UTH A;  3GBA A;  5H8H A;  2P1S A;  1BLF A;  2H99 A;  2QSX A;  1RYX A;  4OEU A;  3IX1 A;  4JDF A;  1ZBM A;  3HN0 A;  3SEU A;  1B1X A;  1B40 A;  1DMB A;  2F34 A;  2ANJ A;  1SYH A;  4GFR A;  1LAX A;  4OES A;  2HAU A;  1B32 A;  4DXB A;  4IY6 A;  1IXI A;  1NFT A;  1P1U A;  4XKP A;  2NWJ A;  3UOR A;  1DPE A;  3OD7 A;  3T93 B;  2Q2A A;  4F1V A;  3RTF B;  5HBC A;  1URS A;  4YU0 A;  3B6Q A;  1M5B A;  3CR9 A;  3U8Q A;  1JVY A;  3IJX B;  4PE5 B;  3PUX E;  1XVY A;  3K1M A;  2QS4 A;  4JB7 A;  2NVU B;  1Q35 A;  1UTH B;  2F7A A;  2ZNT A;  1B4H A;  2RC7 A;  2F78 A;  4DE8 A;  1Y3N A;  1YCJ A;  3M3K A;  3MVY A;  1SW1 A;  3G3G A;  2RF1 A;  3D4C A;  1B52 A;  3LSL A;  4ELQ A;  3KEI A;  5HPQ A;  1LGB C;  1JVX A;  2HXW A;  1MDQ A;  3FXU A;  1IXH A;  3B6T A;  5CBS A;  5DVJ A;  4LZ7 A;  4WKM A;  3IR1 A;  5AA1 A;  1YPN A;  3UA8 A;  2DS9 A;  2DXY A;  3F11 A;  3CSG A;  1JEU A;  3FJM A;  4EQ9 A;  5H8S A;  4PQJ A;  1M5E A;  3KGC A;  2QL3 A;  1P99 A;  3OO7 A;  2O1L A;  3PGF A;  3H6W A;  2O68 A;  3A3C A;  1N3X A;  3MVZ A;  4OTE A;  1Y9U A;  2H25 A;  3DLN A;  1JQF A;  1MRP A;  3PV0 E;  5F1Q A;  2GHB A;  3G3J A;  3K01 A;  1XVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...