4DDDA

Crystal structure of an immunogenic protein from ehrlichia chaffeensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
300
structure length
300
Chain Sequence
SLNREYILIGTGSMTGVYYPIGGSICRFIASDYGKDNKIICSISSTTGSVYNLNSIRYSNMDISIVQSDLEYYAYNGLGFYEKMLPMDNLRMLASLHKEYLTIVVKKSSNISVIDDIKGKRVNIGSPGTGVRVAMLKLLGEKGWTKKDFSVMAELKSSEQAQALCDNKIDVMVDVIGHPNASIQEASATCDIKFIPLDDRLIDDLHAKYPYYQKDIISGGLYNDSPDIQTVSVKASLVTTTELSNDLAYKIVKSIATHLRELRSITGALKTLTVQDMAKSSITPMHDGAERYYKEIGAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunogenic protein
publication title Crystal structure of an immunogenic protein from ehrlichia chaffeensis
rcsb
source organism Ehrlichia chaffeensis
total genus 100
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16868 NMT1_3 NMT1-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4dddA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4dddA01
5EHMA 3FGSA 4XXUA 2QS1A 4OEUA 3K6UA 4R75A 3IO4A 1QULA 3KBRA 1PB9A 3KSXA 1LSTA 5I2KA 4JSOA 3U1OA 5I84A 1B7ZA 3EQ1A 4WXJA 3KGCA 3TFLA 4JWOA 4O3CA 3D4GA 3WAEA 4C1TA 4Z0IA 3MQ9A 4DXUA 4NF5B 3IX1A 1MXWA 4JSDA 5H8QB 4RXLA 4GD5A 2NVUB 4X1DA 3TODA 1T0KA 1XVXA 5CMCA 2X26A 2CMOA 1PBQA 3I6VA 2XXXA 1FQAA 2FNCA 3VE1B 2OBGA 3VXCA 4JWXA 1MRPA 3BKIB 1FCKA 3UGWA 4E0XA 4IO5A 2F7CA 3PD8A 2OCUA 1JW4A 3SEXA 3OELA 4LQ2A 3RTWB 1N7WA 1EU8A 1B5HA 3FUZA 4IB2A 4XTCQ 4ND9A 4ZE9A 1RYOA 3H06B 2F5XA 2M8CA 1FQDA 5I56A 5L9MA 1AMFA 3FV2A 1ELJA 4KQPA 2QS3A 2XXYA 3TZAA 4RPNA 5I57B 1P1QA 3MVZA 3EF7A 4ZZEA 4AB5A 1IEJA 2Q8JA 1MY3A 3U8QA 1R1NA 5I2NB 3M3FA 4G8HA 4DCYA 3KSJA 4RPOA 2B65A 1GV8A 5LOMA 2O69A 3PV0E 2DVCA 3GLBA 3N26A 1I6AA 2XX7A 3VVDA 3VVFA 4U1ZA 1IXGA 5ICQA 2QL3A 3PU5A 3K0VA 3O2AA 3G3JA 3LSLA 2QRYA 1IXCA 5IKBA 1S9TA 4XKNA 4Z7EA 3KN7A 3FIRA 1SYHA 5H8QA 1TFAA 3HN0A 2W7YA 3PUYE 4YMAA 3R7XA 3CG1A 3ODBA 4Q8RA 1SW2A 2ONSA 5AA2B 3FXQA 4BDNA 3SETA 4OESA 3UN6A 2E0SA 1OIBA 5CC2A 1PB8A 3FASA 4AB6A 3H6TA 2VGQA 2WKYA 5DTBA 3TTLA 5KDTB 4FATA 1BLFA 1MS7A 1JEUA 4NF4B 4QFLA 1BIYA 1L5TA 3O28A 2O84X 4GWOA 3QIMA 2REGA 5HM4B 3W15C 1ZBMA 1PDAA 4EUOA 1B0HA 3ILUB 4H0WA 2ZYOA 3G3HA 2R71A 4LP2B 4ZDMA 5JK4A 3FV1A 3FATA 4GRKA 2ONKE 1JW5A 3K1NA 5I2NA 4MH5A 4NWDA 4RNSA 3QSLA 4DZ1A 3CFZA 5FTIA 1LBCA 1QVSA 3KEIA 3T9UA 1M5FA 4ZEIA 3PPPA 3TTNA 3C9HA 5CBRA 3U72A 2G93A 5I58A 3SEYA 4TLLB 1GVCA 1USYH 1Y9UA 1LBBA 3ONMA 1B2HA 4KR5A 1FTLA 2V25A 4G77A 2DE4A 4QSCA 3JZJA 1ZTYA 3PPRA 2DVZA 1MG1A 4RYAA 5AA2A 2Z8DA 4ZE8A 4KYDA 4U4XA 3OO7A 3IOWA 3OXNA 1B3LA 1AOVA 1Z7ME 3FJ7A 1LB8A 2IA4A 1US4A 3VFJA 3ZKLA 5KDTA 4ZEKA 2O1LA 1FW0A 4NF4A 1CB6A 1Y1MA 3MZ9A 2A5TB 1WDNA 3UP9A 1HSEA 4FJPA 4U4SA 3N6TA 1RKMA 1MPCA 3DP6A 3K4UA 3IORA 1JNFA 3H03A 1FTKA 3Q28A 2O7IA 1UTBB 4I8CA 2DOJA 1YTVA 3W9VA 1MQDA 5EYFA 3OO9A 2A5SA 2Q2CA 2UXAA 1HSJA 1OLAA 2H25A 4YKIA 4G2ZA 3M8UA 1MQHA 3OEKA 1WVJA 4F18A 1QUKA 4QHQA 1M5DA 2VP1A 2ZMBA 3C34A 1MQIA 2ALUA 2RCBA 3KN3A 4F3GA 3HHGA 2YPNA 2O68A 3V89B 1DPEA 1AH5A 4EDPA 2O51A 3CR9A 4F2QA 1B1XA 2OLBA 1SYIA 3IOUA 1HSLA 4GL8A 3USDA 2PVUA 2NXOA 1F9BA 2PYYA 3K6WA 4C1UA 3MVWA 1TFDA 4KI0E 4FEDA 5B70A 3I3VA 3K00A 4BDRA 1MY2A 4FECA 4F1VA 3FVOA 1FQBA 2O7UA 5FTHA 4R74A 1OVTA 4ZEDA 3UK4A 2HZLA 2A5TA 2I4CA 4U23A 1Z7NE 4PETA 4FIMA 5H8SA 1XVYA 3D4CA 1D9VA 3G3GA 3K6XA 4LUBA 2THIA 4MLQA 3V8XB 3TCGA 1UTBA 1B6HA 1VR5A 4ZEFA 3ECRA 3E13X 1QUIA 3VLUA 1MQGA 4RA1A 4YAHX 2ABHA 1MPDA 1P1WA 5J1DA 4M1VA 3C31A 4OERA 4JB7A 4PFTA 1B0LA 2H99A 3IJXB 3QYTA 1M5BA 1Y3QA 4LZ8A 1BKAA 4NF8A 4R2FA 2QMWA 4NWCA 3BBRA 3MC2A 1IZ1A 1FTOA 2XXVA 3C36A 4X9TA 1XT8A 3OO6A 1MXXA 2DWHA 1ATGA 4R6HA 4FAJA 1LB9A 2DYXA 3JYRA 2XXPA 1MH3A 1DMBA 1MY0A 4HTGA 2H4IA 1ZMGA 2QS4A 1P1OA 2RF1A 5TP9B 1MY4A 1S50A 1SI0A 2Y84A 2UVGA 3TCFA 3SEWA 2KLFA 1Y4TA 3TPAA 2B3FA 3T9HB 3PUZE 2DE3A 3K1MA 4LZ5A 3N6UA 1Y3NA 3RT8A 1LAGE 3CSBA 3OD7A 1US5A 3QUJA 2GHAA 3HCQA 2VHAA 3SERA 1ZLQA 5CMMA 1MXZA 1SVXB 3TUSA 1YAEA 1M5EA 2V3TA 3VLWA 2Y7PA 2OWTA 5DEXA 4MLVA 3VV5A 5TPAB 4YZZA 3PMVA 2ANJA 4TOZA 4GQOA 5DVIA 2ZYMA 5I59B 2I0CA 1VFDA 3IB2A 1N76A 3TAJA 3UORA 1JW1A 1B3FA 4G8MA 2F8DA 3DP4A 1WODA 3HHFA 3KZGA 2AYSA 4H67A 5F1QA 3B7DA 1XHYA 3OSRA 3MPKA 3O9PA 5DT6A 4R6YA 3MZBA 3MP1A 4QFKA 3FJGA 4RK9A 4OYVA 1MM7A 3G7WA 4YKKA 3THIA 2DQVA 1B3HA 4F2OA 3MP6A 4QSEA 3VDFA 1XC1A 1POY1 4H8JA 5TP9A 5I58B 5KZTA 1TT1A 4GF8A 4BDLA 5HBCA 2UYEA 3B6QA 3OMBA 1NH7A 3PUVE 3RNNA 2BJJX 3IAZA 3HV1A 4H5GA 2O6AA 3B6TA 1B52A 3QXMA 3MZ1A 1OMPA 1B5JA 3FZVA 1MY1A 4MBPA 4JXIA 1N84A 3EHTA 2GRVA 3H6VA 3LUYA 4P0IA 5DVJA 4R9FA 1JQFA 4QRZA 4F19A 2GFEA 5KCJB 3K6VA 4G8NA 5TPAA 1LFIA 4TLMB 4YB6A 2ZYKA 3PUWE 2P0SA 1ZKBA 4OEVA 3PGFA 3F11A 5I59A 2OJTA 2IEEA 1FQFA 3H3GA 4KCCA 4XIGQ 2Z23A 4F3PA 3H4ZA 3SEVA 3U94A 2I3WA 3A3CA 2DS9A 2D5WA 1EZ9A 1LAHE 2QJEA 3DLNA 3FVKA 2HXWA 2I3VA 1H44A 3M3KA 4DIGA 3E3KA 1DOTA 1Y1ZA 4IO6A 1I69A 1LGBC 1GGGA 4IO4A 4LVQA 2XX8A 1FTJA 2PBWA 4IO2A 5L8DA 2HEUA 3EPEA 4OZ9A 1OVBA 3Q25A 4KHZE 4UA8A 2AL5A 3RUMA 3TDJA 2I48A 1Y4CA 4K3FA 2V84A 2UYFA 4WEPA 3CG3A 4KCDA 2H9BA 4ISUA 3IOTA 5JTYB 3IJOB 4G68B 4R2BA 1NMUA 3IO6A 1SQYA 3PPOA 1NNPA 3KOTA 1IQ7A 1NKXA 1VFEA 4ZS9A 1MXYA 5TU0A 4EQBA 3L6GA 5A5XA 4XKRA 1N3WA 3T9VA 2QSXA 5KCJA 2NUVA 4WKMA 2R9JA 3KG2A 2D21A 1QKAA 4EF2A 3TYHA 3VXBA 2RC7A 1H76A 1SBPA 2OWSA 3TQLA 3K01A 3TQWA 1O7TA 4NMYA 4YU0A 3Q29A 1MPBA 2ESNA 1D3KA 3O6HA 4EQ7A 1NNFA 3W9WA 4H5FA 2E1SA 1DTZA 3IOVA 4BDOA 4OFJA 2Q88A 2DP8A 3HO7A 2HQ0A 2P1SA 3LC8A 1B9JA 3RGYA 3PUXE 3CI8A 4KYEA 1PBPA 4OWDA 3U93A 5CBSA 5AE4A 4NF8B 1USYE 3LBSA 2FA7A 4O3AA 1OLCA 1UTHA 4L17A 1AIVA 2F97A 4IGTA 4U2RA 4F31B 5BWJA 4HCYA 1B4HA 3I5OA 1B40A 5JTYA 5H8HA 4G68A 4AQ4A 2DSFA 2X7PA 4OXVA 1NNKA 4EF1A 1DPPA 4LQ5A 3T66A 4O3BA 1GR2A 1LCTA 1MXUA 1R9LA 1FQCA 2Q9TA 4KPTA 2F35A 2RC9A 4F29A 3QAXA 3TCHA 1SW1A 2PX1A 2I49A 4IY5A 2DWAA 1N0TA 1B46A 3TKDA 3RPWA 2HCAA 4PP0A 3Q27A 4XKPA 4YKJA 4C0RA 4OHNA 2RC8A 3FJMA 4YB7A 5DEXB 3DM0A 3TTRA 3L6HA 2HAVA 2P2AA 1LFGA 1ZJLA 3N5LA 2ZXTA 4I62A 4JBZA 1A40A 5DYHA 4HW8A 2RKMA 2AL4A 1B58A 3MWBA 4F1UA 1B51A 4QFPA 1RYXA 3FVNA 4QF9A 4HCWA 1XOCA 3GXAA 3VVEA 3M3LA 4G68C 3R26A 1NL5A 1JETA 4ESXA 4ELPA 3TTKA 3S9MC 1SI1A 2YJPA 4PFWA 4F39A 4H1XA 2XD2A 2XHDA 3PMWA 4GLIA 1IXHA 3MW0A 1JEVA 2HZKA 2F78A 2R6GE 3UIFA 1POTA 2Y7KA 3OENA 3TMGA 4YB5A 2OK2A 4WEDA 4JWYA 1Q1KA 3MVXA 4P0GA 4RK2A 4GXSB 4MFIA 2YLNA 2F7AA 4NE4A 2ZNSA 3CFXA 4PFYA 1PC3A 4BDQA 2UVHA 4RY1A 1IUDA 1ZIUA 3ZKKA 2H98A 1MQJA 2Q89A 3BFUA 4DXBA 4GL0A 2Y7WA 3MPLA 4UACA 3FXRA 4G4PA 1NFTA 1QJMA 1NH8A 4MF3A 4OFLA 3BFTA 3PMXA 2F7BA 2DXYA 2XX9A 3MJNA 4EXKA 1R9QA 3OEMA 1VE4A 3ZSFA 3G3KA 4GXAA 3EHSA 2HAUA 1KWHA 4JDFA 3FD3A 3A3UA 1IXIA 1MDQA 1UIUA 3MP8A 2DXRA 2VD2A 4DLDA 3S9EA 2NOOA 3GZGA 2NWJA 1A8FA 4GIZA 3MVYA 3EN3A 4U22A 1NNTA 1M5CA 4R72A 1GTKA 3MBPA 1FTMA 1N7XA 4ZZAA 1UIVA 3KJ7A 2I4BA 2H5YA 5CMKA 3IR1A 5B7DA 1B3EA 4YKPA 3HPIA 3RY3A 2OZZA 1URGA 1J1NA 4Q5TA 2GH9A 2ZNTA 4R6KA 3RN8A 3LSFB 2QS2A 4LA9A 3O29A 3V5AA 3CVGA 2B3BA 3S2VA 3LR1A 4IY6A 4LONB 1H43A 3E9XA 3RLFE 3TELA 4HS7A 1OQGA 3KJTA 2LAOA 3C32A 1EZPA 3S9LC 1PB7A 1IITA 5AA4B 3O6GA 4H65A 1QW0A 2ONRA 5ICTA 1IIWA 3MAMA 3SEUA 4GVOA 2XXRA 2F6PA 2UVJA 4OFOA 4DE8A 4IO7A 1N3XA 1YCJA 5CRYA 4NF5A 4OVJA 4FORA 2X7QA 4PFUA 1PEBA 2RINA 5FHMA 1XS5A 3ILTB 3TEPA 4DCXA 5A5XB 4PQJA 1B7HA 1LAFE 5L9SA 2Z8FA 3OO8A 2DE2A 3LSXA 1BTJA 5H8NB 3O66A 2GHBA 4IO3A 1I6BA 3KFMA 5AA3A 1SD3A 3E4RA 4KFQA 2I6EA 3CIJA 2CZLA 1MH4A 4GOTA 1MDP1 3LSWA 5ELVA 1EH3A 2F6GA 3B6WA 4ZEBA 1QKBA 4NTLA 3DP8A 2Z22A 3QUFA 3FVGA 2PT1A 4FE8A 4ZECA 2VD3A 5EHSA 3OOAA 2XXHA 3G3FA 1DTGA 3DELB 2XXQA 1B4ZA 1JVYA 1O63A 1DSNA 1B5IA 1LAXA 4KYSA 5I57A 5DVFA 2Y7IA 1SW5A 3ZS6A 4QFOA 4EXLA 3OSQA 2XXUA 3N94A 5JEIA 3P7IA 4H6DA 2XXIA 4ELRA 5K2YA 4P11A 4ONYA 3C33A 5AA1A 3V83A 2FYIA 3RQTA 2I58A 5AA4A 1UTHB 3FXUA 3IL1B 3QK6A 3VLVA 3C4MA 3CSGA 1JVXA 2XXWA 5FHOA 5H8HB 1O64A 1A55A 4ESWA 3SESA 4OETA 3K02A 1A8EA 1ANFA 4F3BA 3O97A 4OQOA 4XKQA 1B1HA 1URSA 2Y7RA 4PE5B 5H8FB 5CM6A 1P1NA 1TWYA 4X48A 2QPQA 5HPQA 3SDFA 4I9DA 5H8NA 1H3DA 5CMBA 1B05A 1D4NA 3IB0A 4Q30B 1Y20A 1YPNA 1P99A 4YICA 3CRBA 2F36A 3T9XB 3RTFB 3RT6B 4POWA 5CI5A 3PPQA 5BUUA 3H6UA 1Q35A 2HFBA 4RJZA 4BLAA 2QMXA 1ZU0A 4F3SA 4N13A 1BP5A 5IAIA 3CFLA 4KD5A 2ZYNA 5AA2D 1B7UA 4F22A 4U21A 4IGRA 3GBBA 3IK6B 1Y3PA 4FEBA 4Q0CA 4DXCA 1AL3A 3R6UA 2DWJA 3S4UA 3UA8A 2PT2A 1S7YA 5M2VA 3H7MA 2D3IA 1EZOA 2XD3A 4POXA 5K2XA 4LATA 3H6WA 2RCAA 1TXFA 1A54A 1OQHA 1FQEA 3C35A 4QFNA 3TTMA 2ZNUA 4NF6B 3S9NC 4M4GA 5L9OA 5ITOA 1VSOA 1LFHA 4R73A 1II5A 2Z8EA 1MXVA 2UVIA 1QUJA 1SDXA 5I2KB 2I0BA 4ELOA 1D9YA 1N04A 5H8FA 3KN8A 4R9GA 2F34A 3JV9A 3AXFA 4X1BA 4F1YA 3IB1A 4OTEA 4NEDA 2XXTA 4OMBA 1MM6A 2AIXA 2REJA 4OENA 3MUQA 4TQUQ 3WAFA 4H8IA 3G3IA 2V3UA 1B3GA 4U1OA 2Q2AA 4ECFA 3T22A 1UQWA 4QSDA 1URDA 4GFRA 3SKPA 3GBAA 3KOSA 4E0WA 3HSTA 1CE2A 4N6PA 3T96B 2VOZA 1B32A 2PMSA 3O6IA 1A99A 3Q26A 5ISUA 1R6ZA 2V3QA 1LLSA 3EHUA 4ELQA 5ITPA 2DWIA 2V93A 3PD9A 4DDDA 4I1DA 3K1PA 1A7LA 4LZ7A 5I56B 5FHNA 1H45A 1P1UA 3A09A 3PPNA 1SW4A 4THIA 1LCFA 4EQ9A 4BDMA 5F7VA 2O1MA 3T93B 1I6QA 3U92A 4YMBA 2G29A 4N07A 3K2DA 4NF6A
chains in the Genus database with same CATH superfamily
5EHMA 3FGSA 4XXUA 4X04A 2QS1A 4OEUA 5EQ7A 3K6UA 4R75A 3IO4A 3KC1A 1QULA 3KBRA 1EYJA 1PB9A 1LBWA 3KSXA 4OVTA 1LSTA 5I2KA 4JSOA 3U1OA 5I84A 1FRPA 1B7ZA 3EQ1A 4WXJA 3KGCA 3TFLA 4JWOA 4O3CA 3D4GA 3WAEA 4C1TA 4Z0IA 3MQ9A 5EYGA 4DXUA 4NF5B 2PFZA 3IX1A 4P56A 1MXWA 4JSDA 5H8QB 4RXLA 4GD5A 2NVUB 4X1DA 1FPIA 1XI6A 4NGUA 3TODA 1T0KA 1XVXA 5CMCA 2X26A 1FPBA 4AS4A 2CMOA 1PBQA 3I6VA 2XXXA 1FQAA 2FNCA 3VE1B 2OBGA 3VXCA 4JWXA 1MRPA 3BKIB 1FCKA 3UGWA 4E0XA 4IO5A 4PGNA 4P47A 2F7CA 3PD8A 2OCUA 1JW4A 3SEXA 3OELA 4LQ2A 3RTWB 1N7WA 1EU8A 1B5HA 3FUZA 4IB2A 4XTCQ 4ND9A 4ZE9A 1RYOA 3H06B 2F5XA 2M8CA 1FQDA 5I56A 5L9MA 1AMFA 3FV2A 1ELJA 4KQPA 2QS3A 2XXYA 3TZAA 4RPNA 1INPA 5I57B 4HE2A 1P1QA 3MVZA 3EF7A 4ZZEA 4AB5A 1IEJA 2Q8JA 2HPGA 1MY3A 3U8QA 1FTAA 1R1NA 5I2NB 3M3FA 4G8HA 4DCYA 4O8MA 3KSJA 4RPOA 2B65A 1GV8A 5LOMA 2O69A 3PV0E 2DVCA 3GLBA 3N26A 1I6AA 2XX7A 3VVDA 3VVFA 4U1ZA 3ROJA 1IXGA 5ICQA 4PTKA 2QL3A 3PU5A 3K0VA 3O2AA 1NV5A 3G3JA 3LSLA 2QRYA 1IXCA 5IKBA 1S9TA 4XKNA 4Z7EA 1K9YA 3KN7A 3FIRA 1SYHA 5H8QA 1TFAA 3HN0A 5I3SA 2W7YA 1FBHA 3PUYE 4P3LA 4YMAA 3R7XA 3CG1A 3ODBA 4Q8RA 1SW2A 2ONSA 5AA2B 3FXQA 3LV0A 4BDNA 3SETA 4OESA 3UN6A 2E0SA 1OIBA 5CC2A 1PB8A 3FASA 4AB6A 3H6TA 2VGQA 2WKYA 5DTBA 3TTLA 5KDTB 1RDZA 4FATA 1BLFA 1MS7A 1JEUA 4NF4B 4QFLA 4P1EA 1NV1A 1BIYA 1L5TA 3O28A 2O84X 4GWOA 3QIMA 2REGA 4UABA 5HM4B 4N6KA 2FIXA 4NQ8A 3W15C 1ZBMA 1PDAA 4EUOA 1B0HA 4MNIA 3ILUB 4H0WA 2WYPA 2ZYOA 3G3HA 4MNPA 2R71A 4LP2B 4ZDMA 1NV3A 4GWZA 5JK4A 5IZZA 3FV1A 3FATA 4GRKA 2ONKE 4N4UA 1JW5A 2B4MA 2KQZA 3K1NA 4PAFA 5I2NA 4MH5A 4NWDA 4RNSA 3QSLA 4DZ1A 3CFZA 5FTIA 4PAIA 1LBCA 1QVSA 3KEIA 2HXRA 3A29A 4GWXA 3T9UA 1M5FA 4ZEIA 3ISPA 3PPPA 4O94A 3TTNA 3C9HA 1FPKA 5CBRA 3U72A 2G93A 2PCRA 5I58A 3SEYA 4TLLB 1GVCA 1USYH 1Y9UA 1LBBA 3ONMA 1B2HA 4KR5A 1FTLA 1D9QA 2V25A 4G77A 2DE4A 4QSCA 3JZJA 1ZTYA 3PPRA 2DVZA 1MG1A 4RYAA 5AA2A 2Z8DA 4ZE8A 4KYDA 4U4XA 3OO7A 3IOWA 3OXNA 1FBEA 5IM2A 1NUWA 1B3LA 4LN5A 1AOVA 1Z7ME 3FJ7A 1LB8A 2IA4A 1US4A 3VFJA 3ZKLA 5KDTA 4ZEKA 2O1LA 4H45A 1FW0A 4NF4A 1CB6A 1Y1MA 3MZ9A 2A5TB 1WDNA 3UP9A 1HSEA 4FJPA 1G0HA 2KR0A 3MSTA 2Q74A 4U4SA 3N6TA 1RKMA 4NG7A 1MPCA 3DP6A 5ET5A 4I3YA 3K4UA 3IORA 4XFEA 1JNFA 3H03A 1FTKA 5I7IA 3Q28A 2O7IA 1UTBB 4I8CA 2DOJA 1YTVA 3W9VA 1MQDA 5EYFA 3OO9A 2A5SA 2Q2CA 2UXAA 1HSJA 1OLAA 2H25A 2OWZA 1IMCA 4YKIA 4G2ZA 3M8UA 1MQHA 4XF5A 3OEKA 1WVJA 4F18A 1FPGA 1QUKA 4QHQA 1M5DA 2HHMA 2VP1A 1NV2A 2ZMBA 3C34A 1MQIA 2ALUA 2RCBA 4MAGA 3KN3A 4F3GA 3HHGA 2YPNA 2O68A 3V89B 1DPEA 2P3VA 1IMDA 4N17A 1AH5A 4EDPA 2O51A 3CR9A 4F2QA 1B1XA 2OLBA 1SYIA 3IOUA 1HSLA 4GL8A 3EKIA 3USDA 2PVUA 2NXOA 1F9BA 2PYYA 3K6WA 4C1UA 4AS5A 3MVWA 3T1BA 1TFDA 3E78A 4KI0E 4FEDA 5B70A 3I3VA 3K00A 4BDRA 1MY2A 4FECA 4F1VA 3FVOA 1FQBA 2O7UA 5FTHA 1FBPA 4R74A 1OVTA 4ZEDA 3UK4A 2HZLA 2A5TA 2CZIA 1LBYA 2I4CA 2QVVA 4U23A 3T0JA 2OX3A 1Z7NE 4PETA 4FIMA 5H8SA 5A5LA 1XVYA 1QGXA 3D4CA 1D9VA 4GWUA 3G3GA 4PC9A 3K6XA 4LUBA 3KC0A 2THIA 4MLQA 3V8XB 3TCGA 1UTBA 1B6HA 1VR5A 4ZEFA 1IMEA 4NN3A 3ECRA 3E13X 1QUIA 3VLUA 1MQGA 4PGPA 4RA1A 4YAHX 2ABHA 1MPDA 5F24A 1P1WA 5J1DA 4M1VA 3C31A 4OERA 4JB7A 4PFTA 1B0LA 2H99A 3IJXB 3QYTA 2CZKA 1M5BA 1Y3QA 4LZ8A 1BKAA 4NF8A 4GX4A 4R2FA 2QMWA 4NWCA 3BBRA 3MC2A 1IZ1A 1FTOA 2XXVA 3C36A 4X9TA 1XT8A 3OO6A 1MXXA 2DWHA 1ATGA 4R6HA 4FAJA 1LB9A 2DYXA 3JYRA 1FPFA 2XXPA 1MH3A 1DMBA 3IFCA 1MY0A 4HTGA 2H4IA 4NHBA 3HFUA 1ZMGA 2QS4A 3PTYA 1P1OA 2RF1A 5TP9B 1MY4A 1S50A 1SI0A 2Y84A 2UVGA 3TCFA 3SEWA 2KLFA 1Y4TA 3TPAA 2B3FA 3T9HB 3PUZE 2DE3A 3K1MA 4LZ5A 3N6UA 1Y3NA 3RT8A 2QFLA 1LAGE 3CSBA 3OD7A 1US5A 3QUJA 2GHAA 3HCQA 3SZPA 4OVPA 2VHAA 3SERA 1ZLQA 5CMMA 1MXZA 1SVXB 3TUSA 1YAEA 1M5EA 2V3TA 3VLWA 2Y7PA 2OWTA 5DEXA 4MLVA 3VV5A 5TPAB 4YZZA 4O7IA 3PMVA 2ANJA 4TOZA 4GQOA 5DVIA 2ZYMA 1FJ6A 5I59B 2I0CA 1VFDA 3IB2A 4MNCA 3E79A 1N76A 3TAJA 3UORA 1JW1A 1B3FA 4G8MA 2F8DA 3DP4A 1WODA 3HHFA 3KZGA 2AYSA 4H67A 4QXDA 5F1QA 3B7DA 1FJ9A 1XHYA 4P9KA 3OSRA 3MPKA 3O9PA 5DT6A 4R6YA 4GWYA 3MZBA 3MP1A 4QFKA 3FJGA 4RK9A 4OYVA 4OANA 1MM7A 3G7WA 4YKKA 3THIA 4PCDA 2DQVA 2FVZA 1B3HA 5T3JA 4F2OA 5LTCA 2Y5KA 3MP6A 4QSEA 1FBGA 3VDFA 1XC1A 1POY1 4H8JA 5TP9A 3BIGA 5I58B 5KZTA 1TT1A 4GF8A 4BDLA 5HBCA 2UYEA 4PF8A 3B6QA 3OMBA 1NH7A 3PUVE 1FPLA 3RNNA 2BJJX 3IAZA 3HV1A 1JP4A 4H5GA 2O6AA 3B6TA 1B52A 3QXMA 3MZ1A 1OMPA 1B5JA 3FZVA 1K9ZA 1MY1A 4MBPA 1NV4A 4JXIA 4N8YA 4PAKA 1N84A 3EHTA 2GRVA 3H6VA 3LUYA 4JVIA 5ESYA 4P0IA 5DVJA 4R9FA 1JQFA 4QRZA 4F19A 2GFEA 5KCJB 1KZ8A 3K6VA 1SPIA 4G8NA 5TPAA 1LFIA 4TLMB 4YB6A 2ZYKA 3PUWE 5EQAA 2P0SA 1ZKBA 4OEVA 3PGFA 3F11A 5I59A 2BJIA 2OJTA 3RYDA 2IEEA 1FQFA 1KA0A 3H3GA 4KCCA 4XIGQ 2Z23A 4F3PA 3H4ZA 3SEVA 3U94A 2I3WA 3A3CA 2DS9A 4FBPA 2D5WA 1EZ9A 1LAHE 2QJEA 1NV7A 3DLNA 4PFRA 3FVKA 2HXWA 2I3VA 1H44A 3M3KA 4DIGA 3E3KA 1DOTA 1Y1ZA 4IO6A 2B4LA 1I69A 1LGBC 1GGGA 4IO4A 4LVQA 2XX8A 1FTJA 2PBWA 4IO2A 2HEUA 5L8DA 3EPEA 4OZ9A 1OVBA 3Q25A 4KHZE 4UA8A 2AL5A 3RUMA 4I40A 3TDJA 2I48A 1Y4CA 4K3FA 2V84A 2UYFA 4WEPA 4PBHA 3CG3A 4KCDA 2H9BA 4HXVA 4ISUA 3IOTA 1FPEA 5JTYB 3IJOB 4G68B 4R2BA 1NMUA 3IO6A 1SQYA 3PPOA 1NNPA 3KOTA 1IQ7A 1NKXA 1VFEA 4ZS9A 4MJOA 5LDZA 1MXYA 5TU0A 4EQBA 3L6GA 5A5XA 2F3DA 4XKRA 1N3WA 5EQ9A 3T9VA 1DCUA 4P1LA 2QSXA 5KCJA 2NUVA 4WKMA 2R9JA 3KG2A 2D21A 1QKAA 4EF2A 3TYHA 3VXBA 2DDKA 4HE1A 2RC7A 1IMFA 2WBBA 1H76A 1SBPA 2OWSA 4NAPA 3TQLA 3K01A 3TQWA 1Q9DA 1NUXA 4JVCA 3QMFA 1O7TA 4NMYA 4MCOA 4YU0A 4OVQA 3Q29A 1MPBA 2ESNA 1D3KA 4X8RA 4GBWA 3O6HA 4EQ7A 1NNFA 2XA5A 3W9WA 4H5FA 2E1SA 4DI3D 4PE3A 1DTZA 3IOVA 4BDOA 4N91A 1NV0A 4OFJA 2Q88A 2DP8A 3B8BA 3HO7A 2HQ0A 2P1SA 3LC8A 2ZZVA 1B9JA 3RGYA 1RDYA 3PUXE 3CI8A 4KYEA 4MEVA 1PBPA 4OWDA 3U93A 5CBSA 5AE4A 4NF8B 1USYE 3LBSA 2FA7A 1FSAA 4O3AA 1DBZA 1OLCA 1UTHA 4L17A 1AIVA 2F97A 3FBPA 4IGTA 4U2RA 4F31B 5BWJA 4HCYA 4O7MA 1B4HA 3I5OA 1B40A 5JTYA 5H8HA 4G68A 4AQ4A 2DSFA 2X7PA 4OXVA 1NNKA 4EF1A 3IFAA 1DPPA 4LQ5A 1IMAA 1LBXA 3T66A 4PFBA 4O3BA 4OVRA 1GR2A 1LCTA 1MXUA 1R9LA 1FQCA 2Q9TA 4KPTA 1AWBA 1FBCA 2F35A 2RC9A 5IZ3B 4F29A 3QAXA 3TCHA 1SW1A 2PX1A 2I49A 4IY5A 2DWAA 1N0TA 1B46A 3FXBA 3TKDA 3RPWA 2HCAA 2CZHA 4PP0A 3Q27A 4XKPA 4YKJA 4C0RA 3BIHA 4OHNA 3MYUA 2RC8A 3FJMA 4NX1A 4YB7A 4H46A 4GX3A 5DEXB 3DM0A 3TTRA 3L6HA 2HAVA 2P2AA 1LFGA 1ZJLA 3N5LA 2ZXTA 4I62A 4JBZA 1A40A 5DYHA 2GQ1A 4HW8A 2RKMA 2AL4A 1B58A 3MWBA 1NV6A 4NF0A 4F1UA 1B51A 4QFPA 1RYXA 3FVNA 4QF9A 4HCWA 1XOCA 3GXAA 3VVEA 3M3LA 4G68C 3R26A 1NL5A 1JETA 4ESXA 4ELPA 3TTKA 3S9MC 1SI1A 1FBDA 2YJPA 4PFWA 4PDHA 4F39A 4H1XA 5ET6A 2XD2A 1NUZA 2XHDA 3PMWA 4GLIA 1IXHA 3MW0A 5I5PA 1JEVA 2HZKA 2F78A 2R6GE 3UIFA 4PDDA 2WEFA 1POTA 2Y7KA 3OENA 3TMGA 4YB5A 2OK2A 4WEDA 4JWYA 1Q1KA 3MVXA 2ZZWA 4P0GA 4RK2A 4GXSB 4MFIA 2YLNA 2F7AA 4NE4A 5DW8A 2ZNSA 2VPNA 3CFXA 4PFYA 1PC3A 4BDQA 2UVHA 4RY1A 1IUDA 1ZIUA 3ZKKA 2H98A 5IZ3A 2VPOA 1MQJA 2Q89A 3BFUA 4DXBA 4N8GA 4GL0A 2Y7WA 3MPLA 4UACA 3FXRA 4G4PA 1NFTA 1QJMA 1NH8A 4MF3A 4OFLA 5ET8A 2P3NA 3BFTA 3PMXA 2F7BA 2DXYA 2XX9A 3MJNA 5EQ8A 4EXKA 1R9QA 3OEMA 1VE4A 3ZSFA 3G3KA 4GXAA 3EHSA 2HAUA 1KWHA 4JDFA 3FD3A 3A3UA 2F3BA 1IXIA 1MDQA 1UIUA 3MP8A 2DXRA 2VD2A 4DLDA 3S9EA 2NOOA 3GZGA 2NWJA 1A8FA 4GIZA 3MVYA 3EN3A 4U22A 1NNTA 1M5CA 4R72A 1NUYA 1GTKA 3MBPA 1FTMA 1N7XA 3LUZA 4ZZAA 1UIVA 3KJ7A 1VDWA 2I4BA 2H5YA 5CMKA 3IR1A 2L5VA 5B7DA 1B3EA 4YKPA 3HPIA 3RY3A 2OZZA 1URGA 1J1NA 4KXPA 4Q5TA 2GH9A 2ZNTA 4R6KA 3RN8A 3LSFB 2XWVA 2QS2A 4LA9A 3O29A 3V5AA 3CVGA 2B3BA 3S2VA 3LR1A 4IY6A 4LONB 3NOHA 1H43A 3E9XA 3RLFE 3TELA 4HS7A 1OQGA 3KJTA 2LAOA 3C32A 1EZPA 3S9LC 2WBDA 1PB7A 1IITA 5AA4B 3O6GA 1LBZA 4H65A 1QW0A 2ONRA 5ICTA 1IIWA 4G61A 3MAMA 3SEUA 4GVOA 2XXRA 2F6PA 2UVJA 4OFOA 4DE8A 5FBPA 4IO7A 1N3XA 1YCJA 5CRYA 1G0IA 4NF5A 2XWKA 4OVJA 4I3EA 4MX6A 4FORA 2X7QA 4PFUA 1PEBA 2RINA 5FHMA 1EYIA 1XS5A 3ILTB 3TEPA 4DCXA 5A5XB 4PQJA 1B7HA 1LAFE 5L9SA 2Z8FA 1FBFA 3OO8A 2DE2A 3LSXA 1BTJA 2CEXA 5H8NB 3O66A 2GHBA 4IO3A 1I6BA 1DK4A 3KFMA 5AA3A 1SD3A 3E4RA 4KFQA 2I6EA 3CIJA 2CZLA 1MH4A 2V4CA 4GOTA 1KA1A 1MDP1 3LSWA 5ELVA 1EH3A 2F6GA 3B6WA 4ZEBA 4MIJA 1QKBA 4NTLA 3DP8A 2Z22A 3QUFA 3FVGA 2PT1A 4FE8A 4ZECA 2VD3A 5EHSA 3OOAA 2JJKA 2XXHA 3G3FA 2R8TA 1DTGA 3DELB 2XXQA 4QBAA 4GBVA 1B4ZA 1JVYA 1O63A 1DSNA 1B5IA 1LAXA 1YYZA 4KYSA 5I57A 5DVFA 2QVUA 2Y7IA 1SW5A 3ZS6A 4QFOA 4EXLA 3OSQA 1RDXA 2XXUA 3N94A 5JEIA 3P7IA 4H6DA 2XXIA 2ZZXA 4ELRA 5K2YA 4P11A 4PBQA 4ONYA 3C33A 5AA1A 3V83A 2FYIA 3RQTA 2I58A 5AA4A 1UTHB 3FXUA 3IL1B 3QK6A 3VLVA 5J16A 3RPLB 4JVDA 3C4MA 2Q8MA 3CSGA 1JVXA 2XXWA 5FHOA 3B50A 5H8HB 1O64A 1A55A 4ESWA 3SESA 4OETA 3K02A 1A8EA 1ANFA 2Y5LA 4F3BA 4GWWA 3O97A 4OQOA 4XKQA 1B1HA 1URSA 2Y7RA 4PE5B 2PFYA 5H8FB 5CM6A 1P1NA 1TWYA 4X48A 4PFIA 2QPQA 5HPQA 3SDFA 4I9DA 5H8NA 4GX6A 1H3DA 5CMBA 1YXIA 1B05A 1D4NA 3IB0A 4Q30B 1Y20A 1YPNA 1P99A 4YICA 3CRBA 2F36A 2FIEA 3T9XB 3RTFB 3RT6B 4POWA 5CI5A 3PPQA 2XWIA 5BUUA 4OVSA 3H6UA 2CEYA 1Q35A 2HFBA 4RJZA 4BLAA 2QMXA 1ZU0A 4F3SA 4N13A 1BP5A 4N81A 5IAIA 3CFLA 4KD5A 2XWOA 2ZYNA 5AA2D 1B7UA 4F22A 4U21A 4IGRA 3GBBA 3IK6B 1Y3PA 4FEBA 4Q0CA 2FBPA 4DXCA 1AL3A 3R6UA 2MKZA 2DWJA 3S4UA 3UA8A 1LBVA 2PT2A 1S7YA 5M2VA 1FPJA 1BK4A 3H7MA 2D3IA 1EZOA 2XD3A 4POXA 5K2XA 3GYYA 3H6WA 4LATA 2RCAA 1TXFA 1A54A 1OQHA 3D1RA 2QVRA 3CHGA 4DI4B 1FQEA 3C35A 4QFNA 3TTMA 2ZNUA 2WX9A 3RPLA 4NF6B 3S9NC 4M4GA 1EYKA 5IGAA 5L9OA 5ITOA 1VSOA 1LFHA 1LEVA 4R73A 1II5A 2Z8EA 5IZ1A 4XEQA 4N6DA 1MXVA 2UVIA 1QUJA 2VT5A 1NI9A 1SDXA 5I2KB 2WYKA 2I0BA 4ELOA 1D9YA 1N04A 5H8FA 3KN8A 4R9GA 4IR8A 2F34A 4N15A 3JV9A 3AXFA 4X1BA 3KBZA 4F1YA 3IB1A 4OTEA 2XXKA 1IMBA 4NEDA 4OMBA 2XXTA 1MM6A 2AIXA 2REJA 4HE0A 4OENA 3MUQA 4TQUQ 3WAFA 4H8IA 3G3IA 2V3UA 1B3GA 2FHYA 4U1OA 2Q2AA 4ECFA 3T22A 1UQWA 5ET7A 4QSDA 1URDA 1CNQA 4GFRA 3SKPA 3GBAA 3KOSA 4E0WA 3HSTA 1CE2A 4N6PA 3T96B 2VOZA 1B32A 2PMSA 3O6IA 1A99A 3Q26A 5ISUA 1YZ0A 4P8BA 1R6ZA 2V3QA 1LLSA 3EHUA 4ELQA 5ITPA 4MMPA 2DWIA 2V93A 3PD9A 4DDDA 4I1DA 3K1PA 1A7LA 4LZ7A 5I56B 5FHNA 1H45A 1P1UA 3A09A 3PPNA 4MHFA 1FPDA 1SW4A 4THIA 1LCFA 4EQ9A 4BDMA 5F7VA 2O1MA 3T93B 4OA4A 1I6QA 5EYHA 3U92A 4YMBA 3U65A 2G29A 4N07A 4GWSA 3K2DA 4NF6A 4PF6A
chains in the Genus database with same CATH topology
5EHMA 3FGSA 4XXUA 2QS1A 4OEUA 3K6UA 4R75A 3IO4A 1QULA 3KBRA 1PB9A 3KSXA 1LSTA 5I2KA 4JSOA 3U1OA 5I84A 1B7ZA 3EQ1A 4WXJA 3KGCA 3TFLA 4JWOA 4O3CA 3D4GA 3WAEA 4C1TA 4Z0IA 3MQ9A 4DXUA 4NF5B 3IX1A 1MXWA 4JSDA 5H8QB 4RXLA 4GD5A 2NVUB 4X1DA 3TODA 1T0KA 1XVXA 5CMCA 2X26A 2CMOA 1PBQA 3I6VA 2XXXA 1FQAA 2FNCA 3VE1B 2OBGA 3VXCA 4JWXA 1MRPA 3BKIB 1FCKA 3UGWA 4E0XA 4IO5A 2F7CA 3PD8A 2OCUA 1JW4A 3SEXA 3OELA 4LQ2A 3RTWB 1N7WA 1EU8A 1B5HA 3FUZA 4IB2A 4XTCQ 4ND9A 4ZE9A 1RYOA 3H06B 2F5XA 2M8CA 1FQDA 5I56A 5L9MA 1AMFA 3FV2A 1ELJA 4KQPA 2QS3A 2XXYA 3TZAA 4RPNA 5I57B 1P1QA 3MVZA 3EF7A 4ZZEA 4AB5A 1IEJA 2Q8JA 1MY3A 3U8QA 1R1NA 5I2NB 3M3FA 4G8HA 4DCYA 3KSJA 4RPOA 2B65A 1GV8A 5LOMA 2O69A 3PV0E 2DVCA 3GLBA 3N26A 1I6AA 2XX7A 3VVDA 3VVFA 4U1ZA 1IXGA 5ICQA 2QL3A 3PU5A 3K0VA 3O2AA 3G3JA 3LSLA 2QRYA 1IXCA 5IKBA 1S9TA 4XKNA 4Z7EA 3KN7A 3FIRA 1SYHA 5H8QA 1TFAA 3HN0A 2W7YA 3PUYE 4YMAA 3R7XA 3CG1A 3ODBA 4Q8RA 1SW2A 2ONSA 5AA2B 3FXQA 4BDNA 3SETA 4OESA 3UN6A 2E0SA 1OIBA 5CC2A 1PB8A 3FASA 4AB6A 3H6TA 2VGQA 2WKYA 5DTBA 3TTLA 5KDTB 4FATA 1BLFA 1MS7A 1JEUA 4NF4B 4QFLA 1BIYA 1L5TA 3O28A 2O84X 4GWOA 3QIMA 2REGA 5HM4B 3W15C 1ZBMA 1PDAA 4EUOA 1B0HA 3ILUB 4H0WA 2ZYOA 3G3HA 2R71A 4LP2B 4ZDMA 5JK4A 3FV1A 3FATA 4GRKA 2ONKE 1JW5A 3K1NA 5I2NA 4MH5A 4NWDA 4RNSA 3QSLA 4DZ1A 3CFZA 5FTIA 1LBCA 1QVSA 3KEIA 3T9UA 1M5FA 4ZEIA 3PPPA 3TTNA 3C9HA 5CBRA 3U72A 2G93A 5I58A 3SEYA 4TLLB 1GVCA 1USYH 1Y9UA 1LBBA 3ONMA 1B2HA 4KR5A 1FTLA 2V25A 4G77A 2DE4A 4QSCA 3JZJA 1ZTYA 3PPRA 2DVZA 1MG1A 4RYAA 5AA2A 2Z8DA 4ZE8A 4KYDA 4U4XA 3OO7A 3IOWA 3OXNA 1B3LA 1AOVA 1Z7ME 3FJ7A 1LB8A 2IA4A 1US4A 3VFJA 3ZKLA 5KDTA 4ZEKA 2O1LA 1FW0A 4NF4A 1CB6A 1Y1MA 3MZ9A 2A5TB 1WDNA 3UP9A 1HSEA 4FJPA 4U4SA 3N6TA 1RKMA 1MPCA 3DP6A 3K4UA 3IORA 1JNFA 3H03A 1FTKA 3Q28A 2O7IA 1UTBB 4I8CA 2DOJA 1YTVA 3W9VA 1MQDA 5EYFA 3OO9A 2A5SA 2Q2CA 2UXAA 1HSJA 1OLAA 2H25A 4YKIA 4G2ZA 3M8UA 1MQHA 3OEKA 1WVJA 4F18A 1QUKA 4QHQA 1M5DA 2VP1A 2ZMBA 3C34A 1MQIA 2ALUA 2RCBA 3KN3A 4F3GA 3HHGA 2YPNA 2O68A 3V89B 1DPEA 1AH5A 4EDPA 2O51A 3CR9A 4F2QA 1B1XA 2OLBA 1SYIA 3IOUA 1HSLA 4GL8A 3USDA 2PVUA 2NXOA 1F9BA 2PYYA 3K6WA 4C1UA 3MVWA 1TFDA 4KI0E 4FEDA 5B70A 3I3VA 3K00A 4BDRA 1MY2A 4FECA 4F1VA 3FVOA 1FQBA 2O7UA 5FTHA 4R74A 1OVTA 4ZEDA 3UK4A 2HZLA 2A5TA 2I4CA 4U23A 1Z7NE 4PETA 4FIMA 5H8SA 1XVYA 3D4CA 1D9VA 3G3GA 3K6XA 4LUBA 2THIA 4MLQA 3V8XB 3TCGA 1UTBA 1B6HA 1VR5A 4ZEFA 3ECRA 3E13X 1QUIA 3VLUA 1MQGA 4RA1A 4YAHX 2ABHA 1MPDA 1P1WA 5J1DA 4M1VA 3C31A 4OERA 4JB7A 4PFTA 1B0LA 2H99A 3IJXB 3QYTA 1M5BA 1Y3QA 4LZ8A 1BKAA 4NF8A 4R2FA 2QMWA 4NWCA 3BBRA 3MC2A 1IZ1A 1FTOA 2XXVA 3C36A 4X9TA 1XT8A 3OO6A 1MXXA 2DWHA 1ATGA 4R6HA 4FAJA 1LB9A 2DYXA 3JYRA 2XXPA 1MH3A 1DMBA 1MY0A 4HTGA 2H4IA 1ZMGA 2QS4A 1P1OA 2RF1A 5TP9B 1MY4A 1S50A 1SI0A 2Y84A 2UVGA 3TCFA 3SEWA 2KLFA 1Y4TA 3TPAA 2B3FA 3T9HB 3PUZE 2DE3A 3K1MA 4LZ5A 3N6UA 1Y3NA 3RT8A 1LAGE 3CSBA 3OD7A 1US5A 3QUJA 2GHAA 3HCQA 2VHAA 3SERA 1ZLQA 5CMMA 1MXZA 1SVXB 3TUSA 1YAEA 1M5EA 2V3TA 3VLWA 2Y7PA 2OWTA 5DEXA 4MLVA 3VV5A 5TPAB 4YZZA 3PMVA 2ANJA 4TOZA 4GQOA 5DVIA 2ZYMA 5I59B 2I0CA 1VFDA 3IB2A 1N76A 3TAJA 3UORA 1JW1A 1B3FA 4G8MA 2F8DA 3DP4A 1WODA 3HHFA 3KZGA 2AYSA 4H67A 5F1QA 3B7DA 1XHYA 3OSRA 3MPKA 3O9PA 5DT6A 4R6YA 3MZBA 3MP1A 4QFKA 3FJGA 4RK9A 4OYVA 1MM7A 3G7WA 4YKKA 3THIA 2DQVA 1B3HA 4F2OA 3MP6A 4QSEA 3VDFA 1XC1A 1POY1 4H8JA 5TP9A 5I58B 5KZTA 1TT1A 4GF8A 4BDLA 5HBCA 2UYEA 3B6QA 3OMBA 1NH7A 3PUVE 3RNNA 2BJJX 3IAZA 3HV1A 4H5GA 2O6AA 3B6TA 1B52A 3QXMA 3MZ1A 1OMPA 1B5JA 3FZVA 1MY1A 4MBPA 4JXIA 1N84A 3EHTA 2GRVA 3H6VA 3LUYA 4P0IA 5DVJA 4R9FA 1JQFA 4QRZA 4F19A 2GFEA 5KCJB 3K6VA 4G8NA 5TPAA 1LFIA 4TLMB 4YB6A 2ZYKA 3PUWE 2P0SA 1ZKBA 4OEVA 3PGFA 3F11A 5I59A 2OJTA 2IEEA 1FQFA 3H3GA 4KCCA 4XIGQ 2Z23A 4F3PA 3H4ZA 3SEVA 3U94A 2I3WA 3A3CA 2DS9A 2D5WA 1EZ9A 1LAHE 2QJEA 3DLNA 3FVKA 2HXWA 2I3VA 1H44A 3M3KA 4DIGA 3E3KA 1DOTA 1Y1ZA 4IO6A 1I69A 1LGBC 1GGGA 4IO4A 4LVQA 2XX8A 1FTJA 2PBWA 4IO2A 5L8DA 2HEUA 3EPEA 4OZ9A 1OVBA 3Q25A 4KHZE 4UA8A 2AL5A 3RUMA 3TDJA 2I48A 1Y4CA 4K3FA 2V84A 2UYFA 4WEPA 3CG3A 4KCDA 2H9BA 4ISUA 3IOTA 5JTYB 3IJOB 4G68B 4R2BA 1NMUA 3IO6A 1SQYA 3PPOA 1NNPA 3KOTA 1IQ7A 1NKXA 1VFEA 4ZS9A 1MXYA 5TU0A 4EQBA 3L6GA 5A5XA 4XKRA 1N3WA 3T9VA 2QSXA 5KCJA 2NUVA 4WKMA 2R9JA 3KG2A 2D21A 1QKAA 4EF2A 3TYHA 3VXBA 2RC7A 1H76A 1SBPA 2OWSA 3TQLA 3K01A 3TQWA 1O7TA 4NMYA 4YU0A 3Q29A 1MPBA 2ESNA 1D3KA 3O6HA 4EQ7A 1NNFA 3W9WA 4H5FA 2E1SA 1DTZA 3IOVA 4BDOA 4OFJA 2Q88A 2DP8A 3HO7A 2HQ0A 2P1SA 3LC8A 1B9JA 3RGYA 3PUXE 3CI8A 4KYEA 1PBPA 4OWDA 3U93A 5CBSA 5AE4A 4NF8B 1USYE 3LBSA 2FA7A 4O3AA 1OLCA 1UTHA 4L17A 1AIVA 2F97A 4IGTA 4U2RA 4F31B 5BWJA 4HCYA 1B4HA 3I5OA 1B40A 5JTYA 5H8HA 4G68A 4AQ4A 2DSFA 2X7PA 4OXVA 1NNKA 4EF1A 1DPPA 4LQ5A 3T66A 4O3BA 1GR2A 1LCTA 1MXUA 1R9LA 1FQCA 2Q9TA 4KPTA 2F35A 2RC9A 4F29A 3QAXA 3TCHA 1SW1A 2PX1A 2I49A 4IY5A 2DWAA 1N0TA 1B46A 3TKDA 3RPWA 2HCAA 4PP0A 3Q27A 4XKPA 4YKJA 4C0RA 4OHNA 2RC8A 3FJMA 4YB7A 5DEXB 3DM0A 3TTRA 3L6HA 2HAVA 2P2AA 1LFGA 1ZJLA 3N5LA 2ZXTA 4I62A 4JBZA 1A40A 5DYHA 4HW8A 2RKMA 2AL4A 1B58A 3MWBA 4F1UA 1B51A 4QFPA 1RYXA 3FVNA 4QF9A 4HCWA 1XOCA 3GXAA 3VVEA 3M3LA 4G68C 3R26A 1NL5A 1JETA 4ESXA 4ELPA 3TTKA 3S9MC 1SI1A 2YJPA 4PFWA 4F39A 4H1XA 2XD2A 2XHDA 3PMWA 4GLIA 1IXHA 3MW0A 1JEVA 2HZKA 2F78A 2R6GE 3UIFA 1POTA 2Y7KA 3OENA 3TMGA 4YB5A 2OK2A 4WEDA 4JWYA 1Q1KA 3MVXA 4P0GA 4RK2A 4GXSB 4MFIA 2YLNA 2F7AA 4NE4A 2ZNSA 3CFXA 4PFYA 1PC3A 4BDQA 2UVHA 4RY1A 1IUDA 1ZIUA 3ZKKA 2H98A 1MQJA 2Q89A 3BFUA 4DXBA 4GL0A 2Y7WA 3MPLA 4UACA 3FXRA 4G4PA 1NFTA 1QJMA 1NH8A 4MF3A 4OFLA 3BFTA 3PMXA 2F7BA 2DXYA 2XX9A 3MJNA 4EXKA 1R9QA 3OEMA 1VE4A 3ZSFA 3G3KA 4GXAA 3EHSA 2HAUA 1KWHA 4JDFA 3FD3A 3A3UA 1IXIA 1MDQA 1UIUA 3MP8A 2DXRA 2VD2A 4DLDA 3S9EA 2NOOA 3GZGA 2NWJA 1A8FA 4GIZA 3MVYA 3EN3A 4U22A 1NNTA 1M5CA 4R72A 1GTKA 3MBPA 1FTMA 1N7XA 4ZZAA 1UIVA 3KJ7A 2I4BA 2H5YA 5CMKA 3IR1A 5B7DA 1B3EA 4YKPA 3HPIA 3RY3A 2OZZA 1URGA 1J1NA 4Q5TA 2GH9A 2ZNTA 4R6KA 3RN8A 3LSFB 2QS2A 4LA9A 3O29A 3V5AA 3CVGA 2B3BA 3S2VA 3LR1A 4IY6A 4LONB 1H43A 3E9XA 3RLFE 3TELA 4HS7A 1OQGA 3KJTA 2LAOA 3C32A 1EZPA 3S9LC 1PB7A 1IITA 5AA4B 3O6GA 4H65A 1QW0A 2ONRA 5ICTA 1IIWA 3MAMA 3SEUA 4GVOA 2XXRA 2F6PA 2UVJA 4OFOA 4DE8A 4IO7A 1N3XA 1YCJA 5CRYA 4NF5A 4OVJA 4FORA 2X7QA 4PFUA 1PEBA 2RINA 5FHMA 1XS5A 3ILTB 3TEPA 4DCXA 5A5XB 4PQJA 1B7HA 1LAFE 5L9SA 2Z8FA 3OO8A 2DE2A 3LSXA 1BTJA 5H8NB 3O66A 2GHBA 4IO3A 1I6BA 3KFMA 5AA3A 1SD3A 3E4RA 4KFQA 2I6EA 3CIJA 2CZLA 1MH4A 4GOTA 1MDP1 3LSWA 5ELVA 1EH3A 2F6GA 3B6WA 4ZEBA 1QKBA 4NTLA 3DP8A 2Z22A 3QUFA 3FVGA 2PT1A 4FE8A 4ZECA 2VD3A 5EHSA 3OOAA 2XXHA 3G3FA 1DTGA 3DELB 2XXQA 1B4ZA 1JVYA 1O63A 1DSNA 1B5IA 1LAXA 4KYSA 5I57A 5DVFA 2Y7IA 1SW5A 3ZS6A 4QFOA 4EXLA 3OSQA 2XXUA 3N94A 5JEIA 3P7IA 4H6DA 2XXIA 4ELRA 5K2YA 4P11A 4ONYA 3C33A 5AA1A 3V83A 2FYIA 3RQTA 2I58A 5AA4A 1UTHB 3FXUA 3IL1B 3QK6A 3VLVA 3C4MA 3CSGA 1JVXA 2XXWA 5FHOA 5H8HB 1O64A 1A55A 4ESWA 3SESA 4OETA 3K02A 1A8EA 1ANFA 4F3BA 3O97A 4OQOA 4XKQA 1B1HA 1URSA 2Y7RA 4PE5B 5H8FB 5CM6A 1P1NA 1TWYA 4X48A 2QPQA 5HPQA 3SDFA 4I9DA 5H8NA 1H3DA 5CMBA 1B05A 1D4NA 3IB0A 4Q30B 1Y20A 1YPNA 1P99A 4YICA 3CRBA 2F36A 3T9XB 3RTFB 3RT6B 4POWA 5CI5A 3PPQA 5BUUA 3H6UA 1Q35A 2HFBA 4RJZA 4BLAA 2QMXA 1ZU0A 4F3SA 4N13A 1BP5A 5IAIA 3CFLA 4KD5A 2ZYNA 5AA2D 1B7UA 4F22A 4U21A 4IGRA 3GBBA 3IK6B 1Y3PA 4FEBA 4Q0CA 4DXCA 1AL3A 3R6UA 2DWJA 3S4UA 3UA8A 2PT2A 1S7YA 5M2VA 3H7MA 2D3IA 1EZOA 2XD3A 4POXA 5K2XA 4LATA 3H6WA 2RCAA 1TXFA 1A54A 1OQHA 1FQEA 3C35A 4QFNA 3TTMA 2ZNUA 4NF6B 3S9NC 4M4GA 5L9OA 5ITOA 1VSOA 1LFHA 4R73A 1II5A 2Z8EA 1MXVA 2UVIA 1QUJA 1SDXA 5I2KB 2I0BA 4ELOA 1D9YA 1N04A 5H8FA 3KN8A 4R9GA 2F34A 3JV9A 3AXFA 4X1BA 4F1YA 3IB1A 4OTEA 4NEDA 2XXTA 4OMBA 1MM6A 2AIXA 2REJA 4OENA 3MUQA 4TQUQ 3WAFA 4H8IA 3G3IA 2V3UA 1B3GA 4U1OA 2Q2AA 4ECFA 3T22A 1UQWA 4QSDA 1URDA 4GFRA 3SKPA 3GBAA 3KOSA 4E0WA 3HSTA 1CE2A 4N6PA 3T96B 2VOZA 1B32A 2PMSA 3O6IA 1A99A 3Q26A 5ISUA 1R6ZA 2V3QA 1LLSA 3EHUA 4ELQA 5ITPA 2DWIA 2V93A 3PD9A 4DDDA 4I1DA 3K1PA 1A7LA 4LZ7A 5I56B 5FHNA 1H45A 1P1UA 3A09A 3PPNA 1SW4A 4THIA 1LCFA 4EQ9A 4BDMA 5F7VA 2O1MA 3T93B 1I6QA 3U92A 4YMBA 2G29A 4N07A 3K2DA 4NF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EHM A;  3FGS A;  4XXU A;  2QS1 A;  4OEU A;  3K6U A;  4R75 A;  3IO4 A;  1QUL A;  3KBR A;  1PB9 A;  3KSX A;  1LST A;  5I2K A;  4JSO A;  3U1O A;  5I84 A;  1B7Z A;  3EQ1 A;  4WXJ A;  3KGC A;  3TFL A;  4JWO A;  4O3C A;  3D4G A;  3WAE A;  4C1T A;  4Z0I A;  3MQ9 A;  4DXU A;  4NF5 B;  3IX1 A;  1MXW A;  4JSD A;  5H8Q B;  4RXL A;  4GD5 A;  2NVU B;  4X1D A;  3TOD A;  1T0K A;  1XVX A;  5CMC A;  2X26 A;  2CMO A;  1PBQ A;  3I6V A;  2XXX A;  1FQA A;  2FNC A;  3VE1 B;  2OBG A;  3VXC A;  4JWX A;  1MRP A;  3BKI B;  1FCK A;  3UGW A;  4E0X A;  4IO5 A;  2F7C A;  3PD8 A;  2OCU A;  1JW4 A;  3SEX A;  3OEL A;  4LQ2 A;  3RTW B;  1N7W A;  1EU8 A;  1B5H A;  3FUZ A;  4IB2 A;  4XTC Q;  4ND9 A;  4ZE9 A;  1RYO A;  3H06 B;  2F5X A;  2M8C A;  1FQD A;  5I56 A;  5L9M A;  1AMF A;  3FV2 A;  1ELJ A;  4KQP A;  2QS3 A;  2XXY A;  3TZA A;  4RPN A;  5I57 B;  1P1Q A;  3MVZ A;  3EF7 A;  4ZZE A;  4AB5 A;  1IEJ A;  2Q8J A;  1MY3 A;  3U8Q A;  1R1N A;  5I2N B;  3M3F A;  4G8H A;  4DCY A;  3KSJ A;  4RPO A;  2B65 A;  1GV8 A;  5LOM A;  2O69 A;  3PV0 E;  2DVC A;  3GLB A;  3N26 A;  1I6A A;  2XX7 A;  3VVD A;  3VVF A;  4U1Z A;  1IXG A;  5ICQ A;  2QL3 A;  3PU5 A;  3K0V A;  3O2A A;  3G3J A;  3LSL A;  2QRY A;  1IXC A;  5IKB A;  1S9T A;  4XKN A;  4Z7E A;  3KN7 A;  3FIR A;  1SYH A;  5H8Q A;  1TFA A;  3HN0 A;  2W7Y A;  3PUY E;  4YMA A;  3R7X A;  3CG1 A;  3ODB A;  4Q8R A;  1SW2 A;  2ONS A;  5AA2 B;  3FXQ A;  4BDN A;  3SET A;  4OES A;  3UN6 A;  2E0S A;  1OIB A;  5CC2 A;  1PB8 A;  3FAS A;  4AB6 A;  3H6T A;  2VGQ A;  2WKY A;  5DTB A;  3TTL A;  5KDT B;  4FAT A;  1BLF A;  1MS7 A;  1JEU A;  4NF4 B;  4QFL A;  1BIY A;  1L5T A;  3O28 A;  2O84 X;  4GWO A;  3QIM A;  2REG A;  5HM4 B;  3W15 C;  1ZBM A;  1PDA A;  4EUO A;  1B0H A;  3ILU B;  4H0W A;  2ZYO A;  3G3H A;  2R71 A;  4LP2 B;  4ZDM A;  5JK4 A;  3FV1 A;  3FAT A;  4GRK A;  2ONK E;  1JW5 A;  3K1N A;  5I2N A;  4MH5 A;  4NWD A;  4RNS A;  3QSL A;  4DZ1 A;  3CFZ A;  5FTI A;  1LBC A;  1QVS A;  3KEI A;  3T9U A;  1M5F A;  4ZEI A;  3PPP A;  3TTN A;  3C9H A;  5CBR A;  3U72 A;  2G93 A;  5I58 A;  3SEY A;  4TLL B;  1GVC A;  1USY H;  1Y9U A;  1LBB A;  3ONM A;  1B2H A;  4KR5 A;  1FTL A;  2V25 A;  4G77 A;  2DE4 A;  4QSC A;  3JZJ A;  1ZTY A;  3PPR A;  2DVZ A;  1MG1 A;  4RYA A;  5AA2 A;  2Z8D A;  4ZE8 A;  4KYD A;  4U4X A;  3OO7 A;  3IOW A;  3OXN A;  1B3L A;  1AOV A;  1Z7M E;  3FJ7 A;  1LB8 A;  2IA4 A;  1US4 A;  3VFJ A;  3ZKL A;  5KDT A;  4ZEK A;  2O1L A;  1FW0 A;  4NF4 A;  1CB6 A;  1Y1M A;  3MZ9 A;  2A5T B;  1WDN A;  3UP9 A;  1HSE A;  4FJP A;  4U4S A;  3N6T A;  1RKM A;  1MPC A;  3DP6 A;  3K4U A;  3IOR A;  1JNF A;  3H03 A;  1FTK A;  3Q28 A;  2O7I A;  1UTB B;  4I8C A;  2DOJ A;  1YTV A;  3W9V A;  1MQD A;  5EYF A;  3OO9 A;  2A5S A;  2Q2C A;  2UXA A;  1HSJ A;  1OLA A;  2H25 A;  4YKI A;  4G2Z A;  3M8U A;  1MQH A;  3OEK A;  1WVJ A;  4F18 A;  1QUK A;  4QHQ A;  1M5D A;  2VP1 A;  2ZMB A;  3C34 A;  1MQI A;  2ALU A;  2RCB A;  3KN3 A;  4F3G A;  3HHG A;  2YPN A;  2O68 A;  3V89 B;  1DPE A;  1AH5 A;  4EDP A;  2O51 A;  3CR9 A;  4F2Q A;  1B1X A;  2OLB A;  1SYI A;  3IOU A;  1HSL A;  4GL8 A;  3USD A;  2PVU A;  2NXO A;  1F9B A;  2PYY A;  3K6W A;  4C1U A;  3MVW A;  1TFD A;  4KI0 E;  4FED A;  5B70 A;  3I3V A;  3K00 A;  4BDR A;  1MY2 A;  4FEC A;  4F1V A;  3FVO A;  1FQB A;  2O7U A;  5FTH A;  4R74 A;  1OVT A;  4ZED A;  3UK4 A;  2HZL A;  2A5T A;  2I4C A;  4U23 A;  1Z7N E;  4PET A;  4FIM A;  5H8S A;  1XVY A;  3D4C A;  1D9V A;  3G3G A;  3K6X A;  4LUB A;  2THI A;  4MLQ A;  3V8X B;  3TCG A;  1UTB A;  1B6H A;  1VR5 A;  4ZEF A;  3ECR A;  3E13 X;  1QUI A;  3VLU A;  1MQG A;  4RA1 A;  4YAH X;  2ABH A;  1MPD A;  1P1W A;  5J1D A;  4M1V A;  3C31 A;  4OER A;  4JB7 A;  4PFT A;  1B0L A;  2H99 A;  3IJX B;  3QYT A;  1M5B A;  1Y3Q A;  4LZ8 A;  1BKA A;  4NF8 A;  4R2F A;  2QMW A;  4NWC A;  3BBR A;  3MC2 A;  1IZ1 A;  1FTO A;  2XXV A;  3C36 A;  4X9T A;  1XT8 A;  3OO6 A;  1MXX A;  2DWH A;  1ATG A;  4R6H A;  4FAJ A;  1LB9 A;  2DYX A;  3JYR A;  2XXP A;  1MH3 A;  1DMB A;  1MY0 A;  4HTG A;  2H4I A;  1ZMG A;  2QS4 A;  1P1O A;  2RF1 A;  5TP9 B;  1MY4 A;  1S50 A;  1SI0 A;  2Y84 A;  2UVG A;  3TCF A;  3SEW A;  2KLF A;  1Y4T A;  3TPA A;  2B3F A;  3T9H B;  3PUZ E;  2DE3 A;  3K1M A;  4LZ5 A;  3N6U A;  1Y3N A;  3RT8 A;  1LAG E;  3CSB A;  3OD7 A;  1US5 A;  3QUJ A;  2GHA A;  3HCQ A;  2VHA A;  3SER A;  1ZLQ A;  5CMM A;  1MXZ A;  1SVX B;  3TUS A;  1YAE A;  1M5E A;  2V3T A;  3VLW A;  2Y7P A;  2OWT A;  5DEX A;  4MLV A;  3VV5 A;  5TPA B;  4YZZ A;  3PMV A;  2ANJ A;  4TOZ A;  4GQO A;  5DVI A;  2ZYM A;  5I59 B;  2I0C A;  1VFD A;  3IB2 A;  1N76 A;  3TAJ A;  3UOR A;  1JW1 A;  1B3F A;  4G8M A;  2F8D A;  3DP4 A;  1WOD A;  3HHF A;  3KZG A;  2AYS A;  4H67 A;  5F1Q A;  3B7D A;  1XHY A;  3OSR A;  3MPK A;  3O9P A;  5DT6 A;  4R6Y A;  3MZB A;  3MP1 A;  4QFK A;  3FJG A;  4RK9 A;  4OYV A;  1MM7 A;  3G7W A;  4YKK A;  3THI A;  2DQV A;  1B3H A;  4F2O A;  3MP6 A;  4QSE A;  3VDF A;  1XC1 A;  1POY 1;  4H8J A;  5TP9 A;  5I58 B;  5KZT A;  1TT1 A;  4GF8 A;  4BDL A;  5HBC A;  2UYE A;  3B6Q A;  3OMB A;  1NH7 A;  3PUV E;  3RNN A;  2BJJ X;  3IAZ A;  3HV1 A;  4H5G A;  2O6A A;  3B6T A;  1B52 A;  3QXM A;  3MZ1 A;  1OMP A;  1B5J A;  3FZV A;  1MY1 A;  4MBP A;  4JXI A;  1N84 A;  3EHT A;  2GRV A;  3H6V A;  3LUY A;  4P0I A;  5DVJ A;  4R9F A;  1JQF A;  4QRZ A;  4F19 A;  2GFE A;  5KCJ B;  3K6V A;  4G8N A;  5TPA A;  1LFI A;  4TLM B;  4YB6 A;  2ZYK A;  3PUW E;  2P0S A;  1ZKB A;  4OEV A;  3PGF A;  3F11 A;  5I59 A;  2OJT A;  2IEE A;  1FQF A;  3H3G A;  4KCC A;  4XIG Q;  2Z23 A;  4F3P A;  3H4Z A;  3SEV A;  3U94 A;  2I3W A;  3A3C A;  2DS9 A;  2D5W A;  1EZ9 A;  1LAH E;  2QJE A;  3DLN A;  3FVK A;  2HXW A;  2I3V A;  1H44 A;  3M3K A;  4DIG A;  3E3K A;  1DOT A;  1Y1Z A;  4IO6 A;  1I69 A;  1LGB C;  1GGG A;  4IO4 A;  4LVQ A;  2XX8 A;  1FTJ A;  2PBW A;  4IO2 A;  5L8D A;  2HEU A;  3EPE A;  4OZ9 A;  1OVB A;  3Q25 A;  4KHZ E;  4UA8 A;  2AL5 A;  3RUM A;  3TDJ A;  2I48 A;  1Y4C A;  4K3F A;  2V84 A;  2UYF A;  4WEP A;  3CG3 A;  4KCD A;  2H9B A;  4ISU A;  3IOT A;  5JTY B;  3IJO B;  4G68 B;  4R2B A;  1NMU A;  3IO6 A;  1SQY A;  3PPO A;  1NNP A;  3KOT A;  1IQ7 A;  1NKX A;  1VFE A;  4ZS9 A;  1MXY A;  5TU0 A;  4EQB A;  3L6G A;  5A5X A;  4XKR A;  1N3W A;  3T9V A;  2QSX A;  5KCJ A;  2NUV A;  4WKM A;  2R9J A;  3KG2 A;  2D21 A;  1QKA A;  4EF2 A;  3TYH A;  3VXB A;  2RC7 A;  1H76 A;  1SBP A;  2OWS A;  3TQL A;  3K01 A;  3TQW A;  1O7T A;  4NMY A;  4YU0 A;  3Q29 A;  1MPB A;  2ESN A;  1D3K A;  3O6H A;  4EQ7 A;  1NNF A;  3W9W A;  4H5F A;  2E1S A;  1DTZ A;  3IOV A;  4BDO A;  4OFJ A;  2Q88 A;  2DP8 A;  3HO7 A;  2HQ0 A;  2P1S A;  3LC8 A;  1B9J A;  3RGY A;  3PUX E;  3CI8 A;  4KYE A;  1PBP A;  4OWD A;  3U93 A;  5CBS A;  5AE4 A;  4NF8 B;  1USY E;  3LBS A;  2FA7 A;  4O3A A;  1OLC A;  1UTH A;  4L17 A;  1AIV A;  2F97 A;  4IGT A;  4U2R A;  4F31 B;  5BWJ A;  4HCY A;  1B4H A;  3I5O A;  1B40 A;  5JTY A;  5H8H A;  4G68 A;  4AQ4 A;  2DSF A;  2X7P A;  4OXV A;  1NNK A;  4EF1 A;  1DPP A;  4LQ5 A;  3T66 A;  4O3B A;  1GR2 A;  1LCT A;  1MXU A;  1R9L A;  1FQC A;  2Q9T A;  4KPT A;  2F35 A;  2RC9 A;  4F29 A;  3QAX A;  3TCH A;  1SW1 A;  2PX1 A;  2I49 A;  4IY5 A;  2DWA A;  1N0T A;  1B46 A;  3TKD A;  3RPW A;  2HCA A;  4PP0 A;  3Q27 A;  4XKP A;  4YKJ A;  4C0R A;  4OHN A;  2RC8 A;  3FJM A;  4YB7 A;  5DEX B;  3DM0 A;  3TTR A;  3L6H A;  2HAV A;  2P2A A;  1LFG A;  1ZJL A;  3N5L A;  2ZXT A;  4I62 A;  4JBZ A;  1A40 A;  5DYH A;  4HW8 A;  2RKM A;  2AL4 A;  1B58 A;  3MWB A;  4F1U A;  1B51 A;  4QFP A;  1RYX A;  3FVN A;  4QF9 A;  4HCW A;  1XOC A;  3GXA A;  3VVE A;  3M3L A;  4G68 C;  3R26 A;  1NL5 A;  1JET A;  4ESX A;  4ELP A;  3TTK A;  3S9M C;  1SI1 A;  2YJP A;  4PFW A;  4F39 A;  4H1X A;  2XD2 A;  2XHD A;  3PMW A;  4GLI A;  1IXH A;  3MW0 A;  1JEV A;  2HZK A;  2F78 A;  2R6G E;  3UIF A;  1POT A;  2Y7K A;  3OEN A;  3TMG A;  4YB5 A;  2OK2 A;  4WED A;  4JWY A;  1Q1K A;  3MVX A;  4P0G A;  4RK2 A;  4GXS B;  4MFI A;  2YLN A;  2F7A A;  4NE4 A;  2ZNS A;  3CFX A;  4PFY A;  1PC3 A;  4BDQ A;  2UVH A;  4RY1 A;  1IUD A;  1ZIU A;  3ZKK A;  2H98 A;  1MQJ A;  2Q89 A;  3BFU A;  4DXB A;  4GL0 A;  2Y7W A;  3MPL A;  4UAC A;  3FXR A;  4G4P A;  1NFT A;  1QJM A;  1NH8 A;  4MF3 A;  4OFL A;  3BFT A;  3PMX A;  2F7B A;  2DXY A;  2XX9 A;  3MJN A;  4EXK A;  1R9Q A;  3OEM A;  1VE4 A;  3ZSF A;  3G3K A;  4GXA A;  3EHS A;  2HAU A;  1KWH A;  4JDF A;  3FD3 A;  3A3U A;  1IXI A;  1MDQ A;  1UIU A;  3MP8 A;  2DXR A;  2VD2 A;  4DLD A;  3S9E A;  2NOO A;  3GZG A;  2NWJ A;  1A8F A;  4GIZ A;  3MVY A;  3EN3 A;  4U22 A;  1NNT A;  1M5C A;  4R72 A;  1GTK A;  3MBP A;  1FTM A;  1N7X A;  4ZZA A;  1UIV A;  3KJ7 A;  2I4B A;  2H5Y A;  5CMK A;  3IR1 A;  5B7D A;  1B3E A;  4YKP A;  3HPI A;  3RY3 A;  2OZZ A;  1URG A;  1J1N A;  4Q5T A;  2GH9 A;  2ZNT A;  4R6K A;  3RN8 A;  3LSF B;  2QS2 A;  4LA9 A;  3O29 A;  3V5A A;  3CVG A;  2B3B A;  3S2V A;  3LR1 A;  4IY6 A;  4LON B;  1H43 A;  3E9X A;  3RLF E;  3TEL A;  4HS7 A;  1OQG A;  3KJT A;  2LAO A;  3C32 A;  1EZP A;  3S9L C;  1PB7 A;  1IIT A;  5AA4 B;  3O6G A;  4H65 A;  1QW0 A;  2ONR A;  5ICT A;  1IIW A;  3MAM A;  3SEU A;  4GVO A;  2XXR A;  2F6P A;  2UVJ A;  4OFO A;  4DE8 A;  4IO7 A;  1N3X A;  1YCJ A;  5CRY A;  4NF5 A;  4OVJ A;  4FOR A;  2X7Q A;  4PFU A;  1PEB A;  2RIN A;  5FHM A;  1XS5 A;  3ILT B;  3TEP A;  4DCX A;  5A5X B;  4PQJ A;  1B7H A;  1LAF E;  5L9S A;  2Z8F A;  3OO8 A;  2DE2 A;  3LSX A;  1BTJ A;  5H8N B;  3O66 A;  2GHB A;  4IO3 A;  1I6B A;  3KFM A;  5AA3 A;  1SD3 A;  3E4R A;  4KFQ A;  2I6E A;  3CIJ A;  2CZL A;  1MH4 A;  4GOT A;  1MDP 1;  3LSW A;  5ELV A;  1EH3 A;  2F6G A;  3B6W A;  4ZEB A;  1QKB A;  4NTL A;  3DP8 A;  2Z22 A;  3QUF A;  3FVG A;  2PT1 A;  4FE8 A;  4ZEC A;  2VD3 A;  5EHS A;  3OOA A;  2XXH A;  3G3F A;  1DTG A;  3DEL B;  2XXQ A;  1B4Z A;  1JVY A;  1O63 A;  1DSN A;  1B5I A;  1LAX A;  4KYS A;  5I57 A;  5DVF A;  2Y7I A;  1SW5 A;  3ZS6 A;  4QFO A;  4EXL A;  3OSQ A;  2XXU A;  3N94 A;  5JEI A;  3P7I A;  4H6D A;  2XXI A;  4ELR A;  5K2Y A;  4P11 A;  4ONY A;  3C33 A;  5AA1 A;  3V83 A;  2FYI A;  3RQT A;  2I58 A;  5AA4 A;  1UTH B;  3FXU A;  3IL1 B;  3QK6 A;  3VLV A;  3C4M A;  3CSG A;  1JVX A;  2XXW A;  5FHO A;  5H8H B;  1O64 A;  1A55 A;  4ESW A;  3SES A;  4OET A;  3K02 A;  1A8E A;  1ANF A;  4F3B A;  3O97 A;  4OQO A;  4XKQ A;  1B1H A;  1URS A;  2Y7R A;  4PE5 B;  5H8F B;  5CM6 A;  1P1N A;  1TWY A;  4X48 A;  2QPQ A;  5HPQ A;  3SDF A;  4I9D A;  5H8N A;  1H3D A;  5CMB A;  1B05 A;  1D4N A;  3IB0 A;  4Q30 B;  1Y20 A;  1YPN A;  1P99 A;  4YIC A;  3CRB A;  2F36 A;  3T9X B;  3RTF B;  3RT6 B;  4POW A;  5CI5 A;  3PPQ A;  5BUU A;  3H6U A;  1Q35 A;  2HFB A;  4RJZ A;  4BLA A;  2QMX A;  1ZU0 A;  4F3S A;  4N13 A;  1BP5 A;  5IAI A;  3CFL A;  4KD5 A;  2ZYN A;  5AA2 D;  1B7U A;  4F22 A;  4U21 A;  4IGR A;  3GBB A;  3IK6 B;  1Y3P A;  4FEB A;  4Q0C A;  4DXC A;  1AL3 A;  3R6U A;  2DWJ A;  3S4U A;  3UA8 A;  2PT2 A;  1S7Y A;  5M2V A;  3H7M A;  2D3I A;  1EZO A;  2XD3 A;  4POX A;  5K2X A;  4LAT A;  3H6W A;  2RCA A;  1TXF A;  1A54 A;  1OQH A;  1FQE A;  3C35 A;  4QFN A;  3TTM A;  2ZNU A;  4NF6 B;  3S9N C;  4M4G A;  5L9O A;  5ITO A;  1VSO A;  1LFH A;  4R73 A;  1II5 A;  2Z8E A;  1MXV A;  2UVI A;  1QUJ A;  1SDX A;  5I2K B;  2I0B A;  4ELO A;  1D9Y A;  1N04 A;  5H8F A;  3KN8 A;  4R9G A;  2F34 A;  3JV9 A;  3AXF A;  4X1B A;  4F1Y A;  3IB1 A;  4OTE A;  4NED A;  2XXT A;  4OMB A;  1MM6 A;  2AIX A;  2REJ A;  4OEN A;  3MUQ A;  4TQU Q;  3WAF A;  4H8I A;  3G3I A;  2V3U A;  1B3G A;  4U1O A;  2Q2A A;  4ECF A;  3T22 A;  1UQW A;  4QSD A;  1URD A;  4GFR A;  3SKP A;  3GBA A;  3KOS A;  4E0W A;  3HST A;  1CE2 A;  4N6P A;  3T96 B;  2VOZ A;  1B32 A;  2PMS A;  3O6I A;  1A99 A;  3Q26 A;  5ISU A;  1R6Z A;  2V3Q A;  1LLS A;  3EHU A;  4ELQ A;  5ITP A;  2DWI A;  2V93 A;  3PD9 A;  4DDD A;  4I1D A;  3K1P A;  1A7L A;  4LZ7 A;  5I56 B;  5FHN A;  1H45 A;  1P1U A;  3A09 A;  3PPN A;  1SW4 A;  4THI A;  1LCF A;  4EQ9 A;  4BDM A;  5F7V A;  2O1M A;  3T93 B;  1I6Q A;  3U92 A;  4YMB A;  2G29 A;  4N07 A;  3K2D A;  4NF6 A; 
#chains in the Genus database with same CATH topology
 5EHM A;  3FGS A;  4XXU A;  4X04 A;  2QS1 A;  4OEU A;  5EQ7 A;  3K6U A;  4R75 A;  3IO4 A;  3KC1 A;  1QUL A;  3KBR A;  1EYJ A;  1PB9 A;  1LBW A;  3KSX A;  4OVT A;  1LST A;  5I2K A;  4JSO A;  3U1O A;  5I84 A;  1FRP A;  1B7Z A;  3EQ1 A;  4WXJ A;  3KGC A;  3TFL A;  4JWO A;  4O3C A;  3D4G A;  3WAE A;  4C1T A;  4Z0I A;  3MQ9 A;  5EYG A;  4DXU A;  4NF5 B;  2PFZ A;  3IX1 A;  4P56 A;  1MXW A;  4JSD A;  5H8Q B;  4RXL A;  4GD5 A;  2NVU B;  4X1D A;  1FPI A;  1XI6 A;  4NGU A;  3TOD A;  1T0K A;  1XVX A;  5CMC A;  2X26 A;  1FPB A;  4AS4 A;  2CMO A;  1PBQ A;  3I6V A;  2XXX A;  1FQA A;  2FNC A;  3VE1 B;  2OBG A;  3VXC A;  4JWX A;  1MRP A;  3BKI B;  1FCK A;  3UGW A;  4E0X A;  4IO5 A;  4PGN A;  4P47 A;  2F7C A;  3PD8 A;  2OCU A;  1JW4 A;  3SEX A;  3OEL A;  4LQ2 A;  3RTW B;  1N7W A;  1EU8 A;  1B5H A;  3FUZ A;  4IB2 A;  4XTC Q;  4ND9 A;  4ZE9 A;  1RYO A;  3H06 B;  2F5X A;  2M8C A;  1FQD A;  5I56 A;  5L9M A;  1AMF A;  3FV2 A;  1ELJ A;  4KQP A;  2QS3 A;  2XXY A;  3TZA A;  4RPN A;  1INP A;  5I57 B;  4HE2 A;  1P1Q A;  3MVZ A;  3EF7 A;  4ZZE A;  4AB5 A;  1IEJ A;  2Q8J A;  2HPG A;  1MY3 A;  3U8Q A;  1FTA A;  1R1N A;  5I2N B;  3M3F A;  4G8H A;  4DCY A;  4O8M A;  3KSJ A;  4RPO A;  2B65 A;  1GV8 A;  5LOM A;  2O69 A;  3PV0 E;  2DVC A;  3GLB A;  3N26 A;  1I6A A;  2XX7 A;  3VVD A;  3VVF A;  4U1Z A;  3ROJ A;  1IXG A;  5ICQ A;  4PTK A;  2QL3 A;  3PU5 A;  3K0V A;  3O2A A;  1NV5 A;  3G3J A;  3LSL A;  2QRY A;  1IXC A;  5IKB A;  1S9T A;  4XKN A;  4Z7E A;  1K9Y A;  3KN7 A;  3FIR A;  1SYH A;  5H8Q A;  1TFA A;  3HN0 A;  5I3S A;  2W7Y A;  1FBH A;  3PUY E;  4P3L A;  4YMA A;  3R7X A;  3CG1 A;  3ODB A;  4Q8R A;  1SW2 A;  2ONS A;  5AA2 B;  3FXQ A;  3LV0 A;  4BDN A;  3SET A;  4OES A;  3UN6 A;  2E0S A;  1OIB A;  5CC2 A;  1PB8 A;  3FAS A;  4AB6 A;  3H6T A;  2VGQ A;  2WKY A;  5DTB A;  3TTL A;  5KDT B;  1RDZ A;  4FAT A;  1BLF A;  1MS7 A;  1JEU A;  4NF4 B;  4QFL A;  4P1E A;  1NV1 A;  1BIY A;  1L5T A;  3O28 A;  2O84 X;  4GWO A;  3QIM A;  2REG A;  4UAB A;  5HM4 B;  4N6K A;  2FIX A;  4NQ8 A;  3W15 C;  1ZBM A;  1PDA A;  4EUO A;  1B0H A;  4MNI A;  3ILU B;  4H0W A;  2WYP A;  2ZYO A;  3G3H A;  4MNP A;  2R71 A;  4LP2 B;  4ZDM A;  1NV3 A;  4GWZ A;  5JK4 A;  5IZZ A;  3FV1 A;  3FAT A;  4GRK A;  2ONK E;  4N4U A;  1JW5 A;  2B4M A;  2KQZ A;  3K1N A;  4PAF A;  5I2N A;  4MH5 A;  4NWD A;  4RNS A;  3QSL A;  4DZ1 A;  3CFZ A;  5FTI A;  4PAI A;  1LBC A;  1QVS A;  3KEI A;  2HXR A;  3A29 A;  4GWX A;  3T9U A;  1M5F A;  4ZEI A;  3ISP A;  3PPP A;  4O94 A;  3TTN A;  3C9H A;  1FPK A;  5CBR A;  3U72 A;  2G93 A;  2PCR A;  5I58 A;  3SEY A;  4TLL B;  1GVC A;  1USY H;  1Y9U A;  1LBB A;  3ONM A;  1B2H A;  4KR5 A;  1FTL A;  1D9Q A;  2V25 A;  4G77 A;  2DE4 A;  4QSC A;  3JZJ A;  1ZTY A;  3PPR A;  2DVZ A;  1MG1 A;  4RYA A;  5AA2 A;  2Z8D A;  4ZE8 A;  4KYD A;  4U4X A;  3OO7 A;  3IOW A;  3OXN A;  1FBE A;  5IM2 A;  1NUW A;  1B3L A;  4LN5 A;  1AOV A;  1Z7M E;  3FJ7 A;  1LB8 A;  2IA4 A;  1US4 A;  3VFJ A;  3ZKL A;  5KDT A;  4ZEK A;  2O1L A;  4H45 A;  1FW0 A;  4NF4 A;  1CB6 A;  1Y1M A;  3MZ9 A;  2A5T B;  1WDN A;  3UP9 A;  1HSE A;  4FJP A;  1G0H A;  2KR0 A;  3MST A;  2Q74 A;  4U4S A;  3N6T A;  1RKM A;  4NG7 A;  1MPC A;  3DP6 A;  5ET5 A;  4I3Y A;  3K4U A;  3IOR A;  4XFE A;  1JNF A;  3H03 A;  1FTK A;  5I7I A;  3Q28 A;  2O7I A;  1UTB B;  4I8C A;  2DOJ A;  1YTV A;  3W9V A;  1MQD A;  5EYF A;  3OO9 A;  2A5S A;  2Q2C A;  2UXA A;  1HSJ A;  1OLA A;  2H25 A;  2OWZ A;  1IMC A;  4YKI A;  4G2Z A;  3M8U A;  1MQH A;  4XF5 A;  3OEK A;  1WVJ A;  4F18 A;  1FPG A;  1QUK A;  4QHQ A;  1M5D A;  2HHM A;  2VP1 A;  1NV2 A;  2ZMB A;  3C34 A;  1MQI A;  2ALU A;  2RCB A;  4MAG A;  3KN3 A;  4F3G A;  3HHG A;  2YPN A;  2O68 A;  3V89 B;  1DPE A;  2P3V A;  1IMD A;  4N17 A;  1AH5 A;  4EDP A;  2O51 A;  3CR9 A;  4F2Q A;  1B1X A;  2OLB A;  1SYI A;  3IOU A;  1HSL A;  4GL8 A;  3EKI A;  3USD A;  2PVU A;  2NXO A;  1F9B A;  2PYY A;  3K6W A;  4C1U A;  4AS5 A;  3MVW A;  3T1B A;  1TFD A;  3E78 A;  4KI0 E;  4FED A;  5B70 A;  3I3V A;  3K00 A;  4BDR A;  1MY2 A;  4FEC A;  4F1V A;  3FVO A;  1FQB A;  2O7U A;  5FTH A;  1FBP A;  4R74 A;  1OVT A;  4ZED A;  3UK4 A;  2HZL A;  2A5T A;  2CZI A;  1LBY A;  2I4C A;  2QVV A;  4U23 A;  3T0J A;  2OX3 A;  1Z7N E;  4PET A;  4FIM A;  5H8S A;  5A5L A;  1XVY A;  1QGX A;  3D4C A;  1D9V A;  4GWU A;  3G3G A;  4PC9 A;  3K6X A;  4LUB A;  3KC0 A;  2THI A;  4MLQ A;  3V8X B;  3TCG A;  1UTB A;  1B6H A;  1VR5 A;  4ZEF A;  1IME A;  4NN3 A;  3ECR A;  3E13 X;  1QUI A;  3VLU A;  1MQG A;  4PGP A;  4RA1 A;  4YAH X;  2ABH A;  1MPD A;  5F24 A;  1P1W A;  5J1D A;  4M1V A;  3C31 A;  4OER A;  4JB7 A;  4PFT A;  1B0L A;  2H99 A;  3IJX B;  3QYT A;  2CZK A;  1M5B A;  1Y3Q A;  4LZ8 A;  1BKA A;  4NF8 A;  4GX4 A;  4R2F A;  2QMW A;  4NWC A;  3BBR A;  3MC2 A;  1IZ1 A;  1FTO A;  2XXV A;  3C36 A;  4X9T A;  1XT8 A;  3OO6 A;  1MXX A;  2DWH A;  1ATG A;  4R6H A;  4FAJ A;  1LB9 A;  2DYX A;  3JYR A;  1FPF A;  2XXP A;  1MH3 A;  1DMB A;  3IFC A;  1MY0 A;  4HTG A;  2H4I A;  4NHB A;  3HFU A;  1ZMG A;  2QS4 A;  3PTY A;  1P1O A;  2RF1 A;  5TP9 B;  1MY4 A;  1S50 A;  1SI0 A;  2Y84 A;  2UVG A;  3TCF A;  3SEW A;  2KLF A;  1Y4T A;  3TPA A;  2B3F A;  3T9H B;  3PUZ E;  2DE3 A;  3K1M A;  4LZ5 A;  3N6U A;  1Y3N A;  3RT8 A;  2QFL A;  1LAG E;  3CSB A;  3OD7 A;  1US5 A;  3QUJ A;  2GHA A;  3HCQ A;  3SZP A;  4OVP A;  2VHA A;  3SER A;  1ZLQ A;  5CMM A;  1MXZ A;  1SVX B;  3TUS A;  1YAE A;  1M5E A;  2V3T A;  3VLW A;  2Y7P A;  2OWT A;  5DEX A;  4MLV A;  3VV5 A;  5TPA B;  4YZZ A;  4O7I A;  3PMV A;  2ANJ A;  4TOZ A;  4GQO A;  5DVI A;  2ZYM A;  1FJ6 A;  5I59 B;  2I0C A;  1VFD A;  3IB2 A;  4MNC A;  3E79 A;  1N76 A;  3TAJ A;  3UOR A;  1JW1 A;  1B3F A;  4G8M A;  2F8D A;  3DP4 A;  1WOD A;  3HHF A;  3KZG A;  2AYS A;  4H67 A;  4QXD A;  5F1Q A;  3B7D A;  1FJ9 A;  1XHY A;  4P9K A;  3OSR A;  3MPK A;  3O9P A;  5DT6 A;  4R6Y A;  4GWY A;  3MZB A;  3MP1 A;  4QFK A;  3FJG A;  4RK9 A;  4OYV A;  4OAN A;  1MM7 A;  3G7W A;  4YKK A;  3THI A;  4PCD A;  2DQV A;  2FVZ A;  1B3H A;  5T3J A;  4F2O A;  5LTC A;  2Y5K A;  3MP6 A;  4QSE A;  1FBG A;  3VDF A;  1XC1 A;  1POY 1;  4H8J A;  5TP9 A;  3BIG A;  5I58 B;  5KZT A;  1TT1 A;  4GF8 A;  4BDL A;  5HBC A;  2UYE A;  4PF8 A;  3B6Q A;  3OMB A;  1NH7 A;  3PUV E;  1FPL A;  3RNN A;  2BJJ X;  3IAZ A;  3HV1 A;  1JP4 A;  4H5G A;  2O6A A;  3B6T A;  1B52 A;  3QXM A;  3MZ1 A;  1OMP A;  1B5J A;  3FZV A;  1K9Z A;  1MY1 A;  4MBP A;  1NV4 A;  4JXI A;  4N8Y A;  4PAK A;  1N84 A;  3EHT A;  2GRV A;  3H6V A;  3LUY A;  4JVI A;  5ESY A;  4P0I A;  5DVJ A;  4R9F A;  1JQF A;  4QRZ A;  4F19 A;  2GFE A;  5KCJ B;  1KZ8 A;  3K6V A;  1SPI A;  4G8N A;  5TPA A;  1LFI A;  4TLM B;  4YB6 A;  2ZYK A;  3PUW E;  5EQA A;  2P0S A;  1ZKB A;  4OEV A;  3PGF A;  3F11 A;  5I59 A;  2BJI A;  2OJT A;  3RYD A;  2IEE A;  1FQF A;  1KA0 A;  3H3G A;  4KCC A;  4XIG Q;  2Z23 A;  4F3P A;  3H4Z A;  3SEV A;  3U94 A;  2I3W A;  3A3C A;  2DS9 A;  4FBP A;  2D5W A;  1EZ9 A;  1LAH E;  2QJE A;  1NV7 A;  3DLN A;  4PFR A;  3FVK A;  2HXW A;  2I3V A;  1H44 A;  3M3K A;  4DIG A;  3E3K A;  1DOT A;  1Y1Z A;  4IO6 A;  2B4L A;  1I69 A;  1LGB C;  1GGG A;  4IO4 A;  4LVQ A;  2XX8 A;  1FTJ A;  2PBW A;  4IO2 A;  2HEU A;  5L8D A;  3EPE A;  4OZ9 A;  1OVB A;  3Q25 A;  4KHZ E;  4UA8 A;  2AL5 A;  3RUM A;  4I40 A;  3TDJ A;  2I48 A;  1Y4C A;  4K3F A;  2V84 A;  2UYF A;  4WEP A;  4PBH A;  3CG3 A;  4KCD A;  2H9B A;  4HXV A;  4ISU A;  3IOT A;  1FPE A;  5JTY B;  3IJO B;  4G68 B;  4R2B A;  1NMU A;  3IO6 A;  1SQY A;  3PPO A;  1NNP A;  3KOT A;  1IQ7 A;  1NKX A;  1VFE A;  4ZS9 A;  4MJO A;  5LDZ A;  1MXY A;  5TU0 A;  4EQB A;  3L6G A;  5A5X A;  2F3D A;  4XKR A;  1N3W A;  5EQ9 A;  3T9V A;  1DCU A;  4P1L A;  2QSX A;  5KCJ A;  2NUV A;  4WKM A;  2R9J A;  3KG2 A;  2D21 A;  1QKA A;  4EF2 A;  3TYH A;  3VXB A;  2DDK A;  4HE1 A;  2RC7 A;  1IMF A;  2WBB A;  1H76 A;  1SBP A;  2OWS A;  4NAP A;  3TQL A;  3K01 A;  3TQW A;  1Q9D A;  1NUX A;  4JVC A;  3QMF A;  1O7T A;  4NMY A;  4MCO A;  4YU0 A;  4OVQ A;  3Q29 A;  1MPB A;  2ESN A;  1D3K A;  4X8R A;  4GBW A;  3O6H A;  4EQ7 A;  1NNF A;  2XA5 A;  3W9W A;  4H5F A;  2E1S A;  4DI3 D;  4PE3 A;  1DTZ A;  3IOV A;  4BDO A;  4N91 A;  1NV0 A;  4OFJ A;  2Q88 A;  2DP8 A;  3B8B A;  3HO7 A;  2HQ0 A;  2P1S A;  3LC8 A;  2ZZV A;  1B9J A;  3RGY A;  1RDY A;  3PUX E;  3CI8 A;  4KYE A;  4MEV A;  1PBP A;  4OWD A;  3U93 A;  5CBS A;  5AE4 A;  4NF8 B;  1USY E;  3LBS A;  2FA7 A;  1FSA A;  4O3A A;  1DBZ A;  1OLC A;  1UTH A;  4L17 A;  1AIV A;  2F97 A;  3FBP A;  4IGT A;  4U2R A;  4F31 B;  5BWJ A;  4HCY A;  4O7M A;  1B4H A;  3I5O A;  1B40 A;  5JTY A;  5H8H A;  4G68 A;  4AQ4 A;  2DSF A;  2X7P A;  4OXV A;  1NNK A;  4EF1 A;  3IFA A;  1DPP A;  4LQ5 A;  1IMA A;  1LBX A;  3T66 A;  4PFB A;  4O3B A;  4OVR A;  1GR2 A;  1LCT A;  1MXU A;  1R9L A;  1FQC A;  2Q9T A;  4KPT A;  1AWB A;  1FBC A;  2F35 A;  2RC9 A;  5IZ3 B;  4F29 A;  3QAX A;  3TCH A;  1SW1 A;  2PX1 A;  2I49 A;  4IY5 A;  2DWA A;  1N0T A;  1B46 A;  3FXB A;  3TKD A;  3RPW A;  2HCA A;  2CZH A;  4PP0 A;  3Q27 A;  4XKP A;  4YKJ A;  4C0R A;  3BIH A;  4OHN A;  3MYU A;  2RC8 A;  3FJM A;  4NX1 A;  4YB7 A;  4H46 A;  4GX3 A;  5DEX B;  3DM0 A;  3TTR A;  3L6H A;  2HAV A;  2P2A A;  1LFG A;  1ZJL A;  3N5L A;  2ZXT A;  4I62 A;  4JBZ A;  1A40 A;  5DYH A;  2GQ1 A;  4HW8 A;  2RKM A;  2AL4 A;  1B58 A;  3MWB A;  1NV6 A;  4NF0 A;  4F1U A;  1B51 A;  4QFP A;  1RYX A;  3FVN A;  4QF9 A;  4HCW A;  1XOC A;  3GXA A;  3VVE A;  3M3L A;  4G68 C;  3R26 A;  1NL5 A;  1JET A;  4ESX A;  4ELP A;  3TTK A;  3S9M C;  1SI1 A;  1FBD A;  2YJP A;  4PFW A;  4PDH A;  4F39 A;  4H1X A;  5ET6 A;  2XD2 A;  1NUZ A;  2XHD A;  3PMW A;  4GLI A;  1IXH A;  3MW0 A;  5I5P A;  1JEV A;  2HZK A;  2F78 A;  2R6G E;  3UIF A;  4PDD A;  2WEF A;  1POT A;  2Y7K A;  3OEN A;  3TMG A;  4YB5 A;  2OK2 A;  4WED A;  4JWY A;  1Q1K A;  3MVX A;  2ZZW A;  4P0G A;  4RK2 A;  4GXS B;  4MFI A;  2YLN A;  2F7A A;  4NE4 A;  5DW8 A;  2ZNS A;  2VPN A;  3CFX A;  4PFY A;  1PC3 A;  4BDQ A;  2UVH A;  4RY1 A;  1IUD A;  1ZIU A;  3ZKK A;  2H98 A;  5IZ3 A;  2VPO A;  1MQJ A;  2Q89 A;  3BFU A;  4DXB A;  4N8G A;  4GL0 A;  2Y7W A;  3MPL A;  4UAC A;  3FXR A;  4G4P A;  1NFT A;  1QJM A;  1NH8 A;  4MF3 A;  4OFL A;  5ET8 A;  2P3N A;  3BFT A;  3PMX A;  2F7B A;  2DXY A;  2XX9 A;  3MJN A;  5EQ8 A;  4EXK A;  1R9Q A;  3OEM A;  1VE4 A;  3ZSF A;  3G3K A;  4GXA A;  3EHS A;  2HAU A;  1KWH A;  4JDF A;  3FD3 A;  3A3U A;  2F3B A;  1IXI A;  1MDQ A;  1UIU A;  3MP8 A;  2DXR A;  2VD2 A;  4DLD A;  3S9E A;  2NOO A;  3GZG A;  2NWJ A;  1A8F A;  4GIZ A;  3MVY A;  3EN3 A;  4U22 A;  1NNT A;  1M5C A;  4R72 A;  1NUY A;  1GTK A;  3MBP A;  1FTM A;  1N7X A;  3LUZ A;  4ZZA A;  1UIV A;  3KJ7 A;  1VDW A;  2I4B A;  2H5Y A;  5CMK A;  3IR1 A;  2L5V A;  5B7D A;  1B3E A;  4YKP A;  3HPI A;  3RY3 A;  2OZZ A;  1URG A;  1J1N A;  4KXP A;  4Q5T A;  2GH9 A;  2ZNT A;  4R6K A;  3RN8 A;  3LSF B;  2XWV A;  2QS2 A;  4LA9 A;  3O29 A;  3V5A A;  3CVG A;  2B3B A;  3S2V A;  3LR1 A;  4IY6 A;  4LON B;  3NOH A;  1H43 A;  3E9X A;  3RLF E;  3TEL A;  4HS7 A;  1OQG A;  3KJT A;  2LAO A;  3C32 A;  1EZP A;  3S9L C;  2WBD A;  1PB7 A;  1IIT A;  5AA4 B;  3O6G A;  1LBZ A;  4H65 A;  1QW0 A;  2ONR A;  5ICT A;  1IIW A;  4G61 A;  3MAM A;  3SEU A;  4GVO A;  2XXR A;  2F6P A;  2UVJ A;  4OFO A;  4DE8 A;  5FBP A;  4IO7 A;  1N3X A;  1YCJ A;  5CRY A;  1G0I A;  4NF5 A;  2XWK A;  4OVJ A;  4I3E A;  4MX6 A;  4FOR A;  2X7Q A;  4PFU A;  1PEB A;  2RIN A;  5FHM A;  1EYI A;  1XS5 A;  3ILT B;  3TEP A;  4DCX A;  5A5X B;  4PQJ A;  1B7H A;  1LAF E;  5L9S A;  2Z8F A;  1FBF A;  3OO8 A;  2DE2 A;  3LSX A;  1BTJ A;  2CEX A;  5H8N B;  3O66 A;  2GHB A;  4IO3 A;  1I6B A;  1DK4 A;  3KFM A;  5AA3 A;  1SD3 A;  3E4R A;  4KFQ A;  2I6E A;  3CIJ A;  2CZL A;  1MH4 A;  2V4C A;  4GOT A;  1KA1 A;  1MDP 1;  3LSW A;  5ELV A;  1EH3 A;  2F6G A;  3B6W A;  4ZEB A;  4MIJ A;  1QKB A;  4NTL A;  3DP8 A;  2Z22 A;  3QUF A;  3FVG A;  2PT1 A;  4FE8 A;  4ZEC A;  2VD3 A;  5EHS A;  3OOA A;  2JJK A;  2XXH A;  3G3F A;  2R8T A;  1DTG A;  3DEL B;  2XXQ A;  4QBA A;  4GBV A;  1B4Z A;  1JVY A;  1O63 A;  1DSN A;  1B5I A;  1LAX A;  1YYZ A;  4KYS A;  5I57 A;  5DVF A;  2QVU A;  2Y7I A;  1SW5 A;  3ZS6 A;  4QFO A;  4EXL A;  3OSQ A;  1RDX A;  2XXU A;  3N94 A;  5JEI A;  3P7I A;  4H6D A;  2XXI A;  2ZZX A;  4ELR A;  5K2Y A;  4P11 A;  4PBQ A;  4ONY A;  3C33 A;  5AA1 A;  3V83 A;  2FYI A;  3RQT A;  2I58 A;  5AA4 A;  1UTH B;  3FXU A;  3IL1 B;  3QK6 A;  3VLV A;  5J16 A;  3RPL B;  4JVD A;  3C4M A;  2Q8M A;  3CSG A;  1JVX A;  2XXW A;  5FHO A;  3B50 A;  5H8H B;  1O64 A;  1A55 A;  4ESW A;  3SES A;  4OET A;  3K02 A;  1A8E A;  1ANF A;  2Y5L A;  4F3B A;  4GWW A;  3O97 A;  4OQO A;  4XKQ A;  1B1H A;  1URS A;  2Y7R A;  4PE5 B;  2PFY A;  5H8F B;  5CM6 A;  1P1N A;  1TWY A;  4X48 A;  4PFI A;  2QPQ A;  5HPQ A;  3SDF A;  4I9D A;  5H8N A;  4GX6 A;  1H3D A;  5CMB A;  1YXI A;  1B05 A;  1D4N A;  3IB0 A;  4Q30 B;  1Y20 A;  1YPN A;  1P99 A;  4YIC A;  3CRB A;  2F36 A;  2FIE A;  3T9X B;  3RTF B;  3RT6 B;  4POW A;  5CI5 A;  3PPQ A;  2XWI A;  5BUU A;  4OVS A;  3H6U A;  2CEY A;  1Q35 A;  2HFB A;  4RJZ A;  4BLA A;  2QMX A;  1ZU0 A;  4F3S A;  4N13 A;  1BP5 A;  4N81 A;  5IAI A;  3CFL A;  4KD5 A;  2XWO A;  2ZYN A;  5AA2 D;  1B7U A;  4F22 A;  4U21 A;  4IGR A;  3GBB A;  3IK6 B;  1Y3P A;  4FEB A;  4Q0C A;  2FBP A;  4DXC A;  1AL3 A;  3R6U A;  2MKZ A;  2DWJ A;  3S4U A;  3UA8 A;  1LBV A;  2PT2 A;  1S7Y A;  5M2V A;  1FPJ A;  1BK4 A;  3H7M A;  2D3I A;  1EZO A;  2XD3 A;  4POX A;  5K2X A;  3GYY A;  3H6W A;  4LAT A;  2RCA A;  1TXF A;  1A54 A;  1OQH A;  3D1R A;  2QVR A;  3CHG A;  4DI4 B;  1FQE A;  3C35 A;  4QFN A;  3TTM A;  2ZNU A;  2WX9 A;  3RPL A;  4NF6 B;  3S9N C;  4M4G A;  1EYK A;  5IGA A;  5L9O A;  5ITO A;  1VSO A;  1LFH A;  1LEV A;  4R73 A;  1II5 A;  2Z8E A;  5IZ1 A;  4XEQ A;  4N6D A;  1MXV A;  2UVI A;  1QUJ A;  2VT5 A;  1NI9 A;  1SDX A;  5I2K B;  2WYK A;  2I0B A;  4ELO A;  1D9Y A;  1N04 A;  5H8F A;  3KN8 A;  4R9G A;  4IR8 A;  2F34 A;  4N15 A;  3JV9 A;  3AXF A;  4X1B A;  3KBZ A;  4F1Y A;  3IB1 A;  4OTE A;  2XXK A;  1IMB A;  4NED A;  4OMB A;  2XXT A;  1MM6 A;  2AIX A;  2REJ A;  4HE0 A;  4OEN A;  3MUQ A;  4TQU Q;  3WAF A;  4H8I A;  3G3I A;  2V3U A;  1B3G A;  2FHY A;  4U1O A;  2Q2A A;  4ECF A;  3T22 A;  1UQW A;  5ET7 A;  4QSD A;  1URD A;  1CNQ A;  4GFR A;  3SKP A;  3GBA A;  3KOS A;  4E0W A;  3HST A;  1CE2 A;  4N6P A;  3T96 B;  2VOZ A;  1B32 A;  2PMS A;  3O6I A;  1A99 A;  3Q26 A;  5ISU A;  1YZ0 A;  4P8B A;  1R6Z A;  2V3Q A;  1LLS A;  3EHU A;  4ELQ A;  5ITP A;  4MMP A;  2DWI A;  2V93 A;  3PD9 A;  4DDD A;  4I1D A;  3K1P A;  1A7L A;  4LZ7 A;  5I56 B;  5FHN A;  1H45 A;  1P1U A;  3A09 A;  3PPN A;  4MHF A;  1FPD A;  1SW4 A;  4THI A;  1LCF A;  4EQ9 A;  4BDM A;  5F7V A;  2O1M A;  3T93 B;  4OA4 A;  1I6Q A;  5EYH A;  3U92 A;  4YMB A;  3U65 A;  2G29 A;  4N07 A;  4GWS A;  3K2D A;  4NF6 A;  4PF6 A; 
#chains in the Genus database with same CATH homology
 5EHM A;  3FGS A;  4XXU A;  2QS1 A;  4OEU A;  3K6U A;  4R75 A;  3IO4 A;  1QUL A;  3KBR A;  1PB9 A;  3KSX A;  1LST A;  5I2K A;  4JSO A;  3U1O A;  5I84 A;  1B7Z A;  3EQ1 A;  4WXJ A;  3KGC A;  3TFL A;  4JWO A;  4O3C A;  3D4G A;  3WAE A;  4C1T A;  4Z0I A;  3MQ9 A;  4DXU A;  4NF5 B;  3IX1 A;  1MXW A;  4JSD A;  5H8Q B;  4RXL A;  4GD5 A;  2NVU B;  4X1D A;  3TOD A;  1T0K A;  1XVX A;  5CMC A;  2X26 A;  2CMO A;  1PBQ A;  3I6V A;  2XXX A;  1FQA A;  2FNC A;  3VE1 B;  2OBG A;  3VXC A;  4JWX A;  1MRP A;  3BKI B;  1FCK A;  3UGW A;  4E0X A;  4IO5 A;  2F7C A;  3PD8 A;  2OCU A;  1JW4 A;  3SEX A;  3OEL A;  4LQ2 A;  3RTW B;  1N7W A;  1EU8 A;  1B5H A;  3FUZ A;  4IB2 A;  4XTC Q;  4ND9 A;  4ZE9 A;  1RYO A;  3H06 B;  2F5X A;  2M8C A;  1FQD A;  5I56 A;  5L9M A;  1AMF A;  3FV2 A;  1ELJ A;  4KQP A;  2QS3 A;  2XXY A;  3TZA A;  4RPN A;  5I57 B;  1P1Q A;  3MVZ A;  3EF7 A;  4ZZE A;  4AB5 A;  1IEJ A;  2Q8J A;  1MY3 A;  3U8Q A;  1R1N A;  5I2N B;  3M3F A;  4G8H A;  4DCY A;  3KSJ A;  4RPO A;  2B65 A;  1GV8 A;  5LOM A;  2O69 A;  3PV0 E;  2DVC A;  3GLB A;  3N26 A;  1I6A A;  2XX7 A;  3VVD A;  3VVF A;  4U1Z A;  1IXG A;  5ICQ A;  2QL3 A;  3PU5 A;  3K0V A;  3O2A A;  3G3J A;  3LSL A;  2QRY A;  1IXC A;  5IKB A;  1S9T A;  4XKN A;  4Z7E A;  3KN7 A;  3FIR A;  1SYH A;  5H8Q A;  1TFA A;  3HN0 A;  2W7Y A;  3PUY E;  4YMA A;  3R7X A;  3CG1 A;  3ODB A;  4Q8R A;  1SW2 A;  2ONS A;  5AA2 B;  3FXQ A;  4BDN A;  3SET A;  4OES A;  3UN6 A;  2E0S A;  1OIB A;  5CC2 A;  1PB8 A;  3FAS A;  4AB6 A;  3H6T A;  2VGQ A;  2WKY A;  5DTB A;  3TTL A;  5KDT B;  4FAT A;  1BLF A;  1MS7 A;  1JEU A;  4NF4 B;  4QFL A;  1BIY A;  1L5T A;  3O28 A;  2O84 X;  4GWO A;  3QIM A;  2REG A;  5HM4 B;  3W15 C;  1ZBM A;  1PDA A;  4EUO A;  1B0H A;  3ILU B;  4H0W A;  2ZYO A;  3G3H A;  2R71 A;  4LP2 B;  4ZDM A;  5JK4 A;  3FV1 A;  3FAT A;  4GRK A;  2ONK E;  1JW5 A;  3K1N A;  5I2N A;  4MH5 A;  4NWD A;  4RNS A;  3QSL A;  4DZ1 A;  3CFZ A;  5FTI A;  1LBC A;  1QVS A;  3KEI A;  3T9U A;  1M5F A;  4ZEI A;  3PPP A;  3TTN A;  3C9H A;  5CBR A;  3U72 A;  2G93 A;  5I58 A;  3SEY A;  4TLL B;  1GVC A;  1USY H;  1Y9U A;  1LBB A;  3ONM A;  1B2H A;  4KR5 A;  1FTL A;  2V25 A;  4G77 A;  2DE4 A;  4QSC A;  3JZJ A;  1ZTY A;  3PPR A;  2DVZ A;  1MG1 A;  4RYA A;  5AA2 A;  2Z8D A;  4ZE8 A;  4KYD A;  4U4X A;  3OO7 A;  3IOW A;  3OXN A;  1B3L A;  1AOV A;  1Z7M E;  3FJ7 A;  1LB8 A;  2IA4 A;  1US4 A;  3VFJ A;  3ZKL A;  5KDT A;  4ZEK A;  2O1L A;  1FW0 A;  4NF4 A;  1CB6 A;  1Y1M A;  3MZ9 A;  2A5T B;  1WDN A;  3UP9 A;  1HSE A;  4FJP A;  4U4S A;  3N6T A;  1RKM A;  1MPC A;  3DP6 A;  3K4U A;  3IOR A;  1JNF A;  3H03 A;  1FTK A;  3Q28 A;  2O7I A;  1UTB B;  4I8C A;  2DOJ A;  1YTV A;  3W9V A;  1MQD A;  5EYF A;  3OO9 A;  2A5S A;  2Q2C A;  2UXA A;  1HSJ A;  1OLA A;  2H25 A;  4YKI A;  4G2Z A;  3M8U A;  1MQH A;  3OEK A;  1WVJ A;  4F18 A;  1QUK A;  4QHQ A;  1M5D A;  2VP1 A;  2ZMB A;  3C34 A;  1MQI A;  2ALU A;  2RCB A;  3KN3 A;  4F3G A;  3HHG A;  2YPN A;  2O68 A;  3V89 B;  1DPE A;  1AH5 A;  4EDP A;  2O51 A;  3CR9 A;  4F2Q A;  1B1X A;  2OLB A;  1SYI A;  3IOU A;  1HSL A;  4GL8 A;  3USD A;  2PVU A;  2NXO A;  1F9B A;  2PYY A;  3K6W A;  4C1U A;  3MVW A;  1TFD A;  4KI0 E;  4FED A;  5B70 A;  3I3V A;  3K00 A;  4BDR A;  1MY2 A;  4FEC A;  4F1V A;  3FVO A;  1FQB A;  2O7U A;  5FTH A;  4R74 A;  1OVT A;  4ZED A;  3UK4 A;  2HZL A;  2A5T A;  2I4C A;  4U23 A;  1Z7N E;  4PET A;  4FIM A;  5H8S A;  1XVY A;  3D4C A;  1D9V A;  3G3G A;  3K6X A;  4LUB A;  2THI A;  4MLQ A;  3V8X B;  3TCG A;  1UTB A;  1B6H A;  1VR5 A;  4ZEF A;  3ECR A;  3E13 X;  1QUI A;  3VLU A;  1MQG A;  4RA1 A;  4YAH X;  2ABH A;  1MPD A;  1P1W A;  5J1D A;  4M1V A;  3C31 A;  4OER A;  4JB7 A;  4PFT A;  1B0L A;  2H99 A;  3IJX B;  3QYT A;  1M5B A;  1Y3Q A;  4LZ8 A;  1BKA A;  4NF8 A;  4R2F A;  2QMW A;  4NWC A;  3BBR A;  3MC2 A;  1IZ1 A;  1FTO A;  2XXV A;  3C36 A;  4X9T A;  1XT8 A;  3OO6 A;  1MXX A;  2DWH A;  1ATG A;  4R6H A;  4FAJ A;  1LB9 A;  2DYX A;  3JYR A;  2XXP A;  1MH3 A;  1DMB A;  1MY0 A;  4HTG A;  2H4I A;  1ZMG A;  2QS4 A;  1P1O A;  2RF1 A;  5TP9 B;  1MY4 A;  1S50 A;  1SI0 A;  2Y84 A;  2UVG A;  3TCF A;  3SEW A;  2KLF A;  1Y4T A;  3TPA A;  2B3F A;  3T9H B;  3PUZ E;  2DE3 A;  3K1M A;  4LZ5 A;  3N6U A;  1Y3N A;  3RT8 A;  1LAG E;  3CSB A;  3OD7 A;  1US5 A;  3QUJ A;  2GHA A;  3HCQ A;  2VHA A;  3SER A;  1ZLQ A;  5CMM A;  1MXZ A;  1SVX B;  3TUS A;  1YAE A;  1M5E A;  2V3T A;  3VLW A;  2Y7P A;  2OWT A;  5DEX A;  4MLV A;  3VV5 A;  5TPA B;  4YZZ A;  3PMV A;  2ANJ A;  4TOZ A;  4GQO A;  5DVI A;  2ZYM A;  5I59 B;  2I0C A;  1VFD A;  3IB2 A;  1N76 A;  3TAJ A;  3UOR A;  1JW1 A;  1B3F A;  4G8M A;  2F8D A;  3DP4 A;  1WOD A;  3HHF A;  3KZG A;  2AYS A;  4H67 A;  5F1Q A;  3B7D A;  1XHY A;  3OSR A;  3MPK A;  3O9P A;  5DT6 A;  4R6Y A;  3MZB A;  3MP1 A;  4QFK A;  3FJG A;  4RK9 A;  4OYV A;  1MM7 A;  3G7W A;  4YKK A;  3THI A;  2DQV A;  1B3H A;  4F2O A;  3MP6 A;  4QSE A;  3VDF A;  1XC1 A;  1POY 1;  4H8J A;  5TP9 A;  5I58 B;  5KZT A;  1TT1 A;  4GF8 A;  4BDL A;  5HBC A;  2UYE A;  3B6Q A;  3OMB A;  1NH7 A;  3PUV E;  3RNN A;  2BJJ X;  3IAZ A;  3HV1 A;  4H5G A;  2O6A A;  3B6T A;  1B52 A;  3QXM A;  3MZ1 A;  1OMP A;  1B5J A;  3FZV A;  1MY1 A;  4MBP A;  4JXI A;  1N84 A;  3EHT A;  2GRV A;  3H6V A;  3LUY A;  4P0I A;  5DVJ A;  4R9F A;  1JQF A;  4QRZ A;  4F19 A;  2GFE A;  5KCJ B;  3K6V A;  4G8N A;  5TPA A;  1LFI A;  4TLM B;  4YB6 A;  2ZYK A;  3PUW E;  2P0S A;  1ZKB A;  4OEV A;  3PGF A;  3F11 A;  5I59 A;  2OJT A;  2IEE A;  1FQF A;  3H3G A;  4KCC A;  4XIG Q;  2Z23 A;  4F3P A;  3H4Z A;  3SEV A;  3U94 A;  2I3W A;  3A3C A;  2DS9 A;  2D5W A;  1EZ9 A;  1LAH E;  2QJE A;  3DLN A;  3FVK A;  2HXW A;  2I3V A;  1H44 A;  3M3K A;  4DIG A;  3E3K A;  1DOT A;  1Y1Z A;  4IO6 A;  1I69 A;  1LGB C;  1GGG A;  4IO4 A;  4LVQ A;  2XX8 A;  1FTJ A;  2PBW A;  4IO2 A;  5L8D A;  2HEU A;  3EPE A;  4OZ9 A;  1OVB A;  3Q25 A;  4KHZ E;  4UA8 A;  2AL5 A;  3RUM A;  3TDJ A;  2I48 A;  1Y4C A;  4K3F A;  2V84 A;  2UYF A;  4WEP A;  3CG3 A;  4KCD A;  2H9B A;  4ISU A;  3IOT A;  5JTY B;  3IJO B;  4G68 B;  4R2B A;  1NMU A;  3IO6 A;  1SQY A;  3PPO A;  1NNP A;  3KOT A;  1IQ7 A;  1NKX A;  1VFE A;  4ZS9 A;  1MXY A;  5TU0 A;  4EQB A;  3L6G A;  5A5X A;  4XKR A;  1N3W A;  3T9V A;  2QSX A;  5KCJ A;  2NUV A;  4WKM A;  2R9J A;  3KG2 A;  2D21 A;  1QKA A;  4EF2 A;  3TYH A;  3VXB A;  2RC7 A;  1H76 A;  1SBP A;  2OWS A;  3TQL A;  3K01 A;  3TQW A;  1O7T A;  4NMY A;  4YU0 A;  3Q29 A;  1MPB A;  2ESN A;  1D3K A;  3O6H A;  4EQ7 A;  1NNF A;  3W9W A;  4H5F A;  2E1S A;  1DTZ A;  3IOV A;  4BDO A;  4OFJ A;  2Q88 A;  2DP8 A;  3HO7 A;  2HQ0 A;  2P1S A;  3LC8 A;  1B9J A;  3RGY A;  3PUX E;  3CI8 A;  4KYE A;  1PBP A;  4OWD A;  3U93 A;  5CBS A;  5AE4 A;  4NF8 B;  1USY E;  3LBS A;  2FA7 A;  4O3A A;  1OLC A;  1UTH A;  4L17 A;  1AIV A;  2F97 A;  4IGT A;  4U2R A;  4F31 B;  5BWJ A;  4HCY A;  1B4H A;  3I5O A;  1B40 A;  5JTY A;  5H8H A;  4G68 A;  4AQ4 A;  2DSF A;  2X7P A;  4OXV A;  1NNK A;  4EF1 A;  1DPP A;  4LQ5 A;  3T66 A;  4O3B A;  1GR2 A;  1LCT A;  1MXU A;  1R9L A;  1FQC A;  2Q9T A;  4KPT A;  2F35 A;  2RC9 A;  4F29 A;  3QAX A;  3TCH A;  1SW1 A;  2PX1 A;  2I49 A;  4IY5 A;  2DWA A;  1N0T A;  1B46 A;  3TKD A;  3RPW A;  2HCA A;  4PP0 A;  3Q27 A;  4XKP A;  4YKJ A;  4C0R A;  4OHN A;  2RC8 A;  3FJM A;  4YB7 A;  5DEX B;  3DM0 A;  3TTR A;  3L6H A;  2HAV A;  2P2A A;  1LFG A;  1ZJL A;  3N5L A;  2ZXT A;  4I62 A;  4JBZ A;  1A40 A;  5DYH A;  4HW8 A;  2RKM A;  2AL4 A;  1B58 A;  3MWB A;  4F1U A;  1B51 A;  4QFP A;  1RYX A;  3FVN A;  4QF9 A;  4HCW A;  1XOC A;  3GXA A;  3VVE A;  3M3L A;  4G68 C;  3R26 A;  1NL5 A;  1JET A;  4ESX A;  4ELP A;  3TTK A;  3S9M C;  1SI1 A;  2YJP A;  4PFW A;  4F39 A;  4H1X A;  2XD2 A;  2XHD A;  3PMW A;  4GLI A;  1IXH A;  3MW0 A;  1JEV A;  2HZK A;  2F78 A;  2R6G E;  3UIF A;  1POT A;  2Y7K A;  3OEN A;  3TMG A;  4YB5 A;  2OK2 A;  4WED A;  4JWY A;  1Q1K A;  3MVX A;  4P0G A;  4RK2 A;  4GXS B;  4MFI A;  2YLN A;  2F7A A;  4NE4 A;  2ZNS A;  3CFX A;  4PFY A;  1PC3 A;  4BDQ A;  2UVH A;  4RY1 A;  1IUD A;  1ZIU A;  3ZKK A;  2H98 A;  1MQJ A;  2Q89 A;  3BFU A;  4DXB A;  4GL0 A;  2Y7W A;  3MPL A;  4UAC A;  3FXR A;  4G4P A;  1NFT A;  1QJM A;  1NH8 A;  4MF3 A;  4OFL A;  3BFT A;  3PMX A;  2F7B A;  2DXY A;  2XX9 A;  3MJN A;  4EXK A;  1R9Q A;  3OEM A;  1VE4 A;  3ZSF A;  3G3K A;  4GXA A;  3EHS A;  2HAU A;  1KWH A;  4JDF A;  3FD3 A;  3A3U A;  1IXI A;  1MDQ A;  1UIU A;  3MP8 A;  2DXR A;  2VD2 A;  4DLD A;  3S9E A;  2NOO A;  3GZG A;  2NWJ A;  1A8F A;  4GIZ A;  3MVY A;  3EN3 A;  4U22 A;  1NNT A;  1M5C A;  4R72 A;  1GTK A;  3MBP A;  1FTM A;  1N7X A;  4ZZA A;  1UIV A;  3KJ7 A;  2I4B A;  2H5Y A;  5CMK A;  3IR1 A;  5B7D A;  1B3E A;  4YKP A;  3HPI A;  3RY3 A;  2OZZ A;  1URG A;  1J1N A;  4Q5T A;  2GH9 A;  2ZNT A;  4R6K A;  3RN8 A;  3LSF B;  2QS2 A;  4LA9 A;  3O29 A;  3V5A A;  3CVG A;  2B3B A;  3S2V A;  3LR1 A;  4IY6 A;  4LON B;  1H43 A;  3E9X A;  3RLF E;  3TEL A;  4HS7 A;  1OQG A;  3KJT A;  2LAO A;  3C32 A;  1EZP A;  3S9L C;  1PB7 A;  1IIT A;  5AA4 B;  3O6G A;  4H65 A;  1QW0 A;  2ONR A;  5ICT A;  1IIW A;  3MAM A;  3SEU A;  4GVO A;  2XXR A;  2F6P A;  2UVJ A;  4OFO A;  4DE8 A;  4IO7 A;  1N3X A;  1YCJ A;  5CRY A;  4NF5 A;  4OVJ A;  4FOR A;  2X7Q A;  4PFU A;  1PEB A;  2RIN A;  5FHM A;  1XS5 A;  3ILT B;  3TEP A;  4DCX A;  5A5X B;  4PQJ A;  1B7H A;  1LAF E;  5L9S A;  2Z8F A;  3OO8 A;  2DE2 A;  3LSX A;  1BTJ A;  5H8N B;  3O66 A;  2GHB A;  4IO3 A;  1I6B A;  3KFM A;  5AA3 A;  1SD3 A;  3E4R A;  4KFQ A;  2I6E A;  3CIJ A;  2CZL A;  1MH4 A;  4GOT A;  1MDP 1;  3LSW A;  5ELV A;  1EH3 A;  2F6G A;  3B6W A;  4ZEB A;  1QKB A;  4NTL A;  3DP8 A;  2Z22 A;  3QUF A;  3FVG A;  2PT1 A;  4FE8 A;  4ZEC A;  2VD3 A;  5EHS A;  3OOA A;  2XXH A;  3G3F A;  1DTG A;  3DEL B;  2XXQ A;  1B4Z A;  1JVY A;  1O63 A;  1DSN A;  1B5I A;  1LAX A;  4KYS A;  5I57 A;  5DVF A;  2Y7I A;  1SW5 A;  3ZS6 A;  4QFO A;  4EXL A;  3OSQ A;  2XXU A;  3N94 A;  5JEI A;  3P7I A;  4H6D A;  2XXI A;  4ELR A;  5K2Y A;  4P11 A;  4ONY A;  3C33 A;  5AA1 A;  3V83 A;  2FYI A;  3RQT A;  2I58 A;  5AA4 A;  1UTH B;  3FXU A;  3IL1 B;  3QK6 A;  3VLV A;  3C4M A;  3CSG A;  1JVX A;  2XXW A;  5FHO A;  5H8H B;  1O64 A;  1A55 A;  4ESW A;  3SES A;  4OET A;  3K02 A;  1A8E A;  1ANF A;  4F3B A;  3O97 A;  4OQO A;  4XKQ A;  1B1H A;  1URS A;  2Y7R A;  4PE5 B;  5H8F B;  5CM6 A;  1P1N A;  1TWY A;  4X48 A;  2QPQ A;  5HPQ A;  3SDF A;  4I9D A;  5H8N A;  1H3D A;  5CMB A;  1B05 A;  1D4N A;  3IB0 A;  4Q30 B;  1Y20 A;  1YPN A;  1P99 A;  4YIC A;  3CRB A;  2F36 A;  3T9X B;  3RTF B;  3RT6 B;  4POW A;  5CI5 A;  3PPQ A;  5BUU A;  3H6U A;  1Q35 A;  2HFB A;  4RJZ A;  4BLA A;  2QMX A;  1ZU0 A;  4F3S A;  4N13 A;  1BP5 A;  5IAI A;  3CFL A;  4KD5 A;  2ZYN A;  5AA2 D;  1B7U A;  4F22 A;  4U21 A;  4IGR A;  3GBB A;  3IK6 B;  1Y3P A;  4FEB A;  4Q0C A;  4DXC A;  1AL3 A;  3R6U A;  2DWJ A;  3S4U A;  3UA8 A;  2PT2 A;  1S7Y A;  5M2V A;  3H7M A;  2D3I A;  1EZO A;  2XD3 A;  4POX A;  5K2X A;  4LAT A;  3H6W A;  2RCA A;  1TXF A;  1A54 A;  1OQH A;  1FQE A;  3C35 A;  4QFN A;  3TTM A;  2ZNU A;  4NF6 B;  3S9N C;  4M4G A;  5L9O A;  5ITO A;  1VSO A;  1LFH A;  4R73 A;  1II5 A;  2Z8E A;  1MXV A;  2UVI A;  1QUJ A;  1SDX A;  5I2K B;  2I0B A;  4ELO A;  1D9Y A;  1N04 A;  5H8F A;  3KN8 A;  4R9G A;  2F34 A;  3JV9 A;  3AXF A;  4X1B A;  4F1Y A;  3IB1 A;  4OTE A;  4NED A;  2XXT A;  4OMB A;  1MM6 A;  2AIX A;  2REJ A;  4OEN A;  3MUQ A;  4TQU Q;  3WAF A;  4H8I A;  3G3I A;  2V3U A;  1B3G A;  4U1O A;  2Q2A A;  4ECF A;  3T22 A;  1UQW A;  4QSD A;  1URD A;  4GFR A;  3SKP A;  3GBA A;  3KOS A;  4E0W A;  3HST A;  1CE2 A;  4N6P A;  3T96 B;  2VOZ A;  1B32 A;  2PMS A;  3O6I A;  1A99 A;  3Q26 A;  5ISU A;  1R6Z A;  2V3Q A;  1LLS A;  3EHU A;  4ELQ A;  5ITP A;  2DWI A;  2V93 A;  3PD9 A;  4DDD A;  4I1D A;  3K1P A;  1A7L A;  4LZ7 A;  5I56 B;  5FHN A;  1H45 A;  1P1U A;  3A09 A;  3PPN A;  1SW4 A;  4THI A;  1LCF A;  4EQ9 A;  4BDM A;  5F7V A;  2O1M A;  3T93 B;  1I6Q A;  3U92 A;  4YMB A;  2G29 A;  4N07 A;  3K2D A;  4NF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...