2W7YA

Structure of a streptococcus pneumoniae solute-binding protein in complex with the blood group a-trisaccharide.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
391
structure length
389
Chain Sequence
EVLEFYHGYHHSEDEWPVAKTMRDLYDKFAEEHSGVEFKPTPVNGDLKDIMNNKVASGEFPDVIDLAGNAVSLAAIEQKLVLDLKPYIDSNKLEKNVGLNYKQNQKDGKIYTVHEQLFTMGLWYNKDIFAKAGAKTPDQWNTWDDFTQAMASIRKQDGVYAFGAGEPSIRLFNTVLGTTENGRKLLDKPLTKEGIESKEFADALKMVMKEIQANGSKNAGGDANAYSKDFQEGKSAVFFNGVWASGEMSKNPSLAPGIYPAGVAISSSGGGITISSKMSEAKQKLALEFLKYMTSDDVQKVIFEKVGANPSNENVNVKELSEKSSEATTKILGQAITQVKNAKAVVPTVSDVWGGDVHTAIINALTESAAENVDVDQKVKSTQDVLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
publication title Blood-Group Antigen Recognition by a Solute-Binding Protein from a Serotype 3 Strain of Streptococcus Pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Sugar binding protein
total genus 119
structure length 389
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2w7yA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2w7yA01
3U94A 4X9TA 3IB2A 5DYHA 3JV9A 1SW1A 3VVDA 1R9LA 1BIYA 4R75A 4YB6A 3PMVA 5J1DA 4G68A 1EH3A 5JTYA 2YPNA 2HZKA 5K2XA 2F7CA 3KN7A 3E3KA 2HCAA 1LCTA 4OEVA 2AYSA 2QMXA 4F3BA 3MVXA 4IO6A 4MLVA 3IJOB 3GLBA 1O64A 1DPEA 2Q2CA 1Y4TA 1H3DA 4I1DA 3Q29A 4DIGA 5L9SA 1TFDA 3S9EA 2UYFA 1JEVA 5CMBA 2ZYOA 3W15C 4EXKA 3E4RA 2ALUA 5CI5A 3L6GA 5FTHA 3CFXA 3IORA 1URDA 2F7BA 2AL5A 5H8QB 4ELOA 2R9JA 4MFIA 1D3KA 1XVXA 3T9HB 4JSDA 3T93B 2DXRA 2Y7PA 3VFJA 1QUKA 4F22A 1VR5A 3PUWE 3FVNA 3MP8A 4R6YA 1EZ9A 2HFBA 1LB8A 1DSNA 2DE2A 2P1SA 3UK4A 5AA3A 2QS2A 4ZEKA 2QRYA 2OCUA 2W7YA 1HSLA 1LAGE 1FTLA 4G2ZA 5DVJA 1LB9A 3H6TA 2XXVA 5A5XB 2HAUA 4H1XA 2Y7WA 2XXUA 2NUVA 3RT6B 4X1DA 1P1WA 1B46A 2ANJA 4BDMA 3LSLA 3VLWA 5DEXA 5I59B 3KZGA 5JEIA 4O3AA 3K01A 1ELJA 4GOTA 1AH5A 2Q9TA 1IIWA 2H98A 3I5OA 3OD7A 5CMCA 2THIA 5L9MA 4MF3A 3A3CA 3R6UA 3FVGA 1TWYA 3LSFB 3M3FA 3OEMA 1LCFA 5TP9B 3KG2A 3SEUA 1AMFA 3PUVE 3BFTA 1US5A 1BTJA 2QL3A 3V8XB 2QMWA 4ZECA 2D5WA 5ITOA 1ZKBA 2OWSA 3TCFA 4OQOA 5H8QA 2OLBA 1M5CA 4NWCA 3TUSA 1DPPA 2G29A 4F18A 3GBAA 1MXYA 1UTBA 4FAJA 1IUDA 2QS4A 2ZNSA 4OVJA 1B1XA 1MQIA 4PFUA 4POWA 2VP1A 4F2OA 3VDFA 1FW0A 1P1OA 1UIUA 2NOOA 3MWBA 5H8FA 4N6PA 5I57A 3SKPA 1R1NA 1XHYA 2V93A 5I2NA 4Q0CA 3CRBA 3U93A 4RPNA 1MXVA 4C1TA 2REGA 4PETA 4R6HA 2RF1A 1BP5A 5I56B 4G4PA 2OWTA 4G8NA 4AB5A 1JVYA 4HTGA 2XXRA 1MDP1 1IQ7A 4IO4A 1LAFE 2Y7RA 5I2KB 1FCKA 3FXRA 3QSLA 1MM7A 4IO3A 3EHTA 2GHBA 4YZZA 4KFQA 4FECA 5AA4B 2B3FA 2ZXTA 4U22A 3G7WA 1O7TA 3K1MA 3EHUA 3W9WA 3K6XA 3BFUA 1SW2A 5CRYA 2H99A 3TTLA 4F31B 1B4HA 4ONYA 2XX8A 2F7AA 2REJA 3IB0A 3LSWA 3CG1A 3S9MC 4L17A 4RPOA 2QS3A 5DT6A 3CI8A 5TP9A 2UVJA 5IAIA 1S50A 4RY1A 1XVYA 3FJGA 3UN6A 3M8UA 4WXJA 4FATA 2O69A 2ZNTA 5CBRA 2NVUB 5KDTB 4R2FA 4X48A 3IO4A 3RN8A 4YKKA 3EQ1A 4YKJA 5TPAB 3M3LA 4DZ1A 4Z0IA 1QKAA 1OVTA 3GXAA 3FVKA 1DMBA 1FQEA 3AXFA 5FTIA 4Z7EA 1Z7NE 1SDXA 1SQYA 4KCCA 1ZTYA 1PBQA 2A5SA 4RYAA 1SYIA 3TEPA 3TODA 3S9LC 3K6UA 3RTWB 3MBPA 3S2VA 3MJNA 4FIMA 1H76A 4Q5TA 3MP1A 4NF4A 3E9XA 4GIZA 2RC7A 1B7HA 3K2DA 2H25A 2CMOA 4KYSA 1OMPA 2ZNUA 3PPRA 1QULA 2V84A 1A40A 1PBPA 1UTHA 2PT1A 1SVXB 4NF8A 4LQ2A 1B5JA 3ZKKA 5I2KA 4RXLA 1ZIUA 4BLAA 3CIJA 3CVGA 2RC8A 5M2VA 3N26A 1MG1A 3PMWA 5AA4A 1NNPA 4OFLA 2YJPA 4QFOA 5FHMA 3MPLA 1XS5A 2DWHA 3U1OA 3CFZA 3G3HA 3KN3A 4BDQA 1NKXA 1Y4CA 1BKAA 2V3QA 1IXGA 3TTNA 1OQHA 3TCHA 2I6EA 3DM0A 2V3UA 3SETA 3B7DA 4EF1A 1MPCA 3CG3A 3ZSFA 5F1QA 5DTBA 3THIA 3RQTA 4GFRA 3ZKLA 1A55A 2PMSA 1B32A 5ISUA 3UA8A 1B5IA 2E1SA 1JEUA 4Q30B 3TELA 4ZDMA 5KCJB 4NTLA 1NMUA 3FZVA 2ONKE 4U1ZA 1H45A 1XC1A 3JYRA 3MZ9A 3OO6A 2D3IA 5BWJA 3LBSA 1SBPA 3CSBA 4FORA 2X7QA 2PT2A 1IXIA 2ONSA 3P7IA 1IXCA 4XKNA 5H8NB 5JK4A 3UGWA 1A99A 3QUJA 3OMBA 1SW5A 5DEXB 3B6TA 4GWOA 3MUQA 1NH7A 1H43A 2XXQA 1WVJA 4HW8A 3OENA 1JW5A 3C32A 1A8EA 3FXUA 4AB6A 4XXUA 4F2QA 1MQJA 4ZEFA 1QW0A 5L8DA 4OYVA 4R74A 3TQWA 3OXNA 1VSOA 4R2BA 4U2RA 1USYE 2VHAA 5AA1A 3MQ9A 5CMKA 2ESNA 2GRVA 4M4GA 3SEVA 2F78A 4KHZE 4QF9A 3LR1A 1B5HA 1LFHA 3T66A 5CM6A 4U4XA 3LSXA 2HQ0A 4R9FA 4THIA 2QS1A 2XX7A 2ZYMA 2F97A 3MZ1A 3PUXE 4WEDA 3O6HA 1DTZA 3H7MA 4XKQA 1EZPA 1LAXA 1ZU0A 5EYFA 1UTBB 3MP6A 1B3FA 3L6HA 3A09A 4ELPA 1YCJA 3KGCA 2I3VA 4KD5A 2RINA 1FQAA 1YPNA 4I62A 1D9VA 4OZ9A 4F1YA 3MW0A 3UORA 2Z23A 5H8FB 5KCJA 2FA7A 3TDJA 5I57B 4PFYA 2X7PA 4YKIA 4HCWA 3K4UA 5I2NB 2UVGA 3K00A 4DLDA 5EHSA 4H8IA 1OLCA 3O29A 4QFKA 4P0GA 1NL5A 4P0IA 2H4IA 3TCGA 3N5LA 2I4BA 5H8NA 3FV2A 2XXIA 3PUZE 4UACA 2HAVA 1OLAA 1P1QA 1UQWA 1NNTA 4ND9A 1R9QA 2H9BA 1N3XA 4NE4A 3MVZA 1FQFA 2DQVA 1I6QA 4QRZA 1GV8A 2RCAA 1JNFA 1B0LA 1B0HA 3EHSA 3OELA 2ZYKA 1USYH 3MVWA 4XTCQ 1DTGA 1ATGA 1XT8A 3VXBA 4F3SA 1S9TA 2XD3A 2V3TA 3F11A 3W9VA 1ZJLA 1FTOA 2DYXA 3TTKA 4F3PA 4BDLA 3QYTA 1N7XA 2P0SA 5EHMA 2O6AA 3KJTA 3RLFE 4KPTA 4EUOA 4DCXA 3K6VA 4QSDA 2Q88A 4U23A 1LBCA 4KQPA 1B7ZA 3PD8A 4U1OA 1MXWA 2AL4A 4RJZA 2XXXA 2Y7KA 4JWYA 1ZLQA 1Y20A 2VOZA 3H4ZA 4IY6A 1MH4A 4K3FA 5B70A 1JW4A 5KZTA 1EZOA 1B7UA 2DVCA 2KLFA 3TYHA 3FVOA 2XX9A 3USDA 4DCYA 3CFLA 1VFEA 3FXQA 1M5FA 5AA2A 1PB9A 4NF4B 4QFLA 2ABHA 1YAEA 3O2AA 4LATA 4IO7A 4EF2A 2O51A 5I84A 2XXYA 3Q26A 1MM6A 3KOSA 4LZ5A 1UTHB 5LOMA 1N7WA 4NF8B 1B52A 1B2HA 3G3KA 2O1LA 1IZ1A 4ESWA 3TAJA 4P11A 4QSEA 4H6DA 1N76A 1NNKA 1SI0A 3QXMA 1MQGA 4OENA 1TFAA 4O3CA 1D9YA 2VGQA 1Q35A 2Y7IA 3DP4A 4OETA 4FE8A 4DXUA 2QPQA 1B6HA 3B6WA 5AA2D 1GR2A 3C34A 3H6UA 1LFIA 5H8SA 4GXSB 3FV1A 1URSA 2R6GE 4JSOA 1I6BA 3M3KA 1M5EA 2RKMA 3VV5A 4YKPA 4DXCA 3HN0A 2F36A 2DWJA 1LBBA 4LA9A 5BUUA 4LUBA 4M1VA 1QUJA 1SD3A 4X1BA 2Q8JA 2LAOA 4BDOA 3IK6B 2G93A 4IB2A 2DE3A 4KCDA 3C33A 1Q1KA 4OFOA 3FASA 1Y3NA 4F39A 3T9UA 3V5AA 3C35A 3WAEA 4GLIA 3PPQA 4XKRA 3CR9A 3V89B 3KBRA 3FATA 3N94A 3SEWA 1ZMGA 4R9GA 4LONB 3VLUA 1CB6A 4ZE9A 2XHDA 4YU0A 3TKDA 4LZ7A 2NWJA 4DXBA 1US4A 4R73A 4H8JA 3G3IA 4EXLA 4OERA 3EPEA 3LC8A 4PFWA 2I49A 4G8MA 5CC2A 1NNFA 1MY0A 2A5TB 1NFTA 1MY3A 1B3EA 1FQDA 2F6GA 1IEJA 3TTRA 4C1UA 2I48A 3PPOA 1GTKA 3TPAA 1POY1 3OO9A 4IGTA 3IL1B 4QHQA 1DOTA 1JVXA 3O6IA 4EDPA 3RPWA 3RNNA 2I0BA 1S7YA 1UIVA 3V83A 4OEUA 4QSCA 3TZAA 3RTFB 1MXXA 3IAZA 3T9XB 1RKMA 4LP2B 5IKBA 4PE5B 1RYXA 4HS7A 3ZS6A 2Y84A 4G8HA 4GRKA 3WAFA 4KYEA 4IGRA 4IO2A 2D21A 4Q8RA 2HXWA 3IOWA 3IX1A 4POXA 4YICA 1B05A 4MLQA 2OK2A 2PX1A 2PBWA 4WEPA 2Q2AA 2UYEA 4TLMB 1FQCA 4RK2A 1MY4A 2P2AA 4F1UA 4PQJA 1B3HA 2O1MA 4LVQA 3HO7A 3PPNA 4GVOA 4ELRA 3R7XA 3MVYA 1F9BA 1QKBA 4EQBA 1LAHE 2AIXA 5DVFA 3CSGA 4ELQA 3OO8A 3UIFA 4GL8A 4NEDA 3VXCA 3GBBA 1YTVA 3N6UA 3K02A 4PFTA 1EU8A 3QUFA 3RGYA 3IR1A 4H65A 5FHNA 2V25A 3T9VA 3BKIB 4OHNA 1VFDA 4HCYA 3IOTA 1B4ZA 2A5TA 3U92A 1R6ZA 1FQBA 4DE8A 2GFEA 2B65A 3MAMA 1D4NA 3DLNA 1POTA 3I3VA 4ESXA 1GGGA 3QAXA 4G77A 3H3GA 3IOVA 3VVFA 2UXAA 1OIBA 1MH3A 4DDDA 3O9PA 3SESA 2ZMBA 3SDFA 4ZEBA 5ICQA 5ICTA 3G3GA 2F6PA 4FEBA 3RT8A 2VD2A 5K2YA 1MRPA 4OMBA 3B6QA 1B58A 1II5A 4GF8A 1N04A 4IO5A 3K0VA 2IA4A 3D4CA 3OOAA 5DVIA 4RNSA 1AL3A 1QUIA 4R6KA 3HCQA 3T96B 4MH5A 2R71A 2F8DA 1H44A 4WKMA 5AA2B 3PPPA 2F35A 1TT1A 2XD2A 1Y3PA 4MBPA 2IEEA 2YLNA 2HZLA 4ZEIA 4QFNA 4OWDA 1O63A 2FNCA 3OSQA 2RC9A 4C0RA 1ZBMA 4XIGQ 2DSFA 4H5FA 3U8QA 5CMMA 1LLSA 3PGFA 1J1NA 2O7UA 4U4SA 1SW4A 4YAHX 1B51A 3G3FA 1WDNA 4ECFA 1B9JA 2OBGA 4R72A 4OTEA 2I4CA 1A54A 4GXAA 4O3BA 3OO7A 2HEUA 1Y1ZA 5L9OA 1OQGA 2PYYA 3OSRA 2XXTA 4GQOA 1AIVA 4KI0E 4F1VA 3C36A 2Z8EA 4JDFA 4PP0A 1NH8A 3MPKA 3HHFA 1PDAA 2CZLA 3PV0E 3QK6A 3VVEA 4QFPA 3KEIA 1P1NA 1Z7ME 4GD5A 3DP8A 4YB5A 2NXOA 4OFJA 4OXVA 4EQ9A 1T0KA 3D4GA 5CBSA 3ODBA 2ONRA 4H67A 4YMBA 4H0WA 3O28A 4TLLB 4EQ7A 3KSJA 3PMXA 1B1HA 4AQ4A 3TFLA 1M5BA 1LGBC 5HBCA 3S9NC 1XOCA 2O84X 1P99A 2DOJA 5H8HB 4TQUQ 1LFGA 1I69A 1N84A 1L5TA 2E0SA 2VD3A 4G68C 3A3UA 5A5XA 2GHAA 2Q89A 2Z8FA 3E13X 1MQDA 1HSJA 3MZBA 1MXUA 1MS7A 3KJ7A 3FGSA 1PEBA 1I6AA 3Q25A 3K6WA 3U72A 5F7VA 1Y3QA 4I9DA 4F3GA 3PUYE 2UVIA 3SERA 3LUYA 3KSXA 2XXWA 5I59A 3FJ7A 4OESA 4JB7A 3DP6A 4NMYA 3MC2A 3N6TA 1JETA 3SEXA 2X26A 1IXHA 3IJXB 3TMGA 1MY2A 3UP9A 3GZGA 2XXHA 3PD9A 3ECRA 3I6VA 2I0CA 3PU5A 4BDNA 4U21A 2GH9A 3IB1A 3KOTA 2B3BA 5HPQA 3HPIA 3T22A 1FTJA 3Q28A 1GVCA 4LQ5A 1PB8A 1PB7A 4NF5B 2DWAA 2OZZA 3KFMA 1JQFA 3FD3A 4ISUA 3O97A 1URGA 1P1UA 2Z8DA 4NF6B 3C31A 3SEYA 4IY5A 4ZZAA 2FYIA 4FJPA 4F19A 1JW1A 5I58B 1B3GA 4I8CA 5FHOA 2I58A 3K1NA 3BBRA 3O66A 4YB7A 4UA8A 1TXFA 3ILTB 5H8HA 3H06B 1N3WA 2M8CA 3JZJA 1RYOA 1PC3A 2DXYA 3IOUA 2F5XA 1MDQA 1MQHA 4N13A 1MXZA 4G68B 1A7LA 5I56A 4JBZA 5JTYB 4TOZA 2DP8A 1LSTA 3FJMA 3FIRA 3ONMA 3EF7A 4KYDA 3TQLA 1Y1MA 4H5GA 4ZE8A 4FEDA 2QJEA 1QVSA 2Z22A 1A8FA 3H03A 1AOVA 3HV1A 4E0WA 2I3WA 1KWHA 2DE4A 1OVBA 4LZ8A 4YMAA 1IITA 3OEKA 5AE4A 1MPBA 2PVUA 3H6VA 1ANFA 3VLVA 1N0TA 4JWOA 5TU0A 4JWXA 4RA1A 2DWIA 5ELVA 2BJJX 1B40A 1Y9UA 3HSTA 1BLFA 3S4UA 3ILUB 4E0XA 3RUMA 2UVHA 2F34A 1QJMA 1M5DA 3EN3A 3G3JA 4ZZEA 2OJTA 3O6GA 2O68A 5HM4B 1MY1A 4JXIA 3Q27A 4RK9A 1HSEA 2ZYNA 2WKYA 4NWDA 2DS9A 2DVZA 3HHGA 1CE2A 5KDTA 3H6WA 4NF5A 3FUZA 3KN8A 1VE4A 3C4MA 3DELB 2RCBA 4ZEDA 4XKPA 3IO6A 1SI1A 1MPDA 3K1PA 2XXPA 5TPAA 4N07A 4NF6A 1WODA 2QSXA 3R26A 4KR5A 3VE1B 1FTKA 1B3LA 4BDRA 2H5YA 5I58A 4ZS9A 3TTMA 4F29A 1FTMA 3C9HA 5ITPA 1SYHA 3RY3A 5B7DA 2O7IA 3QIMA 4GL0A
chains in the Genus database with same CATH superfamily
3U94A 4X9TA 3E79A 3IB2A 5DYHA 1FTAA 3JV9A 1SW1A 3VVDA 1R9LA 1BIYA 3MYUA 4R75A 4YB6A 3PMVA 5J1DA 4G68A 1BK4A 1EH3A 4AS5A 2Q74A 3RPLA 5JTYA 2YPNA 2HZKA 1EYKA 5K2XA 4PBQA 2F7CA 3KN7A 3E3KA 2HCAA 4PCDA 1LCTA 4OEVA 4NAPA 1FSAA 2AYSA 2QMXA 4F3BA 1JP4A 3MVXA 4IO6A 4MLVA 3IJOB 3GLBA 5EYGA 1O64A 2QFLA 1DPEA 2ZZVA 5ESYA 2Q2CA 1Y4TA 1H3DA 4I1DA 3Q29A 4DIGA 5L9SA 3PTYA 1TFDA 3S9EA 2UYFA 1JEVA 5CMBA 2ZYOA 3W15C 4EXKA 3E4RA 2ALUA 5CI5A 3L6GA 5FTHA 3CFXA 3IORA 1URDA 2F7BA 3RYDA 2AL5A 5H8QB 4ELOA 2R9JA 4MFIA 4HE0A 1D3KA 1XVXA 3T9HB 4JSDA 3T93B 2DXRA 2Y7PA 3VFJA 1QUKA 4F22A 1VR5A 3PUWE 3FVNA 3MP8A 4R6YA 1EZ9A 2HFBA 1LB8A 1DSNA 2DE2A 1IMCA 2BJIA 2P1SA 4N6KA 1IMAA 3UK4A 4H46A 5AA3A 2QS2A 4ZEKA 2QRYA 4N81A 2OCUA 2W7YA 1HSLA 1LAGE 1FTLA 4G2ZA 5DVJA 1LB9A 3H6TA 2XXVA 5A5XB 2HAUA 4H1XA 2Y7WA 2XXUA 4PAIA 2NUVA 3RT6B 1LBYA 4X1DA 1P1WA 1B46A 2ANJA 4BDMA 3LSLA 3VLWA 5DEXA 5I59B 1YYZA 3KZGA 5JEIA 5I7IA 4O3AA 4PC9A 4OVTA 5EQ8A 3K01A 1ELJA 2WEFA 4GOTA 1AH5A 3E78A 2Q9TA 1IIWA 2B4LA 2V4CA 2H98A 3I5OA 3OD7A 4GWYA 1NV3A 4GBVA 5CMCA 2THIA 4MHFA 5L9MA 4MF3A 3A3CA 2XWKA 3R6UA 3FVGA 4OVSA 1TWYA 1FPGA 3LSFB 3M3FA 2CZIA 4O7MA 3OEMA 1LCFA 5TP9B 3KG2A 3SEUA 1AMFA 3PUVE 2DDKA 3BFTA 1US5A 1EYIA 1BTJA 2QL3A 3V8XB 2QMWA 4ZECA 2D5WA 5ITOA 1IMEA 1ZKBA 2Y5LA 2OWSA 3TCFA 4OQOA 1FBHA 5H8QA 2OLBA 1M5CA 1G0HA 4NWCA 4AS4A 3TUSA 5EQ7A 1DPPA 2G29A 3B8BA 4F18A 3GBAA 1MXYA 1UTBA 4FAJA 1IUDA 2QS4A 2ZNSA 4OVJA 1B1XA 3IFAA 1MQIA 4PFUA 4POWA 2VP1A 4F2OA 3VDFA 1FW0A 1P1OA 1UIUA 2NOOA 2VT5A 3T0JA 3MWBA 5H8FA 4N6PA 5I57A 3SKPA 1FPLA 1R1NA 1XHYA 2V93A 5I2NA 4Q0CA 3CRBA 3U93A 4RPNA 5ET7A 5FBPA 1MXVA 4C1TA 2REGA 4PETA 4R6HA 2RF1A 1BP5A 4PFBA 5I56B 4G4PA 2OWTA 4G8NA 4AB5A 2PCRA 1JVYA 4HTGA 2XXRA 1MDP1 1IQ7A 4IO4A 1LAFE 1FBFA 2Y7RA 5I2KB 1FCKA 3FXRA 3QSLA 1MM7A 4IO3A 3EHTA 2GHBA 1FPFA 5T3JA 4YZZA 4KFQA 4FECA 5AA4B 2B3FA 2ZXTA 4U22A 3G7WA 1O7TA 3K1MA 4UABA 3EHUA 3W9WA 3K6XA 3BFUA 1SW2A 5CRYA 2H99A 3TTLA 4F31B 1B4HA 4ONYA 2XX8A 2F7AA 2REJA 3IB0A 3LSWA 3CG1A 3S9MC 4L17A 4RPOA 2QS3A 5DT6A 3CI8A 2VPNA 5TP9A 2UVJA 5IAIA 1S50A 4RY1A 1XVYA 3FJGA 3UN6A 3M8UA 4WXJA 2JJKA 4FATA 2O69A 2ZNTA 5CBRA 3ROJA 2NVUB 5KDTB 4R2FA 2P3VA 4X48A 4KXPA 3IO4A 3RN8A 4YKKA 4MCOA 3EQ1A 4YKJA 4NGUA 4XEQA 5TPAB 3M3LA 4DZ1A 4Z0IA 1QKAA 1OVTA 2ZZWA 3GXAA 4G61A 3FVKA 1DMBA 3IFCA 1FQEA 3AXFA 5FTIA 4Z7EA 1Z7NE 1SDXA 1SQYA 2CEXA 4KCCA 1ZTYA 1PBQA 2A5SA 4RYAA 1SYIA 3TEPA 3TODA 3S9LC 3K6UA 1RDYA 3RTWB 3MBPA 3S2VA 3MJNA 4FIMA 1H76A 4Q5TA 3MP1A 4NF4A 2QVUA 3E9XA 4GIZA 2RC7A 1B7HA 3K2DA 2H25A 2CMOA 4KYSA 1OMPA 2ZNUA 3PPRA 1QULA 2V84A 1A40A 5EQAA 1IMBA 1FRPA 1PBPA 1UTHA 2PT1A 1SVXB 4NF8A 4LQ2A 1B5JA 3ZKKA 4IR8A 5I2KA 4RXLA 1ZIUA 4BLAA 3CIJA 3CVGA 2RC8A 5M2VA 3N26A 1MG1A 3PMWA 5AA4A 4LN5A 2F3DA 1NNPA 4OFLA 2YJPA 4QFOA 5FHMA 3MPLA 1XS5A 2DWHA 3U1OA 3CFZA 3G3HA 3KN3A 4BDQA 1NKXA 1Y4CA 1BKAA 2V3QA 1IXGA 3TTNA 1OQHA 1NV0A 4QXDA 3TCHA 2I6EA 3DM0A 2V3UA 4P56A 3SETA 3B7DA 4EF1A 1MPCA 3CG3A 3ZSFA 5F1QA 5DTBA 3THIA 3RQTA 4GFRA 3ZKLA 4JVIA 1A55A 2PMSA 1B32A 5ISUA 3UA8A 1B5IA 2E1SA 4P1LA 1INPA 1JEUA 4Q30B 1FPIA 3TELA 4ZDMA 5KCJB 4NTLA 1NMUA 3FZVA 2ONKE 4P1EA 4U1ZA 1H45A 1XC1A 5IZZA 3JYRA 1AWBA 3MZ9A 3OO6A 2QVRA 2D3IA 5BWJA 3LBSA 1SBPA 3CSBA 4FORA 2X7QA 2PT2A 1IXIA 2ONSA 3P7IA 1IXCA 4GWXA 4XKNA 5H8NB 5JK4A 3UGWA 1A99A 3QUJA 3OMBA 1SW5A 5DEXB 3B6TA 4GWOA 3MUQA 1NH7A 1H43A 2XXQA 1WVJA 4HW8A 3OENA 1JW5A 1FPEA 3C32A 1A8EA 3CHGA 3FXUA 4AB6A 4P3LA 4XXUA 4F2QA 1DCUA 1MQJA 4ZEFA 4P8BA 1QW0A 5L8DA 4OYVA 2WYKA 1NV4A 4R74A 3TQWA 3OXNA 1VSOA 4R2BA 1NUWA 4DI4B 4GWWA 4U2RA 4MEVA 2P3NA 1USYE 2VHAA 5AA1A 3MQ9A 5CMKA 2ESNA 2GRVA 4M4GA 3SEVA 2F78A 4KHZE 4QF9A 3LR1A 1B5HA 1LFHA 3T66A 5CM6A 4U4XA 3LSXA 2HQ0A 4R9FA 4THIA 4MMPA 2QS1A 2XX7A 3QIMA 2ZYMA 2F97A 4HE2A 3MZ1A 3PUXE 4WEDA 3O6HA 1DTZA 3H7MA 2FIEA 4XKQA 1EZPA 4OVQA 4O7IA 1LAXA 1ZU0A 5EYFA 1UTBB 3MP6A 1B3FA 3L6HA 3A09A 4ELPA 1YCJA 3KGCA 2I3VA 4KD5A 2RINA 1FQAA 1YPNA 1FPJA 4I62A 1D9VA 4OZ9A 4F1YA 3MW0A 3UORA 2Z23A 4NN3A 5H8FB 5KCJA 2FA7A 3TDJA 5I57B 4PFYA 2X7PA 4YKIA 4HCWA 3K4UA 5I2NB 4PE3A 2UVGA 3K00A 4DLDA 5EHSA 4H8IA 1OLCA 3O29A 4QFKA 4P0GA 1NL5A 4P0IA 2H4IA 4FBPA 3TCGA 3N5LA 2I4BA 5EQ9A 5H8NA 2XXKA 2QVVA 2XXIA 3FV2A 3PUZE 4UACA 4NG7A 2HAVA 1OLAA 4MJOA 1P1QA 1UQWA 1NNTA 4ND9A 1R9QA 5F24A 4GBWA 2H9BA 1N3XA 4NE4A 3MVZA 1FQFA 2DQVA 1I6QA 3U65A 4OANA 4QRZA 1GV8A 2RCAA 1JNFA 1B0LA 4MNIA 1B0HA 3EHSA 3OELA 2ZYKA 1USYH 3MVWA 4XTCQ 1DTGA 1ATGA 1XT8A 4N15A 3VXBA 4F3SA 1S9TA 4PAKA 2XD3A 2V3TA 3F11A 4P9KA 4X8RA 3W9VA 1ZJLA 1FTOA 2DYXA 3TTKA 5LTCA 4F3PA 4BDLA 3QYTA 1N7XA 2P0SA 5EHMA 2O6AA 3KJTA 3RLFE 2WBBA 4KPTA 4EUOA 4PFIA 4DCXA 3K6VA 4QSDA 2Q88A 4U23A 4X04A 1LBCA 4KQPA 1B7ZA 3PD8A 4U1OA 4MAGA 4N4UA 1MXWA 2AL4A 4RJZA 2XXXA 2Y7KA 4JWYA 1ZLQA 1Y20A 2VOZA 3H4ZA 5I3SA 4IY6A 1MH4A 4K3FA 1LBVA 5B70A 1K9YA 1JW4A 2XWOA 5KZTA 1EZOA 1B7UA 2DVCA 2XWIA 2KLFA 3TYHA 3FVOA 2XX9A 3USDA 4DCYA 3CFLA 1VFEA 3FXQA 1M5FA 5AA2A 1PB9A 2FHYA 4NF4B 4QFLA 2ABHA 3BIHA 1YAEA 2FIXA 3O2AA 1KA1A 4LATA 4IO7A 4EF2A 2O51A 5I84A 2XXYA 3Q26A 1MM6A 3KOSA 4LZ5A 1UTHB 5LOMA 3EKIA 4PF6A 1N7WA 4NF8B 1B52A 1B2HA 3G3KA 2O1LA 3MSTA 1IZ1A 1NUZA 4ESWA 3TAJA 2WBDA 4P11A 1D9QA 3GYYA 1G0IA 4QSEA 2OX3A 4H6DA 1N76A 1NNKA 1SI0A 3QXMA 1MQGA 4OENA 1TFAA 4O3CA 1D9YA 2VGQA 1Q35A 2Y7IA 4JVDA 3DP4A 4OETA 4FE8A 4DXUA 2QPQA 1B6HA 3B6WA 5AA2D 1GR2A 3C34A 3H6UA 1LFIA 5H8SA 1FBEA 4GXSB 1KA0A 1LBXA 3FV1A 1URSA 2R6GE 4JSOA 1I6BA 3M3KA 4PDHA 1M5EA 2RKMA 2Q8MA 3VV5A 4YKPA 4DXCA 3HN0A 2F36A 2DWJA 1LBBA 4LA9A 5BUUA 4LUBA 4M1VA 4I40A 1QUJA 1SD3A 4X1BA 2Q8JA 2LAOA 4BDOA 3IK6B 2G93A 1NI9A 4IB2A 2DE3A 4KCDA 3C33A 1Q1KA 4OFOA 3FASA 1Y3NA 4F39A 3T9UA 3V5AA 3C35A 3WAEA 4GLIA 3PPQA 4XKRA 3CR9A 3V89B 2HPGA 3KBRA 1NV7A 3FATA 1NV5A 4MNCA 3N94A 3SEWA 1ZMGA 4R9GA 4LONB 3VLUA 1CB6A 3KC0A 4ZE9A 2XHDA 4YU0A 3TKDA 5IZ3B 4LZ7A 2NWJA 4DXBA 1US4A 4R73A 4H8JA 3G3IA 4EXLA 4OERA 3EPEA 4XF5A 3LC8A 4PFWA 2I49A 4G8MA 5CC2A 1NNFA 4N91A 1MY0A 2A5TB 2Y5KA 1NFTA 1FBGA 1MY3A 1B3EA 1FQDA 2F6GA 1IEJA 3TTRA 4C1UA 2I48A 5ET5A 3PPOA 3HFUA 1GTKA 3TPAA 1POY1 3OO9A 2CZKA 4IGTA 3IL1B 4QHQA 5IM2A 1DOTA 1JVXA 2XWVA 3O6IA 4HXVA 4EDPA 2B4MA 3RPWA 3RNNA 2I0BA 1S7YA 1UIVA 3V83A 4OEUA 4QSCA 3TZAA 3RTFB 1MXXA 3IAZA 3T9XB 1FJ6A 1RKMA 4LP2B 5IKBA 2XA5A 4PE5B 1RYXA 1EYJA 4HS7A 3ZS6A 2Y84A 4G8HA 5ET8A 2HHMA 4GRKA 3WAFA 4KYEA 4IGRA 3NOHA 4IO2A 2D21A 4O8MA 4Q8RA 2HXWA 3IOWA 3IX1A 4POXA 2CEYA 4YICA 1B05A 4MLQA 2OK2A 4OA4A 2PX1A 2PBWA 4WEPA 2Q2AA 2UYEA 4TLMB 1FQCA 4RK2A 1MY4A 2P2AA 4F1UA 4PQJA 1B3HA 2O1MA 4LVQA 3HO7A 3T1BA 3PPNA 4GVOA 4ELRA 3R7XA 3MVYA 1F9BA 1QKBA 4EQBA 1LAHE 2AIXA 2FBPA 5DVFA 3CSGA 4ELQA 3OO8A 3UIFA 4GL8A 1VDWA 4NEDA 3VXCA 3GBBA 5IZ3A 1YTVA 3N6UA 3K02A 4PFTA 1EU8A 4DI3D 3QUFA 3RGYA 3IR1A 3FXBA 4H65A 5FHNA 2V25A 3T9VA 3BKIB 4MIJA 4OHNA 1VFDA 4HCYA 3IOTA 1B4ZA 2A5TA 3U92A 3B50A 1R6ZA 1FQBA 4DE8A 5A5LA 2GFEA 2B65A 3MAMA 1D4NA 3DLNA 1POTA 4GX3A 5I5PA 1NUYA 3I3VA 4ESXA 4PGNA 1GGGA 3QAXA 5ET6A 4G77A 3H3GA 3IOVA 3VVFA 2UXAA 1OIBA 1MH3A 1K9ZA 4GX4A 4DDDA 2MKZA 3O9PA 3SESA 2ZMBA 3SDFA 5IGAA 4ZEBA 5ICQA 5ICTA 3G3GA 1RDZA 2F6PA 4PAFA 4FEBA 3RT8A 2VD2A 5K2YA 1MRPA 4OMBA 3B6QA 1B58A 4NHBA 1II5A 4GF8A 1N04A 1XI6A 4IO5A 3K0VA 2IA4A 3D4CA 3OOAA 5DVIA 4RNSA 4NX1A 1AL3A 1QUIA 3KC1A 4R6KA 3HCQA 4NQ8A 3T96B 4MH5A 2R71A 2F8DA 1H44A 4WKMA 5AA2B 3PPPA 1LBZA 2F35A 3BIGA 1TT1A 2XD2A 2R8TA 1Y3PA 4MBPA 1QGXA 2IEEA 2YLNA 2HZLA 4ZEIA 4QFNA 4OWDA 1O63A 2FNCA 3OSQA 2RC9A 4C0RA 1ZBMA 4XIGQ 2DSFA 4H5FA 3U8QA 5CMMA 1LLSA 3PGFA 1J1NA 2O7UA 4U4SA 1SW4A 4YAHX 4NF0A 1B51A 3G3FA 1WDNA 4PDDA 4ECFA 1B9JA 1FPBA 1NV1A 2OBGA 4GX6A 4R72A 4H45A 4OTEA 2I4CA 1A54A 4GXAA 4O3BA 4N8YA 3OO7A 2HEUA 1Y1ZA 5L9OA 1OQGA 2PYYA 3OSRA 2XXTA 4GQOA 1AIVA 1FBPA 4KI0E 4MNPA 4F1VA 3C36A 2Z8EA 4JDFA 4PP0A 1NH8A 3MPKA 3HHFA 1PDAA 2CZLA 3PV0E 3QK6A 3VVEA 4QFPA 1NV6A 3KEIA 1P1NA 1Z7ME 4GD5A 3DP8A 4YB5A 1CNQA 2NXOA 4OFJA 4OXVA 3LV0A 4EQ9A 1T0KA 3D4GA 5CBSA 3ODBA 2ONRA 4H67A 4YMBA 4H0WA 3O28A 4TLLB 4EQ7A 3KSJA 3PMXA 1B1HA 4AQ4A 2CZHA 3TFLA 1M5BA 1Q9DA 1SPIA 2KR0A 4OVRA 1LGBC 5HBCA 3S9NC 4XFEA 4GWUA 1XOCA 2O84X 4PGPA 1P99A 2DOJA 5H8HB 1DK4A 4TQUQ 1LFGA 1I69A 1N84A 1L5TA 2E0SA 2VD3A 4G68C 3A3UA 1FPKA 5A5XA 2GHAA 2FVZA 2Q89A 2Z8FA 3E13X 1FJ9A 1MQDA 1HSJA 3MZBA 1MXUA 1MS7A 3KJ7A 3FGSA 1PEBA 1I6AA 3Q25A 5EYHA 3K6WA 3U72A 5F7VA 1Y3QA 4I9DA 4F3GA 3PUYE 2UVIA 3SERA 3LUYA 3KSXA 4GWSA 2XXWA 5I59A 3FJ7A 4OESA 2GQ1A 4JB7A 4P47A 3DP6A 4NMYA 1NV2A 3MC2A 3N6TA 3FBPA 3KBZA 1JETA 2VPOA 3SEXA 1FBDA 2X26A 1IXHA 3IJXB 3TMGA 2ZZXA 3QMFA 1MY2A 3UP9A 3GZGA 2HXRA 2XXHA 3PD9A 3ECRA 3I6VA 2I0CA 4MX6A 5DW8A 3PU5A 4BDNA 4U21A 2GH9A 1YXIA 3IB1A 3KOTA 2WYPA 4N6DA 2B3BA 2OWZA 5HPQA 3HPIA 3T22A 1FTJA 1FBCA 3Q28A 1GVCA 4LQ5A 1PB8A 1PB7A 4NF5B 2DWAA 2OZZA 3KFMA 1JQFA 3FD3A 4ISUA 3O97A 1URGA 1P1UA 2Z8DA 4NF6B 3C31A 2F3BA 3SEYA 4IY5A 4ZZAA 4PTKA 3D1RA 2FYIA 4FJPA 4F19A 1LEVA 5LDZA 1JW1A 5I58B 1B3GA 4OVPA 4I8CA 5FHOA 2I58A 3K1NA 3BBRA 3O66A 4YB7A 4UA8A 1TXFA 3ILTB 5H8HA 3H06B 1N3WA 1DBZA 2M8CA 3JZJA 1RYOA 1PC3A 1LBWA 2DXYA 3IOUA 2F5XA 1MDQA 1MQHA 4N13A 1MXZA 4G68B 1A7LA 4O94A 5I56A 1IMDA 4JBZA 5JTYB 3RPLB 4TOZA 2DP8A 1LSTA 3FJMA 3FIRA 3ONMA 3EF7A 4KYDA 3TQLA 4PBHA 1Y1MA 4N17A 4H5GA 4JVCA 4ZE8A 4FEDA 4N8GA 2QJEA 1QVSA 2Z22A 1A8FA 3H03A 1AOVA 3LUZA 3HV1A 4E0WA 1FPDA 2I3WA 3ISPA 1KWHA 2DE4A 2PFZA 1OVBA 4LZ8A 4YMAA 1IITA 3OEKA 5AE4A 1MPBA 2PVUA 3H6VA 1ANFA 3VLVA 1N0TA 4JWOA 5TU0A 4JWXA 4RA1A 2DWIA 5ELVA 5J16A 2BJJX 1B40A 4PF8A 1Y9UA 3HSTA 1YZ0A 1BLFA 3S4UA 3ILUB 4E0XA 4PFRA 3RUMA 1KZ8A 2UVHA 2F34A 1QJMA 3A29A 1M5DA 3EN3A 3G3JA 4ZZEA 4HE1A 2OJTA 3O6GA 2O68A 5HM4B 1MY1A 4JXIA 2L5VA 3Q27A 4RK9A 1HSEA 2ZYNA 2WKYA 4NWDA 2DS9A 2DVZA 3HHGA 1CE2A 5KDTA 3H6WA 4NF5A 3FUZA 2WX9A 3KN8A 1VE4A 3C4MA 3DELB 1RDXA 2RCBA 4ZEDA 4XKPA 3IO6A 1SI1A 1MPDA 3K1PA 2XXPA 5TPAA 4N07A 4NF6A 4I3YA 1WODA 2QSXA 3R26A 3SZPA 2KQZA 4QBAA 4KR5A 3VE1B 1FTKA 1B3LA 4BDRA 2H5YA 5I58A 4ZS9A 3TTMA 4F29A 1FTMA 3C9HA 5IZ1A 5ITPA 1SYHA 2PFYA 1IMFA 1NUXA 4GWZA 3RY3A 5B7DA 2O7IA 4I3EA 4GL0A
chains in the Genus database with same CATH topology
3U94A 4X9TA 3IB2A 5DYHA 3JV9A 1SW1A 3VVDA 1R9LA 1BIYA 4R75A 4YB6A 3PMVA 5J1DA 4G68A 1EH3A 5JTYA 2YPNA 2HZKA 5K2XA 2F7CA 3KN7A 3E3KA 2HCAA 1LCTA 4OEVA 2AYSA 2QMXA 4F3BA 3MVXA 4IO6A 4MLVA 3IJOB 3GLBA 1O64A 1DPEA 2Q2CA 1Y4TA 1H3DA 4I1DA 3Q29A 4DIGA 5L9SA 1TFDA 3S9EA 2UYFA 1JEVA 5CMBA 2ZYOA 3W15C 4EXKA 3E4RA 2ALUA 5CI5A 3L6GA 5FTHA 3CFXA 3IORA 1URDA 2F7BA 2AL5A 5H8QB 4ELOA 2R9JA 4MFIA 1D3KA 1XVXA 3T9HB 4JSDA 3T93B 2DXRA 2Y7PA 3VFJA 1QUKA 4F22A 1VR5A 3PUWE 3FVNA 3MP8A 4R6YA 1EZ9A 2HFBA 1LB8A 1DSNA 2DE2A 2P1SA 3UK4A 5AA3A 2QS2A 4ZEKA 2QRYA 2OCUA 2W7YA 1HSLA 1LAGE 1FTLA 4G2ZA 5DVJA 1LB9A 3H6TA 2XXVA 5A5XB 2HAUA 4H1XA 2Y7WA 2XXUA 2NUVA 3RT6B 4X1DA 1P1WA 1B46A 2ANJA 4BDMA 3LSLA 3VLWA 5DEXA 5I59B 3KZGA 5JEIA 4O3AA 3K01A 1ELJA 4GOTA 1AH5A 2Q9TA 1IIWA 2H98A 3I5OA 3OD7A 5CMCA 2THIA 5L9MA 4MF3A 3A3CA 3R6UA 3FVGA 1TWYA 3LSFB 3M3FA 3OEMA 1LCFA 5TP9B 3KG2A 3SEUA 1AMFA 3PUVE 3BFTA 1US5A 1BTJA 2QL3A 3V8XB 2QMWA 4ZECA 2D5WA 5ITOA 1ZKBA 2OWSA 3TCFA 4OQOA 5H8QA 2OLBA 1M5CA 4NWCA 3TUSA 1DPPA 2G29A 4F18A 3GBAA 1MXYA 1UTBA 4FAJA 1IUDA 2QS4A 2ZNSA 4OVJA 1B1XA 1MQIA 4PFUA 4POWA 2VP1A 4F2OA 3VDFA 1FW0A 1P1OA 1UIUA 2NOOA 3MWBA 5H8FA 4N6PA 5I57A 3SKPA 1R1NA 1XHYA 2V93A 5I2NA 4Q0CA 3CRBA 3U93A 4RPNA 1MXVA 4C1TA 2REGA 4PETA 4R6HA 2RF1A 1BP5A 5I56B 4G4PA 2OWTA 4G8NA 4AB5A 1JVYA 4HTGA 2XXRA 1MDP1 1IQ7A 4IO4A 1LAFE 2Y7RA 5I2KB 1FCKA 3FXRA 3QSLA 1MM7A 4IO3A 3EHTA 2GHBA 4YZZA 4KFQA 4FECA 5AA4B 2B3FA 2ZXTA 4U22A 3G7WA 1O7TA 3K1MA 3EHUA 3W9WA 3K6XA 3BFUA 1SW2A 5CRYA 2H99A 3TTLA 4F31B 1B4HA 4ONYA 2XX8A 2F7AA 2REJA 3IB0A 3LSWA 3CG1A 3S9MC 4L17A 4RPOA 2QS3A 5DT6A 3CI8A 5TP9A 2UVJA 5IAIA 1S50A 4RY1A 1XVYA 3FJGA 3UN6A 3M8UA 4WXJA 4FATA 2O69A 2ZNTA 5CBRA 2NVUB 5KDTB 4R2FA 4X48A 3IO4A 3RN8A 4YKKA 3EQ1A 4YKJA 5TPAB 3M3LA 4DZ1A 4Z0IA 1QKAA 1OVTA 3GXAA 3FVKA 1DMBA 1FQEA 3AXFA 5FTIA 4Z7EA 1Z7NE 1SDXA 1SQYA 4KCCA 1ZTYA 1PBQA 2A5SA 4RYAA 1SYIA 3TEPA 3TODA 3S9LC 3K6UA 3RTWB 3MBPA 3S2VA 3MJNA 4FIMA 1H76A 4Q5TA 3MP1A 4NF4A 3E9XA 4GIZA 2RC7A 1B7HA 3K2DA 2H25A 2CMOA 4KYSA 1OMPA 2ZNUA 3PPRA 1QULA 2V84A 1A40A 1PBPA 1UTHA 2PT1A 1SVXB 4NF8A 4LQ2A 1B5JA 3ZKKA 5I2KA 4RXLA 1ZIUA 4BLAA 3CIJA 3CVGA 2RC8A 5M2VA 3N26A 1MG1A 3PMWA 5AA4A 1NNPA 4OFLA 2YJPA 4QFOA 5FHMA 3MPLA 1XS5A 2DWHA 3U1OA 3CFZA 3G3HA 3KN3A 4BDQA 1NKXA 1Y4CA 1BKAA 2V3QA 1IXGA 3TTNA 1OQHA 3TCHA 2I6EA 3DM0A 2V3UA 3SETA 3B7DA 4EF1A 1MPCA 3CG3A 3ZSFA 5F1QA 5DTBA 3THIA 3RQTA 4GFRA 3ZKLA 1A55A 2PMSA 1B32A 5ISUA 3UA8A 1B5IA 2E1SA 1JEUA 4Q30B 3TELA 4ZDMA 5KCJB 4NTLA 1NMUA 3FZVA 2ONKE 4U1ZA 1H45A 1XC1A 3JYRA 3MZ9A 3OO6A 2D3IA 5BWJA 3LBSA 1SBPA 3CSBA 4FORA 2X7QA 2PT2A 1IXIA 2ONSA 3P7IA 1IXCA 4XKNA 5H8NB 5JK4A 3UGWA 1A99A 3QUJA 3OMBA 1SW5A 5DEXB 3B6TA 4GWOA 3MUQA 1NH7A 1H43A 2XXQA 1WVJA 4HW8A 3OENA 1JW5A 3C32A 1A8EA 3FXUA 4AB6A 4XXUA 4F2QA 1MQJA 4ZEFA 1QW0A 5L8DA 4OYVA 4R74A 3TQWA 3OXNA 1VSOA 4R2BA 4U2RA 1USYE 2VHAA 5AA1A 3MQ9A 5CMKA 2ESNA 2GRVA 4M4GA 3SEVA 2F78A 4KHZE 4QF9A 3LR1A 1B5HA 1LFHA 3T66A 5CM6A 4U4XA 3LSXA 2HQ0A 4R9FA 4THIA 2QS1A 2XX7A 2ZYMA 2F97A 3MZ1A 3PUXE 4WEDA 3O6HA 1DTZA 3H7MA 4XKQA 1EZPA 1LAXA 1ZU0A 5EYFA 1UTBB 3MP6A 1B3FA 3L6HA 3A09A 4ELPA 1YCJA 3KGCA 2I3VA 4KD5A 2RINA 1FQAA 1YPNA 4I62A 1D9VA 4OZ9A 4F1YA 3MW0A 3UORA 2Z23A 5H8FB 5KCJA 2FA7A 3TDJA 5I57B 4PFYA 2X7PA 4YKIA 4HCWA 3K4UA 5I2NB 2UVGA 3K00A 4DLDA 5EHSA 4H8IA 1OLCA 3O29A 4QFKA 4P0GA 1NL5A 4P0IA 2H4IA 3TCGA 3N5LA 2I4BA 5H8NA 3FV2A 2XXIA 3PUZE 4UACA 2HAVA 1OLAA 1P1QA 1UQWA 1NNTA 4ND9A 1R9QA 2H9BA 1N3XA 4NE4A 3MVZA 1FQFA 2DQVA 1I6QA 4QRZA 1GV8A 2RCAA 1JNFA 1B0LA 1B0HA 3EHSA 3OELA 2ZYKA 1USYH 3MVWA 4XTCQ 1DTGA 1ATGA 1XT8A 3VXBA 4F3SA 1S9TA 2XD3A 2V3TA 3F11A 3W9VA 1ZJLA 1FTOA 2DYXA 3TTKA 4F3PA 4BDLA 3QYTA 1N7XA 2P0SA 5EHMA 2O6AA 3KJTA 3RLFE 4KPTA 4EUOA 4DCXA 3K6VA 4QSDA 2Q88A 4U23A 1LBCA 4KQPA 1B7ZA 3PD8A 4U1OA 1MXWA 2AL4A 4RJZA 2XXXA 2Y7KA 4JWYA 1ZLQA 1Y20A 2VOZA 3H4ZA 4IY6A 1MH4A 4K3FA 5B70A 1JW4A 5KZTA 1EZOA 1B7UA 2DVCA 2KLFA 3TYHA 3FVOA 2XX9A 3USDA 4DCYA 3CFLA 1VFEA 3FXQA 1M5FA 5AA2A 1PB9A 4NF4B 4QFLA 2ABHA 1YAEA 3O2AA 4LATA 4IO7A 4EF2A 2O51A 5I84A 2XXYA 3Q26A 1MM6A 3KOSA 4LZ5A 1UTHB 5LOMA 1N7WA 4NF8B 1B52A 1B2HA 3G3KA 2O1LA 1IZ1A 4ESWA 3TAJA 4P11A 4QSEA 4H6DA 1N76A 1NNKA 1SI0A 3QXMA 1MQGA 4OENA 1TFAA 4O3CA 1D9YA 2VGQA 1Q35A 2Y7IA 3DP4A 4OETA 4FE8A 4DXUA 2QPQA 1B6HA 3B6WA 5AA2D 1GR2A 3C34A 3H6UA 1LFIA 5H8SA 4GXSB 3FV1A 1URSA 2R6GE 4JSOA 1I6BA 3M3KA 1M5EA 2RKMA 3VV5A 4YKPA 4DXCA 3HN0A 2F36A 2DWJA 1LBBA 4LA9A 5BUUA 4LUBA 4M1VA 1QUJA 1SD3A 4X1BA 2Q8JA 2LAOA 4BDOA 3IK6B 2G93A 4IB2A 2DE3A 4KCDA 3C33A 1Q1KA 4OFOA 3FASA 1Y3NA 4F39A 3T9UA 3V5AA 3C35A 3WAEA 4GLIA 3PPQA 4XKRA 3CR9A 3V89B 3KBRA 3FATA 3N94A 3SEWA 1ZMGA 4R9GA 4LONB 3VLUA 1CB6A 4ZE9A 2XHDA 4YU0A 3TKDA 4LZ7A 2NWJA 4DXBA 1US4A 4R73A 4H8JA 3G3IA 4EXLA 4OERA 3EPEA 3LC8A 4PFWA 2I49A 4G8MA 5CC2A 1NNFA 1MY0A 2A5TB 1NFTA 1MY3A 1B3EA 1FQDA 2F6GA 1IEJA 3TTRA 4C1UA 2I48A 3PPOA 1GTKA 3TPAA 1POY1 3OO9A 4IGTA 3IL1B 4QHQA 1DOTA 1JVXA 3O6IA 4EDPA 3RPWA 3RNNA 2I0BA 1S7YA 1UIVA 3V83A 4OEUA 4QSCA 3TZAA 3RTFB 1MXXA 3IAZA 3T9XB 1RKMA 4LP2B 5IKBA 4PE5B 1RYXA 4HS7A 3ZS6A 2Y84A 4G8HA 4GRKA 3WAFA 4KYEA 4IGRA 4IO2A 2D21A 4Q8RA 2HXWA 3IOWA 3IX1A 4POXA 4YICA 1B05A 4MLQA 2OK2A 2PX1A 2PBWA 4WEPA 2Q2AA 2UYEA 4TLMB 1FQCA 4RK2A 1MY4A 2P2AA 4F1UA 4PQJA 1B3HA 2O1MA 4LVQA 3HO7A 3PPNA 4GVOA 4ELRA 3R7XA 3MVYA 1F9BA 1QKBA 4EQBA 1LAHE 2AIXA 5DVFA 3CSGA 4ELQA 3OO8A 3UIFA 4GL8A 4NEDA 3VXCA 3GBBA 1YTVA 3N6UA 3K02A 4PFTA 1EU8A 3QUFA 3RGYA 3IR1A 4H65A 5FHNA 2V25A 3T9VA 3BKIB 4OHNA 1VFDA 4HCYA 3IOTA 1B4ZA 2A5TA 3U92A 1R6ZA 1FQBA 4DE8A 2GFEA 2B65A 3MAMA 1D4NA 3DLNA 1POTA 3I3VA 4ESXA 1GGGA 3QAXA 4G77A 3H3GA 3IOVA 3VVFA 2UXAA 1OIBA 1MH3A 4DDDA 3O9PA 3SESA 2ZMBA 3SDFA 4ZEBA 5ICQA 5ICTA 3G3GA 2F6PA 4FEBA 3RT8A 2VD2A 5K2YA 1MRPA 4OMBA 3B6QA 1B58A 1II5A 4GF8A 1N04A 4IO5A 3K0VA 2IA4A 3D4CA 3OOAA 5DVIA 4RNSA 1AL3A 1QUIA 4R6KA 3HCQA 3T96B 4MH5A 2R71A 2F8DA 1H44A 4WKMA 5AA2B 3PPPA 2F35A 1TT1A 2XD2A 1Y3PA 4MBPA 2IEEA 2YLNA 2HZLA 4ZEIA 4QFNA 4OWDA 1O63A 2FNCA 3OSQA 2RC9A 4C0RA 1ZBMA 4XIGQ 2DSFA 4H5FA 3U8QA 5CMMA 1LLSA 3PGFA 1J1NA 2O7UA 4U4SA 1SW4A 4YAHX 1B51A 3G3FA 1WDNA 4ECFA 1B9JA 2OBGA 4R72A 4OTEA 2I4CA 1A54A 4GXAA 4O3BA 3OO7A 2HEUA 1Y1ZA 5L9OA 1OQGA 2PYYA 3OSRA 2XXTA 4GQOA 1AIVA 4KI0E 4F1VA 3C36A 2Z8EA 4JDFA 4PP0A 1NH8A 3MPKA 3HHFA 1PDAA 2CZLA 3PV0E 3QK6A 3VVEA 4QFPA 3KEIA 1P1NA 1Z7ME 4GD5A 3DP8A 4YB5A 2NXOA 4OFJA 4OXVA 4EQ9A 1T0KA 3D4GA 5CBSA 3ODBA 2ONRA 4H67A 4YMBA 4H0WA 3O28A 4TLLB 4EQ7A 3KSJA 3PMXA 1B1HA 4AQ4A 3TFLA 1M5BA 1LGBC 5HBCA 3S9NC 1XOCA 2O84X 1P99A 2DOJA 5H8HB 4TQUQ 1LFGA 1I69A 1N84A 1L5TA 2E0SA 2VD3A 4G68C 3A3UA 5A5XA 2GHAA 2Q89A 2Z8FA 3E13X 1MQDA 1HSJA 3MZBA 1MXUA 1MS7A 3KJ7A 3FGSA 1PEBA 1I6AA 3Q25A 3K6WA 3U72A 5F7VA 1Y3QA 4I9DA 4F3GA 3PUYE 2UVIA 3SERA 3LUYA 3KSXA 2XXWA 5I59A 3FJ7A 4OESA 4JB7A 3DP6A 4NMYA 3MC2A 3N6TA 1JETA 3SEXA 2X26A 1IXHA 3IJXB 3TMGA 1MY2A 3UP9A 3GZGA 2XXHA 3PD9A 3ECRA 3I6VA 2I0CA 3PU5A 4BDNA 4U21A 2GH9A 3IB1A 3KOTA 2B3BA 5HPQA 3HPIA 3T22A 1FTJA 3Q28A 1GVCA 4LQ5A 1PB8A 1PB7A 4NF5B 2DWAA 2OZZA 3KFMA 1JQFA 3FD3A 4ISUA 3O97A 1URGA 1P1UA 2Z8DA 4NF6B 3C31A 3SEYA 4IY5A 4ZZAA 2FYIA 4FJPA 4F19A 1JW1A 5I58B 1B3GA 4I8CA 5FHOA 2I58A 3K1NA 3BBRA 3O66A 4YB7A 4UA8A 1TXFA 3ILTB 5H8HA 3H06B 1N3WA 2M8CA 3JZJA 1RYOA 1PC3A 2DXYA 3IOUA 2F5XA 1MDQA 1MQHA 4N13A 1MXZA 4G68B 1A7LA 5I56A 4JBZA 5JTYB 4TOZA 2DP8A 1LSTA 3FJMA 3FIRA 3ONMA 3EF7A 4KYDA 3TQLA 1Y1MA 4H5GA 4ZE8A 4FEDA 2QJEA 1QVSA 2Z22A 1A8FA 3H03A 1AOVA 3HV1A 4E0WA 2I3WA 1KWHA 2DE4A 1OVBA 4LZ8A 4YMAA 1IITA 3OEKA 5AE4A 1MPBA 2PVUA 3H6VA 1ANFA 3VLVA 1N0TA 4JWOA 5TU0A 4JWXA 4RA1A 2DWIA 5ELVA 2BJJX 1B40A 1Y9UA 3HSTA 1BLFA 3S4UA 3ILUB 4E0XA 3RUMA 2UVHA 2F34A 1QJMA 1M5DA 3EN3A 3G3JA 4ZZEA 2OJTA 3O6GA 2O68A 5HM4B 1MY1A 4JXIA 3Q27A 4RK9A 1HSEA 2ZYNA 2WKYA 4NWDA 2DS9A 2DVZA 3HHGA 1CE2A 5KDTA 3H6WA 4NF5A 3FUZA 3KN8A 1VE4A 3C4MA 3DELB 2RCBA 4ZEDA 4XKPA 3IO6A 1SI1A 1MPDA 3K1PA 2XXPA 5TPAA 4N07A 4NF6A 1WODA 2QSXA 3R26A 4KR5A 3VE1B 1FTKA 1B3LA 4BDRA 2H5YA 5I58A 4ZS9A 3TTMA 4F29A 1FTMA 3C9HA 5ITPA 1SYHA 3RY3A 5B7DA 2O7IA 3QIMA 4GL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U94 A;  4X9T A;  3IB2 A;  5DYH A;  3JV9 A;  1SW1 A;  3VVD A;  1R9L A;  1BIY A;  4R75 A;  4YB6 A;  3PMV A;  5J1D A;  4G68 A;  1EH3 A;  5JTY A;  2YPN A;  2HZK A;  5K2X A;  2F7C A;  3KN7 A;  3E3K A;  2HCA A;  1LCT A;  4OEV A;  2AYS A;  2QMX A;  4F3B A;  3MVX A;  4IO6 A;  4MLV A;  3IJO B;  3GLB A;  1O64 A;  1DPE A;  2Q2C A;  1Y4T A;  1H3D A;  4I1D A;  3Q29 A;  4DIG A;  5L9S A;  1TFD A;  3S9E A;  2UYF A;  1JEV A;  5CMB A;  2ZYO A;  3W15 C;  4EXK A;  3E4R A;  2ALU A;  5CI5 A;  3L6G A;  5FTH A;  3CFX A;  3IOR A;  1URD A;  2F7B A;  2AL5 A;  5H8Q B;  4ELO A;  2R9J A;  4MFI A;  1D3K A;  1XVX A;  3T9H B;  4JSD A;  3T93 B;  2DXR A;  2Y7P A;  3VFJ A;  1QUK A;  4F22 A;  1VR5 A;  3PUW E;  3FVN A;  3MP8 A;  4R6Y A;  1EZ9 A;  2HFB A;  1LB8 A;  1DSN A;  2DE2 A;  2P1S A;  3UK4 A;  5AA3 A;  2QS2 A;  4ZEK A;  2QRY A;  2OCU A;  2W7Y A;  1HSL A;  1LAG E;  1FTL A;  4G2Z A;  5DVJ A;  1LB9 A;  3H6T A;  2XXV A;  5A5X B;  2HAU A;  4H1X A;  2Y7W A;  2XXU A;  2NUV A;  3RT6 B;  4X1D A;  1P1W A;  1B46 A;  2ANJ A;  4BDM A;  3LSL A;  3VLW A;  5DEX A;  5I59 B;  3KZG A;  5JEI A;  4O3A A;  3K01 A;  1ELJ A;  4GOT A;  1AH5 A;  2Q9T A;  1IIW A;  2H98 A;  3I5O A;  3OD7 A;  5CMC A;  2THI A;  5L9M A;  4MF3 A;  3A3C A;  3R6U A;  3FVG A;  1TWY A;  3LSF B;  3M3F A;  3OEM A;  1LCF A;  5TP9 B;  3KG2 A;  3SEU A;  1AMF A;  3PUV E;  3BFT A;  1US5 A;  1BTJ A;  2QL3 A;  3V8X B;  2QMW A;  4ZEC A;  2D5W A;  5ITO A;  1ZKB A;  2OWS A;  3TCF A;  4OQO A;  5H8Q A;  2OLB A;  1M5C A;  4NWC A;  3TUS A;  1DPP A;  2G29 A;  4F18 A;  3GBA A;  1MXY A;  1UTB A;  4FAJ A;  1IUD A;  2QS4 A;  2ZNS A;  4OVJ A;  1B1X A;  1MQI A;  4PFU A;  4POW A;  2VP1 A;  4F2O A;  3VDF A;  1FW0 A;  1P1O A;  1UIU A;  2NOO A;  3MWB A;  5H8F A;  4N6P A;  5I57 A;  3SKP A;  1R1N A;  1XHY A;  2V93 A;  5I2N A;  4Q0C A;  3CRB A;  3U93 A;  4RPN A;  1MXV A;  4C1T A;  2REG A;  4PET A;  4R6H A;  2RF1 A;  1BP5 A;  5I56 B;  4G4P A;  2OWT A;  4G8N A;  4AB5 A;  1JVY A;  4HTG A;  2XXR A;  1MDP 1;  1IQ7 A;  4IO4 A;  1LAF E;  2Y7R A;  5I2K B;  1FCK A;  3FXR A;  3QSL A;  1MM7 A;  4IO3 A;  3EHT A;  2GHB A;  4YZZ A;  4KFQ A;  4FEC A;  5AA4 B;  2B3F A;  2ZXT A;  4U22 A;  3G7W A;  1O7T A;  3K1M A;  3EHU A;  3W9W A;  3K6X A;  3BFU A;  1SW2 A;  5CRY A;  2H99 A;  3TTL A;  4F31 B;  1B4H A;  4ONY A;  2XX8 A;  2F7A A;  2REJ A;  3IB0 A;  3LSW A;  3CG1 A;  3S9M C;  4L17 A;  4RPO A;  2QS3 A;  5DT6 A;  3CI8 A;  5TP9 A;  2UVJ A;  5IAI A;  1S50 A;  4RY1 A;  1XVY A;  3FJG A;  3UN6 A;  3M8U A;  4WXJ A;  4FAT A;  2O69 A;  2ZNT A;  5CBR A;  2NVU B;  5KDT B;  4R2F A;  4X48 A;  3IO4 A;  3RN8 A;  4YKK A;  3EQ1 A;  4YKJ A;  5TPA B;  3M3L A;  4DZ1 A;  4Z0I A;  1QKA A;  1OVT A;  3GXA A;  3FVK A;  1DMB A;  1FQE A;  3AXF A;  5FTI A;  4Z7E A;  1Z7N E;  1SDX A;  1SQY A;  4KCC A;  1ZTY A;  1PBQ A;  2A5S A;  4RYA A;  1SYI A;  3TEP A;  3TOD A;  3S9L C;  3K6U A;  3RTW B;  3MBP A;  3S2V A;  3MJN A;  4FIM A;  1H76 A;  4Q5T A;  3MP1 A;  4NF4 A;  3E9X A;  4GIZ A;  2RC7 A;  1B7H A;  3K2D A;  2H25 A;  2CMO A;  4KYS A;  1OMP A;  2ZNU A;  3PPR A;  1QUL A;  2V84 A;  1A40 A;  1PBP A;  1UTH A;  2PT1 A;  1SVX B;  4NF8 A;  4LQ2 A;  1B5J A;  3ZKK A;  5I2K A;  4RXL A;  1ZIU A;  4BLA A;  3CIJ A;  3CVG A;  2RC8 A;  5M2V A;  3N26 A;  1MG1 A;  3PMW A;  5AA4 A;  1NNP A;  4OFL A;  2YJP A;  4QFO A;  5FHM A;  3MPL A;  1XS5 A;  2DWH A;  3U1O A;  3CFZ A;  3G3H A;  3KN3 A;  4BDQ A;  1NKX A;  1Y4C A;  1BKA A;  2V3Q A;  1IXG A;  3TTN A;  1OQH A;  3TCH A;  2I6E A;  3DM0 A;  2V3U A;  3SET A;  3B7D A;  4EF1 A;  1MPC A;  3CG3 A;  3ZSF A;  5F1Q A;  5DTB A;  3THI A;  3RQT A;  4GFR A;  3ZKL A;  1A55 A;  2PMS A;  1B32 A;  5ISU A;  3UA8 A;  1B5I A;  2E1S A;  1JEU A;  4Q30 B;  3TEL A;  4ZDM A;  5KCJ B;  4NTL A;  1NMU A;  3FZV A;  2ONK E;  4U1Z A;  1H45 A;  1XC1 A;  3JYR A;  3MZ9 A;  3OO6 A;  2D3I A;  5BWJ A;  3LBS A;  1SBP A;  3CSB A;  4FOR A;  2X7Q A;  2PT2 A;  1IXI A;  2ONS A;  3P7I A;  1IXC A;  4XKN A;  5H8N B;  5JK4 A;  3UGW A;  1A99 A;  3QUJ A;  3OMB A;  1SW5 A;  5DEX B;  3B6T A;  4GWO A;  3MUQ A;  1NH7 A;  1H43 A;  2XXQ A;  1WVJ A;  4HW8 A;  3OEN A;  1JW5 A;  3C32 A;  1A8E A;  3FXU A;  4AB6 A;  4XXU A;  4F2Q A;  1MQJ A;  4ZEF A;  1QW0 A;  5L8D A;  4OYV A;  4R74 A;  3TQW A;  3OXN A;  1VSO A;  4R2B A;  4U2R A;  1USY E;  2VHA A;  5AA1 A;  3MQ9 A;  5CMK A;  2ESN A;  2GRV A;  4M4G A;  3SEV A;  2F78 A;  4KHZ E;  4QF9 A;  3LR1 A;  1B5H A;  1LFH A;  3T66 A;  5CM6 A;  4U4X A;  3LSX A;  2HQ0 A;  4R9F A;  4THI A;  2QS1 A;  2XX7 A;  2ZYM A;  2F97 A;  3MZ1 A;  3PUX E;  4WED A;  3O6H A;  1DTZ A;  3H7M A;  4XKQ A;  1EZP A;  1LAX A;  1ZU0 A;  5EYF A;  1UTB B;  3MP6 A;  1B3F A;  3L6H A;  3A09 A;  4ELP A;  1YCJ A;  3KGC A;  2I3V A;  4KD5 A;  2RIN A;  1FQA A;  1YPN A;  4I62 A;  1D9V A;  4OZ9 A;  4F1Y A;  3MW0 A;  3UOR A;  2Z23 A;  5H8F B;  5KCJ A;  2FA7 A;  3TDJ A;  5I57 B;  4PFY A;  2X7P A;  4YKI A;  4HCW A;  3K4U A;  5I2N B;  2UVG A;  3K00 A;  4DLD A;  5EHS A;  4H8I A;  1OLC A;  3O29 A;  4QFK A;  4P0G A;  1NL5 A;  4P0I A;  2H4I A;  3TCG A;  3N5L A;  2I4B A;  5H8N A;  3FV2 A;  2XXI A;  3PUZ E;  4UAC A;  2HAV A;  1OLA A;  1P1Q A;  1UQW A;  1NNT A;  4ND9 A;  1R9Q A;  2H9B A;  1N3X A;  4NE4 A;  3MVZ A;  1FQF A;  2DQV A;  1I6Q A;  4QRZ A;  1GV8 A;  2RCA A;  1JNF A;  1B0L A;  1B0H A;  3EHS A;  3OEL A;  2ZYK A;  1USY H;  3MVW A;  4XTC Q;  1DTG A;  1ATG A;  1XT8 A;  3VXB A;  4F3S A;  1S9T A;  2XD3 A;  2V3T A;  3F11 A;  3W9V A;  1ZJL A;  1FTO A;  2DYX A;  3TTK A;  4F3P A;  4BDL A;  3QYT A;  1N7X A;  2P0S A;  5EHM A;  2O6A A;  3KJT A;  3RLF E;  4KPT A;  4EUO A;  4DCX A;  3K6V A;  4QSD A;  2Q88 A;  4U23 A;  1LBC A;  4KQP A;  1B7Z A;  3PD8 A;  4U1O A;  1MXW A;  2AL4 A;  4RJZ A;  2XXX A;  2Y7K A;  4JWY A;  1ZLQ A;  1Y20 A;  2VOZ A;  3H4Z A;  4IY6 A;  1MH4 A;  4K3F A;  5B70 A;  1JW4 A;  5KZT A;  1EZO A;  1B7U A;  2DVC A;  2KLF A;  3TYH A;  3FVO A;  2XX9 A;  3USD A;  4DCY A;  3CFL A;  1VFE A;  3FXQ A;  1M5F A;  5AA2 A;  1PB9 A;  4NF4 B;  4QFL A;  2ABH A;  1YAE A;  3O2A A;  4LAT A;  4IO7 A;  4EF2 A;  2O51 A;  5I84 A;  2XXY A;  3Q26 A;  1MM6 A;  3KOS A;  4LZ5 A;  1UTH B;  5LOM A;  1N7W A;  4NF8 B;  1B52 A;  1B2H A;  3G3K A;  2O1L A;  1IZ1 A;  4ESW A;  3TAJ A;  4P11 A;  4QSE A;  4H6D A;  1N76 A;  1NNK A;  1SI0 A;  3QXM A;  1MQG A;  4OEN A;  1TFA A;  4O3C A;  1D9Y A;  2VGQ A;  1Q35 A;  2Y7I A;  3DP4 A;  4OET A;  4FE8 A;  4DXU A;  2QPQ A;  1B6H A;  3B6W A;  5AA2 D;  1GR2 A;  3C34 A;  3H6U A;  1LFI A;  5H8S A;  4GXS B;  3FV1 A;  1URS A;  2R6G E;  4JSO A;  1I6B A;  3M3K A;  1M5E A;  2RKM A;  3VV5 A;  4YKP A;  4DXC A;  3HN0 A;  2F36 A;  2DWJ A;  1LBB A;  4LA9 A;  5BUU A;  4LUB A;  4M1V A;  1QUJ A;  1SD3 A;  4X1B A;  2Q8J A;  2LAO A;  4BDO A;  3IK6 B;  2G93 A;  4IB2 A;  2DE3 A;  4KCD A;  3C33 A;  1Q1K A;  4OFO A;  3FAS A;  1Y3N A;  4F39 A;  3T9U A;  3V5A A;  3C35 A;  3WAE A;  4GLI A;  3PPQ A;  4XKR A;  3CR9 A;  3V89 B;  3KBR A;  3FAT A;  3N94 A;  3SEW A;  1ZMG A;  4R9G A;  4LON B;  3VLU A;  1CB6 A;  4ZE9 A;  2XHD A;  4YU0 A;  3TKD A;  4LZ7 A;  2NWJ A;  4DXB A;  1US4 A;  4R73 A;  4H8J A;  3G3I A;  4EXL A;  4OER A;  3EPE A;  3LC8 A;  4PFW A;  2I49 A;  4G8M A;  5CC2 A;  1NNF A;  1MY0 A;  2A5T B;  1NFT A;  1MY3 A;  1B3E A;  1FQD A;  2F6G A;  1IEJ A;  3TTR A;  4C1U A;  2I48 A;  3PPO A;  1GTK A;  3TPA A;  1POY 1;  3OO9 A;  4IGT A;  3IL1 B;  4QHQ A;  1DOT A;  1JVX A;  3O6I A;  4EDP A;  3RPW A;  3RNN A;  2I0B A;  1S7Y A;  1UIV A;  3V83 A;  4OEU A;  4QSC A;  3TZA A;  3RTF B;  1MXX A;  3IAZ A;  3T9X B;  1RKM A;  4LP2 B;  5IKB A;  4PE5 B;  1RYX A;  4HS7 A;  3ZS6 A;  2Y84 A;  4G8H A;  4GRK A;  3WAF A;  4KYE A;  4IGR A;  4IO2 A;  2D21 A;  4Q8R A;  2HXW A;  3IOW A;  3IX1 A;  4POX A;  4YIC A;  1B05 A;  4MLQ A;  2OK2 A;  2PX1 A;  2PBW A;  4WEP A;  2Q2A A;  2UYE A;  4TLM B;  1FQC A;  4RK2 A;  1MY4 A;  2P2A A;  4F1U A;  4PQJ A;  1B3H A;  2O1M A;  4LVQ A;  3HO7 A;  3PPN A;  4GVO A;  4ELR A;  3R7X A;  3MVY A;  1F9B A;  1QKB A;  4EQB A;  1LAH E;  2AIX A;  5DVF A;  3CSG A;  4ELQ A;  3OO8 A;  3UIF A;  4GL8 A;  4NED A;  3VXC A;  3GBB A;  1YTV A;  3N6U A;  3K02 A;  4PFT A;  1EU8 A;  3QUF A;  3RGY A;  3IR1 A;  4H65 A;  5FHN A;  2V25 A;  3T9V A;  3BKI B;  4OHN A;  1VFD A;  4HCY A;  3IOT A;  1B4Z A;  2A5T A;  3U92 A;  1R6Z A;  1FQB A;  4DE8 A;  2GFE A;  2B65 A;  3MAM A;  1D4N A;  3DLN A;  1POT A;  3I3V A;  4ESX A;  1GGG A;  3QAX A;  4G77 A;  3H3G A;  3IOV A;  3VVF A;  2UXA A;  1OIB A;  1MH3 A;  4DDD A;  3O9P A;  3SES A;  2ZMB A;  3SDF A;  4ZEB A;  5ICQ A;  5ICT A;  3G3G A;  2F6P A;  4FEB A;  3RT8 A;  2VD2 A;  5K2Y A;  1MRP A;  4OMB A;  3B6Q A;  1B58 A;  1II5 A;  4GF8 A;  1N04 A;  4IO5 A;  3K0V A;  2IA4 A;  3D4C A;  3OOA A;  5DVI A;  4RNS A;  1AL3 A;  1QUI A;  4R6K A;  3HCQ A;  3T96 B;  4MH5 A;  2R71 A;  2F8D A;  1H44 A;  4WKM A;  5AA2 B;  3PPP A;  2F35 A;  1TT1 A;  2XD2 A;  1Y3P A;  4MBP A;  2IEE A;  2YLN A;  2HZL A;  4ZEI A;  4QFN A;  4OWD A;  1O63 A;  2FNC A;  3OSQ A;  2RC9 A;  4C0R A;  1ZBM A;  4XIG Q;  2DSF A;  4H5F A;  3U8Q A;  5CMM A;  1LLS A;  3PGF A;  1J1N A;  2O7U A;  4U4S A;  1SW4 A;  4YAH X;  1B51 A;  3G3F A;  1WDN A;  4ECF A;  1B9J A;  2OBG A;  4R72 A;  4OTE A;  2I4C A;  1A54 A;  4GXA A;  4O3B A;  3OO7 A;  2HEU A;  1Y1Z A;  5L9O A;  1OQG A;  2PYY A;  3OSR A;  2XXT A;  4GQO A;  1AIV A;  4KI0 E;  4F1V A;  3C36 A;  2Z8E A;  4JDF A;  4PP0 A;  1NH8 A;  3MPK A;  3HHF A;  1PDA A;  2CZL A;  3PV0 E;  3QK6 A;  3VVE A;  4QFP A;  3KEI A;  1P1N A;  1Z7M E;  4GD5 A;  3DP8 A;  4YB5 A;  2NXO A;  4OFJ A;  4OXV A;  4EQ9 A;  1T0K A;  3D4G A;  5CBS A;  3ODB A;  2ONR A;  4H67 A;  4YMB A;  4H0W A;  3O28 A;  4TLL B;  4EQ7 A;  3KSJ A;  3PMX A;  1B1H A;  4AQ4 A;  3TFL A;  1M5B A;  1LGB C;  5HBC A;  3S9N C;  1XOC A;  2O84 X;  1P99 A;  2DOJ A;  5H8H B;  4TQU Q;  1LFG A;  1I69 A;  1N84 A;  1L5T A;  2E0S A;  2VD3 A;  4G68 C;  3A3U A;  5A5X A;  2GHA A;  2Q89 A;  2Z8F A;  3E13 X;  1MQD A;  1HSJ A;  3MZB A;  1MXU A;  1MS7 A;  3KJ7 A;  3FGS A;  1PEB A;  1I6A A;  3Q25 A;  3K6W A;  3U72 A;  5F7V A;  1Y3Q A;  4I9D A;  4F3G A;  3PUY E;  2UVI A;  3SER A;  3LUY A;  3KSX A;  2XXW A;  5I59 A;  3FJ7 A;  4OES A;  4JB7 A;  3DP6 A;  4NMY A;  3MC2 A;  3N6T A;  1JET A;  3SEX A;  2X26 A;  1IXH A;  3IJX B;  3TMG A;  1MY2 A;  3UP9 A;  3GZG A;  2XXH A;  3PD9 A;  3ECR A;  3I6V A;  2I0C A;  3PU5 A;  4BDN A;  4U21 A;  2GH9 A;  3IB1 A;  3KOT A;  2B3B A;  5HPQ A;  3HPI A;  3T22 A;  1FTJ A;  3Q28 A;  1GVC A;  4LQ5 A;  1PB8 A;  1PB7 A;  4NF5 B;  2DWA A;  2OZZ A;  3KFM A;  1JQF A;  3FD3 A;  4ISU A;  3O97 A;  1URG A;  1P1U A;  2Z8D A;  4NF6 B;  3C31 A;  3SEY A;  4IY5 A;  4ZZA A;  2FYI A;  4FJP A;  4F19 A;  1JW1 A;  5I58 B;  1B3G A;  4I8C A;  5FHO A;  2I58 A;  3K1N A;  3BBR A;  3O66 A;  4YB7 A;  4UA8 A;  1TXF A;  3ILT B;  5H8H A;  3H06 B;  1N3W A;  2M8C A;  3JZJ A;  1RYO A;  1PC3 A;  2DXY A;  3IOU A;  2F5X A;  1MDQ A;  1MQH A;  4N13 A;  1MXZ A;  4G68 B;  1A7L A;  5I56 A;  4JBZ A;  5JTY B;  4TOZ A;  2DP8 A;  1LST A;  3FJM A;  3FIR A;  3ONM A;  3EF7 A;  4KYD A;  3TQL A;  1Y1M A;  4H5G A;  4ZE8 A;  4FED A;  2QJE A;  1QVS A;  2Z22 A;  1A8F A;  3H03 A;  1AOV A;  3HV1 A;  4E0W A;  2I3W A;  1KWH A;  2DE4 A;  1OVB A;  4LZ8 A;  4YMA A;  1IIT A;  3OEK A;  5AE4 A;  1MPB A;  2PVU A;  3H6V A;  1ANF A;  3VLV A;  1N0T A;  4JWO A;  5TU0 A;  4JWX A;  4RA1 A;  2DWI A;  5ELV A;  2BJJ X;  1B40 A;  1Y9U A;  3HST A;  1BLF A;  3S4U A;  3ILU B;  4E0X A;  3RUM A;  2UVH A;  2F34 A;  1QJM A;  1M5D A;  3EN3 A;  3G3J A;  4ZZE A;  2OJT A;  3O6G A;  2O68 A;  5HM4 B;  1MY1 A;  4JXI A;  3Q27 A;  4RK9 A;  1HSE A;  2ZYN A;  2WKY A;  4NWD A;  2DS9 A;  2DVZ A;  3HHG A;  1CE2 A;  5KDT A;  3H6W A;  4NF5 A;  3FUZ A;  3KN8 A;  1VE4 A;  3C4M A;  3DEL B;  2RCB A;  4ZED A;  4XKP A;  3IO6 A;  1SI1 A;  1MPD A;  3K1P A;  2XXP A;  5TPA A;  4N07 A;  4NF6 A;  1WOD A;  2QSX A;  3R26 A;  4KR5 A;  3VE1 B;  1FTK A;  1B3L A;  4BDR A;  2H5Y A;  5I58 A;  4ZS9 A;  3TTM A;  4F29 A;  1FTM A;  3C9H A;  5ITP A;  1SYH A;  3RY3 A;  5B7D A;  2O7I A;  3QIM A;  4GL0 A; 
#chains in the Genus database with same CATH topology
 3U94 A;  4X9T A;  3E79 A;  3IB2 A;  5DYH A;  1FTA A;  3JV9 A;  1SW1 A;  3VVD A;  1R9L A;  1BIY A;  3MYU A;  4R75 A;  4YB6 A;  3PMV A;  5J1D A;  4G68 A;  1BK4 A;  1EH3 A;  4AS5 A;  2Q74 A;  3RPL A;  5JTY A;  2YPN A;  2HZK A;  1EYK A;  5K2X A;  4PBQ A;  2F7C A;  3KN7 A;  3E3K A;  2HCA A;  4PCD A;  1LCT A;  4OEV A;  4NAP A;  1FSA A;  2AYS A;  2QMX A;  4F3B A;  1JP4 A;  3MVX A;  4IO6 A;  4MLV A;  3IJO B;  3GLB A;  5EYG A;  1O64 A;  2QFL A;  1DPE A;  2ZZV A;  5ESY A;  2Q2C A;  1Y4T A;  1H3D A;  4I1D A;  3Q29 A;  4DIG A;  5L9S A;  3PTY A;  1TFD A;  3S9E A;  2UYF A;  1JEV A;  5CMB A;  2ZYO A;  3W15 C;  4EXK A;  3E4R A;  2ALU A;  5CI5 A;  3L6G A;  5FTH A;  3CFX A;  3IOR A;  1URD A;  2F7B A;  3RYD A;  2AL5 A;  5H8Q B;  4ELO A;  2R9J A;  4MFI A;  4HE0 A;  1D3K A;  1XVX A;  3T9H B;  4JSD A;  3T93 B;  2DXR A;  2Y7P A;  3VFJ A;  1QUK A;  4F22 A;  1VR5 A;  3PUW E;  3FVN A;  3MP8 A;  4R6Y A;  1EZ9 A;  2HFB A;  1LB8 A;  1DSN A;  2DE2 A;  1IMC A;  2BJI A;  2P1S A;  4N6K A;  1IMA A;  3UK4 A;  4H46 A;  5AA3 A;  2QS2 A;  4ZEK A;  2QRY A;  4N81 A;  2OCU A;  2W7Y A;  1HSL A;  1LAG E;  1FTL A;  4G2Z A;  5DVJ A;  1LB9 A;  3H6T A;  2XXV A;  5A5X B;  2HAU A;  4H1X A;  2Y7W A;  2XXU A;  4PAI A;  2NUV A;  3RT6 B;  1LBY A;  4X1D A;  1P1W A;  1B46 A;  2ANJ A;  4BDM A;  3LSL A;  3VLW A;  5DEX A;  5I59 B;  1YYZ A;  3KZG A;  5JEI A;  5I7I A;  4O3A A;  4PC9 A;  4OVT A;  5EQ8 A;  3K01 A;  1ELJ A;  2WEF A;  4GOT A;  1AH5 A;  3E78 A;  2Q9T A;  1IIW A;  2B4L A;  2V4C A;  2H98 A;  3I5O A;  3OD7 A;  4GWY A;  1NV3 A;  4GBV A;  5CMC A;  2THI A;  4MHF A;  5L9M A;  4MF3 A;  3A3C A;  2XWK A;  3R6U A;  3FVG A;  4OVS A;  1TWY A;  1FPG A;  3LSF B;  3M3F A;  2CZI A;  4O7M A;  3OEM A;  1LCF A;  5TP9 B;  3KG2 A;  3SEU A;  1AMF A;  3PUV E;  2DDK A;  3BFT A;  1US5 A;  1EYI A;  1BTJ A;  2QL3 A;  3V8X B;  2QMW A;  4ZEC A;  2D5W A;  5ITO A;  1IME A;  1ZKB A;  2Y5L A;  2OWS A;  3TCF A;  4OQO A;  1FBH A;  5H8Q A;  2OLB A;  1M5C A;  1G0H A;  4NWC A;  4AS4 A;  3TUS A;  5EQ7 A;  1DPP A;  2G29 A;  3B8B A;  4F18 A;  3GBA A;  1MXY A;  1UTB A;  4FAJ A;  1IUD A;  2QS4 A;  2ZNS A;  4OVJ A;  1B1X A;  3IFA A;  1MQI A;  4PFU A;  4POW A;  2VP1 A;  4F2O A;  3VDF A;  1FW0 A;  1P1O A;  1UIU A;  2NOO A;  2VT5 A;  3T0J A;  3MWB A;  5H8F A;  4N6P A;  5I57 A;  3SKP A;  1FPL A;  1R1N A;  1XHY A;  2V93 A;  5I2N A;  4Q0C A;  3CRB A;  3U93 A;  4RPN A;  5ET7 A;  5FBP A;  1MXV A;  4C1T A;  2REG A;  4PET A;  4R6H A;  2RF1 A;  1BP5 A;  4PFB A;  5I56 B;  4G4P A;  2OWT A;  4G8N A;  4AB5 A;  2PCR A;  1JVY A;  4HTG A;  2XXR A;  1MDP 1;  1IQ7 A;  4IO4 A;  1LAF E;  1FBF A;  2Y7R A;  5I2K B;  1FCK A;  3FXR A;  3QSL A;  1MM7 A;  4IO3 A;  3EHT A;  2GHB A;  1FPF A;  5T3J A;  4YZZ A;  4KFQ A;  4FEC A;  5AA4 B;  2B3F A;  2ZXT A;  4U22 A;  3G7W A;  1O7T A;  3K1M A;  4UAB A;  3EHU A;  3W9W A;  3K6X A;  3BFU A;  1SW2 A;  5CRY A;  2H99 A;  3TTL A;  4F31 B;  1B4H A;  4ONY A;  2XX8 A;  2F7A A;  2REJ A;  3IB0 A;  3LSW A;  3CG1 A;  3S9M C;  4L17 A;  4RPO A;  2QS3 A;  5DT6 A;  3CI8 A;  2VPN A;  5TP9 A;  2UVJ A;  5IAI A;  1S50 A;  4RY1 A;  1XVY A;  3FJG A;  3UN6 A;  3M8U A;  4WXJ A;  2JJK A;  4FAT A;  2O69 A;  2ZNT A;  5CBR A;  3ROJ A;  2NVU B;  5KDT B;  4R2F A;  2P3V A;  4X48 A;  4KXP A;  3IO4 A;  3RN8 A;  4YKK A;  4MCO A;  3EQ1 A;  4YKJ A;  4NGU A;  4XEQ A;  5TPA B;  3M3L A;  4DZ1 A;  4Z0I A;  1QKA A;  1OVT A;  2ZZW A;  3GXA A;  4G61 A;  3FVK A;  1DMB A;  3IFC A;  1FQE A;  3AXF A;  5FTI A;  4Z7E A;  1Z7N E;  1SDX A;  1SQY A;  2CEX A;  4KCC A;  1ZTY A;  1PBQ A;  2A5S A;  4RYA A;  1SYI A;  3TEP A;  3TOD A;  3S9L C;  3K6U A;  1RDY A;  3RTW B;  3MBP A;  3S2V A;  3MJN A;  4FIM A;  1H76 A;  4Q5T A;  3MP1 A;  4NF4 A;  2QVU A;  3E9X A;  4GIZ A;  2RC7 A;  1B7H A;  3K2D A;  2H25 A;  2CMO A;  4KYS A;  1OMP A;  2ZNU A;  3PPR A;  1QUL A;  2V84 A;  1A40 A;  5EQA A;  1IMB A;  1FRP A;  1PBP A;  1UTH A;  2PT1 A;  1SVX B;  4NF8 A;  4LQ2 A;  1B5J A;  3ZKK A;  4IR8 A;  5I2K A;  4RXL A;  1ZIU A;  4BLA A;  3CIJ A;  3CVG A;  2RC8 A;  5M2V A;  3N26 A;  1MG1 A;  3PMW A;  5AA4 A;  4LN5 A;  2F3D A;  1NNP A;  4OFL A;  2YJP A;  4QFO A;  5FHM A;  3MPL A;  1XS5 A;  2DWH A;  3U1O A;  3CFZ A;  3G3H A;  3KN3 A;  4BDQ A;  1NKX A;  1Y4C A;  1BKA A;  2V3Q A;  1IXG A;  3TTN A;  1OQH A;  1NV0 A;  4QXD A;  3TCH A;  2I6E A;  3DM0 A;  2V3U A;  4P56 A;  3SET A;  3B7D A;  4EF1 A;  1MPC A;  3CG3 A;  3ZSF A;  5F1Q A;  5DTB A;  3THI A;  3RQT A;  4GFR A;  3ZKL A;  4JVI A;  1A55 A;  2PMS A;  1B32 A;  5ISU A;  3UA8 A;  1B5I A;  2E1S A;  4P1L A;  1INP A;  1JEU A;  4Q30 B;  1FPI A;  3TEL A;  4ZDM A;  5KCJ B;  4NTL A;  1NMU A;  3FZV A;  2ONK E;  4P1E A;  4U1Z A;  1H45 A;  1XC1 A;  5IZZ A;  3JYR A;  1AWB A;  3MZ9 A;  3OO6 A;  2QVR A;  2D3I A;  5BWJ A;  3LBS A;  1SBP A;  3CSB A;  4FOR A;  2X7Q A;  2PT2 A;  1IXI A;  2ONS A;  3P7I A;  1IXC A;  4GWX A;  4XKN A;  5H8N B;  5JK4 A;  3UGW A;  1A99 A;  3QUJ A;  3OMB A;  1SW5 A;  5DEX B;  3B6T A;  4GWO A;  3MUQ A;  1NH7 A;  1H43 A;  2XXQ A;  1WVJ A;  4HW8 A;  3OEN A;  1JW5 A;  1FPE A;  3C32 A;  1A8E A;  3CHG A;  3FXU A;  4AB6 A;  4P3L A;  4XXU A;  4F2Q A;  1DCU A;  1MQJ A;  4ZEF A;  4P8B A;  1QW0 A;  5L8D A;  4OYV A;  2WYK A;  1NV4 A;  4R74 A;  3TQW A;  3OXN A;  1VSO A;  4R2B A;  1NUW A;  4DI4 B;  4GWW A;  4U2R A;  4MEV A;  2P3N A;  1USY E;  2VHA A;  5AA1 A;  3MQ9 A;  5CMK A;  2ESN A;  2GRV A;  4M4G A;  3SEV A;  2F78 A;  4KHZ E;  4QF9 A;  3LR1 A;  1B5H A;  1LFH A;  3T66 A;  5CM6 A;  4U4X A;  3LSX A;  2HQ0 A;  4R9F A;  4THI A;  4MMP A;  2QS1 A;  2XX7 A;  3QIM A;  2ZYM A;  2F97 A;  4HE2 A;  3MZ1 A;  3PUX E;  4WED A;  3O6H A;  1DTZ A;  3H7M A;  2FIE A;  4XKQ A;  1EZP A;  4OVQ A;  4O7I A;  1LAX A;  1ZU0 A;  5EYF A;  1UTB B;  3MP6 A;  1B3F A;  3L6H A;  3A09 A;  4ELP A;  1YCJ A;  3KGC A;  2I3V A;  4KD5 A;  2RIN A;  1FQA A;  1YPN A;  1FPJ A;  4I62 A;  1D9V A;  4OZ9 A;  4F1Y A;  3MW0 A;  3UOR A;  2Z23 A;  4NN3 A;  5H8F B;  5KCJ A;  2FA7 A;  3TDJ A;  5I57 B;  4PFY A;  2X7P A;  4YKI A;  4HCW A;  3K4U A;  5I2N B;  4PE3 A;  2UVG A;  3K00 A;  4DLD A;  5EHS A;  4H8I A;  1OLC A;  3O29 A;  4QFK A;  4P0G A;  1NL5 A;  4P0I A;  2H4I A;  4FBP A;  3TCG A;  3N5L A;  2I4B A;  5EQ9 A;  5H8N A;  2XXK A;  2QVV A;  2XXI A;  3FV2 A;  3PUZ E;  4UAC A;  4NG7 A;  2HAV A;  1OLA A;  4MJO A;  1P1Q A;  1UQW A;  1NNT A;  4ND9 A;  1R9Q A;  5F24 A;  4GBW A;  2H9B A;  1N3X A;  4NE4 A;  3MVZ A;  1FQF A;  2DQV A;  1I6Q A;  3U65 A;  4OAN A;  4QRZ A;  1GV8 A;  2RCA A;  1JNF A;  1B0L A;  4MNI A;  1B0H A;  3EHS A;  3OEL A;  2ZYK A;  1USY H;  3MVW A;  4XTC Q;  1DTG A;  1ATG A;  1XT8 A;  4N15 A;  3VXB A;  4F3S A;  1S9T A;  4PAK A;  2XD3 A;  2V3T A;  3F11 A;  4P9K A;  4X8R A;  3W9V A;  1ZJL A;  1FTO A;  2DYX A;  3TTK A;  5LTC A;  4F3P A;  4BDL A;  3QYT A;  1N7X A;  2P0S A;  5EHM A;  2O6A A;  3KJT A;  3RLF E;  2WBB A;  4KPT A;  4EUO A;  4PFI A;  4DCX A;  3K6V A;  4QSD A;  2Q88 A;  4U23 A;  4X04 A;  1LBC A;  4KQP A;  1B7Z A;  3PD8 A;  4U1O A;  4MAG A;  4N4U A;  1MXW A;  2AL4 A;  4RJZ A;  2XXX A;  2Y7K A;  4JWY A;  1ZLQ A;  1Y20 A;  2VOZ A;  3H4Z A;  5I3S A;  4IY6 A;  1MH4 A;  4K3F A;  1LBV A;  5B70 A;  1K9Y A;  1JW4 A;  2XWO A;  5KZT A;  1EZO A;  1B7U A;  2DVC A;  2XWI A;  2KLF A;  3TYH A;  3FVO A;  2XX9 A;  3USD A;  4DCY A;  3CFL A;  1VFE A;  3FXQ A;  1M5F A;  5AA2 A;  1PB9 A;  2FHY A;  4NF4 B;  4QFL A;  2ABH A;  3BIH A;  1YAE A;  2FIX A;  3O2A A;  1KA1 A;  4LAT A;  4IO7 A;  4EF2 A;  2O51 A;  5I84 A;  2XXY A;  3Q26 A;  1MM6 A;  3KOS A;  4LZ5 A;  1UTH B;  5LOM A;  3EKI A;  4PF6 A;  1N7W A;  4NF8 B;  1B52 A;  1B2H A;  3G3K A;  2O1L A;  3MST A;  1IZ1 A;  1NUZ A;  4ESW A;  3TAJ A;  2WBD A;  4P11 A;  1D9Q A;  3GYY A;  1G0I A;  4QSE A;  2OX3 A;  4H6D A;  1N76 A;  1NNK A;  1SI0 A;  3QXM A;  1MQG A;  4OEN A;  1TFA A;  4O3C A;  1D9Y A;  2VGQ A;  1Q35 A;  2Y7I A;  4JVD A;  3DP4 A;  4OET A;  4FE8 A;  4DXU A;  2QPQ A;  1B6H A;  3B6W A;  5AA2 D;  1GR2 A;  3C34 A;  3H6U A;  1LFI A;  5H8S A;  1FBE A;  4GXS B;  1KA0 A;  1LBX A;  3FV1 A;  1URS A;  2R6G E;  4JSO A;  1I6B A;  3M3K A;  4PDH A;  1M5E A;  2RKM A;  2Q8M A;  3VV5 A;  4YKP A;  4DXC A;  3HN0 A;  2F36 A;  2DWJ A;  1LBB A;  4LA9 A;  5BUU A;  4LUB A;  4M1V A;  4I40 A;  1QUJ A;  1SD3 A;  4X1B A;  2Q8J A;  2LAO A;  4BDO A;  3IK6 B;  2G93 A;  1NI9 A;  4IB2 A;  2DE3 A;  4KCD A;  3C33 A;  1Q1K A;  4OFO A;  3FAS A;  1Y3N A;  4F39 A;  3T9U A;  3V5A A;  3C35 A;  3WAE A;  4GLI A;  3PPQ A;  4XKR A;  3CR9 A;  3V89 B;  2HPG A;  3KBR A;  1NV7 A;  3FAT A;  1NV5 A;  4MNC A;  3N94 A;  3SEW A;  1ZMG A;  4R9G A;  4LON B;  3VLU A;  1CB6 A;  3KC0 A;  4ZE9 A;  2XHD A;  4YU0 A;  3TKD A;  5IZ3 B;  4LZ7 A;  2NWJ A;  4DXB A;  1US4 A;  4R73 A;  4H8J A;  3G3I A;  4EXL A;  4OER A;  3EPE A;  4XF5 A;  3LC8 A;  4PFW A;  2I49 A;  4G8M A;  5CC2 A;  1NNF A;  4N91 A;  1MY0 A;  2A5T B;  2Y5K A;  1NFT A;  1FBG A;  1MY3 A;  1B3E A;  1FQD A;  2F6G A;  1IEJ A;  3TTR A;  4C1U A;  2I48 A;  5ET5 A;  3PPO A;  3HFU A;  1GTK A;  3TPA A;  1POY 1;  3OO9 A;  2CZK A;  4IGT A;  3IL1 B;  4QHQ A;  5IM2 A;  1DOT A;  1JVX A;  2XWV A;  3O6I A;  4HXV A;  4EDP A;  2B4M A;  3RPW A;  3RNN A;  2I0B A;  1S7Y A;  1UIV A;  3V83 A;  4OEU A;  4QSC A;  3TZA A;  3RTF B;  1MXX A;  3IAZ A;  3T9X B;  1FJ6 A;  1RKM A;  4LP2 B;  5IKB A;  2XA5 A;  4PE5 B;  1RYX A;  1EYJ A;  4HS7 A;  3ZS6 A;  2Y84 A;  4G8H A;  5ET8 A;  2HHM A;  4GRK A;  3WAF A;  4KYE A;  4IGR A;  3NOH A;  4IO2 A;  2D21 A;  4O8M A;  4Q8R A;  2HXW A;  3IOW A;  3IX1 A;  4POX A;  2CEY A;  4YIC A;  1B05 A;  4MLQ A;  2OK2 A;  4OA4 A;  2PX1 A;  2PBW A;  4WEP A;  2Q2A A;  2UYE A;  4TLM B;  1FQC A;  4RK2 A;  1MY4 A;  2P2A A;  4F1U A;  4PQJ A;  1B3H A;  2O1M A;  4LVQ A;  3HO7 A;  3T1B A;  3PPN A;  4GVO A;  4ELR A;  3R7X A;  3MVY A;  1F9B A;  1QKB A;  4EQB A;  1LAH E;  2AIX A;  2FBP A;  5DVF A;  3CSG A;  4ELQ A;  3OO8 A;  3UIF A;  4GL8 A;  1VDW A;  4NED A;  3VXC A;  3GBB A;  5IZ3 A;  1YTV A;  3N6U A;  3K02 A;  4PFT A;  1EU8 A;  4DI3 D;  3QUF A;  3RGY A;  3IR1 A;  3FXB A;  4H65 A;  5FHN A;  2V25 A;  3T9V A;  3BKI B;  4MIJ A;  4OHN A;  1VFD A;  4HCY A;  3IOT A;  1B4Z A;  2A5T A;  3U92 A;  3B50 A;  1R6Z A;  1FQB A;  4DE8 A;  5A5L A;  2GFE A;  2B65 A;  3MAM A;  1D4N A;  3DLN A;  1POT A;  4GX3 A;  5I5P A;  1NUY A;  3I3V A;  4ESX A;  4PGN A;  1GGG A;  3QAX A;  5ET6 A;  4G77 A;  3H3G A;  3IOV A;  3VVF A;  2UXA A;  1OIB A;  1MH3 A;  1K9Z A;  4GX4 A;  4DDD A;  2MKZ A;  3O9P A;  3SES A;  2ZMB A;  3SDF A;  5IGA A;  4ZEB A;  5ICQ A;  5ICT A;  3G3G A;  1RDZ A;  2F6P A;  4PAF A;  4FEB A;  3RT8 A;  2VD2 A;  5K2Y A;  1MRP A;  4OMB A;  3B6Q A;  1B58 A;  4NHB A;  1II5 A;  4GF8 A;  1N04 A;  1XI6 A;  4IO5 A;  3K0V A;  2IA4 A;  3D4C A;  3OOA A;  5DVI A;  4RNS A;  4NX1 A;  1AL3 A;  1QUI A;  3KC1 A;  4R6K A;  3HCQ A;  4NQ8 A;  3T96 B;  4MH5 A;  2R71 A;  2F8D A;  1H44 A;  4WKM A;  5AA2 B;  3PPP A;  1LBZ A;  2F35 A;  3BIG A;  1TT1 A;  2XD2 A;  2R8T A;  1Y3P A;  4MBP A;  1QGX A;  2IEE A;  2YLN A;  2HZL A;  4ZEI A;  4QFN A;  4OWD A;  1O63 A;  2FNC A;  3OSQ A;  2RC9 A;  4C0R A;  1ZBM A;  4XIG Q;  2DSF A;  4H5F A;  3U8Q A;  5CMM A;  1LLS A;  3PGF A;  1J1N A;  2O7U A;  4U4S A;  1SW4 A;  4YAH X;  4NF0 A;  1B51 A;  3G3F A;  1WDN A;  4PDD A;  4ECF A;  1B9J A;  1FPB A;  1NV1 A;  2OBG A;  4GX6 A;  4R72 A;  4H45 A;  4OTE A;  2I4C A;  1A54 A;  4GXA A;  4O3B A;  4N8Y A;  3OO7 A;  2HEU A;  1Y1Z A;  5L9O A;  1OQG A;  2PYY A;  3OSR A;  2XXT A;  4GQO A;  1AIV A;  1FBP A;  4KI0 E;  4MNP A;  4F1V A;  3C36 A;  2Z8E A;  4JDF A;  4PP0 A;  1NH8 A;  3MPK A;  3HHF A;  1PDA A;  2CZL A;  3PV0 E;  3QK6 A;  3VVE A;  4QFP A;  1NV6 A;  3KEI A;  1P1N A;  1Z7M E;  4GD5 A;  3DP8 A;  4YB5 A;  1CNQ A;  2NXO A;  4OFJ A;  4OXV A;  3LV0 A;  4EQ9 A;  1T0K A;  3D4G A;  5CBS A;  3ODB A;  2ONR A;  4H67 A;  4YMB A;  4H0W A;  3O28 A;  4TLL B;  4EQ7 A;  3KSJ A;  3PMX A;  1B1H A;  4AQ4 A;  2CZH A;  3TFL A;  1M5B A;  1Q9D A;  1SPI A;  2KR0 A;  4OVR A;  1LGB C;  5HBC A;  3S9N C;  4XFE A;  4GWU A;  1XOC A;  2O84 X;  4PGP A;  1P99 A;  2DOJ A;  5H8H B;  1DK4 A;  4TQU Q;  1LFG A;  1I69 A;  1N84 A;  1L5T A;  2E0S A;  2VD3 A;  4G68 C;  3A3U A;  1FPK A;  5A5X A;  2GHA A;  2FVZ A;  2Q89 A;  2Z8F A;  3E13 X;  1FJ9 A;  1MQD A;  1HSJ A;  3MZB A;  1MXU A;  1MS7 A;  3KJ7 A;  3FGS A;  1PEB A;  1I6A A;  3Q25 A;  5EYH A;  3K6W A;  3U72 A;  5F7V A;  1Y3Q A;  4I9D A;  4F3G A;  3PUY E;  2UVI A;  3SER A;  3LUY A;  3KSX A;  4GWS A;  2XXW A;  5I59 A;  3FJ7 A;  4OES A;  2GQ1 A;  4JB7 A;  4P47 A;  3DP6 A;  4NMY A;  1NV2 A;  3MC2 A;  3N6T A;  3FBP A;  3KBZ A;  1JET A;  2VPO A;  3SEX A;  1FBD A;  2X26 A;  1IXH A;  3IJX B;  3TMG A;  2ZZX A;  3QMF A;  1MY2 A;  3UP9 A;  3GZG A;  2HXR A;  2XXH A;  3PD9 A;  3ECR A;  3I6V A;  2I0C A;  4MX6 A;  5DW8 A;  3PU5 A;  4BDN A;  4U21 A;  2GH9 A;  1YXI A;  3IB1 A;  3KOT A;  2WYP A;  4N6D A;  2B3B A;  2OWZ A;  5HPQ A;  3HPI A;  3T22 A;  1FTJ A;  1FBC A;  3Q28 A;  1GVC A;  4LQ5 A;  1PB8 A;  1PB7 A;  4NF5 B;  2DWA A;  2OZZ A;  3KFM A;  1JQF A;  3FD3 A;  4ISU A;  3O97 A;  1URG A;  1P1U A;  2Z8D A;  4NF6 B;  3C31 A;  2F3B A;  3SEY A;  4IY5 A;  4ZZA A;  4PTK A;  3D1R A;  2FYI A;  4FJP A;  4F19 A;  1LEV A;  5LDZ A;  1JW1 A;  5I58 B;  1B3G A;  4OVP A;  4I8C A;  5FHO A;  2I58 A;  3K1N A;  3BBR A;  3O66 A;  4YB7 A;  4UA8 A;  1TXF A;  3ILT B;  5H8H A;  3H06 B;  1N3W A;  1DBZ A;  2M8C A;  3JZJ A;  1RYO A;  1PC3 A;  1LBW A;  2DXY A;  3IOU A;  2F5X A;  1MDQ A;  1MQH A;  4N13 A;  1MXZ A;  4G68 B;  1A7L A;  4O94 A;  5I56 A;  1IMD A;  4JBZ A;  5JTY B;  3RPL B;  4TOZ A;  2DP8 A;  1LST A;  3FJM A;  3FIR A;  3ONM A;  3EF7 A;  4KYD A;  3TQL A;  4PBH A;  1Y1M A;  4N17 A;  4H5G A;  4JVC A;  4ZE8 A;  4FED A;  4N8G A;  2QJE A;  1QVS A;  2Z22 A;  1A8F A;  3H03 A;  1AOV A;  3LUZ A;  3HV1 A;  4E0W A;  1FPD A;  2I3W A;  3ISP A;  1KWH A;  2DE4 A;  2PFZ A;  1OVB A;  4LZ8 A;  4YMA A;  1IIT A;  3OEK A;  5AE4 A;  1MPB A;  2PVU A;  3H6V A;  1ANF A;  3VLV A;  1N0T A;  4JWO A;  5TU0 A;  4JWX A;  4RA1 A;  2DWI A;  5ELV A;  5J16 A;  2BJJ X;  1B40 A;  4PF8 A;  1Y9U A;  3HST A;  1YZ0 A;  1BLF A;  3S4U A;  3ILU B;  4E0X A;  4PFR A;  3RUM A;  1KZ8 A;  2UVH A;  2F34 A;  1QJM A;  3A29 A;  1M5D A;  3EN3 A;  3G3J A;  4ZZE A;  4HE1 A;  2OJT A;  3O6G A;  2O68 A;  5HM4 B;  1MY1 A;  4JXI A;  2L5V A;  3Q27 A;  4RK9 A;  1HSE A;  2ZYN A;  2WKY A;  4NWD A;  2DS9 A;  2DVZ A;  3HHG A;  1CE2 A;  5KDT A;  3H6W A;  4NF5 A;  3FUZ A;  2WX9 A;  3KN8 A;  1VE4 A;  3C4M A;  3DEL B;  1RDX A;  2RCB A;  4ZED A;  4XKP A;  3IO6 A;  1SI1 A;  1MPD A;  3K1P A;  2XXP A;  5TPA A;  4N07 A;  4NF6 A;  4I3Y A;  1WOD A;  2QSX A;  3R26 A;  3SZP A;  2KQZ A;  4QBA A;  4KR5 A;  3VE1 B;  1FTK A;  1B3L A;  4BDR A;  2H5Y A;  5I58 A;  4ZS9 A;  3TTM A;  4F29 A;  1FTM A;  3C9H A;  5IZ1 A;  5ITP A;  1SYH A;  2PFY A;  1IMF A;  1NUX A;  4GWZ A;  3RY3 A;  5B7D A;  2O7I A;  4I3E A;  4GL0 A; 
#chains in the Genus database with same CATH homology
 3U94 A;  4X9T A;  3IB2 A;  5DYH A;  3JV9 A;  1SW1 A;  3VVD A;  1R9L A;  1BIY A;  4R75 A;  4YB6 A;  3PMV A;  5J1D A;  4G68 A;  1EH3 A;  5JTY A;  2YPN A;  2HZK A;  5K2X A;  2F7C A;  3KN7 A;  3E3K A;  2HCA A;  1LCT A;  4OEV A;  2AYS A;  2QMX A;  4F3B A;  3MVX A;  4IO6 A;  4MLV A;  3IJO B;  3GLB A;  1O64 A;  1DPE A;  2Q2C A;  1Y4T A;  1H3D A;  4I1D A;  3Q29 A;  4DIG A;  5L9S A;  1TFD A;  3S9E A;  2UYF A;  1JEV A;  5CMB A;  2ZYO A;  3W15 C;  4EXK A;  3E4R A;  2ALU A;  5CI5 A;  3L6G A;  5FTH A;  3CFX A;  3IOR A;  1URD A;  2F7B A;  2AL5 A;  5H8Q B;  4ELO A;  2R9J A;  4MFI A;  1D3K A;  1XVX A;  3T9H B;  4JSD A;  3T93 B;  2DXR A;  2Y7P A;  3VFJ A;  1QUK A;  4F22 A;  1VR5 A;  3PUW E;  3FVN A;  3MP8 A;  4R6Y A;  1EZ9 A;  2HFB A;  1LB8 A;  1DSN A;  2DE2 A;  2P1S A;  3UK4 A;  5AA3 A;  2QS2 A;  4ZEK A;  2QRY A;  2OCU A;  2W7Y A;  1HSL A;  1LAG E;  1FTL A;  4G2Z A;  5DVJ A;  1LB9 A;  3H6T A;  2XXV A;  5A5X B;  2HAU A;  4H1X A;  2Y7W A;  2XXU A;  2NUV A;  3RT6 B;  4X1D A;  1P1W A;  1B46 A;  2ANJ A;  4BDM A;  3LSL A;  3VLW A;  5DEX A;  5I59 B;  3KZG A;  5JEI A;  4O3A A;  3K01 A;  1ELJ A;  4GOT A;  1AH5 A;  2Q9T A;  1IIW A;  2H98 A;  3I5O A;  3OD7 A;  5CMC A;  2THI A;  5L9M A;  4MF3 A;  3A3C A;  3R6U A;  3FVG A;  1TWY A;  3LSF B;  3M3F A;  3OEM A;  1LCF A;  5TP9 B;  3KG2 A;  3SEU A;  1AMF A;  3PUV E;  3BFT A;  1US5 A;  1BTJ A;  2QL3 A;  3V8X B;  2QMW A;  4ZEC A;  2D5W A;  5ITO A;  1ZKB A;  2OWS A;  3TCF A;  4OQO A;  5H8Q A;  2OLB A;  1M5C A;  4NWC A;  3TUS A;  1DPP A;  2G29 A;  4F18 A;  3GBA A;  1MXY A;  1UTB A;  4FAJ A;  1IUD A;  2QS4 A;  2ZNS A;  4OVJ A;  1B1X A;  1MQI A;  4PFU A;  4POW A;  2VP1 A;  4F2O A;  3VDF A;  1FW0 A;  1P1O A;  1UIU A;  2NOO A;  3MWB A;  5H8F A;  4N6P A;  5I57 A;  3SKP A;  1R1N A;  1XHY A;  2V93 A;  5I2N A;  4Q0C A;  3CRB A;  3U93 A;  4RPN A;  1MXV A;  4C1T A;  2REG A;  4PET A;  4R6H A;  2RF1 A;  1BP5 A;  5I56 B;  4G4P A;  2OWT A;  4G8N A;  4AB5 A;  1JVY A;  4HTG A;  2XXR A;  1MDP 1;  1IQ7 A;  4IO4 A;  1LAF E;  2Y7R A;  5I2K B;  1FCK A;  3FXR A;  3QSL A;  1MM7 A;  4IO3 A;  3EHT A;  2GHB A;  4YZZ A;  4KFQ A;  4FEC A;  5AA4 B;  2B3F A;  2ZXT A;  4U22 A;  3G7W A;  1O7T A;  3K1M A;  3EHU A;  3W9W A;  3K6X A;  3BFU A;  1SW2 A;  5CRY A;  2H99 A;  3TTL A;  4F31 B;  1B4H A;  4ONY A;  2XX8 A;  2F7A A;  2REJ A;  3IB0 A;  3LSW A;  3CG1 A;  3S9M C;  4L17 A;  4RPO A;  2QS3 A;  5DT6 A;  3CI8 A;  5TP9 A;  2UVJ A;  5IAI A;  1S50 A;  4RY1 A;  1XVY A;  3FJG A;  3UN6 A;  3M8U A;  4WXJ A;  4FAT A;  2O69 A;  2ZNT A;  5CBR A;  2NVU B;  5KDT B;  4R2F A;  4X48 A;  3IO4 A;  3RN8 A;  4YKK A;  3EQ1 A;  4YKJ A;  5TPA B;  3M3L A;  4DZ1 A;  4Z0I A;  1QKA A;  1OVT A;  3GXA A;  3FVK A;  1DMB A;  1FQE A;  3AXF A;  5FTI A;  4Z7E A;  1Z7N E;  1SDX A;  1SQY A;  4KCC A;  1ZTY A;  1PBQ A;  2A5S A;  4RYA A;  1SYI A;  3TEP A;  3TOD A;  3S9L C;  3K6U A;  3RTW B;  3MBP A;  3S2V A;  3MJN A;  4FIM A;  1H76 A;  4Q5T A;  3MP1 A;  4NF4 A;  3E9X A;  4GIZ A;  2RC7 A;  1B7H A;  3K2D A;  2H25 A;  2CMO A;  4KYS A;  1OMP A;  2ZNU A;  3PPR A;  1QUL A;  2V84 A;  1A40 A;  1PBP A;  1UTH A;  2PT1 A;  1SVX B;  4NF8 A;  4LQ2 A;  1B5J A;  3ZKK A;  5I2K A;  4RXL A;  1ZIU A;  4BLA A;  3CIJ A;  3CVG A;  2RC8 A;  5M2V A;  3N26 A;  1MG1 A;  3PMW A;  5AA4 A;  1NNP A;  4OFL A;  2YJP A;  4QFO A;  5FHM A;  3MPL A;  1XS5 A;  2DWH A;  3U1O A;  3CFZ A;  3G3H A;  3KN3 A;  4BDQ A;  1NKX A;  1Y4C A;  1BKA A;  2V3Q A;  1IXG A;  3TTN A;  1OQH A;  3TCH A;  2I6E A;  3DM0 A;  2V3U A;  3SET A;  3B7D A;  4EF1 A;  1MPC A;  3CG3 A;  3ZSF A;  5F1Q A;  5DTB A;  3THI A;  3RQT A;  4GFR A;  3ZKL A;  1A55 A;  2PMS A;  1B32 A;  5ISU A;  3UA8 A;  1B5I A;  2E1S A;  1JEU A;  4Q30 B;  3TEL A;  4ZDM A;  5KCJ B;  4NTL A;  1NMU A;  3FZV A;  2ONK E;  4U1Z A;  1H45 A;  1XC1 A;  3JYR A;  3MZ9 A;  3OO6 A;  2D3I A;  5BWJ A;  3LBS A;  1SBP A;  3CSB A;  4FOR A;  2X7Q A;  2PT2 A;  1IXI A;  2ONS A;  3P7I A;  1IXC A;  4XKN A;  5H8N B;  5JK4 A;  3UGW A;  1A99 A;  3QUJ A;  3OMB A;  1SW5 A;  5DEX B;  3B6T A;  4GWO A;  3MUQ A;  1NH7 A;  1H43 A;  2XXQ A;  1WVJ A;  4HW8 A;  3OEN A;  1JW5 A;  3C32 A;  1A8E A;  3FXU A;  4AB6 A;  4XXU A;  4F2Q A;  1MQJ A;  4ZEF A;  1QW0 A;  5L8D A;  4OYV A;  4R74 A;  3TQW A;  3OXN A;  1VSO A;  4R2B A;  4U2R A;  1USY E;  2VHA A;  5AA1 A;  3MQ9 A;  5CMK A;  2ESN A;  2GRV A;  4M4G A;  3SEV A;  2F78 A;  4KHZ E;  4QF9 A;  3LR1 A;  1B5H A;  1LFH A;  3T66 A;  5CM6 A;  4U4X A;  3LSX A;  2HQ0 A;  4R9F A;  4THI A;  2QS1 A;  2XX7 A;  2ZYM A;  2F97 A;  3MZ1 A;  3PUX E;  4WED A;  3O6H A;  1DTZ A;  3H7M A;  4XKQ A;  1EZP A;  1LAX A;  1ZU0 A;  5EYF A;  1UTB B;  3MP6 A;  1B3F A;  3L6H A;  3A09 A;  4ELP A;  1YCJ A;  3KGC A;  2I3V A;  4KD5 A;  2RIN A;  1FQA A;  1YPN A;  4I62 A;  1D9V A;  4OZ9 A;  4F1Y A;  3MW0 A;  3UOR A;  2Z23 A;  5H8F B;  5KCJ A;  2FA7 A;  3TDJ A;  5I57 B;  4PFY A;  2X7P A;  4YKI A;  4HCW A;  3K4U A;  5I2N B;  2UVG A;  3K00 A;  4DLD A;  5EHS A;  4H8I A;  1OLC A;  3O29 A;  4QFK A;  4P0G A;  1NL5 A;  4P0I A;  2H4I A;  3TCG A;  3N5L A;  2I4B A;  5H8N A;  3FV2 A;  2XXI A;  3PUZ E;  4UAC A;  2HAV A;  1OLA A;  1P1Q A;  1UQW A;  1NNT A;  4ND9 A;  1R9Q A;  2H9B A;  1N3X A;  4NE4 A;  3MVZ A;  1FQF A;  2DQV A;  1I6Q A;  4QRZ A;  1GV8 A;  2RCA A;  1JNF A;  1B0L A;  1B0H A;  3EHS A;  3OEL A;  2ZYK A;  1USY H;  3MVW A;  4XTC Q;  1DTG A;  1ATG A;  1XT8 A;  3VXB A;  4F3S A;  1S9T A;  2XD3 A;  2V3T A;  3F11 A;  3W9V A;  1ZJL A;  1FTO A;  2DYX A;  3TTK A;  4F3P A;  4BDL A;  3QYT A;  1N7X A;  2P0S A;  5EHM A;  2O6A A;  3KJT A;  3RLF E;  4KPT A;  4EUO A;  4DCX A;  3K6V A;  4QSD A;  2Q88 A;  4U23 A;  1LBC A;  4KQP A;  1B7Z A;  3PD8 A;  4U1O A;  1MXW A;  2AL4 A;  4RJZ A;  2XXX A;  2Y7K A;  4JWY A;  1ZLQ A;  1Y20 A;  2VOZ A;  3H4Z A;  4IY6 A;  1MH4 A;  4K3F A;  5B70 A;  1JW4 A;  5KZT A;  1EZO A;  1B7U A;  2DVC A;  2KLF A;  3TYH A;  3FVO A;  2XX9 A;  3USD A;  4DCY A;  3CFL A;  1VFE A;  3FXQ A;  1M5F A;  5AA2 A;  1PB9 A;  4NF4 B;  4QFL A;  2ABH A;  1YAE A;  3O2A A;  4LAT A;  4IO7 A;  4EF2 A;  2O51 A;  5I84 A;  2XXY A;  3Q26 A;  1MM6 A;  3KOS A;  4LZ5 A;  1UTH B;  5LOM A;  1N7W A;  4NF8 B;  1B52 A;  1B2H A;  3G3K A;  2O1L A;  1IZ1 A;  4ESW A;  3TAJ A;  4P11 A;  4QSE A;  4H6D A;  1N76 A;  1NNK A;  1SI0 A;  3QXM A;  1MQG A;  4OEN A;  1TFA A;  4O3C A;  1D9Y A;  2VGQ A;  1Q35 A;  2Y7I A;  3DP4 A;  4OET A;  4FE8 A;  4DXU A;  2QPQ A;  1B6H A;  3B6W A;  5AA2 D;  1GR2 A;  3C34 A;  3H6U A;  1LFI A;  5H8S A;  4GXS B;  3FV1 A;  1URS A;  2R6G E;  4JSO A;  1I6B A;  3M3K A;  1M5E A;  2RKM A;  3VV5 A;  4YKP A;  4DXC A;  3HN0 A;  2F36 A;  2DWJ A;  1LBB A;  4LA9 A;  5BUU A;  4LUB A;  4M1V A;  1QUJ A;  1SD3 A;  4X1B A;  2Q8J A;  2LAO A;  4BDO A;  3IK6 B;  2G93 A;  4IB2 A;  2DE3 A;  4KCD A;  3C33 A;  1Q1K A;  4OFO A;  3FAS A;  1Y3N A;  4F39 A;  3T9U A;  3V5A A;  3C35 A;  3WAE A;  4GLI A;  3PPQ A;  4XKR A;  3CR9 A;  3V89 B;  3KBR A;  3FAT A;  3N94 A;  3SEW A;  1ZMG A;  4R9G A;  4LON B;  3VLU A;  1CB6 A;  4ZE9 A;  2XHD A;  4YU0 A;  3TKD A;  4LZ7 A;  2NWJ A;  4DXB A;  1US4 A;  4R73 A;  4H8J A;  3G3I A;  4EXL A;  4OER A;  3EPE A;  3LC8 A;  4PFW A;  2I49 A;  4G8M A;  5CC2 A;  1NNF A;  1MY0 A;  2A5T B;  1NFT A;  1MY3 A;  1B3E A;  1FQD A;  2F6G A;  1IEJ A;  3TTR A;  4C1U A;  2I48 A;  3PPO A;  1GTK A;  3TPA A;  1POY 1;  3OO9 A;  4IGT A;  3IL1 B;  4QHQ A;  1DOT A;  1JVX A;  3O6I A;  4EDP A;  3RPW A;  3RNN A;  2I0B A;  1S7Y A;  1UIV A;  3V83 A;  4OEU A;  4QSC A;  3TZA A;  3RTF B;  1MXX A;  3IAZ A;  3T9X B;  1RKM A;  4LP2 B;  5IKB A;  4PE5 B;  1RYX A;  4HS7 A;  3ZS6 A;  2Y84 A;  4G8H A;  4GRK A;  3WAF A;  4KYE A;  4IGR A;  4IO2 A;  2D21 A;  4Q8R A;  2HXW A;  3IOW A;  3IX1 A;  4POX A;  4YIC A;  1B05 A;  4MLQ A;  2OK2 A;  2PX1 A;  2PBW A;  4WEP A;  2Q2A A;  2UYE A;  4TLM B;  1FQC A;  4RK2 A;  1MY4 A;  2P2A A;  4F1U A;  4PQJ A;  1B3H A;  2O1M A;  4LVQ A;  3HO7 A;  3PPN A;  4GVO A;  4ELR A;  3R7X A;  3MVY A;  1F9B A;  1QKB A;  4EQB A;  1LAH E;  2AIX A;  5DVF A;  3CSG A;  4ELQ A;  3OO8 A;  3UIF A;  4GL8 A;  4NED A;  3VXC A;  3GBB A;  1YTV A;  3N6U A;  3K02 A;  4PFT A;  1EU8 A;  3QUF A;  3RGY A;  3IR1 A;  4H65 A;  5FHN A;  2V25 A;  3T9V A;  3BKI B;  4OHN A;  1VFD A;  4HCY A;  3IOT A;  1B4Z A;  2A5T A;  3U92 A;  1R6Z A;  1FQB A;  4DE8 A;  2GFE A;  2B65 A;  3MAM A;  1D4N A;  3DLN A;  1POT A;  3I3V A;  4ESX A;  1GGG A;  3QAX A;  4G77 A;  3H3G A;  3IOV A;  3VVF A;  2UXA A;  1OIB A;  1MH3 A;  4DDD A;  3O9P A;  3SES A;  2ZMB A;  3SDF A;  4ZEB A;  5ICQ A;  5ICT A;  3G3G A;  2F6P A;  4FEB A;  3RT8 A;  2VD2 A;  5K2Y A;  1MRP A;  4OMB A;  3B6Q A;  1B58 A;  1II5 A;  4GF8 A;  1N04 A;  4IO5 A;  3K0V A;  2IA4 A;  3D4C A;  3OOA A;  5DVI A;  4RNS A;  1AL3 A;  1QUI A;  4R6K A;  3HCQ A;  3T96 B;  4MH5 A;  2R71 A;  2F8D A;  1H44 A;  4WKM A;  5AA2 B;  3PPP A;  2F35 A;  1TT1 A;  2XD2 A;  1Y3P A;  4MBP A;  2IEE A;  2YLN A;  2HZL A;  4ZEI A;  4QFN A;  4OWD A;  1O63 A;  2FNC A;  3OSQ A;  2RC9 A;  4C0R A;  1ZBM A;  4XIG Q;  2DSF A;  4H5F A;  3U8Q A;  5CMM A;  1LLS A;  3PGF A;  1J1N A;  2O7U A;  4U4S A;  1SW4 A;  4YAH X;  1B51 A;  3G3F A;  1WDN A;  4ECF A;  1B9J A;  2OBG A;  4R72 A;  4OTE A;  2I4C A;  1A54 A;  4GXA A;  4O3B A;  3OO7 A;  2HEU A;  1Y1Z A;  5L9O A;  1OQG A;  2PYY A;  3OSR A;  2XXT A;  4GQO A;  1AIV A;  4KI0 E;  4F1V A;  3C36 A;  2Z8E A;  4JDF A;  4PP0 A;  1NH8 A;  3MPK A;  3HHF A;  1PDA A;  2CZL A;  3PV0 E;  3QK6 A;  3VVE A;  4QFP A;  3KEI A;  1P1N A;  1Z7M E;  4GD5 A;  3DP8 A;  4YB5 A;  2NXO A;  4OFJ A;  4OXV A;  4EQ9 A;  1T0K A;  3D4G A;  5CBS A;  3ODB A;  2ONR A;  4H67 A;  4YMB A;  4H0W A;  3O28 A;  4TLL B;  4EQ7 A;  3KSJ A;  3PMX A;  1B1H A;  4AQ4 A;  3TFL A;  1M5B A;  1LGB C;  5HBC A;  3S9N C;  1XOC A;  2O84 X;  1P99 A;  2DOJ A;  5H8H B;  4TQU Q;  1LFG A;  1I69 A;  1N84 A;  1L5T A;  2E0S A;  2VD3 A;  4G68 C;  3A3U A;  5A5X A;  2GHA A;  2Q89 A;  2Z8F A;  3E13 X;  1MQD A;  1HSJ A;  3MZB A;  1MXU A;  1MS7 A;  3KJ7 A;  3FGS A;  1PEB A;  1I6A A;  3Q25 A;  3K6W A;  3U72 A;  5F7V A;  1Y3Q A;  4I9D A;  4F3G A;  3PUY E;  2UVI A;  3SER A;  3LUY A;  3KSX A;  2XXW A;  5I59 A;  3FJ7 A;  4OES A;  4JB7 A;  3DP6 A;  4NMY A;  3MC2 A;  3N6T A;  1JET A;  3SEX A;  2X26 A;  1IXH A;  3IJX B;  3TMG A;  1MY2 A;  3UP9 A;  3GZG A;  2XXH A;  3PD9 A;  3ECR A;  3I6V A;  2I0C A;  3PU5 A;  4BDN A;  4U21 A;  2GH9 A;  3IB1 A;  3KOT A;  2B3B A;  5HPQ A;  3HPI A;  3T22 A;  1FTJ A;  3Q28 A;  1GVC A;  4LQ5 A;  1PB8 A;  1PB7 A;  4NF5 B;  2DWA A;  2OZZ A;  3KFM A;  1JQF A;  3FD3 A;  4ISU A;  3O97 A;  1URG A;  1P1U A;  2Z8D A;  4NF6 B;  3C31 A;  3SEY A;  4IY5 A;  4ZZA A;  2FYI A;  4FJP A;  4F19 A;  1JW1 A;  5I58 B;  1B3G A;  4I8C A;  5FHO A;  2I58 A;  3K1N A;  3BBR A;  3O66 A;  4YB7 A;  4UA8 A;  1TXF A;  3ILT B;  5H8H A;  3H06 B;  1N3W A;  2M8C A;  3JZJ A;  1RYO A;  1PC3 A;  2DXY A;  3IOU A;  2F5X A;  1MDQ A;  1MQH A;  4N13 A;  1MXZ A;  4G68 B;  1A7L A;  5I56 A;  4JBZ A;  5JTY B;  4TOZ A;  2DP8 A;  1LST A;  3FJM A;  3FIR A;  3ONM A;  3EF7 A;  4KYD A;  3TQL A;  1Y1M A;  4H5G A;  4ZE8 A;  4FED A;  2QJE A;  1QVS A;  2Z22 A;  1A8F A;  3H03 A;  1AOV A;  3HV1 A;  4E0W A;  2I3W A;  1KWH A;  2DE4 A;  1OVB A;  4LZ8 A;  4YMA A;  1IIT A;  3OEK A;  5AE4 A;  1MPB A;  2PVU A;  3H6V A;  1ANF A;  3VLV A;  1N0T A;  4JWO A;  5TU0 A;  4JWX A;  4RA1 A;  2DWI A;  5ELV A;  2BJJ X;  1B40 A;  1Y9U A;  3HST A;  1BLF A;  3S4U A;  3ILU B;  4E0X A;  3RUM A;  2UVH A;  2F34 A;  1QJM A;  1M5D A;  3EN3 A;  3G3J A;  4ZZE A;  2OJT A;  3O6G A;  2O68 A;  5HM4 B;  1MY1 A;  4JXI A;  3Q27 A;  4RK9 A;  1HSE A;  2ZYN A;  2WKY A;  4NWD A;  2DS9 A;  2DVZ A;  3HHG A;  1CE2 A;  5KDT A;  3H6W A;  4NF5 A;  3FUZ A;  3KN8 A;  1VE4 A;  3C4M A;  3DEL B;  2RCB A;  4ZED A;  4XKP A;  3IO6 A;  1SI1 A;  1MPD A;  3K1P A;  2XXP A;  5TPA A;  4N07 A;  4NF6 A;  1WOD A;  2QSX A;  3R26 A;  4KR5 A;  3VE1 B;  1FTK A;  1B3L A;  4BDR A;  2H5Y A;  5I58 A;  4ZS9 A;  3TTM A;  4F29 A;  1FTM A;  3C9H A;  5ITP A;  1SYH A;  3RY3 A;  5B7D A;  2O7I A;  3QIM A;  4GL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...