2W7YA

Structure of a streptococcus pneumoniae solute-binding protein in complex with the blood group a-trisaccharide.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
391
structure length
389
Chain Sequence
b'EVLEFYHGYHHSEDEWPVAKTMRDLYDKFAEEHSGVEFKPTPVNGDLKDIMNNKVASGEFPDVIDLAGNAVSLAAIEQKLVLDLKPYIDSNKLEKNVGLNYKQNQKDGKIYTVHEQLFTMGLWYNKDIFAKAGAKTPDQWNTWDDFTQAMASIRKQDGVYAFGAGEPSIRLFNTVLGTTENGRKLLDKPLTKEGIESKEFADALKMVMKEIQANGSKNAGGDANAYSKDFQEGKSAVFFNGVWASGEMSKNPSLAPGIYPAGVAISSSGGGITISSKMSEAKQKLALEFLKYMTSDDVQKVIFEKVGANPSNENVNVKELSEKSSEATTKILGQAITQVKNAKAVVPTVSDVWGGDVHTAIINALTESAAENVDVDQKVKSTQDVLKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
publication title Blood-Group Antigen Recognition by a Solute-Binding Protein from a Serotype 3 Strain of Streptococcus Pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Sugar binding protein
total genus 119
structure length 389
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2w7yA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2w7yA01
4MBPA 3OXNA 1UTBA 4Q5TA 1EZOA 4F3BA 3VXBA 4K3FA 3C36A 3KSJA 1FTKA 1XVYA 1IQ7A 4NWDA 1Z7ME 1MQDA 2V3UA 2QMXA 4G68A 2UYFA 4QFPA 4N07A 3G3GA 1MQJA 1YTVA 4OVJA 3RLFE 4F3SA 2GFEA 1UIVA 4P11A 4F3PA 2DE4A 4MLQA 1MS7A 4F1YA 3IOTA 4TQUQ 1Y3QA 4U21A 4Q30B 1NMUA 1ZKBA 1B1XA 1ATGA 1N7XA 5I56B 3K6VA 4DCXA 3SEUA 1FQCA 3KJ7A 1LAFE 1BKAA 3I3VA 3O97A 1EU8A 1M5CA 1ZMGA 3PD8A 1N7WA 1FQFA 3W9WA 3EN3A 2I49A 1IIWA 3N26A 5AA2B 5DEXA 1MPBA 4KYSA 4RK2A 3HSTA 2NUVA 2F6GA 1P1UA 4H65A 1MQGA 3M3FA 1B9JA 4EXKA 4YICA 5ISUA 4KYEA 4O3CA 3V89B 1DSNA 4EQBA 1MXYA 3ZS6A 2F36A 1PC3A 1ZU0A 1AOVA 1UQWA 1D9VA 2PVUA 3D4CA 3AXFA 2HZKA 5ELVA 4PFUA 5KDTB 1QVSA 2DE2A 2Q88A 1NL5A 3RN8A 4G8NA 3HHGA 3QAXA 4F3GA 4ZEIA 1J1NA 4NF5A 3EQ1A 1SI0A 4QFOA 1GV8A 2UVIA 4YB6A 3O29A 1A40A 4DXUA 2F6PA 3RY3A 1T0KA 3IJOB 1H45A 3C4MA 4P0GA 4OXVA 4U2RA 3V5AA 2H25A 4ZZEA 2Z8FA 2HXWA 3O9PA 2A5TA 2NWJA 4U4XA 5TPAA 3FUZA 3TTLA 4PFYA 2Y7IA 3MVWA 1MY1A 4JXIA 2X26A 2I48A 1KWHA 2OK2A 1MH4A 1O64A 4GF8A 1FTJA 1LFHA 3K02A 4HCYA 1TXFA 3HCQA 3IO4A 2HFBA 3K1MA 2RKMA 3CFLA 3K0VA 1NNKA 2LAOA 2DYXA 2XXWA 1B3HA 4KI0E 5I2NA 4NWCA 4THIA 3PGFA 5FTHA 2AL5A 4KYDA 3MJNA 2I0CA 1LAGE 3PPNA 2Q8JA 2ONSA 1RYOA 2UXAA 1B3LA 1B3EA 3R6UA 4MFIA 3RT6B 5JK4A 4NEDA 1IXIA 3CSGA 3KG2A 3R26A 5A5XA 3G3JA 4H5GA 2PX1A 1SW1A 4H6DA 4KQPA 3K01A 1I6QA 4GL0A 1CE2A 5AA4B 5H8HB 2GHBA 3KN7A 1URGA 3MWBA 3JZJA 4PETA 5I84A 2D21A 2OWTA 3K1PA 1CB6A 5FHMA 3G3HA 1NNTA 4IB2A 3K6UA 2PYYA 5I57A 3WAEA 2OLBA 2W7YA 1YPNA 3PMXA 3UK4A 1S9TA 1LGBC 3TCFA 4KD5A 4L17A 3MZ9A 4IO5A 3HHFA 2O7IA 1GTKA 5I59B 3PUWE 1ZJLA 4OEUA 2I4BA 2QS1A 1Y4TA 3GBBA 3PPRA 2G93A 3W15C 1MH3A 4XTCQ 4FEBA 3UA8A 1JVXA 2NVUB 2FA7A 3VXCA 2XXXA 4WKMA 2RF1A 3HN0A 3LUYA 4G68C 3FJ7A 4UACA 3PPPA 1B1HA 4GVOA 3DP8A 3K6XA 3C34A 4YKIA 4ECFA 3E4RA 4FATA 1US5A 1O7TA 2VGQA 4I1DA 3G3KA 2ESNA 4Q8RA 2OJTA 2F7BA 4QFNA 1DOTA 4TLLB 2ZNSA 1Z7NE 1Y1ZA 4LQ5A 3LBSA 3MZBA 4GFRA 5DVFA 4NF6B 4H5FA 3O66A 4R72A 3KEIA 4X1DA 3FVGA 3TODA 4FECA 4ELQA 1QUIA 2VP1A 4NF8B 3K6WA 4OZ9A 4U22A 5H8QA 4UA8A 4M1VA 2F34A 3CFZA 2O7UA 4YKKA 1B6HA 3THIA 1PBQA 3CG3A 4LP2B 1VR5A 5I2KB 2V84A 4AB6A 2G29A 1HSLA 3IK6B 1MXUA 1SI1A 3U94A 2V25A 3FD3A 4LZ5A 3IB0A 3MVXA 1N84A 3MPLA 1Y4CA 3MP1A 3IO6A 5ICQA 2H98A 1B05A 3TMGA 4F2QA 4YAHX 3RQTA 3VLUA 1TFDA 3MUQA 3TTMA 1MY3A 4OTEA 3VDFA 2E0SA 3QIMA 3N94A 3H06B 2F7CA 1LCTA 3C31A 4RA1A 5L9OA 3FVNA 1R9LA 5L8DA 4H67A 4YMAA 5F1QA 1LSTA 2XHDA 1LB8A 1Y3NA 4DZ1A 2I0BA 4NE4A 3RT8A 1IITA 1Y3PA 1B5JA 1MY2A 1B4ZA 3LSWA 4YKJA 3KN3A 3UORA 1O63A 3UN6A 1DMBA 2Q89A 3K1NA 3U1OA 1JW4A 4R9GA 2AIXA 2DE3A 4PP0A 3TQWA 2RINA 1OIBA 3MQ9A 3FXUA 2QPQA 1QJMA 1H3DA 3H4ZA 4RK9A 2PMSA 4JBZA 1IXHA 2I3VA 2ZYKA 3EHSA 3M8UA 1AH5A 2UYEA 1LBCA 4DLDA 4FAJA 5KCJB 3O6HA 3L6HA 1LFGA 4LZ7A 4ZEKA 3C9HA 3OEMA 1LCFA 3H3GA 1WODA 1I6BA 3QUFA 3C35A 2ZNTA 2XX9A 3CIJA 2NXOA 3CSBA 2FYIA 3OO6A 1MRPA 5ICTA 1P1QA 2AL4A 1R1NA 1D3KA 1MXXA 3H6UA 3DP6A 5BUUA 5H8NB 3KGCA 5LOMA 5TP9B 3S9LC 4IY5A 1JEVA 4GXAA 3QXMA 4OHNA 4POWA 3Q27A 4F39A 4DDDA 2ONKE 3FV1A 2X7PA 5HBCA 3VE1B 5HM4B 2CMOA 5JTYB 5FHNA 4ESWA 2F97A 1SYHA 3A3UA 3MPKA 4QSEA 3PPOA 2Y7KA 4GRKA 4R75A 3QSLA 4IO3A 4YU0A 2O6AA 1QKBA 1IXGA 1OLAA 4Z0IA 2DWJA 1F9BA 1MM7A 3GBAA 1OMPA 2PT1A 4ZEFA 1UTBB 4N6PA 2HQ0A 4ELOA 3OELA 4F31B 3OMBA 1B0LA 3QUJA 4RPNA 2QL3A 2UVGA 3MZ1A 4JDFA 4G68B 3KJTA 2BJJX 1PDAA 2YJPA 2OBGA 4MH5A 4KR5A 5AA1A 4HTGA 4X9TA 2HAVA 4X48A 1B0HA 5AA2D 3ZKKA 4QSCA 2HEUA 1BLFA 1P1WA 2DWIA 1ZTYA 2Q2AA 4G2ZA 2H4IA 1TWYA 5H8FA 1R6ZA 3S9NC 1B3GA 1FQDA 3OSQA 1SW5A 3S9MC 4NMYA 5F7VA 2XX7A 2OZZA 4GQOA 4BDMA 2YPNA 2B65A 3CG1A 1XT8A 4FJPA 4GIZA 2I58A 2O68A 1D4NA 5DEXB 4O3AA 3TDJA 3ONMA 1DPEA 1SBPA 3CVGA 4RY1A 2M8CA 2DOJA 1MDQA 5I59A 1SQYA 3VLVA 1XC1A 3IOVA 3A09A 4NF4A 1USYE 4R6KA 4JWOA 2O69A 1A8EA 4PFTA 4ESXA 4EXLA 1B58A 4GL8A 3N6UA 1N3WA 3IOUA 4RNSA 3E3KA 1LBBA 4ISUA 4PQJA 4GD5A 2QS4A 3K4UA 1IZ1A 4O3BA 3IORA 4HS7A 3IB2A 1VFDA 4R74A 4OFJA 4PE5B 3L6GA 1JW5A 1JETA 1H76A 3HO7A 4NF5B 1B51A 5I58A 1B5HA 2XXYA 3B6WA 3SDFA 5ITOA 5DVIA 3CRBA 1JNFA 2R6GE 1DTGA 1MXZA 3PUVE 2RC7A 4BDOA 3SEXA 2HCAA 3PD9A 3VLWA 3KBRA 4U23A 1A99A 1B4HA 2H5YA 1USYH 5K2XA 2O51A 5DVJA 3T9VA 4QSDA 2QS3A 3PMVA 4DXBA 4KPTA 3FXRA 5CRYA 3IOWA 1Q1KA 4U1ZA 2V93A 4JWXA 2Z22A 1B40A 3D4GA 3EHTA 1WDNA 3S9EA 1B46A 4U4SA 3RGYA 5I2NB 1ZLQA 1ZBMA 5EHSA 1IEJA 2I4CA 1UTHA 4ZEBA 1S50A 3DELB 3VVFA 5AA3A 2OCUA 2DS9A 1B2HA 4I9DA 1AL3A 3RTFB 1BIYA 1DTZA 4BDLA 2RCAA 2Y84A 3FZVA 4POXA 3T96B 1POY1 1S7YA 3M3LA 1B7HA 5A5XB 4ND9A 1ELJA 2HAUA 2UVJA 2GH9A 2D3IA 3SKPA 4NTLA 3TTNA 2A5SA 4XXUA 4YB5A 3FVOA 3FVKA 4OMBA 1MDP1 5CBSA 3MP8A 3KZGA 1N04A 1URSA 1FTLA 3JV9A 1FQAA 1I69A 3VVDA 4KCCA 3F11A 1FQEA 2QSXA 3RNNA 4LA9A 3T9UA 4JWYA 1B32A 1B7UA 4R2FA 4FIMA 1P99A 2VD3A 1L5TA 2H9BA 2QS2A 4H8IA 3OENA 3TZAA 1TFAA 4OYVA 3TCGA 5I57B 5IAIA 3IAZA 4OETA 2GHAA 4OWDA 4ZDMA 4ZE8A 3I5OA 4WEDA 3H6TA 1M5EA 5KCJA 4H0WA 5IKBA 3ECRA 5BWJA 1MY0A 3DP4A 2REJA 3FIRA 1M5FA 1PEBA 3SEYA 4LONB 1QW0A 2ZYOA 3U92A 3B6TA 2DWHA 2RC8A 3UP9A 1ANFA 3IJXB 2KLFA 2XX8A 1WVJA 3ODBA 3G3FA 1OLCA 5I56A 1VE4A 4R6HA 2ZYNA 4XIGQ 5CBRA 2XXHA 3TKDA 3MVZA 3TTKA 3FASA 1Y20A 2Z8EA 4EF1A 4IGTA 5M2VA 1MXWA 1NNPA 2ZNUA 4QFLA 3UGWA 3BFTA 3MW0A 4G8HA 3HPIA 1GR2A 1PBPA 2V3QA 5AA2A 5KZTA 1OQHA 2XD3A 5CMKA 1MQHA 4EQ9A 3VV5A 2PT2A 2XXUA 3SEVA 4LATA 3E13X 2QMWA 3MAMA 3TYHA 4OENA 3OO8A 3LSXA 4LUBA 3H6VA 4IO4A 2OWSA 4DCYA 4EDPA 2VD2A 2ZYMA 4H1XA 3MC2A 5K2YA 3V83A 4ELPA 1XOCA 3TAJA 1N3XA 3VVEA 1LAHE 3S4UA 2Z23A 3S2VA 4TLMB 4PFWA 3IB1A 4JB7A 5H8QB 5EYFA 3KOTA 2ALUA 4IO6A 5KDTA 4JSOA 4YB7A 5ITPA 2RCBA 5AE4A 2VOZA 3LC8A 3PUXE 4GOTA 4QRZA 2F78A 4QFKA 5J1DA 3RUMA 4LVQA 1OVTA 1ZIUA 5CI5A 3BBRA 4RJZA 1URDA 2XXIA 1I6AA 1SYIA 4ZZAA 4GLIA 4C0RA 4Q0CA 2O1MA 3I6VA 2VHAA 2ABHA 2QJEA 3N5LA 3GLBA 2HZLA 3ILTB 4JSDA 4G4PA 4GXSB 3FV2A 4IY6A 1DPPA 2P1SA 3WAFA 1R9QA 4AQ4A 1B3FA 1HSEA 2DVCA 1XHYA 4E0WA 4DE8A 4DXCA 3TUSA 3Q29A 2DP8A 1FW0A 1NKXA 3FATA 4U1OA 4Z7EA 5JEIA 1EZPA 1XS5A 2H99A 4XKPA 3KOSA 2Q2CA 3O6GA 3T93B 2Q9TA 1A55A 3MVYA 3OSRA 4LZ8A 2UVHA 3H03A 1JEUA 1A8FA 3O28A 3K00A 5CMBA 3TELA 4ONYA 2DWAA 4F29A 3TEPA 4IO2A 1POTA 1VSOA 1Q35A 2B3BA 5AA4A 5TU0A 4WXJA 2XXTA 5H8HA 4YKPA 4OFLA 1QKAA 4QHQA 2Y7RA 3FXQA 2DXYA 4I62A 1P1OA 3SETA 1QULA 3SERA 1H44A 1HSJA 4F1UA 4F22A 4M4GA 3KFMA 1JQFA 2E1SA 5CMCA 1XVXA 2RC9A 4TOZA 1P1NA 3BFUA 3LSFB 3R7XA 2F5XA 3T9XB 4ZECA 1SVXB 1RYXA 3B6QA 1N76A 5FTIA 1SD3A 3A3CA 3DLNA 5CM6A 1BTJA 4XKQA 3G7WA 4YMBA 2F8DA 4QF9A 2DXRA 4AB5A 4KHZE 3CI8A 4P0IA 4H8JA 2XD2A 2DSFA 1MY4A 3PUYE 4MF3A 3OD7A 2P0SA 3EPEA 4R2BA 1MPDA 2Y7WA 3RTWB 4OQOA 3E9XA 4OFOA 3U8QA 2DVZA 5L9SA 1FTOA 2IEEA 3IX1A 3SESA 3C33A 4YZZA 3H6WA 1OVBA 1FCKA 3O6IA 3T9HB 4OEVA 3SEWA 3PPQA 5EHMA 4FORA 4ZEDA 1MXVA 3O2AA 4HW8A 4FEDA 1YCJA 3GZGA 3P7IA 1EH3A 3FGSA 4R6YA 2A5TB 4F18A 5TPAB 1PB9A 4EQ7A 4MLVA 1IXCA 5H8FB 4DIGA 3IR1A 2P2AA 3USDA 3MP6A 3EF7A 5L9MA 4NF6A 2PBWA 3CFXA 3KN8A 1MQIA 2X7QA 1II5A 3RPWA 4FE8A 4R73A 5CMMA 4NF8A 3TFLA 4XKRA 3EHUA 3IL1B 3TQLA 1EZ9A 2XXRA 3HV1A 3CR9A 2Y7PA 3FJGA 3H7MA 3ZSFA 4G77A 5I2KA 2ONRA 1LAXA 3K2DA 3JYRA 5FHOA 3TTRA 3T22A 2XXQA 3FJMA 1NH8A 2I6EA 1QUJA 1UIUA 2I3WA 4F2OA 3Q26A 4NF4B 3Q25A 3VFJA 5H8SA 2GRVA 1OQGA 1Y1MA 3G3IA 3ILUB 2WKYA 1BP5A 4RYAA 1NNFA 3PUZE 4OERA 1M5BA 4F19A 2QRYA 4GWOA 2ZXTA 1JW1A 1NFTA 1US4A 4IO7A 4BDRA 5I58B 3QK6A 4I8CA 1Y9UA 3PU5A 4F1VA 4EUOA 2R71A 1FTMA 3Q28A 4HCWA 1LLSA 4BDQA 3BKIB 2O1LA 3LR1A 2CZLA 1SDXA 4R9FA 4N13A 1LFIA 2AYSA 3TPAA 1MM6A 4ELRA 1AMFA 4OESA 4IGRA 3ZKLA 2F35A 1A54A 1TT1A 3V8XB 4RPOA 4LQ2A 1SW2A 4WEPA 1MPCA 2V3TA 3C32A 3U72A 4E0XA 1GVCA 1NH7A 4EF2A 4G8MA 3OEKA 4KCDA 5DT6A 4X1BA 4RXLA 3TCHA 1UTHB 2DQVA 1RKMA 4ZE9A 3PMWA 3OOAA 1PB7A 5DTBA 5CC2A 1VFEA 3UIFA 5H8NA 2XXVA 2XXPA 2THIA 2R9JA 1A7LA 3LSLA 5TP9A 3GXAA 1M5DA 3MBPA 1JVYA 1N0TA 3OO9A 1B7ZA 2REGA 2IA4A 2ANJA 1SW4A 3QYTA 2ZMBA 3N6TA 1QUKA 1H43A 3B7DA 4KFQA 2NOOA 2Z8DA 4BDNA 5HPQA 4C1UA 5B7DA 1AIVA 4BLAA 1MG1A 3DM0A 3W9VA 2O84X 1B5IA 3OO7A 5JTYA 2B3FA 1FQBA 4ZS9A 1LB9A 3T66A 1IUDA 2YLNA 3PV0E 3KSXA 4C1TA 1GGGA 2F7AA 5B70A 3M3KA 5DYHA 2FNCA 3U93A 1B52A 2D5WA 1YAEA 1PB8A 1D9YA 4XKNA
chains in the Genus database with same CATH superfamily
4MBPA 3GYYA 3OXNA 1UTBA 4Q5TA 1EZOA 4F3BA 3VXBA 4K3FA 3C36A 3KSJA 1FTKA 1XVYA 1IQ7A 4NWDA 1Z7ME 1MQDA 2V3UA 2QMXA 1NV7A 4G68A 4PDDA 2UYFA 3PTYA 4QFPA 4N07A 3G3GA 1MQJA 1YTVA 4OVJA 3RLFE 4F3SA 2GFEA 1UIVA 3IFAA 4P11A 4F3PA 2DE4A 4MLQA 4GX4A 4NX1A 1MS7A 2HPGA 4F1YA 3IOTA 4TQUQ 4OVRA 1Y3QA 2DDKA 4U21A 4Q30B 1NMUA 1ZKBA 1B1XA 1ATGA 1N7XA 5ESYA 5I56B 1FPDA 3K6VA 4DCXA 3SEUA 1FQCA 3KJ7A 1LAFE 1BKAA 3E79A 3I3VA 3O97A 1EU8A 1M5CA 1ZMGA 3PD8A 1N7WA 1FQFA 3W9WA 3EN3A 2I49A 1IIWA 3N26A 5AA2B 1BK4A 5DEXA 1MPBA 4KYSA 4RK2A 3HSTA 4PE3A 2NUVA 2F6GA 1P1UA 4H65A 1MQGA 3M3FA 1B9JA 4N4UA 1KA1A 4EXKA 4YICA 5ISUA 4KYEA 4O3CA 3V89B 1DSNA 3A29A 4EQBA 1MXYA 3ZS6A 2F36A 4PCDA 1PC3A 1ZU0A 1AOVA 1UQWA 1D9VA 2PVUA 2CZHA 3D4CA 3AXFA 2HZKA 4NF0A 5ELVA 4NG7A 4PFUA 5KDTB 4MNIA 1QVSA 2DE2A 2Q88A 1NL5A 3RN8A 4G8NA 3HHGA 3QAXA 4F3GA 4ZEIA 1J1NA 4NF5A 3EQ1A 1SI0A 4QFOA 1GV8A 2UVIA 4YB6A 3O29A 1A40A 4DXUA 2F6PA 3RY3A 1T0KA 5LDZA 3IJOB 1H45A 3C4MA 4P0GA 4OXVA 4U2RA 3V5AA 2H25A 4PFBA 4ZZEA 2Z8FA 2HXWA 3O9PA 2A5TA 2NWJA 2L5VA 4U4XA 5TPAA 4XFEA 4QBAA 3FUZA 3TTLA 4PGPA 4PFYA 2Y7IA 4MEVA 5DW8A 3MVWA 2VPNA 1MY1A 4JXIA 2X26A 2I48A 1KWHA 2OK2A 1MH4A 1O64A 4GF8A 1FTJA 1FPIA 1LFHA 3K02A 4HCYA 1TXFA 3HCQA 3IO4A 2HFBA 3K1MA 2RKMA 1VDWA 3CFLA 3K0VA 1NNKA 2LAOA 2DYXA 2XXWA 1B3HA 4KI0E 4PGNA 5I2NA 4NWCA 4THIA 3PGFA 5FTHA 2AL5A 4KYDA 3MJNA 2I0CA 1LAGE 3PPNA 2Q8JA 2ONSA 1RYOA 2UXAA 1B3LA 5IM2A 1B3EA 2WYPA 1IMCA 2Y5KA 3R6UA 4MFIA 3RT6B 5JK4A 4NEDA 1IXIA 3CSGA 3KG2A 3R26A 5A5XA 3G3JA 4H5GA 3D1RA 2PX1A 1SW1A 4H6DA 4KQPA 3K01A 1I6QA 2V4CA 4GL0A 1CE2A 2PFZA 5AA4B 4H46A 5H8HB 2GHBA 3KN7A 1URGA 3MWBA 2XA5A 4JVIA 3JZJA 4PETA 5I84A 1LBWA 2D21A 2FHYA 2OWTA 3U65A 3K1PA 1CB6A 5FHMA 3G3HA 1NNTA 4IB2A 3K6UA 2PYYA 5I57A 3WAEA 2OLBA 2W7YA 1YPNA 3PMXA 3UK4A 1S9TA 1LGBC 3TCFA 4KD5A 4L17A 3MZ9A 1YZ0A 4IO5A 3B8BA 3HHFA 2O7IA 1FBDA 1GTKA 5I59B 3PUWE 1ZJLA 4OEUA 2I4BA 2QS1A 1Y4TA 3GBBA 3PPRA 2G93A 1D9QA 1KZ8A 3W15C 1MH3A 4XTCQ 4FEBA 3UA8A 1JVXA 4OVTA 2NVUB 2FA7A 3VXCA 2XXXA 4WKMA 2RF1A 3HN0A 3LUYA 4G68C 3FJ7A 4PFRA 1FBGA 4UACA 3CHGA 1DBZA 3PPPA 1B1HA 4GVOA 2XWKA 3DP8A 4AS4A 5A5LA 3K6XA 3C34A 4YKIA 4ECFA 3E4RA 4FATA 1US5A 1O7TA 4I1DA 2VGQA 3G3KA 1YXIA 2ESNA 2WEFA 4Q8RA 2OJTA 2F7BA 1DK4A 4QFNA 4FBPA 1DOTA 4TLLB 4GX6A 1NUYA 2ZNSA 1Z7NE 1Y1ZA 4HE1A 4LQ5A 3LBSA 3MZBA 4GFRA 5DVFA 4NF6B 4H5FA 5T3JA 3O66A 2HHMA 4R72A 3KEIA 4X1DA 3FVGA 3TODA 4FECA 4ELQA 2OWZA 1QUIA 2VP1A 4NF8B 3K6WA 1Q9DA 4OZ9A 4U22A 5H8QA 4UA8A 4M1VA 2F34A 5IZZA 3CFZA 2O7UA 4N17A 4YKKA 1B6HA 3THIA 1PBQA 3CG3A 4LP2B 1VR5A 5I2KB 2V84A 4AB6A 1NV1A 2G29A 5EYHA 1FBHA 1HSLA 3IK6B 2XXKA 1MXUA 1SI1A 3U94A 2V25A 3FD3A 4LZ5A 3IB0A 3MVXA 1N84A 3MPLA 4MX6A 1Y4CA 3MP1A 3IO6A 5ICQA 2H98A 1B05A 3TMGA 4F2QA 4YAHX 3RQTA 3VLUA 1TFDA 3MUQA 3TTMA 1MY3A 4OTEA 3VDFA 2E0SA 3QIMA 3N94A 3H06B 3IFCA 2F7CA 1LCTA 3C31A 4RA1A 5L9OA 3FVNA 1R9LA 5F24A 2F3BA 1FSAA 5L8DA 4H67A 4YMAA 5F1QA 1LSTA 2XHDA 1LB8A 4N81A 1Y3NA 4DZ1A 2I0BA 4NE4A 3RT8A 1IITA 1Y3PA 1B5JA 1MY2A 1B4ZA 3LSWA 4YKJA 1FPKA 3KN3A 4MNCA 4GBWA 2PCRA 3UORA 1O63A 3UN6A 1DMBA 2Q89A 3K1NA 3U1OA 1JW4A 4R9GA 2AIXA 2DE3A 4OVSA 4PP0A 3TQWA 3MYUA 2RINA 1OIBA 3MQ9A 3FXUA 2QPQA 1QJMA 1H3DA 3H4ZA 4RK9A 3BIGA 2PMSA 4JBZA 1IXHA 1FJ9A 2I3VA 2ZYKA 3EHSA 3M8UA 1AH5A 2UYEA 1LBCA 4DLDA 4FAJA 5KCJB 3O6HA 3L6HA 1LFGA 4LZ7A 4OVPA 3RPLB 4ZEKA 3C9HA 3OEMA 1LCFA 3H3GA 5IZ3B 1WODA 2Q74A 1I6BA 3QUFA 4X04A 4PF8A 3C35A 2ZNTA 2XX9A 3CIJA 2NXOA 3CSBA 2FYIA 3OO6A 1MRPA 5ICTA 4PTKA 1P1QA 2AL4A 1R1NA 1D3KA 1MXXA 3H6UA 3DP6A 5BUUA 5H8NB 3LV0A 3KGCA 5LOMA 5TP9B 2WBDA 3S9LC 2QFLA 4N8GA 4IY5A 4PFIA 1JEVA 4GXAA 3QXMA 4IR8A 4OHNA 4POWA 3KC0A 3HFUA 5FBPA 3KBZA 4GBVA 3Q27A 2R8TA 4F39A 4DDDA 2ONKE 3FV1A 2X7PA 1NV6A 5HBCA 3VE1B 5HM4B 2CEYA 2CMOA 5IGAA 4O8MA 5JTYB 5FHNA 4ESWA 2F97A 1SYHA 3A3UA 3MPKA 4QSEA 3PPOA 2Y7KA 4GRKA 4R75A 3QSLA 4IO3A 4YU0A 1CNQA 2BJIA 2O6AA 1NV5A 1QKBA 1IXGA 1OLAA 4Z0IA 1F9BA 1MM7A 3GBAA 1OMPA 2PT1A 4ZEFA 1UTBB 4N6PA 2HQ0A 2KR0A 2XWVA 4ELOA 4N15A 3OELA 4F31B 3OMBA 1B0LA 3QUJA 4RPNA 2QL3A 2UVGA 3MZ1A 4JDFA 4G68B 3KJTA 2BJJX 1PDAA 2YJPA 4JVCA 2OBGA 4MH5A 4KR5A 5AA1A 4NHBA 4HTGA 4X9TA 2QVVA 2XWIA 2HAVA 4X48A 1B0HA 5AA2D 3ZKKA 4QSCA 1KA0A 2HEUA 1BLFA 1P1WA 2DWIA 1ZTYA 2Q2AA 4G2ZA 2H4IA 1TWYA 5H8FA 1R6ZA 3S9NC 1B3GA 1FQDA 3OSQA 4DI3D 4H45A 1SW5A 1DCUA 3S9MC 4NMYA 5F7VA 2XX7A 3B50A 2OZZA 4GQOA 1SPIA 4BDMA 2YPNA 4I3EA 2B65A 3CG1A 1XT8A 4FJPA 4GIZA 2I58A 4DI4B 2O68A 1D4NA 5DEXB 2CEXA 4O3AA 1FPGA 1NV3A 3TDJA 3ONMA 1FBCA 4MJOA 1DPEA 1SBPA 4G61A 3CVGA 4NGUA 4RY1A 2M8CA 2DOJA 3MSTA 1MDQA 1XI6A 5I59A 3FXBA 1SQYA 3VLVA 1XC1A 3IOVA 3A09A 4NF4A 1USYE 4R6KA 1IMFA 4JWOA 2O69A 1A8EA 4PFTA 4ESXA 4EXLA 1B58A 4GL8A 3N6UA 1N3WA 3IOUA 4RNSA 3E3KA 1LBBA 4ISUA 4PQJA 4GD5A 2QS4A 3K4UA 1IZ1A 4O3BA 3IORA 4HS7A 3IB2A 1VFDA 2B4LA 4R74A 4OFJA 4PE5B 3L6GA 1JW5A 1JETA 1H76A 2FBPA 3HO7A 4NF5B 1B51A 5I58A 1B5HA 1RDYA 2XXYA 3B6WA 3SDFA 5ITOA 5DVIA 3CRBA 1JNFA 2R6GE 1DTGA 1MXZA 3E78A 3PUVE 2RC7A 4BDOA 3SEXA 2HCAA 3PD9A 3VLWA 1NUZA 3KBRA 4U23A 1A99A 1B4HA 2H5YA 3RYDA 1USYH 5K2XA 2O51A 5DVJA 3T9VA 4QSDA 2QS3A 3PMVA 4DXBA 4KPTA 3FXRA 5CRYA 3IOWA 1Q1KA 4U1ZA 2V93A 4JWXA 2Z22A 1B40A 3D4GA 3EHTA 1WDNA 3S9EA 1B46A 4U4SA 1JP4A 3RGYA 5I2NB 1ZLQA 1ZBMA 5EHSA 1IEJA 2I4CA 1UTHA 4ZEBA 1S50A 3DELB 3VVFA 5AA3A 2OCUA 5ET6A 5ET7A 2DS9A 1B2HA 4I9DA 1AL3A 3RTFB 3ISPA 1BIYA 1DTZA 4BDLA 2RCAA 4MNPA 2Y84A 3FZVA 4POXA 3T96B 1POY1 1S7YA 3M3LA 1B7HA 5A5XB 4ND9A 1ELJA 2HAUA 1FJ6A 2UVJA 2GH9A 2D3IA 3SKPA 4NTLA 3TTNA 2A5SA 4XXUA 4YB5A 3FVOA 3FVKA 4OMBA 1MDP1 5CBSA 3MP8A 3KC1A 3KZGA 1N04A 3T1BA 1URSA 1FTLA 4P3LA 3JV9A 1FQAA 1I69A 3VVDA 4KCCA 3F11A 1FQEA 2QSXA 1RDXA 4P8BA 3RNNA 4LA9A 3T9UA 4JWYA 1B32A 1B7UA 4R2FA 4PAIA 4FIMA 1P99A 2VD3A 4XKNA 1L5TA 2H9BA 2QS2A 4H8IA 3OENA 3TZAA 1TFAA 4OYVA 3TCGA 5I57B 5IAIA 3IAZA 4I40A 4HE2A 4OETA 2GHAA 4OWDA 4ZDMA 4ZE8A 4N6KA 3I5OA 4WEDA 3H6TA 4OA4A 1M5EA 5KCJA 4H0WA 5IKBA 3ECRA 5BWJA 1MY0A 2ZZWA 1G0HA 3DP4A 2REJA 5IZ3A 3FIRA 1M5FA 1PEBA 3SEYA 4LONB 3FBPA 4P1EA 1QW0A 2ZYOA 3U92A 4MIJA 3B6TA 4N6DA 2DWHA 2RC8A 3UP9A 1ANFA 2Q8MA 3IJXB 2KLFA 2XX8A 1FPFA 1WVJA 3ODBA 4GWZA 3G3FA 4MCOA 1OLCA 4MAGA 5I56A 1G0IA 1VE4A 4R6HA 2ZYNA 4XIGQ 5CBRA 2XXHA 3TKDA 3MVZA 3TTKA 3FASA 1Y20A 1LBZA 2Z8EA 4EF1A 4IGTA 5M2VA 1MXWA 1NNPA 2MKZA 2ZNUA 4QFLA 2CZIA 3UGWA 3BFTA 3MW0A 4XF5A 4G8HA 3HPIA 4NAPA 1GR2A 1PBPA 2V3QA 5AA2A 5KZTA 1OQHA 2QVUA 2XD3A 5CMKA 1MQHA 4EQ9A 3VV5A 2PT2A 2XXUA 3SEVA 4LATA 3E13X 2QMWA 3MAMA 3TYHA 4OENA 3OO8A 3LSXA 4LUBA 2P3VA 3H6VA 4IO4A 2OWSA 4DCYA 4EDPA 2VD2A 2ZYMA 4H1XA 3MC2A 5K2YA 3V83A 4O7MA 4ELPA 1XOCA 4NQ8A 3TAJA 1N3XA 3VVEA 1LAHE 3S4UA 2Z23A 3S2VA 4TLMB 4PFWA 3IB1A 4JB7A 5H8QB 5EYFA 3KOTA 2ALUA 4IO6A 5KDTA 4JSOA 4YB7A 5ITPA 2RCBA 5AE4A 4N8YA 4PAKA 2VOZA 3LC8A 3PUXE 4GOTA 4QRZA 2F78A 4QFKA 5J1DA 3RUMA 4LVQA 1OVTA 1ZIUA 5CI5A 3BBRA 4RJZA 1URDA 2XXIA 1I6AA 5EQ9A 1SYIA 4ZZAA 4GLIA 4GWXA 4C0RA 4Q0CA 5I5PA 2O1MA 3I6VA 4XEQA 1FPEA 2VHAA 1LBXA 2ABHA 4O94A 2QJEA 3N5LA 3GLBA 2HZLA 3ILTB 4JSDA 4G4PA 4GXSB 3FV2A 4IY6A 1DPPA 2P1SA 3WAFA 1R9QA 1FPLA 4AQ4A 4PBHA 1B3FA 1HSEA 2DVCA 4OVQA 1XHYA 4E0WA 1LEVA 4DE8A 4DXCA 2JJKA 3TUSA 3Q29A 4LN5A 2DP8A 3SZPA 1FW0A 1NKXA 3FATA 4U1OA 4Z7EA 5JEIA 1EZPA 1LBYA 1XS5A 2H99A 4XKPA 3KOSA 2Q2CA 3O6GA 4PC9A 3T93B 2Q9TA 1A55A 1FRPA 3MVYA 3OSRA 4LZ8A 2UVHA 3H03A 4I3YA 1JEUA 1A8FA 3O28A 3K00A 5CMBA 3TELA 4ONYA 2DWAA 4F29A 2OX3A 4N91A 3TEPA 4IO2A 1POTA 1VSOA 1Q35A 2B3BA 5AA4A 5TU0A 4WXJA 2XXTA 5H8HA 4YKPA 4OFLA 1QKAA 4QHQA 2WYKA 1EYIA 2Y7RA 3FXQA 2DXYA 3EKIA 4I62A 1P1OA 2ZZXA 1NV2A 2QVRA 3SETA 1QULA 3SERA 1H44A 1HSJA 1QGXA 4F1UA 4F22A 2ZZVA 4M4GA 4PAFA 3KFMA 4P1LA 1JQFA 1RDZA 2E1SA 5CMCA 1XVXA 2RC9A 4PBQA 4TOZA 1P1NA 3BFUA 3LSFB 3R7XA 2F5XA 4GWWA 3T9XB 4ZECA 1SVXB 1RYXA 3B6QA 1N76A 4MHFA 4GWYA 4P47A 5FTIA 3T0JA 1SD3A 3A3CA 3DLNA 5CM6A 1BTJA 4XKQA 3G7WA 4YMBA 1NI9A 1NUXA 2F8DA 4QF9A 2DXRA 4AB5A 4KHZE 1LBVA 3CI8A 5EQ7A 1EYJA 4P0IA 2B4MA 4H8JA 2XD2A 1NV0A 2DSFA 4OANA 1FPBA 2P3NA 1MY4A 1IMEA 3PUYE 4MF3A 3OD7A 2P0SA 3EPEA 4R2BA 1MPDA 2Y7WA 3RTWB 4OQOA 3E9XA 4OFOA 3U8QA 3NOHA 2DVZA 5L9SA 2WBBA 5I7IA 1FTOA 2IEEA 3IX1A 2HXRA 3SESA 3C33A 4YZZA 5I3SA 2VT5A 3H6WA 1OVBA 1FCKA 3O6IA 3T9HB 4OEVA 3SEWA 3PPQA 5EHMA 4FORA 4AS5A 4ZEDA 1MXVA 3O2AA 4QXDA 4HW8A 4FEDA 1IMDA 4O7IA 1YCJA 3GZGA 3P7IA 1EH3A 3FGSA 4R6YA 2A5TB 4F18A 5TPAB 1PB9A 4EQ7A 4MMPA 4MLVA 1IXCA 5H8FB 4DIGA 3IR1A 2P2AA 1FBEA 3USDA 3MP6A 3EF7A 5L9MA 4NF6A 2PBWA 3CFXA 3KN8A 2PFYA 1MQIA 2X7QA 1II5A 1IMAA 3RPWA 4FE8A 4R73A 5CMMA 4NF8A 3TFLA 4XKRA 3EHUA 4X8RA 3IL1B 3TQLA 1EZ9A 2XXRA 2KQZA 3HV1A 3CR9A 2Y7PA 3FJGA 3H7MA 3ZSFA 4G77A 2FVZA 1IMBA 5I2KA 2ONRA 1LAXA 3K2DA 1INPA 5J16A 3JYRA 5FHOA 3TTRA 2XWOA 4GWSA 3T22A 5ET5A 2XXQA 3FJMA 1NH8A 2I6EA 1FBPA 1QUJA 1UIUA 2I3WA 3Q26A 4F2OA 4NF4B 3Q25A 3QMFA 3VFJA 5H8SA 2GRVA 4P9KA 1OQGA 1Y1MA 3G3IA 3ILUB 2WKYA 4HE0A 1K9ZA 2FIEA 1BP5A 4RYAA 1NNFA 3PUZE 4OERA 1M5BA 1NUWA 3BIHA 4F19A 2QRYA 4GWOA 2ZXTA 1JW1A 1NFTA 1US4A 4IO7A 4BDRA 5I58B 3QK6A 2FIXA 4I8CA 1Y9UA 3PU5A 4F1VA 2R71A 4EUOA 1FTMA 3Q28A 4HCWA 4UABA 1LLSA 4BDQA 3BKIB 2O1LA 1FPJA 3LR1A 5ET8A 2CZLA 1SDXA 4R9FA 2Y5LA 4KXPA 4N13A 1LFIA 2AYSA 3TPAA 4JVDA 4P56A 1MM6A 1AMFA 4ELRA 4OESA 4IGRA 3ZKLA 1FTAA 3ROJA 2F35A 2F3DA 1A54A 1TT1A 3V8XB 4RPOA 4LQ2A 1SW2A 4WEPA 1MPCA 2V3TA 3C32A 2CZKA 3U72A 4E0XA 1GVCA 5IZ1A 3RPLA 1NH7A 4EF2A 4G8MA 3OEKA 4KCDA 5LTCA 5DT6A 4GWUA 1EYKA 4HXVA 4X1BA 4RXLA 3TCHA 1UTHB 2DQVA 1RKMA 5EQAA 4ZE9A 3PMWA 5EQ8A 1FBFA 3OOAA 1PB7A 5DTBA 5CC2A 1VFEA 3UIFA 5H8NA 2XXVA 2XXPA 2THIA 2R9JA 1A7LA 3LSLA 5TP9A 3GXAA 1M5DA 3MBPA 1JVYA 1N0TA 3OO9A 1B7ZA 2REGA 2VPOA 2IA4A 2WX9A 2ANJA 1SW4A 3QYTA 2ZMBA 3N6TA 4PDHA 1NV4A 1QUKA 1H43A 3B7DA 4KFQA 2NOOA 2Z8DA 1YYZA 4BDNA 5HPQA 4C1UA 5B7DA 1AIVA 4BLAA 1MG1A 3DM0A 4PF6A 3W9VA 2O84X 1K9YA 1B5IA 3OO7A 5JTYA 2B3FA 3LUZA 1FQBA 4ZS9A 1AWBA 1LB9A 3T66A 1IUDA 2YLNA 3PV0E 3KSXA 2GQ1A 4C1TA 1GGGA 2F7AA 5B70A 3M3KA 5DYHA 5EYGA 2FNCA 3U93A 1B52A 2D5WA 1YAEA 4NN3A 1PB8A 1D9YA 2DWJA 4GX3A
chains in the Genus database with same CATH topology
4MBPA 3OXNA 1UTBA 4Q5TA 1EZOA 4F3BA 3VXBA 4K3FA 3C36A 3KSJA 1FTKA 1XVYA 1IQ7A 4NWDA 1Z7ME 1MQDA 2V3UA 2QMXA 4G68A 2UYFA 4QFPA 4N07A 3G3GA 1MQJA 1YTVA 4OVJA 3RLFE 4F3SA 2GFEA 1UIVA 4P11A 4F3PA 2DE4A 4MLQA 1MS7A 4F1YA 3IOTA 4TQUQ 1Y3QA 4U21A 4Q30B 1NMUA 1ZKBA 1B1XA 1ATGA 1N7XA 5I56B 3K6VA 4DCXA 3SEUA 1FQCA 3KJ7A 1LAFE 1BKAA 3I3VA 3O97A 1EU8A 1M5CA 1ZMGA 3PD8A 1N7WA 1FQFA 3W9WA 3EN3A 2I49A 1IIWA 3N26A 5AA2B 5DEXA 1MPBA 4KYSA 4RK2A 3HSTA 2NUVA 2F6GA 1P1UA 4H65A 1MQGA 3M3FA 1B9JA 4EXKA 4YICA 5ISUA 4KYEA 4O3CA 3V89B 1DSNA 4EQBA 1MXYA 3ZS6A 2F36A 1PC3A 1ZU0A 1AOVA 1UQWA 1D9VA 2PVUA 3D4CA 3AXFA 2HZKA 5ELVA 4PFUA 5KDTB 1QVSA 2DE2A 2Q88A 1NL5A 3RN8A 4G8NA 3HHGA 3QAXA 4F3GA 4ZEIA 1J1NA 4NF5A 3EQ1A 1SI0A 4QFOA 1GV8A 2UVIA 4YB6A 3O29A 1A40A 4DXUA 2F6PA 3RY3A 1T0KA 3IJOB 1H45A 3C4MA 4P0GA 4OXVA 4U2RA 3V5AA 2H25A 4ZZEA 2Z8FA 2HXWA 3O9PA 2A5TA 2NWJA 4U4XA 5TPAA 3FUZA 3TTLA 4PFYA 2Y7IA 3MVWA 1MY1A 4JXIA 2X26A 2I48A 1KWHA 2OK2A 1MH4A 1O64A 4GF8A 1FTJA 1LFHA 3K02A 4HCYA 1TXFA 3HCQA 3IO4A 2HFBA 3K1MA 2RKMA 3CFLA 3K0VA 1NNKA 2LAOA 2DYXA 2XXWA 1B3HA 4KI0E 5I2NA 4NWCA 4THIA 3PGFA 5FTHA 2AL5A 4KYDA 3MJNA 2I0CA 1LAGE 3PPNA 2Q8JA 2ONSA 1RYOA 2UXAA 1B3LA 1B3EA 3R6UA 4MFIA 3RT6B 5JK4A 4NEDA 1IXIA 3CSGA 3KG2A 3R26A 5A5XA 3G3JA 4H5GA 2PX1A 1SW1A 4H6DA 4KQPA 3K01A 1I6QA 4GL0A 1CE2A 5AA4B 5H8HB 2GHBA 3KN7A 1URGA 3MWBA 3JZJA 4PETA 5I84A 2D21A 2OWTA 3K1PA 1CB6A 5FHMA 3G3HA 1NNTA 4IB2A 3K6UA 2PYYA 5I57A 3WAEA 2OLBA 2W7YA 1YPNA 3PMXA 3UK4A 1S9TA 1LGBC 3TCFA 4KD5A 4L17A 3MZ9A 4IO5A 3HHFA 2O7IA 1GTKA 5I59B 3PUWE 1ZJLA 4OEUA 2I4BA 2QS1A 1Y4TA 3GBBA 3PPRA 2G93A 3W15C 1MH3A 4XTCQ 4FEBA 3UA8A 1JVXA 2NVUB 2FA7A 3VXCA 2XXXA 4WKMA 2RF1A 3HN0A 3LUYA 4G68C 3FJ7A 4UACA 3PPPA 1B1HA 4GVOA 3DP8A 3K6XA 3C34A 4YKIA 4ECFA 3E4RA 4FATA 1US5A 1O7TA 2VGQA 4I1DA 3G3KA 2ESNA 4Q8RA 2OJTA 2F7BA 4QFNA 1DOTA 4TLLB 2ZNSA 1Z7NE 1Y1ZA 4LQ5A 3LBSA 3MZBA 4GFRA 5DVFA 4NF6B 4H5FA 3O66A 4R72A 3KEIA 4X1DA 3FVGA 3TODA 4FECA 4ELQA 1QUIA 2VP1A 4NF8B 3K6WA 4OZ9A 4U22A 5H8QA 4UA8A 4M1VA 2F34A 3CFZA 2O7UA 4YKKA 1B6HA 3THIA 1PBQA 3CG3A 4LP2B 1VR5A 5I2KB 2V84A 4AB6A 2G29A 1HSLA 3IK6B 1MXUA 1SI1A 3U94A 2V25A 3FD3A 4LZ5A 3IB0A 3MVXA 1N84A 3MPLA 1Y4CA 3MP1A 3IO6A 5ICQA 2H98A 1B05A 3TMGA 4F2QA 4YAHX 3RQTA 3VLUA 1TFDA 3MUQA 3TTMA 1MY3A 4OTEA 3VDFA 2E0SA 3QIMA 3N94A 3H06B 2F7CA 1LCTA 3C31A 4RA1A 5L9OA 3FVNA 1R9LA 5L8DA 4H67A 4YMAA 5F1QA 1LSTA 2XHDA 1LB8A 1Y3NA 4DZ1A 2I0BA 4NE4A 3RT8A 1IITA 1Y3PA 1B5JA 1MY2A 1B4ZA 3LSWA 4YKJA 3KN3A 3UORA 1O63A 3UN6A 1DMBA 2Q89A 3K1NA 3U1OA 1JW4A 4R9GA 2AIXA 2DE3A 4PP0A 3TQWA 2RINA 1OIBA 3MQ9A 3FXUA 2QPQA 1QJMA 1H3DA 3H4ZA 4RK9A 2PMSA 4JBZA 1IXHA 2I3VA 2ZYKA 3EHSA 3M8UA 1AH5A 2UYEA 1LBCA 4DLDA 4FAJA 5KCJB 3O6HA 3L6HA 1LFGA 4LZ7A 4ZEKA 3C9HA 3OEMA 1LCFA 3H3GA 1WODA 1I6BA 3QUFA 3C35A 2ZNTA 2XX9A 3CIJA 2NXOA 3CSBA 2FYIA 3OO6A 1MRPA 5ICTA 1P1QA 2AL4A 1R1NA 1D3KA 1MXXA 3H6UA 3DP6A 5BUUA 5H8NB 3KGCA 5LOMA 5TP9B 3S9LC 4IY5A 1JEVA 4GXAA 3QXMA 4OHNA 4POWA 3Q27A 4F39A 4DDDA 2ONKE 3FV1A 2X7PA 5HBCA 3VE1B 5HM4B 2CMOA 5JTYB 5FHNA 4ESWA 2F97A 1SYHA 3A3UA 3MPKA 4QSEA 3PPOA 2Y7KA 4GRKA 4R75A 3QSLA 4IO3A 4YU0A 2O6AA 1QKBA 1IXGA 1OLAA 4Z0IA 2DWJA 1F9BA 1MM7A 3GBAA 1OMPA 2PT1A 4ZEFA 1UTBB 4N6PA 2HQ0A 4ELOA 3OELA 4F31B 3OMBA 1B0LA 3QUJA 4RPNA 2QL3A 2UVGA 3MZ1A 4JDFA 4G68B 3KJTA 2BJJX 1PDAA 2YJPA 2OBGA 4MH5A 4KR5A 5AA1A 4HTGA 4X9TA 2HAVA 4X48A 1B0HA 5AA2D 3ZKKA 4QSCA 2HEUA 1BLFA 1P1WA 2DWIA 1ZTYA 2Q2AA 4G2ZA 2H4IA 1TWYA 5H8FA 1R6ZA 3S9NC 1B3GA 1FQDA 3OSQA 1SW5A 3S9MC 4NMYA 5F7VA 2XX7A 2OZZA 4GQOA 4BDMA 2YPNA 2B65A 3CG1A 1XT8A 4FJPA 4GIZA 2I58A 2O68A 1D4NA 5DEXB 4O3AA 3TDJA 3ONMA 1DPEA 1SBPA 3CVGA 4RY1A 2M8CA 2DOJA 1MDQA 5I59A 1SQYA 3VLVA 1XC1A 3IOVA 3A09A 4NF4A 1USYE 4R6KA 4JWOA 2O69A 1A8EA 4PFTA 4ESXA 4EXLA 1B58A 4GL8A 3N6UA 1N3WA 3IOUA 4RNSA 3E3KA 1LBBA 4ISUA 4PQJA 4GD5A 2QS4A 3K4UA 1IZ1A 4O3BA 3IORA 4HS7A 3IB2A 1VFDA 4R74A 4OFJA 4PE5B 3L6GA 1JW5A 1JETA 1H76A 3HO7A 4NF5B 1B51A 5I58A 1B5HA 2XXYA 3B6WA 3SDFA 5ITOA 5DVIA 3CRBA 1JNFA 2R6GE 1DTGA 1MXZA 3PUVE 2RC7A 4BDOA 3SEXA 2HCAA 3PD9A 3VLWA 3KBRA 4U23A 1A99A 1B4HA 2H5YA 1USYH 5K2XA 2O51A 5DVJA 3T9VA 4QSDA 2QS3A 3PMVA 4DXBA 4KPTA 3FXRA 5CRYA 3IOWA 1Q1KA 4U1ZA 2V93A 4JWXA 2Z22A 1B40A 3D4GA 3EHTA 1WDNA 3S9EA 1B46A 4U4SA 3RGYA 5I2NB 1ZLQA 1ZBMA 5EHSA 1IEJA 2I4CA 1UTHA 4ZEBA 1S50A 3DELB 3VVFA 5AA3A 2OCUA 2DS9A 1B2HA 4I9DA 1AL3A 3RTFB 1BIYA 1DTZA 4BDLA 2RCAA 2Y84A 3FZVA 4POXA 3T96B 1POY1 1S7YA 3M3LA 1B7HA 5A5XB 4ND9A 1ELJA 2HAUA 2UVJA 2GH9A 2D3IA 3SKPA 4NTLA 3TTNA 2A5SA 4XXUA 4YB5A 3FVOA 3FVKA 4OMBA 1MDP1 5CBSA 3MP8A 3KZGA 1N04A 1URSA 1FTLA 3JV9A 1FQAA 1I69A 3VVDA 4KCCA 3F11A 1FQEA 2QSXA 3RNNA 4LA9A 3T9UA 4JWYA 1B32A 1B7UA 4R2FA 4FIMA 1P99A 2VD3A 1L5TA 2H9BA 2QS2A 4H8IA 3OENA 3TZAA 1TFAA 4OYVA 3TCGA 5I57B 5IAIA 3IAZA 4OETA 2GHAA 4OWDA 4ZDMA 4ZE8A 3I5OA 4WEDA 3H6TA 1M5EA 5KCJA 4H0WA 5IKBA 3ECRA 5BWJA 1MY0A 3DP4A 2REJA 3FIRA 1M5FA 1PEBA 3SEYA 4LONB 1QW0A 2ZYOA 3U92A 3B6TA 2DWHA 2RC8A 3UP9A 1ANFA 3IJXB 2KLFA 2XX8A 1WVJA 3ODBA 3G3FA 1OLCA 5I56A 1VE4A 4R6HA 2ZYNA 4XIGQ 5CBRA 2XXHA 3TKDA 3MVZA 3TTKA 3FASA 1Y20A 2Z8EA 4EF1A 4IGTA 5M2VA 1MXWA 1NNPA 2ZNUA 4QFLA 3UGWA 3BFTA 3MW0A 4G8HA 3HPIA 1GR2A 1PBPA 2V3QA 5AA2A 5KZTA 1OQHA 2XD3A 5CMKA 1MQHA 4EQ9A 3VV5A 2PT2A 2XXUA 3SEVA 4LATA 3E13X 2QMWA 3MAMA 3TYHA 4OENA 3OO8A 3LSXA 4LUBA 3H6VA 4IO4A 2OWSA 4DCYA 4EDPA 2VD2A 2ZYMA 4H1XA 3MC2A 5K2YA 3V83A 4ELPA 1XOCA 3TAJA 1N3XA 3VVEA 1LAHE 3S4UA 2Z23A 3S2VA 4TLMB 4PFWA 3IB1A 4JB7A 5H8QB 5EYFA 3KOTA 2ALUA 4IO6A 5KDTA 4JSOA 4YB7A 5ITPA 2RCBA 5AE4A 2VOZA 3LC8A 3PUXE 4GOTA 4QRZA 2F78A 4QFKA 5J1DA 3RUMA 4LVQA 1OVTA 1ZIUA 5CI5A 3BBRA 4RJZA 1URDA 2XXIA 1I6AA 1SYIA 4ZZAA 4GLIA 4C0RA 4Q0CA 2O1MA 3I6VA 2VHAA 2ABHA 2QJEA 3N5LA 3GLBA 2HZLA 3ILTB 4JSDA 4G4PA 4GXSB 3FV2A 4IY6A 1DPPA 2P1SA 3WAFA 1R9QA 4AQ4A 1B3FA 1HSEA 2DVCA 1XHYA 4E0WA 4DE8A 4DXCA 3TUSA 3Q29A 2DP8A 1FW0A 1NKXA 3FATA 4U1OA 4Z7EA 5JEIA 1EZPA 1XS5A 2H99A 4XKPA 3KOSA 2Q2CA 3O6GA 3T93B 2Q9TA 1A55A 3MVYA 3OSRA 4LZ8A 2UVHA 3H03A 1JEUA 1A8FA 3O28A 3K00A 5CMBA 3TELA 4ONYA 2DWAA 4F29A 3TEPA 4IO2A 1POTA 1VSOA 1Q35A 2B3BA 5AA4A 5TU0A 4WXJA 2XXTA 5H8HA 4YKPA 4OFLA 1QKAA 4QHQA 2Y7RA 3FXQA 2DXYA 4I62A 1P1OA 3SETA 1QULA 3SERA 1H44A 1HSJA 4F1UA 4F22A 4M4GA 3KFMA 1JQFA 2E1SA 5CMCA 1XVXA 2RC9A 4TOZA 1P1NA 3BFUA 3LSFB 3R7XA 2F5XA 3T9XB 4ZECA 1SVXB 1RYXA 3B6QA 1N76A 5FTIA 1SD3A 3A3CA 3DLNA 5CM6A 1BTJA 4XKQA 3G7WA 4YMBA 2F8DA 4QF9A 2DXRA 4AB5A 4KHZE 3CI8A 4P0IA 4H8JA 2XD2A 2DSFA 1MY4A 3PUYE 4MF3A 3OD7A 2P0SA 3EPEA 4R2BA 1MPDA 2Y7WA 3RTWB 4OQOA 3E9XA 4OFOA 3U8QA 2DVZA 5L9SA 1FTOA 2IEEA 3IX1A 3SESA 3C33A 4YZZA 3H6WA 1OVBA 1FCKA 3O6IA 3T9HB 4OEVA 3SEWA 3PPQA 5EHMA 4FORA 4ZEDA 1MXVA 3O2AA 4HW8A 4FEDA 1YCJA 3GZGA 3P7IA 1EH3A 3FGSA 4R6YA 2A5TB 4F18A 5TPAB 1PB9A 4EQ7A 4MLVA 1IXCA 5H8FB 4DIGA 3IR1A 2P2AA 3USDA 3MP6A 3EF7A 5L9MA 4NF6A 2PBWA 3CFXA 3KN8A 1MQIA 2X7QA 1II5A 3RPWA 4FE8A 4R73A 5CMMA 4NF8A 3TFLA 4XKRA 3EHUA 3IL1B 3TQLA 1EZ9A 2XXRA 3HV1A 3CR9A 2Y7PA 3FJGA 3H7MA 3ZSFA 4G77A 5I2KA 2ONRA 1LAXA 3K2DA 3JYRA 5FHOA 3TTRA 3T22A 2XXQA 3FJMA 1NH8A 2I6EA 1QUJA 1UIUA 2I3WA 4F2OA 3Q26A 4NF4B 3Q25A 3VFJA 5H8SA 2GRVA 1OQGA 1Y1MA 3G3IA 3ILUB 2WKYA 1BP5A 4RYAA 1NNFA 3PUZE 4OERA 1M5BA 4F19A 2QRYA 4GWOA 2ZXTA 1JW1A 1NFTA 1US4A 4IO7A 4BDRA 5I58B 3QK6A 4I8CA 1Y9UA 3PU5A 4F1VA 4EUOA 2R71A 1FTMA 3Q28A 4HCWA 1LLSA 4BDQA 3BKIB 2O1LA 3LR1A 2CZLA 1SDXA 4R9FA 4N13A 1LFIA 2AYSA 3TPAA 1MM6A 4ELRA 1AMFA 4OESA 4IGRA 3ZKLA 2F35A 1A54A 1TT1A 3V8XB 4RPOA 4LQ2A 1SW2A 4WEPA 1MPCA 2V3TA 3C32A 3U72A 4E0XA 1GVCA 1NH7A 4EF2A 4G8MA 3OEKA 4KCDA 5DT6A 4X1BA 4RXLA 3TCHA 1UTHB 2DQVA 1RKMA 4ZE9A 3PMWA 3OOAA 1PB7A 5DTBA 5CC2A 1VFEA 3UIFA 5H8NA 2XXVA 2XXPA 2THIA 2R9JA 1A7LA 3LSLA 5TP9A 3GXAA 1M5DA 3MBPA 1JVYA 1N0TA 3OO9A 1B7ZA 2REGA 2IA4A 2ANJA 1SW4A 3QYTA 2ZMBA 3N6TA 1QUKA 1H43A 3B7DA 4KFQA 2NOOA 2Z8DA 4BDNA 5HPQA 4C1UA 5B7DA 1AIVA 4BLAA 1MG1A 3DM0A 3W9VA 2O84X 1B5IA 3OO7A 5JTYA 2B3FA 1FQBA 4ZS9A 1LB9A 3T66A 1IUDA 2YLNA 3PV0E 3KSXA 4C1TA 1GGGA 2F7AA 5B70A 3M3KA 5DYHA 2FNCA 3U93A 1B52A 2D5WA 1YAEA 1PB8A 1D9YA 4XKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBP A;  3OXN A;  1UTB A;  4Q5T A;  1EZO A;  4F3B A;  3VXB A;  4K3F A;  3C36 A;  3KSJ A;  1FTK A;  1XVY A;  1IQ7 A;  4NWD A;  1Z7M E;  1MQD A;  2V3U A;  2QMX A;  4G68 A;  2UYF A;  4QFP A;  4N07 A;  3G3G A;  1MQJ A;  1YTV A;  4OVJ A;  3RLF E;  4F3S A;  2GFE A;  1UIV A;  4P11 A;  4F3P A;  2DE4 A;  4MLQ A;  1MS7 A;  4F1Y A;  3IOT A;  4TQU Q;  1Y3Q A;  4U21 A;  4Q30 B;  1NMU A;  1ZKB A;  1B1X A;  1ATG A;  1N7X A;  5I56 B;  3K6V A;  4DCX A;  3SEU A;  1FQC A;  3KJ7 A;  1LAF E;  1BKA A;  3I3V A;  3O97 A;  1EU8 A;  1M5C A;  1ZMG A;  3PD8 A;  1N7W A;  1FQF A;  3W9W A;  3EN3 A;  2I49 A;  1IIW A;  3N26 A;  5AA2 B;  5DEX A;  1MPB A;  4KYS A;  4RK2 A;  3HST A;  2NUV A;  2F6G A;  1P1U A;  4H65 A;  1MQG A;  3M3F A;  1B9J A;  4EXK A;  4YIC A;  5ISU A;  4KYE A;  4O3C A;  3V89 B;  1DSN A;  4EQB A;  1MXY A;  3ZS6 A;  2F36 A;  1PC3 A;  1ZU0 A;  1AOV A;  1UQW A;  1D9V A;  2PVU A;  3D4C A;  3AXF A;  2HZK A;  5ELV A;  4PFU A;  5KDT B;  1QVS A;  2DE2 A;  2Q88 A;  1NL5 A;  3RN8 A;  4G8N A;  3HHG A;  3QAX A;  4F3G A;  4ZEI A;  1J1N A;  4NF5 A;  3EQ1 A;  1SI0 A;  4QFO A;  1GV8 A;  2UVI A;  4YB6 A;  3O29 A;  1A40 A;  4DXU A;  2F6P A;  3RY3 A;  1T0K A;  3IJO B;  1H45 A;  3C4M A;  4P0G A;  4OXV A;  4U2R A;  3V5A A;  2H25 A;  4ZZE A;  2Z8F A;  2HXW A;  3O9P A;  2A5T A;  2NWJ A;  4U4X A;  5TPA A;  3FUZ A;  3TTL A;  4PFY A;  2Y7I A;  3MVW A;  1MY1 A;  4JXI A;  2X26 A;  2I48 A;  1KWH A;  2OK2 A;  1MH4 A;  1O64 A;  4GF8 A;  1FTJ A;  1LFH A;  3K02 A;  4HCY A;  1TXF A;  3HCQ A;  3IO4 A;  2HFB A;  3K1M A;  2RKM A;  3CFL A;  3K0V A;  1NNK A;  2LAO A;  2DYX A;  2XXW A;  1B3H A;  4KI0 E;  5I2N A;  4NWC A;  4THI A;  3PGF A;  5FTH A;  2AL5 A;  4KYD A;  3MJN A;  2I0C A;  1LAG E;  3PPN A;  2Q8J A;  2ONS A;  1RYO A;  2UXA A;  1B3L A;  1B3E A;  3R6U A;  4MFI A;  3RT6 B;  5JK4 A;  4NED A;  1IXI A;  3CSG A;  3KG2 A;  3R26 A;  5A5X A;  3G3J A;  4H5G A;  2PX1 A;  1SW1 A;  4H6D A;  4KQP A;  3K01 A;  1I6Q A;  4GL0 A;  1CE2 A;  5AA4 B;  5H8H B;  2GHB A;  3KN7 A;  1URG A;  3MWB A;  3JZJ A;  4PET A;  5I84 A;  2D21 A;  2OWT A;  3K1P A;  1CB6 A;  5FHM A;  3G3H A;  1NNT A;  4IB2 A;  3K6U A;  2PYY A;  5I57 A;  3WAE A;  2OLB A;  2W7Y A;  1YPN A;  3PMX A;  3UK4 A;  1S9T A;  1LGB C;  3TCF A;  4KD5 A;  4L17 A;  3MZ9 A;  4IO5 A;  3HHF A;  2O7I A;  1GTK A;  5I59 B;  3PUW E;  1ZJL A;  4OEU A;  2I4B A;  2QS1 A;  1Y4T A;  3GBB A;  3PPR A;  2G93 A;  3W15 C;  1MH3 A;  4XTC Q;  4FEB A;  3UA8 A;  1JVX A;  2NVU B;  2FA7 A;  3VXC A;  2XXX A;  4WKM A;  2RF1 A;  3HN0 A;  3LUY A;  4G68 C;  3FJ7 A;  4UAC A;  3PPP A;  1B1H A;  4GVO A;  3DP8 A;  3K6X A;  3C34 A;  4YKI A;  4ECF A;  3E4R A;  4FAT A;  1US5 A;  1O7T A;  2VGQ A;  4I1D A;  3G3K A;  2ESN A;  4Q8R A;  2OJT A;  2F7B A;  4QFN A;  1DOT A;  4TLL B;  2ZNS A;  1Z7N E;  1Y1Z A;  4LQ5 A;  3LBS A;  3MZB A;  4GFR A;  5DVF A;  4NF6 B;  4H5F A;  3O66 A;  4R72 A;  3KEI A;  4X1D A;  3FVG A;  3TOD A;  4FEC A;  4ELQ A;  1QUI A;  2VP1 A;  4NF8 B;  3K6W A;  4OZ9 A;  4U22 A;  5H8Q A;  4UA8 A;  4M1V A;  2F34 A;  3CFZ A;  2O7U A;  4YKK A;  1B6H A;  3THI A;  1PBQ A;  3CG3 A;  4LP2 B;  1VR5 A;  5I2K B;  2V84 A;  4AB6 A;  2G29 A;  1HSL A;  3IK6 B;  1MXU A;  1SI1 A;  3U94 A;  2V25 A;  3FD3 A;  4LZ5 A;  3IB0 A;  3MVX A;  1N84 A;  3MPL A;  1Y4C A;  3MP1 A;  3IO6 A;  5ICQ A;  2H98 A;  1B05 A;  3TMG A;  4F2Q A;  4YAH X;  3RQT A;  3VLU A;  1TFD A;  3MUQ A;  3TTM A;  1MY3 A;  4OTE A;  3VDF A;  2E0S A;  3QIM A;  3N94 A;  3H06 B;  2F7C A;  1LCT A;  3C31 A;  4RA1 A;  5L9O A;  3FVN A;  1R9L A;  5L8D A;  4H67 A;  4YMA A;  5F1Q A;  1LST A;  2XHD A;  1LB8 A;  1Y3N A;  4DZ1 A;  2I0B A;  4NE4 A;  3RT8 A;  1IIT A;  1Y3P A;  1B5J A;  1MY2 A;  1B4Z A;  3LSW A;  4YKJ A;  3KN3 A;  3UOR A;  1O63 A;  3UN6 A;  1DMB A;  2Q89 A;  3K1N A;  3U1O A;  1JW4 A;  4R9G A;  2AIX A;  2DE3 A;  4PP0 A;  3TQW A;  2RIN A;  1OIB A;  3MQ9 A;  3FXU A;  2QPQ A;  1QJM A;  1H3D A;  3H4Z A;  4RK9 A;  2PMS A;  4JBZ A;  1IXH A;  2I3V A;  2ZYK A;  3EHS A;  3M8U A;  1AH5 A;  2UYE A;  1LBC A;  4DLD A;  4FAJ A;  5KCJ B;  3O6H A;  3L6H A;  1LFG A;  4LZ7 A;  4ZEK A;  3C9H A;  3OEM A;  1LCF A;  3H3G A;  1WOD A;  1I6B A;  3QUF A;  3C35 A;  2ZNT A;  2XX9 A;  3CIJ A;  2NXO A;  3CSB A;  2FYI A;  3OO6 A;  1MRP A;  5ICT A;  1P1Q A;  2AL4 A;  1R1N A;  1D3K A;  1MXX A;  3H6U A;  3DP6 A;  5BUU A;  5H8N B;  3KGC A;  5LOM A;  5TP9 B;  3S9L C;  4IY5 A;  1JEV A;  4GXA A;  3QXM A;  4OHN A;  4POW A;  3Q27 A;  4F39 A;  4DDD A;  2ONK E;  3FV1 A;  2X7P A;  5HBC A;  3VE1 B;  5HM4 B;  2CMO A;  5JTY B;  5FHN A;  4ESW A;  2F97 A;  1SYH A;  3A3U A;  3MPK A;  4QSE A;  3PPO A;  2Y7K A;  4GRK A;  4R75 A;  3QSL A;  4IO3 A;  4YU0 A;  2O6A A;  1QKB A;  1IXG A;  1OLA A;  4Z0I A;  2DWJ A;  1F9B A;  1MM7 A;  3GBA A;  1OMP A;  2PT1 A;  4ZEF A;  1UTB B;  4N6P A;  2HQ0 A;  4ELO A;  3OEL A;  4F31 B;  3OMB A;  1B0L A;  3QUJ A;  4RPN A;  2QL3 A;  2UVG A;  3MZ1 A;  4JDF A;  4G68 B;  3KJT A;  2BJJ X;  1PDA A;  2YJP A;  2OBG A;  4MH5 A;  4KR5 A;  5AA1 A;  4HTG A;  4X9T A;  2HAV A;  4X48 A;  1B0H A;  5AA2 D;  3ZKK A;  4QSC A;  2HEU A;  1BLF A;  1P1W A;  2DWI A;  1ZTY A;  2Q2A A;  4G2Z A;  2H4I A;  1TWY A;  5H8F A;  1R6Z A;  3S9N C;  1B3G A;  1FQD A;  3OSQ A;  1SW5 A;  3S9M C;  4NMY A;  5F7V A;  2XX7 A;  2OZZ A;  4GQO A;  4BDM A;  2YPN A;  2B65 A;  3CG1 A;  1XT8 A;  4FJP A;  4GIZ A;  2I58 A;  2O68 A;  1D4N A;  5DEX B;  4O3A A;  3TDJ A;  3ONM A;  1DPE A;  1SBP A;  3CVG A;  4RY1 A;  2M8C A;  2DOJ A;  1MDQ A;  5I59 A;  1SQY A;  3VLV A;  1XC1 A;  3IOV A;  3A09 A;  4NF4 A;  1USY E;  4R6K A;  4JWO A;  2O69 A;  1A8E A;  4PFT A;  4ESX A;  4EXL A;  1B58 A;  4GL8 A;  3N6U A;  1N3W A;  3IOU A;  4RNS A;  3E3K A;  1LBB A;  4ISU A;  4PQJ A;  4GD5 A;  2QS4 A;  3K4U A;  1IZ1 A;  4O3B A;  3IOR A;  4HS7 A;  3IB2 A;  1VFD A;  4R74 A;  4OFJ A;  4PE5 B;  3L6G A;  1JW5 A;  1JET A;  1H76 A;  3HO7 A;  4NF5 B;  1B51 A;  5I58 A;  1B5H A;  2XXY A;  3B6W A;  3SDF A;  5ITO A;  5DVI A;  3CRB A;  1JNF A;  2R6G E;  1DTG A;  1MXZ A;  3PUV E;  2RC7 A;  4BDO A;  3SEX A;  2HCA A;  3PD9 A;  3VLW A;  3KBR A;  4U23 A;  1A99 A;  1B4H A;  2H5Y A;  1USY H;  5K2X A;  2O51 A;  5DVJ A;  3T9V A;  4QSD A;  2QS3 A;  3PMV A;  4DXB A;  4KPT A;  3FXR A;  5CRY A;  3IOW A;  1Q1K A;  4U1Z A;  2V93 A;  4JWX A;  2Z22 A;  1B40 A;  3D4G A;  3EHT A;  1WDN A;  3S9E A;  1B46 A;  4U4S A;  3RGY A;  5I2N B;  1ZLQ A;  1ZBM A;  5EHS A;  1IEJ A;  2I4C A;  1UTH A;  4ZEB A;  1S50 A;  3DEL B;  3VVF A;  5AA3 A;  2OCU A;  2DS9 A;  1B2H A;  4I9D A;  1AL3 A;  3RTF B;  1BIY A;  1DTZ A;  4BDL A;  2RCA A;  2Y84 A;  3FZV A;  4POX A;  3T96 B;  1POY 1;  1S7Y A;  3M3L A;  1B7H A;  5A5X B;  4ND9 A;  1ELJ A;  2HAU A;  2UVJ A;  2GH9 A;  2D3I A;  3SKP A;  4NTL A;  3TTN A;  2A5S A;  4XXU A;  4YB5 A;  3FVO A;  3FVK A;  4OMB A;  1MDP 1;  5CBS A;  3MP8 A;  3KZG A;  1N04 A;  1URS A;  1FTL A;  3JV9 A;  1FQA A;  1I69 A;  3VVD A;  4KCC A;  3F11 A;  1FQE A;  2QSX A;  3RNN A;  4LA9 A;  3T9U A;  4JWY A;  1B32 A;  1B7U A;  4R2F A;  4FIM A;  1P99 A;  2VD3 A;  1L5T A;  2H9B A;  2QS2 A;  4H8I A;  3OEN A;  3TZA A;  1TFA A;  4OYV A;  3TCG A;  5I57 B;  5IAI A;  3IAZ A;  4OET A;  2GHA A;  4OWD A;  4ZDM A;  4ZE8 A;  3I5O A;  4WED A;  3H6T A;  1M5E A;  5KCJ A;  4H0W A;  5IKB A;  3ECR A;  5BWJ A;  1MY0 A;  3DP4 A;  2REJ A;  3FIR A;  1M5F A;  1PEB A;  3SEY A;  4LON B;  1QW0 A;  2ZYO A;  3U92 A;  3B6T A;  2DWH A;  2RC8 A;  3UP9 A;  1ANF A;  3IJX B;  2KLF A;  2XX8 A;  1WVJ A;  3ODB A;  3G3F A;  1OLC A;  5I56 A;  1VE4 A;  4R6H A;  2ZYN A;  4XIG Q;  5CBR A;  2XXH A;  3TKD A;  3MVZ A;  3TTK A;  3FAS A;  1Y20 A;  2Z8E A;  4EF1 A;  4IGT A;  5M2V A;  1MXW A;  1NNP A;  2ZNU A;  4QFL A;  3UGW A;  3BFT A;  3MW0 A;  4G8H A;  3HPI A;  1GR2 A;  1PBP A;  2V3Q A;  5AA2 A;  5KZT A;  1OQH A;  2XD3 A;  5CMK A;  1MQH A;  4EQ9 A;  3VV5 A;  2PT2 A;  2XXU A;  3SEV A;  4LAT A;  3E13 X;  2QMW A;  3MAM A;  3TYH A;  4OEN A;  3OO8 A;  3LSX A;  4LUB A;  3H6V A;  4IO4 A;  2OWS A;  4DCY A;  4EDP A;  2VD2 A;  2ZYM A;  4H1X A;  3MC2 A;  5K2Y A;  3V83 A;  4ELP A;  1XOC A;  3TAJ A;  1N3X A;  3VVE A;  1LAH E;  3S4U A;  2Z23 A;  3S2V A;  4TLM B;  4PFW A;  3IB1 A;  4JB7 A;  5H8Q B;  5EYF A;  3KOT A;  2ALU A;  4IO6 A;  5KDT A;  4JSO A;  4YB7 A;  5ITP A;  2RCB A;  5AE4 A;  2VOZ A;  3LC8 A;  3PUX E;  4GOT A;  4QRZ A;  2F78 A;  4QFK A;  5J1D A;  3RUM A;  4LVQ A;  1OVT A;  1ZIU A;  5CI5 A;  3BBR A;  4RJZ A;  1URD A;  2XXI A;  1I6A A;  1SYI A;  4ZZA A;  4GLI A;  4C0R A;  4Q0C A;  2O1M A;  3I6V A;  2VHA A;  2ABH A;  2QJE A;  3N5L A;  3GLB A;  2HZL A;  3ILT B;  4JSD A;  4G4P A;  4GXS B;  3FV2 A;  4IY6 A;  1DPP A;  2P1S A;  3WAF A;  1R9Q A;  4AQ4 A;  1B3F A;  1HSE A;  2DVC A;  1XHY A;  4E0W A;  4DE8 A;  4DXC A;  3TUS A;  3Q29 A;  2DP8 A;  1FW0 A;  1NKX A;  3FAT A;  4U1O A;  4Z7E A;  5JEI A;  1EZP A;  1XS5 A;  2H99 A;  4XKP A;  3KOS A;  2Q2C A;  3O6G A;  3T93 B;  2Q9T A;  1A55 A;  3MVY A;  3OSR A;  4LZ8 A;  2UVH A;  3H03 A;  1JEU A;  1A8F A;  3O28 A;  3K00 A;  5CMB A;  3TEL A;  4ONY A;  2DWA A;  4F29 A;  3TEP A;  4IO2 A;  1POT A;  1VSO A;  1Q35 A;  2B3B A;  5AA4 A;  5TU0 A;  4WXJ A;  2XXT A;  5H8H A;  4YKP A;  4OFL A;  1QKA A;  4QHQ A;  2Y7R A;  3FXQ A;  2DXY A;  4I62 A;  1P1O A;  3SET A;  1QUL A;  3SER A;  1H44 A;  1HSJ A;  4F1U A;  4F22 A;  4M4G A;  3KFM A;  1JQF A;  2E1S A;  5CMC A;  1XVX A;  2RC9 A;  4TOZ A;  1P1N A;  3BFU A;  3LSF B;  3R7X A;  2F5X A;  3T9X B;  4ZEC A;  1SVX B;  1RYX A;  3B6Q A;  1N76 A;  5FTI A;  1SD3 A;  3A3C A;  3DLN A;  5CM6 A;  1BTJ A;  4XKQ A;  3G7W A;  4YMB A;  2F8D A;  4QF9 A;  2DXR A;  4AB5 A;  4KHZ E;  3CI8 A;  4P0I A;  4H8J A;  2XD2 A;  2DSF A;  1MY4 A;  3PUY E;  4MF3 A;  3OD7 A;  2P0S A;  3EPE A;  4R2B A;  1MPD A;  2Y7W A;  3RTW B;  4OQO A;  3E9X A;  4OFO A;  3U8Q A;  2DVZ A;  5L9S A;  1FTO A;  2IEE A;  3IX1 A;  3SES A;  3C33 A;  4YZZ A;  3H6W A;  1OVB A;  1FCK A;  3O6I A;  3T9H B;  4OEV A;  3SEW A;  3PPQ A;  5EHM A;  4FOR A;  4ZED A;  1MXV A;  3O2A A;  4HW8 A;  4FED A;  1YCJ A;  3GZG A;  3P7I A;  1EH3 A;  3FGS A;  4R6Y A;  2A5T B;  4F18 A;  5TPA B;  1PB9 A;  4EQ7 A;  4MLV A;  1IXC A;  5H8F B;  4DIG A;  3IR1 A;  2P2A A;  3USD A;  3MP6 A;  3EF7 A;  5L9M A;  4NF6 A;  2PBW A;  3CFX A;  3KN8 A;  1MQI A;  2X7Q A;  1II5 A;  3RPW A;  4FE8 A;  4R73 A;  5CMM A;  4NF8 A;  3TFL A;  4XKR A;  3EHU A;  3IL1 B;  3TQL A;  1EZ9 A;  2XXR A;  3HV1 A;  3CR9 A;  2Y7P A;  3FJG A;  3H7M A;  3ZSF A;  4G77 A;  5I2K A;  2ONR A;  1LAX A;  3K2D A;  3JYR A;  5FHO A;  3TTR A;  3T22 A;  2XXQ A;  3FJM A;  1NH8 A;  2I6E A;  1QUJ A;  1UIU A;  2I3W A;  4F2O A;  3Q26 A;  4NF4 B;  3Q25 A;  3VFJ A;  5H8S A;  2GRV A;  1OQG A;  1Y1M A;  3G3I A;  3ILU B;  2WKY A;  1BP5 A;  4RYA A;  1NNF A;  3PUZ E;  4OER A;  1M5B A;  4F19 A;  2QRY A;  4GWO A;  2ZXT A;  1JW1 A;  1NFT A;  1US4 A;  4IO7 A;  4BDR A;  5I58 B;  3QK6 A;  4I8C A;  1Y9U A;  3PU5 A;  4F1V A;  4EUO A;  2R71 A;  1FTM A;  3Q28 A;  4HCW A;  1LLS A;  4BDQ A;  3BKI B;  2O1L A;  3LR1 A;  2CZL A;  1SDX A;  4R9F A;  4N13 A;  1LFI A;  2AYS A;  3TPA A;  1MM6 A;  4ELR A;  1AMF A;  4OES A;  4IGR A;  3ZKL A;  2F35 A;  1A54 A;  1TT1 A;  3V8X B;  4RPO A;  4LQ2 A;  1SW2 A;  4WEP A;  1MPC A;  2V3T A;  3C32 A;  3U72 A;  4E0X A;  1GVC A;  1NH7 A;  4EF2 A;  4G8M A;  3OEK A;  4KCD A;  5DT6 A;  4X1B A;  4RXL A;  3TCH A;  1UTH B;  2DQV A;  1RKM A;  4ZE9 A;  3PMW A;  3OOA A;  1PB7 A;  5DTB A;  5CC2 A;  1VFE A;  3UIF A;  5H8N A;  2XXV A;  2XXP A;  2THI A;  2R9J A;  1A7L A;  3LSL A;  5TP9 A;  3GXA A;  1M5D A;  3MBP A;  1JVY A;  1N0T A;  3OO9 A;  1B7Z A;  2REG A;  2IA4 A;  2ANJ A;  1SW4 A;  3QYT A;  2ZMB A;  3N6T A;  1QUK A;  1H43 A;  3B7D A;  4KFQ A;  2NOO A;  2Z8D A;  4BDN A;  5HPQ A;  4C1U A;  5B7D A;  1AIV A;  4BLA A;  1MG1 A;  3DM0 A;  3W9V A;  2O84 X;  1B5I A;  3OO7 A;  5JTY A;  2B3F A;  1FQB A;  4ZS9 A;  1LB9 A;  3T66 A;  1IUD A;  2YLN A;  3PV0 E;  3KSX A;  4C1T A;  1GGG A;  2F7A A;  5B70 A;  3M3K A;  5DYH A;  2FNC A;  3U93 A;  1B52 A;  2D5W A;  1YAE A;  1PB8 A;  1D9Y A;  4XKN A; 
#chains in the Genus database with same CATH topology
 4MBP A;  3GYY A;  3OXN A;  1UTB A;  4Q5T A;  1EZO A;  4F3B A;  3VXB A;  4K3F A;  3C36 A;  3KSJ A;  1FTK A;  1XVY A;  1IQ7 A;  4NWD A;  1Z7M E;  1MQD A;  2V3U A;  2QMX A;  1NV7 A;  4G68 A;  4PDD A;  2UYF A;  3PTY A;  4QFP A;  4N07 A;  3G3G A;  1MQJ A;  1YTV A;  4OVJ A;  3RLF E;  4F3S A;  2GFE A;  1UIV A;  3IFA A;  4P11 A;  4F3P A;  2DE4 A;  4MLQ A;  4GX4 A;  4NX1 A;  1MS7 A;  2HPG A;  4F1Y A;  3IOT A;  4TQU Q;  4OVR A;  1Y3Q A;  2DDK A;  4U21 A;  4Q30 B;  1NMU A;  1ZKB A;  1B1X A;  1ATG A;  1N7X A;  5ESY A;  5I56 B;  1FPD A;  3K6V A;  4DCX A;  3SEU A;  1FQC A;  3KJ7 A;  1LAF E;  1BKA A;  3E79 A;  3I3V A;  3O97 A;  1EU8 A;  1M5C A;  1ZMG A;  3PD8 A;  1N7W A;  1FQF A;  3W9W A;  3EN3 A;  2I49 A;  1IIW A;  3N26 A;  5AA2 B;  1BK4 A;  5DEX A;  1MPB A;  4KYS A;  4RK2 A;  3HST A;  4PE3 A;  2NUV A;  2F6G A;  1P1U A;  4H65 A;  1MQG A;  3M3F A;  1B9J A;  4N4U A;  1KA1 A;  4EXK A;  4YIC A;  5ISU A;  4KYE A;  4O3C A;  3V89 B;  1DSN A;  3A29 A;  4EQB A;  1MXY A;  3ZS6 A;  2F36 A;  4PCD A;  1PC3 A;  1ZU0 A;  1AOV A;  1UQW A;  1D9V A;  2PVU A;  2CZH A;  3D4C A;  3AXF A;  2HZK A;  4NF0 A;  5ELV A;  4NG7 A;  4PFU A;  5KDT B;  4MNI A;  1QVS A;  2DE2 A;  2Q88 A;  1NL5 A;  3RN8 A;  4G8N A;  3HHG A;  3QAX A;  4F3G A;  4ZEI A;  1J1N A;  4NF5 A;  3EQ1 A;  1SI0 A;  4QFO A;  1GV8 A;  2UVI A;  4YB6 A;  3O29 A;  1A40 A;  4DXU A;  2F6P A;  3RY3 A;  1T0K A;  5LDZ A;  3IJO B;  1H45 A;  3C4M A;  4P0G A;  4OXV A;  4U2R A;  3V5A A;  2H25 A;  4PFB A;  4ZZE A;  2Z8F A;  2HXW A;  3O9P A;  2A5T A;  2NWJ A;  2L5V A;  4U4X A;  5TPA A;  4XFE A;  4QBA A;  3FUZ A;  3TTL A;  4PGP A;  4PFY A;  2Y7I A;  4MEV A;  5DW8 A;  3MVW A;  2VPN A;  1MY1 A;  4JXI A;  2X26 A;  2I48 A;  1KWH A;  2OK2 A;  1MH4 A;  1O64 A;  4GF8 A;  1FTJ A;  1FPI A;  1LFH A;  3K02 A;  4HCY A;  1TXF A;  3HCQ A;  3IO4 A;  2HFB A;  3K1M A;  2RKM A;  1VDW A;  3CFL A;  3K0V A;  1NNK A;  2LAO A;  2DYX A;  2XXW A;  1B3H A;  4KI0 E;  4PGN A;  5I2N A;  4NWC A;  4THI A;  3PGF A;  5FTH A;  2AL5 A;  4KYD A;  3MJN A;  2I0C A;  1LAG E;  3PPN A;  2Q8J A;  2ONS A;  1RYO A;  2UXA A;  1B3L A;  5IM2 A;  1B3E A;  2WYP A;  1IMC A;  2Y5K A;  3R6U A;  4MFI A;  3RT6 B;  5JK4 A;  4NED A;  1IXI A;  3CSG A;  3KG2 A;  3R26 A;  5A5X A;  3G3J A;  4H5G A;  3D1R A;  2PX1 A;  1SW1 A;  4H6D A;  4KQP A;  3K01 A;  1I6Q A;  2V4C A;  4GL0 A;  1CE2 A;  2PFZ A;  5AA4 B;  4H46 A;  5H8H B;  2GHB A;  3KN7 A;  1URG A;  3MWB A;  2XA5 A;  4JVI A;  3JZJ A;  4PET A;  5I84 A;  1LBW A;  2D21 A;  2FHY A;  2OWT A;  3U65 A;  3K1P A;  1CB6 A;  5FHM A;  3G3H A;  1NNT A;  4IB2 A;  3K6U A;  2PYY A;  5I57 A;  3WAE A;  2OLB A;  2W7Y A;  1YPN A;  3PMX A;  3UK4 A;  1S9T A;  1LGB C;  3TCF A;  4KD5 A;  4L17 A;  3MZ9 A;  1YZ0 A;  4IO5 A;  3B8B A;  3HHF A;  2O7I A;  1FBD A;  1GTK A;  5I59 B;  3PUW E;  1ZJL A;  4OEU A;  2I4B A;  2QS1 A;  1Y4T A;  3GBB A;  3PPR A;  2G93 A;  1D9Q A;  1KZ8 A;  3W15 C;  1MH3 A;  4XTC Q;  4FEB A;  3UA8 A;  1JVX A;  4OVT A;  2NVU B;  2FA7 A;  3VXC A;  2XXX A;  4WKM A;  2RF1 A;  3HN0 A;  3LUY A;  4G68 C;  3FJ7 A;  4PFR A;  1FBG A;  4UAC A;  3CHG A;  1DBZ A;  3PPP A;  1B1H A;  4GVO A;  2XWK A;  3DP8 A;  4AS4 A;  5A5L A;  3K6X A;  3C34 A;  4YKI A;  4ECF A;  3E4R A;  4FAT A;  1US5 A;  1O7T A;  4I1D A;  2VGQ A;  3G3K A;  1YXI A;  2ESN A;  2WEF A;  4Q8R A;  2OJT A;  2F7B A;  1DK4 A;  4QFN A;  4FBP A;  1DOT A;  4TLL B;  4GX6 A;  1NUY A;  2ZNS A;  1Z7N E;  1Y1Z A;  4HE1 A;  4LQ5 A;  3LBS A;  3MZB A;  4GFR A;  5DVF A;  4NF6 B;  4H5F A;  5T3J A;  3O66 A;  2HHM A;  4R72 A;  3KEI A;  4X1D A;  3FVG A;  3TOD A;  4FEC A;  4ELQ A;  2OWZ A;  1QUI A;  2VP1 A;  4NF8 B;  3K6W A;  1Q9D A;  4OZ9 A;  4U22 A;  5H8Q A;  4UA8 A;  4M1V A;  2F34 A;  5IZZ A;  3CFZ A;  2O7U A;  4N17 A;  4YKK A;  1B6H A;  3THI A;  1PBQ A;  3CG3 A;  4LP2 B;  1VR5 A;  5I2K B;  2V84 A;  4AB6 A;  1NV1 A;  2G29 A;  5EYH A;  1FBH A;  1HSL A;  3IK6 B;  2XXK A;  1MXU A;  1SI1 A;  3U94 A;  2V25 A;  3FD3 A;  4LZ5 A;  3IB0 A;  3MVX A;  1N84 A;  3MPL A;  4MX6 A;  1Y4C A;  3MP1 A;  3IO6 A;  5ICQ A;  2H98 A;  1B05 A;  3TMG A;  4F2Q A;  4YAH X;  3RQT A;  3VLU A;  1TFD A;  3MUQ A;  3TTM A;  1MY3 A;  4OTE A;  3VDF A;  2E0S A;  3QIM A;  3N94 A;  3H06 B;  3IFC A;  2F7C A;  1LCT A;  3C31 A;  4RA1 A;  5L9O A;  3FVN A;  1R9L A;  5F24 A;  2F3B A;  1FSA A;  5L8D A;  4H67 A;  4YMA A;  5F1Q A;  1LST A;  2XHD A;  1LB8 A;  4N81 A;  1Y3N A;  4DZ1 A;  2I0B A;  4NE4 A;  3RT8 A;  1IIT A;  1Y3P A;  1B5J A;  1MY2 A;  1B4Z A;  3LSW A;  4YKJ A;  1FPK A;  3KN3 A;  4MNC A;  4GBW A;  2PCR A;  3UOR A;  1O63 A;  3UN6 A;  1DMB A;  2Q89 A;  3K1N A;  3U1O A;  1JW4 A;  4R9G A;  2AIX A;  2DE3 A;  4OVS A;  4PP0 A;  3TQW A;  3MYU A;  2RIN A;  1OIB A;  3MQ9 A;  3FXU A;  2QPQ A;  1QJM A;  1H3D A;  3H4Z A;  4RK9 A;  3BIG A;  2PMS A;  4JBZ A;  1IXH A;  1FJ9 A;  2I3V A;  2ZYK A;  3EHS A;  3M8U A;  1AH5 A;  2UYE A;  1LBC A;  4DLD A;  4FAJ A;  5KCJ B;  3O6H A;  3L6H A;  1LFG A;  4LZ7 A;  4OVP A;  3RPL B;  4ZEK A;  3C9H A;  3OEM A;  1LCF A;  3H3G A;  5IZ3 B;  1WOD A;  2Q74 A;  1I6B A;  3QUF A;  4X04 A;  4PF8 A;  3C35 A;  2ZNT A;  2XX9 A;  3CIJ A;  2NXO A;  3CSB A;  2FYI A;  3OO6 A;  1MRP A;  5ICT A;  4PTK A;  1P1Q A;  2AL4 A;  1R1N A;  1D3K A;  1MXX A;  3H6U A;  3DP6 A;  5BUU A;  5H8N B;  3LV0 A;  3KGC A;  5LOM A;  5TP9 B;  2WBD A;  3S9L C;  2QFL A;  4N8G A;  4IY5 A;  4PFI A;  1JEV A;  4GXA A;  3QXM A;  4IR8 A;  4OHN A;  4POW A;  3KC0 A;  3HFU A;  5FBP A;  3KBZ A;  4GBV A;  3Q27 A;  2R8T A;  4F39 A;  4DDD A;  2ONK E;  3FV1 A;  2X7P A;  1NV6 A;  5HBC A;  3VE1 B;  5HM4 B;  2CEY A;  2CMO A;  5IGA A;  4O8M A;  5JTY B;  5FHN A;  4ESW A;  2F97 A;  1SYH A;  3A3U A;  3MPK A;  4QSE A;  3PPO A;  2Y7K A;  4GRK A;  4R75 A;  3QSL A;  4IO3 A;  4YU0 A;  1CNQ A;  2BJI A;  2O6A A;  1NV5 A;  1QKB A;  1IXG A;  1OLA A;  4Z0I A;  1F9B A;  1MM7 A;  3GBA A;  1OMP A;  2PT1 A;  4ZEF A;  1UTB B;  4N6P A;  2HQ0 A;  2KR0 A;  2XWV A;  4ELO A;  4N15 A;  3OEL A;  4F31 B;  3OMB A;  1B0L A;  3QUJ A;  4RPN A;  2QL3 A;  2UVG A;  3MZ1 A;  4JDF A;  4G68 B;  3KJT A;  2BJJ X;  1PDA A;  2YJP A;  4JVC A;  2OBG A;  4MH5 A;  4KR5 A;  5AA1 A;  4NHB A;  4HTG A;  4X9T A;  2QVV A;  2XWI A;  2HAV A;  4X48 A;  1B0H A;  5AA2 D;  3ZKK A;  4QSC A;  1KA0 A;  2HEU A;  1BLF A;  1P1W A;  2DWI A;  1ZTY A;  2Q2A A;  4G2Z A;  2H4I A;  1TWY A;  5H8F A;  1R6Z A;  3S9N C;  1B3G A;  1FQD A;  3OSQ A;  4DI3 D;  4H45 A;  1SW5 A;  1DCU A;  3S9M C;  4NMY A;  5F7V A;  2XX7 A;  3B50 A;  2OZZ A;  4GQO A;  1SPI A;  4BDM A;  2YPN A;  4I3E A;  2B65 A;  3CG1 A;  1XT8 A;  4FJP A;  4GIZ A;  2I58 A;  4DI4 B;  2O68 A;  1D4N A;  5DEX B;  2CEX A;  4O3A A;  1FPG A;  1NV3 A;  3TDJ A;  3ONM A;  1FBC A;  4MJO A;  1DPE A;  1SBP A;  4G61 A;  3CVG A;  4NGU A;  4RY1 A;  2M8C A;  2DOJ A;  3MST A;  1MDQ A;  1XI6 A;  5I59 A;  3FXB A;  1SQY A;  3VLV A;  1XC1 A;  3IOV A;  3A09 A;  4NF4 A;  1USY E;  4R6K A;  1IMF A;  4JWO A;  2O69 A;  1A8E A;  4PFT A;  4ESX A;  4EXL A;  1B58 A;  4GL8 A;  3N6U A;  1N3W A;  3IOU A;  4RNS A;  3E3K A;  1LBB A;  4ISU A;  4PQJ A;  4GD5 A;  2QS4 A;  3K4U A;  1IZ1 A;  4O3B A;  3IOR A;  4HS7 A;  3IB2 A;  1VFD A;  2B4L A;  4R74 A;  4OFJ A;  4PE5 B;  3L6G A;  1JW5 A;  1JET A;  1H76 A;  2FBP A;  3HO7 A;  4NF5 B;  1B51 A;  5I58 A;  1B5H A;  1RDY A;  2XXY A;  3B6W A;  3SDF A;  5ITO A;  5DVI A;  3CRB A;  1JNF A;  2R6G E;  1DTG A;  1MXZ A;  3E78 A;  3PUV E;  2RC7 A;  4BDO A;  3SEX A;  2HCA A;  3PD9 A;  3VLW A;  1NUZ A;  3KBR A;  4U23 A;  1A99 A;  1B4H A;  2H5Y A;  3RYD A;  1USY H;  5K2X A;  2O51 A;  5DVJ A;  3T9V A;  4QSD A;  2QS3 A;  3PMV A;  4DXB A;  4KPT A;  3FXR A;  5CRY A;  3IOW A;  1Q1K A;  4U1Z A;  2V93 A;  4JWX A;  2Z22 A;  1B40 A;  3D4G A;  3EHT A;  1WDN A;  3S9E A;  1B46 A;  4U4S A;  1JP4 A;  3RGY A;  5I2N B;  1ZLQ A;  1ZBM A;  5EHS A;  1IEJ A;  2I4C A;  1UTH A;  4ZEB A;  1S50 A;  3DEL B;  3VVF A;  5AA3 A;  2OCU A;  5ET6 A;  5ET7 A;  2DS9 A;  1B2H A;  4I9D A;  1AL3 A;  3RTF B;  3ISP A;  1BIY A;  1DTZ A;  4BDL A;  2RCA A;  4MNP A;  2Y84 A;  3FZV A;  4POX A;  3T96 B;  1POY 1;  1S7Y A;  3M3L A;  1B7H A;  5A5X B;  4ND9 A;  1ELJ A;  2HAU A;  1FJ6 A;  2UVJ A;  2GH9 A;  2D3I A;  3SKP A;  4NTL A;  3TTN A;  2A5S A;  4XXU A;  4YB5 A;  3FVO A;  3FVK A;  4OMB A;  1MDP 1;  5CBS A;  3MP8 A;  3KC1 A;  3KZG A;  1N04 A;  3T1B A;  1URS A;  1FTL A;  4P3L A;  3JV9 A;  1FQA A;  1I69 A;  3VVD A;  4KCC A;  3F11 A;  1FQE A;  2QSX A;  1RDX A;  4P8B A;  3RNN A;  4LA9 A;  3T9U A;  4JWY A;  1B32 A;  1B7U A;  4R2F A;  4PAI A;  4FIM A;  1P99 A;  2VD3 A;  4XKN A;  1L5T A;  2H9B A;  2QS2 A;  4H8I A;  3OEN A;  3TZA A;  1TFA A;  4OYV A;  3TCG A;  5I57 B;  5IAI A;  3IAZ A;  4I40 A;  4HE2 A;  4OET A;  2GHA A;  4OWD A;  4ZDM A;  4ZE8 A;  4N6K A;  3I5O A;  4WED A;  3H6T A;  4OA4 A;  1M5E A;  5KCJ A;  4H0W A;  5IKB A;  3ECR A;  5BWJ A;  1MY0 A;  2ZZW A;  1G0H A;  3DP4 A;  2REJ A;  5IZ3 A;  3FIR A;  1M5F A;  1PEB A;  3SEY A;  4LON B;  3FBP A;  4P1E A;  1QW0 A;  2ZYO A;  3U92 A;  4MIJ A;  3B6T A;  4N6D A;  2DWH A;  2RC8 A;  3UP9 A;  1ANF A;  2Q8M A;  3IJX B;  2KLF A;  2XX8 A;  1FPF A;  1WVJ A;  3ODB A;  4GWZ A;  3G3F A;  4MCO A;  1OLC A;  4MAG A;  5I56 A;  1G0I A;  1VE4 A;  4R6H A;  2ZYN A;  4XIG Q;  5CBR A;  2XXH A;  3TKD A;  3MVZ A;  3TTK A;  3FAS A;  1Y20 A;  1LBZ A;  2Z8E A;  4EF1 A;  4IGT A;  5M2V A;  1MXW A;  1NNP A;  2MKZ A;  2ZNU A;  4QFL A;  2CZI A;  3UGW A;  3BFT A;  3MW0 A;  4XF5 A;  4G8H A;  3HPI A;  4NAP A;  1GR2 A;  1PBP A;  2V3Q A;  5AA2 A;  5KZT A;  1OQH A;  2QVU A;  2XD3 A;  5CMK A;  1MQH A;  4EQ9 A;  3VV5 A;  2PT2 A;  2XXU A;  3SEV A;  4LAT A;  3E13 X;  2QMW A;  3MAM A;  3TYH A;  4OEN A;  3OO8 A;  3LSX A;  4LUB A;  2P3V A;  3H6V A;  4IO4 A;  2OWS A;  4DCY A;  4EDP A;  2VD2 A;  2ZYM A;  4H1X A;  3MC2 A;  5K2Y A;  3V83 A;  4O7M A;  4ELP A;  1XOC A;  4NQ8 A;  3TAJ A;  1N3X A;  3VVE A;  1LAH E;  3S4U A;  2Z23 A;  3S2V A;  4TLM B;  4PFW A;  3IB1 A;  4JB7 A;  5H8Q B;  5EYF A;  3KOT A;  2ALU A;  4IO6 A;  5KDT A;  4JSO A;  4YB7 A;  5ITP A;  2RCB A;  5AE4 A;  4N8Y A;  4PAK A;  2VOZ A;  3LC8 A;  3PUX E;  4GOT A;  4QRZ A;  2F78 A;  4QFK A;  5J1D A;  3RUM A;  4LVQ A;  1OVT A;  1ZIU A;  5CI5 A;  3BBR A;  4RJZ A;  1URD A;  2XXI A;  1I6A A;  5EQ9 A;  1SYI A;  4ZZA A;  4GLI A;  4GWX A;  4C0R A;  4Q0C A;  5I5P A;  2O1M A;  3I6V A;  4XEQ A;  1FPE A;  2VHA A;  1LBX A;  2ABH A;  4O94 A;  2QJE A;  3N5L A;  3GLB A;  2HZL A;  3ILT B;  4JSD A;  4G4P A;  4GXS B;  3FV2 A;  4IY6 A;  1DPP A;  2P1S A;  3WAF A;  1R9Q A;  1FPL A;  4AQ4 A;  4PBH A;  1B3F A;  1HSE A;  2DVC A;  4OVQ A;  1XHY A;  4E0W A;  1LEV A;  4DE8 A;  4DXC A;  2JJK A;  3TUS A;  3Q29 A;  4LN5 A;  2DP8 A;  3SZP A;  1FW0 A;  1NKX A;  3FAT A;  4U1O A;  4Z7E A;  5JEI A;  1EZP A;  1LBY A;  1XS5 A;  2H99 A;  4XKP A;  3KOS A;  2Q2C A;  3O6G A;  4PC9 A;  3T93 B;  2Q9T A;  1A55 A;  1FRP A;  3MVY A;  3OSR A;  4LZ8 A;  2UVH A;  3H03 A;  4I3Y A;  1JEU A;  1A8F A;  3O28 A;  3K00 A;  5CMB A;  3TEL A;  4ONY A;  2DWA A;  4F29 A;  2OX3 A;  4N91 A;  3TEP A;  4IO2 A;  1POT A;  1VSO A;  1Q35 A;  2B3B A;  5AA4 A;  5TU0 A;  4WXJ A;  2XXT A;  5H8H A;  4YKP A;  4OFL A;  1QKA A;  4QHQ A;  2WYK A;  1EYI A;  2Y7R A;  3FXQ A;  2DXY A;  3EKI A;  4I62 A;  1P1O A;  2ZZX A;  1NV2 A;  2QVR A;  3SET A;  1QUL A;  3SER A;  1H44 A;  1HSJ A;  1QGX A;  4F1U A;  4F22 A;  2ZZV A;  4M4G A;  4PAF A;  3KFM A;  4P1L A;  1JQF A;  1RDZ A;  2E1S A;  5CMC A;  1XVX A;  2RC9 A;  4PBQ A;  4TOZ A;  1P1N A;  3BFU A;  3LSF B;  3R7X A;  2F5X A;  4GWW A;  3T9X B;  4ZEC A;  1SVX B;  1RYX A;  3B6Q A;  1N76 A;  4MHF A;  4GWY A;  4P47 A;  5FTI A;  3T0J A;  1SD3 A;  3A3C A;  3DLN A;  5CM6 A;  1BTJ A;  4XKQ A;  3G7W A;  4YMB A;  1NI9 A;  1NUX A;  2F8D A;  4QF9 A;  2DXR A;  4AB5 A;  4KHZ E;  1LBV A;  3CI8 A;  5EQ7 A;  1EYJ A;  4P0I A;  2B4M A;  4H8J A;  2XD2 A;  1NV0 A;  2DSF A;  4OAN A;  1FPB A;  2P3N A;  1MY4 A;  1IME A;  3PUY E;  4MF3 A;  3OD7 A;  2P0S A;  3EPE A;  4R2B A;  1MPD A;  2Y7W A;  3RTW B;  4OQO A;  3E9X A;  4OFO A;  3U8Q A;  3NOH A;  2DVZ A;  5L9S A;  2WBB A;  5I7I A;  1FTO A;  2IEE A;  3IX1 A;  2HXR A;  3SES A;  3C33 A;  4YZZ A;  5I3S A;  2VT5 A;  3H6W A;  1OVB A;  1FCK A;  3O6I A;  3T9H B;  4OEV A;  3SEW A;  3PPQ A;  5EHM A;  4FOR A;  4AS5 A;  4ZED A;  1MXV A;  3O2A A;  4QXD A;  4HW8 A;  4FED A;  1IMD A;  4O7I A;  1YCJ A;  3GZG A;  3P7I A;  1EH3 A;  3FGS A;  4R6Y A;  2A5T B;  4F18 A;  5TPA B;  1PB9 A;  4EQ7 A;  4MMP A;  4MLV A;  1IXC A;  5H8F B;  4DIG A;  3IR1 A;  2P2A A;  1FBE A;  3USD A;  3MP6 A;  3EF7 A;  5L9M A;  4NF6 A;  2PBW A;  3CFX A;  3KN8 A;  2PFY A;  1MQI A;  2X7Q A;  1II5 A;  1IMA A;  3RPW A;  4FE8 A;  4R73 A;  5CMM A;  4NF8 A;  3TFL A;  4XKR A;  3EHU A;  4X8R A;  3IL1 B;  3TQL A;  1EZ9 A;  2XXR A;  2KQZ A;  3HV1 A;  3CR9 A;  2Y7P A;  3FJG A;  3H7M A;  3ZSF A;  4G77 A;  2FVZ A;  1IMB A;  5I2K A;  2ONR A;  1LAX A;  3K2D A;  1INP A;  5J16 A;  3JYR A;  5FHO A;  3TTR A;  2XWO A;  4GWS A;  3T22 A;  5ET5 A;  2XXQ A;  3FJM A;  1NH8 A;  2I6E A;  1FBP A;  1QUJ A;  1UIU A;  2I3W A;  3Q26 A;  4F2O A;  4NF4 B;  3Q25 A;  3QMF A;  3VFJ A;  5H8S A;  2GRV A;  4P9K A;  1OQG A;  1Y1M A;  3G3I A;  3ILU B;  2WKY A;  4HE0 A;  1K9Z A;  2FIE A;  1BP5 A;  4RYA A;  1NNF A;  3PUZ E;  4OER A;  1M5B A;  1NUW A;  3BIH A;  4F19 A;  2QRY A;  4GWO A;  2ZXT A;  1JW1 A;  1NFT A;  1US4 A;  4IO7 A;  4BDR A;  5I58 B;  3QK6 A;  2FIX A;  4I8C A;  1Y9U A;  3PU5 A;  4F1V A;  2R71 A;  4EUO A;  1FTM A;  3Q28 A;  4HCW A;  4UAB A;  1LLS A;  4BDQ A;  3BKI B;  2O1L A;  1FPJ A;  3LR1 A;  5ET8 A;  2CZL A;  1SDX A;  4R9F A;  2Y5L A;  4KXP A;  4N13 A;  1LFI A;  2AYS A;  3TPA A;  4JVD A;  4P56 A;  1MM6 A;  1AMF A;  4ELR A;  4OES A;  4IGR A;  3ZKL A;  1FTA A;  3ROJ A;  2F35 A;  2F3D A;  1A54 A;  1TT1 A;  3V8X B;  4RPO A;  4LQ2 A;  1SW2 A;  4WEP A;  1MPC A;  2V3T A;  3C32 A;  2CZK A;  3U72 A;  4E0X A;  1GVC A;  5IZ1 A;  3RPL A;  1NH7 A;  4EF2 A;  4G8M A;  3OEK A;  4KCD A;  5LTC A;  5DT6 A;  4GWU A;  1EYK A;  4HXV A;  4X1B A;  4RXL A;  3TCH A;  1UTH B;  2DQV A;  1RKM A;  5EQA A;  4ZE9 A;  3PMW A;  5EQ8 A;  1FBF A;  3OOA A;  1PB7 A;  5DTB A;  5CC2 A;  1VFE A;  3UIF A;  5H8N A;  2XXV A;  2XXP A;  2THI A;  2R9J A;  1A7L A;  3LSL A;  5TP9 A;  3GXA A;  1M5D A;  3MBP A;  1JVY A;  1N0T A;  3OO9 A;  1B7Z A;  2REG A;  2VPO A;  2IA4 A;  2WX9 A;  2ANJ A;  1SW4 A;  3QYT A;  2ZMB A;  3N6T A;  4PDH A;  1NV4 A;  1QUK A;  1H43 A;  3B7D A;  4KFQ A;  2NOO A;  2Z8D A;  1YYZ A;  4BDN A;  5HPQ A;  4C1U A;  5B7D A;  1AIV A;  4BLA A;  1MG1 A;  3DM0 A;  4PF6 A;  3W9V A;  2O84 X;  1K9Y A;  1B5I A;  3OO7 A;  5JTY A;  2B3F A;  3LUZ A;  1FQB A;  4ZS9 A;  1AWB A;  1LB9 A;  3T66 A;  1IUD A;  2YLN A;  3PV0 E;  3KSX A;  2GQ1 A;  4C1T A;  1GGG A;  2F7A A;  5B70 A;  3M3K A;  5DYH A;  5EYG A;  2FNC A;  3U93 A;  1B52 A;  2D5W A;  1YAE A;  4NN3 A;  1PB8 A;  1D9Y A;  2DWJ A;  4GX3 A; 
#chains in the Genus database with same CATH homology
 4MBP A;  3OXN A;  1UTB A;  4Q5T A;  1EZO A;  4F3B A;  3VXB A;  4K3F A;  3C36 A;  3KSJ A;  1FTK A;  1XVY A;  1IQ7 A;  4NWD A;  1Z7M E;  1MQD A;  2V3U A;  2QMX A;  4G68 A;  2UYF A;  4QFP A;  4N07 A;  3G3G A;  1MQJ A;  1YTV A;  4OVJ A;  3RLF E;  4F3S A;  2GFE A;  1UIV A;  4P11 A;  4F3P A;  2DE4 A;  4MLQ A;  1MS7 A;  4F1Y A;  3IOT A;  4TQU Q;  1Y3Q A;  4U21 A;  4Q30 B;  1NMU A;  1ZKB A;  1B1X A;  1ATG A;  1N7X A;  5I56 B;  3K6V A;  4DCX A;  3SEU A;  1FQC A;  3KJ7 A;  1LAF E;  1BKA A;  3I3V A;  3O97 A;  1EU8 A;  1M5C A;  1ZMG A;  3PD8 A;  1N7W A;  1FQF A;  3W9W A;  3EN3 A;  2I49 A;  1IIW A;  3N26 A;  5AA2 B;  5DEX A;  1MPB A;  4KYS A;  4RK2 A;  3HST A;  2NUV A;  2F6G A;  1P1U A;  4H65 A;  1MQG A;  3M3F A;  1B9J A;  4EXK A;  4YIC A;  5ISU A;  4KYE A;  4O3C A;  3V89 B;  1DSN A;  4EQB A;  1MXY A;  3ZS6 A;  2F36 A;  1PC3 A;  1ZU0 A;  1AOV A;  1UQW A;  1D9V A;  2PVU A;  3D4C A;  3AXF A;  2HZK A;  5ELV A;  4PFU A;  5KDT B;  1QVS A;  2DE2 A;  2Q88 A;  1NL5 A;  3RN8 A;  4G8N A;  3HHG A;  3QAX A;  4F3G A;  4ZEI A;  1J1N A;  4NF5 A;  3EQ1 A;  1SI0 A;  4QFO A;  1GV8 A;  2UVI A;  4YB6 A;  3O29 A;  1A40 A;  4DXU A;  2F6P A;  3RY3 A;  1T0K A;  3IJO B;  1H45 A;  3C4M A;  4P0G A;  4OXV A;  4U2R A;  3V5A A;  2H25 A;  4ZZE A;  2Z8F A;  2HXW A;  3O9P A;  2A5T A;  2NWJ A;  4U4X A;  5TPA A;  3FUZ A;  3TTL A;  4PFY A;  2Y7I A;  3MVW A;  1MY1 A;  4JXI A;  2X26 A;  2I48 A;  1KWH A;  2OK2 A;  1MH4 A;  1O64 A;  4GF8 A;  1FTJ A;  1LFH A;  3K02 A;  4HCY A;  1TXF A;  3HCQ A;  3IO4 A;  2HFB A;  3K1M A;  2RKM A;  3CFL A;  3K0V A;  1NNK A;  2LAO A;  2DYX A;  2XXW A;  1B3H A;  4KI0 E;  5I2N A;  4NWC A;  4THI A;  3PGF A;  5FTH A;  2AL5 A;  4KYD A;  3MJN A;  2I0C A;  1LAG E;  3PPN A;  2Q8J A;  2ONS A;  1RYO A;  2UXA A;  1B3L A;  1B3E A;  3R6U A;  4MFI A;  3RT6 B;  5JK4 A;  4NED A;  1IXI A;  3CSG A;  3KG2 A;  3R26 A;  5A5X A;  3G3J A;  4H5G A;  2PX1 A;  1SW1 A;  4H6D A;  4KQP A;  3K01 A;  1I6Q A;  4GL0 A;  1CE2 A;  5AA4 B;  5H8H B;  2GHB A;  3KN7 A;  1URG A;  3MWB A;  3JZJ A;  4PET A;  5I84 A;  2D21 A;  2OWT A;  3K1P A;  1CB6 A;  5FHM A;  3G3H A;  1NNT A;  4IB2 A;  3K6U A;  2PYY A;  5I57 A;  3WAE A;  2OLB A;  2W7Y A;  1YPN A;  3PMX A;  3UK4 A;  1S9T A;  1LGB C;  3TCF A;  4KD5 A;  4L17 A;  3MZ9 A;  4IO5 A;  3HHF A;  2O7I A;  1GTK A;  5I59 B;  3PUW E;  1ZJL A;  4OEU A;  2I4B A;  2QS1 A;  1Y4T A;  3GBB A;  3PPR A;  2G93 A;  3W15 C;  1MH3 A;  4XTC Q;  4FEB A;  3UA8 A;  1JVX A;  2NVU B;  2FA7 A;  3VXC A;  2XXX A;  4WKM A;  2RF1 A;  3HN0 A;  3LUY A;  4G68 C;  3FJ7 A;  4UAC A;  3PPP A;  1B1H A;  4GVO A;  3DP8 A;  3K6X A;  3C34 A;  4YKI A;  4ECF A;  3E4R A;  4FAT A;  1US5 A;  1O7T A;  2VGQ A;  4I1D A;  3G3K A;  2ESN A;  4Q8R A;  2OJT A;  2F7B A;  4QFN A;  1DOT A;  4TLL B;  2ZNS A;  1Z7N E;  1Y1Z A;  4LQ5 A;  3LBS A;  3MZB A;  4GFR A;  5DVF A;  4NF6 B;  4H5F A;  3O66 A;  4R72 A;  3KEI A;  4X1D A;  3FVG A;  3TOD A;  4FEC A;  4ELQ A;  1QUI A;  2VP1 A;  4NF8 B;  3K6W A;  4OZ9 A;  4U22 A;  5H8Q A;  4UA8 A;  4M1V A;  2F34 A;  3CFZ A;  2O7U A;  4YKK A;  1B6H A;  3THI A;  1PBQ A;  3CG3 A;  4LP2 B;  1VR5 A;  5I2K B;  2V84 A;  4AB6 A;  2G29 A;  1HSL A;  3IK6 B;  1MXU A;  1SI1 A;  3U94 A;  2V25 A;  3FD3 A;  4LZ5 A;  3IB0 A;  3MVX A;  1N84 A;  3MPL A;  1Y4C A;  3MP1 A;  3IO6 A;  5ICQ A;  2H98 A;  1B05 A;  3TMG A;  4F2Q A;  4YAH X;  3RQT A;  3VLU A;  1TFD A;  3MUQ A;  3TTM A;  1MY3 A;  4OTE A;  3VDF A;  2E0S A;  3QIM A;  3N94 A;  3H06 B;  2F7C A;  1LCT A;  3C31 A;  4RA1 A;  5L9O A;  3FVN A;  1R9L A;  5L8D A;  4H67 A;  4YMA A;  5F1Q A;  1LST A;  2XHD A;  1LB8 A;  1Y3N A;  4DZ1 A;  2I0B A;  4NE4 A;  3RT8 A;  1IIT A;  1Y3P A;  1B5J A;  1MY2 A;  1B4Z A;  3LSW A;  4YKJ A;  3KN3 A;  3UOR A;  1O63 A;  3UN6 A;  1DMB A;  2Q89 A;  3K1N A;  3U1O A;  1JW4 A;  4R9G A;  2AIX A;  2DE3 A;  4PP0 A;  3TQW A;  2RIN A;  1OIB A;  3MQ9 A;  3FXU A;  2QPQ A;  1QJM A;  1H3D A;  3H4Z A;  4RK9 A;  2PMS A;  4JBZ A;  1IXH A;  2I3V A;  2ZYK A;  3EHS A;  3M8U A;  1AH5 A;  2UYE A;  1LBC A;  4DLD A;  4FAJ A;  5KCJ B;  3O6H A;  3L6H A;  1LFG A;  4LZ7 A;  4ZEK A;  3C9H A;  3OEM A;  1LCF A;  3H3G A;  1WOD A;  1I6B A;  3QUF A;  3C35 A;  2ZNT A;  2XX9 A;  3CIJ A;  2NXO A;  3CSB A;  2FYI A;  3OO6 A;  1MRP A;  5ICT A;  1P1Q A;  2AL4 A;  1R1N A;  1D3K A;  1MXX A;  3H6U A;  3DP6 A;  5BUU A;  5H8N B;  3KGC A;  5LOM A;  5TP9 B;  3S9L C;  4IY5 A;  1JEV A;  4GXA A;  3QXM A;  4OHN A;  4POW A;  3Q27 A;  4F39 A;  4DDD A;  2ONK E;  3FV1 A;  2X7P A;  5HBC A;  3VE1 B;  5HM4 B;  2CMO A;  5JTY B;  5FHN A;  4ESW A;  2F97 A;  1SYH A;  3A3U A;  3MPK A;  4QSE A;  3PPO A;  2Y7K A;  4GRK A;  4R75 A;  3QSL A;  4IO3 A;  4YU0 A;  2O6A A;  1QKB A;  1IXG A;  1OLA A;  4Z0I A;  2DWJ A;  1F9B A;  1MM7 A;  3GBA A;  1OMP A;  2PT1 A;  4ZEF A;  1UTB B;  4N6P A;  2HQ0 A;  4ELO A;  3OEL A;  4F31 B;  3OMB A;  1B0L A;  3QUJ A;  4RPN A;  2QL3 A;  2UVG A;  3MZ1 A;  4JDF A;  4G68 B;  3KJT A;  2BJJ X;  1PDA A;  2YJP A;  2OBG A;  4MH5 A;  4KR5 A;  5AA1 A;  4HTG A;  4X9T A;  2HAV A;  4X48 A;  1B0H A;  5AA2 D;  3ZKK A;  4QSC A;  2HEU A;  1BLF A;  1P1W A;  2DWI A;  1ZTY A;  2Q2A A;  4G2Z A;  2H4I A;  1TWY A;  5H8F A;  1R6Z A;  3S9N C;  1B3G A;  1FQD A;  3OSQ A;  1SW5 A;  3S9M C;  4NMY A;  5F7V A;  2XX7 A;  2OZZ A;  4GQO A;  4BDM A;  2YPN A;  2B65 A;  3CG1 A;  1XT8 A;  4FJP A;  4GIZ A;  2I58 A;  2O68 A;  1D4N A;  5DEX B;  4O3A A;  3TDJ A;  3ONM A;  1DPE A;  1SBP A;  3CVG A;  4RY1 A;  2M8C A;  2DOJ A;  1MDQ A;  5I59 A;  1SQY A;  3VLV A;  1XC1 A;  3IOV A;  3A09 A;  4NF4 A;  1USY E;  4R6K A;  4JWO A;  2O69 A;  1A8E A;  4PFT A;  4ESX A;  4EXL A;  1B58 A;  4GL8 A;  3N6U A;  1N3W A;  3IOU A;  4RNS A;  3E3K A;  1LBB A;  4ISU A;  4PQJ A;  4GD5 A;  2QS4 A;  3K4U A;  1IZ1 A;  4O3B A;  3IOR A;  4HS7 A;  3IB2 A;  1VFD A;  4R74 A;  4OFJ A;  4PE5 B;  3L6G A;  1JW5 A;  1JET A;  1H76 A;  3HO7 A;  4NF5 B;  1B51 A;  5I58 A;  1B5H A;  2XXY A;  3B6W A;  3SDF A;  5ITO A;  5DVI A;  3CRB A;  1JNF A;  2R6G E;  1DTG A;  1MXZ A;  3PUV E;  2RC7 A;  4BDO A;  3SEX A;  2HCA A;  3PD9 A;  3VLW A;  3KBR A;  4U23 A;  1A99 A;  1B4H A;  2H5Y A;  1USY H;  5K2X A;  2O51 A;  5DVJ A;  3T9V A;  4QSD A;  2QS3 A;  3PMV A;  4DXB A;  4KPT A;  3FXR A;  5CRY A;  3IOW A;  1Q1K A;  4U1Z A;  2V93 A;  4JWX A;  2Z22 A;  1B40 A;  3D4G A;  3EHT A;  1WDN A;  3S9E A;  1B46 A;  4U4S A;  3RGY A;  5I2N B;  1ZLQ A;  1ZBM A;  5EHS A;  1IEJ A;  2I4C A;  1UTH A;  4ZEB A;  1S50 A;  3DEL B;  3VVF A;  5AA3 A;  2OCU A;  2DS9 A;  1B2H A;  4I9D A;  1AL3 A;  3RTF B;  1BIY A;  1DTZ A;  4BDL A;  2RCA A;  2Y84 A;  3FZV A;  4POX A;  3T96 B;  1POY 1;  1S7Y A;  3M3L A;  1B7H A;  5A5X B;  4ND9 A;  1ELJ A;  2HAU A;  2UVJ A;  2GH9 A;  2D3I A;  3SKP A;  4NTL A;  3TTN A;  2A5S A;  4XXU A;  4YB5 A;  3FVO A;  3FVK A;  4OMB A;  1MDP 1;  5CBS A;  3MP8 A;  3KZG A;  1N04 A;  1URS A;  1FTL A;  3JV9 A;  1FQA A;  1I69 A;  3VVD A;  4KCC A;  3F11 A;  1FQE A;  2QSX A;  3RNN A;  4LA9 A;  3T9U A;  4JWY A;  1B32 A;  1B7U A;  4R2F A;  4FIM A;  1P99 A;  2VD3 A;  1L5T A;  2H9B A;  2QS2 A;  4H8I A;  3OEN A;  3TZA A;  1TFA A;  4OYV A;  3TCG A;  5I57 B;  5IAI A;  3IAZ A;  4OET A;  2GHA A;  4OWD A;  4ZDM A;  4ZE8 A;  3I5O A;  4WED A;  3H6T A;  1M5E A;  5KCJ A;  4H0W A;  5IKB A;  3ECR A;  5BWJ A;  1MY0 A;  3DP4 A;  2REJ A;  3FIR A;  1M5F A;  1PEB A;  3SEY A;  4LON B;  1QW0 A;  2ZYO A;  3U92 A;  3B6T A;  2DWH A;  2RC8 A;  3UP9 A;  1ANF A;  3IJX B;  2KLF A;  2XX8 A;  1WVJ A;  3ODB A;  3G3F A;  1OLC A;  5I56 A;  1VE4 A;  4R6H A;  2ZYN A;  4XIG Q;  5CBR A;  2XXH A;  3TKD A;  3MVZ A;  3TTK A;  3FAS A;  1Y20 A;  2Z8E A;  4EF1 A;  4IGT A;  5M2V A;  1MXW A;  1NNP A;  2ZNU A;  4QFL A;  3UGW A;  3BFT A;  3MW0 A;  4G8H A;  3HPI A;  1GR2 A;  1PBP A;  2V3Q A;  5AA2 A;  5KZT A;  1OQH A;  2XD3 A;  5CMK A;  1MQH A;  4EQ9 A;  3VV5 A;  2PT2 A;  2XXU A;  3SEV A;  4LAT A;  3E13 X;  2QMW A;  3MAM A;  3TYH A;  4OEN A;  3OO8 A;  3LSX A;  4LUB A;  3H6V A;  4IO4 A;  2OWS A;  4DCY A;  4EDP A;  2VD2 A;  2ZYM A;  4H1X A;  3MC2 A;  5K2Y A;  3V83 A;  4ELP A;  1XOC A;  3TAJ A;  1N3X A;  3VVE A;  1LAH E;  3S4U A;  2Z23 A;  3S2V A;  4TLM B;  4PFW A;  3IB1 A;  4JB7 A;  5H8Q B;  5EYF A;  3KOT A;  2ALU A;  4IO6 A;  5KDT A;  4JSO A;  4YB7 A;  5ITP A;  2RCB A;  5AE4 A;  2VOZ A;  3LC8 A;  3PUX E;  4GOT A;  4QRZ A;  2F78 A;  4QFK A;  5J1D A;  3RUM A;  4LVQ A;  1OVT A;  1ZIU A;  5CI5 A;  3BBR A;  4RJZ A;  1URD A;  2XXI A;  1I6A A;  1SYI A;  4ZZA A;  4GLI A;  4C0R A;  4Q0C A;  2O1M A;  3I6V A;  2VHA A;  2ABH A;  2QJE A;  3N5L A;  3GLB A;  2HZL A;  3ILT B;  4JSD A;  4G4P A;  4GXS B;  3FV2 A;  4IY6 A;  1DPP A;  2P1S A;  3WAF A;  1R9Q A;  4AQ4 A;  1B3F A;  1HSE A;  2DVC A;  1XHY A;  4E0W A;  4DE8 A;  4DXC A;  3TUS A;  3Q29 A;  2DP8 A;  1FW0 A;  1NKX A;  3FAT A;  4U1O A;  4Z7E A;  5JEI A;  1EZP A;  1XS5 A;  2H99 A;  4XKP A;  3KOS A;  2Q2C A;  3O6G A;  3T93 B;  2Q9T A;  1A55 A;  3MVY A;  3OSR A;  4LZ8 A;  2UVH A;  3H03 A;  1JEU A;  1A8F A;  3O28 A;  3K00 A;  5CMB A;  3TEL A;  4ONY A;  2DWA A;  4F29 A;  3TEP A;  4IO2 A;  1POT A;  1VSO A;  1Q35 A;  2B3B A;  5AA4 A;  5TU0 A;  4WXJ A;  2XXT A;  5H8H A;  4YKP A;  4OFL A;  1QKA A;  4QHQ A;  2Y7R A;  3FXQ A;  2DXY A;  4I62 A;  1P1O A;  3SET A;  1QUL A;  3SER A;  1H44 A;  1HSJ A;  4F1U A;  4F22 A;  4M4G A;  3KFM A;  1JQF A;  2E1S A;  5CMC A;  1XVX A;  2RC9 A;  4TOZ A;  1P1N A;  3BFU A;  3LSF B;  3R7X A;  2F5X A;  3T9X B;  4ZEC A;  1SVX B;  1RYX A;  3B6Q A;  1N76 A;  5FTI A;  1SD3 A;  3A3C A;  3DLN A;  5CM6 A;  1BTJ A;  4XKQ A;  3G7W A;  4YMB A;  2F8D A;  4QF9 A;  2DXR A;  4AB5 A;  4KHZ E;  3CI8 A;  4P0I A;  4H8J A;  2XD2 A;  2DSF A;  1MY4 A;  3PUY E;  4MF3 A;  3OD7 A;  2P0S A;  3EPE A;  4R2B A;  1MPD A;  2Y7W A;  3RTW B;  4OQO A;  3E9X A;  4OFO A;  3U8Q A;  2DVZ A;  5L9S A;  1FTO A;  2IEE A;  3IX1 A;  3SES A;  3C33 A;  4YZZ A;  3H6W A;  1OVB A;  1FCK A;  3O6I A;  3T9H B;  4OEV A;  3SEW A;  3PPQ A;  5EHM A;  4FOR A;  4ZED A;  1MXV A;  3O2A A;  4HW8 A;  4FED A;  1YCJ A;  3GZG A;  3P7I A;  1EH3 A;  3FGS A;  4R6Y A;  2A5T B;  4F18 A;  5TPA B;  1PB9 A;  4EQ7 A;  4MLV A;  1IXC A;  5H8F B;  4DIG A;  3IR1 A;  2P2A A;  3USD A;  3MP6 A;  3EF7 A;  5L9M A;  4NF6 A;  2PBW A;  3CFX A;  3KN8 A;  1MQI A;  2X7Q A;  1II5 A;  3RPW A;  4FE8 A;  4R73 A;  5CMM A;  4NF8 A;  3TFL A;  4XKR A;  3EHU A;  3IL1 B;  3TQL A;  1EZ9 A;  2XXR A;  3HV1 A;  3CR9 A;  2Y7P A;  3FJG A;  3H7M A;  3ZSF A;  4G77 A;  5I2K A;  2ONR A;  1LAX A;  3K2D A;  3JYR A;  5FHO A;  3TTR A;  3T22 A;  2XXQ A;  3FJM A;  1NH8 A;  2I6E A;  1QUJ A;  1UIU A;  2I3W A;  4F2O A;  3Q26 A;  4NF4 B;  3Q25 A;  3VFJ A;  5H8S A;  2GRV A;  1OQG A;  1Y1M A;  3G3I A;  3ILU B;  2WKY A;  1BP5 A;  4RYA A;  1NNF A;  3PUZ E;  4OER A;  1M5B A;  4F19 A;  2QRY A;  4GWO A;  2ZXT A;  1JW1 A;  1NFT A;  1US4 A;  4IO7 A;  4BDR A;  5I58 B;  3QK6 A;  4I8C A;  1Y9U A;  3PU5 A;  4F1V A;  4EUO A;  2R71 A;  1FTM A;  3Q28 A;  4HCW A;  1LLS A;  4BDQ A;  3BKI B;  2O1L A;  3LR1 A;  2CZL A;  1SDX A;  4R9F A;  4N13 A;  1LFI A;  2AYS A;  3TPA A;  1MM6 A;  4ELR A;  1AMF A;  4OES A;  4IGR A;  3ZKL A;  2F35 A;  1A54 A;  1TT1 A;  3V8X B;  4RPO A;  4LQ2 A;  1SW2 A;  4WEP A;  1MPC A;  2V3T A;  3C32 A;  3U72 A;  4E0X A;  1GVC A;  1NH7 A;  4EF2 A;  4G8M A;  3OEK A;  4KCD A;  5DT6 A;  4X1B A;  4RXL A;  3TCH A;  1UTH B;  2DQV A;  1RKM A;  4ZE9 A;  3PMW A;  3OOA A;  1PB7 A;  5DTB A;  5CC2 A;  1VFE A;  3UIF A;  5H8N A;  2XXV A;  2XXP A;  2THI A;  2R9J A;  1A7L A;  3LSL A;  5TP9 A;  3GXA A;  1M5D A;  3MBP A;  1JVY A;  1N0T A;  3OO9 A;  1B7Z A;  2REG A;  2IA4 A;  2ANJ A;  1SW4 A;  3QYT A;  2ZMB A;  3N6T A;  1QUK A;  1H43 A;  3B7D A;  4KFQ A;  2NOO A;  2Z8D A;  4BDN A;  5HPQ A;  4C1U A;  5B7D A;  1AIV A;  4BLA A;  1MG1 A;  3DM0 A;  3W9V A;  2O84 X;  1B5I A;  3OO7 A;  5JTY A;  2B3F A;  1FQB A;  4ZS9 A;  1LB9 A;  3T66 A;  1IUD A;  2YLN A;  3PV0 E;  3KSX A;  4C1T A;  1GGG A;  2F7A A;  5B70 A;  3M3K A;  5DYH A;  2FNC A;  3U93 A;  1B52 A;  2D5W A;  1YAE A;  1PB8 A;  1D9Y A;  4XKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...