2W7YA

Structure of a streptococcus pneumoniae solute-binding protein in complex with the blood group a-trisaccharide.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
391
structure length
389
Chain Sequence
EVLEFYHGYHHSEDEWPVAKTMRDLYDKFAEEHSGVEFKPTPVNGDLKDIMNNKVASGEFPDVIDLAGNAVSLAAIEQKLVLDLKPYIDSNKLEKNVGLNYKQNQKDGKIYTVHEQLFTMGLWYNKDIFAKAGAKTPDQWNTWDDFTQAMASIRKQDGVYAFGAGEPSIRLFNTVLGTTENGRKLLDKPLTKEGIESKEFADALKMVMKEIQANGSKNAGGDANAYSKDFQEGKSAVFFNGVWASGEMSKNPSLAPGIYPAGVAISSSGGGITISSKMSEAKQKLALEFLKYMTSDDVQKVIFEKVGANPSNENVNVKELSEKSSEATTKILGQAITQVKNAKAVVPTVSDVWGGDVHTAIINALTESAAENVDVDQKVKSTQDVLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PROBABLE SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
publication title Blood-Group Antigen Recognition by a Solute-Binding Protein from a Serotype 3 Strain of Streptococcus Pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 119
structure length 389
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2w7yA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2w7yA01
2X7PA 4RPOA 4QSCA 3Q27A 3VLWA 4ECFA 5H8NB 4TOZA 4E0XA 1LAXA 3EN3A 3IJXB 2DOJA 1US5A 3IB1A 4F1YA 4GOTA 1H44A 3PUYE 4X48A 3RGYA 4GXAA 3G3KA 3KBRA 3K4UA 1BKAA 3LR1A 3KZGA 3EHTA 1MXUA 4KCCA 1IITA 5AA2A 1ELJA 2DE4A 1B0HA 2PX1A 3TCFA 3MVYA 3G3HA 4R2FA 1LSTA 4U1ZA 3IJOB 4H8IA 3TTKA 1I69A 4X9TA 3O6HA 4U21A 1SVXB 1SYHA 4E0WA 4R73A 4THIA 5ICQA 3MVXA 2F7CA 4IGRA 4NF6A 4DZ1A 4ZECA 5AA2B 3KSJA 3LSLA 1R1NA 4U23A 5F1QA 2ABHA 2V25A 5J1DA 5CMKA 4TQUQ 4JWXA 2PYYA 1FQFA 2RC8A 4KPTA 1B40A 4G2ZA 1PC3A 2O1MA 4YKJA 2HQ0A 3FJ7A 4NF6B 1MQDA 3H6VA 3C33A 1Q1KA 1KWHA 3M8UA 3H7MA 4MH5A 3MC2A 5CMBA 4FEDA 3MZ1A 3UP9A 4R6HA 1SBPA 1VE4A 3D4GA 4YB6A 4QFOA 1SI1A 4XKQA 1PB7A 4G8HA 1WODA 1B7ZA 1S50A 2XXVA 4LONB 3LC8A 3E3KA 4QFNA 3U93A 3T93B 4YB7A 3RT8A 4ESXA 4O3AA 2OZZA 4ISUA 5FTIA 3WAEA 3TYHA 4H5FA 2Z22A 2THIA 3TZAA 4ZZAA 1S9TA 4POXA 5ISUA 2DXYA 1EZPA 1EZOA 3T9VA 2XD2A 2XX8A 2HAUA 2Y84A 4QFLA 1MPDA 3TEPA 3RY3A 1LFHA 4RJZA 2HAVA 4LQ5A 2OWSA 3KOTA 3K6VA 1LFIA 2M8CA 4YB5A 3U8QA 2ZNUA 1MS7A 5L8DA 4BLAA 3QUFA 2A5TA 4NWCA 3VV5A 1CE2A 3MUQA 1ZTYA 1ZBMA 2Y7PA 3SESA 4KCDA 2NWJA 2RCAA 1XOCA 5BUUA 4F1UA 2A5TB 3Q25A 3PV0E 1M5EA 2XXIA 2QL3A 3A3UA 1A99A 1B6HA 3OENA 1POTA 3PPPA 1MY3A 4YU0A 4N07A 4PP0A 4OFLA 3LBSA 2NUVA 3T96B 1N3WA 2ZXTA 1FQEA 4G68A 1N3XA 2ZYNA 4U1OA 2H9BA 2Z8DA 3FXUA 4WKMA 1S7YA 3QUJA 5TPAA 3PUZE 2B3FA 2DWAA 2V93A 1P1WA 4LUBA 4IO7A 5KZTA 4PFWA 4OENA 5CC2A 2RC9A 5TU0A 3PUXE 3IB0A 5CMCA 4KD5A 1MXYA 4G68B 1A40A 3IOTA 3KFMA 4GQOA 2FA7A 3JZJA 3IB2A 3FV2A 5TPAB 1B7UA 4YZZA 1UIVA 4FAJA 1B46A 3D4CA 3LSXA 1NNPA 4FIMA 3KOSA 4R9GA 3IK6B 5FHOA 1QJMA 2VD2A 5CBRA 1B5HA 1MM6A 2E0SA 2I0BA 2I48A 1CB6A 1WDNA 4LZ8A 1SW1A 3VVEA 4F3SA 2QSXA 3TTMA 4RK2A 4PETA 3DP6A 2IEEA 3PPRA 4F22A 5DYHA 4F19A 4OESA 3SEYA 2UXAA 3K1MA 3HHGA 1IZ1A 1YAEA 2O1LA 4HW8A 3U92A 3BKIB 2IA4A 3RPWA 2AL5A 3E9XA 4X1BA 2H5YA 1FTKA 2UVHA 2I3WA 3PMWA 3H6TA 4H65A 1LCTA 1B32A 3HN0A 5FHNA 2NOOA 3CFXA 3R7XA 1II5A 2XX9A 5K2XA 5L9SA 2RKMA 1DSNA 5KDTA 4AQ4A 3S9NC 4NE4A 2DE3A 3RTFB 1FQAA 4ZDMA 2DWJA 1XVYA 1O63A 4JSDA 1MQHA 2DE2A 3TQWA 4M1VA 4OEUA 5B70A 4DXCA 4GVOA 4H5GA 2R9JA 5JEIA 5KDTB 5IKBA 2ONSA 5M2VA 1POY1 2RINA 3IOVA 5H8HA 1A8FA 2OWTA 1HSLA 1SQYA 1XHYA 3RQTA 1A54A 4IO5A 4LZ5A 4ZEDA 3UA8A 1D9YA 2H98A 4RYAA 4GL0A 4OETA 4EXKA 4F39A 1MM7A 1JW1A 5I59A 1NL5A 1D4NA 4DE8A 5H8HB 1QUIA 1IXIA 1VFEA 3FASA 4U2RA 3KN8A 3WAFA 4EF2A 3OD7A 1A8EA 3HHFA 5DVFA 5I59B 3PUWE 2QS3A 4NEDA 4Z0IA 3K0VA 3MPLA 2XXXA 4ZE9A 3JYRA 3PPQA 1FCKA 3N26A 4JSOA 1JW5A 4JWYA 2CMOA 3PD9A 3H03A 2R71A 4DDDA 4LZ7A 4KR5A 4WEPA 3IO6A 5H8QA 4OEVA 4X1DA 1B0LA 4G4PA 1MPCA 1DTGA 4N13A 2Y7IA 1GGGA 4EXLA 3MPKA 1MG1A 4NF5A 2QJEA 2Z8FA 3FVOA 3UN6A 2YLNA 3K6XA 4Q0CA 1Q35A 1MXVA 4R75A 3T9XB 1XS5A 2UVJA 5H8QB 4U4SA 2Q89A 1LGBC 1DTZA 2DWHA 1MRPA 2HFBA 2DS9A 5I2KA 3RLFE 4NF5B 3OEKA 2G29A 3O6IA 4ZEBA 5DTBA 4F3BA 1ZKBA 2ALUA 4IO2A 3OSQA 1A55A 3S2VA 2D5WA 4KYSA 4XKRA 2AL4A 5EHMA 3UK4A 3E13X 3HSTA 4ELQA 5I2KB 1FTLA 3OMBA 2DWIA 5K2YA 2UYEA 1EZ9A 3SEVA 1XT8A 2REGA 3VE1B 1FQBA 1SW2A 3M3LA 3LSFB 2VGQA 1Y4TA 2VP1A 2ZNSA 1IUDA 2GH9A 3MP1A 3CVGA 2RC7A 2XXYA 3ILTB 2ANJA 1SW4A 3KN3A 1T0KA 4Q8RA 2F34A 3V83A 4G77A 4ZE8A 5AA1A 4IO3A 2DVZA 4H0WA 3Q29A 5HBCA 2XXHA 1BTJA 1B3FA 1P99A 1H3DA 2O7UA 3MZBA 4MLVA 4OYVA 1B51A 3FXQA 5I2NA 2O69A 2Q2AA 1JVXA 4RPNA 3FIRA 2UYFA 3TCGA 4ESWA 5DT6A 1OIBA 3TTLA 3FVKA 4KYEA 3KG2A 4PE5B 3EQ1A 4I62A 4JDFA 4NF4A 4JXIA 3TMGA 4FORA 3VVDA 3FXRA 1J1NA 5I2NB 4ZEIA 5TP9A 3MWBA 1QW0A 1Y1MA 1MY1A 3IAZA 1B9JA 4OERA 5CMMA 4I8CA 3TODA 4U4XA 3DM0A 5JTYA 4LVQA 4NF4B 1QUKA 1AOVA 3QAXA 4LP2B 5HM4B 3VLVA 2QPQA 5TP9B 2PT2A 2HXWA 4OHNA 2V3QA 4R6KA 1DPPA 2XXQA 4UA8A 2VD3A 1Y3NA 5JTYB 2F35A 1ZJLA 4DLDA 1B3EA 3B6QA 1SW5A 1DMBA 3L6GA 1RYOA 1EU8A 1B7HA 2Y7KA 5FHMA 5BWJA 3ZKKA 4C1UA 1GR2A 5DVIA 3FUZA 1LAHE 1ZMGA 5I84A 1FQCA 2GHBA 4KI0E 3FZVA 2KLFA 1SDXA 3HPIA 4QRZA 1VFDA 4H6DA 1XC1A 2FYIA 3OO6A 3P7IA 1ZLQA 3EHUA 1ZIUA 3M3FA 4OTEA 2BJJX 1N7XA 3G3FA 3FVGA 3DLNA 3KJTA 1AL3A 3K02A 2PBWA 2A5SA 2V3UA 4WXJA 1QKBA 4LQ2A 1M5CA 3ZS6A 4C1TA 3C31A 3LUYA 4OWDA 2CZLA 5H8FA 2I3VA 2F6PA 2F5XA 2F7AA 3N6UA 4FE8A 3T9HB 4HCYA 2D3IA 4KYDA 4ZS9A 1P1UA 2DP8A 4M4GA 2OK2A 2XXUA 3C32A 3QXMA 1LAGE 2DQVA 4IB2A 4G8NA 5H8FB 4OZ9A 5KCJA 4YKIA 4DIGA 3VDFA 3BBRA 4KFQA 1YTVA 2V84A 1ANFA 3IOUA 1JQFA 3S4UA 1H45A 1B2HA 2Q9TA 3T9UA 1QUJA 2F7BA 2P0SA 2Q88A 3MBPA 1Y3QA 5KCJB 4XKPA 1ATGA 3THIA 1B3HA 4NTLA 3S9LC 1QVSA 3HO7A 4ZEFA 1MXWA 4FATA 1FTJA 2W7YA 1WVJA 1XVXA 3C9HA 2RCBA 3TCHA 4RK9A 2DSFA 2O6AA 4RA1A 1URSA 1MDP1 5LOMA 5ICTA 4DCXA 3N94A 1URGA 5ELVA 3O97A 2ZYMA 4R72A 1GV8A 1LB9A 2VHAA 4GRKA 3TQLA 1RYXA 3U72A 4OFOA 4R9FA 4EQBA 1JW4A 4DXUA 4PFTA 3SETA 3IORA 2Y7WA 3DP8A 4BDLA 2X7QA 1Z7NE 4RNSA 4H67A 2F78A 1VR5A 1FTMA 2DXRA 3ECRA 3MJNA 5IAIA 2DVCA 3K6UA 2XX7A 1MY2A 1SI0A 3O6GA 4U22A 2G93A 3IO4A 2F6GA 3OO7A 4MF3A 1MDQA 1TFAA 1MXZA 5CBSA 5A5XA 1JETA 1MH4A 3N5LA 1FW0A 4OXVA 3RUMA 1IXGA 3E4RA 4ND9A 3QIMA 1UQWA 3SEUA 3O66A 3CSBA 4O3CA 1H76A 3K00A 5AE4A 1N76A 3MQ9A 4R74A 3CR9A 2GHAA 3N6TA 4OQOA 4F3GA 1B05A 5A5XB 3G7WA 5EYFA 3S9EA 4P11A 1NKXA 3CSGA 1Y1ZA 4G68C 4QSEA 3UORA 1MY4A 1B52A 3C4MA 1US4A 1URDA 2I0CA 2H99A 5I57A 2HZKA 4F2OA 3C36A 4RY1A 1R9LA 1I6BA 1I6QA 4BDOA 4WEDA 1GVCA 2HCAA 4GFRA 4ONYA 1LBCA 3FATA 3MW0A 3F11A 3B6WA 3B7DA 2UVIA 3FD3A 2QS1A 4QFPA 5ITPA 5I57B 3DELB 1IQ7A 1B4HA 1USYE 4QF9A 4OMBA 4QSDA 3PD8A 2ONKE 2B65A 3R6UA 2O51A 5ITOA 3TTRA 2R6GE 4POWA 3GLBA 1LBBA 4PFYA 1MQIA 3I6VA 4G8MA 2GRVA 4FECA 3O9PA 4IY5A 1HSJA 4JB7A 3K01A 4GF8A 3H3GA 2DYXA 4KQPA 1IXCA 4IO6A 2NVUB 1BIYA 4MLQA 3RN8A 2O84X 1GTKA 2X26A 3K6WA 4BDMA 2OJTA 4AB5A 4IGTA 3PUVE 3FJGA 2ZMBA 1BLFA 5B7DA 4DCYA 1AIVA 1JEUA 1UTBA 3SEWA 4I1DA 1PEBA 2XXWA 3W15C 3EF7A 4RXLA 1F9BA 1D9VA 3V8XB 3USDA 2H25A 1P1OA 2WKYA 2XXRA 3H6WA 2OBGA 2OLBA 4LA9A 3ZSFA 3KSXA 2AYSA 1UTBB 4XKNA 1Y9UA 4YKPA 1TWYA 1LAFE 3Q26A 4I9DA 3U94A 3GZGA 4QHQA 1FQDA 4XTCQ 3TDJA 3S9MC 3V5AA 1DPEA 1LCFA 2QS2A 2RF1A 2HEUA 2ZYOA 2H4IA 2XHDA 1OQGA 3FV1A 3O28A 3ILUB 4GWOA 1IXHA 3W9VA 3AXFA 3MP6A 2ONRA 1USYH 1PBQA 3KN7A 2XXPA 3OEMA 3Q28A 2QMWA 3MVWA 2I4BA 3SERA 1MY0A 3PMVA 1BP5A 3QSLA 1SD3A 2QS4A 2F36A 4F3PA 3VFJA 4BDNA 3IL1B 3T66A 1AH5A 5H8SA 1IEJA 4HS7A 4YKKA 1TXFA 3MAMA 4ZZEA 1YPNA 1H43A 1M5DA 1B3LA 4FEBA 1EH3A 3EHSA 4HCWA 3OO9A 3H06B 3HCQA 1P1QA 1A7LA 1HSEA 2I4CA 1L5TA 2REJA 3ZKLA 1M5FA 1OLAA 3H6UA 1Z7ME 2YJPA 1JNFA 3RT6B 4ELRA 4P0GA 3LSWA 3TELA 3FGSA 5AA3A 4TLLB 5HPQA 3PGFA 4Z7EA 4F18A 4F2QA 4PQJA 5L9MA 3CIJA 1OVTA 1PDAA 2P1SA 1N7WA 3C34A 4QFKA 2I58A 4GLIA 5EHSA 3O2AA 1OMPA 1B4ZA 4BDRA 1NFTA 2V3TA 4ZEKA 3U1OA 4IO4A 3KEIA 3L6HA 1O7TA 2I49A 2F97A 3I3VA 5DEXA 1D3KA 3O29A 3QYTA 3OELA 1N04A 4PFUA 2Z8EA 1OQHA 1LLSA 4EDPA 2D21A 4EF1A 1M5BA 4P0IA 1NMUA 4O3BA 3I5OA 1MH3A 3TFLA 1MXXA 1TFDA 1O64A 3IX1A 4GL8A 2YPNA 1N84A 1LFGA 3SDFA 1MQGA 1OLCA 4NMYA 3G3IA 3K2DA 5DEXB 3G3JA 1NNTA 3W9WA 2FNCA 1DOTA 5JK4A 3OSRA 2O7IA 2PVUA 3VXCA 3JV9A 3KJ7A 5I58A 3TPAA 2NXOA 5FTHA 4R6YA 3H4ZA 3R26A 4JWOA 4HTGA 1VSOA 4OFJA 3C35A 1NH8A 4F31B 3V89B 3SEXA 4F1VA 3CFLA 2O68A 4GD5A 3RNNA 1Y20A 1MQJA 5I58B 4BDQA 1TT1A 4KHZE 1PB9A 1YCJA 5AA2D 3G3GA 1IIWA 4LATA 4C0RA 4UACA 3BFTA 3T22A 4GXSB 3IOWA 1NNFA 3IR1A 2LAOA 4XXUA 1PB8A 5CI5A 3VVFA 2HZLA 4F29A 3CFZA 3CG3A 3OXNA 3PPNA 2OCUA 3B6TA 4YMBA 4ELPA 3FJMA 1AMFA 4YMAA 1B1XA 3PMXA 1Y3PA 3M3KA 4TLMB 2Y7RA 3PPOA 4YAHX 1B58A 2ESNA 1RKMA 2ZYKA 3CG1A 3K1NA 2F8DA 4EQ7A 5L9OA 4K3FA 2GFEA 4JBZA 1N0TA 4Q5TA 3UIFA 3HV1A 3MZ9A 3MVZA 2XXTA 3GXAA 1NH7A 3K1PA 5CRYA 3KGCA 3SKPA 2XD3A 2UVGA 4EQ9A 4ELOA 1P1NA 4AB6A 4IY6A 2P2AA 3UGWA 2PT1A 2QMXA 3A09A 3OO8A 3TTNA 5F7VA 1ZU0A 1SYIA 4H8JA 2ZNTA 3GBBA 3CRBA 5I56A 1B1HA 3A3CA 2Q8JA 4OVJA 3DP4A 3RTWB 3TKDA 2PMSA 5CM6A 1Y4CA 1UTHA 2Z23A 4EUOA 4Q30B 1R6ZA 1B3GA 4R2BA 2VOZA 1QKAA 4NWDA 1JVYA 4FJPA 3OOAA 5I56B 4GIZA 5AA4A 3GBAA 3CI8A 1PBPA 4XIGQ 3QK6A 2AIXA 3PU5A 4N6PA 1OVBA 4DXBA 3TAJA 1UTHB 2Q2CA 3VLUA 3VXBA 4NF8A 4YICA 1I6AA 5DVJA 4MFIA 1UIUA 1MPBA 1LB8A 3ONMA 5H8NA 5AA4B 3BFUA 3TUSA 1NNKA 2I6EA 1B5JA 2QRYA 3ODBA 4MBPA 1FTOA 4H1XA 3FVNA 1JEVA 1B5IA 3MP8A 3EPEA 4L17A 2B3BA 1QULA 2E1SA 4NF8B 1R9QA
chains in the Genus database with same CATH superfamily
2X7PA 4RPOA 5LTCA 4QSCA 3Q27A 3VLWA 4ECFA 4AS5A 5H8NB 4TOZA 4E0XA 1LAXA 4MNIA 3EN3A 3IJXB 2DOJA 1US5A 2ZZVA 3IB1A 4F1YA 1D9QA 4NF0A 4GOTA 1H44A 3PUYE 4X48A 3RGYA 4P3LA 4UABA 4GXAA 2JJKA 3G3KA 3KBRA 3K4UA 1BKAA 3LR1A 3KZGA 3EHTA 1MXUA 1JP4A 4KCCA 1IITA 5AA2A 1ELJA 4H46A 4PAKA 2DE4A 1B0HA 2PX1A 3ROJA 3TCFA 3MVYA 3G3HA 4R2FA 1LSTA 4U1ZA 3IJOB 4H8IA 3TTKA 1I69A 3BIGA 4X9TA 3O6HA 4U21A 1SVXB 1SYHA 4E0WA 1NV7A 4P1EA 4R73A 4THIA 5ICQA 3MVXA 2F7CA 4IGRA 4NF6A 4DZ1A 4ZECA 5AA2B 3KSJA 3LSLA 4N81A 1R1NA 4U23A 5F1QA 2ABHA 2V25A 5J1DA 5CMKA 3E78A 4TQUQ 4JWXA 2PYYA 1FQFA 2RC8A 4GWUA 4KPTA 1B40A 4G2ZA 4PBHA 1PC3A 2O1MA 4YKJA 2HQ0A 4DI4B 1LBZA 3FJ7A 4NF6B 1MQDA 3H6VA 3C33A 1Q1KA 1KWHA 3M8UA 3H7MA 4MH5A 3MC2A 5CMBA 4FEDA 3MZ1A 5DW8A 2Q74A 1CNQA 3UP9A 4R6HA 4PFBA 1SBPA 1VE4A 3D4GA 4YB6A 4QFOA 1SI1A 4XKQA 1PB7A 1IMBA 4G8HA 1WODA 1B7ZA 1S50A 2XXVA 4LONB 4OVSA 3LC8A 3E3KA 4QFNA 3U93A 3T93B 4YB7A 3RT8A 4ESXA 4O3AA 4OVQA 2OZZA 4ISUA 2Y5LA 5FTIA 3WAEA 3TYHA 4H5FA 2Z22A 2THIA 3TZAA 4ZZAA 1S9TA 4POXA 5ISUA 2DXYA 1EZPA 1EZOA 3T9VA 2XD2A 2XX8A 4PC9A 2HAUA 2Y84A 1YZ0A 4QFLA 1MPDA 3E79A 3TEPA 3RY3A 1LFHA 4RJZA 2HAVA 4LQ5A 4XF5A 2OWSA 1LBVA 3KOTA 3K6VA 1LFIA 2M8CA 4YB5A 3U8QA 2ZNUA 1MS7A 5L8DA 4BLAA 3QUFA 2A5TA 4NWCA 3VV5A 1BK4A 1CE2A 3MUQA 1NUXA 1ZTYA 1ZBMA 2Y7PA 3SESA 1KZ8A 4KCDA 2NWJA 4MHFA 4NGUA 2WBBA 2RCAA 1XOCA 5BUUA 4MIJA 4F1UA 2A5TB 3Q25A 3PV0E 1M5EA 4MCOA 2XXIA 4OA4A 2QL3A 3A3UA 1A99A 2CZIA 1B6HA 3OENA 1POTA 3PPPA 1MY3A 4YU0A 4N07A 4PP0A 4OFLA 3LBSA 2NUVA 3T96B 1N3WA 2ZXTA 1FQEA 4G68A 1N3XA 2ZYNA 5I7IA 1Q9DA 4U1OA 2H9BA 2Z8DA 3FXUA 3U65A 4WKMA 1S7YA 5EQAA 3QUJA 5TPAA 3PUZE 2B3FA 2DWAA 2V93A 2XWVA 1P1WA 4LUBA 4IO7A 5KZTA 4PFWA 4OENA 5CC2A 2P3VA 2RC9A 5TU0A 3PUXE 3IB0A 5CMCA 4KD5A 1MXYA 4G68B 1A40A 3IOTA 3KFMA 2VT5A 4GQOA 2FA7A 3JZJA 3IB2A 3FV2A 5TPAB 1B7UA 1NUWA 4YZZA 1UIVA 4FAJA 1B46A 3D4CA 3LSXA 1NNPA 4FIMA 3KOSA 4AS4A 4R9GA 3IK6B 2WX9A 5FHOA 1QJMA 2Q8MA 2KR0A 2VD2A 5CBRA 1B5HA 4I3EA 1MM6A 2E0SA 2I0BA 2I48A 1CB6A 1WDNA 4PF6A 4LZ8A 1SW1A 3VVEA 4F3SA 2QSXA 2R8TA 3TTMA 4RK2A 4PETA 3DP6A 2IEEA 3PPRA 4F22A 5DYHA 4F19A 4OESA 3SEYA 2UXAA 3K1MA 3HHGA 1IZ1A 1YAEA 2O1LA 4O7IA 4HW8A 2OWZA 3U92A 3BKIB 2IA4A 3RPWA 2AL5A 3E9XA 4X1BA 4GWWA 1AWBA 2H5YA 1FPJA 1FTKA 2UVHA 2I3WA 1LBYA 2PFZA 3PMWA 2CEXA 1FPIA 5EYGA 3H6TA 4H65A 1FJ9A 1DK4A 1LCTA 1IMCA 1B32A 3HN0A 5FHNA 2NOOA 1XI6A 3CFXA 4OANA 3R7XA 1II5A 4N6KA 2XX9A 5K2XA 4PDHA 5L9SA 2RKMA 1DSNA 5KDTA 4AQ4A 3S9NC 4NE4A 2DE3A 3RTFB 1FQAA 4ZDMA 1FTAA 2DWJA 1XVYA 4NAPA 1O63A 4JSDA 4XFEA 1MQHA 2DE2A 3TQWA 4M1VA 4OEUA 5B70A 4DXCA 4JVCA 4GVOA 4H5GA 2R9JA 5JEIA 5KDTB 5IKBA 2ONSA 5M2VA 1POY1 4MMPA 2RINA 3IOVA 5H8HA 1A8FA 2OWTA 1HSLA 1LEVA 1SQYA 1XHYA 3RQTA 1A54A 4IO5A 4LZ5A 3CHGA 4ZEDA 3UA8A 1D9YA 2H98A 4RYAA 4GL0A 4OETA 4EXKA 4MAGA 4F39A 1MM7A 2WBDA 1JW1A 2FBPA 5I59A 1NL5A 2XWIA 1DCUA 1D4NA 4DE8A 5H8HB 1QUIA 1IXIA 1VFEA 3FASA 1FSAA 4U2RA 3KN8A 3WAFA 4EF2A 3OD7A 1NV4A 1A8EA 3HHFA 4GX6A 5DVFA 5I59B 3PUWE 2QS3A 4NEDA 4Z0IA 3K0VA 4GX3A 4HXVA 3MPLA 2XXXA 4ZE9A 3JYRA 3PPQA 1FCKA 4P47A 3FBPA 3N26A 4JSOA 1JW5A 4JWYA 5ET8A 2CMOA 3PD9A 4FBPA 3IFCA 3H03A 2R71A 4DDDA 4LZ7A 1DBZA 4KR5A 4WEPA 3IO6A 5H8QA 4OEVA 4X1DA 3KC1A 1B0LA 4G4PA 1MPCA 1DTGA 4N13A 2Y7IA 1GGGA 4EXLA 3MPKA 3HFUA 1MG1A 4NF5A 4PF8A 1FPDA 1FPKA 2QJEA 2Z8FA 3FVOA 3UN6A 2L5VA 2YLNA 3K6XA 1NV1A 4Q0CA 1Q35A 2WEFA 1MXVA 4R75A 3T9XB 1XS5A 2UVJA 5H8QB 4U4SA 2Q89A 1LGBC 1DTZA 2DWHA 1MRPA 2HFBA 2DS9A 5I2KA 3RLFE 4NF5B 1NV5A 3OEKA 2G29A 5J16A 3O6IA 4ZEBA 5DTBA 4F3BA 1ZKBA 2ALUA 1FPEA 3ISPA 4IO2A 3OSQA 1A55A 3S2VA 2D5WA 4GWXA 2ZZWA 4KYSA 4XKRA 2AL4A 5EHMA 3UK4A 3E13X 3HSTA 4ELQA 5I2KB 1FTLA 5IZ1A 3OMBA 2DWIA 5K2YA 2WYKA 2UYEA 1EZ9A 3SEVA 1XT8A 2REGA 3VE1B 1FQBA 2VPOA 1SW2A 3M3LA 3LSFB 2VGQA 2B4MA 1Y4TA 3B8BA 2VP1A 2ZNSA 4MNCA 1IUDA 2GH9A 3MP1A 3CVGA 2RC7A 2XXYA 3ILTB 2ANJA 1SW4A 3KN3A 1T0KA 4Q8RA 2F34A 3V83A 3B50A 4G77A 4ZE8A 5AA1A 4IO3A 2DVZA 4H0WA 2FIEA 3Q29A 5HBCA 2WYPA 2CZKA 2XXHA 1BTJA 1B3FA 1P99A 1H3DA 2O7UA 3MZBA 4MLVA 1NV3A 4OYVA 1B51A 3FXQA 5I2NA 4GWYA 2O69A 2Q2AA 1JVXA 4RPNA 4I3YA 3FIRA 2UYFA 3TCGA 4ESWA 5DT6A 1OIBA 3TTLA 3FVKA 4KYEA 3KG2A 3PTYA 4PE5B 3EQ1A 4I62A 4JDFA 4NF4A 4JXIA 3TMGA 4FORA 3VVDA 3FXRA 1J1NA 5I2NB 4ZEIA 5TP9A 3MWBA 1QW0A 1Y1MA 1MY1A 3IFAA 3IAZA 1B9JA 4OERA 5CMMA 4I8CA 3TODA 4U4XA 3DM0A 5JTYA 4NQ8A 4PFRA 4LVQA 4NF4B 1QUKA 1AOVA 3QAXA 4LP2B 5HM4B 1INPA 3VLVA 2QPQA 5TP9B 2PT2A 4N91A 2HXWA 4OHNA 3A29A 2V3QA 4R6KA 4OVPA 1DPPA 2XXQA 4PCDA 4UA8A 2VD3A 1Y3NA 5JTYB 5T3JA 2F35A 1ZJLA 4DLDA 1B3EA 3B6QA 1SW5A 1DMBA 4P9KA 3L6GA 1RYOA 1EU8A 1RDYA 1B7HA 2Y7KA 5FHMA 5BWJA 3ZKKA 4C1UA 5EQ7A 1GR2A 5DVIA 3FUZA 1LAHE 4PFIA 1ZMGA 2BJIA 5I84A 1FQCA 2GHBA 4KI0E 3FZVA 5IZ3A 2KLFA 1SDXA 3HPIA 4QRZA 4G61A 1VFDA 4H6DA 1XC1A 2FYIA 3OO6A 3P7IA 1ZLQA 3EHUA 4NX1A 1ZIUA 3M3FA 5ET5A 4OTEA 2BJJX 1N7XA 3G3FA 3FVGA 3DLNA 3KJTA 1AL3A 3K02A 2PBWA 4PGPA 2A5SA 2V3UA 4WXJA 1QKBA 4LQ2A 1M5CA 3ZS6A 4C1TA 1LBXA 3GYYA 3C31A 3LUYA 5IZ3B 4OWDA 2CZLA 5H8FA 2I3VA 1NV2A 2F6PA 2F5XA 2F7AA 3N6UA 4FE8A 3T9HB 4HCYA 4N8YA 2D3IA 4KYDA 4ZS9A 1P1UA 2DP8A 4M4GA 2OK2A 2XXUA 3C32A 3QXMA 1LAGE 2DQVA 2FHYA 4IB2A 4G8NA 2QVRA 5FBPA 5H8FB 4OZ9A 5KCJA 4YKIA 4DIGA 3VDFA 3BBRA 2PFYA 4KFQA 3RYDA 1YTVA 4P56A 2V84A 1ANFA 2XWKA 3IOUA 1JQFA 3S4UA 1H45A 5IZZA 1B2HA 2Q9TA 3T9UA 1QUJA 2F7BA 2GQ1A 2P0SA 4KXPA 2Q88A 3MBPA 1Y3QA 5KCJB 4XKPA 1G0IA 1ATGA 3THIA 1B3HA 4NTLA 1RDZA 3S9LC 1QVSA 3HO7A 4ZEFA 1MXWA 4FATA 3SZPA 1FTJA 2W7YA 1WVJA 1XVXA 3C9HA 2RCBA 3TCHA 4RK9A 2DSFA 2O6AA 4DI3D 4RA1A 1URSA 1MDP1 5LOMA 1FJ6A 5ICTA 4DCXA 3N94A 1URGA 5ELVA 3O97A 2ZYMA 4R72A 4PE3A 1GV8A 1LB9A 2VHAA 3D1RA 4GRKA 3TQLA 1RYXA 5ET6A 4HE0A 3U72A 4OFOA 4R9FA 2CEYA 4EQBA 1JW4A 3MYUA 4DXUA 4PFTA 3SETA 3IORA 2VPNA 2Y7WA 3DP8A 4BDLA 2X7QA 5A5LA 1Z7NE 4RNSA 4H67A 2F78A 4PGNA 4GBVA 1VR5A 1FTMA 2DXRA 3ECRA 3MJNA 3KC0A 5IAIA 2DVCA 3K6UA 2XX7A 1MY2A 1SI0A 3O6GA 4U22A 1KA1A 2G93A 3IO4A 2F6GA 3OO7A 4MF3A 1MDQA 2Y5KA 1FBEA 1TFAA 5I3SA 1MXZA 5CBSA 2MKZA 1JETA 5A5XA 1MH4A 3N5LA 1FW0A 4OXVA 3RUMA 1IXGA 3E4RA 4ND9A 3QIMA 1UQWA 3SEUA 3KBZA 3O66A 3CSBA 4O3CA 1H76A 3K00A 5AE4A 1N76A 3MQ9A 4R74A 3CR9A 1FPFA 2GHAA 3N6TA 4OQOA 1EYKA 4F3GA 1B05A 5A5XB 3G7WA 5EYFA 3S9EA 1FPLA 4P11A 1NKXA 3CSGA 4HE1A 1Y1ZA 4G68C 4QSEA 5EQ9A 3UORA 1MY4A 1B52A 1NV0A 4P1LA 3C4MA 4JVDA 1US4A 1URDA 2PCRA 2I0CA 2H99A 5I57A 2HZKA 4F2OA 4PDDA 3C36A 4RY1A 1R9LA 1FPGA 1I6BA 1I6QA 4BDOA 3RPLA 4WEDA 1GVCA 2XA5A 2HCAA 4GFRA 4ONYA 1LBCA 3FATA 3MW0A 4O8MA 2OX3A 3F11A 3B6WA 3B7DA 2UVIA 4GWZA 3FD3A 2QS1A 4QFPA 5ITPA 5I57B 1LBWA 3DELB 1IQ7A 1B4HA 1USYE 3RPLB 4QF9A 4OMBA 4QSDA 3PD8A 2ONKE 2B65A 3R6UA 1YYZA 2O51A 5ITOA 3TTRA 2R6GE 4POWA 3T1BA 3GLBA 1LBBA 4PFYA 1MQIA 3I6VA 4G8MA 2GRVA 4FECA 3O9PA 4IY5A 1HSJA 4JB7A 3K01A 4GF8A 1G0HA 3H3GA 2DYXA 4KQPA 1IXCA 4IO6A 2NVUB 1BIYA 1FBGA 4MLQA 3RN8A 2O84X 1GTKA 4GBWA 2X26A 3K6WA 4BDMA 2OJTA 4PAFA 4AB5A 4IGTA 3PUVE 3FJGA 2ZMBA 1BLFA 5B7DA 4DCYA 1AIVA 1JEUA 1FBCA 1UTBA 3T0JA 3EKIA 3SEWA 4I1DA 1PEBA 2XXWA 3W15C 3EF7A 4RXLA 4H45A 1F9BA 1D9VA 2CZHA 3V8XB 3USDA 2H25A 1P1OA 2WKYA 2XXRA 3H6WA 2OBGA 2OLBA 4LA9A 3ZSFA 3KSXA 2AYSA 1UTBB 4XKNA 1Y9UA 4YKPA 5F24A 1TWYA 1LAFE 3Q26A 2KQZA 4P8BA 4I9DA 3U94A 3GZGA 4QHQA 1FQDA 4XTCQ 3TDJA 3S9MC 3V5AA 1DPEA 5EYHA 1LCFA 2QS2A 2RF1A 2HEUA 4N6DA 2ZYOA 2H4IA 2XHDA 2FIXA 1OQGA 3FV1A 3O28A 3ILUB 4GWOA 2F3BA 1IXHA 1NUZA 5ESYA 3W9VA 3AXFA 3MP6A 2ONRA 1USYH 1PBQA 3NOHA 3KN7A 2XXPA 3OEMA 1IMDA 3Q28A 2QMWA 4GX4A 3MVWA 2I4BA 3SERA 1QGXA 1MY0A 3PMVA 4N15A 1BP5A 3QSLA 3MSTA 1SD3A 2QS4A 2F36A 4F3PA 3VFJA 4BDNA 4NN3A 3IL1B 3T66A 1AH5A 1FBDA 5H8SA 1EYJA 1IEJA 4HS7A 4YKKA 1TXFA 3MAMA 4ZZEA 1YPNA 1H43A 1M5DA 1B3LA 4FEBA 1EH3A 3EHSA 4HCWA 3OO9A 3H06B 4IR8A 3HCQA 1FBPA 1NV6A 1A7LA 1P1QA 4QXDA 4PBQA 1HSEA 2I4CA 1L5TA 2REJA 4QBAA 4JVIA 3ZKLA 1M5FA 1OLAA 3H6UA 1Z7ME 2YJPA 1JNFA 3RT6B 4ELRA 4P0GA 4MNPA 3LSWA 3TELA 3FGSA 5AA3A 4TLLB 5HPQA 3PGFA 4Z7EA 4F18A 4F2QA 4PQJA 5L9MA 3CIJA 1OVTA 1PDAA 2P1SA 2P3NA 1N7WA 3C34A 4QFKA 2I58A 4GLIA 4O7MA 5EHSA 3O2AA 1OMPA 1B4ZA 4BDRA 2B4LA 4MEVA 1NFTA 2V3TA 4ZEKA 3U1OA 4IO4A 3KEIA 3L6HA 1O7TA 2ZZXA 2I49A 1NUYA 2F97A 3I3VA 5DEXA 1D3KA 3O29A 3QYTA 3OELA 1N04A 4PFUA 1SPIA 2Z8EA 2HHMA 1OQHA 2HXRA 1LLSA 4EDPA 4O94A 2D21A 4EF1A 1M5BA 4P0IA 1NMUA 4O3BA 3I5OA 1MH3A 3TFLA 1MXXA 1TFDA 1O64A 3IX1A 4GL8A 4MJOA 2YPNA 1N84A 1LFGA 3SDFA 1MQGA 1OLCA 3LV0A 3G3IA 3K2DA 4NMYA 5DEXB 3G3JA 1NNTA 3W9WA 2FNCA 1DOTA 5JK4A 3OSRA 2O7IA 4XEQA 2PVUA 3VXCA 3JV9A 3KJ7A 1VDWA 4OVTA 5I58A 3TPAA 2NXOA 4MX6A 5FTHA 4R6YA 3H4ZA 3R26A 4JWOA 4HTGA 1VSOA 2QVVA 4OFJA 3C35A 1NI9A 1NH8A 4F31B 3V89B 3SEXA 4F1VA 3CFLA 5IGAA 2O68A 4GD5A 3RNNA 2FVZA 1Y20A 4NHBA 4N8GA 1MQJA 5I58B 4BDQA 1TT1A 4KHZE 1PB9A 3FXBA 1YCJA 5AA2D 3G3GA 4NG7A 1IIWA 4LATA 4N17A 1K9ZA 4C0RA 4UACA 3BFTA 3T22A 1IMFA 4GXSB 3IOWA 1NNFA 3IR1A 2LAOA 4OVRA 4XXUA 1PB8A 5CI5A 4I40A 3VVFA 2HZLA 4F29A 3CFZA 3CG3A 3OXNA 3PPNA 2OCUA 3B6TA 4YMBA 1RDXA 4ELPA 3FJMA 5ET7A 1AMFA 4YMAA 1B1XA 4PTKA 3PMXA 1Y3PA 3M3KA 4TLMB 1KA0A 2Y7RA 4N4UA 3PPOA 4YAHX 5IM2A 1B58A 2ESNA 1RKMA 2ZYKA 3CG1A 3K1NA 2F8DA 4X8RA 4EQ7A 5L9OA 4K3FA 5LDZA 1EYIA 2F3DA 2GFEA 4JBZA 1N0TA 4Q5TA 3UIFA 3HV1A 3MZ9A 3MVZA 2XXTA 3GXAA 1IMEA 1NH7A 3K1PA 5CRYA 3KGCA 3SKPA 2XD3A 1FBHA 2UVGA 2QVUA 4EQ9A 4PAIA 4ELOA 1P1NA 4AB6A 4IY6A 2P2AA 2DDKA 5EQ8A 3UGWA 2PT1A 2QMXA 3A09A 3OO8A 3TTNA 5F7VA 1ZU0A 1SYIA 4H8JA 2ZNTA 3GBBA 2QFLA 1FPBA 4LN5A 3CRBA 5I56A 1B1HA 3A3CA 2Q8JA 4OVJA 3DP4A 1IMAA 3RTWB 3TKDA 5I5PA 2PMSA 1FBFA 5CM6A 2XXKA 1Y4CA 1UTHA 2Z23A 4EUOA 4Q30B 1R6ZA 1B3GA 4R2BA 2VOZA 2V4CA 1K9YA 1QKAA 4NWDA 1JVYA 4FJPA 3OOAA 2HPGA 5I56B 4GIZA 5AA4A 1YXIA 3GBAA 3CI8A 1PBPA 4XIGQ 4X04A 3QK6A 3BIHA 2AIXA 3PU5A 4N6PA 1OVBA 4DXBA 3TAJA 1UTHB 2Q2CA 3VLUA 3VXBA 4NF8A 4YICA 1I6AA 5DVJA 4MFIA 1UIUA 1MPBA 1FRPA 1LB8A 3ONMA 4GWSA 5H8NA 5AA4B 3BFUA 2XWOA 3TUSA 1NNKA 2I6EA 3QMFA 1B5JA 2QRYA 3ODBA 3LUZA 4MBPA 1FTOA 4H1XA 3FVNA 1JEVA 1B5IA 3MP8A 3EPEA 4L17A 2B3BA 4HE2A 1QULA 2E1SA 4NF8B 1R9QA
chains in the Genus database with same CATH topology
2X7PA 4RPOA 4QSCA 3Q27A 3VLWA 4ECFA 5H8NB 4TOZA 4E0XA 1LAXA 3EN3A 3IJXB 2DOJA 1US5A 3IB1A 4F1YA 4GOTA 1H44A 3PUYE 4X48A 3RGYA 4GXAA 3G3KA 3KBRA 3K4UA 1BKAA 3LR1A 3KZGA 3EHTA 1MXUA 4KCCA 1IITA 5AA2A 1ELJA 2DE4A 1B0HA 2PX1A 3TCFA 3MVYA 3G3HA 4R2FA 1LSTA 4U1ZA 3IJOB 4H8IA 3TTKA 1I69A 4X9TA 3O6HA 4U21A 1SVXB 1SYHA 4E0WA 4R73A 4THIA 5ICQA 3MVXA 2F7CA 4IGRA 4NF6A 4DZ1A 4ZECA 5AA2B 3KSJA 3LSLA 1R1NA 4U23A 5F1QA 2ABHA 2V25A 5J1DA 5CMKA 4TQUQ 4JWXA 2PYYA 1FQFA 2RC8A 4KPTA 1B40A 4G2ZA 1PC3A 2O1MA 4YKJA 2HQ0A 3FJ7A 4NF6B 1MQDA 3H6VA 3C33A 1Q1KA 1KWHA 3M8UA 3H7MA 4MH5A 3MC2A 5CMBA 4FEDA 3MZ1A 3UP9A 4R6HA 1SBPA 1VE4A 3D4GA 4YB6A 4QFOA 1SI1A 4XKQA 1PB7A 4G8HA 1WODA 1B7ZA 1S50A 2XXVA 4LONB 3LC8A 3E3KA 4QFNA 3U93A 3T93B 4YB7A 3RT8A 4ESXA 4O3AA 2OZZA 4ISUA 5FTIA 3WAEA 3TYHA 4H5FA 2Z22A 2THIA 3TZAA 4ZZAA 1S9TA 4POXA 5ISUA 2DXYA 1EZPA 1EZOA 3T9VA 2XD2A 2XX8A 2HAUA 2Y84A 4QFLA 1MPDA 3TEPA 3RY3A 1LFHA 4RJZA 2HAVA 4LQ5A 2OWSA 3KOTA 3K6VA 1LFIA 2M8CA 4YB5A 3U8QA 2ZNUA 1MS7A 5L8DA 4BLAA 3QUFA 2A5TA 4NWCA 3VV5A 1CE2A 3MUQA 1ZTYA 1ZBMA 2Y7PA 3SESA 4KCDA 2NWJA 2RCAA 1XOCA 5BUUA 4F1UA 2A5TB 3Q25A 3PV0E 1M5EA 2XXIA 2QL3A 3A3UA 1A99A 1B6HA 3OENA 1POTA 3PPPA 1MY3A 4YU0A 4N07A 4PP0A 4OFLA 3LBSA 2NUVA 3T96B 1N3WA 2ZXTA 1FQEA 4G68A 1N3XA 2ZYNA 4U1OA 2H9BA 2Z8DA 3FXUA 4WKMA 1S7YA 3QUJA 5TPAA 3PUZE 2B3FA 2DWAA 2V93A 1P1WA 4LUBA 4IO7A 5KZTA 4PFWA 4OENA 5CC2A 2RC9A 5TU0A 3PUXE 3IB0A 5CMCA 4KD5A 1MXYA 4G68B 1A40A 3IOTA 3KFMA 4GQOA 2FA7A 3JZJA 3IB2A 3FV2A 5TPAB 1B7UA 4YZZA 1UIVA 4FAJA 1B46A 3D4CA 3LSXA 1NNPA 4FIMA 3KOSA 4R9GA 3IK6B 5FHOA 1QJMA 2VD2A 5CBRA 1B5HA 1MM6A 2E0SA 2I0BA 2I48A 1CB6A 1WDNA 4LZ8A 1SW1A 3VVEA 4F3SA 2QSXA 3TTMA 4RK2A 4PETA 3DP6A 2IEEA 3PPRA 4F22A 5DYHA 4F19A 4OESA 3SEYA 2UXAA 3K1MA 3HHGA 1IZ1A 1YAEA 2O1LA 4HW8A 3U92A 3BKIB 2IA4A 3RPWA 2AL5A 3E9XA 4X1BA 2H5YA 1FTKA 2UVHA 2I3WA 3PMWA 3H6TA 4H65A 1LCTA 1B32A 3HN0A 5FHNA 2NOOA 3CFXA 3R7XA 1II5A 2XX9A 5K2XA 5L9SA 2RKMA 1DSNA 5KDTA 4AQ4A 3S9NC 4NE4A 2DE3A 3RTFB 1FQAA 4ZDMA 2DWJA 1XVYA 1O63A 4JSDA 1MQHA 2DE2A 3TQWA 4M1VA 4OEUA 5B70A 4DXCA 4GVOA 4H5GA 2R9JA 5JEIA 5KDTB 5IKBA 2ONSA 5M2VA 1POY1 2RINA 3IOVA 5H8HA 1A8FA 2OWTA 1HSLA 1SQYA 1XHYA 3RQTA 1A54A 4IO5A 4LZ5A 4ZEDA 3UA8A 1D9YA 2H98A 4RYAA 4GL0A 4OETA 4EXKA 4F39A 1MM7A 1JW1A 5I59A 1NL5A 1D4NA 4DE8A 5H8HB 1QUIA 1IXIA 1VFEA 3FASA 4U2RA 3KN8A 3WAFA 4EF2A 3OD7A 1A8EA 3HHFA 5DVFA 5I59B 3PUWE 2QS3A 4NEDA 4Z0IA 3K0VA 3MPLA 2XXXA 4ZE9A 3JYRA 3PPQA 1FCKA 3N26A 4JSOA 1JW5A 4JWYA 2CMOA 3PD9A 3H03A 2R71A 4DDDA 4LZ7A 4KR5A 4WEPA 3IO6A 5H8QA 4OEVA 4X1DA 1B0LA 4G4PA 1MPCA 1DTGA 4N13A 2Y7IA 1GGGA 4EXLA 3MPKA 1MG1A 4NF5A 2QJEA 2Z8FA 3FVOA 3UN6A 2YLNA 3K6XA 4Q0CA 1Q35A 1MXVA 4R75A 3T9XB 1XS5A 2UVJA 5H8QB 4U4SA 2Q89A 1LGBC 1DTZA 2DWHA 1MRPA 2HFBA 2DS9A 5I2KA 3RLFE 4NF5B 3OEKA 2G29A 3O6IA 4ZEBA 5DTBA 4F3BA 1ZKBA 2ALUA 4IO2A 3OSQA 1A55A 3S2VA 2D5WA 4KYSA 4XKRA 2AL4A 5EHMA 3UK4A 3E13X 3HSTA 4ELQA 5I2KB 1FTLA 3OMBA 2DWIA 5K2YA 2UYEA 1EZ9A 3SEVA 1XT8A 2REGA 3VE1B 1FQBA 1SW2A 3M3LA 3LSFB 2VGQA 1Y4TA 2VP1A 2ZNSA 1IUDA 2GH9A 3MP1A 3CVGA 2RC7A 2XXYA 3ILTB 2ANJA 1SW4A 3KN3A 1T0KA 4Q8RA 2F34A 3V83A 4G77A 4ZE8A 5AA1A 4IO3A 2DVZA 4H0WA 3Q29A 5HBCA 2XXHA 1BTJA 1B3FA 1P99A 1H3DA 2O7UA 3MZBA 4MLVA 4OYVA 1B51A 3FXQA 5I2NA 2O69A 2Q2AA 1JVXA 4RPNA 3FIRA 2UYFA 3TCGA 4ESWA 5DT6A 1OIBA 3TTLA 3FVKA 4KYEA 3KG2A 4PE5B 3EQ1A 4I62A 4JDFA 4NF4A 4JXIA 3TMGA 4FORA 3VVDA 3FXRA 1J1NA 5I2NB 4ZEIA 5TP9A 3MWBA 1QW0A 1Y1MA 1MY1A 3IAZA 1B9JA 4OERA 5CMMA 4I8CA 3TODA 4U4XA 3DM0A 5JTYA 4LVQA 4NF4B 1QUKA 1AOVA 3QAXA 4LP2B 5HM4B 3VLVA 2QPQA 5TP9B 2PT2A 2HXWA 4OHNA 2V3QA 4R6KA 1DPPA 2XXQA 4UA8A 2VD3A 1Y3NA 5JTYB 2F35A 1ZJLA 4DLDA 1B3EA 3B6QA 1SW5A 1DMBA 3L6GA 1RYOA 1EU8A 1B7HA 2Y7KA 5FHMA 5BWJA 3ZKKA 4C1UA 1GR2A 5DVIA 3FUZA 1LAHE 1ZMGA 5I84A 1FQCA 2GHBA 4KI0E 3FZVA 2KLFA 1SDXA 3HPIA 4QRZA 1VFDA 4H6DA 1XC1A 2FYIA 3OO6A 3P7IA 1ZLQA 3EHUA 1ZIUA 3M3FA 4OTEA 2BJJX 1N7XA 3G3FA 3FVGA 3DLNA 3KJTA 1AL3A 3K02A 2PBWA 2A5SA 2V3UA 4WXJA 1QKBA 4LQ2A 1M5CA 3ZS6A 4C1TA 3C31A 3LUYA 4OWDA 2CZLA 5H8FA 2I3VA 2F6PA 2F5XA 2F7AA 3N6UA 4FE8A 3T9HB 4HCYA 2D3IA 4KYDA 4ZS9A 1P1UA 2DP8A 4M4GA 2OK2A 2XXUA 3C32A 3QXMA 1LAGE 2DQVA 4IB2A 4G8NA 5H8FB 4OZ9A 5KCJA 4YKIA 4DIGA 3VDFA 3BBRA 4KFQA 1YTVA 2V84A 1ANFA 3IOUA 1JQFA 3S4UA 1H45A 1B2HA 2Q9TA 3T9UA 1QUJA 2F7BA 2P0SA 2Q88A 3MBPA 1Y3QA 5KCJB 4XKPA 1ATGA 3THIA 1B3HA 4NTLA 3S9LC 1QVSA 3HO7A 4ZEFA 1MXWA 4FATA 1FTJA 2W7YA 1WVJA 1XVXA 3C9HA 2RCBA 3TCHA 4RK9A 2DSFA 2O6AA 4RA1A 1URSA 1MDP1 5LOMA 5ICTA 4DCXA 3N94A 1URGA 5ELVA 3O97A 2ZYMA 4R72A 1GV8A 1LB9A 2VHAA 4GRKA 3TQLA 1RYXA 3U72A 4OFOA 4R9FA 4EQBA 1JW4A 4DXUA 4PFTA 3SETA 3IORA 2Y7WA 3DP8A 4BDLA 2X7QA 1Z7NE 4RNSA 4H67A 2F78A 1VR5A 1FTMA 2DXRA 3ECRA 3MJNA 5IAIA 2DVCA 3K6UA 2XX7A 1MY2A 1SI0A 3O6GA 4U22A 2G93A 3IO4A 2F6GA 3OO7A 4MF3A 1MDQA 1TFAA 1MXZA 5CBSA 5A5XA 1JETA 1MH4A 3N5LA 1FW0A 4OXVA 3RUMA 1IXGA 3E4RA 4ND9A 3QIMA 1UQWA 3SEUA 3O66A 3CSBA 4O3CA 1H76A 3K00A 5AE4A 1N76A 3MQ9A 4R74A 3CR9A 2GHAA 3N6TA 4OQOA 4F3GA 1B05A 5A5XB 3G7WA 5EYFA 3S9EA 4P11A 1NKXA 3CSGA 1Y1ZA 4G68C 4QSEA 3UORA 1MY4A 1B52A 3C4MA 1US4A 1URDA 2I0CA 2H99A 5I57A 2HZKA 4F2OA 3C36A 4RY1A 1R9LA 1I6BA 1I6QA 4BDOA 4WEDA 1GVCA 2HCAA 4GFRA 4ONYA 1LBCA 3FATA 3MW0A 3F11A 3B6WA 3B7DA 2UVIA 3FD3A 2QS1A 4QFPA 5ITPA 5I57B 3DELB 1IQ7A 1B4HA 1USYE 4QF9A 4OMBA 4QSDA 3PD8A 2ONKE 2B65A 3R6UA 2O51A 5ITOA 3TTRA 2R6GE 4POWA 3GLBA 1LBBA 4PFYA 1MQIA 3I6VA 4G8MA 2GRVA 4FECA 3O9PA 4IY5A 1HSJA 4JB7A 3K01A 4GF8A 3H3GA 2DYXA 4KQPA 1IXCA 4IO6A 2NVUB 1BIYA 4MLQA 3RN8A 2O84X 1GTKA 2X26A 3K6WA 4BDMA 2OJTA 4AB5A 4IGTA 3PUVE 3FJGA 2ZMBA 1BLFA 5B7DA 4DCYA 1AIVA 1JEUA 1UTBA 3SEWA 4I1DA 1PEBA 2XXWA 3W15C 3EF7A 4RXLA 1F9BA 1D9VA 3V8XB 3USDA 2H25A 1P1OA 2WKYA 2XXRA 3H6WA 2OBGA 2OLBA 4LA9A 3ZSFA 3KSXA 2AYSA 1UTBB 4XKNA 1Y9UA 4YKPA 1TWYA 1LAFE 3Q26A 4I9DA 3U94A 3GZGA 4QHQA 1FQDA 4XTCQ 3TDJA 3S9MC 3V5AA 1DPEA 1LCFA 2QS2A 2RF1A 2HEUA 2ZYOA 2H4IA 2XHDA 1OQGA 3FV1A 3O28A 3ILUB 4GWOA 1IXHA 3W9VA 3AXFA 3MP6A 2ONRA 1USYH 1PBQA 3KN7A 2XXPA 3OEMA 3Q28A 2QMWA 3MVWA 2I4BA 3SERA 1MY0A 3PMVA 1BP5A 3QSLA 1SD3A 2QS4A 2F36A 4F3PA 3VFJA 4BDNA 3IL1B 3T66A 1AH5A 5H8SA 1IEJA 4HS7A 4YKKA 1TXFA 3MAMA 4ZZEA 1YPNA 1H43A 1M5DA 1B3LA 4FEBA 1EH3A 3EHSA 4HCWA 3OO9A 3H06B 3HCQA 1P1QA 1A7LA 1HSEA 2I4CA 1L5TA 2REJA 3ZKLA 1M5FA 1OLAA 3H6UA 1Z7ME 2YJPA 1JNFA 3RT6B 4ELRA 4P0GA 3LSWA 3TELA 3FGSA 5AA3A 4TLLB 5HPQA 3PGFA 4Z7EA 4F18A 4F2QA 4PQJA 5L9MA 3CIJA 1OVTA 1PDAA 2P1SA 1N7WA 3C34A 4QFKA 2I58A 4GLIA 5EHSA 3O2AA 1OMPA 1B4ZA 4BDRA 1NFTA 2V3TA 4ZEKA 3U1OA 4IO4A 3KEIA 3L6HA 1O7TA 2I49A 2F97A 3I3VA 5DEXA 1D3KA 3O29A 3QYTA 3OELA 1N04A 4PFUA 2Z8EA 1OQHA 1LLSA 4EDPA 2D21A 4EF1A 1M5BA 4P0IA 1NMUA 4O3BA 3I5OA 1MH3A 3TFLA 1MXXA 1TFDA 1O64A 3IX1A 4GL8A 2YPNA 1N84A 1LFGA 3SDFA 1MQGA 1OLCA 4NMYA 3G3IA 3K2DA 5DEXB 3G3JA 1NNTA 3W9WA 2FNCA 1DOTA 5JK4A 3OSRA 2O7IA 2PVUA 3VXCA 3JV9A 3KJ7A 5I58A 3TPAA 2NXOA 5FTHA 4R6YA 3H4ZA 3R26A 4JWOA 4HTGA 1VSOA 4OFJA 3C35A 1NH8A 4F31B 3V89B 3SEXA 4F1VA 3CFLA 2O68A 4GD5A 3RNNA 1Y20A 1MQJA 5I58B 4BDQA 1TT1A 4KHZE 1PB9A 1YCJA 5AA2D 3G3GA 1IIWA 4LATA 4C0RA 4UACA 3BFTA 3T22A 4GXSB 3IOWA 1NNFA 3IR1A 2LAOA 4XXUA 1PB8A 5CI5A 3VVFA 2HZLA 4F29A 3CFZA 3CG3A 3OXNA 3PPNA 2OCUA 3B6TA 4YMBA 4ELPA 3FJMA 1AMFA 4YMAA 1B1XA 3PMXA 1Y3PA 3M3KA 4TLMB 2Y7RA 3PPOA 4YAHX 1B58A 2ESNA 1RKMA 2ZYKA 3CG1A 3K1NA 2F8DA 4EQ7A 5L9OA 4K3FA 2GFEA 4JBZA 1N0TA 4Q5TA 3UIFA 3HV1A 3MZ9A 3MVZA 2XXTA 3GXAA 1NH7A 3K1PA 5CRYA 3KGCA 3SKPA 2XD3A 2UVGA 4EQ9A 4ELOA 1P1NA 4AB6A 4IY6A 2P2AA 3UGWA 2PT1A 2QMXA 3A09A 3OO8A 3TTNA 5F7VA 1ZU0A 1SYIA 4H8JA 2ZNTA 3GBBA 3CRBA 5I56A 1B1HA 3A3CA 2Q8JA 4OVJA 3DP4A 3RTWB 3TKDA 2PMSA 5CM6A 1Y4CA 1UTHA 2Z23A 4EUOA 4Q30B 1R6ZA 1B3GA 4R2BA 2VOZA 1QKAA 4NWDA 1JVYA 4FJPA 3OOAA 5I56B 4GIZA 5AA4A 3GBAA 3CI8A 1PBPA 4XIGQ 3QK6A 2AIXA 3PU5A 4N6PA 1OVBA 4DXBA 3TAJA 1UTHB 2Q2CA 3VLUA 3VXBA 4NF8A 4YICA 1I6AA 5DVJA 4MFIA 1UIUA 1MPBA 1LB8A 3ONMA 5H8NA 5AA4B 3BFUA 3TUSA 1NNKA 2I6EA 1B5JA 2QRYA 3ODBA 4MBPA 1FTOA 4H1XA 3FVNA 1JEVA 1B5IA 3MP8A 3EPEA 4L17A 2B3BA 1QULA 2E1SA 4NF8B 1R9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7P A;  4RPO A;  4QSC A;  3Q27 A;  3VLW A;  4ECF A;  5H8N B;  4TOZ A;  4E0X A;  1LAX A;  3EN3 A;  3IJX B;  2DOJ A;  1US5 A;  3IB1 A;  4F1Y A;  4GOT A;  1H44 A;  3PUY E;  4X48 A;  3RGY A;  4GXA A;  3G3K A;  3KBR A;  3K4U A;  1BKA A;  3LR1 A;  3KZG A;  3EHT A;  1MXU A;  4KCC A;  1IIT A;  5AA2 A;  1ELJ A;  2DE4 A;  1B0H A;  2PX1 A;  3TCF A;  3MVY A;  3G3H A;  4R2F A;  1LST A;  4U1Z A;  3IJO B;  4H8I A;  3TTK A;  1I69 A;  4X9T A;  3O6H A;  4U21 A;  1SVX B;  1SYH A;  4E0W A;  4R73 A;  4THI A;  5ICQ A;  3MVX A;  2F7C A;  4IGR A;  4NF6 A;  4DZ1 A;  4ZEC A;  5AA2 B;  3KSJ A;  3LSL A;  1R1N A;  4U23 A;  5F1Q A;  2ABH A;  2V25 A;  5J1D A;  5CMK A;  4TQU Q;  4JWX A;  2PYY A;  1FQF A;  2RC8 A;  4KPT A;  1B40 A;  4G2Z A;  1PC3 A;  2O1M A;  4YKJ A;  2HQ0 A;  3FJ7 A;  4NF6 B;  1MQD A;  3H6V A;  3C33 A;  1Q1K A;  1KWH A;  3M8U A;  3H7M A;  4MH5 A;  3MC2 A;  5CMB A;  4FED A;  3MZ1 A;  3UP9 A;  4R6H A;  1SBP A;  1VE4 A;  3D4G A;  4YB6 A;  4QFO A;  1SI1 A;  4XKQ A;  1PB7 A;  4G8H A;  1WOD A;  1B7Z A;  1S50 A;  2XXV A;  4LON B;  3LC8 A;  3E3K A;  4QFN A;  3U93 A;  3T93 B;  4YB7 A;  3RT8 A;  4ESX A;  4O3A A;  2OZZ A;  4ISU A;  5FTI A;  3WAE A;  3TYH A;  4H5F A;  2Z22 A;  2THI A;  3TZA A;  4ZZA A;  1S9T A;  4POX A;  5ISU A;  2DXY A;  1EZP A;  1EZO A;  3T9V A;  2XD2 A;  2XX8 A;  2HAU A;  2Y84 A;  4QFL A;  1MPD A;  3TEP A;  3RY3 A;  1LFH A;  4RJZ A;  2HAV A;  4LQ5 A;  2OWS A;  3KOT A;  3K6V A;  1LFI A;  2M8C A;  4YB5 A;  3U8Q A;  2ZNU A;  1MS7 A;  5L8D A;  4BLA A;  3QUF A;  2A5T A;  4NWC A;  3VV5 A;  1CE2 A;  3MUQ A;  1ZTY A;  1ZBM A;  2Y7P A;  3SES A;  4KCD A;  2NWJ A;  2RCA A;  1XOC A;  5BUU A;  4F1U A;  2A5T B;  3Q25 A;  3PV0 E;  1M5E A;  2XXI A;  2QL3 A;  3A3U A;  1A99 A;  1B6H A;  3OEN A;  1POT A;  3PPP A;  1MY3 A;  4YU0 A;  4N07 A;  4PP0 A;  4OFL A;  3LBS A;  2NUV A;  3T96 B;  1N3W A;  2ZXT A;  1FQE A;  4G68 A;  1N3X A;  2ZYN A;  4U1O A;  2H9B A;  2Z8D A;  3FXU A;  4WKM A;  1S7Y A;  3QUJ A;  5TPA A;  3PUZ E;  2B3F A;  2DWA A;  2V93 A;  1P1W A;  4LUB A;  4IO7 A;  5KZT A;  4PFW A;  4OEN A;  5CC2 A;  2RC9 A;  5TU0 A;  3PUX E;  3IB0 A;  5CMC A;  4KD5 A;  1MXY A;  4G68 B;  1A40 A;  3IOT A;  3KFM A;  4GQO A;  2FA7 A;  3JZJ A;  3IB2 A;  3FV2 A;  5TPA B;  1B7U A;  4YZZ A;  1UIV A;  4FAJ A;  1B46 A;  3D4C A;  3LSX A;  1NNP A;  4FIM A;  3KOS A;  4R9G A;  3IK6 B;  5FHO A;  1QJM A;  2VD2 A;  5CBR A;  1B5H A;  1MM6 A;  2E0S A;  2I0B A;  2I48 A;  1CB6 A;  1WDN A;  4LZ8 A;  1SW1 A;  3VVE A;  4F3S A;  2QSX A;  3TTM A;  4RK2 A;  4PET A;  3DP6 A;  2IEE A;  3PPR A;  4F22 A;  5DYH A;  4F19 A;  4OES A;  3SEY A;  2UXA A;  3K1M A;  3HHG A;  1IZ1 A;  1YAE A;  2O1L A;  4HW8 A;  3U92 A;  3BKI B;  2IA4 A;  3RPW A;  2AL5 A;  3E9X A;  4X1B A;  2H5Y A;  1FTK A;  2UVH A;  2I3W A;  3PMW A;  3H6T A;  4H65 A;  1LCT A;  1B32 A;  3HN0 A;  5FHN A;  2NOO A;  3CFX A;  3R7X A;  1II5 A;  2XX9 A;  5K2X A;  5L9S A;  2RKM A;  1DSN A;  5KDT A;  4AQ4 A;  3S9N C;  4NE4 A;  2DE3 A;  3RTF B;  1FQA A;  4ZDM A;  2DWJ A;  1XVY A;  1O63 A;  4JSD A;  1MQH A;  2DE2 A;  3TQW A;  4M1V A;  4OEU A;  5B70 A;  4DXC A;  4GVO A;  4H5G A;  2R9J A;  5JEI A;  5KDT B;  5IKB A;  2ONS A;  5M2V A;  1POY 1;  2RIN A;  3IOV A;  5H8H A;  1A8F A;  2OWT A;  1HSL A;  1SQY A;  1XHY A;  3RQT A;  1A54 A;  4IO5 A;  4LZ5 A;  4ZED A;  3UA8 A;  1D9Y A;  2H98 A;  4RYA A;  4GL0 A;  4OET A;  4EXK A;  4F39 A;  1MM7 A;  1JW1 A;  5I59 A;  1NL5 A;  1D4N A;  4DE8 A;  5H8H B;  1QUI A;  1IXI A;  1VFE A;  3FAS A;  4U2R A;  3KN8 A;  3WAF A;  4EF2 A;  3OD7 A;  1A8E A;  3HHF A;  5DVF A;  5I59 B;  3PUW E;  2QS3 A;  4NED A;  4Z0I A;  3K0V A;  3MPL A;  2XXX A;  4ZE9 A;  3JYR A;  3PPQ A;  1FCK A;  3N26 A;  4JSO A;  1JW5 A;  4JWY A;  2CMO A;  3PD9 A;  3H03 A;  2R71 A;  4DDD A;  4LZ7 A;  4KR5 A;  4WEP A;  3IO6 A;  5H8Q A;  4OEV A;  4X1D A;  1B0L A;  4G4P A;  1MPC A;  1DTG A;  4N13 A;  2Y7I A;  1GGG A;  4EXL A;  3MPK A;  1MG1 A;  4NF5 A;  2QJE A;  2Z8F A;  3FVO A;  3UN6 A;  2YLN A;  3K6X A;  4Q0C A;  1Q35 A;  1MXV A;  4R75 A;  3T9X B;  1XS5 A;  2UVJ A;  5H8Q B;  4U4S A;  2Q89 A;  1LGB C;  1DTZ A;  2DWH A;  1MRP A;  2HFB A;  2DS9 A;  5I2K A;  3RLF E;  4NF5 B;  3OEK A;  2G29 A;  3O6I A;  4ZEB A;  5DTB A;  4F3B A;  1ZKB A;  2ALU A;  4IO2 A;  3OSQ A;  1A55 A;  3S2V A;  2D5W A;  4KYS A;  4XKR A;  2AL4 A;  5EHM A;  3UK4 A;  3E13 X;  3HST A;  4ELQ A;  5I2K B;  1FTL A;  3OMB A;  2DWI A;  5K2Y A;  2UYE A;  1EZ9 A;  3SEV A;  1XT8 A;  2REG A;  3VE1 B;  1FQB A;  1SW2 A;  3M3L A;  3LSF B;  2VGQ A;  1Y4T A;  2VP1 A;  2ZNS A;  1IUD A;  2GH9 A;  3MP1 A;  3CVG A;  2RC7 A;  2XXY A;  3ILT B;  2ANJ A;  1SW4 A;  3KN3 A;  1T0K A;  4Q8R A;  2F34 A;  3V83 A;  4G77 A;  4ZE8 A;  5AA1 A;  4IO3 A;  2DVZ A;  4H0W A;  3Q29 A;  5HBC A;  2XXH A;  1BTJ A;  1B3F A;  1P99 A;  1H3D A;  2O7U A;  3MZB A;  4MLV A;  4OYV A;  1B51 A;  3FXQ A;  5I2N A;  2O69 A;  2Q2A A;  1JVX A;  4RPN A;  3FIR A;  2UYF A;  3TCG A;  4ESW A;  5DT6 A;  1OIB A;  3TTL A;  3FVK A;  4KYE A;  3KG2 A;  4PE5 B;  3EQ1 A;  4I62 A;  4JDF A;  4NF4 A;  4JXI A;  3TMG A;  4FOR A;  3VVD A;  3FXR A;  1J1N A;  5I2N B;  4ZEI A;  5TP9 A;  3MWB A;  1QW0 A;  1Y1M A;  1MY1 A;  3IAZ A;  1B9J A;  4OER A;  5CMM A;  4I8C A;  3TOD A;  4U4X A;  3DM0 A;  5JTY A;  4LVQ A;  4NF4 B;  1QUK A;  1AOV A;  3QAX A;  4LP2 B;  5HM4 B;  3VLV A;  2QPQ A;  5TP9 B;  2PT2 A;  2HXW A;  4OHN A;  2V3Q A;  4R6K A;  1DPP A;  2XXQ A;  4UA8 A;  2VD3 A;  1Y3N A;  5JTY B;  2F35 A;  1ZJL A;  4DLD A;  1B3E A;  3B6Q A;  1SW5 A;  1DMB A;  3L6G A;  1RYO A;  1EU8 A;  1B7H A;  2Y7K A;  5FHM A;  5BWJ A;  3ZKK A;  4C1U A;  1GR2 A;  5DVI A;  3FUZ A;  1LAH E;  1ZMG A;  5I84 A;  1FQC A;  2GHB A;  4KI0 E;  3FZV A;  2KLF A;  1SDX A;  3HPI A;  4QRZ A;  1VFD A;  4H6D A;  1XC1 A;  2FYI A;  3OO6 A;  3P7I A;  1ZLQ A;  3EHU A;  1ZIU A;  3M3F A;  4OTE A;  2BJJ X;  1N7X A;  3G3F A;  3FVG A;  3DLN A;  3KJT A;  1AL3 A;  3K02 A;  2PBW A;  2A5S A;  2V3U A;  4WXJ A;  1QKB A;  4LQ2 A;  1M5C A;  3ZS6 A;  4C1T A;  3C31 A;  3LUY A;  4OWD A;  2CZL A;  5H8F A;  2I3V A;  2F6P A;  2F5X A;  2F7A A;  3N6U A;  4FE8 A;  3T9H B;  4HCY A;  2D3I A;  4KYD A;  4ZS9 A;  1P1U A;  2DP8 A;  4M4G A;  2OK2 A;  2XXU A;  3C32 A;  3QXM A;  1LAG E;  2DQV A;  4IB2 A;  4G8N A;  5H8F B;  4OZ9 A;  5KCJ A;  4YKI A;  4DIG A;  3VDF A;  3BBR A;  4KFQ A;  1YTV A;  2V84 A;  1ANF A;  3IOU A;  1JQF A;  3S4U A;  1H45 A;  1B2H A;  2Q9T A;  3T9U A;  1QUJ A;  2F7B A;  2P0S A;  2Q88 A;  3MBP A;  1Y3Q A;  5KCJ B;  4XKP A;  1ATG A;  3THI A;  1B3H A;  4NTL A;  3S9L C;  1QVS A;  3HO7 A;  4ZEF A;  1MXW A;  4FAT A;  1FTJ A;  2W7Y A;  1WVJ A;  1XVX A;  3C9H A;  2RCB A;  3TCH A;  4RK9 A;  2DSF A;  2O6A A;  4RA1 A;  1URS A;  1MDP 1;  5LOM A;  5ICT A;  4DCX A;  3N94 A;  1URG A;  5ELV A;  3O97 A;  2ZYM A;  4R72 A;  1GV8 A;  1LB9 A;  2VHA A;  4GRK A;  3TQL A;  1RYX A;  3U72 A;  4OFO A;  4R9F A;  4EQB A;  1JW4 A;  4DXU A;  4PFT A;  3SET A;  3IOR A;  2Y7W A;  3DP8 A;  4BDL A;  2X7Q A;  1Z7N E;  4RNS A;  4H67 A;  2F78 A;  1VR5 A;  1FTM A;  2DXR A;  3ECR A;  3MJN A;  5IAI A;  2DVC A;  3K6U A;  2XX7 A;  1MY2 A;  1SI0 A;  3O6G A;  4U22 A;  2G93 A;  3IO4 A;  2F6G A;  3OO7 A;  4MF3 A;  1MDQ A;  1TFA A;  1MXZ A;  5CBS A;  5A5X A;  1JET A;  1MH4 A;  3N5L A;  1FW0 A;  4OXV A;  3RUM A;  1IXG A;  3E4R A;  4ND9 A;  3QIM A;  1UQW A;  3SEU A;  3O66 A;  3CSB A;  4O3C A;  1H76 A;  3K00 A;  5AE4 A;  1N76 A;  3MQ9 A;  4R74 A;  3CR9 A;  2GHA A;  3N6T A;  4OQO A;  4F3G A;  1B05 A;  5A5X B;  3G7W A;  5EYF A;  3S9E A;  4P11 A;  1NKX A;  3CSG A;  1Y1Z A;  4G68 C;  4QSE A;  3UOR A;  1MY4 A;  1B52 A;  3C4M A;  1US4 A;  1URD A;  2I0C A;  2H99 A;  5I57 A;  2HZK A;  4F2O A;  3C36 A;  4RY1 A;  1R9L A;  1I6B A;  1I6Q A;  4BDO A;  4WED A;  1GVC A;  2HCA A;  4GFR A;  4ONY A;  1LBC A;  3FAT A;  3MW0 A;  3F11 A;  3B6W A;  3B7D A;  2UVI A;  3FD3 A;  2QS1 A;  4QFP A;  5ITP A;  5I57 B;  3DEL B;  1IQ7 A;  1B4H A;  1USY E;  4QF9 A;  4OMB A;  4QSD A;  3PD8 A;  2ONK E;  2B65 A;  3R6U A;  2O51 A;  5ITO A;  3TTR A;  2R6G E;  4POW A;  3GLB A;  1LBB A;  4PFY A;  1MQI A;  3I6V A;  4G8M A;  2GRV A;  4FEC A;  3O9P A;  4IY5 A;  1HSJ A;  4JB7 A;  3K01 A;  4GF8 A;  3H3G A;  2DYX A;  4KQP A;  1IXC A;  4IO6 A;  2NVU B;  1BIY A;  4MLQ A;  3RN8 A;  2O84 X;  1GTK A;  2X26 A;  3K6W A;  4BDM A;  2OJT A;  4AB5 A;  4IGT A;  3PUV E;  3FJG A;  2ZMB A;  1BLF A;  5B7D A;  4DCY A;  1AIV A;  1JEU A;  1UTB A;  3SEW A;  4I1D A;  1PEB A;  2XXW A;  3W15 C;  3EF7 A;  4RXL A;  1F9B A;  1D9V A;  3V8X B;  3USD A;  2H25 A;  1P1O A;  2WKY A;  2XXR A;  3H6W A;  2OBG A;  2OLB A;  4LA9 A;  3ZSF A;  3KSX A;  2AYS A;  1UTB B;  4XKN A;  1Y9U A;  4YKP A;  1TWY A;  1LAF E;  3Q26 A;  4I9D A;  3U94 A;  3GZG A;  4QHQ A;  1FQD A;  4XTC Q;  3TDJ A;  3S9M C;  3V5A A;  1DPE A;  1LCF A;  2QS2 A;  2RF1 A;  2HEU A;  2ZYO A;  2H4I A;  2XHD A;  1OQG A;  3FV1 A;  3O28 A;  3ILU B;  4GWO A;  1IXH A;  3W9V A;  3AXF A;  3MP6 A;  2ONR A;  1USY H;  1PBQ A;  3KN7 A;  2XXP A;  3OEM A;  3Q28 A;  2QMW A;  3MVW A;  2I4B A;  3SER A;  1MY0 A;  3PMV A;  1BP5 A;  3QSL A;  1SD3 A;  2QS4 A;  2F36 A;  4F3P A;  3VFJ A;  4BDN A;  3IL1 B;  3T66 A;  1AH5 A;  5H8S A;  1IEJ A;  4HS7 A;  4YKK A;  1TXF A;  3MAM A;  4ZZE A;  1YPN A;  1H43 A;  1M5D A;  1B3L A;  4FEB A;  1EH3 A;  3EHS A;  4HCW A;  3OO9 A;  3H06 B;  3HCQ A;  1P1Q A;  1A7L A;  1HSE A;  2I4C A;  1L5T A;  2REJ A;  3ZKL A;  1M5F A;  1OLA A;  3H6U A;  1Z7M E;  2YJP A;  1JNF A;  3RT6 B;  4ELR A;  4P0G A;  3LSW A;  3TEL A;  3FGS A;  5AA3 A;  4TLL B;  5HPQ A;  3PGF A;  4Z7E A;  4F18 A;  4F2Q A;  4PQJ A;  5L9M A;  3CIJ A;  1OVT A;  1PDA A;  2P1S A;  1N7W A;  3C34 A;  4QFK A;  2I58 A;  4GLI A;  5EHS A;  3O2A A;  1OMP A;  1B4Z A;  4BDR A;  1NFT A;  2V3T A;  4ZEK A;  3U1O A;  4IO4 A;  3KEI A;  3L6H A;  1O7T A;  2I49 A;  2F97 A;  3I3V A;  5DEX A;  1D3K A;  3O29 A;  3QYT A;  3OEL A;  1N04 A;  4PFU A;  2Z8E A;  1OQH A;  1LLS A;  4EDP A;  2D21 A;  4EF1 A;  1M5B A;  4P0I A;  1NMU A;  4O3B A;  3I5O A;  1MH3 A;  3TFL A;  1MXX A;  1TFD A;  1O64 A;  3IX1 A;  4GL8 A;  2YPN A;  1N84 A;  1LFG A;  3SDF A;  1MQG A;  1OLC A;  4NMY A;  3G3I A;  3K2D A;  5DEX B;  3G3J A;  1NNT A;  3W9W A;  2FNC A;  1DOT A;  5JK4 A;  3OSR A;  2O7I A;  2PVU A;  3VXC A;  3JV9 A;  3KJ7 A;  5I58 A;  3TPA A;  2NXO A;  5FTH A;  4R6Y A;  3H4Z A;  3R26 A;  4JWO A;  4HTG A;  1VSO A;  4OFJ A;  3C35 A;  1NH8 A;  4F31 B;  3V89 B;  3SEX A;  4F1V A;  3CFL A;  2O68 A;  4GD5 A;  3RNN A;  1Y20 A;  1MQJ A;  5I58 B;  4BDQ A;  1TT1 A;  4KHZ E;  1PB9 A;  1YCJ A;  5AA2 D;  3G3G A;  1IIW A;  4LAT A;  4C0R A;  4UAC A;  3BFT A;  3T22 A;  4GXS B;  3IOW A;  1NNF A;  3IR1 A;  2LAO A;  4XXU A;  1PB8 A;  5CI5 A;  3VVF A;  2HZL A;  4F29 A;  3CFZ A;  3CG3 A;  3OXN A;  3PPN A;  2OCU A;  3B6T A;  4YMB A;  4ELP A;  3FJM A;  1AMF A;  4YMA A;  1B1X A;  3PMX A;  1Y3P A;  3M3K A;  4TLM B;  2Y7R A;  3PPO A;  4YAH X;  1B58 A;  2ESN A;  1RKM A;  2ZYK A;  3CG1 A;  3K1N A;  2F8D A;  4EQ7 A;  5L9O A;  4K3F A;  2GFE A;  4JBZ A;  1N0T A;  4Q5T A;  3UIF A;  3HV1 A;  3MZ9 A;  3MVZ A;  2XXT A;  3GXA A;  1NH7 A;  3K1P A;  5CRY A;  3KGC A;  3SKP A;  2XD3 A;  2UVG A;  4EQ9 A;  4ELO A;  1P1N A;  4AB6 A;  4IY6 A;  2P2A A;  3UGW A;  2PT1 A;  2QMX A;  3A09 A;  3OO8 A;  3TTN A;  5F7V A;  1ZU0 A;  1SYI A;  4H8J A;  2ZNT A;  3GBB A;  3CRB A;  5I56 A;  1B1H A;  3A3C A;  2Q8J A;  4OVJ A;  3DP4 A;  3RTW B;  3TKD A;  2PMS A;  5CM6 A;  1Y4C A;  1UTH A;  2Z23 A;  4EUO A;  4Q30 B;  1R6Z A;  1B3G A;  4R2B A;  2VOZ A;  1QKA A;  4NWD A;  1JVY A;  4FJP A;  3OOA A;  5I56 B;  4GIZ A;  5AA4 A;  3GBA A;  3CI8 A;  1PBP A;  4XIG Q;  3QK6 A;  2AIX A;  3PU5 A;  4N6P A;  1OVB A;  4DXB A;  3TAJ A;  1UTH B;  2Q2C A;  3VLU A;  3VXB A;  4NF8 A;  4YIC A;  1I6A A;  5DVJ A;  4MFI A;  1UIU A;  1MPB A;  1LB8 A;  3ONM A;  5H8N A;  5AA4 B;  3BFU A;  3TUS A;  1NNK A;  2I6E A;  1B5J A;  2QRY A;  3ODB A;  4MBP A;  1FTO A;  4H1X A;  3FVN A;  1JEV A;  1B5I A;  3MP8 A;  3EPE A;  4L17 A;  2B3B A;  1QUL A;  2E1S A;  4NF8 B;  1R9Q A; 
#chains in the Genus database with same CATH topology
 2X7P A;  4RPO A;  5LTC A;  4QSC A;  3Q27 A;  3VLW A;  4ECF A;  4AS5 A;  5H8N B;  4TOZ A;  4E0X A;  1LAX A;  4MNI A;  3EN3 A;  3IJX B;  2DOJ A;  1US5 A;  2ZZV A;  3IB1 A;  4F1Y A;  1D9Q A;  4NF0 A;  4GOT A;  1H44 A;  3PUY E;  4X48 A;  3RGY A;  4P3L A;  4UAB A;  4GXA A;  2JJK A;  3G3K A;  3KBR A;  3K4U A;  1BKA A;  3LR1 A;  3KZG A;  3EHT A;  1MXU A;  1JP4 A;  4KCC A;  1IIT A;  5AA2 A;  1ELJ A;  4H46 A;  4PAK A;  2DE4 A;  1B0H A;  2PX1 A;  3ROJ A;  3TCF A;  3MVY A;  3G3H A;  4R2F A;  1LST A;  4U1Z A;  3IJO B;  4H8I A;  3TTK A;  1I69 A;  3BIG A;  4X9T A;  3O6H A;  4U21 A;  1SVX B;  1SYH A;  4E0W A;  1NV7 A;  4P1E A;  4R73 A;  4THI A;  5ICQ A;  3MVX A;  2F7C A;  4IGR A;  4NF6 A;  4DZ1 A;  4ZEC A;  5AA2 B;  3KSJ A;  3LSL A;  4N81 A;  1R1N A;  4U23 A;  5F1Q A;  2ABH A;  2V25 A;  5J1D A;  5CMK A;  3E78 A;  4TQU Q;  4JWX A;  2PYY A;  1FQF A;  2RC8 A;  4GWU A;  4KPT A;  1B40 A;  4G2Z A;  4PBH A;  1PC3 A;  2O1M A;  4YKJ A;  2HQ0 A;  4DI4 B;  1LBZ A;  3FJ7 A;  4NF6 B;  1MQD A;  3H6V A;  3C33 A;  1Q1K A;  1KWH A;  3M8U A;  3H7M A;  4MH5 A;  3MC2 A;  5CMB A;  4FED A;  3MZ1 A;  5DW8 A;  2Q74 A;  1CNQ A;  3UP9 A;  4R6H A;  4PFB A;  1SBP A;  1VE4 A;  3D4G A;  4YB6 A;  4QFO A;  1SI1 A;  4XKQ A;  1PB7 A;  1IMB A;  4G8H A;  1WOD A;  1B7Z A;  1S50 A;  2XXV A;  4LON B;  4OVS A;  3LC8 A;  3E3K A;  4QFN A;  3U93 A;  3T93 B;  4YB7 A;  3RT8 A;  4ESX A;  4O3A A;  4OVQ A;  2OZZ A;  4ISU A;  2Y5L A;  5FTI A;  3WAE A;  3TYH A;  4H5F A;  2Z22 A;  2THI A;  3TZA A;  4ZZA A;  1S9T A;  4POX A;  5ISU A;  2DXY A;  1EZP A;  1EZO A;  3T9V A;  2XD2 A;  2XX8 A;  4PC9 A;  2HAU A;  2Y84 A;  1YZ0 A;  4QFL A;  1MPD A;  3E79 A;  3TEP A;  3RY3 A;  1LFH A;  4RJZ A;  2HAV A;  4LQ5 A;  4XF5 A;  2OWS A;  1LBV A;  3KOT A;  3K6V A;  1LFI A;  2M8C A;  4YB5 A;  3U8Q A;  2ZNU A;  1MS7 A;  5L8D A;  4BLA A;  3QUF A;  2A5T A;  4NWC A;  3VV5 A;  1BK4 A;  1CE2 A;  3MUQ A;  1NUX A;  1ZTY A;  1ZBM A;  2Y7P A;  3SES A;  1KZ8 A;  4KCD A;  2NWJ A;  4MHF A;  4NGU A;  2WBB A;  2RCA A;  1XOC A;  5BUU A;  4MIJ A;  4F1U A;  2A5T B;  3Q25 A;  3PV0 E;  1M5E A;  4MCO A;  2XXI A;  4OA4 A;  2QL3 A;  3A3U A;  1A99 A;  2CZI A;  1B6H A;  3OEN A;  1POT A;  3PPP A;  1MY3 A;  4YU0 A;  4N07 A;  4PP0 A;  4OFL A;  3LBS A;  2NUV A;  3T96 B;  1N3W A;  2ZXT A;  1FQE A;  4G68 A;  1N3X A;  2ZYN A;  5I7I A;  1Q9D A;  4U1O A;  2H9B A;  2Z8D A;  3FXU A;  3U65 A;  4WKM A;  1S7Y A;  5EQA A;  3QUJ A;  5TPA A;  3PUZ E;  2B3F A;  2DWA A;  2V93 A;  2XWV A;  1P1W A;  4LUB A;  4IO7 A;  5KZT A;  4PFW A;  4OEN A;  5CC2 A;  2P3V A;  2RC9 A;  5TU0 A;  3PUX E;  3IB0 A;  5CMC A;  4KD5 A;  1MXY A;  4G68 B;  1A40 A;  3IOT A;  3KFM A;  2VT5 A;  4GQO A;  2FA7 A;  3JZJ A;  3IB2 A;  3FV2 A;  5TPA B;  1B7U A;  1NUW A;  4YZZ A;  1UIV A;  4FAJ A;  1B46 A;  3D4C A;  3LSX A;  1NNP A;  4FIM A;  3KOS A;  4AS4 A;  4R9G A;  3IK6 B;  2WX9 A;  5FHO A;  1QJM A;  2Q8M A;  2KR0 A;  2VD2 A;  5CBR A;  1B5H A;  4I3E A;  1MM6 A;  2E0S A;  2I0B A;  2I48 A;  1CB6 A;  1WDN A;  4PF6 A;  4LZ8 A;  1SW1 A;  3VVE A;  4F3S A;  2QSX A;  2R8T A;  3TTM A;  4RK2 A;  4PET A;  3DP6 A;  2IEE A;  3PPR A;  4F22 A;  5DYH A;  4F19 A;  4OES A;  3SEY A;  2UXA A;  3K1M A;  3HHG A;  1IZ1 A;  1YAE A;  2O1L A;  4O7I A;  4HW8 A;  2OWZ A;  3U92 A;  3BKI B;  2IA4 A;  3RPW A;  2AL5 A;  3E9X A;  4X1B A;  4GWW A;  1AWB A;  2H5Y A;  1FPJ A;  1FTK A;  2UVH A;  2I3W A;  1LBY A;  2PFZ A;  3PMW A;  2CEX A;  1FPI A;  5EYG A;  3H6T A;  4H65 A;  1FJ9 A;  1DK4 A;  1LCT A;  1IMC A;  1B32 A;  3HN0 A;  5FHN A;  2NOO A;  1XI6 A;  3CFX A;  4OAN A;  3R7X A;  1II5 A;  4N6K A;  2XX9 A;  5K2X A;  4PDH A;  5L9S A;  2RKM A;  1DSN A;  5KDT A;  4AQ4 A;  3S9N C;  4NE4 A;  2DE3 A;  3RTF B;  1FQA A;  4ZDM A;  1FTA A;  2DWJ A;  1XVY A;  4NAP A;  1O63 A;  4JSD A;  4XFE A;  1MQH A;  2DE2 A;  3TQW A;  4M1V A;  4OEU A;  5B70 A;  4DXC A;  4JVC A;  4GVO A;  4H5G A;  2R9J A;  5JEI A;  5KDT B;  5IKB A;  2ONS A;  5M2V A;  1POY 1;  4MMP A;  2RIN A;  3IOV A;  5H8H A;  1A8F A;  2OWT A;  1HSL A;  1LEV A;  1SQY A;  1XHY A;  3RQT A;  1A54 A;  4IO5 A;  4LZ5 A;  3CHG A;  4ZED A;  3UA8 A;  1D9Y A;  2H98 A;  4RYA A;  4GL0 A;  4OET A;  4EXK A;  4MAG A;  4F39 A;  1MM7 A;  2WBD A;  1JW1 A;  2FBP A;  5I59 A;  1NL5 A;  2XWI A;  1DCU A;  1D4N A;  4DE8 A;  5H8H B;  1QUI A;  1IXI A;  1VFE A;  3FAS A;  1FSA A;  4U2R A;  3KN8 A;  3WAF A;  4EF2 A;  3OD7 A;  1NV4 A;  1A8E A;  3HHF A;  4GX6 A;  5DVF A;  5I59 B;  3PUW E;  2QS3 A;  4NED A;  4Z0I A;  3K0V A;  4GX3 A;  4HXV A;  3MPL A;  2XXX A;  4ZE9 A;  3JYR A;  3PPQ A;  1FCK A;  4P47 A;  3FBP A;  3N26 A;  4JSO A;  1JW5 A;  4JWY A;  5ET8 A;  2CMO A;  3PD9 A;  4FBP A;  3IFC A;  3H03 A;  2R71 A;  4DDD A;  4LZ7 A;  1DBZ A;  4KR5 A;  4WEP A;  3IO6 A;  5H8Q A;  4OEV A;  4X1D A;  3KC1 A;  1B0L A;  4G4P A;  1MPC A;  1DTG A;  4N13 A;  2Y7I A;  1GGG A;  4EXL A;  3MPK A;  3HFU A;  1MG1 A;  4NF5 A;  4PF8 A;  1FPD A;  1FPK A;  2QJE A;  2Z8F A;  3FVO A;  3UN6 A;  2L5V A;  2YLN A;  3K6X A;  1NV1 A;  4Q0C A;  1Q35 A;  2WEF A;  1MXV A;  4R75 A;  3T9X B;  1XS5 A;  2UVJ A;  5H8Q B;  4U4S A;  2Q89 A;  1LGB C;  1DTZ A;  2DWH A;  1MRP A;  2HFB A;  2DS9 A;  5I2K A;  3RLF E;  4NF5 B;  1NV5 A;  3OEK A;  2G29 A;  5J16 A;  3O6I A;  4ZEB A;  5DTB A;  4F3B A;  1ZKB A;  2ALU A;  1FPE A;  3ISP A;  4IO2 A;  3OSQ A;  1A55 A;  3S2V A;  2D5W A;  4GWX A;  2ZZW A;  4KYS A;  4XKR A;  2AL4 A;  5EHM A;  3UK4 A;  3E13 X;  3HST A;  4ELQ A;  5I2K B;  1FTL A;  5IZ1 A;  3OMB A;  2DWI A;  5K2Y A;  2WYK A;  2UYE A;  1EZ9 A;  3SEV A;  1XT8 A;  2REG A;  3VE1 B;  1FQB A;  2VPO A;  1SW2 A;  3M3L A;  3LSF B;  2VGQ A;  2B4M A;  1Y4T A;  3B8B A;  2VP1 A;  2ZNS A;  4MNC A;  1IUD A;  2GH9 A;  3MP1 A;  3CVG A;  2RC7 A;  2XXY A;  3ILT B;  2ANJ A;  1SW4 A;  3KN3 A;  1T0K A;  4Q8R A;  2F34 A;  3V83 A;  3B50 A;  4G77 A;  4ZE8 A;  5AA1 A;  4IO3 A;  2DVZ A;  4H0W A;  2FIE A;  3Q29 A;  5HBC A;  2WYP A;  2CZK A;  2XXH A;  1BTJ A;  1B3F A;  1P99 A;  1H3D A;  2O7U A;  3MZB A;  4MLV A;  1NV3 A;  4OYV A;  1B51 A;  3FXQ A;  5I2N A;  4GWY A;  2O69 A;  2Q2A A;  1JVX A;  4RPN A;  4I3Y A;  3FIR A;  2UYF A;  3TCG A;  4ESW A;  5DT6 A;  1OIB A;  3TTL A;  3FVK A;  4KYE A;  3KG2 A;  3PTY A;  4PE5 B;  3EQ1 A;  4I62 A;  4JDF A;  4NF4 A;  4JXI A;  3TMG A;  4FOR A;  3VVD A;  3FXR A;  1J1N A;  5I2N B;  4ZEI A;  5TP9 A;  3MWB A;  1QW0 A;  1Y1M A;  1MY1 A;  3IFA A;  3IAZ A;  1B9J A;  4OER A;  5CMM A;  4I8C A;  3TOD A;  4U4X A;  3DM0 A;  5JTY A;  4NQ8 A;  4PFR A;  4LVQ A;  4NF4 B;  1QUK A;  1AOV A;  3QAX A;  4LP2 B;  5HM4 B;  1INP A;  3VLV A;  2QPQ A;  5TP9 B;  2PT2 A;  4N91 A;  2HXW A;  4OHN A;  3A29 A;  2V3Q A;  4R6K A;  4OVP A;  1DPP A;  2XXQ A;  4PCD A;  4UA8 A;  2VD3 A;  1Y3N A;  5JTY B;  5T3J A;  2F35 A;  1ZJL A;  4DLD A;  1B3E A;  3B6Q A;  1SW5 A;  1DMB A;  4P9K A;  3L6G A;  1RYO A;  1EU8 A;  1RDY A;  1B7H A;  2Y7K A;  5FHM A;  5BWJ A;  3ZKK A;  4C1U A;  5EQ7 A;  1GR2 A;  5DVI A;  3FUZ A;  1LAH E;  4PFI A;  1ZMG A;  2BJI A;  5I84 A;  1FQC A;  2GHB A;  4KI0 E;  3FZV A;  5IZ3 A;  2KLF A;  1SDX A;  3HPI A;  4QRZ A;  4G61 A;  1VFD A;  4H6D A;  1XC1 A;  2FYI A;  3OO6 A;  3P7I A;  1ZLQ A;  3EHU A;  4NX1 A;  1ZIU A;  3M3F A;  5ET5 A;  4OTE A;  2BJJ X;  1N7X A;  3G3F A;  3FVG A;  3DLN A;  3KJT A;  1AL3 A;  3K02 A;  2PBW A;  4PGP A;  2A5S A;  2V3U A;  4WXJ A;  1QKB A;  4LQ2 A;  1M5C A;  3ZS6 A;  4C1T A;  1LBX A;  3GYY A;  3C31 A;  3LUY A;  5IZ3 B;  4OWD A;  2CZL A;  5H8F A;  2I3V A;  1NV2 A;  2F6P A;  2F5X A;  2F7A A;  3N6U A;  4FE8 A;  3T9H B;  4HCY A;  4N8Y A;  2D3I A;  4KYD A;  4ZS9 A;  1P1U A;  2DP8 A;  4M4G A;  2OK2 A;  2XXU A;  3C32 A;  3QXM A;  1LAG E;  2DQV A;  2FHY A;  4IB2 A;  4G8N A;  2QVR A;  5FBP A;  5H8F B;  4OZ9 A;  5KCJ A;  4YKI A;  4DIG A;  3VDF A;  3BBR A;  2PFY A;  4KFQ A;  3RYD A;  1YTV A;  4P56 A;  2V84 A;  1ANF A;  2XWK A;  3IOU A;  1JQF A;  3S4U A;  1H45 A;  5IZZ A;  1B2H A;  2Q9T A;  3T9U A;  1QUJ A;  2F7B A;  2GQ1 A;  2P0S A;  4KXP A;  2Q88 A;  3MBP A;  1Y3Q A;  5KCJ B;  4XKP A;  1G0I A;  1ATG A;  3THI A;  1B3H A;  4NTL A;  1RDZ A;  3S9L C;  1QVS A;  3HO7 A;  4ZEF A;  1MXW A;  4FAT A;  3SZP A;  1FTJ A;  2W7Y A;  1WVJ A;  1XVX A;  3C9H A;  2RCB A;  3TCH A;  4RK9 A;  2DSF A;  2O6A A;  4DI3 D;  4RA1 A;  1URS A;  1MDP 1;  5LOM A;  1FJ6 A;  5ICT A;  4DCX A;  3N94 A;  1URG A;  5ELV A;  3O97 A;  2ZYM A;  4R72 A;  4PE3 A;  1GV8 A;  1LB9 A;  2VHA A;  3D1R A;  4GRK A;  3TQL A;  1RYX A;  5ET6 A;  4HE0 A;  3U72 A;  4OFO A;  4R9F A;  2CEY A;  4EQB A;  1JW4 A;  3MYU A;  4DXU A;  4PFT A;  3SET A;  3IOR A;  2VPN A;  2Y7W A;  3DP8 A;  4BDL A;  2X7Q A;  5A5L A;  1Z7N E;  4RNS A;  4H67 A;  2F78 A;  4PGN A;  4GBV A;  1VR5 A;  1FTM A;  2DXR A;  3ECR A;  3MJN A;  3KC0 A;  5IAI A;  2DVC A;  3K6U A;  2XX7 A;  1MY2 A;  1SI0 A;  3O6G A;  4U22 A;  1KA1 A;  2G93 A;  3IO4 A;  2F6G A;  3OO7 A;  4MF3 A;  1MDQ A;  2Y5K A;  1FBE A;  1TFA A;  5I3S A;  1MXZ A;  5CBS A;  2MKZ A;  1JET A;  5A5X A;  1MH4 A;  3N5L A;  1FW0 A;  4OXV A;  3RUM A;  1IXG A;  3E4R A;  4ND9 A;  3QIM A;  1UQW A;  3SEU A;  3KBZ A;  3O66 A;  3CSB A;  4O3C A;  1H76 A;  3K00 A;  5AE4 A;  1N76 A;  3MQ9 A;  4R74 A;  3CR9 A;  1FPF A;  2GHA A;  3N6T A;  4OQO A;  1EYK A;  4F3G A;  1B05 A;  5A5X B;  3G7W A;  5EYF A;  3S9E A;  1FPL A;  4P11 A;  1NKX A;  3CSG A;  4HE1 A;  1Y1Z A;  4G68 C;  4QSE A;  5EQ9 A;  3UOR A;  1MY4 A;  1B52 A;  1NV0 A;  4P1L A;  3C4M A;  4JVD A;  1US4 A;  1URD A;  2PCR A;  2I0C A;  2H99 A;  5I57 A;  2HZK A;  4F2O A;  4PDD A;  3C36 A;  4RY1 A;  1R9L A;  1FPG A;  1I6B A;  1I6Q A;  4BDO A;  3RPL A;  4WED A;  1GVC A;  2XA5 A;  2HCA A;  4GFR A;  4ONY A;  1LBC A;  3FAT A;  3MW0 A;  4O8M A;  2OX3 A;  3F11 A;  3B6W A;  3B7D A;  2UVI A;  4GWZ A;  3FD3 A;  2QS1 A;  4QFP A;  5ITP A;  5I57 B;  1LBW A;  3DEL B;  1IQ7 A;  1B4H A;  1USY E;  3RPL B;  4QF9 A;  4OMB A;  4QSD A;  3PD8 A;  2ONK E;  2B65 A;  3R6U A;  1YYZ A;  2O51 A;  5ITO A;  3TTR A;  2R6G E;  4POW A;  3T1B A;  3GLB A;  1LBB A;  4PFY A;  1MQI A;  3I6V A;  4G8M A;  2GRV A;  4FEC A;  3O9P A;  4IY5 A;  1HSJ A;  4JB7 A;  3K01 A;  4GF8 A;  1G0H A;  3H3G A;  2DYX A;  4KQP A;  1IXC A;  4IO6 A;  2NVU B;  1BIY A;  1FBG A;  4MLQ A;  3RN8 A;  2O84 X;  1GTK A;  4GBW A;  2X26 A;  3K6W A;  4BDM A;  2OJT A;  4PAF A;  4AB5 A;  4IGT A;  3PUV E;  3FJG A;  2ZMB A;  1BLF A;  5B7D A;  4DCY A;  1AIV A;  1JEU A;  1FBC A;  1UTB A;  3T0J A;  3EKI A;  3SEW A;  4I1D A;  1PEB A;  2XXW A;  3W15 C;  3EF7 A;  4RXL A;  4H45 A;  1F9B A;  1D9V A;  2CZH A;  3V8X B;  3USD A;  2H25 A;  1P1O A;  2WKY A;  2XXR A;  3H6W A;  2OBG A;  2OLB A;  4LA9 A;  3ZSF A;  3KSX A;  2AYS A;  1UTB B;  4XKN A;  1Y9U A;  4YKP A;  5F24 A;  1TWY A;  1LAF E;  3Q26 A;  2KQZ A;  4P8B A;  4I9D A;  3U94 A;  3GZG A;  4QHQ A;  1FQD A;  4XTC Q;  3TDJ A;  3S9M C;  3V5A A;  1DPE A;  5EYH A;  1LCF A;  2QS2 A;  2RF1 A;  2HEU A;  4N6D A;  2ZYO A;  2H4I A;  2XHD A;  2FIX A;  1OQG A;  3FV1 A;  3O28 A;  3ILU B;  4GWO A;  2F3B A;  1IXH A;  1NUZ A;  5ESY A;  3W9V A;  3AXF A;  3MP6 A;  2ONR A;  1USY H;  1PBQ A;  3NOH A;  3KN7 A;  2XXP A;  3OEM A;  1IMD A;  3Q28 A;  2QMW A;  4GX4 A;  3MVW A;  2I4B A;  3SER A;  1QGX A;  1MY0 A;  3PMV A;  4N15 A;  1BP5 A;  3QSL A;  3MST A;  1SD3 A;  2QS4 A;  2F36 A;  4F3P A;  3VFJ A;  4BDN A;  4NN3 A;  3IL1 B;  3T66 A;  1AH5 A;  1FBD A;  5H8S A;  1EYJ A;  1IEJ A;  4HS7 A;  4YKK A;  1TXF A;  3MAM A;  4ZZE A;  1YPN A;  1H43 A;  1M5D A;  1B3L A;  4FEB A;  1EH3 A;  3EHS A;  4HCW A;  3OO9 A;  3H06 B;  4IR8 A;  3HCQ A;  1FBP A;  1NV6 A;  1A7L A;  1P1Q A;  4QXD A;  4PBQ A;  1HSE A;  2I4C A;  1L5T A;  2REJ A;  4QBA A;  4JVI A;  3ZKL A;  1M5F A;  1OLA A;  3H6U A;  1Z7M E;  2YJP A;  1JNF A;  3RT6 B;  4ELR A;  4P0G A;  4MNP A;  3LSW A;  3TEL A;  3FGS A;  5AA3 A;  4TLL B;  5HPQ A;  3PGF A;  4Z7E A;  4F18 A;  4F2Q A;  4PQJ A;  5L9M A;  3CIJ A;  1OVT A;  1PDA A;  2P1S A;  2P3N A;  1N7W A;  3C34 A;  4QFK A;  2I58 A;  4GLI A;  4O7M A;  5EHS A;  3O2A A;  1OMP A;  1B4Z A;  4BDR A;  2B4L A;  4MEV A;  1NFT A;  2V3T A;  4ZEK A;  3U1O A;  4IO4 A;  3KEI A;  3L6H A;  1O7T A;  2ZZX A;  2I49 A;  1NUY A;  2F97 A;  3I3V A;  5DEX A;  1D3K A;  3O29 A;  3QYT A;  3OEL A;  1N04 A;  4PFU A;  1SPI A;  2Z8E A;  2HHM A;  1OQH A;  2HXR A;  1LLS A;  4EDP A;  4O94 A;  2D21 A;  4EF1 A;  1M5B A;  4P0I A;  1NMU A;  4O3B A;  3I5O A;  1MH3 A;  3TFL A;  1MXX A;  1TFD A;  1O64 A;  3IX1 A;  4GL8 A;  4MJO A;  2YPN A;  1N84 A;  1LFG A;  3SDF A;  1MQG A;  1OLC A;  3LV0 A;  3G3I A;  3K2D A;  4NMY A;  5DEX B;  3G3J A;  1NNT A;  3W9W A;  2FNC A;  1DOT A;  5JK4 A;  3OSR A;  2O7I A;  4XEQ A;  2PVU A;  3VXC A;  3JV9 A;  3KJ7 A;  1VDW A;  4OVT A;  5I58 A;  3TPA A;  2NXO A;  4MX6 A;  5FTH A;  4R6Y A;  3H4Z A;  3R26 A;  4JWO A;  4HTG A;  1VSO A;  2QVV A;  4OFJ A;  3C35 A;  1NI9 A;  1NH8 A;  4F31 B;  3V89 B;  3SEX A;  4F1V A;  3CFL A;  5IGA A;  2O68 A;  4GD5 A;  3RNN A;  2FVZ A;  1Y20 A;  4NHB A;  4N8G A;  1MQJ A;  5I58 B;  4BDQ A;  1TT1 A;  4KHZ E;  1PB9 A;  3FXB A;  1YCJ A;  5AA2 D;  3G3G A;  4NG7 A;  1IIW A;  4LAT A;  4N17 A;  1K9Z A;  4C0R A;  4UAC A;  3BFT A;  3T22 A;  1IMF A;  4GXS B;  3IOW A;  1NNF A;  3IR1 A;  2LAO A;  4OVR A;  4XXU A;  1PB8 A;  5CI5 A;  4I40 A;  3VVF A;  2HZL A;  4F29 A;  3CFZ A;  3CG3 A;  3OXN A;  3PPN A;  2OCU A;  3B6T A;  4YMB A;  1RDX A;  4ELP A;  3FJM A;  5ET7 A;  1AMF A;  4YMA A;  1B1X A;  4PTK A;  3PMX A;  1Y3P A;  3M3K A;  4TLM B;  1KA0 A;  2Y7R A;  4N4U A;  3PPO A;  4YAH X;  5IM2 A;  1B58 A;  2ESN A;  1RKM A;  2ZYK A;  3CG1 A;  3K1N A;  2F8D A;  4X8R A;  4EQ7 A;  5L9O A;  4K3F A;  5LDZ A;  1EYI A;  2F3D A;  2GFE A;  4JBZ A;  1N0T A;  4Q5T A;  3UIF A;  3HV1 A;  3MZ9 A;  3MVZ A;  2XXT A;  3GXA A;  1IME A;  1NH7 A;  3K1P A;  5CRY A;  3KGC A;  3SKP A;  2XD3 A;  1FBH A;  2UVG A;  2QVU A;  4EQ9 A;  4PAI A;  4ELO A;  1P1N A;  4AB6 A;  4IY6 A;  2P2A A;  2DDK A;  5EQ8 A;  3UGW A;  2PT1 A;  2QMX A;  3A09 A;  3OO8 A;  3TTN A;  5F7V A;  1ZU0 A;  1SYI A;  4H8J A;  2ZNT A;  3GBB A;  2QFL A;  1FPB A;  4LN5 A;  3CRB A;  5I56 A;  1B1H A;  3A3C A;  2Q8J A;  4OVJ A;  3DP4 A;  1IMA A;  3RTW B;  3TKD A;  5I5P A;  2PMS A;  1FBF A;  5CM6 A;  2XXK A;  1Y4C A;  1UTH A;  2Z23 A;  4EUO A;  4Q30 B;  1R6Z A;  1B3G A;  4R2B A;  2VOZ A;  2V4C A;  1K9Y A;  1QKA A;  4NWD A;  1JVY A;  4FJP A;  3OOA A;  2HPG A;  5I56 B;  4GIZ A;  5AA4 A;  1YXI A;  3GBA A;  3CI8 A;  1PBP A;  4XIG Q;  4X04 A;  3QK6 A;  3BIH A;  2AIX A;  3PU5 A;  4N6P A;  1OVB A;  4DXB A;  3TAJ A;  1UTH B;  2Q2C A;  3VLU A;  3VXB A;  4NF8 A;  4YIC A;  1I6A A;  5DVJ A;  4MFI A;  1UIU A;  1MPB A;  1FRP A;  1LB8 A;  3ONM A;  4GWS A;  5H8N A;  5AA4 B;  3BFU A;  2XWO A;  3TUS A;  1NNK A;  2I6E A;  3QMF A;  1B5J A;  2QRY A;  3ODB A;  3LUZ A;  4MBP A;  1FTO A;  4H1X A;  3FVN A;  1JEV A;  1B5I A;  3MP8 A;  3EPE A;  4L17 A;  2B3B A;  4HE2 A;  1QUL A;  2E1S A;  4NF8 B;  1R9Q A; 
#chains in the Genus database with same CATH homology
 2X7P A;  4RPO A;  4QSC A;  3Q27 A;  3VLW A;  4ECF A;  5H8N B;  4TOZ A;  4E0X A;  1LAX A;  3EN3 A;  3IJX B;  2DOJ A;  1US5 A;  3IB1 A;  4F1Y A;  4GOT A;  1H44 A;  3PUY E;  4X48 A;  3RGY A;  4GXA A;  3G3K A;  3KBR A;  3K4U A;  1BKA A;  3LR1 A;  3KZG A;  3EHT A;  1MXU A;  4KCC A;  1IIT A;  5AA2 A;  1ELJ A;  2DE4 A;  1B0H A;  2PX1 A;  3TCF A;  3MVY A;  3G3H A;  4R2F A;  1LST A;  4U1Z A;  3IJO B;  4H8I A;  3TTK A;  1I69 A;  4X9T A;  3O6H A;  4U21 A;  1SVX B;  1SYH A;  4E0W A;  4R73 A;  4THI A;  5ICQ A;  3MVX A;  2F7C A;  4IGR A;  4NF6 A;  4DZ1 A;  4ZEC A;  5AA2 B;  3KSJ A;  3LSL A;  1R1N A;  4U23 A;  5F1Q A;  2ABH A;  2V25 A;  5J1D A;  5CMK A;  4TQU Q;  4JWX A;  2PYY A;  1FQF A;  2RC8 A;  4KPT A;  1B40 A;  4G2Z A;  1PC3 A;  2O1M A;  4YKJ A;  2HQ0 A;  3FJ7 A;  4NF6 B;  1MQD A;  3H6V A;  3C33 A;  1Q1K A;  1KWH A;  3M8U A;  3H7M A;  4MH5 A;  3MC2 A;  5CMB A;  4FED A;  3MZ1 A;  3UP9 A;  4R6H A;  1SBP A;  1VE4 A;  3D4G A;  4YB6 A;  4QFO A;  1SI1 A;  4XKQ A;  1PB7 A;  4G8H A;  1WOD A;  1B7Z A;  1S50 A;  2XXV A;  4LON B;  3LC8 A;  3E3K A;  4QFN A;  3U93 A;  3T93 B;  4YB7 A;  3RT8 A;  4ESX A;  4O3A A;  2OZZ A;  4ISU A;  5FTI A;  3WAE A;  3TYH A;  4H5F A;  2Z22 A;  2THI A;  3TZA A;  4ZZA A;  1S9T A;  4POX A;  5ISU A;  2DXY A;  1EZP A;  1EZO A;  3T9V A;  2XD2 A;  2XX8 A;  2HAU A;  2Y84 A;  4QFL A;  1MPD A;  3TEP A;  3RY3 A;  1LFH A;  4RJZ A;  2HAV A;  4LQ5 A;  2OWS A;  3KOT A;  3K6V A;  1LFI A;  2M8C A;  4YB5 A;  3U8Q A;  2ZNU A;  1MS7 A;  5L8D A;  4BLA A;  3QUF A;  2A5T A;  4NWC A;  3VV5 A;  1CE2 A;  3MUQ A;  1ZTY A;  1ZBM A;  2Y7P A;  3SES A;  4KCD A;  2NWJ A;  2RCA A;  1XOC A;  5BUU A;  4F1U A;  2A5T B;  3Q25 A;  3PV0 E;  1M5E A;  2XXI A;  2QL3 A;  3A3U A;  1A99 A;  1B6H A;  3OEN A;  1POT A;  3PPP A;  1MY3 A;  4YU0 A;  4N07 A;  4PP0 A;  4OFL A;  3LBS A;  2NUV A;  3T96 B;  1N3W A;  2ZXT A;  1FQE A;  4G68 A;  1N3X A;  2ZYN A;  4U1O A;  2H9B A;  2Z8D A;  3FXU A;  4WKM A;  1S7Y A;  3QUJ A;  5TPA A;  3PUZ E;  2B3F A;  2DWA A;  2V93 A;  1P1W A;  4LUB A;  4IO7 A;  5KZT A;  4PFW A;  4OEN A;  5CC2 A;  2RC9 A;  5TU0 A;  3PUX E;  3IB0 A;  5CMC A;  4KD5 A;  1MXY A;  4G68 B;  1A40 A;  3IOT A;  3KFM A;  4GQO A;  2FA7 A;  3JZJ A;  3IB2 A;  3FV2 A;  5TPA B;  1B7U A;  4YZZ A;  1UIV A;  4FAJ A;  1B46 A;  3D4C A;  3LSX A;  1NNP A;  4FIM A;  3KOS A;  4R9G A;  3IK6 B;  5FHO A;  1QJM A;  2VD2 A;  5CBR A;  1B5H A;  1MM6 A;  2E0S A;  2I0B A;  2I48 A;  1CB6 A;  1WDN A;  4LZ8 A;  1SW1 A;  3VVE A;  4F3S A;  2QSX A;  3TTM A;  4RK2 A;  4PET A;  3DP6 A;  2IEE A;  3PPR A;  4F22 A;  5DYH A;  4F19 A;  4OES A;  3SEY A;  2UXA A;  3K1M A;  3HHG A;  1IZ1 A;  1YAE A;  2O1L A;  4HW8 A;  3U92 A;  3BKI B;  2IA4 A;  3RPW A;  2AL5 A;  3E9X A;  4X1B A;  2H5Y A;  1FTK A;  2UVH A;  2I3W A;  3PMW A;  3H6T A;  4H65 A;  1LCT A;  1B32 A;  3HN0 A;  5FHN A;  2NOO A;  3CFX A;  3R7X A;  1II5 A;  2XX9 A;  5K2X A;  5L9S A;  2RKM A;  1DSN A;  5KDT A;  4AQ4 A;  3S9N C;  4NE4 A;  2DE3 A;  3RTF B;  1FQA A;  4ZDM A;  2DWJ A;  1XVY A;  1O63 A;  4JSD A;  1MQH A;  2DE2 A;  3TQW A;  4M1V A;  4OEU A;  5B70 A;  4DXC A;  4GVO A;  4H5G A;  2R9J A;  5JEI A;  5KDT B;  5IKB A;  2ONS A;  5M2V A;  1POY 1;  2RIN A;  3IOV A;  5H8H A;  1A8F A;  2OWT A;  1HSL A;  1SQY A;  1XHY A;  3RQT A;  1A54 A;  4IO5 A;  4LZ5 A;  4ZED A;  3UA8 A;  1D9Y A;  2H98 A;  4RYA A;  4GL0 A;  4OET A;  4EXK A;  4F39 A;  1MM7 A;  1JW1 A;  5I59 A;  1NL5 A;  1D4N A;  4DE8 A;  5H8H B;  1QUI A;  1IXI A;  1VFE A;  3FAS A;  4U2R A;  3KN8 A;  3WAF A;  4EF2 A;  3OD7 A;  1A8E A;  3HHF A;  5DVF A;  5I59 B;  3PUW E;  2QS3 A;  4NED A;  4Z0I A;  3K0V A;  3MPL A;  2XXX A;  4ZE9 A;  3JYR A;  3PPQ A;  1FCK A;  3N26 A;  4JSO A;  1JW5 A;  4JWY A;  2CMO A;  3PD9 A;  3H03 A;  2R71 A;  4DDD A;  4LZ7 A;  4KR5 A;  4WEP A;  3IO6 A;  5H8Q A;  4OEV A;  4X1D A;  1B0L A;  4G4P A;  1MPC A;  1DTG A;  4N13 A;  2Y7I A;  1GGG A;  4EXL A;  3MPK A;  1MG1 A;  4NF5 A;  2QJE A;  2Z8F A;  3FVO A;  3UN6 A;  2YLN A;  3K6X A;  4Q0C A;  1Q35 A;  1MXV A;  4R75 A;  3T9X B;  1XS5 A;  2UVJ A;  5H8Q B;  4U4S A;  2Q89 A;  1LGB C;  1DTZ A;  2DWH A;  1MRP A;  2HFB A;  2DS9 A;  5I2K A;  3RLF E;  4NF5 B;  3OEK A;  2G29 A;  3O6I A;  4ZEB A;  5DTB A;  4F3B A;  1ZKB A;  2ALU A;  4IO2 A;  3OSQ A;  1A55 A;  3S2V A;  2D5W A;  4KYS A;  4XKR A;  2AL4 A;  5EHM A;  3UK4 A;  3E13 X;  3HST A;  4ELQ A;  5I2K B;  1FTL A;  3OMB A;  2DWI A;  5K2Y A;  2UYE A;  1EZ9 A;  3SEV A;  1XT8 A;  2REG A;  3VE1 B;  1FQB A;  1SW2 A;  3M3L A;  3LSF B;  2VGQ A;  1Y4T A;  2VP1 A;  2ZNS A;  1IUD A;  2GH9 A;  3MP1 A;  3CVG A;  2RC7 A;  2XXY A;  3ILT B;  2ANJ A;  1SW4 A;  3KN3 A;  1T0K A;  4Q8R A;  2F34 A;  3V83 A;  4G77 A;  4ZE8 A;  5AA1 A;  4IO3 A;  2DVZ A;  4H0W A;  3Q29 A;  5HBC A;  2XXH A;  1BTJ A;  1B3F A;  1P99 A;  1H3D A;  2O7U A;  3MZB A;  4MLV A;  4OYV A;  1B51 A;  3FXQ A;  5I2N A;  2O69 A;  2Q2A A;  1JVX A;  4RPN A;  3FIR A;  2UYF A;  3TCG A;  4ESW A;  5DT6 A;  1OIB A;  3TTL A;  3FVK A;  4KYE A;  3KG2 A;  4PE5 B;  3EQ1 A;  4I62 A;  4JDF A;  4NF4 A;  4JXI A;  3TMG A;  4FOR A;  3VVD A;  3FXR A;  1J1N A;  5I2N B;  4ZEI A;  5TP9 A;  3MWB A;  1QW0 A;  1Y1M A;  1MY1 A;  3IAZ A;  1B9J A;  4OER A;  5CMM A;  4I8C A;  3TOD A;  4U4X A;  3DM0 A;  5JTY A;  4LVQ A;  4NF4 B;  1QUK A;  1AOV A;  3QAX A;  4LP2 B;  5HM4 B;  3VLV A;  2QPQ A;  5TP9 B;  2PT2 A;  2HXW A;  4OHN A;  2V3Q A;  4R6K A;  1DPP A;  2XXQ A;  4UA8 A;  2VD3 A;  1Y3N A;  5JTY B;  2F35 A;  1ZJL A;  4DLD A;  1B3E A;  3B6Q A;  1SW5 A;  1DMB A;  3L6G A;  1RYO A;  1EU8 A;  1B7H A;  2Y7K A;  5FHM A;  5BWJ A;  3ZKK A;  4C1U A;  1GR2 A;  5DVI A;  3FUZ A;  1LAH E;  1ZMG A;  5I84 A;  1FQC A;  2GHB A;  4KI0 E;  3FZV A;  2KLF A;  1SDX A;  3HPI A;  4QRZ A;  1VFD A;  4H6D A;  1XC1 A;  2FYI A;  3OO6 A;  3P7I A;  1ZLQ A;  3EHU A;  1ZIU A;  3M3F A;  4OTE A;  2BJJ X;  1N7X A;  3G3F A;  3FVG A;  3DLN A;  3KJT A;  1AL3 A;  3K02 A;  2PBW A;  2A5S A;  2V3U A;  4WXJ A;  1QKB A;  4LQ2 A;  1M5C A;  3ZS6 A;  4C1T A;  3C31 A;  3LUY A;  4OWD A;  2CZL A;  5H8F A;  2I3V A;  2F6P A;  2F5X A;  2F7A A;  3N6U A;  4FE8 A;  3T9H B;  4HCY A;  2D3I A;  4KYD A;  4ZS9 A;  1P1U A;  2DP8 A;  4M4G A;  2OK2 A;  2XXU A;  3C32 A;  3QXM A;  1LAG E;  2DQV A;  4IB2 A;  4G8N A;  5H8F B;  4OZ9 A;  5KCJ A;  4YKI A;  4DIG A;  3VDF A;  3BBR A;  4KFQ A;  1YTV A;  2V84 A;  1ANF A;  3IOU A;  1JQF A;  3S4U A;  1H45 A;  1B2H A;  2Q9T A;  3T9U A;  1QUJ A;  2F7B A;  2P0S A;  2Q88 A;  3MBP A;  1Y3Q A;  5KCJ B;  4XKP A;  1ATG A;  3THI A;  1B3H A;  4NTL A;  3S9L C;  1QVS A;  3HO7 A;  4ZEF A;  1MXW A;  4FAT A;  1FTJ A;  2W7Y A;  1WVJ A;  1XVX A;  3C9H A;  2RCB A;  3TCH A;  4RK9 A;  2DSF A;  2O6A A;  4RA1 A;  1URS A;  1MDP 1;  5LOM A;  5ICT A;  4DCX A;  3N94 A;  1URG A;  5ELV A;  3O97 A;  2ZYM A;  4R72 A;  1GV8 A;  1LB9 A;  2VHA A;  4GRK A;  3TQL A;  1RYX A;  3U72 A;  4OFO A;  4R9F A;  4EQB A;  1JW4 A;  4DXU A;  4PFT A;  3SET A;  3IOR A;  2Y7W A;  3DP8 A;  4BDL A;  2X7Q A;  1Z7N E;  4RNS A;  4H67 A;  2F78 A;  1VR5 A;  1FTM A;  2DXR A;  3ECR A;  3MJN A;  5IAI A;  2DVC A;  3K6U A;  2XX7 A;  1MY2 A;  1SI0 A;  3O6G A;  4U22 A;  2G93 A;  3IO4 A;  2F6G A;  3OO7 A;  4MF3 A;  1MDQ A;  1TFA A;  1MXZ A;  5CBS A;  5A5X A;  1JET A;  1MH4 A;  3N5L A;  1FW0 A;  4OXV A;  3RUM A;  1IXG A;  3E4R A;  4ND9 A;  3QIM A;  1UQW A;  3SEU A;  3O66 A;  3CSB A;  4O3C A;  1H76 A;  3K00 A;  5AE4 A;  1N76 A;  3MQ9 A;  4R74 A;  3CR9 A;  2GHA A;  3N6T A;  4OQO A;  4F3G A;  1B05 A;  5A5X B;  3G7W A;  5EYF A;  3S9E A;  4P11 A;  1NKX A;  3CSG A;  1Y1Z A;  4G68 C;  4QSE A;  3UOR A;  1MY4 A;  1B52 A;  3C4M A;  1US4 A;  1URD A;  2I0C A;  2H99 A;  5I57 A;  2HZK A;  4F2O A;  3C36 A;  4RY1 A;  1R9L A;  1I6B A;  1I6Q A;  4BDO A;  4WED A;  1GVC A;  2HCA A;  4GFR A;  4ONY A;  1LBC A;  3FAT A;  3MW0 A;  3F11 A;  3B6W A;  3B7D A;  2UVI A;  3FD3 A;  2QS1 A;  4QFP A;  5ITP A;  5I57 B;  3DEL B;  1IQ7 A;  1B4H A;  1USY E;  4QF9 A;  4OMB A;  4QSD A;  3PD8 A;  2ONK E;  2B65 A;  3R6U A;  2O51 A;  5ITO A;  3TTR A;  2R6G E;  4POW A;  3GLB A;  1LBB A;  4PFY A;  1MQI A;  3I6V A;  4G8M A;  2GRV A;  4FEC A;  3O9P A;  4IY5 A;  1HSJ A;  4JB7 A;  3K01 A;  4GF8 A;  3H3G A;  2DYX A;  4KQP A;  1IXC A;  4IO6 A;  2NVU B;  1BIY A;  4MLQ A;  3RN8 A;  2O84 X;  1GTK A;  2X26 A;  3K6W A;  4BDM A;  2OJT A;  4AB5 A;  4IGT A;  3PUV E;  3FJG A;  2ZMB A;  1BLF A;  5B7D A;  4DCY A;  1AIV A;  1JEU A;  1UTB A;  3SEW A;  4I1D A;  1PEB A;  2XXW A;  3W15 C;  3EF7 A;  4RXL A;  1F9B A;  1D9V A;  3V8X B;  3USD A;  2H25 A;  1P1O A;  2WKY A;  2XXR A;  3H6W A;  2OBG A;  2OLB A;  4LA9 A;  3ZSF A;  3KSX A;  2AYS A;  1UTB B;  4XKN A;  1Y9U A;  4YKP A;  1TWY A;  1LAF E;  3Q26 A;  4I9D A;  3U94 A;  3GZG A;  4QHQ A;  1FQD A;  4XTC Q;  3TDJ A;  3S9M C;  3V5A A;  1DPE A;  1LCF A;  2QS2 A;  2RF1 A;  2HEU A;  2ZYO A;  2H4I A;  2XHD A;  1OQG A;  3FV1 A;  3O28 A;  3ILU B;  4GWO A;  1IXH A;  3W9V A;  3AXF A;  3MP6 A;  2ONR A;  1USY H;  1PBQ A;  3KN7 A;  2XXP A;  3OEM A;  3Q28 A;  2QMW A;  3MVW A;  2I4B A;  3SER A;  1MY0 A;  3PMV A;  1BP5 A;  3QSL A;  1SD3 A;  2QS4 A;  2F36 A;  4F3P A;  3VFJ A;  4BDN A;  3IL1 B;  3T66 A;  1AH5 A;  5H8S A;  1IEJ A;  4HS7 A;  4YKK A;  1TXF A;  3MAM A;  4ZZE A;  1YPN A;  1H43 A;  1M5D A;  1B3L A;  4FEB A;  1EH3 A;  3EHS A;  4HCW A;  3OO9 A;  3H06 B;  3HCQ A;  1P1Q A;  1A7L A;  1HSE A;  2I4C A;  1L5T A;  2REJ A;  3ZKL A;  1M5F A;  1OLA A;  3H6U A;  1Z7M E;  2YJP A;  1JNF A;  3RT6 B;  4ELR A;  4P0G A;  3LSW A;  3TEL A;  3FGS A;  5AA3 A;  4TLL B;  5HPQ A;  3PGF A;  4Z7E A;  4F18 A;  4F2Q A;  4PQJ A;  5L9M A;  3CIJ A;  1OVT A;  1PDA A;  2P1S A;  1N7W A;  3C34 A;  4QFK A;  2I58 A;  4GLI A;  5EHS A;  3O2A A;  1OMP A;  1B4Z A;  4BDR A;  1NFT A;  2V3T A;  4ZEK A;  3U1O A;  4IO4 A;  3KEI A;  3L6H A;  1O7T A;  2I49 A;  2F97 A;  3I3V A;  5DEX A;  1D3K A;  3O29 A;  3QYT A;  3OEL A;  1N04 A;  4PFU A;  2Z8E A;  1OQH A;  1LLS A;  4EDP A;  2D21 A;  4EF1 A;  1M5B A;  4P0I A;  1NMU A;  4O3B A;  3I5O A;  1MH3 A;  3TFL A;  1MXX A;  1TFD A;  1O64 A;  3IX1 A;  4GL8 A;  2YPN A;  1N84 A;  1LFG A;  3SDF A;  1MQG A;  1OLC A;  4NMY A;  3G3I A;  3K2D A;  5DEX B;  3G3J A;  1NNT A;  3W9W A;  2FNC A;  1DOT A;  5JK4 A;  3OSR A;  2O7I A;  2PVU A;  3VXC A;  3JV9 A;  3KJ7 A;  5I58 A;  3TPA A;  2NXO A;  5FTH A;  4R6Y A;  3H4Z A;  3R26 A;  4JWO A;  4HTG A;  1VSO A;  4OFJ A;  3C35 A;  1NH8 A;  4F31 B;  3V89 B;  3SEX A;  4F1V A;  3CFL A;  2O68 A;  4GD5 A;  3RNN A;  1Y20 A;  1MQJ A;  5I58 B;  4BDQ A;  1TT1 A;  4KHZ E;  1PB9 A;  1YCJ A;  5AA2 D;  3G3G A;  1IIW A;  4LAT A;  4C0R A;  4UAC A;  3BFT A;  3T22 A;  4GXS B;  3IOW A;  1NNF A;  3IR1 A;  2LAO A;  4XXU A;  1PB8 A;  5CI5 A;  3VVF A;  2HZL A;  4F29 A;  3CFZ A;  3CG3 A;  3OXN A;  3PPN A;  2OCU A;  3B6T A;  4YMB A;  4ELP A;  3FJM A;  1AMF A;  4YMA A;  1B1X A;  3PMX A;  1Y3P A;  3M3K A;  4TLM B;  2Y7R A;  3PPO A;  4YAH X;  1B58 A;  2ESN A;  1RKM A;  2ZYK A;  3CG1 A;  3K1N A;  2F8D A;  4EQ7 A;  5L9O A;  4K3F A;  2GFE A;  4JBZ A;  1N0T A;  4Q5T A;  3UIF A;  3HV1 A;  3MZ9 A;  3MVZ A;  2XXT A;  3GXA A;  1NH7 A;  3K1P A;  5CRY A;  3KGC A;  3SKP A;  2XD3 A;  2UVG A;  4EQ9 A;  4ELO A;  1P1N A;  4AB6 A;  4IY6 A;  2P2A A;  3UGW A;  2PT1 A;  2QMX A;  3A09 A;  3OO8 A;  3TTN A;  5F7V A;  1ZU0 A;  1SYI A;  4H8J A;  2ZNT A;  3GBB A;  3CRB A;  5I56 A;  1B1H A;  3A3C A;  2Q8J A;  4OVJ A;  3DP4 A;  3RTW B;  3TKD A;  2PMS A;  5CM6 A;  1Y4C A;  1UTH A;  2Z23 A;  4EUO A;  4Q30 B;  1R6Z A;  1B3G A;  4R2B A;  2VOZ A;  1QKA A;  4NWD A;  1JVY A;  4FJP A;  3OOA A;  5I56 B;  4GIZ A;  5AA4 A;  3GBA A;  3CI8 A;  1PBP A;  4XIG Q;  3QK6 A;  2AIX A;  3PU5 A;  4N6P A;  1OVB A;  4DXB A;  3TAJ A;  1UTH B;  2Q2C A;  3VLU A;  3VXB A;  4NF8 A;  4YIC A;  1I6A A;  5DVJ A;  4MFI A;  1UIU A;  1MPB A;  1LB8 A;  3ONM A;  5H8N A;  5AA4 B;  3BFU A;  3TUS A;  1NNK A;  2I6E A;  1B5J A;  2QRY A;  3ODB A;  4MBP A;  1FTO A;  4H1X A;  3FVN A;  1JEV A;  1B5I A;  3MP8 A;  3EPE A;  4L17 A;  2B3B A;  1QUL A;  2E1S A;  4NF8 B;  1R9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...