2W7YA

Structure of a streptococcus pneumoniae solute-binding protein in complex with the blood group a-trisaccharide.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
391
structure length
389
Chain Sequence
b'EVLEFYHGYHHSEDEWPVAKTMRDLYDKFAEEHSGVEFKPTPVNGDLKDIMNNKVASGEFPDVIDLAGNAVSLAAIEQKLVLDLKPYIDSNKLEKNVGLNYKQNQKDGKIYTVHEQLFTMGLWYNKDIFAKAGAKTPDQWNTWDDFTQAMASIRKQDGVYAFGAGEPSIRLFNTVLGTTENGRKLLDKPLTKEGIESKEFADALKMVMKEIQANGSKNAGGDANAYSKDFQEGKSAVFFNGVWASGEMSKNPSLAPGIYPAGVAISSSGGGITISSKMSEAKQKLALEFLKYMTSDDVQKVIFEKVGANPSNENVNVKELSEKSSEATTKILGQAITQVKNAKAVVPTVSDVWGGDVHTAIINALTESAAENVDVDQKVKSTQDVLKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN
molecule tags Sugar binding protein
source organism Streptococcus pneumoniae
publication title Blood-Group Antigen Recognition by a Solute-Binding Protein from a Serotype 3 Strain of Streptococcus Pneumoniae.
pubmed doi rcsb
total genus 119
structure length 389
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2w7yA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2w7yA01
4IO4A 1MXWA 1D9VA 3U92A 1MS7A 2XXXA 1TFAA 1ZMGA 1US4A 3QXMA 4U23A 4XTCQ 2A5TB 1MH3A 5ICQA 3PPQA 4ZE8A 1PB9A 3H6WA 3VLUA 3V83A 2ONKE 4RA1A 3H3GA 2PVUA 4MH5A 3MBPA 3O9PA 3PUZE 3G3IA 3K1PA 4GF8A 3KFMA 2UVGA 1QUKA 5H8HB 1XT8A 3PPRA 5H8FA 1IITA 2VP1A 2X26A 1IXGA 5KCJA 1QUJA 2H9BA 5BUUA 3V8XB 1SDXA 2HXWA 1EZOA 1POTA 1Z7ME 3RT6B 4F31B 1CE2A 4RY1A 4OERA 2RC7A 5H8NB 4DIGA 2CMOA 1BKAA 3OEKA 3M3LA 4LZ7A 3FD3A 2THIA 3E13X 3G3GA 4X48A 2YLNA 2Q8JA 1NL5A 2DWIA 4MBPA 1NNKA 2ESNA 4OHNA 3FATA 3CR9A 2DE3A 3EPEA 3FVGA 3PUYE 4Q30B 1JVYA 3LUYA 4XIGQ 3VLVA 2AL5A 4L17A 5I2NA 4HS7A 2F97A 1QUIA 3KG2A 4PE5B 5ITOA 1JEUA 4NEDA 4X1DA 4HW8A 5CBSA 4LZ8A 4EQ9A 4M1VA 3TAJA 4R75A 4U21A 3VVEA 2Y7IA 3L6HA 4R2FA 5I57A 4H65A 3RLFE 3OO6A 1B3FA 4EQBA 3A3UA 3FASA 4WXJA 3QUFA 1USYE 3P7IA 5I56B 4NF5A 1GVCA 3KOTA 3LBSA 1L5TA 3OOAA 3QSLA 1LB8A 4LVQA 2GFEA 3FIRA 1DTZA 3CG3A 2DOJA 3MPKA 1GTKA 4QRZA 1URGA 4GOTA 3UGWA 3U94A 3RTWB 2G93A 3QUJA 3THIA 1B7UA 1B7ZA 2P0SA 3KZGA 4H6DA 2H98A 5IAIA 1LLSA 4JSDA 5L9SA 1N3WA 1SQYA 2FYIA 2OCUA 3H06B 5DVJA 1P1WA 2OWSA 1XVYA 2PX1A 3FXQA 4YICA 3TTLA 2OWTA 3GXAA 1FQEA 1ZLQA 2F8DA 2QJEA 2VD2A 3FJGA 4Q0CA 3HO7A 4KD5A 3PMWA 2NXOA 3MVWA 1IEJA 4NF6A 4F3SA 3VLWA 2GH9A 4O3AA 2XXIA 4U1ZA 3O6GA 4ELOA 3GZGA 2O51A 5DVIA 1XOCA 3UN6A 3ZS6A 1FQBA 2NUVA 3G3JA 1IXIA 1FQAA 3E4RA 4R6YA 3LSFB 5CRYA 1MQHA 4OQOA 3OSQA 4F1VA 1SW4A 4Q8RA 3HPIA 2QRYA 5I59A 1MDQA 2Y7RA 4IY5A 2ONSA 5DT6A 3K6WA 3SETA 4BDRA 1LAFE 4TOZA 3VE1B 5JTYB 5I2KA 1R9QA 3KJTA 2V3TA 4YMBA 4X9TA 1SVXB 1DSNA 5AA3A 4GXAA 3K0VA 3OD7A 5KDTB 3S9NC 1MPDA 3TPAA 4R6KA 3H6TA 3IO4A 3RPWA 1ZU0A 1B3GA 2ANJA 4H5FA 4AB5A 1AOVA 1D3KA 3M3KA 4OENA 1GR2A 2AIXA 2OZZA 3LSLA 3M8UA 4YB7A 2V3QA 1B7HA 2P2AA 1LBBA 1XVXA 3U1OA 4GL8A 2RCAA 4H67A 4QFOA 5IKBA 4F39A 5CMBA 1UQWA 2V93A 3IORA 4R2BA 5I2NB 2XXYA 3OELA 2NVUB 3RGYA 2OJTA 3TDJA 1H43A 4GXSB 4Z7EA 5HPQA 3O28A 4IO7A 2F7AA 4POWA 3CI8A 4XKQA 1B2HA 1YTVA 5H8SA 3HN0A 3T9UA 1SW5A 1VFDA 4IO2A 1MDP1 3B6TA 1US5A 3OMBA 1ZBMA 1IQ7A 3WAEA 3VFJA 1T0KA 4NWDA 3UORA 5AA4B 2ZMBA 3IOTA 4HCYA 4XXUA 5H8NA 4FATA 3PD9A 4WKMA 3B6QA 4ISUA 5FHNA 1M5FA 3C33A 3K02A 4ECFA 1ZKBA 2Y7KA 4N13A 1KWHA 1UTBB 3C31A 3VV5A 2B3FA 5FTIA 1NNTA 3TODA 2D5WA 3FV2A 2B3BA 3G3HA 4JB7A 3RNNA 1HSEA 5KDTA 2A5TA 4QSEA 5F7VA 2I6EA 5L8DA 4LQ5A 5EHMA 4YZZA 2R9JA 3D4CA 3M3FA 4OFOA 1DPEA 3VVFA 1JW4A 1A99A 3EHTA 2ZYNA 1FTOA 1B5JA 2D21A 1UTHB 2Q89A 1FTLA 3ILUB 4G77A 1QW0A 1B5IA 1MQIA 1R6ZA 3IX1A 1XS5A 4H1XA 3N26A 3T9VA 2DWHA 2O6AA 2ALUA 3Q29A 4U1OA 3CFZA 4U2RA 1D9YA 3FV1A 4H5GA 3FVNA 1P1NA 4YAHX 2I3VA 2QMXA 1PBQA 4F3BA 3PD8A 1URSA 2RCBA 3CFXA 3PGFA 4DZ1A 1OQHA 1MRPA 3L6GA 3QK6A 2I0BA 4BLAA 4C1TA 2YPNA 3Q28A 1LFGA 4OEVA 2XX7A 3I5OA 4OVJA 3S9EA 3N6UA 3HHGA 1NH8A 5AA1A 4YKPA 3IOUA 2NWJA 3RY3A 5BWJA 3K00A 4Q5TA 3TTMA 1A55A 3C9HA 4KPTA 1ATGA 3MUQA 5CBRA 4F2QA 4RXLA 3CRBA 5KZTA 3V5AA 3TCGA 4F29A 1JVXA 1VSOA 2O7IA 3IR1A 3N5LA 2QS3A 4IY6A 2ZYOA 3TCFA 1LFHA 4JWYA 1IZ1A 1OVBA 1I69A 1OMPA 1RKMA 1B1HA 2I49A 2XXUA 1TFDA 4LZ5A 4X1BA 4YU0A 1LGBC 1Q1KA 3PPPA 3U72A 2O7UA 1MM7A 1O7TA 4RNSA 3T9XB 4I62A 4KCDA 4LQ2A 1VE4A 2UVJA 2PBWA 4DXBA 1II5A 1P1UA 2GHBA 2WKYA 2KLFA 2Q9TA 3EQ1A 4F18A 4OFLA 5DTBA 2LAOA 4IO5A 2I4CA 4RK9A 3S2VA 3SKPA 4IB2A 4R74A 4LATA 3PPNA 1NKXA 2GRVA 1WDNA 3H6UA 4FORA 2HAVA 2QS1A 2RINA 3OO7A 4GFRA 3TYHA 5L9MA 4G8HA 1LBCA 4GD5A 5CMCA 1A54A 1B9JA 5CMKA 3TUSA 1RYXA 4XKPA 3TELA 2Z8FA 4G8NA 5ELVA 3SERA 2DYXA 1UTHA 3Q25A 2QS4A 1MG1A 4RJZA 2I4BA 4F22A 1BIYA 2HZLA 3OENA 3T66A 4BDQA 4ZE9A 1MY4A 3EN3A 3C34A 2Y7PA 3IB2A 3O6HA 3TMGA 3SEWA 3KSJA 1MXXA 2DE4A 4U22A 1DPPA 3KN3A 3B7DA 4DXUA 3DELB 2REGA 4GLIA 4O3CA 3HCQA 3FVKA 2UYEA 4E0WA 1TT1A 5KCJB 3BFTA 3KJ7A 5I57B 3UK4A 2HZKA 1DOTA 1MQGA 5H8QA 3W9VA 4I1DA 4LONB 4DLDA 2DVZA 4H8IA 3BBRA 3I3VA 1H3DA 4FE8A 3MZ1A 1B4ZA 2F6GA 4BDNA 5AA4A 1QKBA 4RPNA 3HHFA 1I6QA 3R6UA 4H8JA 1H76A 4PFTA 4UA8A 5AA2D 2DS9A 5JEIA 1A40A 5TU0A 1LAHE 3TCHA 5ITPA 1O64A 4MLQA 4PP0A 3Q27A 4HTGA 1FQDA 2ZNTA 2RKMA 3CIJA 3O66A 3K2DA 4G4PA 3MWBA 4YKIA 4BDMA 2Z8DA 4NF5B 1LB9A 1XC1A 2HEUA 3C4MA 1AIVA 2R71A 3IL1B 3BKIB 1Y1MA 2ZYKA 4N07A 4KYDA 4EF1A 2RF1A 3CG1A 4GL0A 1NH7A 4R73A 5H8FB 3TZAA 3ODBA 4U4XA 1S9TA 1URDA 4LUBA 4G68C 3U8QA 4ZEKA 3IB0A 3ILTB 4F1UA 1B3LA 3QIMA 5FHMA 4WEPA 1QVSA 1OLCA 1P99A 2PYYA 2O1LA 1MPBA 1FQFA 3MJNA 3PUVE 1FCKA 2VGQA 3BFUA 4KCCA 1PB7A 3MP1A 3OO8A 4ONYA 4E0XA 3O6IA 3GBBA 4NTLA 1SW1A 4OTEA 3CSBA 3S9MC 5F1QA 4PETA 2VD3A 3B6WA 2IEEA 2V25A 3ZSFA 4KFQA 2BJJX 4LP2B 1SW2A 4NWCA 4C0RA 2Y84A 5H8QB 4F3GA 3PMVA 2P1SA 4G8MA 4MFIA 3KGCA 4R72A 2XXPA 4EXLA 3TTKA 4RK2A 1LFIA 4LA9A 5H8HA 1M5DA 3LSXA 1CB6A 1N04A 3EHUA 3IOVA 3ONMA 4OWDA 3AXFA 4R9FA 4JDFA 4O3BA 1I6AA 4YB6A 3CVGA 1ZIUA 3A09A 2D3IA 4H0WA 3OO9A 2OK2A 4QFNA 3OEMA 1TXFA 4DCXA 1SYIA 3RT8A 4AQ4A 1J1NA 1UIVA 2Y7WA 4JWOA 2A5SA 2HCAA 2O69A 2F78A 2RC8A 3DM0A 3MP8A 4OZ9A 4YKKA 4ZZAA 4G68A 4BDOA 3JYRA 1FW0A 1R1NA 2V3UA 3IOWA 4NMYA 4U4SA 1JQFA 3MVYA 5TPAB 4JWXA 2X7QA 1PB8A 4P0GA 5A5XA 3SESA 4ZEBA 3JV9A 1BP5A 5EHSA 4FEDA 3V89B 1TWYA 3JZJA 4ESXA 1MQJA 1ELJA 1Y9UA 1WODA 1MXVA 4PFWA 1MY0A 2ZXTA 1LSTA 4ELPA 1H45A 1Y20A 4ND9A 4ZEFA 2CZLA 3H7MA 2GHAA 3TFLA 2F36A 2I0CA 1PEBA 3KN8A 4OESA 1MXYA 2F7BA 2REJA 1M5BA 2UVIA 4RYAA 4YKJA 1DMBA 2UYFA 4PQJA 4JXIA 1PBPA 5K2XA 3Q26A 3PV0E 4NE4A 3PUWE 4RPOA 4R9GA 1B4HA 3A3CA 2RC9A 1QULA 2O84X 5I2KB 3RN8A 3UP9A 2DP8A 2H4IA 3MC2A 1MH4A 3UIFA 1N76A 1P1OA 2Z23A 2Z8EA 4IGRA 4IO6A 3R26A 2HFBA 4N6PA 5I59B 1R9LA 1MXZA 2DWAA 4P0IA 1B3EA 1USYH 3PMXA 4FEBA 3UA8A 4IGTA 2W7YA 4ELRA 1GGGA 4PFUA 1ZJLA 5JK4A 4FECA 1MM6A 2V84A 2F7CA 4EDPA 5I56A 3CFLA 1A8FA 4MF3A 2M8CA 1A8EA 2XXVA 2I3WA 4THIA 3S9LC 1B3HA 3RQTA 4QF9A 5ICTA 3O97A 2YJPA 3PPOA 5FHOA 1OIBA 3GLBA 2B65A 3KBRA 1AL3A 1MXUA 1B40A 1B1XA 1IXCA 2XXWA 3E9XA 4TLMB 5I58B 2DQVA 3HSTA 3K6XA 4K3FA 1JETA 4GIZA 1MPCA 4ZZEA 1I6BA 1B46A 2XX9A 3G3KA 3VVDA 3OSRA 4QFLA 1QJMA 3VXBA 5CM6A 1B6HA 1SYHA 3I6VA 3SEYA 5CI5A 5CMMA 1B52A 1HSLA 4F3PA 5ISUA 2H25A 1EU8A 3R7XA 4NF8A 4FJPA 1M5EA 3F11A 3K1NA 2UVHA 3KSXA 4UACA 3DP4A 1LAGE 1BLFA 4ZS9A 4GRKA 4Z0IA 3TQLA 5LOMA 2AYSA 2QPQA 3VXCA 3QYTA 4XKNA 5J1DA 2ZYMA 1UIUA 2DXRA 4QSCA 4EQ7A 4EXKA 4YB5A 5HM4B 3FVOA 5DVFA 1SD3A 1UTBA 3PU5A 4P11A 1O63A 2E1SA 1B51A 3KN7A 2F6PA 1N7WA 2I58A 4G2ZA 1XHYA 1ZTYA 5TP9B 3FJMA 3K1MA 1B05A 3IO6A 4QSDA 3ZKLA 3DP6A 4GQOA 5HBCA 4I9DA 4F2OA 1JW1A 1POY1 4KHZE 1OLAA 1NNFA 2XXTA 3LR1A 3USDA 4OETA 1B0HA 3DP8A 3O2AA 3D4GA 3PUXE 1PDAA 4GVOA 3ZKKA 2VHAA 3HV1A 4QHQA 3TKDA 3FGSA 4ZECA 4ESWA 1N7XA 2XD2A 1WVJA 3FZVA 3LC8A 2ZNSA 1Y3NA 2DE2A 4TQUQ 3T93B 4KYEA 5AE4A 3TTRA 4MLVA 2Q88A 2UXAA 4FAJA 2ABHA 4F19A 3EHSA 3MAMA 3GBAA 3S4UA 3FJ7A 2PT2A 2F34A 1AMFA 1VFEA 1Y4CA 1H44A 4WEDA 2O68A 3MQ9A 2OLBA 1B58A 1N0TA 1A7LA 3MVXA 2FA7A 2FNCA 4YMAA 4OXVA 5FTHA 3G3FA 2OBGA 1VR5A 1MY1A 3K4UA 4JBZA 4POXA 4DDDA 3K6VA 5JTYA 1IXHA 4XKRA 1IIWA 1Y3QA 2VOZA 4OYVA 2H5YA 4ZDMA 1Q35A 5K2YA 2H99A 2XD3A 2XXQA 1S50A 3LSWA 3MP6A 5TPAA 3T22A 1D4NA 2R6GE 3N6TA 5M2VA 4GWOA 4NF4B 2AL4A 2QSXA 1FTJA 1OVTA 5DEXA 2Z22A 2QMWA 5DYHA 5A5XB 5AA2A 4JSOA 3O29A 3H4ZA 5I84A 2QL3A 3FXUA 2O1MA 1S7YA 1B0LA 1EH3A 1Y1ZA 1OQGA 4DCYA 4EF2A 4QFKA 3H03A 5I58A 1JEVA 4NF6B 4KI0E 1YAEA 1Z7NE 4FIMA 1MY3A 1DTGA 2DWJA 1SI1A 4F1YA 1HSJA 4KR5A 2XX8A 4KQPA 2G29A 5B70A 1N84A 1F9BA 1SBPA 3IAZA 3MZ9A 1BTJA 3MVZA 2XXRA 1MY2A 2DXYA 1GV8A 3SEVA 5B7DA 1FQCA 3MPLA 2F35A 3T96B 3TEPA 4AB6A 2NOOA 3TTNA 2QS2A 3IK6B 3W15C 4NF4A 4EUOA 1JW5A 3T9HB 2Q2CA 1YPNA 3MZBA 2X7PA 3MW0A 2IA4A 3QAXA 2I48A 1YCJA 4ZEDA 4PFYA 1EZ9A 3FUZA 3K6UA 4R6HA 2DSFA 3RUMA 3EF7A 3FXRA 1PC3A 2ONRA 2XXHA 3G7WA 3IB1A 1Y4TA 3IJXB 4IO3A 4KYSA 2F5XA 1LCFA 2HQ0A 5EYFA 3OXNA 1JNFA 1N3XA 3TQWA 1M5CA 3C36A 2PT1A 2ZNUA 4I8CA 3SEUA 1Y3PA 2PMSA 4OMBA 5TP9A 3K01A 5CC2A 4C1UA 1LCTA 2Q2AA 1NMUA 1ANFA 3ECRA 1SI0A 3DLNA 2E0SA 4BDLA 4ELQA 3U93A 3VDFA 1NNPA 3CSGA 1EZPA 3C32A 1QKAA 2DVCA 2XHDA 1B32A 3RTFB 4OFJA 3WAFA 4DE8A 5L9OA 4OEUA 3KEIA 5DEXB 1NFTA 5AA2B 4TLLB 3E3KA 3N94A 4M4GA 2HAUA 1FTMA 3IJOB 1RYOA 4DXCA 3H6VA 1B5HA 1P1QA 1IUDA 4NF8B 4G68B 4QFPA 4ZEIA 3KOSA 1FTKA 1LAXA 3SDFA 3C35A 3SEXA 3W9WA 1MQDA 4HCWA 1AH5A
chains in the Genus database with same CATH superfamily
4IO4A 1MXWA 1D9VA 3U92A 1MS7A 2BJIA 3QXMA 4XEQA 4U23A 1MH3A 5ICQA 3PPQA 3H6WA 4N81A 3H3GA 2PVUA 3PUZE 3K1PA 5KCJA 2H9BA 2FIEA 2HXWA 3RT6B 1CE2A 4OERA 4DIGA 3OEKA 3M3LA 2DWIA 4MBPA 2ESNA 4NGUA 1KA0A 4N15A 4HS7A 4N6DA 5ITOA 4HE0A 4EQ9A 4M1VA 1NV6A 3VVEA 3L6HA 2WYKA 3RLFE 3OO6A 1FBPA 1USYE 5ET6A 3P7IA 3QSLA 1LB8A 3FIRA 4NQ8A 1DTZA 3CG3A 3THIA 1B7ZA 1LLSA 5L9SA 4ZECA 2PX1A 2NXOA 4F3SA 3VLWA 4GBVA 4O3AA 4U1ZA 5DVIA 3UN6A 1XOCA 1EYKA 3E4RA 1MQHA 1SW4A 3HPIA 4TOZA 3VE1B 3KJTA 2V3TA 4YMBA 1DSNA 3OD7A 3S9NC 3TPAA 2HHMA 3H6TA 3IO4A 1ZU0A 4OENA 3T1BA 1XVXA 4GL8A 3IORA 2XXYA 4GWSA 4MEVA 2NVUB 3RGYA 2OJTA 3TDJA 2F7AA 1YTVA 1US5A 3OMBA 3WAEA 3VFJA 4NWDA 5AA4B 3IOTA 5H8NA 1ZKBA 2Y7KA 1UTBB 3VV5A 3FV2A 2B3BA 1HSEA 2R9JA 3D4CA 3EHTA 2D21A 3ILUB 1FTLA 3Q29A 4U1OA 2I3VA 2QMXA 1PBQA 2RCBA 3CFXA 4DZ1A 1LBYA 3QK6A 4C1TA 1K9YA 3Q28A 2FIXA 1NV0A 4MCOA 4OEVA 3S9EA 3N6UA 4YKPA 1NUWA 2CEYA 2Y5LA 4RXLA 3TCGA 4IY6A 3TCFA 5EHMA 1B1HA 3U72A 1NI9A 2UVJA 4X8RA 2PBWA 2GHBA 1P1UA 4I3YA 4RK9A 4LATA 3PPNA 1WDNA 3H6UA 2QS1A 3TYHA 5A5LA 5CMCA 3SERA 2DYXA 1MG1A 1FBGA 2DE4A 4U22A 4O3CA 3FVKA 4MAGA 4I1DA 4LONB 2DVZA 4H8IA 1H3DA 2F6GA 4AS5A 4RPNA 3HHFA 2DS9A 2QVUA 1O64A 3Q27A 4HTGA 1FQDA 2ZNTA 3O66A 1AIVA 4PF8A 2R8TA 3BKIB 4KYDA 2RF1A 3ODBA 4U4XA 2ZZXA 3QIMA 4WEPA 1P99A 4HE1A 1FQFA 1PB7A 3OO8A 5IZ3B 3CSBA 4PGPA 5I7IA 2IEEA 3ZSFA 4KFQA 5J16A 4NWCA 2XWIA 3PMVA 2P1SA 4G8MA 4EXLA 3KGCA 3TTKA 1M5DA 1CB6A 4DI3D 4JDFA 4YB6A 4H0WA 2D3IA 3OEMA 1SYIA 4GX6A 2A5SA 2O69A 1FPJA 3JYRA 2V3UA 3IOWA 4NMYA 1PB8A 1EYIA 1IMEA 3JV9A 4FEDA 1MQJA 1MXVA 3GYYA 2ZXTA 4I40A 2GHAA 5ET7A 1MXYA 1M5BA 2UVIA 3PV0E 4NE4A 1B4HA 2RC9A 1K9ZA 2O84X 2CZHA 4GWYA 2DP8A 3UP9A 1P1OA 4OVQA 4IGRA 4N6PA 5I59B 1USYH 3IFAA 1ZJLA 5I56A 2F7CA 4EDPA 4MF3A 3RQTA 4QF9A 3PPOA 1FBCA 3GLBA 2B65A 3K6XA 1MPCA 3I6VA 1B52A 1EU8A 3K1NA 2UVHA 3DP4A 3RYDA 4PDDA 3VXCA 5HM4B 1SD3A 3PU5A 1N7WA 3K1MA 1FSAA 1JW1A 1OLAA 3DP8A 3PUXE 1PDAA 4OVSA 2VHAA 4ESWA 2PFZA 3FXBA 3T93B 1WVJA 4H46A 3TTRA 4FAJA 2ABHA 3MAMA 3GBAA 2PT2A 1AMFA 1B58A 5FBPA 3MVXA 2FNCA 5FTHA 4JBZA 1VR5A 3K6VA 5JTYA 1IXHA 1Q9DA 4XKRA 1Y3QA 2VOZA 4P9KA 1Q35A 5K2YA 2H99A 5M2VA 2PFYA 5DYHA 5AA2A 2Z22A 4JSOA 3O29A 3H4ZA 1S7YA 1EH3A 4DCYA 1EYJA 1SI1A 4KR5A 4MMPA 1RDZA 1F9BA 4F2OA 1GV8A 5B7DA 1BTJA 2XXRA 3TTNA 3IK6B 5I5PA 3T9HB 2I48A 3RUMA 3K6UA 3G7WA 3IB1A 5EYFA 3OXNA 1JNFA 3TFLA 3C36A 2PMSA 4OMBA 1NMUA 2E0SA 5EYHA 3VDFA 1NNPA 3CSGA 3KEIA 4PFRA 4TLLB 3N94A 2Q8MA 1FTMA 1IUDA 1LAXA 3C35A 1ZMGA 4XTCQ 4ZE8A 1PB9A 2VPNA 4MNCA 3PPRA 1IITA 1IXGA 1QUJA 3V8XB 1POTA 1Z7ME 2Y5KA 5H8NB 2CMOA 3FD3A 2THIA 3G3GA 1IMCA 1NL5A 2VT5A 3PUYE 4Q30B 4XIGQ 2AL5A 4HW8A 4LZ8A 4R75A 5I57A 4WXJA 3FASA 4X04A 5I56B 1L5TA 2GFEA 2DOJA 3E79A 3UGWA 3U94A 4H6DA 1FJ9A 2H98A 5IAIA 2OCUA 3TTLA 1P1WA 4GWZA 3FXQA 1FQEA 2F8DA 2VD2A 3MVWA 4PBQA 2GH9A 4ELOA 3ZS6A 5F24A 3G3JA 4NHBA 4IY5A 1FPIA 3K6WA 1DCUA 1SVXB 5AA3A 4GXAA 1D9QA 1FPBA 1B3GA 2ANJA 4H5FA 3M3KA 4YB7A 1KZ8A 1B7HA 4H67A 2RCAA 5EQ7A 4F39A 3OELA 1H43A 4POWA 4IO7A 4O7IA 5IGAA 3CI8A 1VFDA 1IQ7A 4P8BA 4FATA 4WKMA 3B8BA 4ECFA 4OVTA 1KWHA 3C31A 2B3FA 3TODA 3KC0A 3G3HA 4QSEA 5F7VA 3VVFA 3M3FA 1DPEA 2ZYNA 1B5JA 1UTHB 1FRPA 2Q89A 4MLVA 1XS5A 2O6AA 2ALUA 4H5GA 4PBHA 1LBXA 3PGFA 3L6GA 2I0BA 4BLAA 3ISPA 2YPNA 4OVJA 3HHGA 1NH8A 5AA1A 3NOHA 3TTMA 4KPTA 5CBRA 3MUQA 3CRBA 5KZTA 3BIHA 4JWYA 1RKMA 2XXUA 1Q1KA 1MM7A 4I62A 4MIJA 2CZKA 4DXBA 2KR0A 2WKYA 4N8YA 4IO5A 4JVCA 1NKXA 4FORA 5A5XB 2HAVA 5L9MA 1RYXA 1NUYA 1UTHA 2F3DA 1BIYA 4MNIA 4BDQA 1MY4A 3EN3A 3O6HA 3KN3A 1TT1A 3KJ7A 4PDHA 3W9VA 3QMFA 4UABA 3MZ1A 4BDNA 1QKBA 1I6QA 1XI6A 1LAHE 4G4PA 3MWBA 4EF1A 4GL0A 4R73A 5H8FB 1URDA 4LUBA 5FHMA 2O1LA 1MPBA 1FJ6A 2VD3A 5H8QB 4F3GA 2XXPA 4RK2A 1LFIA 5H8HA 3B50A 3LSXA 3EHUA 1I6AA 4NAPA 4GX4A 4AQ4A 1J1NA 2HCAA 4ZZAA 2F78A 3MP8A 4OZ9A 5TPAB 3V89B 1ELJA 4PFWA 1LSTA 1NV3A 1H45A 4ELPA 4ND9A 4ZEFA 3H7MA 2HXRA 3KN8A 4OESA 2F7BA 2REJA 2UYFA 3Q26A 3A3CA 1QULA 3RN8A 3T0JA 3UIFA 4IO6A 2OX3A 3PMXA 4PFUA 1MM6A 1A8FA 2M8CA 1A8EA 2XXVA 2I3WA 3S9LC 5FHOA 3E9XA 4MNPA 2DQVA 4K3FA 4GIZA 4ZZEA 3G3KA 3VVDA 3OSRA 2F3BA 4QFLA 3VXBA 5CM6A 5CI5A 1HSLA 2H25A 3R7XA 4O94A 1G0HA 1M5EA 4Z0IA 3TQLA 1LAGE 1BLFA 4ZS9A 2AYSA 4I3EA 3QYTA 4QSCA 2DXRA 4EQ7A 4YB5A 1O63A 5TP9B 1XHYA 1ZTYA 4N17A 4MHFA 4KHZE 3LR1A 4MJOA 4OETA 3O2AA 4QHQA 2XD2A 2QVRA 2Q88A 2MKZA 2UXAA 2F34A 1VFEA 1Y4CA 4WEDA 3MQ9A 2OLBA 1A7LA 2OBGA 3K4UA 1MY1A 4DDDA 4POXA 2H5YA 4ZDMA 2XD3A 2XXQA 3MP6A 5TPAA 3T22A 2R6GE 4GWOA 4NF4B 1OVTA 2QMWA 2QL3A 1OQGA 4QFKA 3H03A 1JEVA 1MY3A 1DTGA 1NV7A 2DWJA 4F1YA 2XX8A 5B70A 1N84A 3MZ9A 3SEVA 3MPLA 2F35A 3W15C 2X7PA 3KC1A 4ZEDA 4PFYA 4R6HA 2DSFA 4LN5A 3IJXB 4XF5A 3TQWA 1M5CA 4I8CA 5CC2A 1ANFA 3ECRA 4BDLA 2CEXA 1FBFA 3C32A 1QKAA 2DVCA 2XHDA 4DE8A 3WAFA 4OFJA 5AA2B 4DXCA 4QFPA 2XWOA 1NV5A 1MQDA 4NTLA 1AH5A 3V83A 4RA1A 3MBPA 3O9PA 5H8HB 3G3IA 5EQ8A 4GF8A 3KFMA 2UVGA 4IR8A 1XT8A 1SDXA 1EZOA 1BKAA 4LZ7A 4JVDA 3E13X 4X48A 2Q8JA 1NNKA 4OHNA 3EPEA 2DE3A 4L17A 3EKIA 1QUIA 4X1DA 3TAJA 4PC9A 2QFLA 1FPEA 1B3FA 3HFUA 3KOTA 4LVQA 4QRZA 4H45A 4GOTA 3RTWB 2G93A 3QUJA 1B7UA 4OVRA 5IM2A 2WX9A 4JSDA 1N3WA 1SQYA 3H06B 2OWSA 1XVYA 2OWTA 2QJEA 3FJGA 4Q0CA 2GQ1A 4NF6A 2XXIA 3O6GA 3GZGA 1FQAA 4R6YA 4OQOA 3OSQA 4Q8RA 5I59A 1MDQA 2Y7RA 4N6KA 1FPKA 5DT6A 5IZ3A 4BDRA 1LAFE 5I2KA 3LV0A 1R9QA 4PGNA 4X9TA 2FBPA 1MPDA 4R6KA 4OANA 2AIXA 2OZZA 2V3QA 1LBBA 3U1OA 4QFOA 1UQWA 2V93A 4R2BA 5I2NB 3RPLB 3O28A 4P3LA 3HN0A 1IMFA 3T9UA 1SW5A 1MDP1 1ZBMA 2XWKA 1M5FA 1DK4A 2OWZA 1NNTA 5IZ1A 4JB7A 2A5TA 2I6EA 4YZZA 1JW4A 4QBAA 1FTOA 4G77A 4H1XA 3IX1A 1B5IA 1MQIA 4GWWA 2DDKA 3CFZA 3RPLA 1D9YA 3FV1A 1P1NA 4YAHX 3PD8A 1IMAA 5IZZA 1OQHA 1LFGA 2XX7A 3RY3A 5ET5A 4Q5TA 1A55A 4F2QA 3D1RA 3LUZA 4F29A 1JVXA 2O7IA 3IR1A 3N5LA 2QS3A 2I49A 1OMPA 4X1BA 2O7UA 3T9XB 3CHGA 4KCDA 1VE4A 1II5A 4IB2A 2GRVA 2RINA 3OO7A 4G8HA 1LBCA 4GD5A 1JP4A 1A54A 4XKPA 1IMDA 2Z8FA 4G8NA 5ELVA 2QS4A 2I4BA 3U65A 2HZLA 1FPDA 3A29A 4ZE9A 1YYZA 2Y7PA 3IB2A 3TMGA 3B7DA 4DXUA 3DELB 2REGA 3HCQA 4E0WA 3BFTA 5I57B 5H8QA 4DLDA 3BBRA 3I3VA 2Q74A 1B4ZA 3MSTA 5AA4A 4H8JA 5TU0A 1BK4A 3SEWA 3CIJA 2RKMA 4BDMA 5ICTA 3K2DA 4PE3A 2Z8DA 1LB9A 3C4MA 1Y1MA 2ZYKA 4N07A 1NH7A 1S9TA 4G68C 3IB0A 3ILTB 4F1UA 1B3LA 1QVSA 2WBBA 1OLCA 1G0IA 3FBPA 2WYPA 3PUVE 2VGQA 3BFUA 4KCCA 3MP1A 3GBBA 1SW1A 5F1QA 4PETA 4LP2B 4MX6A 2Y84A 4MFIA 4R72A 4G61A 3ONMA 1N04A 3AXFA 4R9FA 3CVGA 4P56A 2OK2A 1TXFA 4DCXA 1UIVA 4PTKA 2RC8A 5T3JA 4G68A 4BDOA 1FW0A 4U4SA 1JQFA 2X7QA 3MYUA 4ZEBA 1BP5A 5EHSA 3JZJA 1Y9UA 1MY0A 1Y20A 1VDWA 2I0CA 5EYGA 1PEBA 4YKJA 4O7MA 1NV4A 1PBPA 3PUWE 4R9GA 2H4IA 3MC2A 1N76A 2Z23A 2Z8EA 3R26A 1MXZA 1B3EA 4FEBA 4ELRA 3CFLA 3KBZA 2XA5A 4THIA 4NN3A 3O97A 2YJPA 1B1XA 2PCRA 3HSTA 1JETA 1I6BA 1B46A 2XX9A 1QJMA 1B6HA 3SEYA 4PFBA 4NF8A 4FJPA 3F11A 2QPQA 4XKNA 5J1DA 4EXKA 3FVOA 4P11A 2E1SA 2F6PA 4QSDA 3ZKLA 4I9DA 1POY1 4HXVA 1CNQA 4GVOA 3ZKKA 3HV1A 2XXKA 3FGSA 4TQUQ 4F19A 3FJ7A 4AS4A 1H44A 2O68A 1YXIA 3G3FA 1IIWA 4OYVA 3LSWA 1S50A 1LBZA 3N6TA 4NX1A 1FTAA 3FXUA 2O1MA 4EF2A 4NF6B 4KI0E 1YAEA 1Z7NE 1HSJA 4KQPA 3IAZA 1SBPA 3MVZA 1MY2A 4GX3A 3TEPA 4EUOA 1JW5A 2VPOA 1YPNA 3MZBA 3QAXA 3E78A 1YCJA 3FUZA 3FXRA 1RDYA 4IO3A 1Y4TA 2F5XA 2HQ0A 1LEVA 1N3XA 1LBVA 2ZNUA 1Y3PA 3K01A 4PAKA 1SI0A 3U93A 5L9OA 5DEXB 1NFTA 2HAUA 3IJOB 1RYOA 4ZEIA 3H6VA 1B5HA 4NF8B 4NF0A 3KOSA 3SEXA 3SDFA 5CBSA 2XXXA 1TFAA 1US4A 5DW8A 2A5TB 4N8GA 3VLUA 2ONKE 4MH5A 1QUKA 4FBPA 5H8FA 2VP1A 2X26A 5BUUA 1LBWA 2KQZA 4F31B 1RDXA 4RY1A 2RC7A 2YLNA 3FATA 3CR9A 3FVGA 3VLVA 1JVYA 3LUYA 5I2NA 2F97A 3KG2A 4PE5B 1JEUA 4NEDA 4U21A 2Y7IA 4R2FA 4H65A 5EQAA 4EQBA 3A3UA 2B4LA 3QUFA 4NF5A 3IFCA 1GVCA 3LBSA 3OOAA 3MPKA 5EQ9A 1GTKA 1URGA 1YZ0A 2P0SA 1FPLA 3KZGA 5LDZA 5ESYA 2FYIA 5DVJA 4YICA 3GXAA 1ZLQA 3HO7A 4KD5A 3PMWA 1IEJA 2O51A 1FQBA 2NUVA 2L5VA 1IXIA 3LSFB 5CRYA 4F1VA 2QRYA 2ONSA 3SETA 5JTYB 3K0VA 5KDTB 2P3NA 3RPWA 1IMBA 1AOVA 4AB5A 1D3KA 1GR2A 3LSLA 3M8UA 4O8MA 2P2AA 5IKBA 5CMBA 4GXSB 4Z7EA 5HPQA 2FVZA 4XKQA 5H8SA 1B2HA 4IO2A 3B6TA 1T0KA 3UORA 2ZMBA 4HCYA 3PD9A 3B6QA 4ISUA 5FHNA 3C33A 3K02A 4N13A 3BIGA 5FTIA 2D5WA 3RNNA 4P1LA 5KDTA 4KXPA 5L8DA 4LQ5A 4OFOA 1A99A 4XXUA 1QW0A 3T9VA 1R6ZA 3N26A 2DWHA 4U2RA 3FVNA 4F3BA 4DI4B 1URSA 1DBZA 1MRPA 2V4CA 3I5OA 3IOUA 5BWJA 4PAIA 3K00A 3C9HA 1ATGA 3V5AA 5LTCA 1VSOA 1LFHA 2ZYOA 1IZ1A 1OVBA 1I69A 4LZ5A 4YU0A 1TFDA 1LGBC 3PPPA 1O7TA 4RNSA 4LQ2A 2KLFA 2Q9TA 3EQ1A 4F18A 4OFLA 5DTBA 2LAOA 4PF6A 2I4CA 3S2VA 3SKPA 4R74A 4GFRA 4PCDA 1QGXA 5CMKA 1B9JA 3TUSA 3TELA 4RJZA 3Q25A 4N4UA 4F22A 3OENA 3T66A 3C34A 3KSJA 1MXXA 1DPPA 2WBDA 4GLIA 2JJKA 2UYEA 5KCJB 2ZZWA 3UK4A 2HZKA 1DOTA 1MQGA 1SPIA 4FE8A 4UA8A 3R6UA 1H76A 4PFTA 5AA2D 5JEIA 1A40A 3TCHA 5ITPA 4MLQA 4PP0A 1NV2A 4YKIA 4NF5B 1XC1A 2HEUA 4P1EA 4JVIA 2R71A 3IL1B 3CG1A 3TZAA 3U8QA 1FBHA 1FPFA 4ZEKA 2PYYA 3MJNA 1FCKA 4ONYA 4E0XA 3O6IA 3S9MC 4OTEA 3B6WA 1KA1A 2V25A 2BJJX 1SW2A 4C0RA 3PTYA 4LA9A 4OWDA 3IOVA 4O3BA 1ZIUA 3A09A 2P3VA 3OO9A 4QFNA 2HPGA 3RT8A 4JWOA 2Y7WA 4YKKA 3DM0A 1NUXA 1R1NA 3MVYA 4JWXA 4XFEA 4P0GA 5A5XA 3SESA 4GWUA 1TWYA 4ESXA 1WODA 4QXDA 2CZLA 2F36A 1INPA 4RYAA 1DMBA 1NUZA 4PQJA 4JXIA 5K2XA 1NV1A 4RPOA 5I2KB 2CZIA 1MH4A 4PAFA 1FBEA 2HFBA 1R9LA 2DWAA 4P0IA 3UA8A 4IGTA 2W7YA 5JK4A 1GGGA 4FECA 2V84A 1B3HA 1OIBA 3KBRA 1AL3A 1MXUA 1B40A 1IXCA 2XXWA 1FPGA 4TLMB 5I58B 2ZZVA 1SYHA 4NG7A 5CMMA 4F3PA 5ISUA 4UACA 3KSXA 5LOMA 4GRKA 2ZYMA 1UIUA 5DVFA 1UTBA 1B51A 3KN7A 2I58A 4G2ZA 3FJMA 1B05A 3IO6A 3DP6A 4GQOA 5HBCA 4P47A 1NNFA 2XXTA 4OVPA 3USDA 1B0HA 3D4GA 3SZPA 2WEFA 3TKDA 3ROJA 1N7XA 3FZVA 3LC8A 2ZNSA 1Y3NA 2DE2A 5AE4A 4KYEA 3EHSA 3S4UA 1FBDA 1N0TA 2FA7A 4YMAA 4OXVA 4N91A 2XWVA 4HE2A 4PFIA 4GBWA 1D4NA 2AL4A 2QSXA 1FTJA 5DEXA 5I84A 4OA4A 1B0LA 1Y1ZA 5I58A 4FIMA 5ET8A 2B4MA 2G29A 4GWXA 2DXYA 1FQCA 3T96B 4AB6A 2NOOA 2QS2A 4NF4A 2Q2CA 2QVVA 3MW0A 2IA4A 1EZ9A 3EF7A 1PC3A 2ONRA 2XXHA 4KYSA 1LCFA 2PT1A 3SEUA 5TP9A 4C1UA 1LCTA 2Q2AA 5I3SA 3DLNA 4ELQA 1AWBA 1EZPA 1B32A 3RTFB 4OEUA 3E3KA 4M4GA 1P1QA 4G68B 1FTKA 3W9WA 2NWJA 2FHYA 4HCWA
chains in the Genus database with same CATH topology
4IO4A 1MXWA 1D9VA 3U92A 1MS7A 2XXXA 1TFAA 1ZMGA 1US4A 3QXMA 4U23A 4XTCQ 2A5TB 1MH3A 5ICQA 3PPQA 4ZE8A 1PB9A 3H6WA 3VLUA 3V83A 2ONKE 4RA1A 3H3GA 2PVUA 4MH5A 3MBPA 3O9PA 3PUZE 3G3IA 3K1PA 4GF8A 3KFMA 2UVGA 1QUKA 5H8HB 1XT8A 3PPRA 5H8FA 1IITA 2VP1A 2X26A 1IXGA 5KCJA 1QUJA 2H9BA 5BUUA 3V8XB 1SDXA 2HXWA 1EZOA 1POTA 1Z7ME 3RT6B 4F31B 1CE2A 4RY1A 4OERA 2RC7A 5H8NB 4DIGA 2CMOA 1BKAA 3OEKA 3M3LA 4LZ7A 3FD3A 2THIA 3E13X 3G3GA 4X48A 2YLNA 2Q8JA 1NL5A 2DWIA 4MBPA 1NNKA 2ESNA 4OHNA 3FATA 3CR9A 2DE3A 3EPEA 3FVGA 3PUYE 4Q30B 1JVYA 3LUYA 4XIGQ 3VLVA 2AL5A 4L17A 5I2NA 4HS7A 2F97A 1QUIA 3KG2A 4PE5B 5ITOA 1JEUA 4NEDA 4X1DA 4HW8A 5CBSA 4LZ8A 4EQ9A 4M1VA 3TAJA 4R75A 4U21A 3VVEA 2Y7IA 3L6HA 4R2FA 5I57A 4H65A 3RLFE 3OO6A 1B3FA 4EQBA 3A3UA 3FASA 4WXJA 3QUFA 1USYE 3P7IA 5I56B 4NF5A 1GVCA 3KOTA 3LBSA 1L5TA 3OOAA 3QSLA 1LB8A 4LVQA 2GFEA 3FIRA 1DTZA 3CG3A 2DOJA 3MPKA 1GTKA 4QRZA 1URGA 4GOTA 3UGWA 3U94A 3RTWB 2G93A 3QUJA 3THIA 1B7UA 1B7ZA 2P0SA 3KZGA 4H6DA 2H98A 5IAIA 1LLSA 4JSDA 5L9SA 1N3WA 1SQYA 2FYIA 2OCUA 3H06B 5DVJA 1P1WA 2OWSA 1XVYA 2PX1A 3FXQA 4YICA 3TTLA 2OWTA 3GXAA 1FQEA 1ZLQA 2F8DA 2QJEA 2VD2A 3FJGA 4Q0CA 3HO7A 4KD5A 3PMWA 2NXOA 3MVWA 1IEJA 4NF6A 4F3SA 3VLWA 2GH9A 4O3AA 2XXIA 4U1ZA 3O6GA 4ELOA 3GZGA 2O51A 5DVIA 1XOCA 3UN6A 3ZS6A 1FQBA 2NUVA 3G3JA 1IXIA 1FQAA 3E4RA 4R6YA 3LSFB 5CRYA 1MQHA 4OQOA 3OSQA 4F1VA 1SW4A 4Q8RA 3HPIA 2QRYA 5I59A 1MDQA 2Y7RA 4IY5A 2ONSA 5DT6A 3K6WA 3SETA 4BDRA 1LAFE 4TOZA 3VE1B 5JTYB 5I2KA 1R9QA 3KJTA 2V3TA 4YMBA 4X9TA 1SVXB 1DSNA 5AA3A 4GXAA 3K0VA 3OD7A 5KDTB 3S9NC 1MPDA 3TPAA 4R6KA 3H6TA 3IO4A 3RPWA 1ZU0A 1B3GA 2ANJA 4H5FA 4AB5A 1AOVA 1D3KA 3M3KA 4OENA 1GR2A 2AIXA 2OZZA 3LSLA 3M8UA 4YB7A 2V3QA 1B7HA 2P2AA 1LBBA 1XVXA 3U1OA 4GL8A 2RCAA 4H67A 4QFOA 5IKBA 4F39A 5CMBA 1UQWA 2V93A 3IORA 4R2BA 5I2NB 2XXYA 3OELA 2NVUB 3RGYA 2OJTA 3TDJA 1H43A 4GXSB 4Z7EA 5HPQA 3O28A 4IO7A 2F7AA 4POWA 3CI8A 4XKQA 1B2HA 1YTVA 5H8SA 3HN0A 3T9UA 1SW5A 1VFDA 4IO2A 1MDP1 3B6TA 1US5A 3OMBA 1ZBMA 1IQ7A 3WAEA 3VFJA 1T0KA 4NWDA 3UORA 5AA4B 2ZMBA 3IOTA 4HCYA 4XXUA 5H8NA 4FATA 3PD9A 4WKMA 3B6QA 4ISUA 5FHNA 1M5FA 3C33A 3K02A 4ECFA 1ZKBA 2Y7KA 4N13A 1KWHA 1UTBB 3C31A 3VV5A 2B3FA 5FTIA 1NNTA 3TODA 2D5WA 3FV2A 2B3BA 3G3HA 4JB7A 3RNNA 1HSEA 5KDTA 2A5TA 4QSEA 5F7VA 2I6EA 5L8DA 4LQ5A 5EHMA 4YZZA 2R9JA 3D4CA 3M3FA 4OFOA 1DPEA 3VVFA 1JW4A 1A99A 3EHTA 2ZYNA 1FTOA 1B5JA 2D21A 1UTHB 2Q89A 1FTLA 3ILUB 4G77A 1QW0A 1B5IA 1MQIA 1R6ZA 3IX1A 1XS5A 4H1XA 3N26A 3T9VA 2DWHA 2O6AA 2ALUA 3Q29A 4U1OA 3CFZA 4U2RA 1D9YA 3FV1A 4H5GA 3FVNA 1P1NA 4YAHX 2I3VA 2QMXA 1PBQA 4F3BA 3PD8A 1URSA 2RCBA 3CFXA 3PGFA 4DZ1A 1OQHA 1MRPA 3L6GA 3QK6A 2I0BA 4BLAA 4C1TA 2YPNA 3Q28A 1LFGA 4OEVA 2XX7A 3I5OA 4OVJA 3S9EA 3N6UA 3HHGA 1NH8A 5AA1A 4YKPA 3IOUA 2NWJA 3RY3A 5BWJA 3K00A 4Q5TA 3TTMA 1A55A 3C9HA 4KPTA 1ATGA 3MUQA 5CBRA 4F2QA 4RXLA 3CRBA 5KZTA 3V5AA 3TCGA 4F29A 1JVXA 1VSOA 2O7IA 3IR1A 3N5LA 2QS3A 4IY6A 2ZYOA 3TCFA 1LFHA 4JWYA 1IZ1A 1OVBA 1I69A 1OMPA 1RKMA 1B1HA 2I49A 2XXUA 1TFDA 4LZ5A 4X1BA 4YU0A 1LGBC 1Q1KA 3PPPA 3U72A 2O7UA 1MM7A 1O7TA 4RNSA 3T9XB 4I62A 4KCDA 4LQ2A 1VE4A 2UVJA 2PBWA 4DXBA 1II5A 1P1UA 2GHBA 2WKYA 2KLFA 2Q9TA 3EQ1A 4F18A 4OFLA 5DTBA 2LAOA 4IO5A 2I4CA 4RK9A 3S2VA 3SKPA 4IB2A 4R74A 4LATA 3PPNA 1NKXA 2GRVA 1WDNA 3H6UA 4FORA 2HAVA 2QS1A 2RINA 3OO7A 4GFRA 3TYHA 5L9MA 4G8HA 1LBCA 4GD5A 5CMCA 1A54A 1B9JA 5CMKA 3TUSA 1RYXA 4XKPA 3TELA 2Z8FA 4G8NA 5ELVA 3SERA 2DYXA 1UTHA 3Q25A 2QS4A 1MG1A 4RJZA 2I4BA 4F22A 1BIYA 2HZLA 3OENA 3T66A 4BDQA 4ZE9A 1MY4A 3EN3A 3C34A 2Y7PA 3IB2A 3O6HA 3TMGA 3SEWA 3KSJA 1MXXA 2DE4A 4U22A 1DPPA 3KN3A 3B7DA 4DXUA 3DELB 2REGA 4GLIA 4O3CA 3HCQA 3FVKA 2UYEA 4E0WA 1TT1A 5KCJB 3BFTA 3KJ7A 5I57B 3UK4A 2HZKA 1DOTA 1MQGA 5H8QA 3W9VA 4I1DA 4LONB 4DLDA 2DVZA 4H8IA 3BBRA 3I3VA 1H3DA 4FE8A 3MZ1A 1B4ZA 2F6GA 4BDNA 5AA4A 1QKBA 4RPNA 3HHFA 1I6QA 3R6UA 4H8JA 1H76A 4PFTA 4UA8A 5AA2D 2DS9A 5JEIA 1A40A 5TU0A 1LAHE 3TCHA 5ITPA 1O64A 4MLQA 4PP0A 3Q27A 4HTGA 1FQDA 2ZNTA 2RKMA 3CIJA 3O66A 3K2DA 4G4PA 3MWBA 4YKIA 4BDMA 2Z8DA 4NF5B 1LB9A 1XC1A 2HEUA 3C4MA 1AIVA 2R71A 3IL1B 3BKIB 1Y1MA 2ZYKA 4N07A 4KYDA 4EF1A 2RF1A 3CG1A 4GL0A 1NH7A 4R73A 5H8FB 3TZAA 3ODBA 4U4XA 1S9TA 1URDA 4LUBA 4G68C 3U8QA 4ZEKA 3IB0A 3ILTB 4F1UA 1B3LA 3QIMA 5FHMA 4WEPA 1QVSA 1OLCA 1P99A 2PYYA 2O1LA 1MPBA 1FQFA 3MJNA 3PUVE 1FCKA 2VGQA 3BFUA 4KCCA 1PB7A 3MP1A 3OO8A 4ONYA 4E0XA 3O6IA 3GBBA 4NTLA 1SW1A 4OTEA 3CSBA 3S9MC 5F1QA 4PETA 2VD3A 3B6WA 2IEEA 2V25A 3ZSFA 4KFQA 2BJJX 4LP2B 1SW2A 4NWCA 4C0RA 2Y84A 5H8QB 4F3GA 3PMVA 2P1SA 4G8MA 4MFIA 3KGCA 4R72A 2XXPA 4EXLA 3TTKA 4RK2A 1LFIA 4LA9A 5H8HA 1M5DA 3LSXA 1CB6A 1N04A 3EHUA 3IOVA 3ONMA 4OWDA 3AXFA 4R9FA 4JDFA 4O3BA 1I6AA 4YB6A 3CVGA 1ZIUA 3A09A 2D3IA 4H0WA 3OO9A 2OK2A 4QFNA 3OEMA 1TXFA 4DCXA 1SYIA 3RT8A 4AQ4A 1J1NA 1UIVA 2Y7WA 4JWOA 2A5SA 2HCAA 2O69A 2F78A 2RC8A 3DM0A 3MP8A 4OZ9A 4YKKA 4ZZAA 4G68A 4BDOA 3JYRA 1FW0A 1R1NA 2V3UA 3IOWA 4NMYA 4U4SA 1JQFA 3MVYA 5TPAB 4JWXA 2X7QA 1PB8A 4P0GA 5A5XA 3SESA 4ZEBA 3JV9A 1BP5A 5EHSA 4FEDA 3V89B 1TWYA 3JZJA 4ESXA 1MQJA 1ELJA 1Y9UA 1WODA 1MXVA 4PFWA 1MY0A 2ZXTA 1LSTA 4ELPA 1H45A 1Y20A 4ND9A 4ZEFA 2CZLA 3H7MA 2GHAA 3TFLA 2F36A 2I0CA 1PEBA 3KN8A 4OESA 1MXYA 2F7BA 2REJA 1M5BA 2UVIA 4RYAA 4YKJA 1DMBA 2UYFA 4PQJA 4JXIA 1PBPA 5K2XA 3Q26A 3PV0E 4NE4A 3PUWE 4RPOA 4R9GA 1B4HA 3A3CA 2RC9A 1QULA 2O84X 5I2KB 3RN8A 3UP9A 2DP8A 2H4IA 3MC2A 1MH4A 3UIFA 1N76A 1P1OA 2Z23A 2Z8EA 4IGRA 4IO6A 3R26A 2HFBA 4N6PA 5I59B 1R9LA 1MXZA 2DWAA 4P0IA 1B3EA 1USYH 3PMXA 4FEBA 3UA8A 4IGTA 2W7YA 4ELRA 1GGGA 4PFUA 1ZJLA 5JK4A 4FECA 1MM6A 2V84A 2F7CA 4EDPA 5I56A 3CFLA 1A8FA 4MF3A 2M8CA 1A8EA 2XXVA 2I3WA 4THIA 3S9LC 1B3HA 3RQTA 4QF9A 5ICTA 3O97A 2YJPA 3PPOA 5FHOA 1OIBA 3GLBA 2B65A 3KBRA 1AL3A 1MXUA 1B40A 1B1XA 1IXCA 2XXWA 3E9XA 4TLMB 5I58B 2DQVA 3HSTA 3K6XA 4K3FA 1JETA 4GIZA 1MPCA 4ZZEA 1I6BA 1B46A 2XX9A 3G3KA 3VVDA 3OSRA 4QFLA 1QJMA 3VXBA 5CM6A 1B6HA 1SYHA 3I6VA 3SEYA 5CI5A 5CMMA 1B52A 1HSLA 4F3PA 5ISUA 2H25A 1EU8A 3R7XA 4NF8A 4FJPA 1M5EA 3F11A 3K1NA 2UVHA 3KSXA 4UACA 3DP4A 1LAGE 1BLFA 4ZS9A 4GRKA 4Z0IA 3TQLA 5LOMA 2AYSA 2QPQA 3VXCA 3QYTA 4XKNA 5J1DA 2ZYMA 1UIUA 2DXRA 4QSCA 4EQ7A 4EXKA 4YB5A 5HM4B 3FVOA 5DVFA 1SD3A 1UTBA 3PU5A 4P11A 1O63A 2E1SA 1B51A 3KN7A 2F6PA 1N7WA 2I58A 4G2ZA 1XHYA 1ZTYA 5TP9B 3FJMA 3K1MA 1B05A 3IO6A 4QSDA 3ZKLA 3DP6A 4GQOA 5HBCA 4I9DA 4F2OA 1JW1A 1POY1 4KHZE 1OLAA 1NNFA 2XXTA 3LR1A 3USDA 4OETA 1B0HA 3DP8A 3O2AA 3D4GA 3PUXE 1PDAA 4GVOA 3ZKKA 2VHAA 3HV1A 4QHQA 3TKDA 3FGSA 4ZECA 4ESWA 1N7XA 2XD2A 1WVJA 3FZVA 3LC8A 2ZNSA 1Y3NA 2DE2A 4TQUQ 3T93B 4KYEA 5AE4A 3TTRA 4MLVA 2Q88A 2UXAA 4FAJA 2ABHA 4F19A 3EHSA 3MAMA 3GBAA 3S4UA 3FJ7A 2PT2A 2F34A 1AMFA 1VFEA 1Y4CA 1H44A 4WEDA 2O68A 3MQ9A 2OLBA 1B58A 1N0TA 1A7LA 3MVXA 2FA7A 2FNCA 4YMAA 4OXVA 5FTHA 3G3FA 2OBGA 1VR5A 1MY1A 3K4UA 4JBZA 4POXA 4DDDA 3K6VA 5JTYA 1IXHA 4XKRA 1IIWA 1Y3QA 2VOZA 4OYVA 2H5YA 4ZDMA 1Q35A 5K2YA 2H99A 2XD3A 2XXQA 1S50A 3LSWA 3MP6A 5TPAA 3T22A 1D4NA 2R6GE 3N6TA 5M2VA 4GWOA 4NF4B 2AL4A 2QSXA 1FTJA 1OVTA 5DEXA 2Z22A 2QMWA 5DYHA 5A5XB 5AA2A 4JSOA 3O29A 3H4ZA 5I84A 2QL3A 3FXUA 2O1MA 1S7YA 1B0LA 1EH3A 1Y1ZA 1OQGA 4DCYA 4EF2A 4QFKA 3H03A 5I58A 1JEVA 4NF6B 4KI0E 1YAEA 1Z7NE 4FIMA 1MY3A 1DTGA 2DWJA 1SI1A 4F1YA 1HSJA 4KR5A 2XX8A 4KQPA 2G29A 5B70A 1N84A 1F9BA 1SBPA 3IAZA 3MZ9A 1BTJA 3MVZA 2XXRA 1MY2A 2DXYA 1GV8A 3SEVA 5B7DA 1FQCA 3MPLA 2F35A 3T96B 3TEPA 4AB6A 2NOOA 3TTNA 2QS2A 3IK6B 3W15C 4NF4A 4EUOA 1JW5A 3T9HB 2Q2CA 1YPNA 3MZBA 2X7PA 3MW0A 2IA4A 3QAXA 2I48A 1YCJA 4ZEDA 4PFYA 1EZ9A 3FUZA 3K6UA 4R6HA 2DSFA 3RUMA 3EF7A 3FXRA 1PC3A 2ONRA 2XXHA 3G7WA 3IB1A 1Y4TA 3IJXB 4IO3A 4KYSA 2F5XA 1LCFA 2HQ0A 5EYFA 3OXNA 1JNFA 1N3XA 3TQWA 1M5CA 3C36A 2PT1A 2ZNUA 4I8CA 3SEUA 1Y3PA 2PMSA 4OMBA 5TP9A 3K01A 5CC2A 4C1UA 1LCTA 2Q2AA 1NMUA 1ANFA 3ECRA 1SI0A 3DLNA 2E0SA 4BDLA 4ELQA 3U93A 3VDFA 1NNPA 3CSGA 1EZPA 3C32A 1QKAA 2DVCA 2XHDA 1B32A 3RTFB 4OFJA 3WAFA 4DE8A 5L9OA 4OEUA 3KEIA 5DEXB 1NFTA 5AA2B 4TLLB 3E3KA 3N94A 4M4GA 2HAUA 1FTMA 3IJOB 1RYOA 4DXCA 3H6VA 1B5HA 1P1QA 1IUDA 4NF8B 4G68B 4QFPA 4ZEIA 3KOSA 1FTKA 1LAXA 3SDFA 3C35A 3SEXA 3W9WA 1MQDA 4HCWA 1AH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO4 A;  1MXW A;  1D9V A;  3U92 A;  1MS7 A;  2XXX A;  1TFA A;  1ZMG A;  1US4 A;  3QXM A;  4U23 A;  4XTC Q;  2A5T B;  1MH3 A;  5ICQ A;  3PPQ A;  4ZE8 A;  1PB9 A;  3H6W A;  3VLU A;  3V83 A;  2ONK E;  4RA1 A;  3H3G A;  2PVU A;  4MH5 A;  3MBP A;  3O9P A;  3PUZ E;  3G3I A;  3K1P A;  4GF8 A;  3KFM A;  2UVG A;  1QUK A;  5H8H B;  1XT8 A;  3PPR A;  5H8F A;  1IIT A;  2VP1 A;  2X26 A;  1IXG A;  5KCJ A;  1QUJ A;  2H9B A;  5BUU A;  3V8X B;  1SDX A;  2HXW A;  1EZO A;  1POT A;  1Z7M E;  3RT6 B;  4F31 B;  1CE2 A;  4RY1 A;  4OER A;  2RC7 A;  5H8N B;  4DIG A;  2CMO A;  1BKA A;  3OEK A;  3M3L A;  4LZ7 A;  3FD3 A;  2THI A;  3E13 X;  3G3G A;  4X48 A;  2YLN A;  2Q8J A;  1NL5 A;  2DWI A;  4MBP A;  1NNK A;  2ESN A;  4OHN A;  3FAT A;  3CR9 A;  2DE3 A;  3EPE A;  3FVG A;  3PUY E;  4Q30 B;  1JVY A;  3LUY A;  4XIG Q;  3VLV A;  2AL5 A;  4L17 A;  5I2N A;  4HS7 A;  2F97 A;  1QUI A;  3KG2 A;  4PE5 B;  5ITO A;  1JEU A;  4NED A;  4X1D A;  4HW8 A;  5CBS A;  4LZ8 A;  4EQ9 A;  4M1V A;  3TAJ A;  4R75 A;  4U21 A;  3VVE A;  2Y7I A;  3L6H A;  4R2F A;  5I57 A;  4H65 A;  3RLF E;  3OO6 A;  1B3F A;  4EQB A;  3A3U A;  3FAS A;  4WXJ A;  3QUF A;  1USY E;  3P7I A;  5I56 B;  4NF5 A;  1GVC A;  3KOT A;  3LBS A;  1L5T A;  3OOA A;  3QSL A;  1LB8 A;  4LVQ A;  2GFE A;  3FIR A;  1DTZ A;  3CG3 A;  2DOJ A;  3MPK A;  1GTK A;  4QRZ A;  1URG A;  4GOT A;  3UGW A;  3U94 A;  3RTW B;  2G93 A;  3QUJ A;  3THI A;  1B7U A;  1B7Z A;  2P0S A;  3KZG A;  4H6D A;  2H98 A;  5IAI A;  1LLS A;  4JSD A;  5L9S A;  1N3W A;  1SQY A;  2FYI A;  2OCU A;  3H06 B;  5DVJ A;  1P1W A;  2OWS A;  1XVY A;  2PX1 A;  3FXQ A;  4YIC A;  3TTL A;  2OWT A;  3GXA A;  1FQE A;  1ZLQ A;  2F8D A;  2QJE A;  2VD2 A;  3FJG A;  4Q0C A;  3HO7 A;  4KD5 A;  3PMW A;  2NXO A;  3MVW A;  1IEJ A;  4NF6 A;  4F3S A;  3VLW A;  2GH9 A;  4O3A A;  2XXI A;  4U1Z A;  3O6G A;  4ELO A;  3GZG A;  2O51 A;  5DVI A;  1XOC A;  3UN6 A;  3ZS6 A;  1FQB A;  2NUV A;  3G3J A;  1IXI A;  1FQA A;  3E4R A;  4R6Y A;  3LSF B;  5CRY A;  1MQH A;  4OQO A;  3OSQ A;  4F1V A;  1SW4 A;  4Q8R A;  3HPI A;  2QRY A;  5I59 A;  1MDQ A;  2Y7R A;  4IY5 A;  2ONS A;  5DT6 A;  3K6W A;  3SET A;  4BDR A;  1LAF E;  4TOZ A;  3VE1 B;  5JTY B;  5I2K A;  1R9Q A;  3KJT A;  2V3T A;  4YMB A;  4X9T A;  1SVX B;  1DSN A;  5AA3 A;  4GXA A;  3K0V A;  3OD7 A;  5KDT B;  3S9N C;  1MPD A;  3TPA A;  4R6K A;  3H6T A;  3IO4 A;  3RPW A;  1ZU0 A;  1B3G A;  2ANJ A;  4H5F A;  4AB5 A;  1AOV A;  1D3K A;  3M3K A;  4OEN A;  1GR2 A;  2AIX A;  2OZZ A;  3LSL A;  3M8U A;  4YB7 A;  2V3Q A;  1B7H A;  2P2A A;  1LBB A;  1XVX A;  3U1O A;  4GL8 A;  2RCA A;  4H67 A;  4QFO A;  5IKB A;  4F39 A;  5CMB A;  1UQW A;  2V93 A;  3IOR A;  4R2B A;  5I2N B;  2XXY A;  3OEL A;  2NVU B;  3RGY A;  2OJT A;  3TDJ A;  1H43 A;  4GXS B;  4Z7E A;  5HPQ A;  3O28 A;  4IO7 A;  2F7A A;  4POW A;  3CI8 A;  4XKQ A;  1B2H A;  1YTV A;  5H8S A;  3HN0 A;  3T9U A;  1SW5 A;  1VFD A;  4IO2 A;  1MDP 1;  3B6T A;  1US5 A;  3OMB A;  1ZBM A;  1IQ7 A;  3WAE A;  3VFJ A;  1T0K A;  4NWD A;  3UOR A;  5AA4 B;  2ZMB A;  3IOT A;  4HCY A;  4XXU A;  5H8N A;  4FAT A;  3PD9 A;  4WKM A;  3B6Q A;  4ISU A;  5FHN A;  1M5F A;  3C33 A;  3K02 A;  4ECF A;  1ZKB A;  2Y7K A;  4N13 A;  1KWH A;  1UTB B;  3C31 A;  3VV5 A;  2B3F A;  5FTI A;  1NNT A;  3TOD A;  2D5W A;  3FV2 A;  2B3B A;  3G3H A;  4JB7 A;  3RNN A;  1HSE A;  5KDT A;  2A5T A;  4QSE A;  5F7V A;  2I6E A;  5L8D A;  4LQ5 A;  5EHM A;  4YZZ A;  2R9J A;  3D4C A;  3M3F A;  4OFO A;  1DPE A;  3VVF A;  1JW4 A;  1A99 A;  3EHT A;  2ZYN A;  1FTO A;  1B5J A;  2D21 A;  1UTH B;  2Q89 A;  1FTL A;  3ILU B;  4G77 A;  1QW0 A;  1B5I A;  1MQI A;  1R6Z A;  3IX1 A;  1XS5 A;  4H1X A;  3N26 A;  3T9V A;  2DWH A;  2O6A A;  2ALU A;  3Q29 A;  4U1O A;  3CFZ A;  4U2R A;  1D9Y A;  3FV1 A;  4H5G A;  3FVN A;  1P1N A;  4YAH X;  2I3V A;  2QMX A;  1PBQ A;  4F3B A;  3PD8 A;  1URS A;  2RCB A;  3CFX A;  3PGF A;  4DZ1 A;  1OQH A;  1MRP A;  3L6G A;  3QK6 A;  2I0B A;  4BLA A;  4C1T A;  2YPN A;  3Q28 A;  1LFG A;  4OEV A;  2XX7 A;  3I5O A;  4OVJ A;  3S9E A;  3N6U A;  3HHG A;  1NH8 A;  5AA1 A;  4YKP A;  3IOU A;  2NWJ A;  3RY3 A;  5BWJ A;  3K00 A;  4Q5T A;  3TTM A;  1A55 A;  3C9H A;  4KPT A;  1ATG A;  3MUQ A;  5CBR A;  4F2Q A;  4RXL A;  3CRB A;  5KZT A;  3V5A A;  3TCG A;  4F29 A;  1JVX A;  1VSO A;  2O7I A;  3IR1 A;  3N5L A;  2QS3 A;  4IY6 A;  2ZYO A;  3TCF A;  1LFH A;  4JWY A;  1IZ1 A;  1OVB A;  1I69 A;  1OMP A;  1RKM A;  1B1H A;  2I49 A;  2XXU A;  1TFD A;  4LZ5 A;  4X1B A;  4YU0 A;  1LGB C;  1Q1K A;  3PPP A;  3U72 A;  2O7U A;  1MM7 A;  1O7T A;  4RNS A;  3T9X B;  4I62 A;  4KCD A;  4LQ2 A;  1VE4 A;  2UVJ A;  2PBW A;  4DXB A;  1II5 A;  1P1U A;  2GHB A;  2WKY A;  2KLF A;  2Q9T A;  3EQ1 A;  4F18 A;  4OFL A;  5DTB A;  2LAO A;  4IO5 A;  2I4C A;  4RK9 A;  3S2V A;  3SKP A;  4IB2 A;  4R74 A;  4LAT A;  3PPN A;  1NKX A;  2GRV A;  1WDN A;  3H6U A;  4FOR A;  2HAV A;  2QS1 A;  2RIN A;  3OO7 A;  4GFR A;  3TYH A;  5L9M A;  4G8H A;  1LBC A;  4GD5 A;  5CMC A;  1A54 A;  1B9J A;  5CMK A;  3TUS A;  1RYX A;  4XKP A;  3TEL A;  2Z8F A;  4G8N A;  5ELV A;  3SER A;  2DYX A;  1UTH A;  3Q25 A;  2QS4 A;  1MG1 A;  4RJZ A;  2I4B A;  4F22 A;  1BIY A;  2HZL A;  3OEN A;  3T66 A;  4BDQ A;  4ZE9 A;  1MY4 A;  3EN3 A;  3C34 A;  2Y7P A;  3IB2 A;  3O6H A;  3TMG A;  3SEW A;  3KSJ A;  1MXX A;  2DE4 A;  4U22 A;  1DPP A;  3KN3 A;  3B7D A;  4DXU A;  3DEL B;  2REG A;  4GLI A;  4O3C A;  3HCQ A;  3FVK A;  2UYE A;  4E0W A;  1TT1 A;  5KCJ B;  3BFT A;  3KJ7 A;  5I57 B;  3UK4 A;  2HZK A;  1DOT A;  1MQG A;  5H8Q A;  3W9V A;  4I1D A;  4LON B;  4DLD A;  2DVZ A;  4H8I A;  3BBR A;  3I3V A;  1H3D A;  4FE8 A;  3MZ1 A;  1B4Z A;  2F6G A;  4BDN A;  5AA4 A;  1QKB A;  4RPN A;  3HHF A;  1I6Q A;  3R6U A;  4H8J A;  1H76 A;  4PFT A;  4UA8 A;  5AA2 D;  2DS9 A;  5JEI A;  1A40 A;  5TU0 A;  1LAH E;  3TCH A;  5ITP A;  1O64 A;  4MLQ A;  4PP0 A;  3Q27 A;  4HTG A;  1FQD A;  2ZNT A;  2RKM A;  3CIJ A;  3O66 A;  3K2D A;  4G4P A;  3MWB A;  4YKI A;  4BDM A;  2Z8D A;  4NF5 B;  1LB9 A;  1XC1 A;  2HEU A;  3C4M A;  1AIV A;  2R71 A;  3IL1 B;  3BKI B;  1Y1M A;  2ZYK A;  4N07 A;  4KYD A;  4EF1 A;  2RF1 A;  3CG1 A;  4GL0 A;  1NH7 A;  4R73 A;  5H8F B;  3TZA A;  3ODB A;  4U4X A;  1S9T A;  1URD A;  4LUB A;  4G68 C;  3U8Q A;  4ZEK A;  3IB0 A;  3ILT B;  4F1U A;  1B3L A;  3QIM A;  5FHM A;  4WEP A;  1QVS A;  1OLC A;  1P99 A;  2PYY A;  2O1L A;  1MPB A;  1FQF A;  3MJN A;  3PUV E;  1FCK A;  2VGQ A;  3BFU A;  4KCC A;  1PB7 A;  3MP1 A;  3OO8 A;  4ONY A;  4E0X A;  3O6I A;  3GBB A;  4NTL A;  1SW1 A;  4OTE A;  3CSB A;  3S9M C;  5F1Q A;  4PET A;  2VD3 A;  3B6W A;  2IEE A;  2V25 A;  3ZSF A;  4KFQ A;  2BJJ X;  4LP2 B;  1SW2 A;  4NWC A;  4C0R A;  2Y84 A;  5H8Q B;  4F3G A;  3PMV A;  2P1S A;  4G8M A;  4MFI A;  3KGC A;  4R72 A;  2XXP A;  4EXL A;  3TTK A;  4RK2 A;  1LFI A;  4LA9 A;  5H8H A;  1M5D A;  3LSX A;  1CB6 A;  1N04 A;  3EHU A;  3IOV A;  3ONM A;  4OWD A;  3AXF A;  4R9F A;  4JDF A;  4O3B A;  1I6A A;  4YB6 A;  3CVG A;  1ZIU A;  3A09 A;  2D3I A;  4H0W A;  3OO9 A;  2OK2 A;  4QFN A;  3OEM A;  1TXF A;  4DCX A;  1SYI A;  3RT8 A;  4AQ4 A;  1J1N A;  1UIV A;  2Y7W A;  4JWO A;  2A5S A;  2HCA A;  2O69 A;  2F78 A;  2RC8 A;  3DM0 A;  3MP8 A;  4OZ9 A;  4YKK A;  4ZZA A;  4G68 A;  4BDO A;  3JYR A;  1FW0 A;  1R1N A;  2V3U A;  3IOW A;  4NMY A;  4U4S A;  1JQF A;  3MVY A;  5TPA B;  4JWX A;  2X7Q A;  1PB8 A;  4P0G A;  5A5X A;  3SES A;  4ZEB A;  3JV9 A;  1BP5 A;  5EHS A;  4FED A;  3V89 B;  1TWY A;  3JZJ A;  4ESX A;  1MQJ A;  1ELJ A;  1Y9U A;  1WOD A;  1MXV A;  4PFW A;  1MY0 A;  2ZXT A;  1LST A;  4ELP A;  1H45 A;  1Y20 A;  4ND9 A;  4ZEF A;  2CZL A;  3H7M A;  2GHA A;  3TFL A;  2F36 A;  2I0C A;  1PEB A;  3KN8 A;  4OES A;  1MXY A;  2F7B A;  2REJ A;  1M5B A;  2UVI A;  4RYA A;  4YKJ A;  1DMB A;  2UYF A;  4PQJ A;  4JXI A;  1PBP A;  5K2X A;  3Q26 A;  3PV0 E;  4NE4 A;  3PUW E;  4RPO A;  4R9G A;  1B4H A;  3A3C A;  2RC9 A;  1QUL A;  2O84 X;  5I2K B;  3RN8 A;  3UP9 A;  2DP8 A;  2H4I A;  3MC2 A;  1MH4 A;  3UIF A;  1N76 A;  1P1O A;  2Z23 A;  2Z8E A;  4IGR A;  4IO6 A;  3R26 A;  2HFB A;  4N6P A;  5I59 B;  1R9L A;  1MXZ A;  2DWA A;  4P0I A;  1B3E A;  1USY H;  3PMX A;  4FEB A;  3UA8 A;  4IGT A;  2W7Y A;  4ELR A;  1GGG A;  4PFU A;  1ZJL A;  5JK4 A;  4FEC A;  1MM6 A;  2V84 A;  2F7C A;  4EDP A;  5I56 A;  3CFL A;  1A8F A;  4MF3 A;  2M8C A;  1A8E A;  2XXV A;  2I3W A;  4THI A;  3S9L C;  1B3H A;  3RQT A;  4QF9 A;  5ICT A;  3O97 A;  2YJP A;  3PPO A;  5FHO A;  1OIB A;  3GLB A;  2B65 A;  3KBR A;  1AL3 A;  1MXU A;  1B40 A;  1B1X A;  1IXC A;  2XXW A;  3E9X A;  4TLM B;  5I58 B;  2DQV A;  3HST A;  3K6X A;  4K3F A;  1JET A;  4GIZ A;  1MPC A;  4ZZE A;  1I6B A;  1B46 A;  2XX9 A;  3G3K A;  3VVD A;  3OSR A;  4QFL A;  1QJM A;  3VXB A;  5CM6 A;  1B6H A;  1SYH A;  3I6V A;  3SEY A;  5CI5 A;  5CMM A;  1B52 A;  1HSL A;  4F3P A;  5ISU A;  2H25 A;  1EU8 A;  3R7X A;  4NF8 A;  4FJP A;  1M5E A;  3F11 A;  3K1N A;  2UVH A;  3KSX A;  4UAC A;  3DP4 A;  1LAG E;  1BLF A;  4ZS9 A;  4GRK A;  4Z0I A;  3TQL A;  5LOM A;  2AYS A;  2QPQ A;  3VXC A;  3QYT A;  4XKN A;  5J1D A;  2ZYM A;  1UIU A;  2DXR A;  4QSC A;  4EQ7 A;  4EXK A;  4YB5 A;  5HM4 B;  3FVO A;  5DVF A;  1SD3 A;  1UTB A;  3PU5 A;  4P11 A;  1O63 A;  2E1S A;  1B51 A;  3KN7 A;  2F6P A;  1N7W A;  2I58 A;  4G2Z A;  1XHY A;  1ZTY A;  5TP9 B;  3FJM A;  3K1M A;  1B05 A;  3IO6 A;  4QSD A;  3ZKL A;  3DP6 A;  4GQO A;  5HBC A;  4I9D A;  4F2O A;  1JW1 A;  1POY 1;  4KHZ E;  1OLA A;  1NNF A;  2XXT A;  3LR1 A;  3USD A;  4OET A;  1B0H A;  3DP8 A;  3O2A A;  3D4G A;  3PUX E;  1PDA A;  4GVO A;  3ZKK A;  2VHA A;  3HV1 A;  4QHQ A;  3TKD A;  3FGS A;  4ZEC A;  4ESW A;  1N7X A;  2XD2 A;  1WVJ A;  3FZV A;  3LC8 A;  2ZNS A;  1Y3N A;  2DE2 A;  4TQU Q;  3T93 B;  4KYE A;  5AE4 A;  3TTR A;  4MLV A;  2Q88 A;  2UXA A;  4FAJ A;  2ABH A;  4F19 A;  3EHS A;  3MAM A;  3GBA A;  3S4U A;  3FJ7 A;  2PT2 A;  2F34 A;  1AMF A;  1VFE A;  1Y4C A;  1H44 A;  4WED A;  2O68 A;  3MQ9 A;  2OLB A;  1B58 A;  1N0T A;  1A7L A;  3MVX A;  2FA7 A;  2FNC A;  4YMA A;  4OXV A;  5FTH A;  3G3F A;  2OBG A;  1VR5 A;  1MY1 A;  3K4U A;  4JBZ A;  4POX A;  4DDD A;  3K6V A;  5JTY A;  1IXH A;  4XKR A;  1IIW A;  1Y3Q A;  2VOZ A;  4OYV A;  2H5Y A;  4ZDM A;  1Q35 A;  5K2Y A;  2H99 A;  2XD3 A;  2XXQ A;  1S50 A;  3LSW A;  3MP6 A;  5TPA A;  3T22 A;  1D4N A;  2R6G E;  3N6T A;  5M2V A;  4GWO A;  4NF4 B;  2AL4 A;  2QSX A;  1FTJ A;  1OVT A;  5DEX A;  2Z22 A;  2QMW A;  5DYH A;  5A5X B;  5AA2 A;  4JSO A;  3O29 A;  3H4Z A;  5I84 A;  2QL3 A;  3FXU A;  2O1M A;  1S7Y A;  1B0L A;  1EH3 A;  1Y1Z A;  1OQG A;  4DCY A;  4EF2 A;  4QFK A;  3H03 A;  5I58 A;  1JEV A;  4NF6 B;  4KI0 E;  1YAE A;  1Z7N E;  4FIM A;  1MY3 A;  1DTG A;  2DWJ A;  1SI1 A;  4F1Y A;  1HSJ A;  4KR5 A;  2XX8 A;  4KQP A;  2G29 A;  5B70 A;  1N84 A;  1F9B A;  1SBP A;  3IAZ A;  3MZ9 A;  1BTJ A;  3MVZ A;  2XXR A;  1MY2 A;  2DXY A;  1GV8 A;  3SEV A;  5B7D A;  1FQC A;  3MPL A;  2F35 A;  3T96 B;  3TEP A;  4AB6 A;  2NOO A;  3TTN A;  2QS2 A;  3IK6 B;  3W15 C;  4NF4 A;  4EUO A;  1JW5 A;  3T9H B;  2Q2C A;  1YPN A;  3MZB A;  2X7P A;  3MW0 A;  2IA4 A;  3QAX A;  2I48 A;  1YCJ A;  4ZED A;  4PFY A;  1EZ9 A;  3FUZ A;  3K6U A;  4R6H A;  2DSF A;  3RUM A;  3EF7 A;  3FXR A;  1PC3 A;  2ONR A;  2XXH A;  3G7W A;  3IB1 A;  1Y4T A;  3IJX B;  4IO3 A;  4KYS A;  2F5X A;  1LCF A;  2HQ0 A;  5EYF A;  3OXN A;  1JNF A;  1N3X A;  3TQW A;  1M5C A;  3C36 A;  2PT1 A;  2ZNU A;  4I8C A;  3SEU A;  1Y3P A;  2PMS A;  4OMB A;  5TP9 A;  3K01 A;  5CC2 A;  4C1U A;  1LCT A;  2Q2A A;  1NMU A;  1ANF A;  3ECR A;  1SI0 A;  3DLN A;  2E0S A;  4BDL A;  4ELQ A;  3U93 A;  3VDF A;  1NNP A;  3CSG A;  1EZP A;  3C32 A;  1QKA A;  2DVC A;  2XHD A;  1B32 A;  3RTF B;  4OFJ A;  3WAF A;  4DE8 A;  5L9O A;  4OEU A;  3KEI A;  5DEX B;  1NFT A;  5AA2 B;  4TLL B;  3E3K A;  3N94 A;  4M4G A;  2HAU A;  1FTM A;  3IJO B;  1RYO A;  4DXC A;  3H6V A;  1B5H A;  1P1Q A;  1IUD A;  4NF8 B;  4G68 B;  4QFP A;  4ZEI A;  3KOS A;  1FTK A;  1LAX A;  3SDF A;  3C35 A;  3SEX A;  3W9W A;  1MQD A;  4HCW A;  1AH5 A; 
#chains in the Genus database with same CATH topology
 4IO4 A;  1MXW A;  1D9V A;  3U92 A;  1MS7 A;  2BJI A;  3QXM A;  4XEQ A;  4U23 A;  1MH3 A;  5ICQ A;  3PPQ A;  3H6W A;  4N81 A;  3H3G A;  2PVU A;  3PUZ E;  3K1P A;  5KCJ A;  2H9B A;  2FIE A;  2HXW A;  3RT6 B;  1CE2 A;  4OER A;  4DIG A;  3OEK A;  3M3L A;  2DWI A;  4MBP A;  2ESN A;  4NGU A;  1KA0 A;  4N15 A;  4HS7 A;  4N6D A;  5ITO A;  4HE0 A;  4EQ9 A;  4M1V A;  1NV6 A;  3VVE A;  3L6H A;  2WYK A;  3RLF E;  3OO6 A;  1FBP A;  1USY E;  5ET6 A;  3P7I A;  3QSL A;  1LB8 A;  3FIR A;  4NQ8 A;  1DTZ A;  3CG3 A;  3THI A;  1B7Z A;  1LLS A;  5L9S A;  4ZEC A;  2PX1 A;  2NXO A;  4F3S A;  3VLW A;  4GBV A;  4O3A A;  4U1Z A;  5DVI A;  3UN6 A;  1XOC A;  1EYK A;  3E4R A;  1MQH A;  1SW4 A;  3HPI A;  4TOZ A;  3VE1 B;  3KJT A;  2V3T A;  4YMB A;  1DSN A;  3OD7 A;  3S9N C;  3TPA A;  2HHM A;  3H6T A;  3IO4 A;  1ZU0 A;  4OEN A;  3T1B A;  1XVX A;  4GL8 A;  3IOR A;  2XXY A;  4GWS A;  4MEV A;  2NVU B;  3RGY A;  2OJT A;  3TDJ A;  2F7A A;  1YTV A;  1US5 A;  3OMB A;  3WAE A;  3VFJ A;  4NWD A;  5AA4 B;  3IOT A;  5H8N A;  1ZKB A;  2Y7K A;  1UTB B;  3VV5 A;  3FV2 A;  2B3B A;  1HSE A;  2R9J A;  3D4C A;  3EHT A;  2D21 A;  3ILU B;  1FTL A;  3Q29 A;  4U1O A;  2I3V A;  2QMX A;  1PBQ A;  2RCB A;  3CFX A;  4DZ1 A;  1LBY A;  3QK6 A;  4C1T A;  1K9Y A;  3Q28 A;  2FIX A;  1NV0 A;  4MCO A;  4OEV A;  3S9E A;  3N6U A;  4YKP A;  1NUW A;  2CEY A;  2Y5L A;  4RXL A;  3TCG A;  4IY6 A;  3TCF A;  5EHM A;  1B1H A;  3U72 A;  1NI9 A;  2UVJ A;  4X8R A;  2PBW A;  2GHB A;  1P1U A;  4I3Y A;  4RK9 A;  4LAT A;  3PPN A;  1WDN A;  3H6U A;  2QS1 A;  3TYH A;  5A5L A;  5CMC A;  3SER A;  2DYX A;  1MG1 A;  1FBG A;  2DE4 A;  4U22 A;  4O3C A;  3FVK A;  4MAG A;  4I1D A;  4LON B;  2DVZ A;  4H8I A;  1H3D A;  2F6G A;  4AS5 A;  4RPN A;  3HHF A;  2DS9 A;  2QVU A;  1O64 A;  3Q27 A;  4HTG A;  1FQD A;  2ZNT A;  3O66 A;  1AIV A;  4PF8 A;  2R8T A;  3BKI B;  4KYD A;  2RF1 A;  3ODB A;  4U4X A;  2ZZX A;  3QIM A;  4WEP A;  1P99 A;  4HE1 A;  1FQF A;  1PB7 A;  3OO8 A;  5IZ3 B;  3CSB A;  4PGP A;  5I7I A;  2IEE A;  3ZSF A;  4KFQ A;  5J16 A;  4NWC A;  2XWI A;  3PMV A;  2P1S A;  4G8M A;  4EXL A;  3KGC A;  3TTK A;  1M5D A;  1CB6 A;  4DI3 D;  4JDF A;  4YB6 A;  4H0W A;  2D3I A;  3OEM A;  1SYI A;  4GX6 A;  2A5S A;  2O69 A;  1FPJ A;  3JYR A;  2V3U A;  3IOW A;  4NMY A;  1PB8 A;  1EYI A;  1IME A;  3JV9 A;  4FED A;  1MQJ A;  1MXV A;  3GYY A;  2ZXT A;  4I40 A;  2GHA A;  5ET7 A;  1MXY A;  1M5B A;  2UVI A;  3PV0 E;  4NE4 A;  1B4H A;  2RC9 A;  1K9Z A;  2O84 X;  2CZH A;  4GWY A;  2DP8 A;  3UP9 A;  1P1O A;  4OVQ A;  4IGR A;  4N6P A;  5I59 B;  1USY H;  3IFA A;  1ZJL A;  5I56 A;  2F7C A;  4EDP A;  4MF3 A;  3RQT A;  4QF9 A;  3PPO A;  1FBC A;  3GLB A;  2B65 A;  3K6X A;  1MPC A;  3I6V A;  1B52 A;  1EU8 A;  3K1N A;  2UVH A;  3DP4 A;  3RYD A;  4PDD A;  3VXC A;  5HM4 B;  1SD3 A;  3PU5 A;  1N7W A;  3K1M A;  1FSA A;  1JW1 A;  1OLA A;  3DP8 A;  3PUX E;  1PDA A;  4OVS A;  2VHA A;  4ESW A;  2PFZ A;  3FXB A;  3T93 B;  1WVJ A;  4H46 A;  3TTR A;  4FAJ A;  2ABH A;  3MAM A;  3GBA A;  2PT2 A;  1AMF A;  1B58 A;  5FBP A;  3MVX A;  2FNC A;  5FTH A;  4JBZ A;  1VR5 A;  3K6V A;  5JTY A;  1IXH A;  1Q9D A;  4XKR A;  1Y3Q A;  2VOZ A;  4P9K A;  1Q35 A;  5K2Y A;  2H99 A;  5M2V A;  2PFY A;  5DYH A;  5AA2 A;  2Z22 A;  4JSO A;  3O29 A;  3H4Z A;  1S7Y A;  1EH3 A;  4DCY A;  1EYJ A;  1SI1 A;  4KR5 A;  4MMP A;  1RDZ A;  1F9B A;  4F2O A;  1GV8 A;  5B7D A;  1BTJ A;  2XXR A;  3TTN A;  3IK6 B;  5I5P A;  3T9H B;  2I48 A;  3RUM A;  3K6U A;  3G7W A;  3IB1 A;  5EYF A;  3OXN A;  1JNF A;  3TFL A;  3C36 A;  2PMS A;  4OMB A;  1NMU A;  2E0S A;  5EYH A;  3VDF A;  1NNP A;  3CSG A;  3KEI A;  4PFR A;  4TLL B;  3N94 A;  2Q8M A;  1FTM A;  1IUD A;  1LAX A;  3C35 A;  1ZMG A;  4XTC Q;  4ZE8 A;  1PB9 A;  2VPN A;  4MNC A;  3PPR A;  1IIT A;  1IXG A;  1QUJ A;  3V8X B;  1POT A;  1Z7M E;  2Y5K A;  5H8N B;  2CMO A;  3FD3 A;  2THI A;  3G3G A;  1IMC A;  1NL5 A;  2VT5 A;  3PUY E;  4Q30 B;  4XIG Q;  2AL5 A;  4HW8 A;  4LZ8 A;  4R75 A;  5I57 A;  4WXJ A;  3FAS A;  4X04 A;  5I56 B;  1L5T A;  2GFE A;  2DOJ A;  3E79 A;  3UGW A;  3U94 A;  4H6D A;  1FJ9 A;  2H98 A;  5IAI A;  2OCU A;  3TTL A;  1P1W A;  4GWZ A;  3FXQ A;  1FQE A;  2F8D A;  2VD2 A;  3MVW A;  4PBQ A;  2GH9 A;  4ELO A;  3ZS6 A;  5F24 A;  3G3J A;  4NHB A;  4IY5 A;  1FPI A;  3K6W A;  1DCU A;  1SVX B;  5AA3 A;  4GXA A;  1D9Q A;  1FPB A;  1B3G A;  2ANJ A;  4H5F A;  3M3K A;  4YB7 A;  1KZ8 A;  1B7H A;  4H67 A;  2RCA A;  5EQ7 A;  4F39 A;  3OEL A;  1H43 A;  4POW A;  4IO7 A;  4O7I A;  5IGA A;  3CI8 A;  1VFD A;  1IQ7 A;  4P8B A;  4FAT A;  4WKM A;  3B8B A;  4ECF A;  4OVT A;  1KWH A;  3C31 A;  2B3F A;  3TOD A;  3KC0 A;  3G3H A;  4QSE A;  5F7V A;  3VVF A;  3M3F A;  1DPE A;  2ZYN A;  1B5J A;  1UTH B;  1FRP A;  2Q89 A;  4MLV A;  1XS5 A;  2O6A A;  2ALU A;  4H5G A;  4PBH A;  1LBX A;  3PGF A;  3L6G A;  2I0B A;  4BLA A;  3ISP A;  2YPN A;  4OVJ A;  3HHG A;  1NH8 A;  5AA1 A;  3NOH A;  3TTM A;  4KPT A;  5CBR A;  3MUQ A;  3CRB A;  5KZT A;  3BIH A;  4JWY A;  1RKM A;  2XXU A;  1Q1K A;  1MM7 A;  4I62 A;  4MIJ A;  2CZK A;  4DXB A;  2KR0 A;  2WKY A;  4N8Y A;  4IO5 A;  4JVC A;  1NKX A;  4FOR A;  5A5X B;  2HAV A;  5L9M A;  1RYX A;  1NUY A;  1UTH A;  2F3D A;  1BIY A;  4MNI A;  4BDQ A;  1MY4 A;  3EN3 A;  3O6H A;  3KN3 A;  1TT1 A;  3KJ7 A;  4PDH A;  3W9V A;  3QMF A;  4UAB A;  3MZ1 A;  4BDN A;  1QKB A;  1I6Q A;  1XI6 A;  1LAH E;  4G4P A;  3MWB A;  4EF1 A;  4GL0 A;  4R73 A;  5H8F B;  1URD A;  4LUB A;  5FHM A;  2O1L A;  1MPB A;  1FJ6 A;  2VD3 A;  5H8Q B;  4F3G A;  2XXP A;  4RK2 A;  1LFI A;  5H8H A;  3B50 A;  3LSX A;  3EHU A;  1I6A A;  4NAP A;  4GX4 A;  4AQ4 A;  1J1N A;  2HCA A;  4ZZA A;  2F78 A;  3MP8 A;  4OZ9 A;  5TPA B;  3V89 B;  1ELJ A;  4PFW A;  1LST A;  1NV3 A;  1H45 A;  4ELP A;  4ND9 A;  4ZEF A;  3H7M A;  2HXR A;  3KN8 A;  4OES A;  2F7B A;  2REJ A;  2UYF A;  3Q26 A;  3A3C A;  1QUL A;  3RN8 A;  3T0J A;  3UIF A;  4IO6 A;  2OX3 A;  3PMX A;  4PFU A;  1MM6 A;  1A8F A;  2M8C A;  1A8E A;  2XXV A;  2I3W A;  3S9L C;  5FHO A;  3E9X A;  4MNP A;  2DQV A;  4K3F A;  4GIZ A;  4ZZE A;  3G3K A;  3VVD A;  3OSR A;  2F3B A;  4QFL A;  3VXB A;  5CM6 A;  5CI5 A;  1HSL A;  2H25 A;  3R7X A;  4O94 A;  1G0H A;  1M5E A;  4Z0I A;  3TQL A;  1LAG E;  1BLF A;  4ZS9 A;  2AYS A;  4I3E A;  3QYT A;  4QSC A;  2DXR A;  4EQ7 A;  4YB5 A;  1O63 A;  5TP9 B;  1XHY A;  1ZTY A;  4N17 A;  4MHF A;  4KHZ E;  3LR1 A;  4MJO A;  4OET A;  3O2A A;  4QHQ A;  2XD2 A;  2QVR A;  2Q88 A;  2MKZ A;  2UXA A;  2F34 A;  1VFE A;  1Y4C A;  4WED A;  3MQ9 A;  2OLB A;  1A7L A;  2OBG A;  3K4U A;  1MY1 A;  4DDD A;  4POX A;  2H5Y A;  4ZDM A;  2XD3 A;  2XXQ A;  3MP6 A;  5TPA A;  3T22 A;  2R6G E;  4GWO A;  4NF4 B;  1OVT A;  2QMW A;  2QL3 A;  1OQG A;  4QFK A;  3H03 A;  1JEV A;  1MY3 A;  1DTG A;  1NV7 A;  2DWJ A;  4F1Y A;  2XX8 A;  5B70 A;  1N84 A;  3MZ9 A;  3SEV A;  3MPL A;  2F35 A;  3W15 C;  2X7P A;  3KC1 A;  4ZED A;  4PFY A;  4R6H A;  2DSF A;  4LN5 A;  3IJX B;  4XF5 A;  3TQW A;  1M5C A;  4I8C A;  5CC2 A;  1ANF A;  3ECR A;  4BDL A;  2CEX A;  1FBF A;  3C32 A;  1QKA A;  2DVC A;  2XHD A;  4DE8 A;  3WAF A;  4OFJ A;  5AA2 B;  4DXC A;  4QFP A;  2XWO A;  1NV5 A;  1MQD A;  4NTL A;  1AH5 A;  3V83 A;  4RA1 A;  3MBP A;  3O9P A;  5H8H B;  3G3I A;  5EQ8 A;  4GF8 A;  3KFM A;  2UVG A;  4IR8 A;  1XT8 A;  1SDX A;  1EZO A;  1BKA A;  4LZ7 A;  4JVD A;  3E13 X;  4X48 A;  2Q8J A;  1NNK A;  4OHN A;  3EPE A;  2DE3 A;  4L17 A;  3EKI A;  1QUI A;  4X1D A;  3TAJ A;  4PC9 A;  2QFL A;  1FPE A;  1B3F A;  3HFU A;  3KOT A;  4LVQ A;  4QRZ A;  4H45 A;  4GOT A;  3RTW B;  2G93 A;  3QUJ A;  1B7U A;  4OVR A;  5IM2 A;  2WX9 A;  4JSD A;  1N3W A;  1SQY A;  3H06 B;  2OWS A;  1XVY A;  2OWT A;  2QJE A;  3FJG A;  4Q0C A;  2GQ1 A;  4NF6 A;  2XXI A;  3O6G A;  3GZG A;  1FQA A;  4R6Y A;  4OQO A;  3OSQ A;  4Q8R A;  5I59 A;  1MDQ A;  2Y7R A;  4N6K A;  1FPK A;  5DT6 A;  5IZ3 A;  4BDR A;  1LAF E;  5I2K A;  3LV0 A;  1R9Q A;  4PGN A;  4X9T A;  2FBP A;  1MPD A;  4R6K A;  4OAN A;  2AIX A;  2OZZ A;  2V3Q A;  1LBB A;  3U1O A;  4QFO A;  1UQW A;  2V93 A;  4R2B A;  5I2N B;  3RPL B;  3O28 A;  4P3L A;  3HN0 A;  1IMF A;  3T9U A;  1SW5 A;  1MDP 1;  1ZBM A;  2XWK A;  1M5F A;  1DK4 A;  2OWZ A;  1NNT A;  5IZ1 A;  4JB7 A;  2A5T A;  2I6E A;  4YZZ A;  1JW4 A;  4QBA A;  1FTO A;  4G77 A;  4H1X A;  3IX1 A;  1B5I A;  1MQI A;  4GWW A;  2DDK A;  3CFZ A;  3RPL A;  1D9Y A;  3FV1 A;  1P1N A;  4YAH X;  3PD8 A;  1IMA A;  5IZZ A;  1OQH A;  1LFG A;  2XX7 A;  3RY3 A;  5ET5 A;  4Q5T A;  1A55 A;  4F2Q A;  3D1R A;  3LUZ A;  4F29 A;  1JVX A;  2O7I A;  3IR1 A;  3N5L A;  2QS3 A;  2I49 A;  1OMP A;  4X1B A;  2O7U A;  3T9X B;  3CHG A;  4KCD A;  1VE4 A;  1II5 A;  4IB2 A;  2GRV A;  2RIN A;  3OO7 A;  4G8H A;  1LBC A;  4GD5 A;  1JP4 A;  1A54 A;  4XKP A;  1IMD A;  2Z8F A;  4G8N A;  5ELV A;  2QS4 A;  2I4B A;  3U65 A;  2HZL A;  1FPD A;  3A29 A;  4ZE9 A;  1YYZ A;  2Y7P A;  3IB2 A;  3TMG A;  3B7D A;  4DXU A;  3DEL B;  2REG A;  3HCQ A;  4E0W A;  3BFT A;  5I57 B;  5H8Q A;  4DLD A;  3BBR A;  3I3V A;  2Q74 A;  1B4Z A;  3MST A;  5AA4 A;  4H8J A;  5TU0 A;  1BK4 A;  3SEW A;  3CIJ A;  2RKM A;  4BDM A;  5ICT A;  3K2D A;  4PE3 A;  2Z8D A;  1LB9 A;  3C4M A;  1Y1M A;  2ZYK A;  4N07 A;  1NH7 A;  1S9T A;  4G68 C;  3IB0 A;  3ILT B;  4F1U A;  1B3L A;  1QVS A;  2WBB A;  1OLC A;  1G0I A;  3FBP A;  2WYP A;  3PUV E;  2VGQ A;  3BFU A;  4KCC A;  3MP1 A;  3GBB A;  1SW1 A;  5F1Q A;  4PET A;  4LP2 B;  4MX6 A;  2Y84 A;  4MFI A;  4R72 A;  4G61 A;  3ONM A;  1N04 A;  3AXF A;  4R9F A;  3CVG A;  4P56 A;  2OK2 A;  1TXF A;  4DCX A;  1UIV A;  4PTK A;  2RC8 A;  5T3J A;  4G68 A;  4BDO A;  1FW0 A;  4U4S A;  1JQF A;  2X7Q A;  3MYU A;  4ZEB A;  1BP5 A;  5EHS A;  3JZJ A;  1Y9U A;  1MY0 A;  1Y20 A;  1VDW A;  2I0C A;  5EYG A;  1PEB A;  4YKJ A;  4O7M A;  1NV4 A;  1PBP A;  3PUW E;  4R9G A;  2H4I A;  3MC2 A;  1N76 A;  2Z23 A;  2Z8E A;  3R26 A;  1MXZ A;  1B3E A;  4FEB A;  4ELR A;  3CFL A;  3KBZ A;  2XA5 A;  4THI A;  4NN3 A;  3O97 A;  2YJP A;  1B1X A;  2PCR A;  3HST A;  1JET A;  1I6B A;  1B46 A;  2XX9 A;  1QJM A;  1B6H A;  3SEY A;  4PFB A;  4NF8 A;  4FJP A;  3F11 A;  2QPQ A;  4XKN A;  5J1D A;  4EXK A;  3FVO A;  4P11 A;  2E1S A;  2F6P A;  4QSD A;  3ZKL A;  4I9D A;  1POY 1;  4HXV A;  1CNQ A;  4GVO A;  3ZKK A;  3HV1 A;  2XXK A;  3FGS A;  4TQU Q;  4F19 A;  3FJ7 A;  4AS4 A;  1H44 A;  2O68 A;  1YXI A;  3G3F A;  1IIW A;  4OYV A;  3LSW A;  1S50 A;  1LBZ A;  3N6T A;  4NX1 A;  1FTA A;  3FXU A;  2O1M A;  4EF2 A;  4NF6 B;  4KI0 E;  1YAE A;  1Z7N E;  1HSJ A;  4KQP A;  3IAZ A;  1SBP A;  3MVZ A;  1MY2 A;  4GX3 A;  3TEP A;  4EUO A;  1JW5 A;  2VPO A;  1YPN A;  3MZB A;  3QAX A;  3E78 A;  1YCJ A;  3FUZ A;  3FXR A;  1RDY A;  4IO3 A;  1Y4T A;  2F5X A;  2HQ0 A;  1LEV A;  1N3X A;  1LBV A;  2ZNU A;  1Y3P A;  3K01 A;  4PAK A;  1SI0 A;  3U93 A;  5L9O A;  5DEX B;  1NFT A;  2HAU A;  3IJO B;  1RYO A;  4ZEI A;  3H6V A;  1B5H A;  4NF8 B;  4NF0 A;  3KOS A;  3SEX A;  3SDF A;  5CBS A;  2XXX A;  1TFA A;  1US4 A;  5DW8 A;  2A5T B;  4N8G A;  3VLU A;  2ONK E;  4MH5 A;  1QUK A;  4FBP A;  5H8F A;  2VP1 A;  2X26 A;  5BUU A;  1LBW A;  2KQZ A;  4F31 B;  1RDX A;  4RY1 A;  2RC7 A;  2YLN A;  3FAT A;  3CR9 A;  3FVG A;  3VLV A;  1JVY A;  3LUY A;  5I2N A;  2F97 A;  3KG2 A;  4PE5 B;  1JEU A;  4NED A;  4U21 A;  2Y7I A;  4R2F A;  4H65 A;  5EQA A;  4EQB A;  3A3U A;  2B4L A;  3QUF A;  4NF5 A;  3IFC A;  1GVC A;  3LBS A;  3OOA A;  3MPK A;  5EQ9 A;  1GTK A;  1URG A;  1YZ0 A;  2P0S A;  1FPL A;  3KZG A;  5LDZ A;  5ESY A;  2FYI A;  5DVJ A;  4YIC A;  3GXA A;  1ZLQ A;  3HO7 A;  4KD5 A;  3PMW A;  1IEJ A;  2O51 A;  1FQB A;  2NUV A;  2L5V A;  1IXI A;  3LSF B;  5CRY A;  4F1V A;  2QRY A;  2ONS A;  3SET A;  5JTY B;  3K0V A;  5KDT B;  2P3N A;  3RPW A;  1IMB A;  1AOV A;  4AB5 A;  1D3K A;  1GR2 A;  3LSL A;  3M8U A;  4O8M A;  2P2A A;  5IKB A;  5CMB A;  4GXS B;  4Z7E A;  5HPQ A;  2FVZ A;  4XKQ A;  5H8S A;  1B2H A;  4IO2 A;  3B6T A;  1T0K A;  3UOR A;  2ZMB A;  4HCY A;  3PD9 A;  3B6Q A;  4ISU A;  5FHN A;  3C33 A;  3K02 A;  4N13 A;  3BIG A;  5FTI A;  2D5W A;  3RNN A;  4P1L A;  5KDT A;  4KXP A;  5L8D A;  4LQ5 A;  4OFO A;  1A99 A;  4XXU A;  1QW0 A;  3T9V A;  1R6Z A;  3N26 A;  2DWH A;  4U2R A;  3FVN A;  4F3B A;  4DI4 B;  1URS A;  1DBZ A;  1MRP A;  2V4C A;  3I5O A;  3IOU A;  5BWJ A;  4PAI A;  3K00 A;  3C9H A;  1ATG A;  3V5A A;  5LTC A;  1VSO A;  1LFH A;  2ZYO A;  1IZ1 A;  1OVB A;  1I69 A;  4LZ5 A;  4YU0 A;  1TFD A;  1LGB C;  3PPP A;  1O7T A;  4RNS A;  4LQ2 A;  2KLF A;  2Q9T A;  3EQ1 A;  4F18 A;  4OFL A;  5DTB A;  2LAO A;  4PF6 A;  2I4C A;  3S2V A;  3SKP A;  4R74 A;  4GFR A;  4PCD A;  1QGX A;  5CMK A;  1B9J A;  3TUS A;  3TEL A;  4RJZ A;  3Q25 A;  4N4U A;  4F22 A;  3OEN A;  3T66 A;  3C34 A;  3KSJ A;  1MXX A;  1DPP A;  2WBD A;  4GLI A;  2JJK A;  2UYE A;  5KCJ B;  2ZZW A;  3UK4 A;  2HZK A;  1DOT A;  1MQG A;  1SPI A;  4FE8 A;  4UA8 A;  3R6U A;  1H76 A;  4PFT A;  5AA2 D;  5JEI A;  1A40 A;  3TCH A;  5ITP A;  4MLQ A;  4PP0 A;  1NV2 A;  4YKI A;  4NF5 B;  1XC1 A;  2HEU A;  4P1E A;  4JVI A;  2R71 A;  3IL1 B;  3CG1 A;  3TZA A;  3U8Q A;  1FBH A;  1FPF A;  4ZEK A;  2PYY A;  3MJN A;  1FCK A;  4ONY A;  4E0X A;  3O6I A;  3S9M C;  4OTE A;  3B6W A;  1KA1 A;  2V25 A;  2BJJ X;  1SW2 A;  4C0R A;  3PTY A;  4LA9 A;  4OWD A;  3IOV A;  4O3B A;  1ZIU A;  3A09 A;  2P3V A;  3OO9 A;  4QFN A;  2HPG A;  3RT8 A;  4JWO A;  2Y7W A;  4YKK A;  3DM0 A;  1NUX A;  1R1N A;  3MVY A;  4JWX A;  4XFE A;  4P0G A;  5A5X A;  3SES A;  4GWU A;  1TWY A;  4ESX A;  1WOD A;  4QXD A;  2CZL A;  2F36 A;  1INP A;  4RYA A;  1DMB A;  1NUZ A;  4PQJ A;  4JXI A;  5K2X A;  1NV1 A;  4RPO A;  5I2K B;  2CZI A;  1MH4 A;  4PAF A;  1FBE A;  2HFB A;  1R9L A;  2DWA A;  4P0I A;  3UA8 A;  4IGT A;  2W7Y A;  5JK4 A;  1GGG A;  4FEC A;  2V84 A;  1B3H A;  1OIB A;  3KBR A;  1AL3 A;  1MXU A;  1B40 A;  1IXC A;  2XXW A;  1FPG A;  4TLM B;  5I58 B;  2ZZV A;  1SYH A;  4NG7 A;  5CMM A;  4F3P A;  5ISU A;  4UAC A;  3KSX A;  5LOM A;  4GRK A;  2ZYM A;  1UIU A;  5DVF A;  1UTB A;  1B51 A;  3KN7 A;  2I58 A;  4G2Z A;  3FJM A;  1B05 A;  3IO6 A;  3DP6 A;  4GQO A;  5HBC A;  4P47 A;  1NNF A;  2XXT A;  4OVP A;  3USD A;  1B0H A;  3D4G A;  3SZP A;  2WEF A;  3TKD A;  3ROJ A;  1N7X A;  3FZV A;  3LC8 A;  2ZNS A;  1Y3N A;  2DE2 A;  5AE4 A;  4KYE A;  3EHS A;  3S4U A;  1FBD A;  1N0T A;  2FA7 A;  4YMA A;  4OXV A;  4N91 A;  2XWV A;  4HE2 A;  4PFI A;  4GBW A;  1D4N A;  2AL4 A;  2QSX A;  1FTJ A;  5DEX A;  5I84 A;  4OA4 A;  1B0L A;  1Y1Z A;  5I58 A;  4FIM A;  5ET8 A;  2B4M A;  2G29 A;  4GWX A;  2DXY A;  1FQC A;  3T96 B;  4AB6 A;  2NOO A;  2QS2 A;  4NF4 A;  2Q2C A;  2QVV A;  3MW0 A;  2IA4 A;  1EZ9 A;  3EF7 A;  1PC3 A;  2ONR A;  2XXH A;  4KYS A;  1LCF A;  2PT1 A;  3SEU A;  5TP9 A;  4C1U A;  1LCT A;  2Q2A A;  5I3S A;  3DLN A;  4ELQ A;  1AWB A;  1EZP A;  1B32 A;  3RTF B;  4OEU A;  3E3K A;  4M4G A;  1P1Q A;  4G68 B;  1FTK A;  3W9W A;  2NWJ A;  2FHY A;  4HCW A; 
#chains in the Genus database with same CATH homology
 4IO4 A;  1MXW A;  1D9V A;  3U92 A;  1MS7 A;  2XXX A;  1TFA A;  1ZMG A;  1US4 A;  3QXM A;  4U23 A;  4XTC Q;  2A5T B;  1MH3 A;  5ICQ A;  3PPQ A;  4ZE8 A;  1PB9 A;  3H6W A;  3VLU A;  3V83 A;  2ONK E;  4RA1 A;  3H3G A;  2PVU A;  4MH5 A;  3MBP A;  3O9P A;  3PUZ E;  3G3I A;  3K1P A;  4GF8 A;  3KFM A;  2UVG A;  1QUK A;  5H8H B;  1XT8 A;  3PPR A;  5H8F A;  1IIT A;  2VP1 A;  2X26 A;  1IXG A;  5KCJ A;  1QUJ A;  2H9B A;  5BUU A;  3V8X B;  1SDX A;  2HXW A;  1EZO A;  1POT A;  1Z7M E;  3RT6 B;  4F31 B;  1CE2 A;  4RY1 A;  4OER A;  2RC7 A;  5H8N B;  4DIG A;  2CMO A;  1BKA A;  3OEK A;  3M3L A;  4LZ7 A;  3FD3 A;  2THI A;  3E13 X;  3G3G A;  4X48 A;  2YLN A;  2Q8J A;  1NL5 A;  2DWI A;  4MBP A;  1NNK A;  2ESN A;  4OHN A;  3FAT A;  3CR9 A;  2DE3 A;  3EPE A;  3FVG A;  3PUY E;  4Q30 B;  1JVY A;  3LUY A;  4XIG Q;  3VLV A;  2AL5 A;  4L17 A;  5I2N A;  4HS7 A;  2F97 A;  1QUI A;  3KG2 A;  4PE5 B;  5ITO A;  1JEU A;  4NED A;  4X1D A;  4HW8 A;  5CBS A;  4LZ8 A;  4EQ9 A;  4M1V A;  3TAJ A;  4R75 A;  4U21 A;  3VVE A;  2Y7I A;  3L6H A;  4R2F A;  5I57 A;  4H65 A;  3RLF E;  3OO6 A;  1B3F A;  4EQB A;  3A3U A;  3FAS A;  4WXJ A;  3QUF A;  1USY E;  3P7I A;  5I56 B;  4NF5 A;  1GVC A;  3KOT A;  3LBS A;  1L5T A;  3OOA A;  3QSL A;  1LB8 A;  4LVQ A;  2GFE A;  3FIR A;  1DTZ A;  3CG3 A;  2DOJ A;  3MPK A;  1GTK A;  4QRZ A;  1URG A;  4GOT A;  3UGW A;  3U94 A;  3RTW B;  2G93 A;  3QUJ A;  3THI A;  1B7U A;  1B7Z A;  2P0S A;  3KZG A;  4H6D A;  2H98 A;  5IAI A;  1LLS A;  4JSD A;  5L9S A;  1N3W A;  1SQY A;  2FYI A;  2OCU A;  3H06 B;  5DVJ A;  1P1W A;  2OWS A;  1XVY A;  2PX1 A;  3FXQ A;  4YIC A;  3TTL A;  2OWT A;  3GXA A;  1FQE A;  1ZLQ A;  2F8D A;  2QJE A;  2VD2 A;  3FJG A;  4Q0C A;  3HO7 A;  4KD5 A;  3PMW A;  2NXO A;  3MVW A;  1IEJ A;  4NF6 A;  4F3S A;  3VLW A;  2GH9 A;  4O3A A;  2XXI A;  4U1Z A;  3O6G A;  4ELO A;  3GZG A;  2O51 A;  5DVI A;  1XOC A;  3UN6 A;  3ZS6 A;  1FQB A;  2NUV A;  3G3J A;  1IXI A;  1FQA A;  3E4R A;  4R6Y A;  3LSF B;  5CRY A;  1MQH A;  4OQO A;  3OSQ A;  4F1V A;  1SW4 A;  4Q8R A;  3HPI A;  2QRY A;  5I59 A;  1MDQ A;  2Y7R A;  4IY5 A;  2ONS A;  5DT6 A;  3K6W A;  3SET A;  4BDR A;  1LAF E;  4TOZ A;  3VE1 B;  5JTY B;  5I2K A;  1R9Q A;  3KJT A;  2V3T A;  4YMB A;  4X9T A;  1SVX B;  1DSN A;  5AA3 A;  4GXA A;  3K0V A;  3OD7 A;  5KDT B;  3S9N C;  1MPD A;  3TPA A;  4R6K A;  3H6T A;  3IO4 A;  3RPW A;  1ZU0 A;  1B3G A;  2ANJ A;  4H5F A;  4AB5 A;  1AOV A;  1D3K A;  3M3K A;  4OEN A;  1GR2 A;  2AIX A;  2OZZ A;  3LSL A;  3M8U A;  4YB7 A;  2V3Q A;  1B7H A;  2P2A A;  1LBB A;  1XVX A;  3U1O A;  4GL8 A;  2RCA A;  4H67 A;  4QFO A;  5IKB A;  4F39 A;  5CMB A;  1UQW A;  2V93 A;  3IOR A;  4R2B A;  5I2N B;  2XXY A;  3OEL A;  2NVU B;  3RGY A;  2OJT A;  3TDJ A;  1H43 A;  4GXS B;  4Z7E A;  5HPQ A;  3O28 A;  4IO7 A;  2F7A A;  4POW A;  3CI8 A;  4XKQ A;  1B2H A;  1YTV A;  5H8S A;  3HN0 A;  3T9U A;  1SW5 A;  1VFD A;  4IO2 A;  1MDP 1;  3B6T A;  1US5 A;  3OMB A;  1ZBM A;  1IQ7 A;  3WAE A;  3VFJ A;  1T0K A;  4NWD A;  3UOR A;  5AA4 B;  2ZMB A;  3IOT A;  4HCY A;  4XXU A;  5H8N A;  4FAT A;  3PD9 A;  4WKM A;  3B6Q A;  4ISU A;  5FHN A;  1M5F A;  3C33 A;  3K02 A;  4ECF A;  1ZKB A;  2Y7K A;  4N13 A;  1KWH A;  1UTB B;  3C31 A;  3VV5 A;  2B3F A;  5FTI A;  1NNT A;  3TOD A;  2D5W A;  3FV2 A;  2B3B A;  3G3H A;  4JB7 A;  3RNN A;  1HSE A;  5KDT A;  2A5T A;  4QSE A;  5F7V A;  2I6E A;  5L8D A;  4LQ5 A;  5EHM A;  4YZZ A;  2R9J A;  3D4C A;  3M3F A;  4OFO A;  1DPE A;  3VVF A;  1JW4 A;  1A99 A;  3EHT A;  2ZYN A;  1FTO A;  1B5J A;  2D21 A;  1UTH B;  2Q89 A;  1FTL A;  3ILU B;  4G77 A;  1QW0 A;  1B5I A;  1MQI A;  1R6Z A;  3IX1 A;  1XS5 A;  4H1X A;  3N26 A;  3T9V A;  2DWH A;  2O6A A;  2ALU A;  3Q29 A;  4U1O A;  3CFZ A;  4U2R A;  1D9Y A;  3FV1 A;  4H5G A;  3FVN A;  1P1N A;  4YAH X;  2I3V A;  2QMX A;  1PBQ A;  4F3B A;  3PD8 A;  1URS A;  2RCB A;  3CFX A;  3PGF A;  4DZ1 A;  1OQH A;  1MRP A;  3L6G A;  3QK6 A;  2I0B A;  4BLA A;  4C1T A;  2YPN A;  3Q28 A;  1LFG A;  4OEV A;  2XX7 A;  3I5O A;  4OVJ A;  3S9E A;  3N6U A;  3HHG A;  1NH8 A;  5AA1 A;  4YKP A;  3IOU A;  2NWJ A;  3RY3 A;  5BWJ A;  3K00 A;  4Q5T A;  3TTM A;  1A55 A;  3C9H A;  4KPT A;  1ATG A;  3MUQ A;  5CBR A;  4F2Q A;  4RXL A;  3CRB A;  5KZT A;  3V5A A;  3TCG A;  4F29 A;  1JVX A;  1VSO A;  2O7I A;  3IR1 A;  3N5L A;  2QS3 A;  4IY6 A;  2ZYO A;  3TCF A;  1LFH A;  4JWY A;  1IZ1 A;  1OVB A;  1I69 A;  1OMP A;  1RKM A;  1B1H A;  2I49 A;  2XXU A;  1TFD A;  4LZ5 A;  4X1B A;  4YU0 A;  1LGB C;  1Q1K A;  3PPP A;  3U72 A;  2O7U A;  1MM7 A;  1O7T A;  4RNS A;  3T9X B;  4I62 A;  4KCD A;  4LQ2 A;  1VE4 A;  2UVJ A;  2PBW A;  4DXB A;  1II5 A;  1P1U A;  2GHB A;  2WKY A;  2KLF A;  2Q9T A;  3EQ1 A;  4F18 A;  4OFL A;  5DTB A;  2LAO A;  4IO5 A;  2I4C A;  4RK9 A;  3S2V A;  3SKP A;  4IB2 A;  4R74 A;  4LAT A;  3PPN A;  1NKX A;  2GRV A;  1WDN A;  3H6U A;  4FOR A;  2HAV A;  2QS1 A;  2RIN A;  3OO7 A;  4GFR A;  3TYH A;  5L9M A;  4G8H A;  1LBC A;  4GD5 A;  5CMC A;  1A54 A;  1B9J A;  5CMK A;  3TUS A;  1RYX A;  4XKP A;  3TEL A;  2Z8F A;  4G8N A;  5ELV A;  3SER A;  2DYX A;  1UTH A;  3Q25 A;  2QS4 A;  1MG1 A;  4RJZ A;  2I4B A;  4F22 A;  1BIY A;  2HZL A;  3OEN A;  3T66 A;  4BDQ A;  4ZE9 A;  1MY4 A;  3EN3 A;  3C34 A;  2Y7P A;  3IB2 A;  3O6H A;  3TMG A;  3SEW A;  3KSJ A;  1MXX A;  2DE4 A;  4U22 A;  1DPP A;  3KN3 A;  3B7D A;  4DXU A;  3DEL B;  2REG A;  4GLI A;  4O3C A;  3HCQ A;  3FVK A;  2UYE A;  4E0W A;  1TT1 A;  5KCJ B;  3BFT A;  3KJ7 A;  5I57 B;  3UK4 A;  2HZK A;  1DOT A;  1MQG A;  5H8Q A;  3W9V A;  4I1D A;  4LON B;  4DLD A;  2DVZ A;  4H8I A;  3BBR A;  3I3V A;  1H3D A;  4FE8 A;  3MZ1 A;  1B4Z A;  2F6G A;  4BDN A;  5AA4 A;  1QKB A;  4RPN A;  3HHF A;  1I6Q A;  3R6U A;  4H8J A;  1H76 A;  4PFT A;  4UA8 A;  5AA2 D;  2DS9 A;  5JEI A;  1A40 A;  5TU0 A;  1LAH E;  3TCH A;  5ITP A;  1O64 A;  4MLQ A;  4PP0 A;  3Q27 A;  4HTG A;  1FQD A;  2ZNT A;  2RKM A;  3CIJ A;  3O66 A;  3K2D A;  4G4P A;  3MWB A;  4YKI A;  4BDM A;  2Z8D A;  4NF5 B;  1LB9 A;  1XC1 A;  2HEU A;  3C4M A;  1AIV A;  2R71 A;  3IL1 B;  3BKI B;  1Y1M A;  2ZYK A;  4N07 A;  4KYD A;  4EF1 A;  2RF1 A;  3CG1 A;  4GL0 A;  1NH7 A;  4R73 A;  5H8F B;  3TZA A;  3ODB A;  4U4X A;  1S9T A;  1URD A;  4LUB A;  4G68 C;  3U8Q A;  4ZEK A;  3IB0 A;  3ILT B;  4F1U A;  1B3L A;  3QIM A;  5FHM A;  4WEP A;  1QVS A;  1OLC A;  1P99 A;  2PYY A;  2O1L A;  1MPB A;  1FQF A;  3MJN A;  3PUV E;  1FCK A;  2VGQ A;  3BFU A;  4KCC A;  1PB7 A;  3MP1 A;  3OO8 A;  4ONY A;  4E0X A;  3O6I A;  3GBB A;  4NTL A;  1SW1 A;  4OTE A;  3CSB A;  3S9M C;  5F1Q A;  4PET A;  2VD3 A;  3B6W A;  2IEE A;  2V25 A;  3ZSF A;  4KFQ A;  2BJJ X;  4LP2 B;  1SW2 A;  4NWC A;  4C0R A;  2Y84 A;  5H8Q B;  4F3G A;  3PMV A;  2P1S A;  4G8M A;  4MFI A;  3KGC A;  4R72 A;  2XXP A;  4EXL A;  3TTK A;  4RK2 A;  1LFI A;  4LA9 A;  5H8H A;  1M5D A;  3LSX A;  1CB6 A;  1N04 A;  3EHU A;  3IOV A;  3ONM A;  4OWD A;  3AXF A;  4R9F A;  4JDF A;  4O3B A;  1I6A A;  4YB6 A;  3CVG A;  1ZIU A;  3A09 A;  2D3I A;  4H0W A;  3OO9 A;  2OK2 A;  4QFN A;  3OEM A;  1TXF A;  4DCX A;  1SYI A;  3RT8 A;  4AQ4 A;  1J1N A;  1UIV A;  2Y7W A;  4JWO A;  2A5S A;  2HCA A;  2O69 A;  2F78 A;  2RC8 A;  3DM0 A;  3MP8 A;  4OZ9 A;  4YKK A;  4ZZA A;  4G68 A;  4BDO A;  3JYR A;  1FW0 A;  1R1N A;  2V3U A;  3IOW A;  4NMY A;  4U4S A;  1JQF A;  3MVY A;  5TPA B;  4JWX A;  2X7Q A;  1PB8 A;  4P0G A;  5A5X A;  3SES A;  4ZEB A;  3JV9 A;  1BP5 A;  5EHS A;  4FED A;  3V89 B;  1TWY A;  3JZJ A;  4ESX A;  1MQJ A;  1ELJ A;  1Y9U A;  1WOD A;  1MXV A;  4PFW A;  1MY0 A;  2ZXT A;  1LST A;  4ELP A;  1H45 A;  1Y20 A;  4ND9 A;  4ZEF A;  2CZL A;  3H7M A;  2GHA A;  3TFL A;  2F36 A;  2I0C A;  1PEB A;  3KN8 A;  4OES A;  1MXY A;  2F7B A;  2REJ A;  1M5B A;  2UVI A;  4RYA A;  4YKJ A;  1DMB A;  2UYF A;  4PQJ A;  4JXI A;  1PBP A;  5K2X A;  3Q26 A;  3PV0 E;  4NE4 A;  3PUW E;  4RPO A;  4R9G A;  1B4H A;  3A3C A;  2RC9 A;  1QUL A;  2O84 X;  5I2K B;  3RN8 A;  3UP9 A;  2DP8 A;  2H4I A;  3MC2 A;  1MH4 A;  3UIF A;  1N76 A;  1P1O A;  2Z23 A;  2Z8E A;  4IGR A;  4IO6 A;  3R26 A;  2HFB A;  4N6P A;  5I59 B;  1R9L A;  1MXZ A;  2DWA A;  4P0I A;  1B3E A;  1USY H;  3PMX A;  4FEB A;  3UA8 A;  4IGT A;  2W7Y A;  4ELR A;  1GGG A;  4PFU A;  1ZJL A;  5JK4 A;  4FEC A;  1MM6 A;  2V84 A;  2F7C A;  4EDP A;  5I56 A;  3CFL A;  1A8F A;  4MF3 A;  2M8C A;  1A8E A;  2XXV A;  2I3W A;  4THI A;  3S9L C;  1B3H A;  3RQT A;  4QF9 A;  5ICT A;  3O97 A;  2YJP A;  3PPO A;  5FHO A;  1OIB A;  3GLB A;  2B65 A;  3KBR A;  1AL3 A;  1MXU A;  1B40 A;  1B1X A;  1IXC A;  2XXW A;  3E9X A;  4TLM B;  5I58 B;  2DQV A;  3HST A;  3K6X A;  4K3F A;  1JET A;  4GIZ A;  1MPC A;  4ZZE A;  1I6B A;  1B46 A;  2XX9 A;  3G3K A;  3VVD A;  3OSR A;  4QFL A;  1QJM A;  3VXB A;  5CM6 A;  1B6H A;  1SYH A;  3I6V A;  3SEY A;  5CI5 A;  5CMM A;  1B52 A;  1HSL A;  4F3P A;  5ISU A;  2H25 A;  1EU8 A;  3R7X A;  4NF8 A;  4FJP A;  1M5E A;  3F11 A;  3K1N A;  2UVH A;  3KSX A;  4UAC A;  3DP4 A;  1LAG E;  1BLF A;  4ZS9 A;  4GRK A;  4Z0I A;  3TQL A;  5LOM A;  2AYS A;  2QPQ A;  3VXC A;  3QYT A;  4XKN A;  5J1D A;  2ZYM A;  1UIU A;  2DXR A;  4QSC A;  4EQ7 A;  4EXK A;  4YB5 A;  5HM4 B;  3FVO A;  5DVF A;  1SD3 A;  1UTB A;  3PU5 A;  4P11 A;  1O63 A;  2E1S A;  1B51 A;  3KN7 A;  2F6P A;  1N7W A;  2I58 A;  4G2Z A;  1XHY A;  1ZTY A;  5TP9 B;  3FJM A;  3K1M A;  1B05 A;  3IO6 A;  4QSD A;  3ZKL A;  3DP6 A;  4GQO A;  5HBC A;  4I9D A;  4F2O A;  1JW1 A;  1POY 1;  4KHZ E;  1OLA A;  1NNF A;  2XXT A;  3LR1 A;  3USD A;  4OET A;  1B0H A;  3DP8 A;  3O2A A;  3D4G A;  3PUX E;  1PDA A;  4GVO A;  3ZKK A;  2VHA A;  3HV1 A;  4QHQ A;  3TKD A;  3FGS A;  4ZEC A;  4ESW A;  1N7X A;  2XD2 A;  1WVJ A;  3FZV A;  3LC8 A;  2ZNS A;  1Y3N A;  2DE2 A;  4TQU Q;  3T93 B;  4KYE A;  5AE4 A;  3TTR A;  4MLV A;  2Q88 A;  2UXA A;  4FAJ A;  2ABH A;  4F19 A;  3EHS A;  3MAM A;  3GBA A;  3S4U A;  3FJ7 A;  2PT2 A;  2F34 A;  1AMF A;  1VFE A;  1Y4C A;  1H44 A;  4WED A;  2O68 A;  3MQ9 A;  2OLB A;  1B58 A;  1N0T A;  1A7L A;  3MVX A;  2FA7 A;  2FNC A;  4YMA A;  4OXV A;  5FTH A;  3G3F A;  2OBG A;  1VR5 A;  1MY1 A;  3K4U A;  4JBZ A;  4POX A;  4DDD A;  3K6V A;  5JTY A;  1IXH A;  4XKR A;  1IIW A;  1Y3Q A;  2VOZ A;  4OYV A;  2H5Y A;  4ZDM A;  1Q35 A;  5K2Y A;  2H99 A;  2XD3 A;  2XXQ A;  1S50 A;  3LSW A;  3MP6 A;  5TPA A;  3T22 A;  1D4N A;  2R6G E;  3N6T A;  5M2V A;  4GWO A;  4NF4 B;  2AL4 A;  2QSX A;  1FTJ A;  1OVT A;  5DEX A;  2Z22 A;  2QMW A;  5DYH A;  5A5X B;  5AA2 A;  4JSO A;  3O29 A;  3H4Z A;  5I84 A;  2QL3 A;  3FXU A;  2O1M A;  1S7Y A;  1B0L A;  1EH3 A;  1Y1Z A;  1OQG A;  4DCY A;  4EF2 A;  4QFK A;  3H03 A;  5I58 A;  1JEV A;  4NF6 B;  4KI0 E;  1YAE A;  1Z7N E;  4FIM A;  1MY3 A;  1DTG A;  2DWJ A;  1SI1 A;  4F1Y A;  1HSJ A;  4KR5 A;  2XX8 A;  4KQP A;  2G29 A;  5B70 A;  1N84 A;  1F9B A;  1SBP A;  3IAZ A;  3MZ9 A;  1BTJ A;  3MVZ A;  2XXR A;  1MY2 A;  2DXY A;  1GV8 A;  3SEV A;  5B7D A;  1FQC A;  3MPL A;  2F35 A;  3T96 B;  3TEP A;  4AB6 A;  2NOO A;  3TTN A;  2QS2 A;  3IK6 B;  3W15 C;  4NF4 A;  4EUO A;  1JW5 A;  3T9H B;  2Q2C A;  1YPN A;  3MZB A;  2X7P A;  3MW0 A;  2IA4 A;  3QAX A;  2I48 A;  1YCJ A;  4ZED A;  4PFY A;  1EZ9 A;  3FUZ A;  3K6U A;  4R6H A;  2DSF A;  3RUM A;  3EF7 A;  3FXR A;  1PC3 A;  2ONR A;  2XXH A;  3G7W A;  3IB1 A;  1Y4T A;  3IJX B;  4IO3 A;  4KYS A;  2F5X A;  1LCF A;  2HQ0 A;  5EYF A;  3OXN A;  1JNF A;  1N3X A;  3TQW A;  1M5C A;  3C36 A;  2PT1 A;  2ZNU A;  4I8C A;  3SEU A;  1Y3P A;  2PMS A;  4OMB A;  5TP9 A;  3K01 A;  5CC2 A;  4C1U A;  1LCT A;  2Q2A A;  1NMU A;  1ANF A;  3ECR A;  1SI0 A;  3DLN A;  2E0S A;  4BDL A;  4ELQ A;  3U93 A;  3VDF A;  1NNP A;  3CSG A;  1EZP A;  3C32 A;  1QKA A;  2DVC A;  2XHD A;  1B32 A;  3RTF B;  4OFJ A;  3WAF A;  4DE8 A;  5L9O A;  4OEU A;  3KEI A;  5DEX B;  1NFT A;  5AA2 B;  4TLL B;  3E3K A;  3N94 A;  4M4G A;  2HAU A;  1FTM A;  3IJO B;  1RYO A;  4DXC A;  3H6V A;  1B5H A;  1P1Q A;  1IUD A;  4NF8 B;  4G68 B;  4QFP A;  4ZEI A;  3KOS A;  1FTK A;  1LAX A;  3SDF A;  3C35 A;  3SEX A;  3W9W A;  1MQD A;  4HCW A;  1AH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...