2B3BA

Thermus thermophilus glucose/galactose binding protein with bound glucose
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
392
structure length
392
Chain Sequence
MKLEIFSWWAGDEGPALEALIRLYKQKYPGVEVINATVTGGAGVNARAVLKTRMLGGDPPDTFQVHAGMELIGTWVVANRMEDLSALFRQEGWLQAFPKGLIDLISYKGGIWSVPVNIHRSNVMWYLPAKLKGWGVNPPRTWDKFLATCQTLKQKGLEAPLALGENWTQQHLWESVALAVLGPDDWNNLWNGKLKFTDPKAVRAWEVFGRVLDCANKDAAGLSWQQAVDRVVQGKAAFNIMGDWAAGYMTTTLKLKPGTDFAWAPSPGTQGVFMMLSDSFGLPKGAKNRQNAINWLRLVGSKEGQDTSNPLKGSIAARLDSDPSKYNAYGQSAMRDWRSNRIVGSLVHGAVAPESFMSQFGTVMEIFLQTRNPQAAANAAQAIADQVGLGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords glucose-binding protein
publication title The crystal structure of a thermophilic glucose binding protein reveals adaptations that interconvert mono and di-saccharide binding sites.
pubmed doi rcsb
source organism Thermus thermophilus hb27
total genus 155
structure length 392
sequence length 392
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2b3bA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2b3bA02
4KCDA 3THIA 1FQCA 4YKJA 4RA1A 4KQPA 1IEJA 2DE3A 2F36A 5H8HB 2DE4A 4KHZE 4PFYA 3HV1A 2HAUA 2V25A 1USYE 4EQ7A 4G8MA 3L6HA 4N6PA 4JBZA 1B46A 2QMXA 4ELRA 3EN3A 2P0SA 5H8NA 3VVFA 2D21A 1URGA 4OFJA 4DIGA 5TP9B 1WVJA 1PB9A 4QSEA 2O7UA 2XXPA 3CSBA 1B0HA 3LBSA 3V8XB 3KGCA 3QIMA 3RUMA 1LBBA 5FHNA 4OENA 4OZ9A 4WXJA 1JW4A 3G3FA 5CMMA 2QRYA 1WDNA 3IJXB 3ONMA 5ICQA 3H03A 2OWTA 3E4RA 2LAOA 1JQFA 5JTYB 4OMBA 4QHQA 3E3KA 3G3GA 2Z22A 5I58B 3MWBA 3FVKA 5JK4A 2FYIA 3W9WA 2I48A 1LFGA 4BDQA 5AA2B 2O6AA 3U93A 3KG2A 3K00A 3EHTA 4MF3A 1DTGA 3QK6A 3U8QA 4F3SA 1NNKA 2HCAA 3WAEA 1H3DA 2Y7IA 3H6TA 4ZE9A 2HXWA 4X48A 4ELQA 3C33A 1OQHA 2ZNUA 4UACA 3ODBA 3H06B 2D5WA 2V3TA 4BDOA 2F7CA 1AH5A 5L9SA 3AXFA 4O3CA 3OXNA 1FQDA 1IXHA 1PEBA 3FIRA 3DP8A 4E0XA 4DXUA 3FATA 2A5TB 1VSOA 4C1TA 2RCBA 2THIA 1NKXA 1B3LA 3DLNA 4R73A 1MY0A 4KPTA 2IA4A 5DTBA 5AA3A 3Q29A 5I56B 3LUYA 2XXTA 4P0IA 3K6XA 5A5XA 3HO7A 4C1UA 2ONKE 1GR2A 2OJTA 2QMWA 3OO7A 3N6TA 4H65A 4LZ7A 4ONYA 4XIGQ 1EH3A 5FTIA 2I4BA 2RC7A 3MP1A 3RTFB 4R74A 4F22A 4IGTA 1GGGA 1NNTA 1M5DA 1I6AA 3MZBA 1GTKA 4EXKA 3JZJA 3Q25A 3PD9A 3IAZA 2DSFA 4GRKA 1OLCA 4U4XA 4DCXA 3IOWA 4PE5B 2O1MA 4NF8B 3CR9A 3H6VA 1JVXA 3R6UA 5L8DA 1B2HA 2W7YA 4M1VA 2AYSA 3OENA 2HZKA 3K1MA 1N7WA 3MC2A 4ZECA 3M3KA 4QFNA 4LUBA 2H98A 1NNPA 3TQLA 3H4ZA 4R9GA 3RTWB 3D4GA 1R9LA 1Z7ME 2Q88A 3DM0A 4ZS9A 4I1DA 2AIXA 3HHGA 2F6PA 3VV5A 4EF2A 3ZS6A 1MPDA 4IY5A 3MVZA 1MY4A 1SI1A 2YLNA 1N84A 2QJEA 3FVOA 4PQJA 4H1XA 3C4MA 4K3FA 1ZKBA 5HPQA 2CZLA 2ESNA 4LZ8A 4JB7A 1B32A 1FTMA 4GD5A 4O3AA 3SKPA 2D3IA 1B9JA 1QW0A 3KSJA 3CFLA 4R2BA 1MQDA 1Y3QA 2ZYNA 3H6UA 5ICTA 1VFDA 4U1ZA 1A99A 2Y84A 3FXUA 4R6YA 1H44A 3OEMA 1B0LA 2ALUA 3H3GA 4TLLB 5TPAB 3TAJA 1QVSA 4NF6A 4G8NA 5I2KB 3MVYA 2ZXTA 1IUDA 4ECFA 3MBPA 5H8QB 4U21A 4OQOA 1A55A 2V84A 1D9VA 2I0CA 2GHBA 4R6KA 3VXCA 2UVIA 2Y7WA 4F2OA 4OWDA 3Q28A 4R9FA 3KOSA 3LC8A 5IAIA 1IZ1A 5DEXA 1M5BA 1Q1KA 2XXYA 4AQ4A 1XVYA 4TOZA 3ZSFA 3R26A 2I3WA 1PDAA 2OZZA 4OEUA 1N76A 3VXBA 4F2QA 4QSDA 1ELJA 5DYHA 4EXLA 4G68B 1OMPA 4I62A 4P0GA 4N07A 1MDQA 3S9MC 2Z8EA 2VOZA 3KN7A 4U22A 2UVHA 5HM4B 2ONRA 4EQ9A 2HAVA 3PPOA 2QS1A 4F29A 3N6UA 1MQHA 3GZGA 1JVYA 2B3FA 3PUYE 3T93B 1AMFA 2F35A 4NE4A 1Y4CA 1DPPA 3U92A 1SYIA 1J1NA 3FXRA 4I8CA 5I57B 4RPOA 1SW1A 1FTKA 3KOTA 5FHOA 3TUSA 1YAEA 3JV9A 1ZIUA 2QS2A 4F18A 3FVGA 1FTOA 4JWOA 4HCYA 4GXAA 3O66A 1SBPA 4Q30B 2BJJX 3FGSA 2P1SA 5K2YA 5CM6A 4RY1A 2X7QA 4RNSA 1B3HA 5EYFA 2V3UA 3PMVA 3A3UA 3IB2A 2PVUA 1MH4A 4JWXA 1Y20A 3C36A 2UXAA 3CVGA 3ILUB 2O7IA 4FE8A 1B5JA 2IEEA 4GXSB 1O63A 4HS7A 5AA2A 2I3VA 1B3EA 2VD2A 3TTMA 5I59B 2VGQA 2ZYOA 4F1UA 4IB2A 5J1DA 2XXXA 1QUJA 4ZEBA 1HSJA 2DS9A 3K1NA 3VFJA 4H6DA 3FD3A 5EHMA 1SW5A 3S2VA 3QXMA 1OLAA 3H6WA 4KYEA 3RLFE 3MPKA 1OIBA 4H67A 4LA9A 2DVCA 2A5TA 1II5A 2HFBA 4NF4B 4X1BA 3MVWA 5AA1A 2O69A 3KJTA 3UIFA 4PFTA 4GL0A 3VLVA 3V83A 4G8HA 1R6ZA 3G3IA 1UTBB 3O29A 2OK2A 1Y4TA 3S4UA 3K2DA 3PUWE 1NNFA 1S7YA 1M5CA 3RY3A 4G4PA 4ND9A 3MVXA 3B6WA 3KJ7A 3PUXE 4BDRA 4NF5A 4KI0E 1GV8A 1LB8A 4IGRA 3RPWA 1IXCA 2NXOA 3TZAA 1LAHE 3MPLA 5CBSA 4FEBA 1MXVA 3BBRA 4MH5A 1VR5A 4H5GA 4ELOA 1A8EA 1Y9UA 3BKIB 2DXYA 4QFPA 4XXUA 4NF8A 4ISUA 3IOTA 1D4NA 3BFTA 1MH3A 4R2FA 2QL3A 4NMYA 3LSLA 2M8CA 2QS4A 1YPNA 3O2AA 1MY1A 2DE2A 4DXCA 4OVJA 3TTLA 3KZGA 3F11A 2GH9A 2F7BA 1B4HA 3K0VA 3VLUA 3HSTA 4HW8A 3S9LC 5DVFA 4OFLA 4X9TA 3PD8A 2E0SA 3OO6A 1MQJA 3N5LA 4F1VA 5TU0A 1JNFA 3C31A 4PFUA 1B4ZA 4OYVA 3DP4A 4X1DA 3FXQA 3M8UA 4YB6A 2O51A 1UTHB 3IOVA 3RQTA 3B6TA 2DWJA 4IO7A 5H8NB 5KZTA 3W9VA 1QULA 1BIYA 1EU8A 1A54A 3PMWA 4MFIA 3MP6A 2NWJA 1NFTA 3IK6B 2R6GE 2Y7KA 3IOUA 3SEYA 1NL5A 1XS5A 2R9JA 3SDFA 3MAMA 4ZZAA 1WODA 3HHFA 2FNCA 3GBAA 2Q2CA 3A09A 2GFEA 2X26A 4ZZEA 1XT8A 5H8FB 1MQIA 4TLMB 4RYAA 4BDMA 3U1OA 4NTLA 1FQAA 4IO4A 1JETA 5TPAA 4OHNA 5EHSA 4QSCA 3RT6B 4DDDA 2Y7PA 3O97A 1JEUA 4YU0A 3QSLA 2XX8A 1B51A 3G3JA 1HSLA 4UA8A 1PC3A 1MPBA 2F7AA 3TPAA 3PUZE 4R72A 4F3PA 4IO5A 1POY1 1XHYA 2I58A 2H99A 1ZJLA 4G77A 3ECRA 1H76A 4N13A 4QFKA 1RYOA 3OOAA 1FQBA 2XXHA 4KFQA 2XXRA 1ZU0A 2RF1A 3FJ7A 2ZNSA 5KDTB 2RC9A 3EHUA 3UGWA 3TEPA 4JSOA 1RYXA 4G68A 3SEUA 2QSXA 3VDFA 5F1QA 2VD3A 4OXVA 3SETA 4E0WA 1BTJA 2I4CA 3TCGA 2V93A 3OSRA 2XX9A 4Q8RA 2RKMA 3N26A 4FORA 5A5XB 5BUUA 3KSXA 2Z23A 1L5TA 2F78A 3C9HA 5I57A 1MM6A 5CMBA 2PX1A 3ZKLA 3H7MA 1MG1A 2UVGA 2H25A 1QUKA 3IB1A 2R71A 1IXIA 1KWHA 4P11A 1ZBMA 3K4UA 2PBWA 5KCJB 1PB7A 4FAJA 5I2NB 3JYRA 4YAHX 1TWYA 4GIZA 4H8IA 1D3KA 1BP5A 4DXBA 3HN0A 1TT1A 5CMCA 4IO6A 1QJMA 4NEDA 1FW0A 4YB5A 1UIVA 2HEUA 4U23A 1R1NA 1YCJA 1N7XA 3OMBA 4JXIA 1DSNA 4LQ2A 4O3BA 4XKNA 4FECA 3FASA 3EQ1A 4PFWA 4Z0IA 1DTZA 1LFHA 3I5OA 2ZNTA 2Q8JA 1N0TA 2CMOA 1YTVA 1AIVA 3CFZA 5ITOA 3A3CA 5DVIA 4XKPA 5H8HA 3HPIA 1LB9A 2A5SA 3M3FA 4ZE8A 3PPRA 1JW1A 1P1OA 1FCKA 5FHMA 1BLFA 5ELVA 1ZLQA 1QUIA 4ZEKA 4R6HA 5AE4A 2GHAA 4F3GA 1UIUA 4LQ5A 4MLQA 4MBPA 2DWAA 3PPPA 3IORA 1AL3A 3T22A 4HCWA 3CRBA 5TP9A 1T0KA 4G68C 5ISUA 4JDFA 3VVEA 4IO3A 1A7LA 4GL8A 1JEVA 3MZ9A 1B1XA 2I6EA 3E9XA 2UYFA 4ESXA 2UYEA 3I3VA 4RPNA 4GF8A 1IITA 5IKBA 3CIJA 1ZMGA 1POTA 3UK4A 2H5YA 1N3WA 2HQ0A 3RGYA 3TTKA 5JTYA 3FV2A 4ZEFA 5I58A 2HZLA 1B58A 2VP1A 3O28A 3SEVA 1A8FA 4H8JA 2NUVA 3FVNA 4F3BA 1SDXA 1P1QA 1MS7A 1Y3NA 4WEPA 3HCQA 3B7DA 4OFOA 3B6QA 4YB7A 4U4SA 3O6GA 2Y7RA 4NWDA 1P1UA 4ZDMA 1IXGA 4WEDA 5M2VA 2QS3A 3OELA 1M5EA 2XXIA 4PP0A 4Q0CA 1EZPA 1MXXA 3ILTB 5AA4B 3ZKKA 2NOOA 3CSGA 2F8DA 2XXQA 3WAFA 3TODA 4C0RA 1B5HA 4DLDA 3L6GA 4YKKA 1LBCA 4EDPA 5I56A 2DWIA 3T9XB 1UTHA 1F9BA 2WKYA 3OO9A 1B05A 3KBRA 3K6WA 2G93A 3PPNA 4QRZA 2YPNA 4QFOA 3V89B 3KEIA 3TTNA 3TCHA 3C35A 3UORA 4OERA 4GVOA 3G7WA 1P1WA 5DT6A 5B70A 4OESA 5LOMA 4U1OA 4NWCA 3TTRA 1Q35A 3IL1B 1SW4A 4OTEA 3S9EA 4Z7EA 1S50A 5H8FA 1MPCA 2OWSA 3T66A 4KCCA 3G3KA 3K02A 1URDA 1P99A 1B52A 1MXZA 4KYDA 1SQYA 2DYXA 4IO2A 3EHSA 4QF9A 3E13X 2UVJA 3QUJA 1HSEA 3LSXA 3MW0A 3I6VA 5L9MA 3GLBA 3OO8A 1S9TA 1LFIA 1Y3PA 2DXRA 4KYSA 4LP2B 4YMAA 3OD7A 3Q27A 5HBCA 1PBPA 1ANFA 1MQGA 4RXLA 5CC2A 3OSQA 3P7IA 2XXUA 2B3BA 3FJMA 3LSFB 1FQEA 1SYHA 1PB8A 3IJOB 3VVDA 4OETA 1B3GA 1D9YA 4H5FA 2AL5A 3IX1A 2GRVA 4ZEIA 5BWJA 4THIA 5KDTA 3FV1A 5L9OA 1Y1MA 4DE8A 4I9DA 4FEDA 1FTJA 1CE2A 3C32A 3SESA 1LGBC 1OQGA 1TFDA 1IIWA 1LCTA 3MJNA 4POWA 2ABHA 4M4GA 4BDNA 3IO4A 1A40A 3Q26A 2AL4A 2O68A 1GVCA 3FZVA 1LLSA 3TQWA 2V3QA 2DQVA 4JSDA 4WKMA 1SW2A 4MLVA 1SVXB 1M5FA 4EQBA 3UP9A 3CG3A 4R75A 1VFEA 4OEVA 1ZTYA 5I84A 2ONSA 4TQUQ 3IO6A 4IY6A 4ELPA 2PYYA 3PUVE 4NF5B 2I49A 3LR1A 5I2KA 2Z8DA 1MXWA 2OCUA 5F7VA 1SI0A 3SERA 5KCJA 2ANJA 4KR5A 5I2NA 1I6BA 5H8QA 1UQWA 2H9BA 1USYH 1XOCA 4GOTA 1OVTA 1MY3A 2P2AA 5CMKA 3CFXA 3VE1B 2XXWA 2Q89A 5K2XA 4U2RA 3OEKA 1B5IA 4F19A 2DP8A 5H8SA 1ATGA 1XC1A 3K6VA 1QKBA 1PBQA 1DPEA 4LZ5A 1URSA 3R7XA 3O6IA 3DELB 3GXAA 3V5AA 2QPQA 2XX7A 4RK9A 3FJGA 3N94A 1NH7A 2O84X 3TMGA 1EZOA 2RCAA 1FQFA 3C34A 3TELA 1TXFA 3BFUA 4L17A 2F6GA 1IQ7A 3UN6A 4KD5A 3MZ1A 4EF1A 1LAFE 4H0WA 1EZ9A 2ZYMA 3VLWA 3MQ9A 3EF7A 4GFRA 3TCFA 1OVBA 4YMBA 2XHDA 1LCFA 2ZMBA 4JWYA 1XVXA 4XKRA 3W15C 4F31B 1CB6A 3K1PA 1B7UA 3CI8A 4FIMA 4AB5A 3D4CA 2NVUB 4RJZA 1B40A 2Q9TA 1DOTA 5CBRA 2OBGA 1N04A 4YICA 2PMSA 2REJA 1NH8A 4FATA 1FTLA 1I69A 3MUQA 3SEXA 1JW5A 3TYHA 3O9PA 2KLFA 4BLAA 1US4A 4ESWA 3FUZA 2REGA 2F97A 3RN8A 4BDLA 4Q5TA 5DVJA 1MXUA 3TDJA 1B6HA 1LAXA 3S9NC 4DZ1A 4YKPA 3T9UA 2VHAA 5I59A 1O64A 1B7HA 2XD3A 3M3LA 4AB6A 2F5XA 3DP6A 2E1SA 4LONB 3KFMA 3KN3A 2B65A 4ZEDA 3EPEA 1NMUA 3QUFA 1US5A 1O7TA 2PT2A 4F1YA 4PETA 3PV0E 3O6HA 4YZZA 2DOJA 4LATA 3T9HB 4RK2A 1I6QA 3QAXA 5FTHA 1Z7NE 3KN8A 2I0BA 5AA4A 4POXA 5CI5A 3MP8A 4NF4A 1AOVA 3RT8A 5B7DA 2G29A 1R9QA 2OLBA 2O1LA 3RNNA 5AA2D 3GBBA 3U94A 1DMBA 1MXYA 2F34A 1UTBA 2X7PA 5ITPA 1LSTA 1H45A 2FA7A 3SEWA 1VE4A 2ZYKA 4GQOA 2H4IA 3T96B 1N3XA 4GWOA 4G2ZA 3TFLA 3TKDA 4HTGA 1P1NA 3K6UA 4NF6B 4EUOA 1B1HA 4XKQA 1B3FA 2RINA 1QKAA 3USDA 1B7ZA 3QYTA 1Y1ZA 1MRPA 2RC8A 4QFLA 3U72A 5JEIA 3LSWA 4FJPA 2PT1A 3CG1A 3PPQA 1RKMA 2YJPA 2Q2AA 2XXVA 4LVQA 3PGFA 5DEXB 1MM7A 1LAGE 4GLIA 1BKAA 1SD3A 3IB0A 3K01A 1MY2A 3IR1A 3PU5A 2DWHA 3T9VA 1TFAA 2XD2A 4F39A 2DVZA 2Z8FA 5CRYA 1MDP1 3UA8A 3PMXA 3G3HA 4XTCQ 4DCYA 4YKIA 1H43A
chains in the Genus database with same CATH superfamily
1RDXA 4KCDA 3THIA 1FQCA 4YKJA 4I3EA 2ZZXA 4RA1A 4KQPA 1IEJA 2DE3A 2F36A 4PF8A 5H8HB 2DE4A 4KHZE 4PFYA 3HV1A 2HAUA 2V25A 4MMPA 1USYE 4EQ7A 3PTYA 4G8MA 3L6HA 4N6PA 4PFBA 4JBZA 1B46A 2QMXA 4ELRA 3EN3A 2P0SA 5H8NA 3VVFA 2D21A 1URGA 1NI9A 4OFJA 1FPEA 4DIGA 5TP9B 4PAKA 1WVJA 1PB9A 4QSEA 2O7UA 2XXPA 3CSBA 1B0HA 3LBSA 3V8XB 3KGCA 4PBQA 3QIMA 3RUMA 1LBBA 5FHNA 4OENA 4OZ9A 4WXJA 1JW4A 3G3FA 5CMMA 2F3BA 2QRYA 4MNIA 1WDNA 3IJXB 3ONMA 5ICQA 4PAFA 3H03A 2OWTA 4GWWA 3E4RA 2LAOA 1JQFA 2L5VA 5JTYB 4OMBA 4QHQA 3E3KA 3G3GA 2Z22A 2Y5KA 5I58B 3MWBA 2FIXA 1FPJA 3FVKA 5JK4A 2FYIA 3W9WA 2I48A 1LFGA 4BDQA 5AA2B 2O6AA 3D1RA 3U93A 3KG2A 3K00A 3EHTA 4MF3A 1DTGA 3QK6A 3U8QA 4F3SA 1NNKA 2HCAA 1LBVA 3WAEA 1H3DA 2Y7IA 3H6TA 4ZE9A 2HXWA 4P47A 4X48A 4ELQA 3C33A 1OQHA 2ZNUA 4UACA 3ODBA 3H06B 2D5WA 2V3TA 4BDOA 2F7CA 1AH5A 5L9SA 3AXFA 4N4UA 4O3CA 2Q74A 3OXNA 1FQDA 1IXHA 1PEBA 3FIRA 3DP8A 4E0XA 4DXUA 4NF0A 3FATA 2A5TB 1VSOA 1FJ9A 4C1TA 2RCBA 2THIA 5EQ9A 1NKXA 1B3LA 3DLNA 4R73A 1MY0A 4KPTA 2IA4A 5DTBA 5AA3A 3Q29A 5I56B 3LUYA 2XXTA 4P0IA 3K6XA 5A5XA 3HO7A 4C1UA 2ONKE 1GR2A 2OJTA 4PAIA 1BK4A 2QMWA 3OO7A 3N6TA 1IMDA 5I7IA 4H65A 4LZ7A 4ONYA 4XIGQ 1EH3A 5FTIA 2I4BA 1QGXA 2RC7A 3MP1A 3RTFB 4R74A 4F22A 4IGTA 1GGGA 1NNTA 1M5DA 1I6AA 1NV1A 3MZBA 3E79A 1GTKA 4EXKA 5LTCA 3JZJA 3Q25A 2XXKA 3PD9A 5ESYA 2XWOA 3IAZA 2DSFA 4GRKA 1OLCA 4U4XA 4DCXA 3IOWA 4PE5B 2O1MA 4NF8B 3CR9A 2HHMA 3H6VA 1JVXA 3R6UA 5L8DA 1B2HA 2W7YA 4M1VA 2AYSA 3OENA 2HZKA 3K1MA 1N7WA 5IM2A 3MC2A 1D9QA 4ZECA 3M3KA 3RYDA 4QFNA 4P9KA 4LUBA 2H98A 1NNPA 3TQLA 3H4ZA 4R9GA 3RTWB 3D4GA 1R9LA 1Z7ME 2Q88A 3DM0A 4ZS9A 4I1DA 2AIXA 3HHGA 2JJKA 2F6PA 3VV5A 4EF2A 3ZS6A 3CHGA 1MPDA 4IY5A 3MVZA 4P56A 1MY4A 5EYGA 4AS5A 1SI1A 2YLNA 1N84A 2QJEA 2CEXA 4P1EA 3FVOA 4PQJA 4H1XA 3C4MA 4K3FA 1ZKBA 5HPQA 2CZLA 2ESNA 4MCOA 4LZ8A 4JB7A 1B32A 1FTMA 4GD5A 4O3AA 3SKPA 2D3IA 1B9JA 2HPGA 1QW0A 3KSJA 3MYUA 5IZZA 3CFLA 4R2BA 1MQDA 1Y3QA 2ZYNA 3H6UA 5ICTA 1VFDA 2VPNA 4U1ZA 1A99A 2Y84A 1YYZA 3FXUA 4R6YA 1H44A 3OEMA 4MAGA 1B0LA 2ALUA 3H3GA 4TLLB 5TPAB 3TAJA 2PCRA 1QVSA 4NF6A 4G8NA 5I2KB 3MVYA 2ZXTA 1IUDA 4ECFA 3MBPA 5H8QB 4U21A 4OQOA 1A55A 2V84A 1D9VA 2I0CA 2GHBA 4R6KA 3VXCA 2P3NA 1SPIA 2UVIA 2Y7WA 4F2OA 4OWDA 1DCUA 3Q28A 4R9FA 3KOSA 3LC8A 2Y5LA 5IAIA 1IZ1A 5DEXA 1M5BA 1Q1KA 2XXYA 4AQ4A 1XVYA 4TOZA 3ZSFA 4PDHA 3R26A 2I3WA 1PDAA 2OZZA 4OEUA 1YXIA 1N76A 3VXBA 4F2QA 4QSDA 3T1BA 1ELJA 5DYHA 4EXLA 4PC9A 5IZ3B 4G68B 1OMPA 4I62A 4P0GA 4N07A 1MDQA 3S9MC 2Z8EA 2VOZA 3KN7A 4U22A 2UVHA 5HM4B 2ONRA 4EQ9A 1KZ8A 2HAVA 3PPOA 2QS1A 4F29A 2XWIA 3N6UA 1MQHA 2HXRA 3GZGA 1JVYA 2B3FA 3PUYE 3T93B 4O7IA 1AMFA 2F35A 4NE4A 1Y4CA 1IMFA 1DPPA 3U92A 1SYIA 1FBGA 5F24A 1J1NA 3FXRA 4I8CA 5I57B 4RPOA 1SW1A 1FTKA 3KOTA 5ET6A 5FHOA 3TUSA 1YAEA 3JV9A 1ZIUA 2QS2A 4XFEA 2Q8MA 5LDZA 4F18A 2XWVA 3FVGA 1FTOA 4JWOA 4H45A 4HCYA 1LBWA 4GXAA 4MNPA 3O66A 1SBPA 2DDKA 2VT5A 4Q30B 2BJJX 3FGSA 2P1SA 5K2YA 5CM6A 4RY1A 2X7QA 4RNSA 1B3HA 5EYFA 2V3UA 3PMVA 3A3UA 3IB2A 2PVUA 1MH4A 5ET8A 1XI6A 4JWXA 1Y20A 3C36A 2UXAA 3CVGA 3ILUB 2O7IA 4FE8A 1B5JA 2IEEA 4GXSB 1O63A 4HS7A 5AA2A 4XF5A 2I3VA 4P8BA 1B3EA 2VD2A 3TTMA 5I59B 2VGQA 1INPA 2ZYOA 1NV4A 4PGNA 4F1UA 4IB2A 5J1DA 2XXXA 1QUJA 4ZEBA 1HSJA 3GYYA 2DS9A 3K1NA 3VFJA 4H6DA 3A29A 4GBVA 3FD3A 4X8RA 5EHMA 1SW5A 3S2VA 3QXMA 1OLAA 3H6WA 4KYEA 3BIHA 3RLFE 3KBZA 3MPKA 1OIBA 4H67A 4LA9A 4P3LA 2DVCA 2BJIA 2A5TA 1II5A 2HFBA 4NF4B 4X1BA 3MVWA 5AA1A 3FBPA 4GWYA 2O69A 3KJTA 3UIFA 4PFTA 4OVRA 4GL0A 3VLVA 3V83A 4O8MA 3LV0A 4G8HA 1R6ZA 3G3IA 1UTBB 3O29A 4OVTA 2OK2A 3KC0A 1Y4TA 3S4UA 3K2DA 3PUWE 1NNFA 1S7YA 1M5CA 3RY3A 4G4PA 1AWBA 4ND9A 1G0HA 3MVXA 5FBPA 3B6WA 3KJ7A 2CZIA 3PUXE 4BDRA 4NF5A 4KI0E 1NUWA 1GV8A 1LB8A 4HE1A 4IGRA 3RPWA 1IXCA 2NXOA 3TZAA 4PDDA 1LAHE 3MPLA 5CBSA 4FEBA 1MXVA 3BBRA 4MH5A 1NV0A 1VR5A 4H5GA 1DK4A 4ELOA 1A8EA 1Y9UA 3BKIB 2DXYA 1LEVA 4QFPA 4XXUA 4NF8A 4ISUA 3IOTA 1D4NA 3BFTA 1MH3A 4R2FA 2QL3A 4NMYA 3LSLA 2M8CA 2QS4A 4PFIA 1YPNA 1NV5A 3O2AA 1MY1A 2DE2A 4DXCA 4OVJA 3TTLA 3KZGA 4AS4A 3F11A 4MHFA 2GH9A 1K9YA 5EYHA 2F7BA 1IMBA 4P1LA 1B4HA 3K0VA 3VLUA 3HSTA 3IFCA 4HW8A 3S9LC 5DVFA 4N15A 4OFLA 4X9TA 3PD8A 2E0SA 3OO6A 3RPLB 1MQJA 3N5LA 4F1VA 5TU0A 1JNFA 3C31A 4PFUA 1B4ZA 4OYVA 3DP4A 4X1DA 3FXQA 3M8UA 4YB6A 2O51A 1UTHB 3IOVA 3RQTA 2CZHA 3B6TA 4GBWA 2DWJA 4IO7A 5H8NB 5KZTA 3W9VA 1NUYA 1QULA 1BIYA 1EU8A 1A54A 5EQ7A 3PMWA 4NX1A 4MFIA 3MP6A 2NWJA 4UABA 1NFTA 3IK6B 2R6GE 2Y7KA 3IOUA 3SEYA 5IGAA 1NL5A 1XS5A 2R9JA 3SDFA 3MAMA 4ZZAA 4PF6A 1WODA 3HHFA 2FNCA 3GBAA 2Q2CA 3A09A 2GFEA 2X26A 4ZZEA 2ZZWA 1XT8A 4JVCA 5H8FB 1MQIA 4TLMB 4RYAA 4BDMA 3U1OA 4NTLA 3FXBA 1FQAA 4IO4A 1JETA 4QXDA 5EQAA 5TPAA 4OHNA 5EHSA 4QSCA 3RT6B 4DDDA 2Y7PA 4H46A 3O97A 1JEUA 1FPFA 4PE3A 4YU0A 3QSLA 2XX8A 1B51A 3G3JA 1HSLA 4UA8A 2B4LA 1PC3A 1MPBA 2F7AA 3SZPA 3TPAA 3PUZE 4R72A 4F3PA 4IO5A 1G0IA 1POY1 2FBPA 1XHYA 2I58A 2H99A 1ZJLA 4G77A 3ECRA 1H76A 4N13A 4QFKA 1RYOA 3OOAA 5I3SA 1NUZA 1FQBA 2XXHA 4KFQA 2XXRA 1ZU0A 2RF1A 3FJ7A 2ZNSA 5KDTB 4NQ8A 2RC9A 3EHUA 3UGWA 3TEPA 4JSOA 1RYXA 4G68A 3SEUA 2QSXA 3VDFA 5F1QA 2VD3A 4OXVA 1Q9DA 3SETA 4E0WA 1BTJA 4O94A 3T0JA 2I4CA 3TCGA 2V93A 3OSRA 2XX9A 4Q8RA 2RKMA 1LBXA 3N26A 4FORA 5A5XB 5BUUA 1FSAA 3KSXA 2Z23A 1YZ0A 1L5TA 2F78A 3C9HA 5I57A 1NV2A 1MM6A 5CMBA 2CZKA 2PX1A 3ZKLA 1NV7A 3H7MA 1MG1A 2UVGA 2H25A 1QUKA 3IB1A 2R71A 1IXIA 1KWHA 1FPDA 4P11A 1ZBMA 3K4UA 2PBWA 5KCJB 1PB7A 4FAJA 5I2NB 5A5LA 3JYRA 4YAHX 3BIGA 4GX4A 1TWYA 4GIZA 4H8IA 1D3KA 1BP5A 4DXBA 3HN0A 1CNQA 1TT1A 5CMCA 4IO6A 1QJMA 4DI4B 4NEDA 1FW0A 4YB5A 1RDYA 4FBPA 1UIVA 2HEUA 4U23A 1R1NA 4HE0A 1YCJA 1N7XA 4N6KA 3OMBA 5J16A 4JXIA 1DSNA 4LQ2A 4O3BA 4XKNA 4FECA 3FASA 3EQ1A 4PFWA 4Z0IA 1DTZA 4OVQA 1LFHA 3I5OA 2ZNTA 2Q8JA 1N0TA 2CMOA 1YTVA 1AIVA 3CFZA 5ITOA 3A3CA 5DVIA 4GX3A 3HFUA 1FBHA 4XKPA 5H8HA 3HPIA 1LB9A 2A5SA 4N91A 3M3FA 4ZE8A 3PPRA 1JW1A 1P1OA 4PCDA 1FCKA 5FHMA 1BLFA 5ELVA 1ZLQA 2FIEA 1QUIA 5ET7A 4ZEKA 4R6HA 3B8BA 5AE4A 2GHAA 4F3GA 1UIUA 2KR0A 4LQ5A 4MLQA 4MBPA 2DWAA 3PPPA 3IORA 1AL3A 3T22A 4HCWA 3CRBA 5TP9A 1KA0A 1T0KA 1NV3A 4G68C 5ISUA 1FBDA 4JDFA 3VVEA 4IO3A 4PFRA 1A7LA 4GL8A 1JEVA 3MZ9A 1B1XA 2I6EA 3E9XA 2UYFA 4ESXA 2UYEA 3I3VA 4RPNA 4GF8A 1IITA 5IKBA 3CIJA 1ZMGA 1POTA 3UK4A 2FHYA 2H5YA 1N3WA 2V4CA 2HQ0A 3RGYA 4GWSA 3TTKA 5JTYA 3FV2A 4ZEFA 2GQ1A 5I58A 2HZLA 1B58A 2VP1A 3O28A 4KXPA 3SEVA 1FPIA 1A8FA 4H8JA 2NUVA 3FVNA 4F3BA 1SDXA 1P1QA 1MS7A 1Y3NA 4WEPA 3HCQA 3B7DA 5I5PA 5DW8A 4OFOA 3B6QA 4YB7A 4NGUA 2QFLA 4U4SA 3O6GA 2Y7RA 4NWDA 1P1UA 4I40A 4ZDMA 5EQ8A 1IXGA 4WEDA 5M2VA 4IR8A 2QS3A 3OELA 1M5EA 4PP0A 1FPLA 2XXIA 4Q0CA 1EZPA 1MXXA 3ILTB 5AA4B 4N81A 3ZKKA 1FBPA 1LBYA 3RPLA 2NOOA 3CSGA 2F8DA 2XXQA 3TODA 3WAFA 4N8GA 4C0RA 1B5HA 4DLDA 3L6GA 4YKKA 4JVIA 1LBCA 4EDPA 5I56A 2DWIA 3T9XB 1UTHA 2WBBA 1F9BA 2WKYA 3OO9A 1B05A 4PTKA 3LUZA 3E78A 3KBRA 3K6WA 4GWXA 2G93A 3PPNA 4X04A 4QRZA 2YPNA 4QFOA 3V89B 3KEIA 3TTNA 3TCHA 3C35A 3UORA 4OERA 4GVOA 3ROJA 3G7WA 1P1WA 2F3DA 5DT6A 5B70A 4OESA 5LOMA 4U1OA 4NWCA 3TTRA 5ET5A 1Q35A 3IL1B 1SW4A 4OTEA 1IMCA 1LBZA 3S9EA 4Z7EA 1S50A 5H8FA 1MPCA 2OWSA 3T66A 4KCCA 3G3KA 3K02A 1URDA 1P99A 1B52A 1MXZA 4KYDA 1SQYA 2DYXA 4IO2A 1IMEA 3EHSA 4NN3A 4QF9A 3E13X 2UVJA 3QUJA 1HSEA 3LSXA 1FBEA 3I6VA 3MW0A 5L9MA 3GLBA 3OO8A 1S9TA 4LN5A 1LFIA 1Y3PA 3NOHA 2DXRA 4KYSA 4LP2B 4YMAA 3OD7A 3ISPA 1EYIA 3Q27A 1FPKA 5HBCA 1PBPA 1ANFA 1MQGA 4RXLA 1FBCA 5CC2A 3OSQA 3P7IA 2XXUA 4MNCA 2B3BA 2B4MA 3FJMA 3LSFB 1FQEA 1SYHA 1PB8A 3IJOB 3VVDA 4OETA 1B3GA 1D9YA 2P3VA 4H5FA 2AL5A 3IX1A 2GRVA 4MX6A 4ZEIA 5BWJA 4THIA 4N6DA 5KDTA 3FV1A 5L9OA 1Y1MA 4DE8A 4I9DA 4FEDA 1FTJA 1CE2A 3C32A 3SESA 1LGBC 1OQGA 1TFDA 1IIWA 1LCTA 3MJNA 2WYKA 4POWA 2QVRA 2QVUA 2ABHA 4M4GA 4BDNA 3IO4A 1A40A 1IMAA 3Q26A 2AL4A 2O68A 1GVCA 3FZVA 1LLSA 3TQWA 4G61A 2V3QA 2DQVA 4JSDA 4WKMA 4NAPA 4QBAA 4XEQA 1SW2A 4HXVA 4MLVA 1SVXB 1M5FA 2R8TA 4EQBA 3UP9A 3CG3A 4R75A 1VFEA 4OEVA 1ZTYA 5I84A 2KQZA 4PGPA 2ONSA 4TQUQ 3IO6A 4IY6A 4ELPA 2PYYA 3PUVE 4NF5B 3B50A 2I49A 3LR1A 5I2KA 2Z8DA 4JVDA 1MXWA 2OCUA 5F7VA 2WYPA 1SI0A 2ZZVA 4N8YA 3SERA 5KCJA 2ANJA 4KR5A 3QMFA 5I2NA 1I6BA 5H8QA 1UQWA 4NHBA 2H9BA 1USYH 1XOCA 4GOTA 1OVTA 1MY3A 2OX3A 2MKZA 2P2AA 5CMKA 3CFXA 4OA4A 3VE1B 2XXWA 2Q89A 5K2XA 4U2RA 3OEKA 1B5IA 4F19A 2DP8A 5H8SA 1ATGA 2PFYA 2CEYA 1XC1A 3K6VA 1QKBA 1PBQA 1DPEA 4LZ5A 1URSA 3R7XA 3O6IA 2WX9A 3DELB 3GXAA 3V5AA 2QPQA 2XX7A 4RK9A 3FJGA 3N94A 5IZ3A 1NH7A 2O84X 3TMGA 1EZOA 2RCAA 1FQFA 2XA5A 2VPOA 3C34A 3TELA 1TXFA 3BFUA 4L17A 2F6GA 1IQ7A 3UN6A 4KD5A 4GX6A 3MZ1A 4EF1A 1LAFE 4H0WA 4PBHA 1EZ9A 2ZYMA 3VLWA 3MQ9A 3EF7A 4GFRA 3TCFA 1OVBA 4MIJA 4YMBA 3U65A 2WBDA 2XHDA 1LCFA 4MEVA 2ZMBA 4JWYA 1XVXA 4XKRA 3W15C 4F31B 1CB6A 3K1PA 1EYJA 1B7UA 2PFZA 3CI8A 4FIMA 4AB5A 3D4CA 2NVUB 4RJZA 1B40A 2Q9TA 2WEFA 1DOTA 5CBRA 2OBGA 1N04A 1NUXA 4HE2A 4YICA 1NV6A 4MJOA 2PMSA 2REJA 1NH8A 1FTAA 4GWZA 4FATA 1FTLA 1I69A 3MUQA 3SEXA 1JW5A 3TYHA 3O9PA 1JP4A 2KLFA 4BLAA 1US4A 4ESWA 3FUZA 2REGA 2F97A 3RN8A 4BDLA 3MSTA 4Q5TA 5DVJA 1MXUA 2OWZA 3TDJA 1B6HA 1LAXA 3S9NC 1RDZA 4DZ1A 4YKPA 2FVZA 3T9UA 2VHAA 5I59A 1O64A 1B7HA 2XD3A 1DBZA 3M3LA 4AB6A 2F5XA 3DP6A 2E1SA 4LONB 3KFMA 3KN3A 1FPGA 2B65A 4ZEDA 3EPEA 1NMUA 3QUFA 1US5A 1O7TA 1EYKA 2PT2A 1FBFA 4F1YA 4PETA 3PV0E 3O6HA 4YZZA 2DOJA 4LATA 3T9HB 1FJ6A 4RK2A 1I6QA 3QAXA 4OVSA 5FTHA 1Z7NE 3KN8A 2I0BA 5AA4A 4POXA 5CI5A 1VDWA 3MP8A 4NF4A 1AOVA 4OVPA 4DI3D 3RT8A 5B7DA 2G29A 1R9QA 2OLBA 2O1LA 3RNNA 5T3JA 5AA2D 3GBBA 3U94A 1DMBA 1MXYA 2F34A 1UTBA 2X7PA 5ITPA 4OANA 1LSTA 4N17A 1FPBA 1H45A 2FA7A 3SEWA 1VE4A 4GWUA 2ZYKA 4GQOA 2H4IA 3T96B 1N3XA 4GWOA 4G2ZA 3TFLA 3TKDA 4HTGA 1P1NA 3K6UA 4NF6B 2QVVA 4EUOA 1B1HA 4XKQA 1B3FA 1K9ZA 2RINA 1KA1A 1QKAA 4O7MA 3USDA 3IFAA 1B7ZA 3QYTA 1FRPA 2XWKA 1Y1ZA 1MRPA 2RC8A 4QFLA 3EKIA 3U72A 5JEIA 3LSWA 4FJPA 2PT1A 3CG1A 3PPQA 1RKMA 2YJPA 2Q2AA 2XXVA 4LVQA 3PGFA 5DEXB 1MM7A 1LAGE 4GLIA 1BKAA 1SD3A 3IB0A 3K01A 1MY2A 3IR1A 4NG7A 3PU5A 2DWHA 3T9VA 1TFAA 2XD2A 4F39A 2DVZA 2Z8FA 5CRYA 1MDP1 3UA8A 3PMXA 3G3HA 5IZ1A 4XTCQ 4DCYA 4YKIA 3KC1A 4I3YA 1H43A
chains in the Genus database with same CATH topology
4KCDA 3THIA 1FQCA 4YKJA 4RA1A 4KQPA 1IEJA 2DE3A 2F36A 5H8HB 2DE4A 4KHZE 4PFYA 3HV1A 2HAUA 2V25A 1USYE 4EQ7A 4G8MA 3L6HA 4N6PA 4JBZA 1B46A 2QMXA 4ELRA 3EN3A 2P0SA 5H8NA 3VVFA 2D21A 1URGA 4OFJA 4DIGA 5TP9B 1WVJA 1PB9A 4QSEA 2O7UA 2XXPA 3CSBA 1B0HA 3LBSA 3V8XB 3KGCA 3QIMA 3RUMA 1LBBA 5FHNA 4OENA 4OZ9A 4WXJA 1JW4A 3G3FA 5CMMA 2QRYA 1WDNA 3IJXB 3ONMA 5ICQA 3H03A 2OWTA 3E4RA 2LAOA 1JQFA 5JTYB 4OMBA 4QHQA 3E3KA 3G3GA 2Z22A 5I58B 3MWBA 3FVKA 5JK4A 2FYIA 3W9WA 2I48A 1LFGA 4BDQA 5AA2B 2O6AA 3U93A 3KG2A 3K00A 3EHTA 4MF3A 1DTGA 3QK6A 3U8QA 4F3SA 1NNKA 2HCAA 3WAEA 1H3DA 2Y7IA 3H6TA 4ZE9A 2HXWA 4X48A 4ELQA 3C33A 1OQHA 2ZNUA 4UACA 3ODBA 3H06B 2D5WA 2V3TA 4BDOA 2F7CA 1AH5A 5L9SA 3AXFA 4O3CA 3OXNA 1FQDA 1IXHA 1PEBA 3FIRA 3DP8A 4E0XA 4DXUA 3FATA 2A5TB 1VSOA 4C1TA 2RCBA 2THIA 1NKXA 1B3LA 3DLNA 4R73A 1MY0A 4KPTA 2IA4A 5DTBA 5AA3A 3Q29A 5I56B 3LUYA 2XXTA 4P0IA 3K6XA 5A5XA 3HO7A 4C1UA 2ONKE 1GR2A 2OJTA 2QMWA 3OO7A 3N6TA 4H65A 4LZ7A 4ONYA 4XIGQ 1EH3A 5FTIA 2I4BA 2RC7A 3MP1A 3RTFB 4R74A 4F22A 4IGTA 1GGGA 1NNTA 1M5DA 1I6AA 3MZBA 1GTKA 4EXKA 3JZJA 3Q25A 3PD9A 3IAZA 2DSFA 4GRKA 1OLCA 4U4XA 4DCXA 3IOWA 4PE5B 2O1MA 4NF8B 3CR9A 3H6VA 1JVXA 3R6UA 5L8DA 1B2HA 2W7YA 4M1VA 2AYSA 3OENA 2HZKA 3K1MA 1N7WA 3MC2A 4ZECA 3M3KA 4QFNA 4LUBA 2H98A 1NNPA 3TQLA 3H4ZA 4R9GA 3RTWB 3D4GA 1R9LA 1Z7ME 2Q88A 3DM0A 4ZS9A 4I1DA 2AIXA 3HHGA 2F6PA 3VV5A 4EF2A 3ZS6A 1MPDA 4IY5A 3MVZA 1MY4A 1SI1A 2YLNA 1N84A 2QJEA 3FVOA 4PQJA 4H1XA 3C4MA 4K3FA 1ZKBA 5HPQA 2CZLA 2ESNA 4LZ8A 4JB7A 1B32A 1FTMA 4GD5A 4O3AA 3SKPA 2D3IA 1B9JA 1QW0A 3KSJA 3CFLA 4R2BA 1MQDA 1Y3QA 2ZYNA 3H6UA 5ICTA 1VFDA 4U1ZA 1A99A 2Y84A 3FXUA 4R6YA 1H44A 3OEMA 1B0LA 2ALUA 3H3GA 4TLLB 5TPAB 3TAJA 1QVSA 4NF6A 4G8NA 5I2KB 3MVYA 2ZXTA 1IUDA 4ECFA 3MBPA 5H8QB 4U21A 4OQOA 1A55A 2V84A 1D9VA 2I0CA 2GHBA 4R6KA 3VXCA 2UVIA 2Y7WA 4F2OA 4OWDA 3Q28A 4R9FA 3KOSA 3LC8A 5IAIA 1IZ1A 5DEXA 1M5BA 1Q1KA 2XXYA 4AQ4A 1XVYA 4TOZA 3ZSFA 3R26A 2I3WA 1PDAA 2OZZA 4OEUA 1N76A 3VXBA 4F2QA 4QSDA 1ELJA 5DYHA 4EXLA 4G68B 1OMPA 4I62A 4P0GA 4N07A 1MDQA 3S9MC 2Z8EA 2VOZA 3KN7A 4U22A 2UVHA 5HM4B 2ONRA 4EQ9A 2HAVA 3PPOA 2QS1A 4F29A 3N6UA 1MQHA 3GZGA 1JVYA 2B3FA 3PUYE 3T93B 1AMFA 2F35A 4NE4A 1Y4CA 1DPPA 3U92A 1SYIA 1J1NA 3FXRA 4I8CA 5I57B 4RPOA 1SW1A 1FTKA 3KOTA 5FHOA 3TUSA 1YAEA 3JV9A 1ZIUA 2QS2A 4F18A 3FVGA 1FTOA 4JWOA 4HCYA 4GXAA 3O66A 1SBPA 4Q30B 2BJJX 3FGSA 2P1SA 5K2YA 5CM6A 4RY1A 2X7QA 4RNSA 1B3HA 5EYFA 2V3UA 3PMVA 3A3UA 3IB2A 2PVUA 1MH4A 4JWXA 1Y20A 3C36A 2UXAA 3CVGA 3ILUB 2O7IA 4FE8A 1B5JA 2IEEA 4GXSB 1O63A 4HS7A 5AA2A 2I3VA 1B3EA 2VD2A 3TTMA 5I59B 2VGQA 2ZYOA 4F1UA 4IB2A 5J1DA 2XXXA 1QUJA 4ZEBA 1HSJA 2DS9A 3K1NA 3VFJA 4H6DA 3FD3A 5EHMA 1SW5A 3S2VA 3QXMA 1OLAA 3H6WA 4KYEA 3RLFE 3MPKA 1OIBA 4H67A 4LA9A 2DVCA 2A5TA 1II5A 2HFBA 4NF4B 4X1BA 3MVWA 5AA1A 2O69A 3KJTA 3UIFA 4PFTA 4GL0A 3VLVA 3V83A 4G8HA 1R6ZA 3G3IA 1UTBB 3O29A 2OK2A 1Y4TA 3S4UA 3K2DA 3PUWE 1NNFA 1S7YA 1M5CA 3RY3A 4G4PA 4ND9A 3MVXA 3B6WA 3KJ7A 3PUXE 4BDRA 4NF5A 4KI0E 1GV8A 1LB8A 4IGRA 3RPWA 1IXCA 2NXOA 3TZAA 1LAHE 3MPLA 5CBSA 4FEBA 1MXVA 3BBRA 4MH5A 1VR5A 4H5GA 4ELOA 1A8EA 1Y9UA 3BKIB 2DXYA 4QFPA 4XXUA 4NF8A 4ISUA 3IOTA 1D4NA 3BFTA 1MH3A 4R2FA 2QL3A 4NMYA 3LSLA 2M8CA 2QS4A 1YPNA 3O2AA 1MY1A 2DE2A 4DXCA 4OVJA 3TTLA 3KZGA 3F11A 2GH9A 2F7BA 1B4HA 3K0VA 3VLUA 3HSTA 4HW8A 3S9LC 5DVFA 4OFLA 4X9TA 3PD8A 2E0SA 3OO6A 1MQJA 3N5LA 4F1VA 5TU0A 1JNFA 3C31A 4PFUA 1B4ZA 4OYVA 3DP4A 4X1DA 3FXQA 3M8UA 4YB6A 2O51A 1UTHB 3IOVA 3RQTA 3B6TA 2DWJA 4IO7A 5H8NB 5KZTA 3W9VA 1QULA 1BIYA 1EU8A 1A54A 3PMWA 4MFIA 3MP6A 2NWJA 1NFTA 3IK6B 2R6GE 2Y7KA 3IOUA 3SEYA 1NL5A 1XS5A 2R9JA 3SDFA 3MAMA 4ZZAA 1WODA 3HHFA 2FNCA 3GBAA 2Q2CA 3A09A 2GFEA 2X26A 4ZZEA 1XT8A 5H8FB 1MQIA 4TLMB 4RYAA 4BDMA 3U1OA 4NTLA 1FQAA 4IO4A 1JETA 5TPAA 4OHNA 5EHSA 4QSCA 3RT6B 4DDDA 2Y7PA 3O97A 1JEUA 4YU0A 3QSLA 2XX8A 1B51A 3G3JA 1HSLA 4UA8A 1PC3A 1MPBA 2F7AA 3TPAA 3PUZE 4R72A 4F3PA 4IO5A 1POY1 1XHYA 2I58A 2H99A 1ZJLA 4G77A 3ECRA 1H76A 4N13A 4QFKA 1RYOA 3OOAA 1FQBA 2XXHA 4KFQA 2XXRA 1ZU0A 2RF1A 3FJ7A 2ZNSA 5KDTB 2RC9A 3EHUA 3UGWA 3TEPA 4JSOA 1RYXA 4G68A 3SEUA 2QSXA 3VDFA 5F1QA 2VD3A 4OXVA 3SETA 4E0WA 1BTJA 2I4CA 3TCGA 2V93A 3OSRA 2XX9A 4Q8RA 2RKMA 3N26A 4FORA 5A5XB 5BUUA 3KSXA 2Z23A 1L5TA 2F78A 3C9HA 5I57A 1MM6A 5CMBA 2PX1A 3ZKLA 3H7MA 1MG1A 2UVGA 2H25A 1QUKA 3IB1A 2R71A 1IXIA 1KWHA 4P11A 1ZBMA 3K4UA 2PBWA 5KCJB 1PB7A 4FAJA 5I2NB 3JYRA 4YAHX 1TWYA 4GIZA 4H8IA 1D3KA 1BP5A 4DXBA 3HN0A 1TT1A 5CMCA 4IO6A 1QJMA 4NEDA 1FW0A 4YB5A 1UIVA 2HEUA 4U23A 1R1NA 1YCJA 1N7XA 3OMBA 4JXIA 1DSNA 4LQ2A 4O3BA 4XKNA 4FECA 3FASA 3EQ1A 4PFWA 4Z0IA 1DTZA 1LFHA 3I5OA 2ZNTA 2Q8JA 1N0TA 2CMOA 1YTVA 1AIVA 3CFZA 5ITOA 3A3CA 5DVIA 4XKPA 5H8HA 3HPIA 1LB9A 2A5SA 3M3FA 4ZE8A 3PPRA 1JW1A 1P1OA 1FCKA 5FHMA 1BLFA 5ELVA 1ZLQA 1QUIA 4ZEKA 4R6HA 5AE4A 2GHAA 4F3GA 1UIUA 4LQ5A 4MLQA 4MBPA 2DWAA 3PPPA 3IORA 1AL3A 3T22A 4HCWA 3CRBA 5TP9A 1T0KA 4G68C 5ISUA 4JDFA 3VVEA 4IO3A 1A7LA 4GL8A 1JEVA 3MZ9A 1B1XA 2I6EA 3E9XA 2UYFA 4ESXA 2UYEA 3I3VA 4RPNA 4GF8A 1IITA 5IKBA 3CIJA 1ZMGA 1POTA 3UK4A 2H5YA 1N3WA 2HQ0A 3RGYA 3TTKA 5JTYA 3FV2A 4ZEFA 5I58A 2HZLA 1B58A 2VP1A 3O28A 3SEVA 1A8FA 4H8JA 2NUVA 3FVNA 4F3BA 1SDXA 1P1QA 1MS7A 1Y3NA 4WEPA 3HCQA 3B7DA 4OFOA 3B6QA 4YB7A 4U4SA 3O6GA 2Y7RA 4NWDA 1P1UA 4ZDMA 1IXGA 4WEDA 5M2VA 2QS3A 3OELA 1M5EA 2XXIA 4PP0A 4Q0CA 1EZPA 1MXXA 3ILTB 5AA4B 3ZKKA 2NOOA 3CSGA 2F8DA 2XXQA 3WAFA 3TODA 4C0RA 1B5HA 4DLDA 3L6GA 4YKKA 1LBCA 4EDPA 5I56A 2DWIA 3T9XB 1UTHA 1F9BA 2WKYA 3OO9A 1B05A 3KBRA 3K6WA 2G93A 3PPNA 4QRZA 2YPNA 4QFOA 3V89B 3KEIA 3TTNA 3TCHA 3C35A 3UORA 4OERA 4GVOA 3G7WA 1P1WA 5DT6A 5B70A 4OESA 5LOMA 4U1OA 4NWCA 3TTRA 1Q35A 3IL1B 1SW4A 4OTEA 3S9EA 4Z7EA 1S50A 5H8FA 1MPCA 2OWSA 3T66A 4KCCA 3G3KA 3K02A 1URDA 1P99A 1B52A 1MXZA 4KYDA 1SQYA 2DYXA 4IO2A 3EHSA 4QF9A 3E13X 2UVJA 3QUJA 1HSEA 3LSXA 3MW0A 3I6VA 5L9MA 3GLBA 3OO8A 1S9TA 1LFIA 1Y3PA 2DXRA 4KYSA 4LP2B 4YMAA 3OD7A 3Q27A 5HBCA 1PBPA 1ANFA 1MQGA 4RXLA 5CC2A 3OSQA 3P7IA 2XXUA 2B3BA 3FJMA 3LSFB 1FQEA 1SYHA 1PB8A 3IJOB 3VVDA 4OETA 1B3GA 1D9YA 4H5FA 2AL5A 3IX1A 2GRVA 4ZEIA 5BWJA 4THIA 5KDTA 3FV1A 5L9OA 1Y1MA 4DE8A 4I9DA 4FEDA 1FTJA 1CE2A 3C32A 3SESA 1LGBC 1OQGA 1TFDA 1IIWA 1LCTA 3MJNA 4POWA 2ABHA 4M4GA 4BDNA 3IO4A 1A40A 3Q26A 2AL4A 2O68A 1GVCA 3FZVA 1LLSA 3TQWA 2V3QA 2DQVA 4JSDA 4WKMA 1SW2A 4MLVA 1SVXB 1M5FA 4EQBA 3UP9A 3CG3A 4R75A 1VFEA 4OEVA 1ZTYA 5I84A 2ONSA 4TQUQ 3IO6A 4IY6A 4ELPA 2PYYA 3PUVE 4NF5B 2I49A 3LR1A 5I2KA 2Z8DA 1MXWA 2OCUA 5F7VA 1SI0A 3SERA 5KCJA 2ANJA 4KR5A 5I2NA 1I6BA 5H8QA 1UQWA 2H9BA 1USYH 1XOCA 4GOTA 1OVTA 1MY3A 2P2AA 5CMKA 3CFXA 3VE1B 2XXWA 2Q89A 5K2XA 4U2RA 3OEKA 1B5IA 4F19A 2DP8A 5H8SA 1ATGA 1XC1A 3K6VA 1QKBA 1PBQA 1DPEA 4LZ5A 1URSA 3R7XA 3O6IA 3DELB 3GXAA 3V5AA 2QPQA 2XX7A 4RK9A 3FJGA 3N94A 1NH7A 2O84X 3TMGA 1EZOA 2RCAA 1FQFA 3C34A 3TELA 1TXFA 3BFUA 4L17A 2F6GA 1IQ7A 3UN6A 4KD5A 3MZ1A 4EF1A 1LAFE 4H0WA 1EZ9A 2ZYMA 3VLWA 3MQ9A 3EF7A 4GFRA 3TCFA 1OVBA 4YMBA 2XHDA 1LCFA 2ZMBA 4JWYA 1XVXA 4XKRA 3W15C 4F31B 1CB6A 3K1PA 1B7UA 3CI8A 4FIMA 4AB5A 3D4CA 2NVUB 4RJZA 1B40A 2Q9TA 1DOTA 5CBRA 2OBGA 1N04A 4YICA 2PMSA 2REJA 1NH8A 4FATA 1FTLA 1I69A 3MUQA 3SEXA 1JW5A 3TYHA 3O9PA 2KLFA 4BLAA 1US4A 4ESWA 3FUZA 2REGA 2F97A 3RN8A 4BDLA 4Q5TA 5DVJA 1MXUA 3TDJA 1B6HA 1LAXA 3S9NC 4DZ1A 4YKPA 3T9UA 2VHAA 5I59A 1O64A 1B7HA 2XD3A 3M3LA 4AB6A 2F5XA 3DP6A 2E1SA 4LONB 3KFMA 3KN3A 2B65A 4ZEDA 3EPEA 1NMUA 3QUFA 1US5A 1O7TA 2PT2A 4F1YA 4PETA 3PV0E 3O6HA 4YZZA 2DOJA 4LATA 3T9HB 4RK2A 1I6QA 3QAXA 5FTHA 1Z7NE 3KN8A 2I0BA 5AA4A 4POXA 5CI5A 3MP8A 4NF4A 1AOVA 3RT8A 5B7DA 2G29A 1R9QA 2OLBA 2O1LA 3RNNA 5AA2D 3GBBA 3U94A 1DMBA 1MXYA 2F34A 1UTBA 2X7PA 5ITPA 1LSTA 1H45A 2FA7A 3SEWA 1VE4A 2ZYKA 4GQOA 2H4IA 3T96B 1N3XA 4GWOA 4G2ZA 3TFLA 3TKDA 4HTGA 1P1NA 3K6UA 4NF6B 4EUOA 1B1HA 4XKQA 1B3FA 2RINA 1QKAA 3USDA 1B7ZA 3QYTA 1Y1ZA 1MRPA 2RC8A 4QFLA 3U72A 5JEIA 3LSWA 4FJPA 2PT1A 3CG1A 3PPQA 1RKMA 2YJPA 2Q2AA 2XXVA 4LVQA 3PGFA 5DEXB 1MM7A 1LAGE 4GLIA 1BKAA 1SD3A 3IB0A 3K01A 1MY2A 3IR1A 3PU5A 2DWHA 3T9VA 1TFAA 2XD2A 4F39A 2DVZA 2Z8FA 5CRYA 1MDP1 3UA8A 3PMXA 3G3HA 4XTCQ 4DCYA 4YKIA 1H43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KCD A;  3THI A;  1FQC A;  4YKJ A;  4RA1 A;  4KQP A;  1IEJ A;  2DE3 A;  2F36 A;  5H8H B;  2DE4 A;  4KHZ E;  4PFY A;  3HV1 A;  2HAU A;  2V25 A;  1USY E;  4EQ7 A;  4G8M A;  3L6H A;  4N6P A;  4JBZ A;  1B46 A;  2QMX A;  4ELR A;  3EN3 A;  2P0S A;  5H8N A;  3VVF A;  2D21 A;  1URG A;  4OFJ A;  4DIG A;  5TP9 B;  1WVJ A;  1PB9 A;  4QSE A;  2O7U A;  2XXP A;  3CSB A;  1B0H A;  3LBS A;  3V8X B;  3KGC A;  3QIM A;  3RUM A;  1LBB A;  5FHN A;  4OEN A;  4OZ9 A;  4WXJ A;  1JW4 A;  3G3F A;  5CMM A;  2QRY A;  1WDN A;  3IJX B;  3ONM A;  5ICQ A;  3H03 A;  2OWT A;  3E4R A;  2LAO A;  1JQF A;  5JTY B;  4OMB A;  4QHQ A;  3E3K A;  3G3G A;  2Z22 A;  5I58 B;  3MWB A;  3FVK A;  5JK4 A;  2FYI A;  3W9W A;  2I48 A;  1LFG A;  4BDQ A;  5AA2 B;  2O6A A;  3U93 A;  3KG2 A;  3K00 A;  3EHT A;  4MF3 A;  1DTG A;  3QK6 A;  3U8Q A;  4F3S A;  1NNK A;  2HCA A;  3WAE A;  1H3D A;  2Y7I A;  3H6T A;  4ZE9 A;  2HXW A;  4X48 A;  4ELQ A;  3C33 A;  1OQH A;  2ZNU A;  4UAC A;  3ODB A;  3H06 B;  2D5W A;  2V3T A;  4BDO A;  2F7C A;  1AH5 A;  5L9S A;  3AXF A;  4O3C A;  3OXN A;  1FQD A;  1IXH A;  1PEB A;  3FIR A;  3DP8 A;  4E0X A;  4DXU A;  3FAT A;  2A5T B;  1VSO A;  4C1T A;  2RCB A;  2THI A;  1NKX A;  1B3L A;  3DLN A;  4R73 A;  1MY0 A;  4KPT A;  2IA4 A;  5DTB A;  5AA3 A;  3Q29 A;  5I56 B;  3LUY A;  2XXT A;  4P0I A;  3K6X A;  5A5X A;  3HO7 A;  4C1U A;  2ONK E;  1GR2 A;  2OJT A;  2QMW A;  3OO7 A;  3N6T A;  4H65 A;  4LZ7 A;  4ONY A;  4XIG Q;  1EH3 A;  5FTI A;  2I4B A;  2RC7 A;  3MP1 A;  3RTF B;  4R74 A;  4F22 A;  4IGT A;  1GGG A;  1NNT A;  1M5D A;  1I6A A;  3MZB A;  1GTK A;  4EXK A;  3JZJ A;  3Q25 A;  3PD9 A;  3IAZ A;  2DSF A;  4GRK A;  1OLC A;  4U4X A;  4DCX A;  3IOW A;  4PE5 B;  2O1M A;  4NF8 B;  3CR9 A;  3H6V A;  1JVX A;  3R6U A;  5L8D A;  1B2H A;  2W7Y A;  4M1V A;  2AYS A;  3OEN A;  2HZK A;  3K1M A;  1N7W A;  3MC2 A;  4ZEC A;  3M3K A;  4QFN A;  4LUB A;  2H98 A;  1NNP A;  3TQL A;  3H4Z A;  4R9G A;  3RTW B;  3D4G A;  1R9L A;  1Z7M E;  2Q88 A;  3DM0 A;  4ZS9 A;  4I1D A;  2AIX A;  3HHG A;  2F6P A;  3VV5 A;  4EF2 A;  3ZS6 A;  1MPD A;  4IY5 A;  3MVZ A;  1MY4 A;  1SI1 A;  2YLN A;  1N84 A;  2QJE A;  3FVO A;  4PQJ A;  4H1X A;  3C4M A;  4K3F A;  1ZKB A;  5HPQ A;  2CZL A;  2ESN A;  4LZ8 A;  4JB7 A;  1B32 A;  1FTM A;  4GD5 A;  4O3A A;  3SKP A;  2D3I A;  1B9J A;  1QW0 A;  3KSJ A;  3CFL A;  4R2B A;  1MQD A;  1Y3Q A;  2ZYN A;  3H6U A;  5ICT A;  1VFD A;  4U1Z A;  1A99 A;  2Y84 A;  3FXU A;  4R6Y A;  1H44 A;  3OEM A;  1B0L A;  2ALU A;  3H3G A;  4TLL B;  5TPA B;  3TAJ A;  1QVS A;  4NF6 A;  4G8N A;  5I2K B;  3MVY A;  2ZXT A;  1IUD A;  4ECF A;  3MBP A;  5H8Q B;  4U21 A;  4OQO A;  1A55 A;  2V84 A;  1D9V A;  2I0C A;  2GHB A;  4R6K A;  3VXC A;  2UVI A;  2Y7W A;  4F2O A;  4OWD A;  3Q28 A;  4R9F A;  3KOS A;  3LC8 A;  5IAI A;  1IZ1 A;  5DEX A;  1M5B A;  1Q1K A;  2XXY A;  4AQ4 A;  1XVY A;  4TOZ A;  3ZSF A;  3R26 A;  2I3W A;  1PDA A;  2OZZ A;  4OEU A;  1N76 A;  3VXB A;  4F2Q A;  4QSD A;  1ELJ A;  5DYH A;  4EXL A;  4G68 B;  1OMP A;  4I62 A;  4P0G A;  4N07 A;  1MDQ A;  3S9M C;  2Z8E A;  2VOZ A;  3KN7 A;  4U22 A;  2UVH A;  5HM4 B;  2ONR A;  4EQ9 A;  2HAV A;  3PPO A;  2QS1 A;  4F29 A;  3N6U A;  1MQH A;  3GZG A;  1JVY A;  2B3F A;  3PUY E;  3T93 B;  1AMF A;  2F35 A;  4NE4 A;  1Y4C A;  1DPP A;  3U92 A;  1SYI A;  1J1N A;  3FXR A;  4I8C A;  5I57 B;  4RPO A;  1SW1 A;  1FTK A;  3KOT A;  5FHO A;  3TUS A;  1YAE A;  3JV9 A;  1ZIU A;  2QS2 A;  4F18 A;  3FVG A;  1FTO A;  4JWO A;  4HCY A;  4GXA A;  3O66 A;  1SBP A;  4Q30 B;  2BJJ X;  3FGS A;  2P1S A;  5K2Y A;  5CM6 A;  4RY1 A;  2X7Q A;  4RNS A;  1B3H A;  5EYF A;  2V3U A;  3PMV A;  3A3U A;  3IB2 A;  2PVU A;  1MH4 A;  4JWX A;  1Y20 A;  3C36 A;  2UXA A;  3CVG A;  3ILU B;  2O7I A;  4FE8 A;  1B5J A;  2IEE A;  4GXS B;  1O63 A;  4HS7 A;  5AA2 A;  2I3V A;  1B3E A;  2VD2 A;  3TTM A;  5I59 B;  2VGQ A;  2ZYO A;  4F1U A;  4IB2 A;  5J1D A;  2XXX A;  1QUJ A;  4ZEB A;  1HSJ A;  2DS9 A;  3K1N A;  3VFJ A;  4H6D A;  3FD3 A;  5EHM A;  1SW5 A;  3S2V A;  3QXM A;  1OLA A;  3H6W A;  4KYE A;  3RLF E;  3MPK A;  1OIB A;  4H67 A;  4LA9 A;  2DVC A;  2A5T A;  1II5 A;  2HFB A;  4NF4 B;  4X1B A;  3MVW A;  5AA1 A;  2O69 A;  3KJT A;  3UIF A;  4PFT A;  4GL0 A;  3VLV A;  3V83 A;  4G8H A;  1R6Z A;  3G3I A;  1UTB B;  3O29 A;  2OK2 A;  1Y4T A;  3S4U A;  3K2D A;  3PUW E;  1NNF A;  1S7Y A;  1M5C A;  3RY3 A;  4G4P A;  4ND9 A;  3MVX A;  3B6W A;  3KJ7 A;  3PUX E;  4BDR A;  4NF5 A;  4KI0 E;  1GV8 A;  1LB8 A;  4IGR A;  3RPW A;  1IXC A;  2NXO A;  3TZA A;  1LAH E;  3MPL A;  5CBS A;  4FEB A;  1MXV A;  3BBR A;  4MH5 A;  1VR5 A;  4H5G A;  4ELO A;  1A8E A;  1Y9U A;  3BKI B;  2DXY A;  4QFP A;  4XXU A;  4NF8 A;  4ISU A;  3IOT A;  1D4N A;  3BFT A;  1MH3 A;  4R2F A;  2QL3 A;  4NMY A;  3LSL A;  2M8C A;  2QS4 A;  1YPN A;  3O2A A;  1MY1 A;  2DE2 A;  4DXC A;  4OVJ A;  3TTL A;  3KZG A;  3F11 A;  2GH9 A;  2F7B A;  1B4H A;  3K0V A;  3VLU A;  3HST A;  4HW8 A;  3S9L C;  5DVF A;  4OFL A;  4X9T A;  3PD8 A;  2E0S A;  3OO6 A;  1MQJ A;  3N5L A;  4F1V A;  5TU0 A;  1JNF A;  3C31 A;  4PFU A;  1B4Z A;  4OYV A;  3DP4 A;  4X1D A;  3FXQ A;  3M8U A;  4YB6 A;  2O51 A;  1UTH B;  3IOV A;  3RQT A;  3B6T A;  2DWJ A;  4IO7 A;  5H8N B;  5KZT A;  3W9V A;  1QUL A;  1BIY A;  1EU8 A;  1A54 A;  3PMW A;  4MFI A;  3MP6 A;  2NWJ A;  1NFT A;  3IK6 B;  2R6G E;  2Y7K A;  3IOU A;  3SEY A;  1NL5 A;  1XS5 A;  2R9J A;  3SDF A;  3MAM A;  4ZZA A;  1WOD A;  3HHF A;  2FNC A;  3GBA A;  2Q2C A;  3A09 A;  2GFE A;  2X26 A;  4ZZE A;  1XT8 A;  5H8F B;  1MQI A;  4TLM B;  4RYA A;  4BDM A;  3U1O A;  4NTL A;  1FQA A;  4IO4 A;  1JET A;  5TPA A;  4OHN A;  5EHS A;  4QSC A;  3RT6 B;  4DDD A;  2Y7P A;  3O97 A;  1JEU A;  4YU0 A;  3QSL A;  2XX8 A;  1B51 A;  3G3J A;  1HSL A;  4UA8 A;  1PC3 A;  1MPB A;  2F7A A;  3TPA A;  3PUZ E;  4R72 A;  4F3P A;  4IO5 A;  1POY 1;  1XHY A;  2I58 A;  2H99 A;  1ZJL A;  4G77 A;  3ECR A;  1H76 A;  4N13 A;  4QFK A;  1RYO A;  3OOA A;  1FQB A;  2XXH A;  4KFQ A;  2XXR A;  1ZU0 A;  2RF1 A;  3FJ7 A;  2ZNS A;  5KDT B;  2RC9 A;  3EHU A;  3UGW A;  3TEP A;  4JSO A;  1RYX A;  4G68 A;  3SEU A;  2QSX A;  3VDF A;  5F1Q A;  2VD3 A;  4OXV A;  3SET A;  4E0W A;  1BTJ A;  2I4C A;  3TCG A;  2V93 A;  3OSR A;  2XX9 A;  4Q8R A;  2RKM A;  3N26 A;  4FOR A;  5A5X B;  5BUU A;  3KSX A;  2Z23 A;  1L5T A;  2F78 A;  3C9H A;  5I57 A;  1MM6 A;  5CMB A;  2PX1 A;  3ZKL A;  3H7M A;  1MG1 A;  2UVG A;  2H25 A;  1QUK A;  3IB1 A;  2R71 A;  1IXI A;  1KWH A;  4P11 A;  1ZBM A;  3K4U A;  2PBW A;  5KCJ B;  1PB7 A;  4FAJ A;  5I2N B;  3JYR A;  4YAH X;  1TWY A;  4GIZ A;  4H8I A;  1D3K A;  1BP5 A;  4DXB A;  3HN0 A;  1TT1 A;  5CMC A;  4IO6 A;  1QJM A;  4NED A;  1FW0 A;  4YB5 A;  1UIV A;  2HEU A;  4U23 A;  1R1N A;  1YCJ A;  1N7X A;  3OMB A;  4JXI A;  1DSN A;  4LQ2 A;  4O3B A;  4XKN A;  4FEC A;  3FAS A;  3EQ1 A;  4PFW A;  4Z0I A;  1DTZ A;  1LFH A;  3I5O A;  2ZNT A;  2Q8J A;  1N0T A;  2CMO A;  1YTV A;  1AIV A;  3CFZ A;  5ITO A;  3A3C A;  5DVI A;  4XKP A;  5H8H A;  3HPI A;  1LB9 A;  2A5S A;  3M3F A;  4ZE8 A;  3PPR A;  1JW1 A;  1P1O A;  1FCK A;  5FHM A;  1BLF A;  5ELV A;  1ZLQ A;  1QUI A;  4ZEK A;  4R6H A;  5AE4 A;  2GHA A;  4F3G A;  1UIU A;  4LQ5 A;  4MLQ A;  4MBP A;  2DWA A;  3PPP A;  3IOR A;  1AL3 A;  3T22 A;  4HCW A;  3CRB A;  5TP9 A;  1T0K A;  4G68 C;  5ISU A;  4JDF A;  3VVE A;  4IO3 A;  1A7L A;  4GL8 A;  1JEV A;  3MZ9 A;  1B1X A;  2I6E A;  3E9X A;  2UYF A;  4ESX A;  2UYE A;  3I3V A;  4RPN A;  4GF8 A;  1IIT A;  5IKB A;  3CIJ A;  1ZMG A;  1POT A;  3UK4 A;  2H5Y A;  1N3W A;  2HQ0 A;  3RGY A;  3TTK A;  5JTY A;  3FV2 A;  4ZEF A;  5I58 A;  2HZL A;  1B58 A;  2VP1 A;  3O28 A;  3SEV A;  1A8F A;  4H8J A;  2NUV A;  3FVN A;  4F3B A;  1SDX A;  1P1Q A;  1MS7 A;  1Y3N A;  4WEP A;  3HCQ A;  3B7D A;  4OFO A;  3B6Q A;  4YB7 A;  4U4S A;  3O6G A;  2Y7R A;  4NWD A;  1P1U A;  4ZDM A;  1IXG A;  4WED A;  5M2V A;  2QS3 A;  3OEL A;  1M5E A;  2XXI A;  4PP0 A;  4Q0C A;  1EZP A;  1MXX A;  3ILT B;  5AA4 B;  3ZKK A;  2NOO A;  3CSG A;  2F8D A;  2XXQ A;  3WAF A;  3TOD A;  4C0R A;  1B5H A;  4DLD A;  3L6G A;  4YKK A;  1LBC A;  4EDP A;  5I56 A;  2DWI A;  3T9X B;  1UTH A;  1F9B A;  2WKY A;  3OO9 A;  1B05 A;  3KBR A;  3K6W A;  2G93 A;  3PPN A;  4QRZ A;  2YPN A;  4QFO A;  3V89 B;  3KEI A;  3TTN A;  3TCH A;  3C35 A;  3UOR A;  4OER A;  4GVO A;  3G7W A;  1P1W A;  5DT6 A;  5B70 A;  4OES A;  5LOM A;  4U1O A;  4NWC A;  3TTR A;  1Q35 A;  3IL1 B;  1SW4 A;  4OTE A;  3S9E A;  4Z7E A;  1S50 A;  5H8F A;  1MPC A;  2OWS A;  3T66 A;  4KCC A;  3G3K A;  3K02 A;  1URD A;  1P99 A;  1B52 A;  1MXZ A;  4KYD A;  1SQY A;  2DYX A;  4IO2 A;  3EHS A;  4QF9 A;  3E13 X;  2UVJ A;  3QUJ A;  1HSE A;  3LSX A;  3MW0 A;  3I6V A;  5L9M A;  3GLB A;  3OO8 A;  1S9T A;  1LFI A;  1Y3P A;  2DXR A;  4KYS A;  4LP2 B;  4YMA A;  3OD7 A;  3Q27 A;  5HBC A;  1PBP A;  1ANF A;  1MQG A;  4RXL A;  5CC2 A;  3OSQ A;  3P7I A;  2XXU A;  2B3B A;  3FJM A;  3LSF B;  1FQE A;  1SYH A;  1PB8 A;  3IJO B;  3VVD A;  4OET A;  1B3G A;  1D9Y A;  4H5F A;  2AL5 A;  3IX1 A;  2GRV A;  4ZEI A;  5BWJ A;  4THI A;  5KDT A;  3FV1 A;  5L9O A;  1Y1M A;  4DE8 A;  4I9D A;  4FED A;  1FTJ A;  1CE2 A;  3C32 A;  3SES A;  1LGB C;  1OQG A;  1TFD A;  1IIW A;  1LCT A;  3MJN A;  4POW A;  2ABH A;  4M4G A;  4BDN A;  3IO4 A;  1A40 A;  3Q26 A;  2AL4 A;  2O68 A;  1GVC A;  3FZV A;  1LLS A;  3TQW A;  2V3Q A;  2DQV A;  4JSD A;  4WKM A;  1SW2 A;  4MLV A;  1SVX B;  1M5F A;  4EQB A;  3UP9 A;  3CG3 A;  4R75 A;  1VFE A;  4OEV A;  1ZTY A;  5I84 A;  2ONS A;  4TQU Q;  3IO6 A;  4IY6 A;  4ELP A;  2PYY A;  3PUV E;  4NF5 B;  2I49 A;  3LR1 A;  5I2K A;  2Z8D A;  1MXW A;  2OCU A;  5F7V A;  1SI0 A;  3SER A;  5KCJ A;  2ANJ A;  4KR5 A;  5I2N A;  1I6B A;  5H8Q A;  1UQW A;  2H9B A;  1USY H;  1XOC A;  4GOT A;  1OVT A;  1MY3 A;  2P2A A;  5CMK A;  3CFX A;  3VE1 B;  2XXW A;  2Q89 A;  5K2X A;  4U2R A;  3OEK A;  1B5I A;  4F19 A;  2DP8 A;  5H8S A;  1ATG A;  1XC1 A;  3K6V A;  1QKB A;  1PBQ A;  1DPE A;  4LZ5 A;  1URS A;  3R7X A;  3O6I A;  3DEL B;  3GXA A;  3V5A A;  2QPQ A;  2XX7 A;  4RK9 A;  3FJG A;  3N94 A;  1NH7 A;  2O84 X;  3TMG A;  1EZO A;  2RCA A;  1FQF A;  3C34 A;  3TEL A;  1TXF A;  3BFU A;  4L17 A;  2F6G A;  1IQ7 A;  3UN6 A;  4KD5 A;  3MZ1 A;  4EF1 A;  1LAF E;  4H0W A;  1EZ9 A;  2ZYM A;  3VLW A;  3MQ9 A;  3EF7 A;  4GFR A;  3TCF A;  1OVB A;  4YMB A;  2XHD A;  1LCF A;  2ZMB A;  4JWY A;  1XVX A;  4XKR A;  3W15 C;  4F31 B;  1CB6 A;  3K1P A;  1B7U A;  3CI8 A;  4FIM A;  4AB5 A;  3D4C A;  2NVU B;  4RJZ A;  1B40 A;  2Q9T A;  1DOT A;  5CBR A;  2OBG A;  1N04 A;  4YIC A;  2PMS A;  2REJ A;  1NH8 A;  4FAT A;  1FTL A;  1I69 A;  3MUQ A;  3SEX A;  1JW5 A;  3TYH A;  3O9P A;  2KLF A;  4BLA A;  1US4 A;  4ESW A;  3FUZ A;  2REG A;  2F97 A;  3RN8 A;  4BDL A;  4Q5T A;  5DVJ A;  1MXU A;  3TDJ A;  1B6H A;  1LAX A;  3S9N C;  4DZ1 A;  4YKP A;  3T9U A;  2VHA A;  5I59 A;  1O64 A;  1B7H A;  2XD3 A;  3M3L A;  4AB6 A;  2F5X A;  3DP6 A;  2E1S A;  4LON B;  3KFM A;  3KN3 A;  2B65 A;  4ZED A;  3EPE A;  1NMU A;  3QUF A;  1US5 A;  1O7T A;  2PT2 A;  4F1Y A;  4PET A;  3PV0 E;  3O6H A;  4YZZ A;  2DOJ A;  4LAT A;  3T9H B;  4RK2 A;  1I6Q A;  3QAX A;  5FTH A;  1Z7N E;  3KN8 A;  2I0B A;  5AA4 A;  4POX A;  5CI5 A;  3MP8 A;  4NF4 A;  1AOV A;  3RT8 A;  5B7D A;  2G29 A;  1R9Q A;  2OLB A;  2O1L A;  3RNN A;  5AA2 D;  3GBB A;  3U94 A;  1DMB A;  1MXY A;  2F34 A;  1UTB A;  2X7P A;  5ITP A;  1LST A;  1H45 A;  2FA7 A;  3SEW A;  1VE4 A;  2ZYK A;  4GQO A;  2H4I A;  3T96 B;  1N3X A;  4GWO A;  4G2Z A;  3TFL A;  3TKD A;  4HTG A;  1P1N A;  3K6U A;  4NF6 B;  4EUO A;  1B1H A;  4XKQ A;  1B3F A;  2RIN A;  1QKA A;  3USD A;  1B7Z A;  3QYT A;  1Y1Z A;  1MRP A;  2RC8 A;  4QFL A;  3U72 A;  5JEI A;  3LSW A;  4FJP A;  2PT1 A;  3CG1 A;  3PPQ A;  1RKM A;  2YJP A;  2Q2A A;  2XXV A;  4LVQ A;  3PGF A;  5DEX B;  1MM7 A;  1LAG E;  4GLI A;  1BKA A;  1SD3 A;  3IB0 A;  3K01 A;  1MY2 A;  3IR1 A;  3PU5 A;  2DWH A;  3T9V A;  1TFA A;  2XD2 A;  4F39 A;  2DVZ A;  2Z8F A;  5CRY A;  1MDP 1;  3UA8 A;  3PMX A;  3G3H A;  4XTC Q;  4DCY A;  4YKI A;  1H43 A; 
#chains in the Genus database with same CATH topology
 1RDX A;  4KCD A;  3THI A;  1FQC A;  4YKJ A;  4I3E A;  2ZZX A;  4RA1 A;  4KQP A;  1IEJ A;  2DE3 A;  2F36 A;  4PF8 A;  5H8H B;  2DE4 A;  4KHZ E;  4PFY A;  3HV1 A;  2HAU A;  2V25 A;  4MMP A;  1USY E;  4EQ7 A;  3PTY A;  4G8M A;  3L6H A;  4N6P A;  4PFB A;  4JBZ A;  1B46 A;  2QMX A;  4ELR A;  3EN3 A;  2P0S A;  5H8N A;  3VVF A;  2D21 A;  1URG A;  1NI9 A;  4OFJ A;  1FPE A;  4DIG A;  5TP9 B;  4PAK A;  1WVJ A;  1PB9 A;  4QSE A;  2O7U A;  2XXP A;  3CSB A;  1B0H A;  3LBS A;  3V8X B;  3KGC A;  4PBQ A;  3QIM A;  3RUM A;  1LBB A;  5FHN A;  4OEN A;  4OZ9 A;  4WXJ A;  1JW4 A;  3G3F A;  5CMM A;  2F3B A;  2QRY A;  4MNI A;  1WDN A;  3IJX B;  3ONM A;  5ICQ A;  4PAF A;  3H03 A;  2OWT A;  4GWW A;  3E4R A;  2LAO A;  1JQF A;  2L5V A;  5JTY B;  4OMB A;  4QHQ A;  3E3K A;  3G3G A;  2Z22 A;  2Y5K A;  5I58 B;  3MWB A;  2FIX A;  1FPJ A;  3FVK A;  5JK4 A;  2FYI A;  3W9W A;  2I48 A;  1LFG A;  4BDQ A;  5AA2 B;  2O6A A;  3D1R A;  3U93 A;  3KG2 A;  3K00 A;  3EHT A;  4MF3 A;  1DTG A;  3QK6 A;  3U8Q A;  4F3S A;  1NNK A;  2HCA A;  1LBV A;  3WAE A;  1H3D A;  2Y7I A;  3H6T A;  4ZE9 A;  2HXW A;  4P47 A;  4X48 A;  4ELQ A;  3C33 A;  1OQH A;  2ZNU A;  4UAC A;  3ODB A;  3H06 B;  2D5W A;  2V3T A;  4BDO A;  2F7C A;  1AH5 A;  5L9S A;  3AXF A;  4N4U A;  4O3C A;  2Q74 A;  3OXN A;  1FQD A;  1IXH A;  1PEB A;  3FIR A;  3DP8 A;  4E0X A;  4DXU A;  4NF0 A;  3FAT A;  2A5T B;  1VSO A;  1FJ9 A;  4C1T A;  2RCB A;  2THI A;  5EQ9 A;  1NKX A;  1B3L A;  3DLN A;  4R73 A;  1MY0 A;  4KPT A;  2IA4 A;  5DTB A;  5AA3 A;  3Q29 A;  5I56 B;  3LUY A;  2XXT A;  4P0I A;  3K6X A;  5A5X A;  3HO7 A;  4C1U A;  2ONK E;  1GR2 A;  2OJT A;  4PAI A;  1BK4 A;  2QMW A;  3OO7 A;  3N6T A;  1IMD A;  5I7I A;  4H65 A;  4LZ7 A;  4ONY A;  4XIG Q;  1EH3 A;  5FTI A;  2I4B A;  1QGX A;  2RC7 A;  3MP1 A;  3RTF B;  4R74 A;  4F22 A;  4IGT A;  1GGG A;  1NNT A;  1M5D A;  1I6A A;  1NV1 A;  3MZB A;  3E79 A;  1GTK A;  4EXK A;  5LTC A;  3JZJ A;  3Q25 A;  2XXK A;  3PD9 A;  5ESY A;  2XWO A;  3IAZ A;  2DSF A;  4GRK A;  1OLC A;  4U4X A;  4DCX A;  3IOW A;  4PE5 B;  2O1M A;  4NF8 B;  3CR9 A;  2HHM A;  3H6V A;  1JVX A;  3R6U A;  5L8D A;  1B2H A;  2W7Y A;  4M1V A;  2AYS A;  3OEN A;  2HZK A;  3K1M A;  1N7W A;  5IM2 A;  3MC2 A;  1D9Q A;  4ZEC A;  3M3K A;  3RYD A;  4QFN A;  4P9K A;  4LUB A;  2H98 A;  1NNP A;  3TQL A;  3H4Z A;  4R9G A;  3RTW B;  3D4G A;  1R9L A;  1Z7M E;  2Q88 A;  3DM0 A;  4ZS9 A;  4I1D A;  2AIX A;  3HHG A;  2JJK A;  2F6P A;  3VV5 A;  4EF2 A;  3ZS6 A;  3CHG A;  1MPD A;  4IY5 A;  3MVZ A;  4P56 A;  1MY4 A;  5EYG A;  4AS5 A;  1SI1 A;  2YLN A;  1N84 A;  2QJE A;  2CEX A;  4P1E A;  3FVO A;  4PQJ A;  4H1X A;  3C4M A;  4K3F A;  1ZKB A;  5HPQ A;  2CZL A;  2ESN A;  4MCO A;  4LZ8 A;  4JB7 A;  1B32 A;  1FTM A;  4GD5 A;  4O3A A;  3SKP A;  2D3I A;  1B9J A;  2HPG A;  1QW0 A;  3KSJ A;  3MYU A;  5IZZ A;  3CFL A;  4R2B A;  1MQD A;  1Y3Q A;  2ZYN A;  3H6U A;  5ICT A;  1VFD A;  2VPN A;  4U1Z A;  1A99 A;  2Y84 A;  1YYZ A;  3FXU A;  4R6Y A;  1H44 A;  3OEM A;  4MAG A;  1B0L A;  2ALU A;  3H3G A;  4TLL B;  5TPA B;  3TAJ A;  2PCR A;  1QVS A;  4NF6 A;  4G8N A;  5I2K B;  3MVY A;  2ZXT A;  1IUD A;  4ECF A;  3MBP A;  5H8Q B;  4U21 A;  4OQO A;  1A55 A;  2V84 A;  1D9V A;  2I0C A;  2GHB A;  4R6K A;  3VXC A;  2P3N A;  1SPI A;  2UVI A;  2Y7W A;  4F2O A;  4OWD A;  1DCU A;  3Q28 A;  4R9F A;  3KOS A;  3LC8 A;  2Y5L A;  5IAI A;  1IZ1 A;  5DEX A;  1M5B A;  1Q1K A;  2XXY A;  4AQ4 A;  1XVY A;  4TOZ A;  3ZSF A;  4PDH A;  3R26 A;  2I3W A;  1PDA A;  2OZZ A;  4OEU A;  1YXI A;  1N76 A;  3VXB A;  4F2Q A;  4QSD A;  3T1B A;  1ELJ A;  5DYH A;  4EXL A;  4PC9 A;  5IZ3 B;  4G68 B;  1OMP A;  4I62 A;  4P0G A;  4N07 A;  1MDQ A;  3S9M C;  2Z8E A;  2VOZ A;  3KN7 A;  4U22 A;  2UVH A;  5HM4 B;  2ONR A;  4EQ9 A;  1KZ8 A;  2HAV A;  3PPO A;  2QS1 A;  4F29 A;  2XWI A;  3N6U A;  1MQH A;  2HXR A;  3GZG A;  1JVY A;  2B3F A;  3PUY E;  3T93 B;  4O7I A;  1AMF A;  2F35 A;  4NE4 A;  1Y4C A;  1IMF A;  1DPP A;  3U92 A;  1SYI A;  1FBG A;  5F24 A;  1J1N A;  3FXR A;  4I8C A;  5I57 B;  4RPO A;  1SW1 A;  1FTK A;  3KOT A;  5ET6 A;  5FHO A;  3TUS A;  1YAE A;  3JV9 A;  1ZIU A;  2QS2 A;  4XFE A;  2Q8M A;  5LDZ A;  4F18 A;  2XWV A;  3FVG A;  1FTO A;  4JWO A;  4H45 A;  4HCY A;  1LBW A;  4GXA A;  4MNP A;  3O66 A;  1SBP A;  2DDK A;  2VT5 A;  4Q30 B;  2BJJ X;  3FGS A;  2P1S A;  5K2Y A;  5CM6 A;  4RY1 A;  2X7Q A;  4RNS A;  1B3H A;  5EYF A;  2V3U A;  3PMV A;  3A3U A;  3IB2 A;  2PVU A;  1MH4 A;  5ET8 A;  1XI6 A;  4JWX A;  1Y20 A;  3C36 A;  2UXA A;  3CVG A;  3ILU B;  2O7I A;  4FE8 A;  1B5J A;  2IEE A;  4GXS B;  1O63 A;  4HS7 A;  5AA2 A;  4XF5 A;  2I3V A;  4P8B A;  1B3E A;  2VD2 A;  3TTM A;  5I59 B;  2VGQ A;  1INP A;  2ZYO A;  1NV4 A;  4PGN A;  4F1U A;  4IB2 A;  5J1D A;  2XXX A;  1QUJ A;  4ZEB A;  1HSJ A;  3GYY A;  2DS9 A;  3K1N A;  3VFJ A;  4H6D A;  3A29 A;  4GBV A;  3FD3 A;  4X8R A;  5EHM A;  1SW5 A;  3S2V A;  3QXM A;  1OLA A;  3H6W A;  4KYE A;  3BIH A;  3RLF E;  3KBZ A;  3MPK A;  1OIB A;  4H67 A;  4LA9 A;  4P3L A;  2DVC A;  2BJI A;  2A5T A;  1II5 A;  2HFB A;  4NF4 B;  4X1B A;  3MVW A;  5AA1 A;  3FBP A;  4GWY A;  2O69 A;  3KJT A;  3UIF A;  4PFT A;  4OVR A;  4GL0 A;  3VLV A;  3V83 A;  4O8M A;  3LV0 A;  4G8H A;  1R6Z A;  3G3I A;  1UTB B;  3O29 A;  4OVT A;  2OK2 A;  3KC0 A;  1Y4T A;  3S4U A;  3K2D A;  3PUW E;  1NNF A;  1S7Y A;  1M5C A;  3RY3 A;  4G4P A;  1AWB A;  4ND9 A;  1G0H A;  3MVX A;  5FBP A;  3B6W A;  3KJ7 A;  2CZI A;  3PUX E;  4BDR A;  4NF5 A;  4KI0 E;  1NUW A;  1GV8 A;  1LB8 A;  4HE1 A;  4IGR A;  3RPW A;  1IXC A;  2NXO A;  3TZA A;  4PDD A;  1LAH E;  3MPL A;  5CBS A;  4FEB A;  1MXV A;  3BBR A;  4MH5 A;  1NV0 A;  1VR5 A;  4H5G A;  1DK4 A;  4ELO A;  1A8E A;  1Y9U A;  3BKI B;  2DXY A;  1LEV A;  4QFP A;  4XXU A;  4NF8 A;  4ISU A;  3IOT A;  1D4N A;  3BFT A;  1MH3 A;  4R2F A;  2QL3 A;  4NMY A;  3LSL A;  2M8C A;  2QS4 A;  4PFI A;  1YPN A;  1NV5 A;  3O2A A;  1MY1 A;  2DE2 A;  4DXC A;  4OVJ A;  3TTL A;  3KZG A;  4AS4 A;  3F11 A;  4MHF A;  2GH9 A;  1K9Y A;  5EYH A;  2F7B A;  1IMB A;  4P1L A;  1B4H A;  3K0V A;  3VLU A;  3HST A;  3IFC A;  4HW8 A;  3S9L C;  5DVF A;  4N15 A;  4OFL A;  4X9T A;  3PD8 A;  2E0S A;  3OO6 A;  3RPL B;  1MQJ A;  3N5L A;  4F1V A;  5TU0 A;  1JNF A;  3C31 A;  4PFU A;  1B4Z A;  4OYV A;  3DP4 A;  4X1D A;  3FXQ A;  3M8U A;  4YB6 A;  2O51 A;  1UTH B;  3IOV A;  3RQT A;  2CZH A;  3B6T A;  4GBW A;  2DWJ A;  4IO7 A;  5H8N B;  5KZT A;  3W9V A;  1NUY A;  1QUL A;  1BIY A;  1EU8 A;  1A54 A;  5EQ7 A;  3PMW A;  4NX1 A;  4MFI A;  3MP6 A;  2NWJ A;  4UAB A;  1NFT A;  3IK6 B;  2R6G E;  2Y7K A;  3IOU A;  3SEY A;  5IGA A;  1NL5 A;  1XS5 A;  2R9J A;  3SDF A;  3MAM A;  4ZZA A;  4PF6 A;  1WOD A;  3HHF A;  2FNC A;  3GBA A;  2Q2C A;  3A09 A;  2GFE A;  2X26 A;  4ZZE A;  2ZZW A;  1XT8 A;  4JVC A;  5H8F B;  1MQI A;  4TLM B;  4RYA A;  4BDM A;  3U1O A;  4NTL A;  3FXB A;  1FQA A;  4IO4 A;  1JET A;  4QXD A;  5EQA A;  5TPA A;  4OHN A;  5EHS A;  4QSC A;  3RT6 B;  4DDD A;  2Y7P A;  4H46 A;  3O97 A;  1JEU A;  1FPF A;  4PE3 A;  4YU0 A;  3QSL A;  2XX8 A;  1B51 A;  3G3J A;  1HSL A;  4UA8 A;  2B4L A;  1PC3 A;  1MPB A;  2F7A A;  3SZP A;  3TPA A;  3PUZ E;  4R72 A;  4F3P A;  4IO5 A;  1G0I A;  1POY 1;  2FBP A;  1XHY A;  2I58 A;  2H99 A;  1ZJL A;  4G77 A;  3ECR A;  1H76 A;  4N13 A;  4QFK A;  1RYO A;  3OOA A;  5I3S A;  1NUZ A;  1FQB A;  2XXH A;  4KFQ A;  2XXR A;  1ZU0 A;  2RF1 A;  3FJ7 A;  2ZNS A;  5KDT B;  4NQ8 A;  2RC9 A;  3EHU A;  3UGW A;  3TEP A;  4JSO A;  1RYX A;  4G68 A;  3SEU A;  2QSX A;  3VDF A;  5F1Q A;  2VD3 A;  4OXV A;  1Q9D A;  3SET A;  4E0W A;  1BTJ A;  4O94 A;  3T0J A;  2I4C A;  3TCG A;  2V93 A;  3OSR A;  2XX9 A;  4Q8R A;  2RKM A;  1LBX A;  3N26 A;  4FOR A;  5A5X B;  5BUU A;  1FSA A;  3KSX A;  2Z23 A;  1YZ0 A;  1L5T A;  2F78 A;  3C9H A;  5I57 A;  1NV2 A;  1MM6 A;  5CMB A;  2CZK A;  2PX1 A;  3ZKL A;  1NV7 A;  3H7M A;  1MG1 A;  2UVG A;  2H25 A;  1QUK A;  3IB1 A;  2R71 A;  1IXI A;  1KWH A;  1FPD A;  4P11 A;  1ZBM A;  3K4U A;  2PBW A;  5KCJ B;  1PB7 A;  4FAJ A;  5I2N B;  5A5L A;  3JYR A;  4YAH X;  3BIG A;  4GX4 A;  1TWY A;  4GIZ A;  4H8I A;  1D3K A;  1BP5 A;  4DXB A;  3HN0 A;  1CNQ A;  1TT1 A;  5CMC A;  4IO6 A;  1QJM A;  4DI4 B;  4NED A;  1FW0 A;  4YB5 A;  1RDY A;  4FBP A;  1UIV A;  2HEU A;  4U23 A;  1R1N A;  4HE0 A;  1YCJ A;  1N7X A;  4N6K A;  3OMB A;  5J16 A;  4JXI A;  1DSN A;  4LQ2 A;  4O3B A;  4XKN A;  4FEC A;  3FAS A;  3EQ1 A;  4PFW A;  4Z0I A;  1DTZ A;  4OVQ A;  1LFH A;  3I5O A;  2ZNT A;  2Q8J A;  1N0T A;  2CMO A;  1YTV A;  1AIV A;  3CFZ A;  5ITO A;  3A3C A;  5DVI A;  4GX3 A;  3HFU A;  1FBH A;  4XKP A;  5H8H A;  3HPI A;  1LB9 A;  2A5S A;  4N91 A;  3M3F A;  4ZE8 A;  3PPR A;  1JW1 A;  1P1O A;  4PCD A;  1FCK A;  5FHM A;  1BLF A;  5ELV A;  1ZLQ A;  2FIE A;  1QUI A;  5ET7 A;  4ZEK A;  4R6H A;  3B8B A;  5AE4 A;  2GHA A;  4F3G A;  1UIU A;  2KR0 A;  4LQ5 A;  4MLQ A;  4MBP A;  2DWA A;  3PPP A;  3IOR A;  1AL3 A;  3T22 A;  4HCW A;  3CRB A;  5TP9 A;  1KA0 A;  1T0K A;  1NV3 A;  4G68 C;  5ISU A;  1FBD A;  4JDF A;  3VVE A;  4IO3 A;  4PFR A;  1A7L A;  4GL8 A;  1JEV A;  3MZ9 A;  1B1X A;  2I6E A;  3E9X A;  2UYF A;  4ESX A;  2UYE A;  3I3V A;  4RPN A;  4GF8 A;  1IIT A;  5IKB A;  3CIJ A;  1ZMG A;  1POT A;  3UK4 A;  2FHY A;  2H5Y A;  1N3W A;  2V4C A;  2HQ0 A;  3RGY A;  4GWS A;  3TTK A;  5JTY A;  3FV2 A;  4ZEF A;  2GQ1 A;  5I58 A;  2HZL A;  1B58 A;  2VP1 A;  3O28 A;  4KXP A;  3SEV A;  1FPI A;  1A8F A;  4H8J A;  2NUV A;  3FVN A;  4F3B A;  1SDX A;  1P1Q A;  1MS7 A;  1Y3N A;  4WEP A;  3HCQ A;  3B7D A;  5I5P A;  5DW8 A;  4OFO A;  3B6Q A;  4YB7 A;  4NGU A;  2QFL A;  4U4S A;  3O6G A;  2Y7R A;  4NWD A;  1P1U A;  4I40 A;  4ZDM A;  5EQ8 A;  1IXG A;  4WED A;  5M2V A;  4IR8 A;  2QS3 A;  3OEL A;  1M5E A;  4PP0 A;  1FPL A;  2XXI A;  4Q0C A;  1EZP A;  1MXX A;  3ILT B;  5AA4 B;  4N81 A;  3ZKK A;  1FBP A;  1LBY A;  3RPL A;  2NOO A;  3CSG A;  2F8D A;  2XXQ A;  3TOD A;  3WAF A;  4N8G A;  4C0R A;  1B5H A;  4DLD A;  3L6G A;  4YKK A;  4JVI A;  1LBC A;  4EDP A;  5I56 A;  2DWI A;  3T9X B;  1UTH A;  2WBB A;  1F9B A;  2WKY A;  3OO9 A;  1B05 A;  4PTK A;  3LUZ A;  3E78 A;  3KBR A;  3K6W A;  4GWX A;  2G93 A;  3PPN A;  4X04 A;  4QRZ A;  2YPN A;  4QFO A;  3V89 B;  3KEI A;  3TTN A;  3TCH A;  3C35 A;  3UOR A;  4OER A;  4GVO A;  3ROJ A;  3G7W A;  1P1W A;  2F3D A;  5DT6 A;  5B70 A;  4OES A;  5LOM A;  4U1O A;  4NWC A;  3TTR A;  5ET5 A;  1Q35 A;  3IL1 B;  1SW4 A;  4OTE A;  1IMC A;  1LBZ A;  3S9E A;  4Z7E A;  1S50 A;  5H8F A;  1MPC A;  2OWS A;  3T66 A;  4KCC A;  3G3K A;  3K02 A;  1URD A;  1P99 A;  1B52 A;  1MXZ A;  4KYD A;  1SQY A;  2DYX A;  4IO2 A;  1IME A;  3EHS A;  4NN3 A;  4QF9 A;  3E13 X;  2UVJ A;  3QUJ A;  1HSE A;  3LSX A;  1FBE A;  3I6V A;  3MW0 A;  5L9M A;  3GLB A;  3OO8 A;  1S9T A;  4LN5 A;  1LFI A;  1Y3P A;  3NOH A;  2DXR A;  4KYS A;  4LP2 B;  4YMA A;  3OD7 A;  3ISP A;  1EYI A;  3Q27 A;  1FPK A;  5HBC A;  1PBP A;  1ANF A;  1MQG A;  4RXL A;  1FBC A;  5CC2 A;  3OSQ A;  3P7I A;  2XXU A;  4MNC A;  2B3B A;  2B4M A;  3FJM A;  3LSF B;  1FQE A;  1SYH A;  1PB8 A;  3IJO B;  3VVD A;  4OET A;  1B3G A;  1D9Y A;  2P3V A;  4H5F A;  2AL5 A;  3IX1 A;  2GRV A;  4MX6 A;  4ZEI A;  5BWJ A;  4THI A;  4N6D A;  5KDT A;  3FV1 A;  5L9O A;  1Y1M A;  4DE8 A;  4I9D A;  4FED A;  1FTJ A;  1CE2 A;  3C32 A;  3SES A;  1LGB C;  1OQG A;  1TFD A;  1IIW A;  1LCT A;  3MJN A;  2WYK A;  4POW A;  2QVR A;  2QVU A;  2ABH A;  4M4G A;  4BDN A;  3IO4 A;  1A40 A;  1IMA A;  3Q26 A;  2AL4 A;  2O68 A;  1GVC A;  3FZV A;  1LLS A;  3TQW A;  4G61 A;  2V3Q A;  2DQV A;  4JSD A;  4WKM A;  4NAP A;  4QBA A;  4XEQ A;  1SW2 A;  4HXV A;  4MLV A;  1SVX B;  1M5F A;  2R8T A;  4EQB A;  3UP9 A;  3CG3 A;  4R75 A;  1VFE A;  4OEV A;  1ZTY A;  5I84 A;  2KQZ A;  4PGP A;  2ONS A;  4TQU Q;  3IO6 A;  4IY6 A;  4ELP A;  2PYY A;  3PUV E;  4NF5 B;  3B50 A;  2I49 A;  3LR1 A;  5I2K A;  2Z8D A;  4JVD A;  1MXW A;  2OCU A;  5F7V A;  2WYP A;  1SI0 A;  2ZZV A;  4N8Y A;  3SER A;  5KCJ A;  2ANJ A;  4KR5 A;  3QMF A;  5I2N A;  1I6B A;  5H8Q A;  1UQW A;  4NHB A;  2H9B A;  1USY H;  1XOC A;  4GOT A;  1OVT A;  1MY3 A;  2OX3 A;  2MKZ A;  2P2A A;  5CMK A;  3CFX A;  4OA4 A;  3VE1 B;  2XXW A;  2Q89 A;  5K2X A;  4U2R A;  3OEK A;  1B5I A;  4F19 A;  2DP8 A;  5H8S A;  1ATG A;  2PFY A;  2CEY A;  1XC1 A;  3K6V A;  1QKB A;  1PBQ A;  1DPE A;  4LZ5 A;  1URS A;  3R7X A;  3O6I A;  2WX9 A;  3DEL B;  3GXA A;  3V5A A;  2QPQ A;  2XX7 A;  4RK9 A;  3FJG A;  3N94 A;  5IZ3 A;  1NH7 A;  2O84 X;  3TMG A;  1EZO A;  2RCA A;  1FQF A;  2XA5 A;  2VPO A;  3C34 A;  3TEL A;  1TXF A;  3BFU A;  4L17 A;  2F6G A;  1IQ7 A;  3UN6 A;  4KD5 A;  4GX6 A;  3MZ1 A;  4EF1 A;  1LAF E;  4H0W A;  4PBH A;  1EZ9 A;  2ZYM A;  3VLW A;  3MQ9 A;  3EF7 A;  4GFR A;  3TCF A;  1OVB A;  4MIJ A;  4YMB A;  3U65 A;  2WBD A;  2XHD A;  1LCF A;  4MEV A;  2ZMB A;  4JWY A;  1XVX A;  4XKR A;  3W15 C;  4F31 B;  1CB6 A;  3K1P A;  1EYJ A;  1B7U A;  2PFZ A;  3CI8 A;  4FIM A;  4AB5 A;  3D4C A;  2NVU B;  4RJZ A;  1B40 A;  2Q9T A;  2WEF A;  1DOT A;  5CBR A;  2OBG A;  1N04 A;  1NUX A;  4HE2 A;  4YIC A;  1NV6 A;  4MJO A;  2PMS A;  2REJ A;  1NH8 A;  1FTA A;  4GWZ A;  4FAT A;  1FTL A;  1I69 A;  3MUQ A;  3SEX A;  1JW5 A;  3TYH A;  3O9P A;  1JP4 A;  2KLF A;  4BLA A;  1US4 A;  4ESW A;  3FUZ A;  2REG A;  2F97 A;  3RN8 A;  4BDL A;  3MST A;  4Q5T A;  5DVJ A;  1MXU A;  2OWZ A;  3TDJ A;  1B6H A;  1LAX A;  3S9N C;  1RDZ A;  4DZ1 A;  4YKP A;  2FVZ A;  3T9U A;  2VHA A;  5I59 A;  1O64 A;  1B7H A;  2XD3 A;  1DBZ A;  3M3L A;  4AB6 A;  2F5X A;  3DP6 A;  2E1S A;  4LON B;  3KFM A;  3KN3 A;  1FPG A;  2B65 A;  4ZED A;  3EPE A;  1NMU A;  3QUF A;  1US5 A;  1O7T A;  1EYK A;  2PT2 A;  1FBF A;  4F1Y A;  4PET A;  3PV0 E;  3O6H A;  4YZZ A;  2DOJ A;  4LAT A;  3T9H B;  1FJ6 A;  4RK2 A;  1I6Q A;  3QAX A;  4OVS A;  5FTH A;  1Z7N E;  3KN8 A;  2I0B A;  5AA4 A;  4POX A;  5CI5 A;  1VDW A;  3MP8 A;  4NF4 A;  1AOV A;  4OVP A;  4DI3 D;  3RT8 A;  5B7D A;  2G29 A;  1R9Q A;  2OLB A;  2O1L A;  3RNN A;  5T3J A;  5AA2 D;  3GBB A;  3U94 A;  1DMB A;  1MXY A;  2F34 A;  1UTB A;  2X7P A;  5ITP A;  4OAN A;  1LST A;  4N17 A;  1FPB A;  1H45 A;  2FA7 A;  3SEW A;  1VE4 A;  4GWU A;  2ZYK A;  4GQO A;  2H4I A;  3T96 B;  1N3X A;  4GWO A;  4G2Z A;  3TFL A;  3TKD A;  4HTG A;  1P1N A;  3K6U A;  4NF6 B;  2QVV A;  4EUO A;  1B1H A;  4XKQ A;  1B3F A;  1K9Z A;  2RIN A;  1KA1 A;  1QKA A;  4O7M A;  3USD A;  3IFA A;  1B7Z A;  3QYT A;  1FRP A;  2XWK A;  1Y1Z A;  1MRP A;  2RC8 A;  4QFL A;  3EKI A;  3U72 A;  5JEI A;  3LSW A;  4FJP A;  2PT1 A;  3CG1 A;  3PPQ A;  1RKM A;  2YJP A;  2Q2A A;  2XXV A;  4LVQ A;  3PGF A;  5DEX B;  1MM7 A;  1LAG E;  4GLI A;  1BKA A;  1SD3 A;  3IB0 A;  3K01 A;  1MY2 A;  3IR1 A;  4NG7 A;  3PU5 A;  2DWH A;  3T9V A;  1TFA A;  2XD2 A;  4F39 A;  2DVZ A;  2Z8F A;  5CRY A;  1MDP 1;  3UA8 A;  3PMX A;  3G3H A;  5IZ1 A;  4XTC Q;  4DCY A;  4YKI A;  3KC1 A;  4I3Y A;  1H43 A; 
#chains in the Genus database with same CATH homology
 4KCD A;  3THI A;  1FQC A;  4YKJ A;  4RA1 A;  4KQP A;  1IEJ A;  2DE3 A;  2F36 A;  5H8H B;  2DE4 A;  4KHZ E;  4PFY A;  3HV1 A;  2HAU A;  2V25 A;  1USY E;  4EQ7 A;  4G8M A;  3L6H A;  4N6P A;  4JBZ A;  1B46 A;  2QMX A;  4ELR A;  3EN3 A;  2P0S A;  5H8N A;  3VVF A;  2D21 A;  1URG A;  4OFJ A;  4DIG A;  5TP9 B;  1WVJ A;  1PB9 A;  4QSE A;  2O7U A;  2XXP A;  3CSB A;  1B0H A;  3LBS A;  3V8X B;  3KGC A;  3QIM A;  3RUM A;  1LBB A;  5FHN A;  4OEN A;  4OZ9 A;  4WXJ A;  1JW4 A;  3G3F A;  5CMM A;  2QRY A;  1WDN A;  3IJX B;  3ONM A;  5ICQ A;  3H03 A;  2OWT A;  3E4R A;  2LAO A;  1JQF A;  5JTY B;  4OMB A;  4QHQ A;  3E3K A;  3G3G A;  2Z22 A;  5I58 B;  3MWB A;  3FVK A;  5JK4 A;  2FYI A;  3W9W A;  2I48 A;  1LFG A;  4BDQ A;  5AA2 B;  2O6A A;  3U93 A;  3KG2 A;  3K00 A;  3EHT A;  4MF3 A;  1DTG A;  3QK6 A;  3U8Q A;  4F3S A;  1NNK A;  2HCA A;  3WAE A;  1H3D A;  2Y7I A;  3H6T A;  4ZE9 A;  2HXW A;  4X48 A;  4ELQ A;  3C33 A;  1OQH A;  2ZNU A;  4UAC A;  3ODB A;  3H06 B;  2D5W A;  2V3T A;  4BDO A;  2F7C A;  1AH5 A;  5L9S A;  3AXF A;  4O3C A;  3OXN A;  1FQD A;  1IXH A;  1PEB A;  3FIR A;  3DP8 A;  4E0X A;  4DXU A;  3FAT A;  2A5T B;  1VSO A;  4C1T A;  2RCB A;  2THI A;  1NKX A;  1B3L A;  3DLN A;  4R73 A;  1MY0 A;  4KPT A;  2IA4 A;  5DTB A;  5AA3 A;  3Q29 A;  5I56 B;  3LUY A;  2XXT A;  4P0I A;  3K6X A;  5A5X A;  3HO7 A;  4C1U A;  2ONK E;  1GR2 A;  2OJT A;  2QMW A;  3OO7 A;  3N6T A;  4H65 A;  4LZ7 A;  4ONY A;  4XIG Q;  1EH3 A;  5FTI A;  2I4B A;  2RC7 A;  3MP1 A;  3RTF B;  4R74 A;  4F22 A;  4IGT A;  1GGG A;  1NNT A;  1M5D A;  1I6A A;  3MZB A;  1GTK A;  4EXK A;  3JZJ A;  3Q25 A;  3PD9 A;  3IAZ A;  2DSF A;  4GRK A;  1OLC A;  4U4X A;  4DCX A;  3IOW A;  4PE5 B;  2O1M A;  4NF8 B;  3CR9 A;  3H6V A;  1JVX A;  3R6U A;  5L8D A;  1B2H A;  2W7Y A;  4M1V A;  2AYS A;  3OEN A;  2HZK A;  3K1M A;  1N7W A;  3MC2 A;  4ZEC A;  3M3K A;  4QFN A;  4LUB A;  2H98 A;  1NNP A;  3TQL A;  3H4Z A;  4R9G A;  3RTW B;  3D4G A;  1R9L A;  1Z7M E;  2Q88 A;  3DM0 A;  4ZS9 A;  4I1D A;  2AIX A;  3HHG A;  2F6P A;  3VV5 A;  4EF2 A;  3ZS6 A;  1MPD A;  4IY5 A;  3MVZ A;  1MY4 A;  1SI1 A;  2YLN A;  1N84 A;  2QJE A;  3FVO A;  4PQJ A;  4H1X A;  3C4M A;  4K3F A;  1ZKB A;  5HPQ A;  2CZL A;  2ESN A;  4LZ8 A;  4JB7 A;  1B32 A;  1FTM A;  4GD5 A;  4O3A A;  3SKP A;  2D3I A;  1B9J A;  1QW0 A;  3KSJ A;  3CFL A;  4R2B A;  1MQD A;  1Y3Q A;  2ZYN A;  3H6U A;  5ICT A;  1VFD A;  4U1Z A;  1A99 A;  2Y84 A;  3FXU A;  4R6Y A;  1H44 A;  3OEM A;  1B0L A;  2ALU A;  3H3G A;  4TLL B;  5TPA B;  3TAJ A;  1QVS A;  4NF6 A;  4G8N A;  5I2K B;  3MVY A;  2ZXT A;  1IUD A;  4ECF A;  3MBP A;  5H8Q B;  4U21 A;  4OQO A;  1A55 A;  2V84 A;  1D9V A;  2I0C A;  2GHB A;  4R6K A;  3VXC A;  2UVI A;  2Y7W A;  4F2O A;  4OWD A;  3Q28 A;  4R9F A;  3KOS A;  3LC8 A;  5IAI A;  1IZ1 A;  5DEX A;  1M5B A;  1Q1K A;  2XXY A;  4AQ4 A;  1XVY A;  4TOZ A;  3ZSF A;  3R26 A;  2I3W A;  1PDA A;  2OZZ A;  4OEU A;  1N76 A;  3VXB A;  4F2Q A;  4QSD A;  1ELJ A;  5DYH A;  4EXL A;  4G68 B;  1OMP A;  4I62 A;  4P0G A;  4N07 A;  1MDQ A;  3S9M C;  2Z8E A;  2VOZ A;  3KN7 A;  4U22 A;  2UVH A;  5HM4 B;  2ONR A;  4EQ9 A;  2HAV A;  3PPO A;  2QS1 A;  4F29 A;  3N6U A;  1MQH A;  3GZG A;  1JVY A;  2B3F A;  3PUY E;  3T93 B;  1AMF A;  2F35 A;  4NE4 A;  1Y4C A;  1DPP A;  3U92 A;  1SYI A;  1J1N A;  3FXR A;  4I8C A;  5I57 B;  4RPO A;  1SW1 A;  1FTK A;  3KOT A;  5FHO A;  3TUS A;  1YAE A;  3JV9 A;  1ZIU A;  2QS2 A;  4F18 A;  3FVG A;  1FTO A;  4JWO A;  4HCY A;  4GXA A;  3O66 A;  1SBP A;  4Q30 B;  2BJJ X;  3FGS A;  2P1S A;  5K2Y A;  5CM6 A;  4RY1 A;  2X7Q A;  4RNS A;  1B3H A;  5EYF A;  2V3U A;  3PMV A;  3A3U A;  3IB2 A;  2PVU A;  1MH4 A;  4JWX A;  1Y20 A;  3C36 A;  2UXA A;  3CVG A;  3ILU B;  2O7I A;  4FE8 A;  1B5J A;  2IEE A;  4GXS B;  1O63 A;  4HS7 A;  5AA2 A;  2I3V A;  1B3E A;  2VD2 A;  3TTM A;  5I59 B;  2VGQ A;  2ZYO A;  4F1U A;  4IB2 A;  5J1D A;  2XXX A;  1QUJ A;  4ZEB A;  1HSJ A;  2DS9 A;  3K1N A;  3VFJ A;  4H6D A;  3FD3 A;  5EHM A;  1SW5 A;  3S2V A;  3QXM A;  1OLA A;  3H6W A;  4KYE A;  3RLF E;  3MPK A;  1OIB A;  4H67 A;  4LA9 A;  2DVC A;  2A5T A;  1II5 A;  2HFB A;  4NF4 B;  4X1B A;  3MVW A;  5AA1 A;  2O69 A;  3KJT A;  3UIF A;  4PFT A;  4GL0 A;  3VLV A;  3V83 A;  4G8H A;  1R6Z A;  3G3I A;  1UTB B;  3O29 A;  2OK2 A;  1Y4T A;  3S4U A;  3K2D A;  3PUW E;  1NNF A;  1S7Y A;  1M5C A;  3RY3 A;  4G4P A;  4ND9 A;  3MVX A;  3B6W A;  3KJ7 A;  3PUX E;  4BDR A;  4NF5 A;  4KI0 E;  1GV8 A;  1LB8 A;  4IGR A;  3RPW A;  1IXC A;  2NXO A;  3TZA A;  1LAH E;  3MPL A;  5CBS A;  4FEB A;  1MXV A;  3BBR A;  4MH5 A;  1VR5 A;  4H5G A;  4ELO A;  1A8E A;  1Y9U A;  3BKI B;  2DXY A;  4QFP A;  4XXU A;  4NF8 A;  4ISU A;  3IOT A;  1D4N A;  3BFT A;  1MH3 A;  4R2F A;  2QL3 A;  4NMY A;  3LSL A;  2M8C A;  2QS4 A;  1YPN A;  3O2A A;  1MY1 A;  2DE2 A;  4DXC A;  4OVJ A;  3TTL A;  3KZG A;  3F11 A;  2GH9 A;  2F7B A;  1B4H A;  3K0V A;  3VLU A;  3HST A;  4HW8 A;  3S9L C;  5DVF A;  4OFL A;  4X9T A;  3PD8 A;  2E0S A;  3OO6 A;  1MQJ A;  3N5L A;  4F1V A;  5TU0 A;  1JNF A;  3C31 A;  4PFU A;  1B4Z A;  4OYV A;  3DP4 A;  4X1D A;  3FXQ A;  3M8U A;  4YB6 A;  2O51 A;  1UTH B;  3IOV A;  3RQT A;  3B6T A;  2DWJ A;  4IO7 A;  5H8N B;  5KZT A;  3W9V A;  1QUL A;  1BIY A;  1EU8 A;  1A54 A;  3PMW A;  4MFI A;  3MP6 A;  2NWJ A;  1NFT A;  3IK6 B;  2R6G E;  2Y7K A;  3IOU A;  3SEY A;  1NL5 A;  1XS5 A;  2R9J A;  3SDF A;  3MAM A;  4ZZA A;  1WOD A;  3HHF A;  2FNC A;  3GBA A;  2Q2C A;  3A09 A;  2GFE A;  2X26 A;  4ZZE A;  1XT8 A;  5H8F B;  1MQI A;  4TLM B;  4RYA A;  4BDM A;  3U1O A;  4NTL A;  1FQA A;  4IO4 A;  1JET A;  5TPA A;  4OHN A;  5EHS A;  4QSC A;  3RT6 B;  4DDD A;  2Y7P A;  3O97 A;  1JEU A;  4YU0 A;  3QSL A;  2XX8 A;  1B51 A;  3G3J A;  1HSL A;  4UA8 A;  1PC3 A;  1MPB A;  2F7A A;  3TPA A;  3PUZ E;  4R72 A;  4F3P A;  4IO5 A;  1POY 1;  1XHY A;  2I58 A;  2H99 A;  1ZJL A;  4G77 A;  3ECR A;  1H76 A;  4N13 A;  4QFK A;  1RYO A;  3OOA A;  1FQB A;  2XXH A;  4KFQ A;  2XXR A;  1ZU0 A;  2RF1 A;  3FJ7 A;  2ZNS A;  5KDT B;  2RC9 A;  3EHU A;  3UGW A;  3TEP A;  4JSO A;  1RYX A;  4G68 A;  3SEU A;  2QSX A;  3VDF A;  5F1Q A;  2VD3 A;  4OXV A;  3SET A;  4E0W A;  1BTJ A;  2I4C A;  3TCG A;  2V93 A;  3OSR A;  2XX9 A;  4Q8R A;  2RKM A;  3N26 A;  4FOR A;  5A5X B;  5BUU A;  3KSX A;  2Z23 A;  1L5T A;  2F78 A;  3C9H A;  5I57 A;  1MM6 A;  5CMB A;  2PX1 A;  3ZKL A;  3H7M A;  1MG1 A;  2UVG A;  2H25 A;  1QUK A;  3IB1 A;  2R71 A;  1IXI A;  1KWH A;  4P11 A;  1ZBM A;  3K4U A;  2PBW A;  5KCJ B;  1PB7 A;  4FAJ A;  5I2N B;  3JYR A;  4YAH X;  1TWY A;  4GIZ A;  4H8I A;  1D3K A;  1BP5 A;  4DXB A;  3HN0 A;  1TT1 A;  5CMC A;  4IO6 A;  1QJM A;  4NED A;  1FW0 A;  4YB5 A;  1UIV A;  2HEU A;  4U23 A;  1R1N A;  1YCJ A;  1N7X A;  3OMB A;  4JXI A;  1DSN A;  4LQ2 A;  4O3B A;  4XKN A;  4FEC A;  3FAS A;  3EQ1 A;  4PFW A;  4Z0I A;  1DTZ A;  1LFH A;  3I5O A;  2ZNT A;  2Q8J A;  1N0T A;  2CMO A;  1YTV A;  1AIV A;  3CFZ A;  5ITO A;  3A3C A;  5DVI A;  4XKP A;  5H8H A;  3HPI A;  1LB9 A;  2A5S A;  3M3F A;  4ZE8 A;  3PPR A;  1JW1 A;  1P1O A;  1FCK A;  5FHM A;  1BLF A;  5ELV A;  1ZLQ A;  1QUI A;  4ZEK A;  4R6H A;  5AE4 A;  2GHA A;  4F3G A;  1UIU A;  4LQ5 A;  4MLQ A;  4MBP A;  2DWA A;  3PPP A;  3IOR A;  1AL3 A;  3T22 A;  4HCW A;  3CRB A;  5TP9 A;  1T0K A;  4G68 C;  5ISU A;  4JDF A;  3VVE A;  4IO3 A;  1A7L A;  4GL8 A;  1JEV A;  3MZ9 A;  1B1X A;  2I6E A;  3E9X A;  2UYF A;  4ESX A;  2UYE A;  3I3V A;  4RPN A;  4GF8 A;  1IIT A;  5IKB A;  3CIJ A;  1ZMG A;  1POT A;  3UK4 A;  2H5Y A;  1N3W A;  2HQ0 A;  3RGY A;  3TTK A;  5JTY A;  3FV2 A;  4ZEF A;  5I58 A;  2HZL A;  1B58 A;  2VP1 A;  3O28 A;  3SEV A;  1A8F A;  4H8J A;  2NUV A;  3FVN A;  4F3B A;  1SDX A;  1P1Q A;  1MS7 A;  1Y3N A;  4WEP A;  3HCQ A;  3B7D A;  4OFO A;  3B6Q A;  4YB7 A;  4U4S A;  3O6G A;  2Y7R A;  4NWD A;  1P1U A;  4ZDM A;  1IXG A;  4WED A;  5M2V A;  2QS3 A;  3OEL A;  1M5E A;  2XXI A;  4PP0 A;  4Q0C A;  1EZP A;  1MXX A;  3ILT B;  5AA4 B;  3ZKK A;  2NOO A;  3CSG A;  2F8D A;  2XXQ A;  3WAF A;  3TOD A;  4C0R A;  1B5H A;  4DLD A;  3L6G A;  4YKK A;  1LBC A;  4EDP A;  5I56 A;  2DWI A;  3T9X B;  1UTH A;  1F9B A;  2WKY A;  3OO9 A;  1B05 A;  3KBR A;  3K6W A;  2G93 A;  3PPN A;  4QRZ A;  2YPN A;  4QFO A;  3V89 B;  3KEI A;  3TTN A;  3TCH A;  3C35 A;  3UOR A;  4OER A;  4GVO A;  3G7W A;  1P1W A;  5DT6 A;  5B70 A;  4OES A;  5LOM A;  4U1O A;  4NWC A;  3TTR A;  1Q35 A;  3IL1 B;  1SW4 A;  4OTE A;  3S9E A;  4Z7E A;  1S50 A;  5H8F A;  1MPC A;  2OWS A;  3T66 A;  4KCC A;  3G3K A;  3K02 A;  1URD A;  1P99 A;  1B52 A;  1MXZ A;  4KYD A;  1SQY A;  2DYX A;  4IO2 A;  3EHS A;  4QF9 A;  3E13 X;  2UVJ A;  3QUJ A;  1HSE A;  3LSX A;  3MW0 A;  3I6V A;  5L9M A;  3GLB A;  3OO8 A;  1S9T A;  1LFI A;  1Y3P A;  2DXR A;  4KYS A;  4LP2 B;  4YMA A;  3OD7 A;  3Q27 A;  5HBC A;  1PBP A;  1ANF A;  1MQG A;  4RXL A;  5CC2 A;  3OSQ A;  3P7I A;  2XXU A;  2B3B A;  3FJM A;  3LSF B;  1FQE A;  1SYH A;  1PB8 A;  3IJO B;  3VVD A;  4OET A;  1B3G A;  1D9Y A;  4H5F A;  2AL5 A;  3IX1 A;  2GRV A;  4ZEI A;  5BWJ A;  4THI A;  5KDT A;  3FV1 A;  5L9O A;  1Y1M A;  4DE8 A;  4I9D A;  4FED A;  1FTJ A;  1CE2 A;  3C32 A;  3SES A;  1LGB C;  1OQG A;  1TFD A;  1IIW A;  1LCT A;  3MJN A;  4POW A;  2ABH A;  4M4G A;  4BDN A;  3IO4 A;  1A40 A;  3Q26 A;  2AL4 A;  2O68 A;  1GVC A;  3FZV A;  1LLS A;  3TQW A;  2V3Q A;  2DQV A;  4JSD A;  4WKM A;  1SW2 A;  4MLV A;  1SVX B;  1M5F A;  4EQB A;  3UP9 A;  3CG3 A;  4R75 A;  1VFE A;  4OEV A;  1ZTY A;  5I84 A;  2ONS A;  4TQU Q;  3IO6 A;  4IY6 A;  4ELP A;  2PYY A;  3PUV E;  4NF5 B;  2I49 A;  3LR1 A;  5I2K A;  2Z8D A;  1MXW A;  2OCU A;  5F7V A;  1SI0 A;  3SER A;  5KCJ A;  2ANJ A;  4KR5 A;  5I2N A;  1I6B A;  5H8Q A;  1UQW A;  2H9B A;  1USY H;  1XOC A;  4GOT A;  1OVT A;  1MY3 A;  2P2A A;  5CMK A;  3CFX A;  3VE1 B;  2XXW A;  2Q89 A;  5K2X A;  4U2R A;  3OEK A;  1B5I A;  4F19 A;  2DP8 A;  5H8S A;  1ATG A;  1XC1 A;  3K6V A;  1QKB A;  1PBQ A;  1DPE A;  4LZ5 A;  1URS A;  3R7X A;  3O6I A;  3DEL B;  3GXA A;  3V5A A;  2QPQ A;  2XX7 A;  4RK9 A;  3FJG A;  3N94 A;  1NH7 A;  2O84 X;  3TMG A;  1EZO A;  2RCA A;  1FQF A;  3C34 A;  3TEL A;  1TXF A;  3BFU A;  4L17 A;  2F6G A;  1IQ7 A;  3UN6 A;  4KD5 A;  3MZ1 A;  4EF1 A;  1LAF E;  4H0W A;  1EZ9 A;  2ZYM A;  3VLW A;  3MQ9 A;  3EF7 A;  4GFR A;  3TCF A;  1OVB A;  4YMB A;  2XHD A;  1LCF A;  2ZMB A;  4JWY A;  1XVX A;  4XKR A;  3W15 C;  4F31 B;  1CB6 A;  3K1P A;  1B7U A;  3CI8 A;  4FIM A;  4AB5 A;  3D4C A;  2NVU B;  4RJZ A;  1B40 A;  2Q9T A;  1DOT A;  5CBR A;  2OBG A;  1N04 A;  4YIC A;  2PMS A;  2REJ A;  1NH8 A;  4FAT A;  1FTL A;  1I69 A;  3MUQ A;  3SEX A;  1JW5 A;  3TYH A;  3O9P A;  2KLF A;  4BLA A;  1US4 A;  4ESW A;  3FUZ A;  2REG A;  2F97 A;  3RN8 A;  4BDL A;  4Q5T A;  5DVJ A;  1MXU A;  3TDJ A;  1B6H A;  1LAX A;  3S9N C;  4DZ1 A;  4YKP A;  3T9U A;  2VHA A;  5I59 A;  1O64 A;  1B7H A;  2XD3 A;  3M3L A;  4AB6 A;  2F5X A;  3DP6 A;  2E1S A;  4LON B;  3KFM A;  3KN3 A;  2B65 A;  4ZED A;  3EPE A;  1NMU A;  3QUF A;  1US5 A;  1O7T A;  2PT2 A;  4F1Y A;  4PET A;  3PV0 E;  3O6H A;  4YZZ A;  2DOJ A;  4LAT A;  3T9H B;  4RK2 A;  1I6Q A;  3QAX A;  5FTH A;  1Z7N E;  3KN8 A;  2I0B A;  5AA4 A;  4POX A;  5CI5 A;  3MP8 A;  4NF4 A;  1AOV A;  3RT8 A;  5B7D A;  2G29 A;  1R9Q A;  2OLB A;  2O1L A;  3RNN A;  5AA2 D;  3GBB A;  3U94 A;  1DMB A;  1MXY A;  2F34 A;  1UTB A;  2X7P A;  5ITP A;  1LST A;  1H45 A;  2FA7 A;  3SEW A;  1VE4 A;  2ZYK A;  4GQO A;  2H4I A;  3T96 B;  1N3X A;  4GWO A;  4G2Z A;  3TFL A;  3TKD A;  4HTG A;  1P1N A;  3K6U A;  4NF6 B;  4EUO A;  1B1H A;  4XKQ A;  1B3F A;  2RIN A;  1QKA A;  3USD A;  1B7Z A;  3QYT A;  1Y1Z A;  1MRP A;  2RC8 A;  4QFL A;  3U72 A;  5JEI A;  3LSW A;  4FJP A;  2PT1 A;  3CG1 A;  3PPQ A;  1RKM A;  2YJP A;  2Q2A A;  2XXV A;  4LVQ A;  3PGF A;  5DEX B;  1MM7 A;  1LAG E;  4GLI A;  1BKA A;  1SD3 A;  3IB0 A;  3K01 A;  1MY2 A;  3IR1 A;  3PU5 A;  2DWH A;  3T9V A;  1TFA A;  2XD2 A;  4F39 A;  2DVZ A;  2Z8F A;  5CRY A;  1MDP 1;  3UA8 A;  3PMX A;  3G3H A;  4XTC Q;  4DCY A;  4YKI A;  1H43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...