5JK4A

Phosphate-binding protein from stenotrophomonas maltophilia.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
373
structure length
373
Chain Sequence
ETAVTGGGASLPADLYKGSADSILPANFSYAVTGSGTGKKAFLENNSALFSTTGTVHFAGSDSVLSSTELNTYNSTYNVSGDANRYGALVQIPSVATSVTIPFNKAGSAVDLSVTQICGIFSGKINNWSQLAGLGRTGAIQVVYRGESSGTSELLTRFLTSACQPADVSGTNLKLANGVPAFSVQSTFANLFTTVPSNFVAAPATGGSALYNAVYAVDGRVGYVGPDVIPSLTDATKVAKVKSFSPDEVSVQATLETAAPPTGAAAENPANWVPVFGNPSAGYPIAGYTNFVFGQCYKNATVGANVRGFLTRHYGSTVVNGVEQGPNDDAIRAHKFIPLTKAWRDAVRARFATATNAGAVNNPSTCSGIGRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Alkaline phosphatase
publication title The 1.1 angstrom resolution structure of a periplasmic phosphate-binding protein from Stenotrophomonas maltophilia: a crystallization contaminant identified by molecular replacement using the entire Protein Data Bank.
pubmed doi rcsb
total genus 116
structure length 373
sequence length 373
ec nomenclature ec 3.1.3.1: Alkaline phosphatase.
pdb deposition date 2016-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5jk4A02
3.40.190.260 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5jk4A01
3BBRA 4E0WA 4ZE9A 2I58A 2I3VA 1SYHA 1FW0A 1J1NA 2QL3A 2AIXA 2I48A 1FQCA 3IK6B 1AIVA 4IO7A 1B5JA 3RUMA 2PYYA 4F31B 4G68B 2CZLA 1JEUA 2NVUB 1T0KA 3MP1A 4Z0IA 2XXYA 2AYSA 5I59A 1IXCA 4QSDA 4F3PA 3L6HA 4U21A 4N13A 1NMUA 2OWSA 1B7UA 3VVDA 1BIYA 4HW8A 1DTZA 1MXYA 2F34A 4FORA 2O51A 2DXYA 3FJ7A 1M5DA 5FHMA 1URDA 4F39A 3VXBA 1P1UA 2NWJA 2ZNSA 5ISUA 2F36A 1JW5A 3KGCA 3EHUA 1VR5A 5CI5A 4NF4B 4FE8A 1SW2A 4X9TA 4ZEDA 4YMBA 5TU0A 4LUBA 3TTKA 3OD7A 1H43A 5CMKA 3S9EA 3IOUA 4BDRA 4KI0E 3IX1A 4MF3A 4IO5A 3FIRA 3EHSA 1NNKA 5F7VA 2V93A 5AA2D 1DMBA 3M3KA 2R71A 5IKBA 1OVBA 2AL4A 1M5FA 4R6HA 1GVCA 4TQUQ 3PUZE 4ND9A 1D9VA 1A55A 1MG1A 2I6EA 3MVWA 4OQOA 1HSLA 4WXJA 1B58A 4GD5A 3A09A 4IO2A 1LSTA 1LGBC 3FGSA 4HCWA 3FZVA 4R2FA 5I59B 1Y4TA 1P1WA 2ZYNA 3TMGA 4ZZEA 1USYE 3TPAA 4HCYA 4LVQA 3MP6A 5DYHA 4DXCA 3PMWA 1XVXA 3FV1A 4JWOA 4P11A 2I0BA 3O2AA 5H8HA 3DP8A 4OZ9A 3FJGA 2O7UA 4MH5A 3UP9A 1JNFA 1FTJA 3ZSFA 2V3TA 2OK2A 5AA2A 1MY3A 4IO3A 2P2AA 4OEUA 4R9FA 3Q28A 2VP1A 1SW5A 1OLAA 3HV1A 4KR5A 1NNTA 3FV2A 3RT6B 2HXWA 3O28A 4QFNA 4ZZAA 2P0SA 2PVUA 3IORA 3MZBA 4GXSB 3R6UA 4NF6A 4OFJA 2A5SA 3MZ1A 4F22A 4EDPA 2DP8A 4BDQA 1R1NA 2I0CA 3KN8A 1QUJA 1SDXA 2OWTA 1H76A 2DVCA 4G8MA 4LZ5A 5I58A 4EXLA 1JVYA 4GXAA 3PPOA 3UK4A 1FQAA 4M1VA 3IR1A 4GOTA 4ISUA 5AA3A 3KBRA 3M8UA 3P7IA 4GQOA 1PEBA 4PFYA 3O66A 1B5HA 3H06B 4U1OA 4R72A 4H8JA 5DVIA 1IQ7A 1Q35A 4AB5A 5H8HB 2QPQA 2YJPA 3C31A 3VXCA 4ELOA 3CG3A 1MM6A 1MQGA 4IGRA 3PPNA 3Q29A 1P99A 4P0IA 4RYAA 1NH7A 2IA4A 5M2VA 4U23A 3GZGA 3W15C 4EQ9A 3KN7A 1LCTA 4ZEFA 2BJJX 2VGQA 4I9DA 4YB7A 1EZ9A 4N07A 1SI1A 5KZTA 2ALUA 1M5CA 2FYIA 3S2VA 1QKAA 5CC2A 1WODA 3UN6A 1B1XA 3TTLA 1D3KA 4EXKA 1MXVA 2H5YA 2O7IA 3SEXA 2DYXA 4HTGA 1EH3A 4F19A 4YICA 3MQ9A 1XVYA 1TFAA 4X1BA 4MFIA 1LAGE 3IO4A 2X7QA 3N94A 3KSJA 1MM7A 3MC2A 2Y7KA 1XOCA 4G8HA 2Z8FA 2XXPA 5AE4A 3H6VA 5L9SA 1URGA 4KD5A 3K6WA 2XXRA 5KCJB 1PBPA 1MY1A 1YAEA 1N7WA 3THIA 1I6QA 3TYHA 2ANJA 4JB7A 3USDA 3I3VA 1NNFA 4U1ZA 4KHZE 4QRZA 4R75A 4E0XA 2DQVA 2F7AA 1D4NA 4G68A 4WKMA 3TTNA 1B7HA 3MZ9A 3QXMA 3C32A 2QS1A 3G3KA 3GLBA 3O9PA 4GIZA 2QMWA 3RQTA 3H6TA 5ITPA 4O3CA 1PB9A 1N0TA 3UGWA 3PMVA 3TODA 1D9YA 2H99A 1B4ZA 1B46A 1B2HA 3TQLA 2H9BA 4Q8RA 4C0RA 1RYXA 2LAOA 4AQ4A 4KYEA 3EN3A 3DM0A 1NFTA 2VD2A 2QSXA 4RPNA 4POXA 2R6GE 4X48A 1YPNA 3KZGA 4F3SA 4DCXA 3IOVA 3C33A 3E13X 3T9XB 5TPAA 5JK4A 1FQEA 1DPPA 5CBRA 2ZYKA 5L8DA 4DXBA 4EQBA 1GGGA 2HAVA 1CB6A 4IO6A 1Y1MA 1UQWA 3PUVE 4YB5A 1Y3PA 4DXUA 1LLSA 4BDLA 4F2QA 1B52A 1B1HA 2G93A 3RY3A 1IUDA 5DTBA 4RPOA 3EPEA 3H03A 3OMBA 1HSEA 3MVXA 1UTHA 3HO7A 4F2OA 1MY0A 4POWA 4THIA 1AMFA 1SW4A 3JV9A 3OO7A 2O1LA 3G3FA 3O6IA 1LFGA 5TP9A 3VE1B 4PETA 2ONSA 1B3FA 1GR2A 3PGFA 3KFMA 3BFTA 4WEPA 3UIFA 1BP5A 4DIGA 3VLVA 4XKPA 2F6PA 1I69A 4I8CA 3K6XA 2F6GA 1Y3QA 3SEWA 3PU5A 1OLCA 3OENA 4ZDMA 5K2YA 1B3GA 3KEIA 4LQ5A 5CMBA 2OBGA 1EZPA 3MP8A 1QJMA 3MPKA 3VVEA 2W7YA 3KJTA 2D3IA 4Q5TA 1BKAA 4LZ8A 1MXWA 1OMPA 3FVGA 2B3FA 1ZIUA 3LSFB 2DWJA 2Q88A 3EHTA 4OHNA 1MPCA 3FD3A 2PX1A 1MXUA 1EU8A 3S4UA 3KG2A 1I6BA 2V3QA 2VOZA 3MJNA 5TPAB 2ZNUA 4MLQA 3CI8A 4K3FA 4NWCA 1IEJA 2XX9A 5ICQA 1RYOA 3U94A 5I56A 3K00A 1ZLQA 5FHOA 5I84A 4JSDA 4F1VA 3G3GA 2HZKA 1MY4A 5H8NB 2DE2A 3BKIB 4XTCQ 3IB0A 4OYVA 4UACA 2O84X 1UTHB 2R9JA 2RC9A 2DVZA 4EF2A 3SDFA 3S9NC 3ONMA 1UIUA 5TP9B 5ICTA 1N04A 5LOMA 3CSGA 4XKRA 4R9GA 3HSTA 4DCYA 1TFDA 5KDTA 3M3LA 5DVFA 1FTMA 3CFLA 2ZXTA 1ATGA 3T22A 3MW0A 4O3AA 2V3UA 3K1NA 1FCKA 2HCAA 4IY5A 1S9TA 2CMOA 3CFZA 3C36A 5CMCA 3IOWA 3B6QA 1MXZA 2AL5A 4YZZA 4HS7A 3FATA 1H45A 1ZBMA 4H65A 1MDQA 5I2KA 2XXHA 1NL5A 4NF8A 2D21A 1FTOA 2E0SA 3AXFA 1PBQA 2ONRA 1B40A 1JQFA 4Z7EA 5I56B 2XHDA 5BWJA 3H6UA 4OESA 3TDJA 1XT8A 5CRYA 3H4ZA 2XXUA 5CM6A 2Y7RA 3SKPA 1WDNA 3K6UA 1N76A 4UA8A 2B65A 4XKQA 4LA9A 2B3BA 3D4CA 4QSCA 4KCDA 2UVHA 5IAIA 2Q8JA 1EZOA 2KLFA 3E9XA 2V84A 5DEXA 5L9OA 1LB8A 2XXIA 5DT6A 3TELA 4RJZA 2Q2CA 3TEPA 4PQJA 1SQYA 5KDTB 1MRPA 1GTKA 1MH4A 4NWDA 3FJMA 2E1SA 5HPQA 1XC1A 3GBBA 4IB2A 2F7CA 2Y7WA 2HFBA 3U93A 2XXVA 3C4MA 4R73A 5KCJA 1LFHA 4H67A 1SBPA 2ZYMA 3HN0A 1P1OA 3SEUA 2HZLA 4GRKA 3OEKA 1FTLA 3OELA 4TOZA 5BUUA 1ELJA 3T93B 4BDOA 4U2RA 4OETA 2OZZA 4IO4A 4G77A 5I2KB 3HHFA 4QF9A 4F3BA 4I62A 3E4RA 3SETA 4KFQA 4NF8B 4FEBA 1R6ZA 2QMXA 3K4UA 3VFJA 1ZKBA 3K2DA 2Y84A 3C9HA 3OXNA 3B7DA 4LQ2A 4GVOA 5I2NA 2HQ0A 1CE2A 1UTBB 1IXIA 1A54A 1Y1ZA 4QFLA 1ZU0A 3RTFB 4IY6A 2REGA 4JSOA 3N6TA 4DE8A 1A8EA 4C1TA 1B32A 1Q1KA 3KN3A 4ZEIA 4GFRA 3TCGA 2XXTA 4QHQA 1MPDA 1LAXA 3N26A 4KCCA 5DEXB 4QSEA 2GHAA 4KYSA 1UIVA 3IB1A 1FQBA 3BFUA 3ODBA 1DPEA 3KSXA 1H3DA 3O29A 5B7DA 1B7ZA 3I5OA 1PDAA 1MQHA 5EYFA 4LONB 2ZMBA 3H3GA 3SERA 1IIWA 4I1DA 5F1QA 2OJTA 3T9HB 5CBSA 3TFLA 4KPTA 3VLWA 1YTVA 2XX8A 4PFUA 3PV0E 1DSNA 4GL8A 3OO6A 1DOTA 3GBAA 3ZS6A 3IO6A 4AB6A 4PFWA 2GHBA 3IL1B 2V25A 4RK2A 1M5EA 2O69A 3U72A 2DXRA 3MUQA 4G8NA 3CFXA 4XXUA 1LBCA 5AA4B 2Q9TA 3E3KA 1B3EA 2FA7A 2DWAA 2PBWA 1N3XA 2A5TA 2O68A 3IJXB 2F35A 2H25A 4ZECA 4EF1A 1YCJA 1A7LA 2YPNA 3W9WA 1GV8A 3QUJA 3OO8A 2OCUA 4RXLA 5I2NB 1ZJLA 2DS9A 4DZ1A 3K1MA 3KOTA 3IB2A 4YB6A 1XS5A 3I6VA 2UXAA 1B9JA 4ZEBA 2QS3A 3FVKA 1TT1A 4F1YA 1A8FA 4ESWA 4KYDA 3LSWA 1B6HA 3C35A 4H1XA 1II5A 3PUYE 4ZE8A 4ELPA 4G2ZA 3PPQA 1WVJA 5L9MA 4FATA 4OVJA 5I57B 1L5TA 4JBZA 3PUXE 3PD8A 3KJ7A 1O63A 4R6YA 3ECRA 4RY1A 3Q25A 5JEIA 3ZKLA 5CMMA 1B3HA 1S50A 1LAHE 3G3IA 4FIMA 1KWHA 5H8NA 4Q30B 3DELB 1USYH 2UYFA 1SVXB 2WKYA 1LAFE 2GRVA 2XXWA 3OEMA 3D4GA 1QUKA 2UVIA 3EQ1A 2A5TB 1VFDA 1R9QA 3HCQA 3N5LA 4YU0A 1AOVA 3DLNA 3T9UA 4DDDA 3LSXA 4RNSA 3IJOB 2Z8EA 3OSQA 3V89B 4WEDA 3UORA 1JETA 1QKBA 3K1PA 1IXHA 4TLLB 1Z7NE 2I49A 2RC8A 3CIJA 3CR9A 3U1OA 4U4XA 4XIGQ 1LCFA 4H0WA 2THIA 4QFKA 3G7WA 1MQJA 1B05A 2DWIA 2Z8DA 3JZJA 2XD2A 3TCFA 4ESXA 2O6AA 4H6DA 5B70A 1MDP1 1MQDA 3PD9A 4C1UA 3TCHA 1B4HA 3U92A 4GWOA 3WAFA 2HAUA 2F8DA 3VDFA 3FVOA 1N7XA 1A99A 2I4BA 3OSRA 1SW1A 3TTMA 1R9LA 5H8SA 2DE3A 2PMSA 4O3BA 3A3UA 4NF5A 3OOAA 4GLIA 4F1UA 4ELQA 3PUWE 3Q26A 2F97A 3TKDA 2F5XA 3QYTA 3UA8A 3FVNA 4PFTA 2QRYA 1POTA 3DP6A 4H8IA 3PPRA 4NE4A 4GF8A 2XD3A 3QIMA 2NUVA 3TAJA 3LR1A 3GXAA 3M3FA 1VE4A 3O6GA 3RGYA 4Q0CA 2G29A 4OFLA 4YKKA 1JW1A 4H5FA 3C34A 4FAJA 1IZ1A 3FXQA 3HPIA 5EHMA 1POY1 3S9LC 3CRBA 3V5AA 4X1DA 3SEYA 4EUOA 3FXRA 1B3LA 2FNCA 4RK9A 1IXGA 4R2BA 4NEDA 3MVZA 1MH3A 3SEVA 1BTJA 3O97A 3H7MA 2ESNA 3RT8A 2XXXA 1NKXA 4JXIA 1SYIA 5H8FA 2REJA 3LUYA 2QS4A 1MS7A 1A40A 3CG1A 2Y7IA 1MPBA 2UVGA 2IEEA 3SESA 5AA1A 3QK6A 1S7YA 3ILUB 3QSLA 1QUIA 1DTGA 2UVJA 3QUFA 2F78A 5H8QA 1Y9UA 5A5XA 1UTBA 4JDFA 4OEVA 1Y3NA 1OQGA 1MXXA 4XKNA 2VD3A 5FHNA 4G4PA 1FQFA 4NF5B 3W9VA 1HSJA 1OVTA 2X7PA 3VLUA 4LZ7A 1Z7ME 3MWBA 4OTEA 2Z22A 1LB9A 4U4SA 4EQ7A 1QW0A 4BDNA 1ZTYA 1BLFA 4ONYA 1PC3A 1OQHA 2DWHA 4YAHX 2OLBA 4U22A 4N6PA 4OFOA 4H5GA 1B51A 4NTLA 3B6TA 3TZAA 3V83A 3F11A 4G68C 5FTHA 1VSOA 2UYEA 2XX7A 4MBPA 3RNNA 4YMAA 1FTKA 1O64A 1TWYA 3A3CA 4M4GA 2PT1A 1US5A 2HEUA 1VFEA 3K01A 3PPPA 4JWYA 3K0VA 3LC8A 4TLMB 1AL3A 2Y7PA 1O7TA 4DLDA 4OENA 2RINA 1ZMGA 3EF7A 5ELVA 4ELRA 5AA4A 2GH9A 1F9BA 3MVYA 5H8FB 4BLAA 5J1DA 4NMYA 5AA2B 1P1QA 3JYRA 5FTIA 3ZKKA 2NOOA 3RLFE 3T66A 3R7XA 1B0LA 3LSLA 5H8QB 5ITOA 5A5XB 3OO9A 2QJEA 2GFEA 5K2XA 3T96B 3LBSA 1Y4CA 2RCBA 2Z23A 4BDMA 1QULA 4FEDA 4NF6B 3TTRA 4R74A 4ZS9A 3FUZA 4KQPA 1P1NA 5JTYA 1NH8A 1M5BA 1PB7A 1PB8A 1ANFA 3WAEA 3L6GA 1LFIA 1URSA 3O6HA 2QS2A 1SI0A 1JVXA 4JWXA 1TXFA 3VV5A 2PT2A 1B0HA 3B6WA 4OERA 4OWDA 5I57A 1QVSA 4IGTA 5I58B 4F29A 1FQDA 1I6AA 4R6KA 4LP2B 1RKMA 2DSFA 2X26A 4P0GA 4RA1A 2RC7A 3TQWA 2RCAA 1SD3A 3RTWB 1N3WA 4OMBA 3T9VA 4ECFA 2VHAA 3IAZA 5EHSA 2XXQA 4GL0A 1MQIA 1Y20A 2YLNA 5HBCA 4QFPA 4OXVA 2DE4A 1OIBA 1US4A 2NXOA 1N84A 2O1MA 2I4CA 2Q89A 3V8XB 1JW4A 1H44A 3CVGA 1XHYA 3RPWA 3H6WA 2ZNTA 2P1SA 3K02A 2ONKE 2ZYOA 3FXUA 3N6UA 2DOJA 3Q27A 4FJPA 3G3HA 3HHGA 3G3JA 3CSBA 1NNPA 4ZEKA 3PMXA 4MLVA 4FECA 5JTYB 4LATA 3MBPA 2ABHA 3MPLA 3RN8A 2D5WA 4YKIA 4QFOA 3K6VA 3TUSA 4PP0A 3FASA 4L17A 4YKPA 2I3WA 1B5IA 2RKMA 2Q2AA 1MY2A 3KOSA 3ILTB 2H98A 3U8QA 2M8CA 1IITA 1LBBA 3R26A 3DP4A 3QAXA 4YKJA 3VVFA 3IOTA 1AH5A 4F18A 4NF4A 3S9MC 1JEVA 2F7BA 2H4IA 3MAMA 4F3GA 4PE5B 5HM4B 5DVJA 2RF1A
chains in the Genus database with same CATH superfamily
3BBRA 4E0WA 4ZE9A 1LBVA 2I58A 2I3VA 1SYHA 1FW0A 1J1NA 2KQZA 2QL3A 2AIXA 2I48A 1FQCA 3IK6B 1AIVA 4IO7A 1B5JA 3RUMA 2PYYA 4F31B 4G68B 2CZLA 4MHFA 4PGNA 1JEUA 5EYGA 2NVUB 1T0KA 3MP1A 4Z0IA 2XXYA 2AYSA 2PFZA 5I59A 1IXCA 4QSDA 4F3PA 1LBXA 3L6HA 2XWKA 4U21A 4N13A 1NMUA 2OWSA 1B7UA 3VVDA 2GQ1A 1BIYA 4HW8A 1DTZA 4NQ8A 1MXYA 2F34A 4FORA 2O51A 2DXYA 3FJ7A 1M5DA 5FHMA 1URDA 4F39A 3VXBA 1P1UA 2CZKA 4N81A 2ZNSA 2NWJA 5ISUA 4MAGA 2F36A 1JW5A 3KGCA 3EHUA 1VR5A 4PGPA 5CI5A 2FIEA 4NF4B 4FE8A 1SW2A 4X9TA 4ZEDA 4YMBA 5TU0A 4LUBA 3TTKA 3OD7A 1H43A 5CMKA 3S9EA 3IOUA 4BDRA 4KI0E 3IX1A 4MF3A 4IO5A 3EKIA 3FIRA 3EHSA 1SPIA 1NNKA 5F7VA 2V93A 5AA2D 1DMBA 3M3KA 2R71A 1NV3A 1OVBA 2AL4A 5IKBA 1M5FA 4R6HA 1GVCA 4TQUQ 3PUZE 4ND9A 1D9VA 1A55A 1MG1A 2I6EA 3MVWA 4OQOA 1HSLA 4WXJA 1B58A 4GD5A 3A09A 4IO2A 1LSTA 1LGBC 3FGSA 4HCWA 3FZVA 4R2FA 5I59B 4HE2A 1Y4TA 1P1WA 2ZYNA 5LDZA 3TMGA 4ZZEA 5ET5A 1VDWA 1USYE 3TPAA 2F3BA 4HCYA 4LVQA 3MP6A 5DYHA 4DXCA 4PFIA 3PMWA 1XVXA 4MNIA 3FV1A 4JWOA 4P11A 2I0BA 3O2AA 4PCDA 2PFYA 5H8HA 3DP8A 4OZ9A 3FJGA 2O7UA 4MH5A 3UP9A 1JNFA 1FTJA 3ZSFA 2V3TA 3BIHA 5ET7A 1FPFA 2OK2A 5AA2A 1MY3A 4X04A 4IO3A 2P2AA 4OEUA 4R9FA 3Q28A 2VP1A 1D9QA 1SW5A 1OLAA 4KR5A 2OX3A 3HV1A 1NNTA 3FV2A 3RT6B 2HXWA 2WX9A 3O28A 4QFNA 4ZZAA 2P0SA 2PVUA 2CEXA 3IORA 4PDHA 3MZBA 4GXSB 3R6UA 4NF6A 4OFJA 2A5SA 3MZ1A 3ISPA 4F22A 4EDPA 2DP8A 4BDQA 1R1NA 4O7MA 1CNQA 2CZIA 2I0CA 3KN8A 1QUJA 1SDXA 2OWTA 1H76A 2DVCA 4G8MA 4UABA 4LZ5A 5I58A 4EXLA 1JVYA 4GXAA 3PPOA 4NG7A 4PE3A 3UK4A 1FQAA 5ET6A 4M1VA 4MJOA 3IR1A 4GOTA 4P3LA 4ISUA 5AA3A 5ET8A 3KBRA 3M8UA 3P7IA 4GQOA 1PEBA 4PFYA 3O66A 2Y5LA 1B5HA 1QGXA 3H06B 4U1OA 4R72A 4H8JA 5DVIA 1IQ7A 1Q35A 4AB5A 5H8HB 2QPQA 2YJPA 3C31A 1FPIA 3VXCA 4ELOA 3CG3A 1RDXA 1MM6A 1MQGA 4IGRA 3PPNA 1NI9A 3ROJA 3Q29A 1P99A 4P0IA 4RYAA 1NH7A 2IA4A 5M2VA 4U23A 3GZGA 3W15C 4EQ9A 4LN5A 3KN7A 1LCTA 4ZEFA 4N6DA 2BJJX 3FXBA 2VGQA 4N91A 1NV7A 4I9DA 1EYKA 4YB7A 1EZ9A 4MIJA 4N07A 4AS5A 1SI1A 1DCUA 5KZTA 2ALUA 1M5CA 2FYIA 3S2VA 1QKAA 5CC2A 1WODA 3UN6A 1B1XA 3TTLA 1D3KA 4EXKA 1MXVA 2VPOA 2H5YA 2O7IA 3SEXA 2DYXA 4HTGA 1EH3A 4PF8A 4F19A 4YICA 4IR8A 3MQ9A 1XVYA 1TFAA 4JVDA 4X1BA 1NV2A 5EQ8A 4MFIA 1LAGE 2PCRA 3IO4A 1FJ6A 2X7QA 3N94A 1FBPA 3RPLA 3KSJA 1MM7A 1BK4A 2Y7KA 3MC2A 1XOCA 4G8HA 1EYJA 1IMFA 1G0IA 2Z8FA 2XXPA 5AE4A 3H6VA 5L9SA 1URGA 1IMBA 4KD5A 3K6WA 2XXRA 4GWYA 5KCJB 3LV0A 1PBPA 1MY1A 1YAEA 1N7WA 3THIA 1I6QA 3TYHA 2ANJA 4JB7A 3SZPA 3USDA 3I3VA 4O8MA 1NNFA 4U1ZA 4KHZE 4QRZA 4R75A 4E0XA 2DQVA 2XWIA 2F7AA 1D4NA 4G68A 4PC9A 4WKMA 3TTNA 1B7HA 5ESYA 4NAPA 3MZ9A 3QXMA 3C32A 2QS1A 3G3KA 3GLBA 3O9PA 4GIZA 4H45A 2QMWA 3RQTA 4AS4A 3MYUA 2L5VA 3H6TA 5ITPA 4O3CA 4G61A 1PB9A 1N0TA 3UGWA 3GYYA 3PMVA 3TODA 1D9YA 2H99A 1NV5A 1B4ZA 3E79A 1B46A 1B2HA 1KZ8A 3TQLA 2H9BA 1LBZA 3NOHA 1G0HA 4Q8RA 4C0RA 1RYXA 2LAOA 4AQ4A 4KYEA 3EN3A 4N4UA 3DM0A 4HXVA 1NFTA 2VD2A 2QSXA 4RPNA 4POXA 2R6GE 4X48A 1YPNA 4P8BA 3KZGA 4F3SA 3KBZA 4DCXA 3IOVA 3C33A 4GBVA 3E13X 3T9XB 5TPAA 5F24A 5JK4A 1FQEA 1DPPA 5CBRA 2ZYKA 5L8DA 4DXBA 4EQBA 1GGGA 2HAVA 1CB6A 4IO6A 1Y1MA 1UQWA 3PUVE 4YB5A 1Y3PA 4DXUA 1LLSA 4BDLA 4H46A 4F2QA 1B52A 4OVSA 1B1HA 2G93A 3RY3A 1IUDA 5DTBA 4RPOA 3EPEA 3H03A 3OMBA 1HSEA 3MVXA 1UTHA 4N8YA 3HO7A 4F2OA 1MY0A 4POWA 4THIA 1AMFA 1SW4A 4I3YA 3JV9A 3OO7A 2O1LA 3G3FA 3O6IA 1LFGA 5TP9A 3VE1B 4PETA 2ONSA 1B3FA 1GR2A 3PGFA 3KFMA 5IZ3A 3BFTA 4WEPA 3UIFA 1BP5A 2V4CA 4DIGA 3VLVA 4XKPA 4NGUA 2F6PA 1I69A 4I8CA 3K6XA 4FBPA 2F6GA 1Y3QA 3SEWA 3PU5A 1OLCA 3OENA 4ZDMA 5K2YA 1INPA 1B3GA 3KEIA 4LQ5A 5CMBA 2OBGA 1EZPA 3MP8A 1QJMA 3MPKA 4MX6A 3VVEA 2W7YA 3KJTA 4GWUA 2D3IA 4Q5TA 1BKAA 4LZ8A 1FJ9A 1MXWA 4QXDA 1OMPA 3FVGA 4NF0A 2B3FA 1ZIUA 3LSFB 2DWJA 2Q88A 3EHTA 4OHNA 1MPCA 3FD3A 1IMEA 2PX1A 1MXUA 1EU8A 3S4UA 3KG2A 1K9YA 1I6BA 2V3QA 2VOZA 3MJNA 5TPAB 2ZNUA 4MLQA 3CI8A 4K3FA 4NWCA 2MKZA 1IEJA 2XX9A 5ICQA 1RYOA 3U94A 4PBHA 5I56A 3K00A 1ZLQA 5FHOA 5I84A 2WYPA 4JSDA 4F1VA 3G3GA 2HZKA 1MY4A 5H8NB 2DE2A 3BKIB 2XXKA 4XTCQ 3IB0A 4UACA 4OYVA 2O84X 3T0JA 1UTHB 2R9JA 2RC9A 2DVZA 4EF2A 3SDFA 3S9NC 4DI3D 3ONMA 4P1EA 1UIUA 5TP9B 5ICTA 1N04A 4PAKA 5LOMA 4NX1A 3B8BA 3CSGA 4XKRA 4R9GA 3HSTA 4DCYA 1TFDA 2HHMA 5KDTA 3M3LA 5DVFA 1FBEA 1FTMA 5IZ3B 3CFLA 2ZXTA 1ATGA 2FHYA 5LTCA 2Y5KA 3T22A 3MW0A 4O3AA 2V3UA 3K1NA 1FCKA 2HCAA 4IY5A 1S9TA 4MEVA 2CMOA 3CFZA 1K9ZA 3C36A 1FPDA 1JP4A 5CMCA 3IOWA 3B6QA 1MXZA 2AL5A 4YZZA 4HS7A 3FATA 3BIGA 1H45A 1ZBMA 4H65A 1MDQA 2CEYA 1EYIA 5I2KA 2XXHA 3IFCA 4PDDA 1NL5A 1FRPA 4NF8A 2D21A 1FTOA 2E0SA 3AXFA 4XF5A 1PBQA 2ONRA 2QVUA 1B40A 5EQ9A 1JQFA 4Z7EA 5I56B 4PF6A 2XHDA 5BWJA 3LUZA 3H6UA 2ZZWA 1NV4A 4OESA 2WEFA 3TDJA 2XA5A 1XT8A 5CRYA 3H4ZA 2XXUA 3HFUA 5CM6A 2Y7RA 3SKPA 1WDNA 3K6UA 1N76A 4UA8A 4XFEA 2B65A 4XKQA 4LA9A 2B3BA 3D4CA 4QSCA 4KCDA 2UVHA 5IAIA 2Q8JA 1EZOA 1FBGA 4GX4A 2KLFA 3E9XA 2V84A 3FBPA 5DEXA 5L9OA 1LB8A 2XXIA 5DT6A 3TELA 3E78A 4RJZA 2Q2CA 3TEPA 4PQJA 1SQYA 5KDTB 1MRPA 1GTKA 1MH4A 4N6KA 4NWDA 3FJMA 2E1SA 5HPQA 1XC1A 3GBBA 4IB2A 2F7CA 2Y7WA 2HFBA 3U93A 5DW8A 2XXVA 3C4MA 4R73A 5KCJA 1LFHA 4H67A 1SBPA 2ZYMA 4HE0A 3HN0A 1Q9DA 1P1OA 3SEUA 2HZLA 4GRKA 3OEKA 1FTLA 3OELA 4TOZA 5BUUA 1ELJA 3T93B 4BDOA 2FIXA 4U2RA 4OETA 2OZZA 4IO4A 4G77A 5I2KB 3HHFA 4QF9A 4MNPA 4F3BA 4I62A 3E4RA 3SETA 4KFQA 4NF8B 4FEBA 1R6ZA 2QMXA 3K4UA 3VFJA 1ZKBA 3K2DA 2Y84A 4PTKA 3C9HA 3OXNA 3B7DA 4LQ2A 4GVOA 5I2NA 1FPBA 2HQ0A 1CE2A 1UTBB 1IXIA 4OVRA 1A54A 1Y1ZA 4QFLA 1ZU0A 3RTFB 4PFRA 4IY6A 2REGA 4JSOA 3N6TA 4DE8A 1A8EA 4OVPA 4C1TA 1B32A 4GWWA 1Q1KA 3KN3A 4ZEIA 4GFRA 4X8RA 3TCGA 2XXTA 4QHQA 1MPDA 1LAXA 3N26A 4KCCA 5DEXB 4QSEA 2GHAA 4KYSA 2Q8MA 1UIVA 3IB1A 1FQBA 3BFUA 3ODBA 1DPEA 3KSXA 1YZ0A 1H3DA 4NHBA 3O29A 5B7DA 1B7ZA 3I5OA 1PDAA 1MQHA 2FBPA 2R8TA 5EYFA 4LONB 4O7IA 2ZMBA 2Q74A 3H3GA 3SERA 1IIWA 4I1DA 5F1QA 2OJTA 3T9HB 5CBSA 3TFLA 4KPTA 1DBZA 2ZZXA 3VLWA 1YTVA 2WBBA 2XX8A 4PFUA 3PV0E 1DSNA 4GL8A 3OO6A 1DOTA 3GBAA 5IGAA 3ZS6A 3IO6A 4AB6A 4PFWA 2GHBA 3IL1B 4P47A 2V25A 4RK2A 1M5EA 2O69A 3U72A 2DXRA 3MUQA 4G8NA 3CFXA 4XXUA 1LBCA 5AA4B 2Q9TA 3E3KA 1B3EA 2FA7A 2DWAA 2PBWA 1N3XA 2A5TA 2O68A 3IJXB 2F35A 2H25A 4I3EA 4ZECA 4EF1A 1YCJA 1A7LA 2YPNA 3W9WA 1GV8A 1FPGA 3T1BA 3QUJA 3OO8A 2OCUA 4RXLA 4P1LA 5I2NB 1ZJLA 2DS9A 4DZ1A 1IMDA 3K1MA 3KOTA 3IB2A 4YB6A 1XS5A 3I6VA 1NV1A 2UXAA 1B9JA 4ZEBA 2QS3A 3FVKA 1AWBA 1TT1A 4F1YA 1FTAA 1FPKA 2BJIA 1A8FA 4ESWA 4KYDA 5IZ1A 3LSWA 1B6HA 3C35A 4H1XA 1II5A 3PUYE 4ZE8A 4ELPA 4G2ZA 3PPQA 1WVJA 5J16A 5L9MA 4FATA 2QFLA 4OVJA 5I57B 4OANA 1L5TA 4JBZA 3PUXE 2CZHA 3PD8A 3KJ7A 1O63A 4R6YA 3ECRA 4RY1A 3Q25A 5JEIA 3ZKLA 2WYKA 5CMMA 1B3HA 1S50A 1LAHE 3G3IA 4FIMA 1KWHA 3MSTA 5H8NA 4Q30B 3DELB 1USYH 2UYFA 1SVXB 2WKYA 1LAFE 2GRVA 2XXWA 3OEMA 1NUWA 2XWOA 4JVIA 1LBYA 3D4GA 1IMAA 1QUKA 2UVIA 5A5LA 3EQ1A 2A5TB 4PAIA 1VFDA 2OWZA 1R9QA 5EQ7A 3HCQA 3N5LA 4YU0A 1AOVA 3DLNA 3T9UA 4OA4A 4DDDA 2FVZA 3LSXA 4RNSA 3IJOB 2Z8EA 2VT5A 1KA1A 3OSQA 3V89B 4GWXA 4WEDA 4GWSA 4PFBA 3UORA 1JETA 1QKBA 3K1PA 1IXHA 5I5PA 2P3NA 4TLLB 1Z7NE 1NV6A 4P56A 2I49A 2RC8A 3CIJA 3CR9A 3U1OA 4U4XA 2WBDA 4XIGQ 1LCFA 4H0WA 2THIA 4KXPA 4O94A 4QFKA 3G7WA 1MQJA 1B05A 2HXRA 2DWIA 2Z8DA 3JZJA 5FBPA 2XD2A 3TCFA 4ESXA 2O6AA 4H6DA 4MNCA 4N17A 5B70A 1MDP1 1MQDA 3PD9A 4C1UA 3TCHA 1B4HA 3U92A 4GWOA 3CHGA 3WAFA 1IMCA 2HAUA 2F8DA 3VDFA 3FVOA 1N7XA 1A99A 2I4BA 3OSRA 2KR0A 1SW1A 3TTMA 1R9LA 5H8SA 2DE3A 2PMSA 4O3BA 3A3UA 2F3DA 4NF5A 3OOAA 4GLIA 2JJKA 4F1UA 4GBWA 4ELQA 5IZZA 3KC1A 3PUWE 3Q26A 2F97A 3TKDA 2F5XA 1FSAA 3QYTA 3UA8A 3FVNA 4PFTA 2QRYA 1POTA 3DP6A 4H8IA 3PPRA 4NE4A 4GF8A 2XD3A 3RYDA 3QIMA 4I40A 2NUVA 3TAJA 4P9KA 3LR1A 3GXAA 3M3FA 1VE4A 3O6GA 3RGYA 4Q0CA 3KC0A 2G29A 4MMPA 4OVTA 4OFLA 4YKKA 1JW1A 4H5FA 3C34A 4FAJA 1IZ1A 3FXQA 3HPIA 5EHMA 1POY1 3S9LC 3CRBA 3V5AA 4X1DA 3SEYA 4EUOA 4PAFA 3FXRA 1FBHA 1B3LA 2FNCA 1NUYA 4RK9A 1IXGA 4R2BA 4NEDA 3MVZA 1MH3A 3SEVA 1BTJA 3O97A 3H7MA 2ESNA 3RT8A 2XXXA 1NKXA 4JXIA 1SYIA 5H8FA 2REJA 3LUYA 2QS4A 1MS7A 3D1RA 1A40A 3CG1A 2Y7IA 1MPBA 2UVGA 2IEEA 3SESA 4N8GA 4GWZA 5AA1A 3QK6A 1S7YA 1YXIA 1FBDA 3ILUB 3QSLA 1YYZA 1QUIA 1DTGA 2UVJA 4GX3A 3QUFA 2F78A 5H8QA 1Y9UA 5A5XA 1UTBA 1FPEA 4JDFA 4OEVA 1Y3NA 1OQGA 1MXXA 4XKNA 5EYHA 2VD3A 5FHNA 4NN3A 4G4PA 1FQFA 4NF5B 3W9VA 1HSJA 1FBFA 1OVTA 2X7PA 3VLUA 4LZ7A 1Z7ME 3MWBA 4OTEA 2Z22A 1LB9A 4U4SA 4EQ7A 2QVVA 2P3VA 1QW0A 4BDNA 1ZTYA 2QVRA 1BLFA 4ONYA 5I7IA 1PC3A 1OQHA 2DWHA 4YAHX 2OLBA 4U22A 4N6PA 2B4MA 4OFOA 4H5GA 1B51A 4NTLA 3B6TA 3TZAA 3V83A 3F11A 4G68C 4GX6A 5FTHA 1XI6A 1VSOA 2UYEA 2XX7A 4MBPA 3RNNA 4YMAA 1FTKA 1O64A 1TWYA 3A3CA 3IFAA 4M4GA 2PT1A 1US5A 2HEUA 1VFEA 3QMFA 3K01A 3PPPA 4JWYA 3K0VA 3LC8A 4TLMB 1AL3A 2Y7PA 1KA0A 1O7TA 4DLDA 4OENA 2RINA 1ZMGA 3EF7A 5ELVA 4ELRA 5AA4A 1DK4A 1FBCA 1F9BA 2GH9A 3MVYA 5H8FB 2B4LA 3B50A 4BLAA 5J1DA 1NV0A 4NMYA 5AA2B 2HPGA 1P1QA 3JYRA 5FTIA 3ZKKA 2NOOA 3RLFE 3T66A 3R7XA 1FPJA 1B0LA 3LSLA 5H8QB 5ITOA 5A5XB 3OO9A 2QJEA 2GFEA 5I3SA 5K2XA 3T96B 3LBSA 5IM2A 1Y4CA 2RCBA 2Z23A 4BDMA 1QULA 4FEDA 4NF6B 3TTRA 4R74A 4ZS9A 3FUZA 4KQPA 1P1NA 5JTYA 1NH8A 1M5BA 1PB7A 1LBWA 4QBAA 1PB8A 4PBQA 1ANFA 3WAEA 3L6GA 1LFIA 1URSA 3O6HA 2QS2A 1SI0A 1JVXA 4JWXA 1TXFA 3VV5A 2PT2A 1B0HA 3B6WA 5T3JA 4OERA 4HE1A 4OWDA 5I57A 1QVSA 4IGTA 5I58B 4F29A 1FQDA 1RDZA 1I6AA 4R6KA 4LP2B 1RKMA 2DSFA 2X26A 4P0GA 4RA1A 2RC7A 3TQWA 2RCAA 4OVQA 1SD3A 3RTWB 3A29A 1N3WA 4OMBA 3T9VA 4ECFA 2VHAA 3IAZA 5EHSA 2XXQA 4GL0A 1MQIA 1Y20A 2YLNA 1FPLA 1NUZA 1RDYA 5HBCA 4QFPA 3PTYA 4OXVA 2DE4A 1OIBA 1US4A 2NXOA 1N84A 2O1MA 2I4CA 2Q89A 3V8XB 1JW4A 1H44A 3CVGA 1XHYA 3RPWA 3H6WA 2ZNTA 4MCOA 2P1SA 3K02A 2ONKE 2VPNA 2ZYOA 3FXUA 3N6UA 2DOJA 3Q27A 4FJPA 3G3HA 3HHGA 3G3JA 3CSBA 1NNPA 4ZEKA 4XEQA 3PMXA 4MLVA 4FECA 5JTYB 4LATA 3MBPA 1LEVA 2ABHA 3MPLA 3RN8A 2D5WA 2ZZVA 1NUXA 4YKIA 3U65A 4QFOA 3K6VA 3TUSA 4PP0A 2XWVA 3FASA 4L17A 4YKPA 4JVCA 2I3WA 1B5IA 2RKMA 2Q2AA 1MY2A 3KOSA 3ILTB 2H98A 3U8QA 2M8CA 1IITA 1LBBA 2DDKA 3R26A 3DP4A 3QAXA 4N15A 4DI4B 4YKJA 3RPLB 3VVFA 3IOTA 1AH5A 4F18A 4NF4A 3S9MC 1JEVA 2F7BA 2H4IA 3MAMA 4F3GA 4PE5B 5HM4B 5DVJA 5EQAA 2RF1A
chains in the Genus database with same CATH topology
3BBRA 4E0WA 4ZE9A 1LBVA 2I58A 2I3VA 1SYHA 1FW0A 1J1NA 2KQZA 2QL3A 2AIXA 2I48A 1FQCA 3IK6B 1AIVA 4IO7A 1B5JA 3RUMA 2PYYA 4F31B 4G68B 2CZLA 4MHFA 4PGNA 1JEUA 5EYGA 2NVUB 1T0KA 3MP1A 4Z0IA 2XXYA 2AYSA 2PFZA 5I59A 1IXCA 4QSDA 4F3PA 1LBXA 3L6HA 2XWKA 4U21A 4N13A 1NMUA 2OWSA 1B7UA 3VVDA 2GQ1A 1BIYA 4HW8A 1DTZA 4NQ8A 1MXYA 2F34A 4FORA 2O51A 2DXYA 3FJ7A 1M5DA 5FHMA 1URDA 4F39A 3VXBA 1P1UA 2NWJA 2CZKA 2ZNSA 4N81A 5ISUA 4MAGA 2F36A 1JW5A 3KGCA 3EHUA 1VR5A 4PGPA 5CI5A 2FIEA 4NF4B 4FE8A 1SW2A 4X9TA 4ZEDA 4YMBA 5TU0A 4LUBA 3TTKA 3OD7A 1H43A 5CMKA 3S9EA 3IOUA 4BDRA 4KI0E 3IX1A 4MF3A 4IO5A 3EKIA 3FIRA 3EHSA 1SPIA 1NNKA 5F7VA 2V93A 5AA2D 1DMBA 3M3KA 2R71A 5IKBA 1OVBA 2AL4A 1NV3A 1M5FA 4R6HA 1GVCA 4TQUQ 3PUZE 4ND9A 1D9VA 1A55A 1MG1A 2I6EA 3MVWA 4OQOA 1HSLA 4WXJA 1B58A 4GD5A 3A09A 4IO2A 1LSTA 1LGBC 3FGSA 4HCWA 3FZVA 4R2FA 5I59B 4HE2A 1Y4TA 1P1WA 2ZYNA 5LDZA 3TMGA 4ZZEA 5ET5A 1VDWA 1USYE 3TPAA 4HCYA 4LVQA 2F3BA 3MP6A 5DYHA 4DXCA 4PFIA 3PMWA 1XVXA 4MNIA 3FV1A 4JWOA 4P11A 2I0BA 3O2AA 4PCDA 5H8HA 2PFYA 3DP8A 4OZ9A 3FJGA 2O7UA 4MH5A 3UP9A 1JNFA 1FTJA 3ZSFA 2V3TA 3BIHA 5ET7A 1FPFA 2OK2A 5AA2A 1MY3A 4X04A 4IO3A 2P2AA 4OEUA 4R9FA 3Q28A 2VP1A 1D9QA 1SW5A 1OLAA 3HV1A 4KR5A 2OX3A 1NNTA 3FV2A 3RT6B 2HXWA 3O28A 2WX9A 4QFNA 4ZZAA 2P0SA 2PVUA 2CEXA 3IORA 4PDHA 3MZBA 4GXSB 3R6UA 4NF6A 4OFJA 2A5SA 3MZ1A 3ISPA 4F22A 4EDPA 2DP8A 4BDQA 1R1NA 4O7MA 1CNQA 2CZIA 2I0CA 3KN8A 1QUJA 1SDXA 2OWTA 1H76A 2DVCA 4G8MA 4UABA 4LZ5A 5I58A 4EXLA 1JVYA 4GXAA 3PPOA 4NG7A 4PE3A 3UK4A 1FQAA 5ET6A 4M1VA 4MJOA 3IR1A 4GOTA 4P3LA 4ISUA 5AA3A 5ET8A 3KBRA 3M8UA 3P7IA 4GQOA 1PEBA 4PFYA 3O66A 2Y5LA 1B5HA 1QGXA 3H06B 4U1OA 4R72A 4H8JA 5DVIA 1IQ7A 1Q35A 4AB5A 5H8HB 2QPQA 2YJPA 3C31A 1FPIA 3VXCA 4ELOA 3CG3A 1RDXA 1MM6A 1MQGA 4IGRA 3PPNA 1NI9A 3ROJA 3Q29A 1P99A 4P0IA 4RYAA 1NH7A 2IA4A 5M2VA 4U23A 3GZGA 3W15C 4EQ9A 4LN5A 3KN7A 1LCTA 4ZEFA 4N6DA 2BJJX 3FXBA 2VGQA 4N91A 1NV7A 4I9DA 1EYKA 4YB7A 1EZ9A 4MIJA 4N07A 4AS5A 1SI1A 1DCUA 5KZTA 2ALUA 1M5CA 2FYIA 3S2VA 1QKAA 5CC2A 1WODA 3UN6A 1B1XA 3TTLA 1D3KA 4EXKA 1MXVA 2VPOA 2H5YA 2O7IA 3SEXA 2DYXA 4HTGA 1EH3A 4PF8A 4F19A 4YICA 4IR8A 3MQ9A 1XVYA 1TFAA 4JVDA 4X1BA 1NV2A 5EQ8A 4MFIA 1LAGE 2PCRA 3IO4A 1FJ6A 2X7QA 3N94A 1FBPA 3RPLA 3KSJA 1MM7A 3MC2A 2Y7KA 1BK4A 1XOCA 4G8HA 1EYJA 1IMFA 1G0IA 2Z8FA 2XXPA 5AE4A 3H6VA 5L9SA 1URGA 4KD5A 1IMBA 3K6WA 2XXRA 4GWYA 5KCJB 3LV0A 1PBPA 1MY1A 1YAEA 1N7WA 3THIA 1I6QA 3TYHA 2ANJA 4JB7A 3USDA 3SZPA 3I3VA 4O8MA 1NNFA 4U1ZA 4KHZE 4QRZA 4R75A 4E0XA 2DQVA 2XWIA 2F7AA 1D4NA 4G68A 4PC9A 4WKMA 3TTNA 1B7HA 5ESYA 4NAPA 3MZ9A 3QXMA 3C32A 2QS1A 3G3KA 3GLBA 3O9PA 4GIZA 4H45A 2QMWA 3RQTA 4AS4A 3MYUA 2L5VA 3H6TA 5ITPA 4O3CA 4G61A 1PB9A 1N0TA 3UGWA 3GYYA 3PMVA 3TODA 1D9YA 2H99A 1NV5A 1B4ZA 3E79A 1B46A 1B2HA 1KZ8A 3TQLA 2H9BA 4Q8RA 1LBZA 1G0HA 3NOHA 4C0RA 1RYXA 2LAOA 4AQ4A 4KYEA 3EN3A 4N4UA 3DM0A 4HXVA 1NFTA 2VD2A 2QSXA 4RPNA 4POXA 2R6GE 4X48A 1YPNA 4P8BA 3KZGA 4F3SA 4DCXA 3KBZA 3IOVA 3C33A 4GBVA 3E13X 3T9XB 5TPAA 5JK4A 5F24A 1FQEA 1DPPA 5CBRA 2ZYKA 5L8DA 4DXBA 4EQBA 1GGGA 2HAVA 1CB6A 4IO6A 1Y1MA 1UQWA 3PUVE 4YB5A 1Y3PA 4DXUA 1LLSA 4BDLA 4F2QA 4H46A 1B52A 4OVSA 1B1HA 2G93A 3RY3A 1IUDA 5DTBA 4RPOA 3EPEA 3H03A 3OMBA 1HSEA 3MVXA 1UTHA 4N8YA 3HO7A 4F2OA 1MY0A 4POWA 4THIA 1AMFA 1SW4A 4I3YA 3JV9A 3OO7A 2O1LA 3G3FA 3O6IA 1LFGA 5TP9A 3VE1B 4PETA 2ONSA 1B3FA 1GR2A 3PGFA 3KFMA 5IZ3A 3BFTA 4WEPA 3UIFA 1BP5A 2V4CA 4DIGA 3VLVA 4XKPA 4NGUA 2F6PA 1I69A 4I8CA 3K6XA 4FBPA 2F6GA 1Y3QA 3SEWA 3PU5A 1OLCA 3OENA 4ZDMA 5K2YA 1B3GA 1INPA 3KEIA 4LQ5A 5CMBA 2OBGA 1EZPA 3MP8A 1QJMA 3MPKA 3VVEA 4MX6A 2W7YA 3KJTA 4GWUA 2D3IA 4Q5TA 1BKAA 4LZ8A 1FJ9A 1MXWA 4QXDA 1OMPA 3FVGA 4NF0A 2B3FA 1ZIUA 3LSFB 2DWJA 2Q88A 3EHTA 4OHNA 1MPCA 3FD3A 1IMEA 2PX1A 1MXUA 1EU8A 3S4UA 3KG2A 1K9YA 1I6BA 2V3QA 2VOZA 3MJNA 5TPAB 2ZNUA 4MLQA 3CI8A 4K3FA 4NWCA 2MKZA 1IEJA 2XX9A 5ICQA 1RYOA 3U94A 4PBHA 5I56A 3K00A 1ZLQA 5FHOA 5I84A 2WYPA 4JSDA 4F1VA 3G3GA 2HZKA 1MY4A 5H8NB 2DE2A 3BKIB 2XXKA 4XTCQ 3IB0A 4OYVA 4UACA 2O84X 3T0JA 1UTHB 2R9JA 2RC9A 2DVZA 4EF2A 3SDFA 3S9NC 4DI3D 3ONMA 4P1EA 1UIUA 5TP9B 5ICTA 1N04A 4PAKA 5LOMA 4NX1A 3B8BA 3CSGA 4XKRA 4R9GA 3HSTA 4DCYA 1TFDA 2HHMA 5KDTA 3M3LA 5DVFA 1FTMA 1FBEA 5IZ3B 3CFLA 2ZXTA 1ATGA 2FHYA 5LTCA 2Y5KA 3T22A 3MW0A 4O3AA 2V3UA 3K1NA 1FCKA 2HCAA 4IY5A 1S9TA 4MEVA 2CMOA 3CFZA 1K9ZA 3C36A 1FPDA 1JP4A 5CMCA 3IOWA 3B6QA 1MXZA 2AL5A 4YZZA 4HS7A 3FATA 3BIGA 1H45A 1ZBMA 4H65A 1MDQA 2CEYA 1EYIA 5I2KA 2XXHA 3IFCA 4PDDA 1NL5A 1FRPA 4NF8A 2D21A 1FTOA 2E0SA 3AXFA 4XF5A 1PBQA 2ONRA 2QVUA 1B40A 5EQ9A 1JQFA 4Z7EA 5I56B 4PF6A 2XHDA 5BWJA 3LUZA 3H6UA 2ZZWA 1NV4A 4OESA 2WEFA 3TDJA 2XA5A 1XT8A 5CRYA 3H4ZA 2XXUA 5CM6A 3HFUA 2Y7RA 3SKPA 1WDNA 3K6UA 1N76A 4UA8A 4XFEA 2B65A 4XKQA 4LA9A 2B3BA 3D4CA 4QSCA 4KCDA 2UVHA 5IAIA 2Q8JA 1EZOA 1FBGA 4GX4A 2KLFA 3E9XA 2V84A 3FBPA 5DEXA 5L9OA 1LB8A 2XXIA 5DT6A 3TELA 3E78A 4RJZA 2Q2CA 3TEPA 4PQJA 1SQYA 5KDTB 1MRPA 1GTKA 1MH4A 4NWDA 4N6KA 3FJMA 2E1SA 5HPQA 1XC1A 3GBBA 4IB2A 2F7CA 2Y7WA 2HFBA 3U93A 5DW8A 2XXVA 3C4MA 4R73A 5KCJA 1LFHA 4H67A 1SBPA 2ZYMA 4HE0A 3HN0A 1Q9DA 1P1OA 3SEUA 2HZLA 4GRKA 3OEKA 1FTLA 3OELA 4TOZA 5BUUA 1ELJA 3T93B 4BDOA 2FIXA 4U2RA 4OETA 2OZZA 4IO4A 4G77A 5I2KB 3HHFA 4QF9A 4MNPA 4F3BA 4I62A 3E4RA 3SETA 4KFQA 4NF8B 4FEBA 1R6ZA 2QMXA 3K4UA 3VFJA 1ZKBA 3K2DA 2Y84A 4PTKA 3C9HA 3OXNA 3B7DA 4LQ2A 4GVOA 5I2NA 2HQ0A 1FPBA 1CE2A 1UTBB 1IXIA 4OVRA 1A54A 1Y1ZA 4QFLA 1ZU0A 3RTFB 4PFRA 4IY6A 2REGA 4JSOA 3N6TA 4DE8A 1A8EA 4OVPA 4C1TA 1B32A 4GWWA 1Q1KA 3KN3A 4ZEIA 4GFRA 4X8RA 3TCGA 2XXTA 4QHQA 1MPDA 1LAXA 3N26A 4KCCA 5DEXB 4QSEA 2GHAA 4KYSA 2Q8MA 1UIVA 3IB1A 1FQBA 3BFUA 3ODBA 1DPEA 3KSXA 1YZ0A 1H3DA 4NHBA 3O29A 5B7DA 1B7ZA 3I5OA 1PDAA 1MQHA 2FBPA 2R8TA 5EYFA 4LONB 4O7IA 2ZMBA 3H3GA 2Q74A 3SERA 1IIWA 4I1DA 5F1QA 2OJTA 3T9HB 5CBSA 3TFLA 4KPTA 1DBZA 3VLWA 2ZZXA 1YTVA 2WBBA 2XX8A 4PFUA 3PV0E 1DSNA 4GL8A 3OO6A 1DOTA 3GBAA 5IGAA 3ZS6A 3IO6A 4AB6A 4PFWA 2GHBA 3IL1B 4P47A 2V25A 4RK2A 1M5EA 2O69A 3U72A 2DXRA 3MUQA 4G8NA 3CFXA 4XXUA 1LBCA 5AA4B 2Q9TA 3E3KA 1B3EA 2FA7A 2DWAA 2PBWA 1N3XA 2A5TA 2O68A 3IJXB 2F35A 2H25A 4ZECA 4I3EA 4EF1A 1YCJA 1A7LA 2YPNA 3W9WA 1GV8A 1FPGA 3T1BA 3QUJA 3OO8A 2OCUA 4RXLA 4P1LA 5I2NB 1ZJLA 2DS9A 4DZ1A 1IMDA 3K1MA 3KOTA 3IB2A 4YB6A 1XS5A 3I6VA 1NV1A 2UXAA 1B9JA 4ZEBA 2QS3A 3FVKA 1AWBA 1TT1A 4F1YA 1FTAA 1FPKA 2BJIA 1A8FA 4ESWA 4KYDA 5IZ1A 3LSWA 1B6HA 3C35A 4H1XA 1II5A 3PUYE 4ZE8A 4ELPA 4G2ZA 3PPQA 1WVJA 5J16A 5L9MA 4FATA 2QFLA 4OVJA 5I57B 4OANA 1L5TA 4JBZA 3PUXE 3PD8A 2CZHA 3KJ7A 1O63A 4R6YA 3ECRA 4RY1A 3Q25A 5JEIA 3ZKLA 2WYKA 5CMMA 1B3HA 1S50A 1LAHE 3G3IA 4FIMA 1KWHA 5H8NA 3MSTA 4Q30B 3DELB 1USYH 2UYFA 1SVXB 2WKYA 1LAFE 2GRVA 2XXWA 3OEMA 1NUWA 2XWOA 4JVIA 1LBYA 3D4GA 1QUKA 1IMAA 2UVIA 5A5LA 3EQ1A 2A5TB 4PAIA 1VFDA 2OWZA 1R9QA 5EQ7A 3HCQA 3N5LA 4YU0A 1AOVA 3DLNA 3T9UA 4OA4A 4DDDA 2FVZA 3LSXA 4RNSA 3IJOB 2Z8EA 3OSQA 3V89B 1KA1A 2VT5A 4GWXA 4WEDA 4GWSA 4PFBA 3UORA 1JETA 1QKBA 3K1PA 1IXHA 5I5PA 2P3NA 4TLLB 1Z7NE 1NV6A 4P56A 2I49A 2RC8A 3CIJA 3CR9A 3U1OA 4U4XA 2WBDA 4XIGQ 1LCFA 4H0WA 2THIA 4KXPA 4O94A 4QFKA 3G7WA 1MQJA 1B05A 2HXRA 2DWIA 2Z8DA 3JZJA 5FBPA 2XD2A 3TCFA 4ESXA 2O6AA 4H6DA 4MNCA 4N17A 5B70A 1MDP1 1MQDA 3PD9A 4C1UA 3TCHA 1B4HA 3U92A 4GWOA 3CHGA 3WAFA 1IMCA 2HAUA 2F8DA 3VDFA 3FVOA 1N7XA 1A99A 2I4BA 3OSRA 2KR0A 1SW1A 3TTMA 1R9LA 5H8SA 2DE3A 2PMSA 4O3BA 3A3UA 2F3DA 4NF5A 3OOAA 4GLIA 2JJKA 4F1UA 4GBWA 4ELQA 5IZZA 3KC1A 3PUWE 3Q26A 2F97A 3TKDA 2F5XA 3QYTA 1FSAA 3UA8A 3FVNA 4PFTA 2QRYA 1POTA 3DP6A 4H8IA 3PPRA 4NE4A 4GF8A 2XD3A 3RYDA 3QIMA 4I40A 2NUVA 3TAJA 4P9KA 3LR1A 3GXAA 3M3FA 1VE4A 3O6GA 3RGYA 4Q0CA 3KC0A 2G29A 4MMPA 4OVTA 4OFLA 4YKKA 1JW1A 4H5FA 3C34A 4FAJA 1IZ1A 3FXQA 3HPIA 5EHMA 1POY1 3S9LC 3CRBA 3V5AA 4X1DA 3SEYA 4EUOA 4PAFA 3FXRA 1FBHA 1B3LA 2FNCA 1NUYA 4RK9A 1IXGA 4R2BA 4NEDA 3MVZA 1MH3A 3SEVA 1BTJA 3O97A 3H7MA 2ESNA 3RT8A 2XXXA 1NKXA 4JXIA 1SYIA 5H8FA 2REJA 3LUYA 2QS4A 1MS7A 3D1RA 1A40A 3CG1A 2Y7IA 1MPBA 2UVGA 2IEEA 3SESA 4N8GA 4GWZA 5AA1A 3QK6A 1S7YA 1YXIA 1FBDA 3ILUB 3QSLA 1YYZA 1QUIA 1DTGA 2UVJA 4GX3A 3QUFA 2F78A 5H8QA 1Y9UA 5A5XA 1UTBA 1FPEA 4JDFA 4OEVA 1Y3NA 1OQGA 1MXXA 4XKNA 5EYHA 2VD3A 5FHNA 4NN3A 4G4PA 1FQFA 4NF5B 3W9VA 1HSJA 1FBFA 1OVTA 2X7PA 3VLUA 4LZ7A 1Z7ME 3MWBA 4OTEA 2Z22A 1LB9A 4U4SA 4EQ7A 2QVVA 2P3VA 1QW0A 4BDNA 1ZTYA 2QVRA 1BLFA 4ONYA 5I7IA 1PC3A 1OQHA 2DWHA 4YAHX 2OLBA 4U22A 4N6PA 2B4MA 4OFOA 4H5GA 1B51A 4NTLA 3B6TA 3TZAA 3V83A 3F11A 4G68C 4GX6A 5FTHA 1XI6A 1VSOA 2UYEA 2XX7A 4MBPA 3RNNA 4YMAA 1FTKA 1O64A 1TWYA 3A3CA 3IFAA 4M4GA 2PT1A 1US5A 2HEUA 1VFEA 3QMFA 3K01A 3PPPA 4JWYA 3K0VA 3LC8A 4TLMB 1AL3A 2Y7PA 1KA0A 1O7TA 4DLDA 4OENA 2RINA 1ZMGA 3EF7A 5ELVA 4ELRA 5AA4A 2GH9A 1F9BA 1DK4A 3MVYA 1FBCA 5H8FB 2B4LA 3B50A 4BLAA 5J1DA 1NV0A 4NMYA 5AA2B 2HPGA 1P1QA 3JYRA 5FTIA 3ZKKA 2NOOA 3RLFE 3T66A 3R7XA 1FPJA 1B0LA 3LSLA 5H8QB 5ITOA 5A5XB 3OO9A 2QJEA 2GFEA 5K2XA 3T96B 5I3SA 3LBSA 5IM2A 1Y4CA 2RCBA 2Z23A 4BDMA 1QULA 4FEDA 4NF6B 3TTRA 4R74A 4ZS9A 3FUZA 4KQPA 1P1NA 5JTYA 1NH8A 1M5BA 1PB7A 1LBWA 4QBAA 1PB8A 4PBQA 1ANFA 3WAEA 3L6GA 1LFIA 1URSA 3O6HA 2QS2A 1SI0A 1JVXA 4JWXA 1TXFA 3VV5A 2PT2A 1B0HA 3B6WA 5T3JA 4OERA 4HE1A 4OWDA 5I57A 1QVSA 4IGTA 5I58B 4F29A 1FQDA 1RDZA 1I6AA 4R6KA 4LP2B 1RKMA 2DSFA 2X26A 4P0GA 4RA1A 2RC7A 3TQWA 2RCAA 4OVQA 1SD3A 3RTWB 3A29A 1N3WA 4OMBA 3T9VA 4ECFA 2VHAA 3IAZA 5EHSA 2XXQA 4GL0A 1MQIA 1Y20A 2YLNA 1FPLA 1NUZA 1RDYA 5HBCA 4QFPA 3PTYA 4OXVA 2DE4A 1OIBA 1US4A 2NXOA 1N84A 2O1MA 2I4CA 2Q89A 3V8XB 1JW4A 1H44A 3CVGA 1XHYA 3RPWA 3H6WA 2ZNTA 4MCOA 2P1SA 3K02A 2ONKE 2VPNA 2ZYOA 3FXUA 3N6UA 2DOJA 3Q27A 4FJPA 3G3HA 3HHGA 3G3JA 3CSBA 1NNPA 4ZEKA 4XEQA 3PMXA 4MLVA 4FECA 5JTYB 4LATA 3MBPA 1LEVA 2ABHA 3MPLA 3RN8A 2D5WA 2ZZVA 1NUXA 4YKIA 3U65A 4QFOA 3K6VA 3TUSA 4PP0A 2XWVA 3FASA 4L17A 4YKPA 4JVCA 2I3WA 1B5IA 2RKMA 2Q2AA 1MY2A 3KOSA 3ILTB 2H98A 3U8QA 2M8CA 1IITA 1LBBA 3R26A 2DDKA 3DP4A 3QAXA 4N15A 4DI4B 4YKJA 3RPLB 3VVFA 3IOTA 1AH5A 4F18A 4NF4A 3S9MC 1JEVA 2F7BA 2H4IA 3MAMA 4F3GA 4PE5B 5HM4B 5DVJA 5EQAA 2RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBR A;  4E0W A;  4ZE9 A;  2I58 A;  2I3V A;  1SYH A;  1FW0 A;  1J1N A;  2QL3 A;  2AIX A;  2I48 A;  1FQC A;  3IK6 B;  1AIV A;  4IO7 A;  1B5J A;  3RUM A;  2PYY A;  4F31 B;  4G68 B;  2CZL A;  1JEU A;  2NVU B;  1T0K A;  3MP1 A;  4Z0I A;  2XXY A;  2AYS A;  5I59 A;  1IXC A;  4QSD A;  4F3P A;  3L6H A;  4U21 A;  4N13 A;  1NMU A;  2OWS A;  1B7U A;  3VVD A;  1BIY A;  4HW8 A;  1DTZ A;  1MXY A;  2F34 A;  4FOR A;  2O51 A;  2DXY A;  3FJ7 A;  1M5D A;  5FHM A;  1URD A;  4F39 A;  3VXB A;  1P1U A;  2NWJ A;  2ZNS A;  5ISU A;  2F36 A;  1JW5 A;  3KGC A;  3EHU A;  1VR5 A;  5CI5 A;  4NF4 B;  4FE8 A;  1SW2 A;  4X9T A;  4ZED A;  4YMB A;  5TU0 A;  4LUB A;  3TTK A;  3OD7 A;  1H43 A;  5CMK A;  3S9E A;  3IOU A;  4BDR A;  4KI0 E;  3IX1 A;  4MF3 A;  4IO5 A;  3FIR A;  3EHS A;  1NNK A;  5F7V A;  2V93 A;  5AA2 D;  1DMB A;  3M3K A;  2R71 A;  5IKB A;  1OVB A;  2AL4 A;  1M5F A;  4R6H A;  1GVC A;  4TQU Q;  3PUZ E;  4ND9 A;  1D9V A;  1A55 A;  1MG1 A;  2I6E A;  3MVW A;  4OQO A;  1HSL A;  4WXJ A;  1B58 A;  4GD5 A;  3A09 A;  4IO2 A;  1LST A;  1LGB C;  3FGS A;  4HCW A;  3FZV A;  4R2F A;  5I59 B;  1Y4T A;  1P1W A;  2ZYN A;  3TMG A;  4ZZE A;  1USY E;  3TPA A;  4HCY A;  4LVQ A;  3MP6 A;  5DYH A;  4DXC A;  3PMW A;  1XVX A;  3FV1 A;  4JWO A;  4P11 A;  2I0B A;  3O2A A;  5H8H A;  3DP8 A;  4OZ9 A;  3FJG A;  2O7U A;  4MH5 A;  3UP9 A;  1JNF A;  1FTJ A;  3ZSF A;  2V3T A;  2OK2 A;  5AA2 A;  1MY3 A;  4IO3 A;  2P2A A;  4OEU A;  4R9F A;  3Q28 A;  2VP1 A;  1SW5 A;  1OLA A;  3HV1 A;  4KR5 A;  1NNT A;  3FV2 A;  3RT6 B;  2HXW A;  3O28 A;  4QFN A;  4ZZA A;  2P0S A;  2PVU A;  3IOR A;  3MZB A;  4GXS B;  3R6U A;  4NF6 A;  4OFJ A;  2A5S A;  3MZ1 A;  4F22 A;  4EDP A;  2DP8 A;  4BDQ A;  1R1N A;  2I0C A;  3KN8 A;  1QUJ A;  1SDX A;  2OWT A;  1H76 A;  2DVC A;  4G8M A;  4LZ5 A;  5I58 A;  4EXL A;  1JVY A;  4GXA A;  3PPO A;  3UK4 A;  1FQA A;  4M1V A;  3IR1 A;  4GOT A;  4ISU A;  5AA3 A;  3KBR A;  3M8U A;  3P7I A;  4GQO A;  1PEB A;  4PFY A;  3O66 A;  1B5H A;  3H06 B;  4U1O A;  4R72 A;  4H8J A;  5DVI A;  1IQ7 A;  1Q35 A;  4AB5 A;  5H8H B;  2QPQ A;  2YJP A;  3C31 A;  3VXC A;  4ELO A;  3CG3 A;  1MM6 A;  1MQG A;  4IGR A;  3PPN A;  3Q29 A;  1P99 A;  4P0I A;  4RYA A;  1NH7 A;  2IA4 A;  5M2V A;  4U23 A;  3GZG A;  3W15 C;  4EQ9 A;  3KN7 A;  1LCT A;  4ZEF A;  2BJJ X;  2VGQ A;  4I9D A;  4YB7 A;  1EZ9 A;  4N07 A;  1SI1 A;  5KZT A;  2ALU A;  1M5C A;  2FYI A;  3S2V A;  1QKA A;  5CC2 A;  1WOD A;  3UN6 A;  1B1X A;  3TTL A;  1D3K A;  4EXK A;  1MXV A;  2H5Y A;  2O7I A;  3SEX A;  2DYX A;  4HTG A;  1EH3 A;  4F19 A;  4YIC A;  3MQ9 A;  1XVY A;  1TFA A;  4X1B A;  4MFI A;  1LAG E;  3IO4 A;  2X7Q A;  3N94 A;  3KSJ A;  1MM7 A;  3MC2 A;  2Y7K A;  1XOC A;  4G8H A;  2Z8F A;  2XXP A;  5AE4 A;  3H6V A;  5L9S A;  1URG A;  4KD5 A;  3K6W A;  2XXR A;  5KCJ B;  1PBP A;  1MY1 A;  1YAE A;  1N7W A;  3THI A;  1I6Q A;  3TYH A;  2ANJ A;  4JB7 A;  3USD A;  3I3V A;  1NNF A;  4U1Z A;  4KHZ E;  4QRZ A;  4R75 A;  4E0X A;  2DQV A;  2F7A A;  1D4N A;  4G68 A;  4WKM A;  3TTN A;  1B7H A;  3MZ9 A;  3QXM A;  3C32 A;  2QS1 A;  3G3K A;  3GLB A;  3O9P A;  4GIZ A;  2QMW A;  3RQT A;  3H6T A;  5ITP A;  4O3C A;  1PB9 A;  1N0T A;  3UGW A;  3PMV A;  3TOD A;  1D9Y A;  2H99 A;  1B4Z A;  1B46 A;  1B2H A;  3TQL A;  2H9B A;  4Q8R A;  4C0R A;  1RYX A;  2LAO A;  4AQ4 A;  4KYE A;  3EN3 A;  3DM0 A;  1NFT A;  2VD2 A;  2QSX A;  4RPN A;  4POX A;  2R6G E;  4X48 A;  1YPN A;  3KZG A;  4F3S A;  4DCX A;  3IOV A;  3C33 A;  3E13 X;  3T9X B;  5TPA A;  5JK4 A;  1FQE A;  1DPP A;  5CBR A;  2ZYK A;  5L8D A;  4DXB A;  4EQB A;  1GGG A;  2HAV A;  1CB6 A;  4IO6 A;  1Y1M A;  1UQW A;  3PUV E;  4YB5 A;  1Y3P A;  4DXU A;  1LLS A;  4BDL A;  4F2Q A;  1B52 A;  1B1H A;  2G93 A;  3RY3 A;  1IUD A;  5DTB A;  4RPO A;  3EPE A;  3H03 A;  3OMB A;  1HSE A;  3MVX A;  1UTH A;  3HO7 A;  4F2O A;  1MY0 A;  4POW A;  4THI A;  1AMF A;  1SW4 A;  3JV9 A;  3OO7 A;  2O1L A;  3G3F A;  3O6I A;  1LFG A;  5TP9 A;  3VE1 B;  4PET A;  2ONS A;  1B3F A;  1GR2 A;  3PGF A;  3KFM A;  3BFT A;  4WEP A;  3UIF A;  1BP5 A;  4DIG A;  3VLV A;  4XKP A;  2F6P A;  1I69 A;  4I8C A;  3K6X A;  2F6G A;  1Y3Q A;  3SEW A;  3PU5 A;  1OLC A;  3OEN A;  4ZDM A;  5K2Y A;  1B3G A;  3KEI A;  4LQ5 A;  5CMB A;  2OBG A;  1EZP A;  3MP8 A;  1QJM A;  3MPK A;  3VVE A;  2W7Y A;  3KJT A;  2D3I A;  4Q5T A;  1BKA A;  4LZ8 A;  1MXW A;  1OMP A;  3FVG A;  2B3F A;  1ZIU A;  3LSF B;  2DWJ A;  2Q88 A;  3EHT A;  4OHN A;  1MPC A;  3FD3 A;  2PX1 A;  1MXU A;  1EU8 A;  3S4U A;  3KG2 A;  1I6B A;  2V3Q A;  2VOZ A;  3MJN A;  5TPA B;  2ZNU A;  4MLQ A;  3CI8 A;  4K3F A;  4NWC A;  1IEJ A;  2XX9 A;  5ICQ A;  1RYO A;  3U94 A;  5I56 A;  3K00 A;  1ZLQ A;  5FHO A;  5I84 A;  4JSD A;  4F1V A;  3G3G A;  2HZK A;  1MY4 A;  5H8N B;  2DE2 A;  3BKI B;  4XTC Q;  3IB0 A;  4OYV A;  4UAC A;  2O84 X;  1UTH B;  2R9J A;  2RC9 A;  2DVZ A;  4EF2 A;  3SDF A;  3S9N C;  3ONM A;  1UIU A;  5TP9 B;  5ICT A;  1N04 A;  5LOM A;  3CSG A;  4XKR A;  4R9G A;  3HST A;  4DCY A;  1TFD A;  5KDT A;  3M3L A;  5DVF A;  1FTM A;  3CFL A;  2ZXT A;  1ATG A;  3T22 A;  3MW0 A;  4O3A A;  2V3U A;  3K1N A;  1FCK A;  2HCA A;  4IY5 A;  1S9T A;  2CMO A;  3CFZ A;  3C36 A;  5CMC A;  3IOW A;  3B6Q A;  1MXZ A;  2AL5 A;  4YZZ A;  4HS7 A;  3FAT A;  1H45 A;  1ZBM A;  4H65 A;  1MDQ A;  5I2K A;  2XXH A;  1NL5 A;  4NF8 A;  2D21 A;  1FTO A;  2E0S A;  3AXF A;  1PBQ A;  2ONR A;  1B40 A;  1JQF A;  4Z7E A;  5I56 B;  2XHD A;  5BWJ A;  3H6U A;  4OES A;  3TDJ A;  1XT8 A;  5CRY A;  3H4Z A;  2XXU A;  5CM6 A;  2Y7R A;  3SKP A;  1WDN A;  3K6U A;  1N76 A;  4UA8 A;  2B65 A;  4XKQ A;  4LA9 A;  2B3B A;  3D4C A;  4QSC A;  4KCD A;  2UVH A;  5IAI A;  2Q8J A;  1EZO A;  2KLF A;  3E9X A;  2V84 A;  5DEX A;  5L9O A;  1LB8 A;  2XXI A;  5DT6 A;  3TEL A;  4RJZ A;  2Q2C A;  3TEP A;  4PQJ A;  1SQY A;  5KDT B;  1MRP A;  1GTK A;  1MH4 A;  4NWD A;  3FJM A;  2E1S A;  5HPQ A;  1XC1 A;  3GBB A;  4IB2 A;  2F7C A;  2Y7W A;  2HFB A;  3U93 A;  2XXV A;  3C4M A;  4R73 A;  5KCJ A;  1LFH A;  4H67 A;  1SBP A;  2ZYM A;  3HN0 A;  1P1O A;  3SEU A;  2HZL A;  4GRK A;  3OEK A;  1FTL A;  3OEL A;  4TOZ A;  5BUU A;  1ELJ A;  3T93 B;  4BDO A;  4U2R A;  4OET A;  2OZZ A;  4IO4 A;  4G77 A;  5I2K B;  3HHF A;  4QF9 A;  4F3B A;  4I62 A;  3E4R A;  3SET A;  4KFQ A;  4NF8 B;  4FEB A;  1R6Z A;  2QMX A;  3K4U A;  3VFJ A;  1ZKB A;  3K2D A;  2Y84 A;  3C9H A;  3OXN A;  3B7D A;  4LQ2 A;  4GVO A;  5I2N A;  2HQ0 A;  1CE2 A;  1UTB B;  1IXI A;  1A54 A;  1Y1Z A;  4QFL A;  1ZU0 A;  3RTF B;  4IY6 A;  2REG A;  4JSO A;  3N6T A;  4DE8 A;  1A8E A;  4C1T A;  1B32 A;  1Q1K A;  3KN3 A;  4ZEI A;  4GFR A;  3TCG A;  2XXT A;  4QHQ A;  1MPD A;  1LAX A;  3N26 A;  4KCC A;  5DEX B;  4QSE A;  2GHA A;  4KYS A;  1UIV A;  3IB1 A;  1FQB A;  3BFU A;  3ODB A;  1DPE A;  3KSX A;  1H3D A;  3O29 A;  5B7D A;  1B7Z A;  3I5O A;  1PDA A;  1MQH A;  5EYF A;  4LON B;  2ZMB A;  3H3G A;  3SER A;  1IIW A;  4I1D A;  5F1Q A;  2OJT A;  3T9H B;  5CBS A;  3TFL A;  4KPT A;  3VLW A;  1YTV A;  2XX8 A;  4PFU A;  3PV0 E;  1DSN A;  4GL8 A;  3OO6 A;  1DOT A;  3GBA A;  3ZS6 A;  3IO6 A;  4AB6 A;  4PFW A;  2GHB A;  3IL1 B;  2V25 A;  4RK2 A;  1M5E A;  2O69 A;  3U72 A;  2DXR A;  3MUQ A;  4G8N A;  3CFX A;  4XXU A;  1LBC A;  5AA4 B;  2Q9T A;  3E3K A;  1B3E A;  2FA7 A;  2DWA A;  2PBW A;  1N3X A;  2A5T A;  2O68 A;  3IJX B;  2F35 A;  2H25 A;  4ZEC A;  4EF1 A;  1YCJ A;  1A7L A;  2YPN A;  3W9W A;  1GV8 A;  3QUJ A;  3OO8 A;  2OCU A;  4RXL A;  5I2N B;  1ZJL A;  2DS9 A;  4DZ1 A;  3K1M A;  3KOT A;  3IB2 A;  4YB6 A;  1XS5 A;  3I6V A;  2UXA A;  1B9J A;  4ZEB A;  2QS3 A;  3FVK A;  1TT1 A;  4F1Y A;  1A8F A;  4ESW A;  4KYD A;  3LSW A;  1B6H A;  3C35 A;  4H1X A;  1II5 A;  3PUY E;  4ZE8 A;  4ELP A;  4G2Z A;  3PPQ A;  1WVJ A;  5L9M A;  4FAT A;  4OVJ A;  5I57 B;  1L5T A;  4JBZ A;  3PUX E;  3PD8 A;  3KJ7 A;  1O63 A;  4R6Y A;  3ECR A;  4RY1 A;  3Q25 A;  5JEI A;  3ZKL A;  5CMM A;  1B3H A;  1S50 A;  1LAH E;  3G3I A;  4FIM A;  1KWH A;  5H8N A;  4Q30 B;  3DEL B;  1USY H;  2UYF A;  1SVX B;  2WKY A;  1LAF E;  2GRV A;  2XXW A;  3OEM A;  3D4G A;  1QUK A;  2UVI A;  3EQ1 A;  2A5T B;  1VFD A;  1R9Q A;  3HCQ A;  3N5L A;  4YU0 A;  1AOV A;  3DLN A;  3T9U A;  4DDD A;  3LSX A;  4RNS A;  3IJO B;  2Z8E A;  3OSQ A;  3V89 B;  4WED A;  3UOR A;  1JET A;  1QKB A;  3K1P A;  1IXH A;  4TLL B;  1Z7N E;  2I49 A;  2RC8 A;  3CIJ A;  3CR9 A;  3U1O A;  4U4X A;  4XIG Q;  1LCF A;  4H0W A;  2THI A;  4QFK A;  3G7W A;  1MQJ A;  1B05 A;  2DWI A;  2Z8D A;  3JZJ A;  2XD2 A;  3TCF A;  4ESX A;  2O6A A;  4H6D A;  5B70 A;  1MDP 1;  1MQD A;  3PD9 A;  4C1U A;  3TCH A;  1B4H A;  3U92 A;  4GWO A;  3WAF A;  2HAU A;  2F8D A;  3VDF A;  3FVO A;  1N7X A;  1A99 A;  2I4B A;  3OSR A;  1SW1 A;  3TTM A;  1R9L A;  5H8S A;  2DE3 A;  2PMS A;  4O3B A;  3A3U A;  4NF5 A;  3OOA A;  4GLI A;  4F1U A;  4ELQ A;  3PUW E;  3Q26 A;  2F97 A;  3TKD A;  2F5X A;  3QYT A;  3UA8 A;  3FVN A;  4PFT A;  2QRY A;  1POT A;  3DP6 A;  4H8I A;  3PPR A;  4NE4 A;  4GF8 A;  2XD3 A;  3QIM A;  2NUV A;  3TAJ A;  3LR1 A;  3GXA A;  3M3F A;  1VE4 A;  3O6G A;  3RGY A;  4Q0C A;  2G29 A;  4OFL A;  4YKK A;  1JW1 A;  4H5F A;  3C34 A;  4FAJ A;  1IZ1 A;  3FXQ A;  3HPI A;  5EHM A;  1POY 1;  3S9L C;  3CRB A;  3V5A A;  4X1D A;  3SEY A;  4EUO A;  3FXR A;  1B3L A;  2FNC A;  4RK9 A;  1IXG A;  4R2B A;  4NED A;  3MVZ A;  1MH3 A;  3SEV A;  1BTJ A;  3O97 A;  3H7M A;  2ESN A;  3RT8 A;  2XXX A;  1NKX A;  4JXI A;  1SYI A;  5H8F A;  2REJ A;  3LUY A;  2QS4 A;  1MS7 A;  1A40 A;  3CG1 A;  2Y7I A;  1MPB A;  2UVG A;  2IEE A;  3SES A;  5AA1 A;  3QK6 A;  1S7Y A;  3ILU B;  3QSL A;  1QUI A;  1DTG A;  2UVJ A;  3QUF A;  2F78 A;  5H8Q A;  1Y9U A;  5A5X A;  1UTB A;  4JDF A;  4OEV A;  1Y3N A;  1OQG A;  1MXX A;  4XKN A;  2VD3 A;  5FHN A;  4G4P A;  1FQF A;  4NF5 B;  3W9V A;  1HSJ A;  1OVT A;  2X7P A;  3VLU A;  4LZ7 A;  1Z7M E;  3MWB A;  4OTE A;  2Z22 A;  1LB9 A;  4U4S A;  4EQ7 A;  1QW0 A;  4BDN A;  1ZTY A;  1BLF A;  4ONY A;  1PC3 A;  1OQH A;  2DWH A;  4YAH X;  2OLB A;  4U22 A;  4N6P A;  4OFO A;  4H5G A;  1B51 A;  4NTL A;  3B6T A;  3TZA A;  3V83 A;  3F11 A;  4G68 C;  5FTH A;  1VSO A;  2UYE A;  2XX7 A;  4MBP A;  3RNN A;  4YMA A;  1FTK A;  1O64 A;  1TWY A;  3A3C A;  4M4G A;  2PT1 A;  1US5 A;  2HEU A;  1VFE A;  3K01 A;  3PPP A;  4JWY A;  3K0V A;  3LC8 A;  4TLM B;  1AL3 A;  2Y7P A;  1O7T A;  4DLD A;  4OEN A;  2RIN A;  1ZMG A;  3EF7 A;  5ELV A;  4ELR A;  5AA4 A;  2GH9 A;  1F9B A;  3MVY A;  5H8F B;  4BLA A;  5J1D A;  4NMY A;  5AA2 B;  1P1Q A;  3JYR A;  5FTI A;  3ZKK A;  2NOO A;  3RLF E;  3T66 A;  3R7X A;  1B0L A;  3LSL A;  5H8Q B;  5ITO A;  5A5X B;  3OO9 A;  2QJE A;  2GFE A;  5K2X A;  3T96 B;  3LBS A;  1Y4C A;  2RCB A;  2Z23 A;  4BDM A;  1QUL A;  4FED A;  4NF6 B;  3TTR A;  4R74 A;  4ZS9 A;  3FUZ A;  4KQP A;  1P1N A;  5JTY A;  1NH8 A;  1M5B A;  1PB7 A;  1PB8 A;  1ANF A;  3WAE A;  3L6G A;  1LFI A;  1URS A;  3O6H A;  2QS2 A;  1SI0 A;  1JVX A;  4JWX A;  1TXF A;  3VV5 A;  2PT2 A;  1B0H A;  3B6W A;  4OER A;  4OWD A;  5I57 A;  1QVS A;  4IGT A;  5I58 B;  4F29 A;  1FQD A;  1I6A A;  4R6K A;  4LP2 B;  1RKM A;  2DSF A;  2X26 A;  4P0G A;  4RA1 A;  2RC7 A;  3TQW A;  2RCA A;  1SD3 A;  3RTW B;  1N3W A;  4OMB A;  3T9V A;  4ECF A;  2VHA A;  3IAZ A;  5EHS A;  2XXQ A;  4GL0 A;  1MQI A;  1Y20 A;  2YLN A;  5HBC A;  4QFP A;  4OXV A;  2DE4 A;  1OIB A;  1US4 A;  2NXO A;  1N84 A;  2O1M A;  2I4C A;  2Q89 A;  3V8X B;  1JW4 A;  1H44 A;  3CVG A;  1XHY A;  3RPW A;  3H6W A;  2ZNT A;  2P1S A;  3K02 A;  2ONK E;  2ZYO A;  3FXU A;  3N6U A;  2DOJ A;  3Q27 A;  4FJP A;  3G3H A;  3HHG A;  3G3J A;  3CSB A;  1NNP A;  4ZEK A;  3PMX A;  4MLV A;  4FEC A;  5JTY B;  4LAT A;  3MBP A;  2ABH A;  3MPL A;  3RN8 A;  2D5W A;  4YKI A;  4QFO A;  3K6V A;  3TUS A;  4PP0 A;  3FAS A;  4L17 A;  4YKP A;  2I3W A;  1B5I A;  2RKM A;  2Q2A A;  1MY2 A;  3KOS A;  3ILT B;  2H98 A;  3U8Q A;  2M8C A;  1IIT A;  1LBB A;  3R26 A;  3DP4 A;  3QAX A;  4YKJ A;  3VVF A;  3IOT A;  1AH5 A;  4F18 A;  4NF4 A;  3S9M C;  1JEV A;  2F7B A;  2H4I A;  3MAM A;  4F3G A;  4PE5 B;  5HM4 B;  5DVJ A;  2RF1 A; 
#chains in the Genus database with same CATH topology
 3BBR A;  4E0W A;  4ZE9 A;  1LBV A;  2I58 A;  2I3V A;  1SYH A;  1FW0 A;  1J1N A;  2KQZ A;  2QL3 A;  2AIX A;  2I48 A;  1FQC A;  3IK6 B;  1AIV A;  4IO7 A;  1B5J A;  3RUM A;  2PYY A;  4F31 B;  4G68 B;  2CZL A;  4MHF A;  4PGN A;  1JEU A;  5EYG A;  2NVU B;  1T0K A;  3MP1 A;  4Z0I A;  2XXY A;  2AYS A;  2PFZ A;  5I59 A;  1IXC A;  4QSD A;  4F3P A;  1LBX A;  3L6H A;  2XWK A;  4U21 A;  4N13 A;  1NMU A;  2OWS A;  1B7U A;  3VVD A;  2GQ1 A;  1BIY A;  4HW8 A;  1DTZ A;  4NQ8 A;  1MXY A;  2F34 A;  4FOR A;  2O51 A;  2DXY A;  3FJ7 A;  1M5D A;  5FHM A;  1URD A;  4F39 A;  3VXB A;  1P1U A;  2CZK A;  4N81 A;  2ZNS A;  2NWJ A;  5ISU A;  4MAG A;  2F36 A;  1JW5 A;  3KGC A;  3EHU A;  1VR5 A;  4PGP A;  5CI5 A;  2FIE A;  4NF4 B;  4FE8 A;  1SW2 A;  4X9T A;  4ZED A;  4YMB A;  5TU0 A;  4LUB A;  3TTK A;  3OD7 A;  1H43 A;  5CMK A;  3S9E A;  3IOU A;  4BDR A;  4KI0 E;  3IX1 A;  4MF3 A;  4IO5 A;  3EKI A;  3FIR A;  3EHS A;  1SPI A;  1NNK A;  5F7V A;  2V93 A;  5AA2 D;  1DMB A;  3M3K A;  2R71 A;  1NV3 A;  1OVB A;  2AL4 A;  5IKB A;  1M5F A;  4R6H A;  1GVC A;  4TQU Q;  3PUZ E;  4ND9 A;  1D9V A;  1A55 A;  1MG1 A;  2I6E A;  3MVW A;  4OQO A;  1HSL A;  4WXJ A;  1B58 A;  4GD5 A;  3A09 A;  4IO2 A;  1LST A;  1LGB C;  3FGS A;  4HCW A;  3FZV A;  4R2F A;  5I59 B;  4HE2 A;  1Y4T A;  1P1W A;  2ZYN A;  5LDZ A;  3TMG A;  4ZZE A;  5ET5 A;  1VDW A;  1USY E;  3TPA A;  2F3B A;  4HCY A;  4LVQ A;  3MP6 A;  5DYH A;  4DXC A;  4PFI A;  3PMW A;  1XVX A;  4MNI A;  3FV1 A;  4JWO A;  4P11 A;  2I0B A;  3O2A A;  4PCD A;  2PFY A;  5H8H A;  3DP8 A;  4OZ9 A;  3FJG A;  2O7U A;  4MH5 A;  3UP9 A;  1JNF A;  1FTJ A;  3ZSF A;  2V3T A;  3BIH A;  5ET7 A;  1FPF A;  2OK2 A;  5AA2 A;  1MY3 A;  4X04 A;  4IO3 A;  2P2A A;  4OEU A;  4R9F A;  3Q28 A;  2VP1 A;  1D9Q A;  1SW5 A;  1OLA A;  4KR5 A;  2OX3 A;  3HV1 A;  1NNT A;  3FV2 A;  3RT6 B;  2HXW A;  2WX9 A;  3O28 A;  4QFN A;  4ZZA A;  2P0S A;  2PVU A;  2CEX A;  3IOR A;  4PDH A;  3MZB A;  4GXS B;  3R6U A;  4NF6 A;  4OFJ A;  2A5S A;  3MZ1 A;  3ISP A;  4F22 A;  4EDP A;  2DP8 A;  4BDQ A;  1R1N A;  4O7M A;  1CNQ A;  2CZI A;  2I0C A;  3KN8 A;  1QUJ A;  1SDX A;  2OWT A;  1H76 A;  2DVC A;  4G8M A;  4UAB A;  4LZ5 A;  5I58 A;  4EXL A;  1JVY A;  4GXA A;  3PPO A;  4NG7 A;  4PE3 A;  3UK4 A;  1FQA A;  5ET6 A;  4M1V A;  4MJO A;  3IR1 A;  4GOT A;  4P3L A;  4ISU A;  5AA3 A;  5ET8 A;  3KBR A;  3M8U A;  3P7I A;  4GQO A;  1PEB A;  4PFY A;  3O66 A;  2Y5L A;  1B5H A;  1QGX A;  3H06 B;  4U1O A;  4R72 A;  4H8J A;  5DVI A;  1IQ7 A;  1Q35 A;  4AB5 A;  5H8H B;  2QPQ A;  2YJP A;  3C31 A;  1FPI A;  3VXC A;  4ELO A;  3CG3 A;  1RDX A;  1MM6 A;  1MQG A;  4IGR A;  3PPN A;  1NI9 A;  3ROJ A;  3Q29 A;  1P99 A;  4P0I A;  4RYA A;  1NH7 A;  2IA4 A;  5M2V A;  4U23 A;  3GZG A;  3W15 C;  4EQ9 A;  4LN5 A;  3KN7 A;  1LCT A;  4ZEF A;  4N6D A;  2BJJ X;  3FXB A;  2VGQ A;  4N91 A;  1NV7 A;  4I9D A;  1EYK A;  4YB7 A;  1EZ9 A;  4MIJ A;  4N07 A;  4AS5 A;  1SI1 A;  1DCU A;  5KZT A;  2ALU A;  1M5C A;  2FYI A;  3S2V A;  1QKA A;  5CC2 A;  1WOD A;  3UN6 A;  1B1X A;  3TTL A;  1D3K A;  4EXK A;  1MXV A;  2VPO A;  2H5Y A;  2O7I A;  3SEX A;  2DYX A;  4HTG A;  1EH3 A;  4PF8 A;  4F19 A;  4YIC A;  4IR8 A;  3MQ9 A;  1XVY A;  1TFA A;  4JVD A;  4X1B A;  1NV2 A;  5EQ8 A;  4MFI A;  1LAG E;  2PCR A;  3IO4 A;  1FJ6 A;  2X7Q A;  3N94 A;  1FBP A;  3RPL A;  3KSJ A;  1MM7 A;  1BK4 A;  2Y7K A;  3MC2 A;  1XOC A;  4G8H A;  1EYJ A;  1IMF A;  1G0I A;  2Z8F A;  2XXP A;  5AE4 A;  3H6V A;  5L9S A;  1URG A;  1IMB A;  4KD5 A;  3K6W A;  2XXR A;  4GWY A;  5KCJ B;  3LV0 A;  1PBP A;  1MY1 A;  1YAE A;  1N7W A;  3THI A;  1I6Q A;  3TYH A;  2ANJ A;  4JB7 A;  3SZP A;  3USD A;  3I3V A;  4O8M A;  1NNF A;  4U1Z A;  4KHZ E;  4QRZ A;  4R75 A;  4E0X A;  2DQV A;  2XWI A;  2F7A A;  1D4N A;  4G68 A;  4PC9 A;  4WKM A;  3TTN A;  1B7H A;  5ESY A;  4NAP A;  3MZ9 A;  3QXM A;  3C32 A;  2QS1 A;  3G3K A;  3GLB A;  3O9P A;  4GIZ A;  4H45 A;  2QMW A;  3RQT A;  4AS4 A;  3MYU A;  2L5V A;  3H6T A;  5ITP A;  4O3C A;  4G61 A;  1PB9 A;  1N0T A;  3UGW A;  3GYY A;  3PMV A;  3TOD A;  1D9Y A;  2H99 A;  1NV5 A;  1B4Z A;  3E79 A;  1B46 A;  1B2H A;  1KZ8 A;  3TQL A;  2H9B A;  1LBZ A;  3NOH A;  1G0H A;  4Q8R A;  4C0R A;  1RYX A;  2LAO A;  4AQ4 A;  4KYE A;  3EN3 A;  4N4U A;  3DM0 A;  4HXV A;  1NFT A;  2VD2 A;  2QSX A;  4RPN A;  4POX A;  2R6G E;  4X48 A;  1YPN A;  4P8B A;  3KZG A;  4F3S A;  3KBZ A;  4DCX A;  3IOV A;  3C33 A;  4GBV A;  3E13 X;  3T9X B;  5TPA A;  5F24 A;  5JK4 A;  1FQE A;  1DPP A;  5CBR A;  2ZYK A;  5L8D A;  4DXB A;  4EQB A;  1GGG A;  2HAV A;  1CB6 A;  4IO6 A;  1Y1M A;  1UQW A;  3PUV E;  4YB5 A;  1Y3P A;  4DXU A;  1LLS A;  4BDL A;  4H46 A;  4F2Q A;  1B52 A;  4OVS A;  1B1H A;  2G93 A;  3RY3 A;  1IUD A;  5DTB A;  4RPO A;  3EPE A;  3H03 A;  3OMB A;  1HSE A;  3MVX A;  1UTH A;  4N8Y A;  3HO7 A;  4F2O A;  1MY0 A;  4POW A;  4THI A;  1AMF A;  1SW4 A;  4I3Y A;  3JV9 A;  3OO7 A;  2O1L A;  3G3F A;  3O6I A;  1LFG A;  5TP9 A;  3VE1 B;  4PET A;  2ONS A;  1B3F A;  1GR2 A;  3PGF A;  3KFM A;  5IZ3 A;  3BFT A;  4WEP A;  3UIF A;  1BP5 A;  2V4C A;  4DIG A;  3VLV A;  4XKP A;  4NGU A;  2F6P A;  1I69 A;  4I8C A;  3K6X A;  4FBP A;  2F6G A;  1Y3Q A;  3SEW A;  3PU5 A;  1OLC A;  3OEN A;  4ZDM A;  5K2Y A;  1INP A;  1B3G A;  3KEI A;  4LQ5 A;  5CMB A;  2OBG A;  1EZP A;  3MP8 A;  1QJM A;  3MPK A;  4MX6 A;  3VVE A;  2W7Y A;  3KJT A;  4GWU A;  2D3I A;  4Q5T A;  1BKA A;  4LZ8 A;  1FJ9 A;  1MXW A;  4QXD A;  1OMP A;  3FVG A;  4NF0 A;  2B3F A;  1ZIU A;  3LSF B;  2DWJ A;  2Q88 A;  3EHT A;  4OHN A;  1MPC A;  3FD3 A;  1IME A;  2PX1 A;  1MXU A;  1EU8 A;  3S4U A;  3KG2 A;  1K9Y A;  1I6B A;  2V3Q A;  2VOZ A;  3MJN A;  5TPA B;  2ZNU A;  4MLQ A;  3CI8 A;  4K3F A;  4NWC A;  2MKZ A;  1IEJ A;  2XX9 A;  5ICQ A;  1RYO A;  3U94 A;  4PBH A;  5I56 A;  3K00 A;  1ZLQ A;  5FHO A;  5I84 A;  2WYP A;  4JSD A;  4F1V A;  3G3G A;  2HZK A;  1MY4 A;  5H8N B;  2DE2 A;  3BKI B;  2XXK A;  4XTC Q;  3IB0 A;  4UAC A;  4OYV A;  2O84 X;  3T0J A;  1UTH B;  2R9J A;  2RC9 A;  2DVZ A;  4EF2 A;  3SDF A;  3S9N C;  4DI3 D;  3ONM A;  4P1E A;  1UIU A;  5TP9 B;  5ICT A;  1N04 A;  4PAK A;  5LOM A;  4NX1 A;  3B8B A;  3CSG A;  4XKR A;  4R9G A;  3HST A;  4DCY A;  1TFD A;  2HHM A;  5KDT A;  3M3L A;  5DVF A;  1FBE A;  1FTM A;  5IZ3 B;  3CFL A;  2ZXT A;  1ATG A;  2FHY A;  5LTC A;  2Y5K A;  3T22 A;  3MW0 A;  4O3A A;  2V3U A;  3K1N A;  1FCK A;  2HCA A;  4IY5 A;  1S9T A;  4MEV A;  2CMO A;  3CFZ A;  1K9Z A;  3C36 A;  1FPD A;  1JP4 A;  5CMC A;  3IOW A;  3B6Q A;  1MXZ A;  2AL5 A;  4YZZ A;  4HS7 A;  3FAT A;  3BIG A;  1H45 A;  1ZBM A;  4H65 A;  1MDQ A;  2CEY A;  1EYI A;  5I2K A;  2XXH A;  3IFC A;  4PDD A;  1NL5 A;  1FRP A;  4NF8 A;  2D21 A;  1FTO A;  2E0S A;  3AXF A;  4XF5 A;  1PBQ A;  2ONR A;  2QVU A;  1B40 A;  5EQ9 A;  1JQF A;  4Z7E A;  5I56 B;  4PF6 A;  2XHD A;  5BWJ A;  3LUZ A;  3H6U A;  2ZZW A;  1NV4 A;  4OES A;  2WEF A;  3TDJ A;  2XA5 A;  1XT8 A;  5CRY A;  3H4Z A;  2XXU A;  3HFU A;  5CM6 A;  2Y7R A;  3SKP A;  1WDN A;  3K6U A;  1N76 A;  4UA8 A;  4XFE A;  2B65 A;  4XKQ A;  4LA9 A;  2B3B A;  3D4C A;  4QSC A;  4KCD A;  2UVH A;  5IAI A;  2Q8J A;  1EZO A;  1FBG A;  4GX4 A;  2KLF A;  3E9X A;  2V84 A;  3FBP A;  5DEX A;  5L9O A;  1LB8 A;  2XXI A;  5DT6 A;  3TEL A;  3E78 A;  4RJZ A;  2Q2C A;  3TEP A;  4PQJ A;  1SQY A;  5KDT B;  1MRP A;  1GTK A;  1MH4 A;  4N6K A;  4NWD A;  3FJM A;  2E1S A;  5HPQ A;  1XC1 A;  3GBB A;  4IB2 A;  2F7C A;  2Y7W A;  2HFB A;  3U93 A;  5DW8 A;  2XXV A;  3C4M A;  4R73 A;  5KCJ A;  1LFH A;  4H67 A;  1SBP A;  2ZYM A;  4HE0 A;  3HN0 A;  1Q9D A;  1P1O A;  3SEU A;  2HZL A;  4GRK A;  3OEK A;  1FTL A;  3OEL A;  4TOZ A;  5BUU A;  1ELJ A;  3T93 B;  4BDO A;  2FIX A;  4U2R A;  4OET A;  2OZZ A;  4IO4 A;  4G77 A;  5I2K B;  3HHF A;  4QF9 A;  4MNP A;  4F3B A;  4I62 A;  3E4R A;  3SET A;  4KFQ A;  4NF8 B;  4FEB A;  1R6Z A;  2QMX A;  3K4U A;  3VFJ A;  1ZKB A;  3K2D A;  2Y84 A;  4PTK A;  3C9H A;  3OXN A;  3B7D A;  4LQ2 A;  4GVO A;  5I2N A;  1FPB A;  2HQ0 A;  1CE2 A;  1UTB B;  1IXI A;  4OVR A;  1A54 A;  1Y1Z A;  4QFL A;  1ZU0 A;  3RTF B;  4PFR A;  4IY6 A;  2REG A;  4JSO A;  3N6T A;  4DE8 A;  1A8E A;  4OVP A;  4C1T A;  1B32 A;  4GWW A;  1Q1K A;  3KN3 A;  4ZEI A;  4GFR A;  4X8R A;  3TCG A;  2XXT A;  4QHQ A;  1MPD A;  1LAX A;  3N26 A;  4KCC A;  5DEX B;  4QSE A;  2GHA A;  4KYS A;  2Q8M A;  1UIV A;  3IB1 A;  1FQB A;  3BFU A;  3ODB A;  1DPE A;  3KSX A;  1YZ0 A;  1H3D A;  4NHB A;  3O29 A;  5B7D A;  1B7Z A;  3I5O A;  1PDA A;  1MQH A;  2FBP A;  2R8T A;  5EYF A;  4LON B;  4O7I A;  2ZMB A;  2Q74 A;  3H3G A;  3SER A;  1IIW A;  4I1D A;  5F1Q A;  2OJT A;  3T9H B;  5CBS A;  3TFL A;  4KPT A;  1DBZ A;  2ZZX A;  3VLW A;  1YTV A;  2WBB A;  2XX8 A;  4PFU A;  3PV0 E;  1DSN A;  4GL8 A;  3OO6 A;  1DOT A;  3GBA A;  5IGA A;  3ZS6 A;  3IO6 A;  4AB6 A;  4PFW A;  2GHB A;  3IL1 B;  4P47 A;  2V25 A;  4RK2 A;  1M5E A;  2O69 A;  3U72 A;  2DXR A;  3MUQ A;  4G8N A;  3CFX A;  4XXU A;  1LBC A;  5AA4 B;  2Q9T A;  3E3K A;  1B3E A;  2FA7 A;  2DWA A;  2PBW A;  1N3X A;  2A5T A;  2O68 A;  3IJX B;  2F35 A;  2H25 A;  4I3E A;  4ZEC A;  4EF1 A;  1YCJ A;  1A7L A;  2YPN A;  3W9W A;  1GV8 A;  1FPG A;  3T1B A;  3QUJ A;  3OO8 A;  2OCU A;  4RXL A;  4P1L A;  5I2N B;  1ZJL A;  2DS9 A;  4DZ1 A;  1IMD A;  3K1M A;  3KOT A;  3IB2 A;  4YB6 A;  1XS5 A;  3I6V A;  1NV1 A;  2UXA A;  1B9J A;  4ZEB A;  2QS3 A;  3FVK A;  1AWB A;  1TT1 A;  4F1Y A;  1FTA A;  1FPK A;  2BJI A;  1A8F A;  4ESW A;  4KYD A;  5IZ1 A;  3LSW A;  1B6H A;  3C35 A;  4H1X A;  1II5 A;  3PUY E;  4ZE8 A;  4ELP A;  4G2Z A;  3PPQ A;  1WVJ A;  5J16 A;  5L9M A;  4FAT A;  2QFL A;  4OVJ A;  5I57 B;  4OAN A;  1L5T A;  4JBZ A;  3PUX E;  2CZH A;  3PD8 A;  3KJ7 A;  1O63 A;  4R6Y A;  3ECR A;  4RY1 A;  3Q25 A;  5JEI A;  3ZKL A;  2WYK A;  5CMM A;  1B3H A;  1S50 A;  1LAH E;  3G3I A;  4FIM A;  1KWH A;  3MST A;  5H8N A;  4Q30 B;  3DEL B;  1USY H;  2UYF A;  1SVX B;  2WKY A;  1LAF E;  2GRV A;  2XXW A;  3OEM A;  1NUW A;  2XWO A;  4JVI A;  1LBY A;  3D4G A;  1IMA A;  1QUK A;  2UVI A;  5A5L A;  3EQ1 A;  2A5T B;  4PAI A;  1VFD A;  2OWZ A;  1R9Q A;  5EQ7 A;  3HCQ A;  3N5L A;  4YU0 A;  1AOV A;  3DLN A;  3T9U A;  4OA4 A;  4DDD A;  2FVZ A;  3LSX A;  4RNS A;  3IJO B;  2Z8E A;  2VT5 A;  1KA1 A;  3OSQ A;  3V89 B;  4GWX A;  4WED A;  4GWS A;  4PFB A;  3UOR A;  1JET A;  1QKB A;  3K1P A;  1IXH A;  5I5P A;  2P3N A;  4TLL B;  1Z7N E;  1NV6 A;  4P56 A;  2I49 A;  2RC8 A;  3CIJ A;  3CR9 A;  3U1O A;  4U4X A;  2WBD A;  4XIG Q;  1LCF A;  4H0W A;  2THI A;  4KXP A;  4O94 A;  4QFK A;  3G7W A;  1MQJ A;  1B05 A;  2HXR A;  2DWI A;  2Z8D A;  3JZJ A;  5FBP A;  2XD2 A;  3TCF A;  4ESX A;  2O6A A;  4H6D A;  4MNC A;  4N17 A;  5B70 A;  1MDP 1;  1MQD A;  3PD9 A;  4C1U A;  3TCH A;  1B4H A;  3U92 A;  4GWO A;  3CHG A;  3WAF A;  1IMC A;  2HAU A;  2F8D A;  3VDF A;  3FVO A;  1N7X A;  1A99 A;  2I4B A;  3OSR A;  2KR0 A;  1SW1 A;  3TTM A;  1R9L A;  5H8S A;  2DE3 A;  2PMS A;  4O3B A;  3A3U A;  2F3D A;  4NF5 A;  3OOA A;  4GLI A;  2JJK A;  4F1U A;  4GBW A;  4ELQ A;  5IZZ A;  3KC1 A;  3PUW E;  3Q26 A;  2F97 A;  3TKD A;  2F5X A;  1FSA A;  3QYT A;  3UA8 A;  3FVN A;  4PFT A;  2QRY A;  1POT A;  3DP6 A;  4H8I A;  3PPR A;  4NE4 A;  4GF8 A;  2XD3 A;  3RYD A;  3QIM A;  4I40 A;  2NUV A;  3TAJ A;  4P9K A;  3LR1 A;  3GXA A;  3M3F A;  1VE4 A;  3O6G A;  3RGY A;  4Q0C A;  3KC0 A;  2G29 A;  4MMP A;  4OVT A;  4OFL A;  4YKK A;  1JW1 A;  4H5F A;  3C34 A;  4FAJ A;  1IZ1 A;  3FXQ A;  3HPI A;  5EHM A;  1POY 1;  3S9L C;  3CRB A;  3V5A A;  4X1D A;  3SEY A;  4EUO A;  4PAF A;  3FXR A;  1FBH A;  1B3L A;  2FNC A;  1NUY A;  4RK9 A;  1IXG A;  4R2B A;  4NED A;  3MVZ A;  1MH3 A;  3SEV A;  1BTJ A;  3O97 A;  3H7M A;  2ESN A;  3RT8 A;  2XXX A;  1NKX A;  4JXI A;  1SYI A;  5H8F A;  2REJ A;  3LUY A;  2QS4 A;  1MS7 A;  3D1R A;  1A40 A;  3CG1 A;  2Y7I A;  1MPB A;  2UVG A;  2IEE A;  3SES A;  4N8G A;  4GWZ A;  5AA1 A;  3QK6 A;  1S7Y A;  1YXI A;  1FBD A;  3ILU B;  3QSL A;  1YYZ A;  1QUI A;  1DTG A;  2UVJ A;  4GX3 A;  3QUF A;  2F78 A;  5H8Q A;  1Y9U A;  5A5X A;  1UTB A;  1FPE A;  4JDF A;  4OEV A;  1Y3N A;  1OQG A;  1MXX A;  4XKN A;  5EYH A;  2VD3 A;  5FHN A;  4NN3 A;  4G4P A;  1FQF A;  4NF5 B;  3W9V A;  1HSJ A;  1FBF A;  1OVT A;  2X7P A;  3VLU A;  4LZ7 A;  1Z7M E;  3MWB A;  4OTE A;  2Z22 A;  1LB9 A;  4U4S A;  4EQ7 A;  2QVV A;  2P3V A;  1QW0 A;  4BDN A;  1ZTY A;  2QVR A;  1BLF A;  4ONY A;  5I7I A;  1PC3 A;  1OQH A;  2DWH A;  4YAH X;  2OLB A;  4U22 A;  4N6P A;  2B4M A;  4OFO A;  4H5G A;  1B51 A;  4NTL A;  3B6T A;  3TZA A;  3V83 A;  3F11 A;  4G68 C;  4GX6 A;  5FTH A;  1XI6 A;  1VSO A;  2UYE A;  2XX7 A;  4MBP A;  3RNN A;  4YMA A;  1FTK A;  1O64 A;  1TWY A;  3A3C A;  3IFA A;  4M4G A;  2PT1 A;  1US5 A;  2HEU A;  1VFE A;  3QMF A;  3K01 A;  3PPP A;  4JWY A;  3K0V A;  3LC8 A;  4TLM B;  1AL3 A;  2Y7P A;  1KA0 A;  1O7T A;  4DLD A;  4OEN A;  2RIN A;  1ZMG A;  3EF7 A;  5ELV A;  4ELR A;  5AA4 A;  1DK4 A;  1FBC A;  1F9B A;  2GH9 A;  3MVY A;  5H8F B;  2B4L A;  3B50 A;  4BLA A;  5J1D A;  1NV0 A;  4NMY A;  5AA2 B;  2HPG A;  1P1Q A;  3JYR A;  5FTI A;  3ZKK A;  2NOO A;  3RLF E;  3T66 A;  3R7X A;  1FPJ A;  1B0L A;  3LSL A;  5H8Q B;  5ITO A;  5A5X B;  3OO9 A;  2QJE A;  2GFE A;  5I3S A;  5K2X A;  3T96 B;  3LBS A;  5IM2 A;  1Y4C A;  2RCB A;  2Z23 A;  4BDM A;  1QUL A;  4FED A;  4NF6 B;  3TTR A;  4R74 A;  4ZS9 A;  3FUZ A;  4KQP A;  1P1N A;  5JTY A;  1NH8 A;  1M5B A;  1PB7 A;  1LBW A;  4QBA A;  1PB8 A;  4PBQ A;  1ANF A;  3WAE A;  3L6G A;  1LFI A;  1URS A;  3O6H A;  2QS2 A;  1SI0 A;  1JVX A;  4JWX A;  1TXF A;  3VV5 A;  2PT2 A;  1B0H A;  3B6W A;  5T3J A;  4OER A;  4HE1 A;  4OWD A;  5I57 A;  1QVS A;  4IGT A;  5I58 B;  4F29 A;  1FQD A;  1RDZ A;  1I6A A;  4R6K A;  4LP2 B;  1RKM A;  2DSF A;  2X26 A;  4P0G A;  4RA1 A;  2RC7 A;  3TQW A;  2RCA A;  4OVQ A;  1SD3 A;  3RTW B;  3A29 A;  1N3W A;  4OMB A;  3T9V A;  4ECF A;  2VHA A;  3IAZ A;  5EHS A;  2XXQ A;  4GL0 A;  1MQI A;  1Y20 A;  2YLN A;  1FPL A;  1NUZ A;  1RDY A;  5HBC A;  4QFP A;  3PTY A;  4OXV A;  2DE4 A;  1OIB A;  1US4 A;  2NXO A;  1N84 A;  2O1M A;  2I4C A;  2Q89 A;  3V8X B;  1JW4 A;  1H44 A;  3CVG A;  1XHY A;  3RPW A;  3H6W A;  2ZNT A;  4MCO A;  2P1S A;  3K02 A;  2ONK E;  2VPN A;  2ZYO A;  3FXU A;  3N6U A;  2DOJ A;  3Q27 A;  4FJP A;  3G3H A;  3HHG A;  3G3J A;  3CSB A;  1NNP A;  4ZEK A;  4XEQ A;  3PMX A;  4MLV A;  4FEC A;  5JTY B;  4LAT A;  3MBP A;  1LEV A;  2ABH A;  3MPL A;  3RN8 A;  2D5W A;  2ZZV A;  1NUX A;  4YKI A;  3U65 A;  4QFO A;  3K6V A;  3TUS A;  4PP0 A;  2XWV A;  3FAS A;  4L17 A;  4YKP A;  4JVC A;  2I3W A;  1B5I A;  2RKM A;  2Q2A A;  1MY2 A;  3KOS A;  3ILT B;  2H98 A;  3U8Q A;  2M8C A;  1IIT A;  1LBB A;  2DDK A;  3R26 A;  3DP4 A;  3QAX A;  4N15 A;  4DI4 B;  4YKJ A;  3RPL B;  3VVF A;  3IOT A;  1AH5 A;  4F18 A;  4NF4 A;  3S9M C;  1JEV A;  2F7B A;  2H4I A;  3MAM A;  4F3G A;  4PE5 B;  5HM4 B;  5DVJ A;  5EQA A;  2RF1 A; 
#chains in the Genus database with same CATH homology
 3BBR A;  4E0W A;  4ZE9 A;  1LBV A;  2I58 A;  2I3V A;  1SYH A;  1FW0 A;  1J1N A;  2KQZ A;  2QL3 A;  2AIX A;  2I48 A;  1FQC A;  3IK6 B;  1AIV A;  4IO7 A;  1B5J A;  3RUM A;  2PYY A;  4F31 B;  4G68 B;  2CZL A;  4MHF A;  4PGN A;  1JEU A;  5EYG A;  2NVU B;  1T0K A;  3MP1 A;  4Z0I A;  2XXY A;  2AYS A;  2PFZ A;  5I59 A;  1IXC A;  4QSD A;  4F3P A;  1LBX A;  3L6H A;  2XWK A;  4U21 A;  4N13 A;  1NMU A;  2OWS A;  1B7U A;  3VVD A;  2GQ1 A;  1BIY A;  4HW8 A;  1DTZ A;  4NQ8 A;  1MXY A;  2F34 A;  4FOR A;  2O51 A;  2DXY A;  3FJ7 A;  1M5D A;  5FHM A;  1URD A;  4F39 A;  3VXB A;  1P1U A;  2NWJ A;  2CZK A;  2ZNS A;  4N81 A;  5ISU A;  4MAG A;  2F36 A;  1JW5 A;  3KGC A;  3EHU A;  1VR5 A;  4PGP A;  5CI5 A;  2FIE A;  4NF4 B;  4FE8 A;  1SW2 A;  4X9T A;  4ZED A;  4YMB A;  5TU0 A;  4LUB A;  3TTK A;  3OD7 A;  1H43 A;  5CMK A;  3S9E A;  3IOU A;  4BDR A;  4KI0 E;  3IX1 A;  4MF3 A;  4IO5 A;  3EKI A;  3FIR A;  3EHS A;  1SPI A;  1NNK A;  5F7V A;  2V93 A;  5AA2 D;  1DMB A;  3M3K A;  2R71 A;  5IKB A;  1OVB A;  2AL4 A;  1NV3 A;  1M5F A;  4R6H A;  1GVC A;  4TQU Q;  3PUZ E;  4ND9 A;  1D9V A;  1A55 A;  1MG1 A;  2I6E A;  3MVW A;  4OQO A;  1HSL A;  4WXJ A;  1B58 A;  4GD5 A;  3A09 A;  4IO2 A;  1LST A;  1LGB C;  3FGS A;  4HCW A;  3FZV A;  4R2F A;  5I59 B;  4HE2 A;  1Y4T A;  1P1W A;  2ZYN A;  5LDZ A;  3TMG A;  4ZZE A;  5ET5 A;  1VDW A;  1USY E;  3TPA A;  4HCY A;  4LVQ A;  2F3B A;  3MP6 A;  5DYH A;  4DXC A;  4PFI A;  3PMW A;  1XVX A;  4MNI A;  3FV1 A;  4JWO A;  4P11 A;  2I0B A;  3O2A A;  4PCD A;  5H8H A;  2PFY A;  3DP8 A;  4OZ9 A;  3FJG A;  2O7U A;  4MH5 A;  3UP9 A;  1JNF A;  1FTJ A;  3ZSF A;  2V3T A;  3BIH A;  5ET7 A;  1FPF A;  2OK2 A;  5AA2 A;  1MY3 A;  4X04 A;  4IO3 A;  2P2A A;  4OEU A;  4R9F A;  3Q28 A;  2VP1 A;  1D9Q A;  1SW5 A;  1OLA A;  3HV1 A;  4KR5 A;  2OX3 A;  1NNT A;  3FV2 A;  3RT6 B;  2HXW A;  3O28 A;  2WX9 A;  4QFN A;  4ZZA A;  2P0S A;  2PVU A;  2CEX A;  3IOR A;  4PDH A;  3MZB A;  4GXS B;  3R6U A;  4NF6 A;  4OFJ A;  2A5S A;  3MZ1 A;  3ISP A;  4F22 A;  4EDP A;  2DP8 A;  4BDQ A;  1R1N A;  4O7M A;  1CNQ A;  2CZI A;  2I0C A;  3KN8 A;  1QUJ A;  1SDX A;  2OWT A;  1H76 A;  2DVC A;  4G8M A;  4UAB A;  4LZ5 A;  5I58 A;  4EXL A;  1JVY A;  4GXA A;  3PPO A;  4NG7 A;  4PE3 A;  3UK4 A;  1FQA A;  5ET6 A;  4M1V A;  4MJO A;  3IR1 A;  4GOT A;  4P3L A;  4ISU A;  5AA3 A;  5ET8 A;  3KBR A;  3M8U A;  3P7I A;  4GQO A;  1PEB A;  4PFY A;  3O66 A;  2Y5L A;  1B5H A;  1QGX A;  3H06 B;  4U1O A;  4R72 A;  4H8J A;  5DVI A;  1IQ7 A;  1Q35 A;  4AB5 A;  5H8H B;  2QPQ A;  2YJP A;  3C31 A;  1FPI A;  3VXC A;  4ELO A;  3CG3 A;  1RDX A;  1MM6 A;  1MQG A;  4IGR A;  3PPN A;  1NI9 A;  3ROJ A;  3Q29 A;  1P99 A;  4P0I A;  4RYA A;  1NH7 A;  2IA4 A;  5M2V A;  4U23 A;  3GZG A;  3W15 C;  4EQ9 A;  4LN5 A;  3KN7 A;  1LCT A;  4ZEF A;  4N6D A;  2BJJ X;  3FXB A;  2VGQ A;  4N91 A;  1NV7 A;  4I9D A;  1EYK A;  4YB7 A;  1EZ9 A;  4MIJ A;  4N07 A;  4AS5 A;  1SI1 A;  1DCU A;  5KZT A;  2ALU A;  1M5C A;  2FYI A;  3S2V A;  1QKA A;  5CC2 A;  1WOD A;  3UN6 A;  1B1X A;  3TTL A;  1D3K A;  4EXK A;  1MXV A;  2VPO A;  2H5Y A;  2O7I A;  3SEX A;  2DYX A;  4HTG A;  1EH3 A;  4PF8 A;  4F19 A;  4YIC A;  4IR8 A;  3MQ9 A;  1XVY A;  1TFA A;  4JVD A;  4X1B A;  1NV2 A;  5EQ8 A;  4MFI A;  1LAG E;  2PCR A;  3IO4 A;  1FJ6 A;  2X7Q A;  3N94 A;  1FBP A;  3RPL A;  3KSJ A;  1MM7 A;  3MC2 A;  2Y7K A;  1BK4 A;  1XOC A;  4G8H A;  1EYJ A;  1IMF A;  1G0I A;  2Z8F A;  2XXP A;  5AE4 A;  3H6V A;  5L9S A;  1URG A;  4KD5 A;  1IMB A;  3K6W A;  2XXR A;  4GWY A;  5KCJ B;  3LV0 A;  1PBP A;  1MY1 A;  1YAE A;  1N7W A;  3THI A;  1I6Q A;  3TYH A;  2ANJ A;  4JB7 A;  3USD A;  3SZP A;  3I3V A;  4O8M A;  1NNF A;  4U1Z A;  4KHZ E;  4QRZ A;  4R75 A;  4E0X A;  2DQV A;  2XWI A;  2F7A A;  1D4N A;  4G68 A;  4PC9 A;  4WKM A;  3TTN A;  1B7H A;  5ESY A;  4NAP A;  3MZ9 A;  3QXM A;  3C32 A;  2QS1 A;  3G3K A;  3GLB A;  3O9P A;  4GIZ A;  4H45 A;  2QMW A;  3RQT A;  4AS4 A;  3MYU A;  2L5V A;  3H6T A;  5ITP A;  4O3C A;  4G61 A;  1PB9 A;  1N0T A;  3UGW A;  3GYY A;  3PMV A;  3TOD A;  1D9Y A;  2H99 A;  1NV5 A;  1B4Z A;  3E79 A;  1B46 A;  1B2H A;  1KZ8 A;  3TQL A;  2H9B A;  4Q8R A;  1LBZ A;  1G0H A;  3NOH A;  4C0R A;  1RYX A;  2LAO A;  4AQ4 A;  4KYE A;  3EN3 A;  4N4U A;  3DM0 A;  4HXV A;  1NFT A;  2VD2 A;  2QSX A;  4RPN A;  4POX A;  2R6G E;  4X48 A;  1YPN A;  4P8B A;  3KZG A;  4F3S A;  4DCX A;  3KBZ A;  3IOV A;  3C33 A;  4GBV A;  3E13 X;  3T9X B;  5TPA A;  5JK4 A;  5F24 A;  1FQE A;  1DPP A;  5CBR A;  2ZYK A;  5L8D A;  4DXB A;  4EQB A;  1GGG A;  2HAV A;  1CB6 A;  4IO6 A;  1Y1M A;  1UQW A;  3PUV E;  4YB5 A;  1Y3P A;  4DXU A;  1LLS A;  4BDL A;  4F2Q A;  4H46 A;  1B52 A;  4OVS A;  1B1H A;  2G93 A;  3RY3 A;  1IUD A;  5DTB A;  4RPO A;  3EPE A;  3H03 A;  3OMB A;  1HSE A;  3MVX A;  1UTH A;  4N8Y A;  3HO7 A;  4F2O A;  1MY0 A;  4POW A;  4THI A;  1AMF A;  1SW4 A;  4I3Y A;  3JV9 A;  3OO7 A;  2O1L A;  3G3F A;  3O6I A;  1LFG A;  5TP9 A;  3VE1 B;  4PET A;  2ONS A;  1B3F A;  1GR2 A;  3PGF A;  3KFM A;  5IZ3 A;  3BFT A;  4WEP A;  3UIF A;  1BP5 A;  2V4C A;  4DIG A;  3VLV A;  4XKP A;  4NGU A;  2F6P A;  1I69 A;  4I8C A;  3K6X A;  4FBP A;  2F6G A;  1Y3Q A;  3SEW A;  3PU5 A;  1OLC A;  3OEN A;  4ZDM A;  5K2Y A;  1B3G A;  1INP A;  3KEI A;  4LQ5 A;  5CMB A;  2OBG A;  1EZP A;  3MP8 A;  1QJM A;  3MPK A;  3VVE A;  4MX6 A;  2W7Y A;  3KJT A;  4GWU A;  2D3I A;  4Q5T A;  1BKA A;  4LZ8 A;  1FJ9 A;  1MXW A;  4QXD A;  1OMP A;  3FVG A;  4NF0 A;  2B3F A;  1ZIU A;  3LSF B;  2DWJ A;  2Q88 A;  3EHT A;  4OHN A;  1MPC A;  3FD3 A;  1IME A;  2PX1 A;  1MXU A;  1EU8 A;  3S4U A;  3KG2 A;  1K9Y A;  1I6B A;  2V3Q A;  2VOZ A;  3MJN A;  5TPA B;  2ZNU A;  4MLQ A;  3CI8 A;  4K3F A;  4NWC A;  2MKZ A;  1IEJ A;  2XX9 A;  5ICQ A;  1RYO A;  3U94 A;  4PBH A;  5I56 A;  3K00 A;  1ZLQ A;  5FHO A;  5I84 A;  2WYP A;  4JSD A;  4F1V A;  3G3G A;  2HZK A;  1MY4 A;  5H8N B;  2DE2 A;  3BKI B;  2XXK A;  4XTC Q;  3IB0 A;  4OYV A;  4UAC A;  2O84 X;  3T0J A;  1UTH B;  2R9J A;  2RC9 A;  2DVZ A;  4EF2 A;  3SDF A;  3S9N C;  4DI3 D;  3ONM A;  4P1E A;  1UIU A;  5TP9 B;  5ICT A;  1N04 A;  4PAK A;  5LOM A;  4NX1 A;  3B8B A;  3CSG A;  4XKR A;  4R9G A;  3HST A;  4DCY A;  1TFD A;  2HHM A;  5KDT A;  3M3L A;  5DVF A;  1FTM A;  1FBE A;  5IZ3 B;  3CFL A;  2ZXT A;  1ATG A;  2FHY A;  5LTC A;  2Y5K A;  3T22 A;  3MW0 A;  4O3A A;  2V3U A;  3K1N A;  1FCK A;  2HCA A;  4IY5 A;  1S9T A;  4MEV A;  2CMO A;  3CFZ A;  1K9Z A;  3C36 A;  1FPD A;  1JP4 A;  5CMC A;  3IOW A;  3B6Q A;  1MXZ A;  2AL5 A;  4YZZ A;  4HS7 A;  3FAT A;  3BIG A;  1H45 A;  1ZBM A;  4H65 A;  1MDQ A;  2CEY A;  1EYI A;  5I2K A;  2XXH A;  3IFC A;  4PDD A;  1NL5 A;  1FRP A;  4NF8 A;  2D21 A;  1FTO A;  2E0S A;  3AXF A;  4XF5 A;  1PBQ A;  2ONR A;  2QVU A;  1B40 A;  5EQ9 A;  1JQF A;  4Z7E A;  5I56 B;  4PF6 A;  2XHD A;  5BWJ A;  3LUZ A;  3H6U A;  2ZZW A;  1NV4 A;  4OES A;  2WEF A;  3TDJ A;  2XA5 A;  1XT8 A;  5CRY A;  3H4Z A;  2XXU A;  5CM6 A;  3HFU A;  2Y7R A;  3SKP A;  1WDN A;  3K6U A;  1N76 A;  4UA8 A;  4XFE A;  2B65 A;  4XKQ A;  4LA9 A;  2B3B A;  3D4C A;  4QSC A;  4KCD A;  2UVH A;  5IAI A;  2Q8J A;  1EZO A;  1FBG A;  4GX4 A;  2KLF A;  3E9X A;  2V84 A;  3FBP A;  5DEX A;  5L9O A;  1LB8 A;  2XXI A;  5DT6 A;  3TEL A;  3E78 A;  4RJZ A;  2Q2C A;  3TEP A;  4PQJ A;  1SQY A;  5KDT B;  1MRP A;  1GTK A;  1MH4 A;  4NWD A;  4N6K A;  3FJM A;  2E1S A;  5HPQ A;  1XC1 A;  3GBB A;  4IB2 A;  2F7C A;  2Y7W A;  2HFB A;  3U93 A;  5DW8 A;  2XXV A;  3C4M A;  4R73 A;  5KCJ A;  1LFH A;  4H67 A;  1SBP A;  2ZYM A;  4HE0 A;  3HN0 A;  1Q9D A;  1P1O A;  3SEU A;  2HZL A;  4GRK A;  3OEK A;  1FTL A;  3OEL A;  4TOZ A;  5BUU A;  1ELJ A;  3T93 B;  4BDO A;  2FIX A;  4U2R A;  4OET A;  2OZZ A;  4IO4 A;  4G77 A;  5I2K B;  3HHF A;  4QF9 A;  4MNP A;  4F3B A;  4I62 A;  3E4R A;  3SET A;  4KFQ A;  4NF8 B;  4FEB A;  1R6Z A;  2QMX A;  3K4U A;  3VFJ A;  1ZKB A;  3K2D A;  2Y84 A;  4PTK A;  3C9H A;  3OXN A;  3B7D A;  4LQ2 A;  4GVO A;  5I2N A;  2HQ0 A;  1FPB A;  1CE2 A;  1UTB B;  1IXI A;  4OVR A;  1A54 A;  1Y1Z A;  4QFL A;  1ZU0 A;  3RTF B;  4PFR A;  4IY6 A;  2REG A;  4JSO A;  3N6T A;  4DE8 A;  1A8E A;  4OVP A;  4C1T A;  1B32 A;  4GWW A;  1Q1K A;  3KN3 A;  4ZEI A;  4GFR A;  4X8R A;  3TCG A;  2XXT A;  4QHQ A;  1MPD A;  1LAX A;  3N26 A;  4KCC A;  5DEX B;  4QSE A;  2GHA A;  4KYS A;  2Q8M A;  1UIV A;  3IB1 A;  1FQB A;  3BFU A;  3ODB A;  1DPE A;  3KSX A;  1YZ0 A;  1H3D A;  4NHB A;  3O29 A;  5B7D A;  1B7Z A;  3I5O A;  1PDA A;  1MQH A;  2FBP A;  2R8T A;  5EYF A;  4LON B;  4O7I A;  2ZMB A;  3H3G A;  2Q74 A;  3SER A;  1IIW A;  4I1D A;  5F1Q A;  2OJT A;  3T9H B;  5CBS A;  3TFL A;  4KPT A;  1DBZ A;  3VLW A;  2ZZX A;  1YTV A;  2WBB A;  2XX8 A;  4PFU A;  3PV0 E;  1DSN A;  4GL8 A;  3OO6 A;  1DOT A;  3GBA A;  5IGA A;  3ZS6 A;  3IO6 A;  4AB6 A;  4PFW A;  2GHB A;  3IL1 B;  4P47 A;  2V25 A;  4RK2 A;  1M5E A;  2O69 A;  3U72 A;  2DXR A;  3MUQ A;  4G8N A;  3CFX A;  4XXU A;  1LBC A;  5AA4 B;  2Q9T A;  3E3K A;  1B3E A;  2FA7 A;  2DWA A;  2PBW A;  1N3X A;  2A5T A;  2O68 A;  3IJX B;  2F35 A;  2H25 A;  4ZEC A;  4I3E A;  4EF1 A;  1YCJ A;  1A7L A;  2YPN A;  3W9W A;  1GV8 A;  1FPG A;  3T1B A;  3QUJ A;  3OO8 A;  2OCU A;  4RXL A;  4P1L A;  5I2N B;  1ZJL A;  2DS9 A;  4DZ1 A;  1IMD A;  3K1M A;  3KOT A;  3IB2 A;  4YB6 A;  1XS5 A;  3I6V A;  1NV1 A;  2UXA A;  1B9J A;  4ZEB A;  2QS3 A;  3FVK A;  1AWB A;  1TT1 A;  4F1Y A;  1FTA A;  1FPK A;  2BJI A;  1A8F A;  4ESW A;  4KYD A;  5IZ1 A;  3LSW A;  1B6H A;  3C35 A;  4H1X A;  1II5 A;  3PUY E;  4ZE8 A;  4ELP A;  4G2Z A;  3PPQ A;  1WVJ A;  5J16 A;  5L9M A;  4FAT A;  2QFL A;  4OVJ A;  5I57 B;  4OAN A;  1L5T A;  4JBZ A;  3PUX E;  3PD8 A;  2CZH A;  3KJ7 A;  1O63 A;  4R6Y A;  3ECR A;  4RY1 A;  3Q25 A;  5JEI A;  3ZKL A;  2WYK A;  5CMM A;  1B3H A;  1S50 A;  1LAH E;  3G3I A;  4FIM A;  1KWH A;  5H8N A;  3MST A;  4Q30 B;  3DEL B;  1USY H;  2UYF A;  1SVX B;  2WKY A;  1LAF E;  2GRV A;  2XXW A;  3OEM A;  1NUW A;  2XWO A;  4JVI A;  1LBY A;  3D4G A;  1QUK A;  1IMA A;  2UVI A;  5A5L A;  3EQ1 A;  2A5T B;  4PAI A;  1VFD A;  2OWZ A;  1R9Q A;  5EQ7 A;  3HCQ A;  3N5L A;  4YU0 A;  1AOV A;  3DLN A;  3T9U A;  4OA4 A;  4DDD A;  2FVZ A;  3LSX A;  4RNS A;  3IJO B;  2Z8E A;  3OSQ A;  3V89 B;  1KA1 A;  2VT5 A;  4GWX A;  4WED A;  4GWS A;  4PFB A;  3UOR A;  1JET A;  1QKB A;  3K1P A;  1IXH A;  5I5P A;  2P3N A;  4TLL B;  1Z7N E;  1NV6 A;  4P56 A;  2I49 A;  2RC8 A;  3CIJ A;  3CR9 A;  3U1O A;  4U4X A;  2WBD A;  4XIG Q;  1LCF A;  4H0W A;  2THI A;  4KXP A;  4O94 A;  4QFK A;  3G7W A;  1MQJ A;  1B05 A;  2HXR A;  2DWI A;  2Z8D A;  3JZJ A;  5FBP A;  2XD2 A;  3TCF A;  4ESX A;  2O6A A;  4H6D A;  4MNC A;  4N17 A;  5B70 A;  1MDP 1;  1MQD A;  3PD9 A;  4C1U A;  3TCH A;  1B4H A;  3U92 A;  4GWO A;  3CHG A;  3WAF A;  1IMC A;  2HAU A;  2F8D A;  3VDF A;  3FVO A;  1N7X A;  1A99 A;  2I4B A;  3OSR A;  2KR0 A;  1SW1 A;  3TTM A;  1R9L A;  5H8S A;  2DE3 A;  2PMS A;  4O3B A;  3A3U A;  2F3D A;  4NF5 A;  3OOA A;  4GLI A;  2JJK A;  4F1U A;  4GBW A;  4ELQ A;  5IZZ A;  3KC1 A;  3PUW E;  3Q26 A;  2F97 A;  3TKD A;  2F5X A;  3QYT A;  1FSA A;  3UA8 A;  3FVN A;  4PFT A;  2QRY A;  1POT A;  3DP6 A;  4H8I A;  3PPR A;  4NE4 A;  4GF8 A;  2XD3 A;  3RYD A;  3QIM A;  4I40 A;  2NUV A;  3TAJ A;  4P9K A;  3LR1 A;  3GXA A;  3M3F A;  1VE4 A;  3O6G A;  3RGY A;  4Q0C A;  3KC0 A;  2G29 A;  4MMP A;  4OVT A;  4OFL A;  4YKK A;  1JW1 A;  4H5F A;  3C34 A;  4FAJ A;  1IZ1 A;  3FXQ A;  3HPI A;  5EHM A;  1POY 1;  3S9L C;  3CRB A;  3V5A A;  4X1D A;  3SEY A;  4EUO A;  4PAF A;  3FXR A;  1FBH A;  1B3L A;  2FNC A;  1NUY A;  4RK9 A;  1IXG A;  4R2B A;  4NED A;  3MVZ A;  1MH3 A;  3SEV A;  1BTJ A;  3O97 A;  3H7M A;  2ESN A;  3RT8 A;  2XXX A;  1NKX A;  4JXI A;  1SYI A;  5H8F A;  2REJ A;  3LUY A;  2QS4 A;  1MS7 A;  3D1R A;  1A40 A;  3CG1 A;  2Y7I A;  1MPB A;  2UVG A;  2IEE A;  3SES A;  4N8G A;  4GWZ A;  5AA1 A;  3QK6 A;  1S7Y A;  1YXI A;  1FBD A;  3ILU B;  3QSL A;  1YYZ A;  1QUI A;  1DTG A;  2UVJ A;  4GX3 A;  3QUF A;  2F78 A;  5H8Q A;  1Y9U A;  5A5X A;  1UTB A;  1FPE A;  4JDF A;  4OEV A;  1Y3N A;  1OQG A;  1MXX A;  4XKN A;  5EYH A;  2VD3 A;  5FHN A;  4NN3 A;  4G4P A;  1FQF A;  4NF5 B;  3W9V A;  1HSJ A;  1FBF A;  1OVT A;  2X7P A;  3VLU A;  4LZ7 A;  1Z7M E;  3MWB A;  4OTE A;  2Z22 A;  1LB9 A;  4U4S A;  4EQ7 A;  2QVV A;  2P3V A;  1QW0 A;  4BDN A;  1ZTY A;  2QVR A;  1BLF A;  4ONY A;  5I7I A;  1PC3 A;  1OQH A;  2DWH A;  4YAH X;  2OLB A;  4U22 A;  4N6P A;  2B4M A;  4OFO A;  4H5G A;  1B51 A;  4NTL A;  3B6T A;  3TZA A;  3V83 A;  3F11 A;  4G68 C;  4GX6 A;  5FTH A;  1XI6 A;  1VSO A;  2UYE A;  2XX7 A;  4MBP A;  3RNN A;  4YMA A;  1FTK A;  1O64 A;  1TWY A;  3A3C A;  3IFA A;  4M4G A;  2PT1 A;  1US5 A;  2HEU A;  1VFE A;  3QMF A;  3K01 A;  3PPP A;  4JWY A;  3K0V A;  3LC8 A;  4TLM B;  1AL3 A;  2Y7P A;  1KA0 A;  1O7T A;  4DLD A;  4OEN A;  2RIN A;  1ZMG A;  3EF7 A;  5ELV A;  4ELR A;  5AA4 A;  2GH9 A;  1F9B A;  1DK4 A;  3MVY A;  1FBC A;  5H8F B;  2B4L A;  3B50 A;  4BLA A;  5J1D A;  1NV0 A;  4NMY A;  5AA2 B;  2HPG A;  1P1Q A;  3JYR A;  5FTI A;  3ZKK A;  2NOO A;  3RLF E;  3T66 A;  3R7X A;  1FPJ A;  1B0L A;  3LSL A;  5H8Q B;  5ITO A;  5A5X B;  3OO9 A;  2QJE A;  2GFE A;  5K2X A;  3T96 B;  5I3S A;  3LBS A;  5IM2 A;  1Y4C A;  2RCB A;  2Z23 A;  4BDM A;  1QUL A;  4FED A;  4NF6 B;  3TTR A;  4R74 A;  4ZS9 A;  3FUZ A;  4KQP A;  1P1N A;  5JTY A;  1NH8 A;  1M5B A;  1PB7 A;  1LBW A;  4QBA A;  1PB8 A;  4PBQ A;  1ANF A;  3WAE A;  3L6G A;  1LFI A;  1URS A;  3O6H A;  2QS2 A;  1SI0 A;  1JVX A;  4JWX A;  1TXF A;  3VV5 A;  2PT2 A;  1B0H A;  3B6W A;  5T3J A;  4OER A;  4HE1 A;  4OWD A;  5I57 A;  1QVS A;  4IGT A;  5I58 B;  4F29 A;  1FQD A;  1RDZ A;  1I6A A;  4R6K A;  4LP2 B;  1RKM A;  2DSF A;  2X26 A;  4P0G A;  4RA1 A;  2RC7 A;  3TQW A;  2RCA A;  4OVQ A;  1SD3 A;  3RTW B;  3A29 A;  1N3W A;  4OMB A;  3T9V A;  4ECF A;  2VHA A;  3IAZ A;  5EHS A;  2XXQ A;  4GL0 A;  1MQI A;  1Y20 A;  2YLN A;  1FPL A;  1NUZ A;  1RDY A;  5HBC A;  4QFP A;  3PTY A;  4OXV A;  2DE4 A;  1OIB A;  1US4 A;  2NXO A;  1N84 A;  2O1M A;  2I4C A;  2Q89 A;  3V8X B;  1JW4 A;  1H44 A;  3CVG A;  1XHY A;  3RPW A;  3H6W A;  2ZNT A;  4MCO A;  2P1S A;  3K02 A;  2ONK E;  2VPN A;  2ZYO A;  3FXU A;  3N6U A;  2DOJ A;  3Q27 A;  4FJP A;  3G3H A;  3HHG A;  3G3J A;  3CSB A;  1NNP A;  4ZEK A;  4XEQ A;  3PMX A;  4MLV A;  4FEC A;  5JTY B;  4LAT A;  3MBP A;  1LEV A;  2ABH A;  3MPL A;  3RN8 A;  2D5W A;  2ZZV A;  1NUX A;  4YKI A;  3U65 A;  4QFO A;  3K6V A;  3TUS A;  4PP0 A;  2XWV A;  3FAS A;  4L17 A;  4YKP A;  4JVC A;  2I3W A;  1B5I A;  2RKM A;  2Q2A A;  1MY2 A;  3KOS A;  3ILT B;  2H98 A;  3U8Q A;  2M8C A;  1IIT A;  1LBB A;  3R26 A;  2DDK A;  3DP4 A;  3QAX A;  4N15 A;  4DI4 B;  4YKJ A;  3RPL B;  3VVF A;  3IOT A;  1AH5 A;  4F18 A;  4NF4 A;  3S9M C;  1JEV A;  2F7B A;  2H4I A;  3MAM A;  4F3G A;  4PE5 B;  5HM4 B;  5DVJ A;  5EQA A;  2RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...