1S50A

X-ray structure of the glur6 ligand binding core (s1s2a) in complex with glutamate at 1.65 a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
SNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: Molecular mechanisms underlying kainate receptor selectivity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate Receptor 6
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2004-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s50A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s50A02
5H8QA 5HBCA 4ZZAA 3L6HA 1CB6A 1TWYA 1FCKA 2M8CA 1XVXA 2REGA 1MS7A 2PT1A 3FXQA 4OEVA 1NFTA 3KJTA 3Q29A 2ONKE 3TQWA 4FAJA 2O51A 3JZJA 2FA7A 5ICTA 2HQ0A 2IEEA 3A09A 4X48A 3SERA 2YPNA 3DP6A 2H99A 1SYIA 4KCDA 4XTCQ 1B46A 3TZAA 1WVJA 2QMWA 3KGCA 2UVIA 2Z8FA 1NNKA 3VXBA 4H5FA 4R6KA 3HPIA 4QFPA 3H6VA 4NF8A 2OBGA 3EF7A 3CI8A 2XHDA 2THIA 3MVYA 4MFIA 3TMGA 4RPOA 5L9MA 1VFDA 1Y9UA 2CMOA 4QSEA 4OETA 4ZEFA 2ALUA 1B7UA 1DPEA 3KOSA 3D4GA 2B65A 3PU5A 3G3GA 4N07A 2AL5A 4KPTA 4U1OA 3C33A 4EF2A 5B70A 5KZTA 2OZZA 4X9TA 1BP5A 1OVBA 2H4IA 4JBZA 4F1UA 1QULA 2PX1A 1LAFE 3OO6A 5H8FB 4AB6A 2I4BA 5TP9A 2CZLA 2B3FA 1UTHB 4ELOA 5I56B 4NF4B 4GXSB 3F11A 1QUJA 4F22A 4YB6A 4LQ2A 3C9HA 4KYSA 4H65A 3M3KA 4KYEA 1Y20A 1A55A 3QUFA 3W9VA 3FJGA 1P1OA 3BFUA 3GZGA 3FJ7A 4OMBA 3RT8A 1NH7A 3JV9A 2AIXA 4YU0A 3QXMA 1IXCA 1A8EA 1URDA 4BDRA 2HZKA 4C1UA 4YKJA 1MQGA 3PPOA 3GXAA 1QUIA 1VR5A 3VV5A 4DIGA 5I84A 4GIZA 3HHFA 3PD8A 4IB2A 1QVSA 4QF9A 1PC3A 3RY3A 5BWJA 1B6HA 1MY1A 1MXXA 1B58A 4R9FA 4NMYA 4EQ9A 1O63A 3RPWA 3RGYA 4DCXA 3BFTA 4F39A 1FQBA 2G93A 1JW5A 2OJTA 3KJ7A 4X1BA 5ICQA 2F5XA 4FEDA 4NF6B 2F36A 4NTLA 2FYIA 2XXHA 4G68C 1WODA 5ITOA 5KDTB 4LATA 2I0CA 2GH9A 4NEDA 3T9VA 5CMCA 2OK2A 3G7WA 2RCAA 2DQVA 3VVFA 5L8DA 1A99A 2RKMA 3FVOA 2XD3A 3O97A 1OMPA 1ZIUA 3HCQA 1N3WA 2ANJA 2DE3A 3FD3A 4PETA 3OSQA 5I56A 1FTOA 2UXAA 4F3PA 4MH5A 1Y4TA 5TPAA 1II5A 5ISUA 4F29A 5J1DA 1J1NA 1VFEA 4YB5A 2O84X 2NVUB 3UP9A 2XX7A 2XXUA 3I3VA 2H9BA 2V84A 1DMBA 1MH4A 1Y4CA 3IJOB 2RF1A 4L17A 4OFJA 1USYE 4QSDA 4X1DA 4EQ7A 3O28A 3S9MC 1PB9A 4G8HA 2I48A 1EZPA 1IXIA 1N3XA 3TYHA 4DCYA 3QIMA 1I6AA 1DSNA 2ZMBA 3GBBA 1LLSA 1I6QA 3HHGA 2GHBA 1GV8A 2VGQA 1HSLA 2I0BA 3H6TA 3K6XA 1ANFA 1LCFA 1ZLQA 3KSXA 2DOJA 4GXAA 3DP4A 5H8NA 4GF8A 1D3KA 4DDDA 3PPPA 3HN0A 1Z7NE 1ZKBA 3K01A 5HPQA 4JWXA 4WEDA 1GTKA 1PB7A 4F3GA 1H45A 3VDFA 3LC8A 3PUZE 2ZYNA 3OO7A 1ATGA 4U22A 5FHMA 3WAFA 1Z7ME 1AOVA 1LAHE 4YB7A 2I4CA 1A7LA 3FGSA 2RCBA 3H3GA 1T0KA 4IGTA 3IK6B 3TCHA 3VVDA 1F9BA 2QRYA 2VP1A 3E9XA 4G68B 4MBPA 4F1VA 1XT8A 3H03A 3OENA 4PE5B 1PBPA 4OESA 2BJJX 3OEKA 1SVXB 4YKKA 3K4UA 1UTHA 4QHQA 1MQIA 4QSCA 3VLWA 1XC1A 1H76A 4TOZA 1LAXA 1N84A 4QFOA 5CI5A 4ZEKA 2YJPA 4DXUA 4R74A 2HXWA 3LSWA 1Q1KA 1SD3A 1D4NA 3GBAA 3U93A 2W7YA 4XKPA 2RC9A 3PPQA 5DEXA 5AA4B 3FXRA 3PMWA 3KZGA 3CFXA 5DYHA 2V3UA 3SEWA 3UIFA 5KDTA 4KYDA 3O66A 4GL8A 4POWA 3FVKA 5CBSA 1DTZA 3OOAA 5L9OA 2Q89A 3SEXA 5JK4A 1YPNA 1OLCA 3H4ZA 3FZVA 1MXWA 3N5LA 3IOWA 1B52A 2OCUA 4G77A 1YAEA 3TTNA 3CVGA 3EQ1A 5AA2D 3CFZA 3G3IA 1A54A 4WKMA 1MPDA 4BDMA 5IKBA 5I2NA 2F97A 5AA4A 1US4A 3KN3A 3N94A 4YAHX 5CM6A 3C31A 1BLFA 2XXQA 3HSTA 3QK6A 5A5XB 3A3UA 5DT6A 1JEUA 3BKIB 3IB2A 1B40A 4JB7A 4XKQA 4JSDA 1OQHA 1SW4A 3MBPA 4XKNA 4Q0CA 2O7IA 3O9PA 3T9HB 5KCJB 2F7AA 3Q25A 4IO6A 1MPBA 1SBPA 1N0TA 3PUVE 3K02A 5L9SA 3SETA 1FQDA 3K1MA 3MP8A 3IX1A 1URGA 3TCFA 4AB5A 2REJA 1IUDA 3G3JA 4Q5TA 3B7DA 1I6BA 3OO9A 4GRKA 4F2QA 1OQGA 2A5TA 1AMFA 1SYHA 4KFQA 2GFEA 3TAJA 5DVIA 3AXFA 4LQ5A 3PV0E 1IIWA 3IL1B 3MVXA 1R9QA 1PEBA 5I57B 4LZ7A 3O6IA 4LONB 4NF4A 1JW1A 3D4CA 2H25A 2UYFA 4ND9A 4QFLA 1IXGA 5H8FA 4RPNA 3KG2A 1MY4A 4R6YA 3H6WA 4EXLA 3R6UA 2RC7A 5CMBA 2I3WA 4KI0E 5KCJA 1GR2A 1MDQA 1PDAA 2Q2AA 1Y1MA 3OSRA 3V83A 1P1NA 3TTLA 4ESXA 2FNCA 3IORA 2QS2A 3MZ1A 2UVJA 3Q27A 4U4SA 1S50A 2ZNSA 4YKIA 3QYTA 3KEIA 3ECRA 4HS7A 4PFWA 1I69A 5EHSA 3U72A 4C1TA 1B3HA 4KQPA 1N7XA 2QS1A 2D5WA 4IO5A 5BUUA 1RYOA 5CMKA 3QAXA 1MXZA 1EZ9A 4ELQA 3WAEA 2OWSA 1UIUA 5I2KA 2O6AA 5EHMA 1BKAA 1P1WA 3UGWA 4JXIA 2HZLA 1M5BA 1IZ1A 1M5FA 1TFDA 1XOCA 2X7QA 3M8UA 2UVGA 3MP6A 1H43A 1URSA 4IY6A 4MF3A 3V89B 2VD3A 4ECFA 3ZS6A 1SI1A 4IGRA 4MLVA 1B3EA 2YLNA 4OERA 4G68A 4RYAA 2XXXA 3CR9A 4GQOA 1QKAA 4NF5A 4RJZA 2AYSA 3K00A 3MWBA 1B2HA 3ONMA 1AH5A 2Y7KA 2ZNUA 3N26A 4TQUQ 3S9NC 5H8HB 1LGBC 5DVJA 3Q26A 3QSLA 1O7TA 1POY1 4IO7A 4G4PA 4KCCA 4PQJA 4RK9A 1GGGA 2HEUA 1LAGE 3G3HA 5HM4B 3G3FA 3TCGA 4YKPA 1IQ7A 3T9UA 3FIRA 4ELRA 1FQCA 1LBBA 2E1SA 1R1NA 3OEMA 1AL3A 4HCWA 1PBQA 1B1XA 3DLNA 3V5AA 5IAIA 1JEVA 2ABHA 1LSTA 4OZ9A 1B5JA 4OTEA 2F8DA 5CRYA 4GWOA 3UN6A 3MJNA 1B51A 4IO3A 3FV2A 3TTMA 3TPAA 3CSBA 1R9LA 4DZ1A 1MDP1 2DYXA 4R73A 4KD5A 1LB9A 1HSEA 1QW0A 1SI0A 4AQ4A 4ZS9A 3K6WA 3C32A 4I8CA 3LSLA 1YCJA 2V3QA 4F1YA 4YZZA 5LOMA 3KBRA 2XD2A 2Y7IA 3TKDA 4EUOA 3TFLA 2DWHA 3O29A 5DVFA 3K0VA 4YICA 3PGFA 5FTIA 4THIA 4Z7EA 5I57A 3S2VA 2XXVA 1S9TA 3VLUA 3VXCA 1LFHA 2F7CA 3G3KA 1RKMA 1B4ZA 4LVQA 1MH3A 4FE8A 2A5TB 3H6UA 1OVTA 4RA1A 2PT2A 3ZKLA 1BIYA 2QMXA 3MZ9A 4GOTA 4TLMB 1NL5A 1IEJA 3LR1A 3M3LA 3JYRA 2R6GE 1NH8A 4H0WA 4YMAA 1MQDA 3MW0A 2V3TA 4N13A 1IITA 3N6UA 4NWCA 4I9DA 1FTLA 4UACA 4UA8A 4PFUA 1QKBA 1PB8A 4OENA 4M4GA 5FHOA 1XHYA 2ZXTA 1NMUA 3S9EA 2ZYOA 3C35A 4BDOA 4OVJA 2GHAA 1VE4A 3C34A 1A40A 1TT1A 3TELA 4HW8A 3RLFE 4O3AA 2F78A 3RT6B 2XXIA 1US5A 1DOTA 2UYEA 1FW0A 1M5EA 1NKXA 2F7BA 1OLAA 3IAZA 3FASA 3O6HA 4HTGA 1VSOA 4U4XA 1A8FA 5JTYA 3MVZA 1M5CA 2D21A 3IO4A 3CG1A 3OELA 2X7PA 3DELB 4GD5A 4I62A 4JWYA 4PFYA 5AA3A 1UQWA 4R75A 1H44A 1RYXA 2ONSA 4RNSA 2QS4A 2D3IA 1B4HA 1JW4A 1UTBA 1FTKA 1IXHA 1B5HA 1QUKA 1S7YA 1N04A 2AL4A 3B6WA 1B3FA 2O1LA 2Q88A 3LBSA 4F3SA 2LAOA 3I6VA 3PUXE 4EXKA 2I58A 3ZSFA 1P99A 5B7DA 2DWAA 3FXUA 5DTBA 3TEPA 1Y3QA 5FTHA 2HCAA 1UIVA 2HAVA 4Z0IA 3SDFA 1MXUA 2Z8DA 4NE4A 2F6GA 1B9JA 5CBRA 1N7WA 4U21A 2XXRA 2DXYA 2XXYA 2V25A 2G29A 4ZEBA 1B3GA 3LSXA 5H8SA 4XKRA 3O2AA 1WDNA 2WKYA 1CE2A 2DWIA 5TP9B 2XXTA 4LZ5A 4EDPA 3Q28A 3FV1A 4ZE9A 4EF1A 1O64A 4HCYA 1B32A 5CC2A 1FQFA 2O69A 1MM6A 3OXNA 3PUWE 1Q35A 1B05A 1FQAA 1H3DA 3EN3A 4FIMA 3VE1B 4R2BA 4F2OA 2H98A 1M5DA 2DVZA 2PMSA 3N6TA 3K1NA 3PMVA 4RXLA 5H8QB 1HSJA 5AA2B 3TUSA 2ONRA 2XX8A 3K1PA 4GFRA 4BDNA 3K6VA 4NF8B 3CSGA 3KN7A 4ZEDA 2DWJA 4K3FA 4DLDA 2IA4A 1XVYA 3L6GA 2F6PA 1SW5A 1MY0A 1UTBB 2PVUA 2X26A 3E4RA 4R2FA 3U1OA 3T66A 2DP8A 3S4UA 3UK4A 2XXWA 4O3CA 4XXUA 3B6QA 4FEBA 2F35A 1SW1A 1LFIA 2Q9TA 2XXPA 3IB0A 4LP2B 3MP1A 3MPLA 2Y7RA 2DE2A 3K2DA 3T9XB 3LSFB 3PUYE 3DP8A 1FTJA 4NF5B 3RQTA 5TPAB 2Q8JA 3CG3A 3UORA 1SQYA 4FATA 4IO4A 1LCTA 1USYH 4P0GA 3E13X 2DXRA 2ZYKA 4U23A 3I5OA 1Y3NA 4PFTA 3MUQA 1ZJLA 4YMBA 3USDA 3FUZA 1ZBMA 1TFAA 1YTVA 4IY5A 3S9LC 1MXYA 2VOZA 3RUMA 5FHNA 3THIA 5H8NB 1JVXA 4F31B 3U8QA 3ODBA 4QFNA 3SKPA 3DM0A 2GRVA 5K2XA 1ZU0A 2I6EA 2Z23A 1LFGA 4H67A 4P11A 2XX9A 4GLIA 3VVEA 3HO7A 4QRZA 3MZBA 1OIBA 2ESNA 4DXBA 4ZECA 3E3KA 1MM7A 2DVCA 3A3CA 4PP0A 2RINA 5F7VA 4ONYA 1POTA 2O7UA 3O6GA 3V8XB 5TU0A 1B7HA 1NNPA 4Q30B 1L5TA 3TTKA 1ZTYA 1NNFA 1BTJA 1SW2A 2I3VA 3FATA 4TLLB 1SDXA 1NNTA 2QL3A 3PPRA 2B3BA 3KOTA 3TODA 2Q2CA 2HAUA 3K6UA 3OD7A 3IB1A 4OFOA 4Q8RA 3UA8A 3W9WA 1EZOA 1LBCA 2H5YA 1MQHA 2Y84A 3BBRA 1B1HA 5CMMA 5AE4A 4JDFA 4ELPA 4BLAA 1JQFA 2RC8A 1D9YA 3R7XA 2KLFA 4GVOA 4H6DA 2DS9A 4OEUA 4F19A 5ITPA 1JVYA 1ZMGA 3CRBA 3CIJA 1MRPA 2R71A 3EHSA 4N6PA 3RN8A 3MVWA 4NWDA 1Y1ZA 3IOVA 3P7IA 4LUBA 3SEVA 3IOUA 3MQ9A 2P2AA 4R9GA 2A5SA 4ZDMA 5AA2A 1MY3A 4RY1A 2ZYMA 3TTRA 4GL0A 4BDQA 3ILUB 3SEYA 2OLBA 4R6HA 1P1UA 1N76A 2O68A 2R9JA 1B7ZA 4KHZE 2V93A 5M2VA 3U94A 5DEXB 3R26A 2Y7WA 3GLBA 4G8MA 3T22A 3VLVA 4M1VA 1TXFA 3HV1A 2DE4A 5I58A 5I2NB 3B6TA 4O3BA 5F1QA 2QJEA 1FTMA 4DXCA 3M3FA 3RNNA 2PYYA 4JWOA 2PBWA 4H8JA 4JSOA 2NXOA 1B3LA 4G2ZA 2I49A 3IOTA 3SESA 1Y3PA 2E0SA 4BDLA 3IO6A 3C4MA 3ILTB 3T93B 4P0IA 4ZE8A 4FJPA 4MLQA 3EPEA 4OWDA 5AA1A 2QS3A 4OFLA 1EU8A 4OXVA 3RTWB 1R6ZA 4C0RA 4DE8A 4E0XA 3KSJA 3TDJA 1FQEA 2VHAA 1MQJA 2Z22A 4H5GA 1B0HA 4ZEIA 1B0LA 5I58B 5A5XA 3C36A 1JNFA 4OHNA 4F18A 3H7MA 1D9VA 4ZZEA 3U92A 3LUYA 3PMXA 5I59A 3MPKA 2VD2A 4POXA 3H06B 3IR1A 5JTYB 3TQLA 4I1DA 1KWHA 1MG1A 2QPQA 3OO8A 5EYFA 2P1SA 3QUJA 2UVHA 4RK2A 1GVCA 2NWJA 3W15C 2O1MA 4H8IA 2Z8EA 3IJXB 4U2RA 1DPPA 3MAMA 1MPCA 5K2YA 3PPNA 3FVNA 1B5IA 2NOOA 3FJMA 3ZKKA 2P0SA 5I59B 1ELJA 2QSXA 3CFLA 3EHTA 3FVGA 4QFKA 4LA9A 5ELVA 1P1QA 4OYVA 2OWTA 4NF6A 4WXJA 2HFBA 1QJMA 4FORA 4OQOA 3PD9A 1DTGA 3RTFB 2F34A 1XS5A 3T96B 2Y7PA 3KN8A 4H1XA 5JEIA 4LZ8A 4F3BA 4G8NA 3EHUA 3KFMA 1EH3A 4ISUA 4R72A 4U1ZA 4IO2A 4WEPA 4E0WA 1AIVA 3SEUA 4ESWA 1MY2A 2DSFA 3OMBA 1MXVA 1JETA 2NUVA 4KR5A 3VFJA 4FECA 5H8HA 5I2KB 4XIGQ 2ZNTA 4EQBA 3MC2A 1LB8A
chains in the Genus database with same CATH superfamily
2PT1A 1NFTA 2XWIA 3KJTA 2FA7A 4GBWA 2HQ0A 3DP6A 4DXCA 2QMWA 2UVIA 4R6KA 1G0HA 3MVYA 3TMGA 5L9MA 4OA4A 2CMOA 4ZEFA 5ICQA 2B65A 4EF2A 3G3GA 5B70A 2H4IA 4F1UA 1NV5A 4AB6A 1QGXA 4GXSB 1QUJA 4LQ2A 4KYEA 1D9QA 4OVTA 3RT8A 1URDA 1VR5A 2VT5A 4DIGA 5I84A 4G61A 4JVCA 4PTKA 3RY3A 4NMYA 4EQ9A 1O63A 3BFTA 1FQBA 2G93A 3KJ7A 4X1BA 2B4LA 2XXHA 1WODA 5ITOA 2DQVA 1A99A 2RKMA 3O97A 4OVQA 5EQ8A 3OSQA 1Y4TA 5J1DA 1VFEA 3UP9A 1NUWA 2V84A 4OFJA 4X1DA 4EQ7A 1FPJA 3TYHA 1FPGA 1I6AA 2ZMBA 3HHGA 1HSLA 3H6TA 1ZLQA 2DOJA 3PPPA 3HN0A 3K01A 5HPQA 1DBZA 1PB7A 3LC8A 3PUZE 4XFEA 3OO7A 3WAFA 1LAHE 3H3GA 4IGTA 3TCHA 4MBPA 4G68B 1JP4A 1XT8A 3OENA 4PE5B 3OEKA 3K4UA 4P56A 3T1BA 1XC1A 5CI5A 1LAXA 4DXUA 2YJPA 3GBAA 3U93A 5DEXA 5AA4B 5F24A 5DYHA 2V3UA 4I40A 3FVKA 5JK4A 4G77A 1OLCA 1B52A 2OCUA 3EQ1A 3G3IA 4BDMA 1MPDA 5AA4A 1US4A 3KN3A 4XF5A 3QK6A 4XKQA 4JB7A 3KBZA 1OQHA 4XKNA 2O7IA 3O9PA 1MPBA 5L9SA 3G3JA 3OO9A 1AMFA 4KFQA 4LQ5A 1IIWA 1KA1A 3MVXA 1PEBA 3O6IA 4QFLA 4QXDA 3H6WA 4EXLA 4KI0E 1MDQA 1PDAA 2Q2AA 1Y1MA 1P1NA 4MIJA 4U4SA 2XA5A 4YKIA 4HS7A 4N81A 1N7XA 2QS1A 2D5WA 5BUUA 1MXZA 2OWSA 5I2KA 5EHMA 1BKAA 1IZ1A 3M8UA 1TFDA 2X7QA 3MP6A 4IY6A 2UVGA 1H43A 4ECFA 2VD3A 1RDYA 1SI1A 2YLNA 4RYAA 4OVPA 1B2HA 3N26A 4TQUQ 2KR0A 3QSLA 3B8BA 3EKIA 3OEMA 1AL3A 2ABHA 1LSTA 4OZ9A 5EQAA 1R9LA 2DYXA 2ZZVA 1DCUA 4UABA 5LOMA 4F1YA 4EUOA 2Y7IA 5DVFA 5FTIA 4Z7EA 5I57A 3S2VA 1LFHA 3QMFA 1RKMA 1MH3A 3H6UA 1OVTA 2PT2A 1BIYA 2QMXA 3MZ9A 4FBPA 3BIHA 1IEJA 1NH8A 4YMAA 4DI3D 4NWCA 1FTLA 4OENA 2ZXTA 3C35A 3C34A 4HW8A 1FW0A 1M5EA 3O6HA 1FPDA 2F7BA 3FASA 1EYKA 1M5CA 3IO4A 3CG1A 4NGUA 5EYGA 2QVVA 1RYXA 4R75A 2ONSA 2B4MA 4HXVA 4RNSA 1B4HA 1B5HA 1N04A 2O1LA 4EXKA 2HHMA 5B7DA 3TEPA 1UIVA 4ZEBA 5H8SA 3O2AA 4ZE9A 1FPBA 3FV1A 4HCYA 2O69A 3A29A 1H3DA 4F2OA 2DVZA 5H8QB 2ONRA 1FRPA 2XX8A 4MAGA 4NF8B 3CSGA 4K3FA 5EQ9A 2F6PA 1MY0A 4PBQA 3T66A 2DP8A 3S4UA 2XXWA 3IB0A 3MPLA 2Y7RA 3K2DA 3PUYE 1FTJA 4P0GA 2DXRA 3I5OA 4PDHA 3USDA 3FUZA 1ZBMA 1BK4A 1LFGA 2KQZA 4P11A 2XX9A 3HO7A 2P3VA 1FPKA 2ESNA 2DVCA 2QVUA 3A3CA 5F7VA 1B7HA 1ZTYA 1SW2A 4MEVA 1NNTA 3KOTA 3K6UA 1NV1A 1EZOA 3IB1A 1NV3A 3BBRA 5AE4A 4JDFA 1ZMGA 4GWSA 4N6PA 3RN8A 1Y1ZA 3SEVA 3IOUA 4R9GA 2A5SA 2OWZA 4PAKA 1P1UA 1N76A 2R9JA 5DEXB 3R26A 3T22A 2DE4A 5I58A 5I2NB 3HFUA 5F1QA 1FTMA 2PBWA 4H8JA 2NXOA 4G2ZA 4MMPA 3C4MA 3ILTB 3T93B 2L5VA 4MLQA 3EPEA 4OWDA 3RTWB 4OXVA 3KSJA 5FBPA 5I58B 1B0HA 5A5XA 3NOHA 1JNFA 5I59A 2VD2A 4POXA 3IR1A 5EQ7A 3OO8A 3ZKKA 4H8IA 1MPCA 3PPNA 3FJMA 5I59B 5ELVA 1P1QA 4NF6A 2HFBA 1QJMA 1DTGA 2F34A 5ESYA 4HE2A 4G8NA 1EH3A 4IO2A 4WEPA 3SEUA 2DSFA 2NUVA 1LB8A 4N15A 1FCKA 2M8CA 1XVXA 2REGA 1MS7A 1LBWA 2ONKE 3JZJA 4X48A 2YPNA 4KCDA 2H99A 1B46A 2FIEA 2Z8FA 1NNKA 1VDWA 4QFPA 3H6VA 4NF8A 2OBGA 3CI8A 2XHDA 3BIGA 1B7UA 3D4GA 3PU5A 1EZPA 4KPTA 1BP5A 2I4BA 1UTHB 5I56B 4NF4B 4F22A 4YB6A 3C9HA 4KYSA 1NV6A 3BFUA 3GZGA 1IXCA 1A8EA 2HZKA 4C1UA 1MQGA 3PPOA 3VV5A 4IB2A 1PC3A 1MXXA 1B58A 4R9FA 4DCXA 2MKZA 2OJTA 2F5XA 1IMAA 2BJIA 4LATA 2I0CA 4NEDA 3G7WA 3VVFA 3FVOA 4GX3A 2ANJA 2DE3A 5TPAA 5ISUA 4YB5A 2O84X 2NVUB 3I3VA 1DMBA 4QSDA 1Y4CA 3O28A 3S9MC 1PB9A 2I48A 4DCYA 1DSNA 2GHBA 1GV8A 2VGQA 3KSXA 1LCFA 4GXAA 3DP4A 1D3KA 4DDDA 2ZYNA 1Z7ME 2I4CA 1A7LA 3FGSA 2RCBA 1T0KA 1FSAA 2VP1A 3H03A 1YYZA 4N6KA 4QHQA 3VLWA 4QFOA 4R74A 1Q1KA 1SD3A 5LDZA 4N4UA 2W7YA 3FXRA 3KZGA 3CFXA 3SEWA 3UIFA 5KDTA 5L9OA 3O66A 1IMFA 3B50A 3H4ZA 3FZVA 3IOWA 1YAEA 4WKMA 5IKBA 1BLFA 1Q9DA 5DT6A 4JSDA 2HXRA 1SW4A 4PF8A 1FTAA 4Q0CA 3T9HB 1N0TA 2QVRA 3PUVE 2ZZWA 3K1MA 3MP8A 3IX1A 1URGA 2GFEA 2WX9A 4IR8A 5I57B 4LZ7A 4LONB 3D4CA 5H8FA 3KG2A 3R6UA 1FBFA 2UVJA 1DK4A 2F3BA 4I3EA 3ECRA 1FPIA 5EHSA 3MSTA 1B3HA 3D1RA 4O7IA 3UGWA 1P1WA 1XOCA 1FPFA 4IGRA 4MLVA 4P3LA 1QKAA 3MWBA 1AH5A 2Y7KA 2ZNUA 5H8HB 4IO7A 1O7TA 3E79A 4RK9A 1FBPA 1GGGA 2HEUA 3G3HA 5HM4B 3G3FA 4YKPA 3FIRA 5I7IA 1XI6A 1PBQA 3DLNA 3V5AA 5IAIA 1B5JA 4MHFA 4GWOA 3MJNA 3SZPA 3CSBA 4KD5A 1LB9A 1SI0A 4AQ4A 4ZS9A 3C32A 2V3QA 3TKDA 3TFLA 3K0VA 4YICA 2QFLA 2XXKA 4THIA 1FBGA 2F7CA 4LVQA 3ZKLA 4H0WA 3MW0A 2OX3A 4UA8A 4UACA 1PB8A 2VPNA 5IZ3B 4PDDA 5FHOA 2ZYOA 4OVJA 1A40A 3TELA 3RLFE 2XXIA 4P1LA 1OLAA 3MVZA 2D21A 4JWYA 3OELA 3DELB 4GD5A 4PFYA 3T0JA 1YZ0A 4Z0IA 2D3IA 1QUKA 3B6WA 1IXHA 2AL4A 2LAOA 5ET8A 3ZSFA 3FXBA 2DWAA 3FXUA 1MXUA 5CBRA 2F6GA 4U21A 2XXRA 2DXYA 2V25A 2G29A 4HE1A 1WDNA 4EDPA 3Q28A 1B32A 1MM6A 4O8MA 3N6TA 2PMSA 5ET7A 3K1NA 4GWWA 1HSJA 3TUSA 4ZEDA 5DW8A 2ZZXA 2X26A 4O3CA 3IFAA 1IMEA 1NUXA 2DE2A 3LSFB 5TPAB 3CG3A 4MNPA 1SQYA 5IZ1A 1LCTA 1USYH 3E13X 2ZYKA 1ZJLA 1MXYA 3RUMA 3THIA 4F31B 4QFNA 3SKPA 1IMBA 1ZU0A 1LBYA 4N17A 1OIBA 4ZECA 1K9ZA 4Q30B 3KC0A 4TLLB 3VDFA 3ZS6A 3TODA 3OD7A 2HAUA 2FBPA 2Q8MA 2Y84A 1B1HA 5ITPA 3CRBA 3EHSA 2CZIA 3IOVA 3P7IA 3MQ9A 2FVZA 4RY1A 5IGAA 5JTYA 3SEYA 3U94A 3VLVA 3GLBA 4M1VA 3B6TA 4O3BA 3M3FA 4O7MA 4JWOA 2I49A 4BDLA 1Y3PA 4ZE8A 3U65A 1EU8A 4C0RA 2VHAA 4H5GA 3C36A 1D9VA 4MX6A 3TQLA 5I5PA 3QUJA 2UVHA 2Z8EA 4U2RA 1DPPA 4GX6A 3FVNA 2NOOA 2QSXA 3EHTA 4QFKA 4OQOA 3T96B 3LUZA 3PD9A 4P8BA 4LZ8A 4R72A 4U1ZA 1AIVA 4ESWA 1MXVA 1JETA 3VFJA 5I2KB 4EQBA 3O6GA 5HBCA 4ZZAA 2WBDA 1CB6A 2O51A 5J16A 2Y5LA 4JVIA 3VXBA 3KGCA 4PC9A 4H5FA 3EF7A 4P1EA 2THIA 1Y9UA 4QSEA 4OETA 1DPEA 3KOSA 2AL5A 5KZTA 4X9TA 2CEYA 2PX1A 5H8FB 2CZLA 2B3FA 4H65A 3M3KA 1Y20A 1A55A 3QUFA 5T3JA 3W9VA 4GWXA 2AIXA 4BDRA 4YKJA 3GXAA 1QUIA 1LEVA 4GIZA 3HHFA 5BWJA 1B6HA 4F39A 1JW5A 2F36A 4NTLA 2FYIA 5KDTB 3FBPA 5CMCA 2OK2A 2RCAA 5L8DA 2XD3A 3HCQA 1N3WA 3FD3A 4F29A 1KA0A 4PGNA 3IJOB 2H9BA 1MH4A 2RF1A 4G8HA 4PFIA 3GYYA 3GBBA 1LLSA 1I6QA 4ELRA 4HCWA 3K6XA 3RPLB 1ANFA 4GF8A 1Z7NE 4WEDA 1H45A 1INPA 1AOVA 4YB7A 3IK6B 2QRYA 3E9XA 4F1VA 4GBVA 2BJJX 4YKKA 1MQIA 4OVSA 4ZEKA 2HXWA 1D4NA 4XKPA 2RC9A 3PPQA 3PMWA 1FJ6A 4KYDA 4POWA 1DTZA 2Q89A 3SEXA 1YPNA 2V4CA 3TTNA 5AA2D 3CFZA 1A54A 2F97A 3N94A 4YAHX 5CM6A 2XXQA 1JEUA 3BKIB 4GWYA 3Q25A 4IO6A 1SBPA 1FQDA 3TCFA 2REJA 4Q5TA 1I6BA 4GRKA 1OQGA 2A5TA 3AXFA 4AS4A 3IL1B 2H25A 2UYFA 4RPNA 5KCJA 3V83A 2FNCA 2Y5KA 3QYTA 3KEIA 1I69A 4KQPA 5CMKA 1EZ9A 3WAEA 2JJKA 1FBEA 1UIUA 2O6AA 4JXIA 2HZLA 1M5FA 1URSA 4MF3A 1B3EA 4G68A 4GQOA 4RJZA 2AYSA 3K00A 3ONMA 3S9NC 1LGBC 5DVJA 4PQJA 3Q26A 3TDJA 1POY1 4KCCA 4MCOA 4P47A 2PCRA 3T9UA 1LBBA 1NI9A 4PFRA 4OTEA 5CBSA 3UN6A 2F8DA 3TPAA 4DZ1A 1MDP1 4OVRA 4XEQA 3E78A 3K6WA 4I8CA 3LSLA 5IZ3A 3KBRA 2XD2A 2DWHA 3O29A 3PGFA 2CZHA 1S9TA 4HE0A 4FE8A 4GOTA 4TLMB 2PFYA 3LR1A 2R6GE 1MQDA 2V3TA 4PF6A 1XHYA 1NMUA 3S9EA 1VE4A 3RT6B 3IAZA 3KC1A 1VSOA 4U4XA 1A8FA 3CHGA 1UQWA 1H44A 2QS4A 1JW4A 1FTKA 1S7YA 1B3FA 3LBSA 4F3SA 3I6VA 2I58A 4PE3A 1P99A 1SPIA 3PTYA 5LTCA 5FTHA 2HAVA 2PFZA 1N7WA 2XXYA 3LSXA 3LV0A 4XKRA 1CE2A 5TP9B 2XXTA 3PUWE 1B05A 4DI4B 3EN3A 4FIMA 3VE1B 4R2BA 2H98A 3K1PA 4GFRA 3KN7A 2FIXA 3L6GA 4R2FA 3VLUA 3U1OA 4XXUA 2Q9TA 1LFIA 3UK4A 3T9XB 2Q8JA 4FATA 4IO4A 4PAIA 1Y3NA 4PFTA 4YMBA 1YTVA 2VOZA 2VPOA 3ODBA 5K2XA 2DDKA 4NQ8A 4H67A 2WYKA 4GLIA 2WEFA 4QRZA 3RPLA 3E3KA 1MM7A 4PP0A 2RINA 2O7UA 4MJOA 1NNPA 4NN3A 1NNFA 1BTJA 3FATA 3PPRA 2B3BA 4OFOA 1LBCA 1MQHA 4BLAA 1JQFA 3R7XA 4GVOA 4F19A 1JVYA 5ET6A 1MRPA 1NV2A 4NWDA 2P2AA 5AA2A 1MY3A 3TTRA 2P3NA 4GWUA 4BDQA 2O68A 4E0XA 2Y7WA 4X8RA 4NAPA 3HV1A 1NUYA 1K9YA 3RNNA 3IOTA 3IO6A 4P0IA 4FJPA 5AA1A 4JVDA 2QS3A 4DE8A 1FQEA 4NHBA 4OHNA 4F18A 4ZZEA 3PMXA 1AWBA 1KWHA 1MG1A 5H8NB 1GVCA 2P1SA 4RK2A 3W15C 2O1MA 3MAMA 1B5IA 4X04A 2P0SA 1ELJA 3CFLA 4LA9A 4WXJA 5IZZA 3RTFB 5JEIA 1XS5A 4F3BA 3EHUA 4ISUA 4E0WA 2R8TA 1MY2A 3OMBA 4KR5A 4FECA 5H8HA 2ZNTA 4LN5A 5H8QA 4P9KA 3L6HA 1TWYA 4YZZA 3FXQA 4FAJA 3TQWA 4OEVA 3Q29A 5ICTA 2IEEA 3A09A 3SERA 3TZAA 1SYIA 2Q74A 4XTCQ 1WVJA 1NUZA 2CZKA 3HPIA 4MFIA 4RPOA 1VFDA 2ALUA 4N07A 4U1OA 3C33A 2OZZA 1G0IA 1OVBA 4JBZA 1QULA 1LAFE 4NG7A 3OO6A 5TP9A 4ELOA 3F11A 5A5LA 2HPGA 3FJGA 1P1OA 2F3DA 3FJ7A 4OMBA 1NH7A 3JV9A 4YU0A 3QXMA 5EYHA 4PAFA 3PD8A 4QF9A 1QVSA 1MY1A 3RPWA 3RGYA 4FEDA 4NF6B 4G68C 2GH9A 3T9VA 1OMPA 1ZIUA 1IMCA 4PETA 5I56A 1FTOA 2UXAA 4F3PA 4MH5A 1II5A 1J1NA 2XX7A 2XXUA 4L17A 1RDXA 1USYE 4PGPA 1IXIA 1N3XA 4O94A 3QIMA 2I0BA 5H8NA 1ZKBA 2XWOA 4JWXA 1GTKA 4F3GA 4QBAA 1ATGA 4U22A 2FHYA 5FHMA 3VVDA 1F9BA 1FJ9A 1PBPA 4KXPA 4PFBA 4OESA 1SVXB 1UTHA 4QSCA 1H76A 4TOZA 1N84A 3LSWA 4MNCA 4H45A 4GL8A 3OOAA 3N5LA 1MXWA 3CVGA 5I2NA 3C31A 3HSTA 5A5XB 3A3UA 5IM2A 3IB2A 1B40A 4N8YA 1FBCA 3MBPA 5KCJB 1LBXA 2F7AA 3K02A 3RYDA 4H46A 3SETA 1LBVA 4AB5A 1IUDA 3B7DA 4N91A 4F2QA 1SYHA 3TAJA 5DVIA 2XWVA 3PV0E 4NF0A 1R9QA 4NF4A 1FBDA 4ND9A 1JW1A 1IXGA 1MY4A 4R6YA 2RC7A 5CMBA 2I3WA 1GR2A 3OSRA 3TTLA 4ESXA 3IORA 3MZ1A 2QS2A 3Q27A 1S50A 2ZNSA 3U72A 4PFWA 4C1TA 1IMDA 1NV0A 4IO5A 1RYOA 3QAXA 4ELQA 4EF1A 1M5BA 4I1DA 1FPLA 3V89B 4OERA 2XXXA 3CR9A 4NF5A 4N6DA 4G4PA 1LAGE 3TCGA 1IQ7A 1FPEA 1FQCA 2E1SA 4I3YA 1R1NA 4PBHA 1B1XA 1JEVA 5CRYA 1B51A 4IO3A 3FV2A 3TTMA 4R73A 1HSEA 1QW0A 1YCJA 4NX1A 2XXVA 3VXCA 3G3KA 1B4ZA 4RA1A 2A5TB 1NL5A 3M3LA 3JYRA 2XWKA 4N13A 1IITA 3N6UA 4I9DA 4PFUA 1QKBA 4GX4A 4M4GA 4BDOA 2GHAA 2CEXA 1TT1A 4O3AA 2F78A 1US5A 1DOTA 2UYEA 1NKXA 4HTGA 2X7PA 4I62A 5AA3A 2WBBA 1UTBA 3MVWA 4FORA 2Q88A 3ROJA 3PUXE 5DTBA 1Y3QA 3SDFA 2HCAA 2Z8DA 4NE4A 1B9JA 1B3GA 2GQ1A 2WKYA 2DWIA 1EYIA 4LZ5A 3ISPA 1O64A 5CC2A 2WYPA 1FQFA 3OXNA 3MYUA 1Q35A 1FQAA 1M5DA 4RXLA 3PMVA 5AA2B 4BDNA 3K6VA 2DWJA 4DLDA 2IA4A 1XVYA 1SW5A 1UTBB 3E4RA 2PVUA 3B6QA 4FEBA 4OANA 1SW1A 2F35A 2XXPA 4LP2B 3MP1A 3DP8A 4NF5B 3RQTA 3UORA 4U23A 1NV7A 3MUQA 4IY5A 1TFAA 3S9LC 5FHNA 1JVXA 3U8QA 3DM0A 2GRVA 2I6EA 2Z23A 1NV4A 3VVEA 3MZBA 4DXBA 4N8GA 4PCDA 4GWZA 4ONYA 1POTA 3V8XB 5TU0A 3TTKA 1L5TA 2I3VA 5I3SA 1SDXA 2QL3A 2Q2CA 4Q8RA 3UA8A 3W9WA 2H5YA 5CMMA 4ELPA 2RC8A 1D9YA 2KLFA 4H6DA 2DS9A 4OEUA 3CIJA 2R71A 4LUBA 4ZDMA 2ZYMA 4GL0A 3ILUB 1RDZA 2OLBA 4KHZE 4R6HA 5M2VA 1B7ZA 2V93A 4G8MA 1TXFA 2QJEA 2PYYA 1EYJA 3IFCA 4JSOA 1CNQA 4AS5A 1B3LA 3SESA 2E0SA 5ET5A 4OFLA 1R6ZA 2Z22A 1MQJA 4ZEIA 1B0LA 3H7MA 3U92A 3LUYA 3MPKA 5JTYB 3H06B 2QPQA 5EYFA 2NWJA 3IJXB 5K2YA 3FVGA 1KZ8A 4OYVA 2OWTA 2Y7PA 3KN8A 4H1XA 3KFMA 1FBHA 1YXIA 4MNIA 4XIGQ 1LBZA 3MC2A
chains in the Genus database with same CATH topology
5H8QA 5HBCA 4ZZAA 3L6HA 1CB6A 1TWYA 1FCKA 2M8CA 1XVXA 2REGA 1MS7A 2PT1A 3FXQA 4OEVA 1NFTA 3KJTA 3Q29A 2ONKE 3TQWA 4FAJA 2O51A 3JZJA 2FA7A 5ICTA 2HQ0A 2IEEA 3A09A 4X48A 3SERA 2YPNA 3DP6A 2H99A 1SYIA 4KCDA 4XTCQ 1B46A 3TZAA 1WVJA 2QMWA 3KGCA 2UVIA 2Z8FA 1NNKA 3VXBA 4H5FA 4R6KA 3HPIA 4QFPA 3H6VA 4NF8A 2OBGA 3EF7A 3CI8A 2XHDA 2THIA 3MVYA 4MFIA 3TMGA 4RPOA 5L9MA 1VFDA 1Y9UA 2CMOA 4QSEA 4OETA 4ZEFA 2ALUA 1B7UA 1DPEA 3KOSA 3D4GA 2B65A 3PU5A 3G3GA 4N07A 2AL5A 4KPTA 4U1OA 3C33A 4EF2A 5B70A 5KZTA 2OZZA 4X9TA 1BP5A 1OVBA 2H4IA 4JBZA 4F1UA 1QULA 2PX1A 1LAFE 3OO6A 5H8FB 4AB6A 2I4BA 5TP9A 2CZLA 2B3FA 1UTHB 4ELOA 5I56B 4NF4B 4GXSB 3F11A 1QUJA 4F22A 4YB6A 4LQ2A 3C9HA 4KYSA 4H65A 3M3KA 4KYEA 1Y20A 1A55A 3QUFA 3W9VA 3FJGA 1P1OA 3BFUA 3GZGA 3FJ7A 4OMBA 3RT8A 1NH7A 3JV9A 2AIXA 4YU0A 3QXMA 1IXCA 1A8EA 1URDA 4BDRA 2HZKA 4C1UA 4YKJA 1MQGA 3PPOA 3GXAA 1QUIA 1VR5A 3VV5A 4DIGA 5I84A 4GIZA 3HHFA 3PD8A 4IB2A 1QVSA 4QF9A 1PC3A 3RY3A 5BWJA 1B6HA 1MY1A 1MXXA 1B58A 4R9FA 4NMYA 4EQ9A 1O63A 3RPWA 3RGYA 4DCXA 3BFTA 4F39A 1FQBA 2G93A 1JW5A 2OJTA 3KJ7A 4X1BA 5ICQA 2F5XA 4FEDA 4NF6B 2F36A 4NTLA 2FYIA 2XXHA 4G68C 1WODA 5ITOA 5KDTB 4LATA 2I0CA 2GH9A 4NEDA 3T9VA 5CMCA 2OK2A 3G7WA 2RCAA 2DQVA 3VVFA 5L8DA 1A99A 2RKMA 3FVOA 2XD3A 3O97A 1OMPA 1ZIUA 3HCQA 1N3WA 2ANJA 2DE3A 3FD3A 4PETA 3OSQA 5I56A 1FTOA 2UXAA 4F3PA 4MH5A 1Y4TA 5TPAA 1II5A 5ISUA 4F29A 5J1DA 1J1NA 1VFEA 4YB5A 2O84X 2NVUB 3UP9A 2XX7A 2XXUA 3I3VA 2H9BA 2V84A 1DMBA 1MH4A 1Y4CA 3IJOB 2RF1A 4L17A 4OFJA 1USYE 4QSDA 4X1DA 4EQ7A 3O28A 3S9MC 1PB9A 4G8HA 2I48A 1EZPA 1IXIA 1N3XA 3TYHA 4DCYA 3QIMA 1I6AA 1DSNA 2ZMBA 3GBBA 1LLSA 1I6QA 3HHGA 2GHBA 1GV8A 2VGQA 1HSLA 2I0BA 3H6TA 3K6XA 1ANFA 1LCFA 1ZLQA 3KSXA 2DOJA 4GXAA 3DP4A 5H8NA 4GF8A 1D3KA 4DDDA 3PPPA 3HN0A 1Z7NE 1ZKBA 3K01A 5HPQA 4JWXA 4WEDA 1GTKA 1PB7A 4F3GA 1H45A 3VDFA 3LC8A 3PUZE 2ZYNA 3OO7A 1ATGA 4U22A 5FHMA 3WAFA 1Z7ME 1AOVA 1LAHE 4YB7A 2I4CA 1A7LA 3FGSA 2RCBA 3H3GA 1T0KA 4IGTA 3IK6B 3TCHA 3VVDA 1F9BA 2QRYA 2VP1A 3E9XA 4G68B 4MBPA 4F1VA 1XT8A 3H03A 3OENA 4PE5B 1PBPA 4OESA 2BJJX 3OEKA 1SVXB 4YKKA 3K4UA 1UTHA 4QHQA 1MQIA 4QSCA 3VLWA 1XC1A 1H76A 4TOZA 1LAXA 1N84A 4QFOA 5CI5A 4ZEKA 2YJPA 4DXUA 4R74A 2HXWA 3LSWA 1Q1KA 1SD3A 1D4NA 3GBAA 3U93A 2W7YA 4XKPA 2RC9A 3PPQA 5DEXA 5AA4B 3FXRA 3PMWA 3KZGA 3CFXA 5DYHA 2V3UA 3SEWA 3UIFA 5KDTA 4KYDA 3O66A 4GL8A 4POWA 3FVKA 5CBSA 1DTZA 3OOAA 5L9OA 2Q89A 3SEXA 5JK4A 1YPNA 1OLCA 3H4ZA 3FZVA 1MXWA 3N5LA 3IOWA 1B52A 2OCUA 4G77A 1YAEA 3TTNA 3CVGA 3EQ1A 5AA2D 3CFZA 3G3IA 1A54A 4WKMA 1MPDA 4BDMA 5IKBA 5I2NA 2F97A 5AA4A 1US4A 3KN3A 3N94A 4YAHX 5CM6A 3C31A 1BLFA 2XXQA 3HSTA 3QK6A 5A5XB 3A3UA 5DT6A 1JEUA 3BKIB 3IB2A 1B40A 4JB7A 4XKQA 4JSDA 1OQHA 1SW4A 3MBPA 4XKNA 4Q0CA 2O7IA 3O9PA 3T9HB 5KCJB 2F7AA 3Q25A 4IO6A 1MPBA 1SBPA 1N0TA 3PUVE 3K02A 5L9SA 3SETA 1FQDA 3K1MA 3MP8A 3IX1A 1URGA 3TCFA 4AB5A 2REJA 1IUDA 3G3JA 4Q5TA 3B7DA 1I6BA 3OO9A 4GRKA 4F2QA 1OQGA 2A5TA 1AMFA 1SYHA 4KFQA 2GFEA 3TAJA 5DVIA 3AXFA 4LQ5A 3PV0E 1IIWA 3IL1B 3MVXA 1R9QA 1PEBA 5I57B 4LZ7A 3O6IA 4LONB 4NF4A 1JW1A 3D4CA 2H25A 2UYFA 4ND9A 4QFLA 1IXGA 5H8FA 4RPNA 3KG2A 1MY4A 4R6YA 3H6WA 4EXLA 3R6UA 2RC7A 5CMBA 2I3WA 4KI0E 5KCJA 1GR2A 1MDQA 1PDAA 2Q2AA 1Y1MA 3OSRA 3V83A 1P1NA 3TTLA 4ESXA 2FNCA 3IORA 2QS2A 3MZ1A 2UVJA 3Q27A 4U4SA 1S50A 2ZNSA 4YKIA 3QYTA 3KEIA 3ECRA 4HS7A 4PFWA 1I69A 5EHSA 3U72A 4C1TA 1B3HA 4KQPA 1N7XA 2QS1A 2D5WA 4IO5A 5BUUA 1RYOA 5CMKA 3QAXA 1MXZA 1EZ9A 4ELQA 3WAEA 2OWSA 1UIUA 5I2KA 2O6AA 5EHMA 1BKAA 1P1WA 3UGWA 4JXIA 2HZLA 1M5BA 1IZ1A 1M5FA 1TFDA 1XOCA 2X7QA 3M8UA 2UVGA 3MP6A 1H43A 1URSA 4IY6A 4MF3A 3V89B 2VD3A 4ECFA 3ZS6A 1SI1A 4IGRA 4MLVA 1B3EA 2YLNA 4OERA 4G68A 4RYAA 2XXXA 3CR9A 4GQOA 1QKAA 4NF5A 4RJZA 2AYSA 3K00A 3MWBA 1B2HA 3ONMA 1AH5A 2Y7KA 2ZNUA 3N26A 4TQUQ 3S9NC 5H8HB 1LGBC 5DVJA 3Q26A 3QSLA 1O7TA 1POY1 4IO7A 4G4PA 4KCCA 4PQJA 4RK9A 1GGGA 2HEUA 1LAGE 3G3HA 5HM4B 3G3FA 3TCGA 4YKPA 1IQ7A 3T9UA 3FIRA 4ELRA 1FQCA 1LBBA 2E1SA 1R1NA 3OEMA 1AL3A 4HCWA 1PBQA 1B1XA 3DLNA 3V5AA 5IAIA 1JEVA 2ABHA 1LSTA 4OZ9A 1B5JA 4OTEA 2F8DA 5CRYA 4GWOA 3UN6A 3MJNA 1B51A 4IO3A 3FV2A 3TTMA 3TPAA 3CSBA 1R9LA 4DZ1A 1MDP1 2DYXA 4R73A 4KD5A 1LB9A 1HSEA 1QW0A 1SI0A 4AQ4A 4ZS9A 3K6WA 3C32A 4I8CA 3LSLA 1YCJA 2V3QA 4F1YA 4YZZA 5LOMA 3KBRA 2XD2A 2Y7IA 3TKDA 4EUOA 3TFLA 2DWHA 3O29A 5DVFA 3K0VA 4YICA 3PGFA 5FTIA 4THIA 4Z7EA 5I57A 3S2VA 2XXVA 1S9TA 3VLUA 3VXCA 1LFHA 2F7CA 3G3KA 1RKMA 1B4ZA 4LVQA 1MH3A 4FE8A 2A5TB 3H6UA 1OVTA 4RA1A 2PT2A 3ZKLA 1BIYA 2QMXA 3MZ9A 4GOTA 4TLMB 1NL5A 1IEJA 3LR1A 3M3LA 3JYRA 2R6GE 1NH8A 4H0WA 4YMAA 1MQDA 3MW0A 2V3TA 4N13A 1IITA 3N6UA 4NWCA 4I9DA 1FTLA 4UACA 4UA8A 4PFUA 1QKBA 1PB8A 4OENA 4M4GA 5FHOA 1XHYA 2ZXTA 1NMUA 3S9EA 2ZYOA 3C35A 4BDOA 4OVJA 2GHAA 1VE4A 3C34A 1A40A 1TT1A 3TELA 4HW8A 3RLFE 4O3AA 2F78A 3RT6B 2XXIA 1US5A 1DOTA 2UYEA 1FW0A 1M5EA 1NKXA 2F7BA 1OLAA 3IAZA 3FASA 3O6HA 4HTGA 1VSOA 4U4XA 1A8FA 5JTYA 3MVZA 1M5CA 2D21A 3IO4A 3CG1A 3OELA 2X7PA 3DELB 4GD5A 4I62A 4JWYA 4PFYA 5AA3A 1UQWA 4R75A 1H44A 1RYXA 2ONSA 4RNSA 2QS4A 2D3IA 1B4HA 1JW4A 1UTBA 1FTKA 1IXHA 1B5HA 1QUKA 1S7YA 1N04A 2AL4A 3B6WA 1B3FA 2O1LA 2Q88A 3LBSA 4F3SA 2LAOA 3I6VA 3PUXE 4EXKA 2I58A 3ZSFA 1P99A 5B7DA 2DWAA 3FXUA 5DTBA 3TEPA 1Y3QA 5FTHA 2HCAA 1UIVA 2HAVA 4Z0IA 3SDFA 1MXUA 2Z8DA 4NE4A 2F6GA 1B9JA 5CBRA 1N7WA 4U21A 2XXRA 2DXYA 2XXYA 2V25A 2G29A 4ZEBA 1B3GA 3LSXA 5H8SA 4XKRA 3O2AA 1WDNA 2WKYA 1CE2A 2DWIA 5TP9B 2XXTA 4LZ5A 4EDPA 3Q28A 3FV1A 4ZE9A 4EF1A 1O64A 4HCYA 1B32A 5CC2A 1FQFA 2O69A 1MM6A 3OXNA 3PUWE 1Q35A 1B05A 1FQAA 1H3DA 3EN3A 4FIMA 3VE1B 4R2BA 4F2OA 2H98A 1M5DA 2DVZA 2PMSA 3N6TA 3K1NA 3PMVA 4RXLA 5H8QB 1HSJA 5AA2B 3TUSA 2ONRA 2XX8A 3K1PA 4GFRA 4BDNA 3K6VA 4NF8B 3CSGA 3KN7A 4ZEDA 2DWJA 4K3FA 4DLDA 2IA4A 1XVYA 3L6GA 2F6PA 1SW5A 1MY0A 1UTBB 2PVUA 2X26A 3E4RA 4R2FA 3U1OA 3T66A 2DP8A 3S4UA 3UK4A 2XXWA 4O3CA 4XXUA 3B6QA 4FEBA 2F35A 1SW1A 1LFIA 2Q9TA 2XXPA 3IB0A 4LP2B 3MP1A 3MPLA 2Y7RA 2DE2A 3K2DA 3T9XB 3LSFB 3PUYE 3DP8A 1FTJA 4NF5B 3RQTA 5TPAB 2Q8JA 3CG3A 3UORA 1SQYA 4FATA 4IO4A 1LCTA 1USYH 4P0GA 3E13X 2DXRA 2ZYKA 4U23A 3I5OA 1Y3NA 4PFTA 3MUQA 1ZJLA 4YMBA 3USDA 3FUZA 1ZBMA 1TFAA 1YTVA 4IY5A 3S9LC 1MXYA 2VOZA 3RUMA 5FHNA 3THIA 5H8NB 1JVXA 4F31B 3U8QA 3ODBA 4QFNA 3SKPA 3DM0A 2GRVA 5K2XA 1ZU0A 2I6EA 2Z23A 1LFGA 4H67A 4P11A 2XX9A 4GLIA 3VVEA 3HO7A 4QRZA 3MZBA 1OIBA 2ESNA 4DXBA 4ZECA 3E3KA 1MM7A 2DVCA 3A3CA 4PP0A 2RINA 5F7VA 4ONYA 1POTA 2O7UA 3O6GA 3V8XB 5TU0A 1B7HA 1NNPA 4Q30B 1L5TA 3TTKA 1ZTYA 1NNFA 1BTJA 1SW2A 2I3VA 3FATA 4TLLB 1SDXA 1NNTA 2QL3A 3PPRA 2B3BA 3KOTA 3TODA 2Q2CA 2HAUA 3K6UA 3OD7A 3IB1A 4OFOA 4Q8RA 3UA8A 3W9WA 1EZOA 1LBCA 2H5YA 1MQHA 2Y84A 3BBRA 1B1HA 5CMMA 5AE4A 4JDFA 4ELPA 4BLAA 1JQFA 2RC8A 1D9YA 3R7XA 2KLFA 4GVOA 4H6DA 2DS9A 4OEUA 4F19A 5ITPA 1JVYA 1ZMGA 3CRBA 3CIJA 1MRPA 2R71A 3EHSA 4N6PA 3RN8A 3MVWA 4NWDA 1Y1ZA 3IOVA 3P7IA 4LUBA 3SEVA 3IOUA 3MQ9A 2P2AA 4R9GA 2A5SA 4ZDMA 5AA2A 1MY3A 4RY1A 2ZYMA 3TTRA 4GL0A 4BDQA 3ILUB 3SEYA 2OLBA 4R6HA 1P1UA 1N76A 2O68A 2R9JA 1B7ZA 4KHZE 2V93A 5M2VA 3U94A 5DEXB 3R26A 2Y7WA 3GLBA 4G8MA 3T22A 3VLVA 4M1VA 1TXFA 3HV1A 2DE4A 5I58A 5I2NB 3B6TA 4O3BA 5F1QA 2QJEA 1FTMA 4DXCA 3M3FA 3RNNA 2PYYA 4JWOA 2PBWA 4H8JA 4JSOA 2NXOA 1B3LA 4G2ZA 2I49A 3IOTA 3SESA 1Y3PA 2E0SA 4BDLA 3IO6A 3C4MA 3ILTB 3T93B 4P0IA 4ZE8A 4FJPA 4MLQA 3EPEA 4OWDA 5AA1A 2QS3A 4OFLA 1EU8A 4OXVA 3RTWB 1R6ZA 4C0RA 4DE8A 4E0XA 3KSJA 3TDJA 1FQEA 2VHAA 1MQJA 2Z22A 4H5GA 1B0HA 4ZEIA 1B0LA 5I58B 5A5XA 3C36A 1JNFA 4OHNA 4F18A 3H7MA 1D9VA 4ZZEA 3U92A 3LUYA 3PMXA 5I59A 3MPKA 2VD2A 4POXA 3H06B 3IR1A 5JTYB 3TQLA 4I1DA 1KWHA 1MG1A 2QPQA 3OO8A 5EYFA 2P1SA 3QUJA 2UVHA 4RK2A 1GVCA 2NWJA 3W15C 2O1MA 4H8IA 2Z8EA 3IJXB 4U2RA 1DPPA 3MAMA 1MPCA 5K2YA 3PPNA 3FVNA 1B5IA 2NOOA 3FJMA 3ZKKA 2P0SA 5I59B 1ELJA 2QSXA 3CFLA 3EHTA 3FVGA 4QFKA 4LA9A 5ELVA 1P1QA 4OYVA 2OWTA 4NF6A 4WXJA 2HFBA 1QJMA 4FORA 4OQOA 3PD9A 1DTGA 3RTFB 2F34A 1XS5A 3T96B 2Y7PA 3KN8A 4H1XA 5JEIA 4LZ8A 4F3BA 4G8NA 3EHUA 3KFMA 1EH3A 4ISUA 4R72A 4U1ZA 4IO2A 4WEPA 4E0WA 1AIVA 3SEUA 4ESWA 1MY2A 2DSFA 3OMBA 1MXVA 1JETA 2NUVA 4KR5A 3VFJA 4FECA 5H8HA 5I2KB 4XIGQ 2ZNTA 4EQBA 3MC2A 1LB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H8Q A;  5HBC A;  4ZZA A;  3L6H A;  1CB6 A;  1TWY A;  1FCK A;  2M8C A;  1XVX A;  2REG A;  1MS7 A;  2PT1 A;  3FXQ A;  4OEV A;  1NFT A;  3KJT A;  3Q29 A;  2ONK E;  3TQW A;  4FAJ A;  2O51 A;  3JZJ A;  2FA7 A;  5ICT A;  2HQ0 A;  2IEE A;  3A09 A;  4X48 A;  3SER A;  2YPN A;  3DP6 A;  2H99 A;  1SYI A;  4KCD A;  4XTC Q;  1B46 A;  3TZA A;  1WVJ A;  2QMW A;  3KGC A;  2UVI A;  2Z8F A;  1NNK A;  3VXB A;  4H5F A;  4R6K A;  3HPI A;  4QFP A;  3H6V A;  4NF8 A;  2OBG A;  3EF7 A;  3CI8 A;  2XHD A;  2THI A;  3MVY A;  4MFI A;  3TMG A;  4RPO A;  5L9M A;  1VFD A;  1Y9U A;  2CMO A;  4QSE A;  4OET A;  4ZEF A;  2ALU A;  1B7U A;  1DPE A;  3KOS A;  3D4G A;  2B65 A;  3PU5 A;  3G3G A;  4N07 A;  2AL5 A;  4KPT A;  4U1O A;  3C33 A;  4EF2 A;  5B70 A;  5KZT A;  2OZZ A;  4X9T A;  1BP5 A;  1OVB A;  2H4I A;  4JBZ A;  4F1U A;  1QUL A;  2PX1 A;  1LAF E;  3OO6 A;  5H8F B;  4AB6 A;  2I4B A;  5TP9 A;  2CZL A;  2B3F A;  1UTH B;  4ELO A;  5I56 B;  4NF4 B;  4GXS B;  3F11 A;  1QUJ A;  4F22 A;  4YB6 A;  4LQ2 A;  3C9H A;  4KYS A;  4H65 A;  3M3K A;  4KYE A;  1Y20 A;  1A55 A;  3QUF A;  3W9V A;  3FJG A;  1P1O A;  3BFU A;  3GZG A;  3FJ7 A;  4OMB A;  3RT8 A;  1NH7 A;  3JV9 A;  2AIX A;  4YU0 A;  3QXM A;  1IXC A;  1A8E A;  1URD A;  4BDR A;  2HZK A;  4C1U A;  4YKJ A;  1MQG A;  3PPO A;  3GXA A;  1QUI A;  1VR5 A;  3VV5 A;  4DIG A;  5I84 A;  4GIZ A;  3HHF A;  3PD8 A;  4IB2 A;  1QVS A;  4QF9 A;  1PC3 A;  3RY3 A;  5BWJ A;  1B6H A;  1MY1 A;  1MXX A;  1B58 A;  4R9F A;  4NMY A;  4EQ9 A;  1O63 A;  3RPW A;  3RGY A;  4DCX A;  3BFT A;  4F39 A;  1FQB A;  2G93 A;  1JW5 A;  2OJT A;  3KJ7 A;  4X1B A;  5ICQ A;  2F5X A;  4FED A;  4NF6 B;  2F36 A;  4NTL A;  2FYI A;  2XXH A;  4G68 C;  1WOD A;  5ITO A;  5KDT B;  4LAT A;  2I0C A;  2GH9 A;  4NED A;  3T9V A;  5CMC A;  2OK2 A;  3G7W A;  2RCA A;  2DQV A;  3VVF A;  5L8D A;  1A99 A;  2RKM A;  3FVO A;  2XD3 A;  3O97 A;  1OMP A;  1ZIU A;  3HCQ A;  1N3W A;  2ANJ A;  2DE3 A;  3FD3 A;  4PET A;  3OSQ A;  5I56 A;  1FTO A;  2UXA A;  4F3P A;  4MH5 A;  1Y4T A;  5TPA A;  1II5 A;  5ISU A;  4F29 A;  5J1D A;  1J1N A;  1VFE A;  4YB5 A;  2O84 X;  2NVU B;  3UP9 A;  2XX7 A;  2XXU A;  3I3V A;  2H9B A;  2V84 A;  1DMB A;  1MH4 A;  1Y4C A;  3IJO B;  2RF1 A;  4L17 A;  4OFJ A;  1USY E;  4QSD A;  4X1D A;  4EQ7 A;  3O28 A;  3S9M C;  1PB9 A;  4G8H A;  2I48 A;  1EZP A;  1IXI A;  1N3X A;  3TYH A;  4DCY A;  3QIM A;  1I6A A;  1DSN A;  2ZMB A;  3GBB A;  1LLS A;  1I6Q A;  3HHG A;  2GHB A;  1GV8 A;  2VGQ A;  1HSL A;  2I0B A;  3H6T A;  3K6X A;  1ANF A;  1LCF A;  1ZLQ A;  3KSX A;  2DOJ A;  4GXA A;  3DP4 A;  5H8N A;  4GF8 A;  1D3K A;  4DDD A;  3PPP A;  3HN0 A;  1Z7N E;  1ZKB A;  3K01 A;  5HPQ A;  4JWX A;  4WED A;  1GTK A;  1PB7 A;  4F3G A;  1H45 A;  3VDF A;  3LC8 A;  3PUZ E;  2ZYN A;  3OO7 A;  1ATG A;  4U22 A;  5FHM A;  3WAF A;  1Z7M E;  1AOV A;  1LAH E;  4YB7 A;  2I4C A;  1A7L A;  3FGS A;  2RCB A;  3H3G A;  1T0K A;  4IGT A;  3IK6 B;  3TCH A;  3VVD A;  1F9B A;  2QRY A;  2VP1 A;  3E9X A;  4G68 B;  4MBP A;  4F1V A;  1XT8 A;  3H03 A;  3OEN A;  4PE5 B;  1PBP A;  4OES A;  2BJJ X;  3OEK A;  1SVX B;  4YKK A;  3K4U A;  1UTH A;  4QHQ A;  1MQI A;  4QSC A;  3VLW A;  1XC1 A;  1H76 A;  4TOZ A;  1LAX A;  1N84 A;  4QFO A;  5CI5 A;  4ZEK A;  2YJP A;  4DXU A;  4R74 A;  2HXW A;  3LSW A;  1Q1K A;  1SD3 A;  1D4N A;  3GBA A;  3U93 A;  2W7Y A;  4XKP A;  2RC9 A;  3PPQ A;  5DEX A;  5AA4 B;  3FXR A;  3PMW A;  3KZG A;  3CFX A;  5DYH A;  2V3U A;  3SEW A;  3UIF A;  5KDT A;  4KYD A;  3O66 A;  4GL8 A;  4POW A;  3FVK A;  5CBS A;  1DTZ A;  3OOA A;  5L9O A;  2Q89 A;  3SEX A;  5JK4 A;  1YPN A;  1OLC A;  3H4Z A;  3FZV A;  1MXW A;  3N5L A;  3IOW A;  1B52 A;  2OCU A;  4G77 A;  1YAE A;  3TTN A;  3CVG A;  3EQ1 A;  5AA2 D;  3CFZ A;  3G3I A;  1A54 A;  4WKM A;  1MPD A;  4BDM A;  5IKB A;  5I2N A;  2F97 A;  5AA4 A;  1US4 A;  3KN3 A;  3N94 A;  4YAH X;  5CM6 A;  3C31 A;  1BLF A;  2XXQ A;  3HST A;  3QK6 A;  5A5X B;  3A3U A;  5DT6 A;  1JEU A;  3BKI B;  3IB2 A;  1B40 A;  4JB7 A;  4XKQ A;  4JSD A;  1OQH A;  1SW4 A;  3MBP A;  4XKN A;  4Q0C A;  2O7I A;  3O9P A;  3T9H B;  5KCJ B;  2F7A A;  3Q25 A;  4IO6 A;  1MPB A;  1SBP A;  1N0T A;  3PUV E;  3K02 A;  5L9S A;  3SET A;  1FQD A;  3K1M A;  3MP8 A;  3IX1 A;  1URG A;  3TCF A;  4AB5 A;  2REJ A;  1IUD A;  3G3J A;  4Q5T A;  3B7D A;  1I6B A;  3OO9 A;  4GRK A;  4F2Q A;  1OQG A;  2A5T A;  1AMF A;  1SYH A;  4KFQ A;  2GFE A;  3TAJ A;  5DVI A;  3AXF A;  4LQ5 A;  3PV0 E;  1IIW A;  3IL1 B;  3MVX A;  1R9Q A;  1PEB A;  5I57 B;  4LZ7 A;  3O6I A;  4LON B;  4NF4 A;  1JW1 A;  3D4C A;  2H25 A;  2UYF A;  4ND9 A;  4QFL A;  1IXG A;  5H8F A;  4RPN A;  3KG2 A;  1MY4 A;  4R6Y A;  3H6W A;  4EXL A;  3R6U A;  2RC7 A;  5CMB A;  2I3W A;  4KI0 E;  5KCJ A;  1GR2 A;  1MDQ A;  1PDA A;  2Q2A A;  1Y1M A;  3OSR A;  3V83 A;  1P1N A;  3TTL A;  4ESX A;  2FNC A;  3IOR A;  2QS2 A;  3MZ1 A;  2UVJ A;  3Q27 A;  4U4S A;  1S50 A;  2ZNS A;  4YKI A;  3QYT A;  3KEI A;  3ECR A;  4HS7 A;  4PFW A;  1I69 A;  5EHS A;  3U72 A;  4C1T A;  1B3H A;  4KQP A;  1N7X A;  2QS1 A;  2D5W A;  4IO5 A;  5BUU A;  1RYO A;  5CMK A;  3QAX A;  1MXZ A;  1EZ9 A;  4ELQ A;  3WAE A;  2OWS A;  1UIU A;  5I2K A;  2O6A A;  5EHM A;  1BKA A;  1P1W A;  3UGW A;  4JXI A;  2HZL A;  1M5B A;  1IZ1 A;  1M5F A;  1TFD A;  1XOC A;  2X7Q A;  3M8U A;  2UVG A;  3MP6 A;  1H43 A;  1URS A;  4IY6 A;  4MF3 A;  3V89 B;  2VD3 A;  4ECF A;  3ZS6 A;  1SI1 A;  4IGR A;  4MLV A;  1B3E A;  2YLN A;  4OER A;  4G68 A;  4RYA A;  2XXX A;  3CR9 A;  4GQO A;  1QKA A;  4NF5 A;  4RJZ A;  2AYS A;  3K00 A;  3MWB A;  1B2H A;  3ONM A;  1AH5 A;  2Y7K A;  2ZNU A;  3N26 A;  4TQU Q;  3S9N C;  5H8H B;  1LGB C;  5DVJ A;  3Q26 A;  3QSL A;  1O7T A;  1POY 1;  4IO7 A;  4G4P A;  4KCC A;  4PQJ A;  4RK9 A;  1GGG A;  2HEU A;  1LAG E;  3G3H A;  5HM4 B;  3G3F A;  3TCG A;  4YKP A;  1IQ7 A;  3T9U A;  3FIR A;  4ELR A;  1FQC A;  1LBB A;  2E1S A;  1R1N A;  3OEM A;  1AL3 A;  4HCW A;  1PBQ A;  1B1X A;  3DLN A;  3V5A A;  5IAI A;  1JEV A;  2ABH A;  1LST A;  4OZ9 A;  1B5J A;  4OTE A;  2F8D A;  5CRY A;  4GWO A;  3UN6 A;  3MJN A;  1B51 A;  4IO3 A;  3FV2 A;  3TTM A;  3TPA A;  3CSB A;  1R9L A;  4DZ1 A;  1MDP 1;  2DYX A;  4R73 A;  4KD5 A;  1LB9 A;  1HSE A;  1QW0 A;  1SI0 A;  4AQ4 A;  4ZS9 A;  3K6W A;  3C32 A;  4I8C A;  3LSL A;  1YCJ A;  2V3Q A;  4F1Y A;  4YZZ A;  5LOM A;  3KBR A;  2XD2 A;  2Y7I A;  3TKD A;  4EUO A;  3TFL A;  2DWH A;  3O29 A;  5DVF A;  3K0V A;  4YIC A;  3PGF A;  5FTI A;  4THI A;  4Z7E A;  5I57 A;  3S2V A;  2XXV A;  1S9T A;  3VLU A;  3VXC A;  1LFH A;  2F7C A;  3G3K A;  1RKM A;  1B4Z A;  4LVQ A;  1MH3 A;  4FE8 A;  2A5T B;  3H6U A;  1OVT A;  4RA1 A;  2PT2 A;  3ZKL A;  1BIY A;  2QMX A;  3MZ9 A;  4GOT A;  4TLM B;  1NL5 A;  1IEJ A;  3LR1 A;  3M3L A;  3JYR A;  2R6G E;  1NH8 A;  4H0W A;  4YMA A;  1MQD A;  3MW0 A;  2V3T A;  4N13 A;  1IIT A;  3N6U A;  4NWC A;  4I9D A;  1FTL A;  4UAC A;  4UA8 A;  4PFU A;  1QKB A;  1PB8 A;  4OEN A;  4M4G A;  5FHO A;  1XHY A;  2ZXT A;  1NMU A;  3S9E A;  2ZYO A;  3C35 A;  4BDO A;  4OVJ A;  2GHA A;  1VE4 A;  3C34 A;  1A40 A;  1TT1 A;  3TEL A;  4HW8 A;  3RLF E;  4O3A A;  2F78 A;  3RT6 B;  2XXI A;  1US5 A;  1DOT A;  2UYE A;  1FW0 A;  1M5E A;  1NKX A;  2F7B A;  1OLA A;  3IAZ A;  3FAS A;  3O6H A;  4HTG A;  1VSO A;  4U4X A;  1A8F A;  5JTY A;  3MVZ A;  1M5C A;  2D21 A;  3IO4 A;  3CG1 A;  3OEL A;  2X7P A;  3DEL B;  4GD5 A;  4I62 A;  4JWY A;  4PFY A;  5AA3 A;  1UQW A;  4R75 A;  1H44 A;  1RYX A;  2ONS A;  4RNS A;  2QS4 A;  2D3I A;  1B4H A;  1JW4 A;  1UTB A;  1FTK A;  1IXH A;  1B5H A;  1QUK A;  1S7Y A;  1N04 A;  2AL4 A;  3B6W A;  1B3F A;  2O1L A;  2Q88 A;  3LBS A;  4F3S A;  2LAO A;  3I6V A;  3PUX E;  4EXK A;  2I58 A;  3ZSF A;  1P99 A;  5B7D A;  2DWA A;  3FXU A;  5DTB A;  3TEP A;  1Y3Q A;  5FTH A;  2HCA A;  1UIV A;  2HAV A;  4Z0I A;  3SDF A;  1MXU A;  2Z8D A;  4NE4 A;  2F6G A;  1B9J A;  5CBR A;  1N7W A;  4U21 A;  2XXR A;  2DXY A;  2XXY A;  2V25 A;  2G29 A;  4ZEB A;  1B3G A;  3LSX A;  5H8S A;  4XKR A;  3O2A A;  1WDN A;  2WKY A;  1CE2 A;  2DWI A;  5TP9 B;  2XXT A;  4LZ5 A;  4EDP A;  3Q28 A;  3FV1 A;  4ZE9 A;  4EF1 A;  1O64 A;  4HCY A;  1B32 A;  5CC2 A;  1FQF A;  2O69 A;  1MM6 A;  3OXN A;  3PUW E;  1Q35 A;  1B05 A;  1FQA A;  1H3D A;  3EN3 A;  4FIM A;  3VE1 B;  4R2B A;  4F2O A;  2H98 A;  1M5D A;  2DVZ A;  2PMS A;  3N6T A;  3K1N A;  3PMV A;  4RXL A;  5H8Q B;  1HSJ A;  5AA2 B;  3TUS A;  2ONR A;  2XX8 A;  3K1P A;  4GFR A;  4BDN A;  3K6V A;  4NF8 B;  3CSG A;  3KN7 A;  4ZED A;  2DWJ A;  4K3F A;  4DLD A;  2IA4 A;  1XVY A;  3L6G A;  2F6P A;  1SW5 A;  1MY0 A;  1UTB B;  2PVU A;  2X26 A;  3E4R A;  4R2F A;  3U1O A;  3T66 A;  2DP8 A;  3S4U A;  3UK4 A;  2XXW A;  4O3C A;  4XXU A;  3B6Q A;  4FEB A;  2F35 A;  1SW1 A;  1LFI A;  2Q9T A;  2XXP A;  3IB0 A;  4LP2 B;  3MP1 A;  3MPL A;  2Y7R A;  2DE2 A;  3K2D A;  3T9X B;  3LSF B;  3PUY E;  3DP8 A;  1FTJ A;  4NF5 B;  3RQT A;  5TPA B;  2Q8J A;  3CG3 A;  3UOR A;  1SQY A;  4FAT A;  4IO4 A;  1LCT A;  1USY H;  4P0G A;  3E13 X;  2DXR A;  2ZYK A;  4U23 A;  3I5O A;  1Y3N A;  4PFT A;  3MUQ A;  1ZJL A;  4YMB A;  3USD A;  3FUZ A;  1ZBM A;  1TFA A;  1YTV A;  4IY5 A;  3S9L C;  1MXY A;  2VOZ A;  3RUM A;  5FHN A;  3THI A;  5H8N B;  1JVX A;  4F31 B;  3U8Q A;  3ODB A;  4QFN A;  3SKP A;  3DM0 A;  2GRV A;  5K2X A;  1ZU0 A;  2I6E A;  2Z23 A;  1LFG A;  4H67 A;  4P11 A;  2XX9 A;  4GLI A;  3VVE A;  3HO7 A;  4QRZ A;  3MZB A;  1OIB A;  2ESN A;  4DXB A;  4ZEC A;  3E3K A;  1MM7 A;  2DVC A;  3A3C A;  4PP0 A;  2RIN A;  5F7V A;  4ONY A;  1POT A;  2O7U A;  3O6G A;  3V8X B;  5TU0 A;  1B7H A;  1NNP A;  4Q30 B;  1L5T A;  3TTK A;  1ZTY A;  1NNF A;  1BTJ A;  1SW2 A;  2I3V A;  3FAT A;  4TLL B;  1SDX A;  1NNT A;  2QL3 A;  3PPR A;  2B3B A;  3KOT A;  3TOD A;  2Q2C A;  2HAU A;  3K6U A;  3OD7 A;  3IB1 A;  4OFO A;  4Q8R A;  3UA8 A;  3W9W A;  1EZO A;  1LBC A;  2H5Y A;  1MQH A;  2Y84 A;  3BBR A;  1B1H A;  5CMM A;  5AE4 A;  4JDF A;  4ELP A;  4BLA A;  1JQF A;  2RC8 A;  1D9Y A;  3R7X A;  2KLF A;  4GVO A;  4H6D A;  2DS9 A;  4OEU A;  4F19 A;  5ITP A;  1JVY A;  1ZMG A;  3CRB A;  3CIJ A;  1MRP A;  2R71 A;  3EHS A;  4N6P A;  3RN8 A;  3MVW A;  4NWD A;  1Y1Z A;  3IOV A;  3P7I A;  4LUB A;  3SEV A;  3IOU A;  3MQ9 A;  2P2A A;  4R9G A;  2A5S A;  4ZDM A;  5AA2 A;  1MY3 A;  4RY1 A;  2ZYM A;  3TTR A;  4GL0 A;  4BDQ A;  3ILU B;  3SEY A;  2OLB A;  4R6H A;  1P1U A;  1N76 A;  2O68 A;  2R9J A;  1B7Z A;  4KHZ E;  2V93 A;  5M2V A;  3U94 A;  5DEX B;  3R26 A;  2Y7W A;  3GLB A;  4G8M A;  3T22 A;  3VLV A;  4M1V A;  1TXF A;  3HV1 A;  2DE4 A;  5I58 A;  5I2N B;  3B6T A;  4O3B A;  5F1Q A;  2QJE A;  1FTM A;  4DXC A;  3M3F A;  3RNN A;  2PYY A;  4JWO A;  2PBW A;  4H8J A;  4JSO A;  2NXO A;  1B3L A;  4G2Z A;  2I49 A;  3IOT A;  3SES A;  1Y3P A;  2E0S A;  4BDL A;  3IO6 A;  3C4M A;  3ILT B;  3T93 B;  4P0I A;  4ZE8 A;  4FJP A;  4MLQ A;  3EPE A;  4OWD A;  5AA1 A;  2QS3 A;  4OFL A;  1EU8 A;  4OXV A;  3RTW B;  1R6Z A;  4C0R A;  4DE8 A;  4E0X A;  3KSJ A;  3TDJ A;  1FQE A;  2VHA A;  1MQJ A;  2Z22 A;  4H5G A;  1B0H A;  4ZEI A;  1B0L A;  5I58 B;  5A5X A;  3C36 A;  1JNF A;  4OHN A;  4F18 A;  3H7M A;  1D9V A;  4ZZE A;  3U92 A;  3LUY A;  3PMX A;  5I59 A;  3MPK A;  2VD2 A;  4POX A;  3H06 B;  3IR1 A;  5JTY B;  3TQL A;  4I1D A;  1KWH A;  1MG1 A;  2QPQ A;  3OO8 A;  5EYF A;  2P1S A;  3QUJ A;  2UVH A;  4RK2 A;  1GVC A;  2NWJ A;  3W15 C;  2O1M A;  4H8I A;  2Z8E A;  3IJX B;  4U2R A;  1DPP A;  3MAM A;  1MPC A;  5K2Y A;  3PPN A;  3FVN A;  1B5I A;  2NOO A;  3FJM A;  3ZKK A;  2P0S A;  5I59 B;  1ELJ A;  2QSX A;  3CFL A;  3EHT A;  3FVG A;  4QFK A;  4LA9 A;  5ELV A;  1P1Q A;  4OYV A;  2OWT A;  4NF6 A;  4WXJ A;  2HFB A;  1QJM A;  4FOR A;  4OQO A;  3PD9 A;  1DTG A;  3RTF B;  2F34 A;  1XS5 A;  3T96 B;  2Y7P A;  3KN8 A;  4H1X A;  5JEI A;  4LZ8 A;  4F3B A;  4G8N A;  3EHU A;  3KFM A;  1EH3 A;  4ISU A;  4R72 A;  4U1Z A;  4IO2 A;  4WEP A;  4E0W A;  1AIV A;  3SEU A;  4ESW A;  1MY2 A;  2DSF A;  3OMB A;  1MXV A;  1JET A;  2NUV A;  4KR5 A;  3VFJ A;  4FEC A;  5H8H A;  5I2K B;  4XIG Q;  2ZNT A;  4EQB A;  3MC2 A;  1LB8 A; 
#chains in the Genus database with same CATH topology
 2PT1 A;  1NFT A;  2XWI A;  3KJT A;  2FA7 A;  4GBW A;  2HQ0 A;  3DP6 A;  4DXC A;  2QMW A;  2UVI A;  4R6K A;  1G0H A;  3MVY A;  3TMG A;  5L9M A;  4OA4 A;  2CMO A;  4ZEF A;  5ICQ A;  2B65 A;  4EF2 A;  3G3G A;  5B70 A;  2H4I A;  4F1U A;  1NV5 A;  4AB6 A;  1QGX A;  4GXS B;  1QUJ A;  4LQ2 A;  4KYE A;  1D9Q A;  4OVT A;  3RT8 A;  1URD A;  1VR5 A;  2VT5 A;  4DIG A;  5I84 A;  4G61 A;  4JVC A;  4PTK A;  3RY3 A;  4NMY A;  4EQ9 A;  1O63 A;  3BFT A;  1FQB A;  2G93 A;  3KJ7 A;  4X1B A;  2B4L A;  2XXH A;  1WOD A;  5ITO A;  2DQV A;  1A99 A;  2RKM A;  3O97 A;  4OVQ A;  5EQ8 A;  3OSQ A;  1Y4T A;  5J1D A;  1VFE A;  3UP9 A;  1NUW A;  2V84 A;  4OFJ A;  4X1D A;  4EQ7 A;  1FPJ A;  3TYH A;  1FPG A;  1I6A A;  2ZMB A;  3HHG A;  1HSL A;  3H6T A;  1ZLQ A;  2DOJ A;  3PPP A;  3HN0 A;  3K01 A;  5HPQ A;  1DBZ A;  1PB7 A;  3LC8 A;  3PUZ E;  4XFE A;  3OO7 A;  3WAF A;  1LAH E;  3H3G A;  4IGT A;  3TCH A;  4MBP A;  4G68 B;  1JP4 A;  1XT8 A;  3OEN A;  4PE5 B;  3OEK A;  3K4U A;  4P56 A;  3T1B A;  1XC1 A;  5CI5 A;  1LAX A;  4DXU A;  2YJP A;  3GBA A;  3U93 A;  5DEX A;  5AA4 B;  5F24 A;  5DYH A;  2V3U A;  4I40 A;  3FVK A;  5JK4 A;  4G77 A;  1OLC A;  1B52 A;  2OCU A;  3EQ1 A;  3G3I A;  4BDM A;  1MPD A;  5AA4 A;  1US4 A;  3KN3 A;  4XF5 A;  3QK6 A;  4XKQ A;  4JB7 A;  3KBZ A;  1OQH A;  4XKN A;  2O7I A;  3O9P A;  1MPB A;  5L9S A;  3G3J A;  3OO9 A;  1AMF A;  4KFQ A;  4LQ5 A;  1IIW A;  1KA1 A;  3MVX A;  1PEB A;  3O6I A;  4QFL A;  4QXD A;  3H6W A;  4EXL A;  4KI0 E;  1MDQ A;  1PDA A;  2Q2A A;  1Y1M A;  1P1N A;  4MIJ A;  4U4S A;  2XA5 A;  4YKI A;  4HS7 A;  4N81 A;  1N7X A;  2QS1 A;  2D5W A;  5BUU A;  1MXZ A;  2OWS A;  5I2K A;  5EHM A;  1BKA A;  1IZ1 A;  3M8U A;  1TFD A;  2X7Q A;  3MP6 A;  4IY6 A;  2UVG A;  1H43 A;  4ECF A;  2VD3 A;  1RDY A;  1SI1 A;  2YLN A;  4RYA A;  4OVP A;  1B2H A;  3N26 A;  4TQU Q;  2KR0 A;  3QSL A;  3B8B A;  3EKI A;  3OEM A;  1AL3 A;  2ABH A;  1LST A;  4OZ9 A;  5EQA A;  1R9L A;  2DYX A;  2ZZV A;  1DCU A;  4UAB A;  5LOM A;  4F1Y A;  4EUO A;  2Y7I A;  5DVF A;  5FTI A;  4Z7E A;  5I57 A;  3S2V A;  1LFH A;  3QMF A;  1RKM A;  1MH3 A;  3H6U A;  1OVT A;  2PT2 A;  1BIY A;  2QMX A;  3MZ9 A;  4FBP A;  3BIH A;  1IEJ A;  1NH8 A;  4YMA A;  4DI3 D;  4NWC A;  1FTL A;  4OEN A;  2ZXT A;  3C35 A;  3C34 A;  4HW8 A;  1FW0 A;  1M5E A;  3O6H A;  1FPD A;  2F7B A;  3FAS A;  1EYK A;  1M5C A;  3IO4 A;  3CG1 A;  4NGU A;  5EYG A;  2QVV A;  1RYX A;  4R75 A;  2ONS A;  2B4M A;  4HXV A;  4RNS A;  1B4H A;  1B5H A;  1N04 A;  2O1L A;  4EXK A;  2HHM A;  5B7D A;  3TEP A;  1UIV A;  4ZEB A;  5H8S A;  3O2A A;  4ZE9 A;  1FPB A;  3FV1 A;  4HCY A;  2O69 A;  3A29 A;  1H3D A;  4F2O A;  2DVZ A;  5H8Q B;  2ONR A;  1FRP A;  2XX8 A;  4MAG A;  4NF8 B;  3CSG A;  4K3F A;  5EQ9 A;  2F6P A;  1MY0 A;  4PBQ A;  3T66 A;  2DP8 A;  3S4U A;  2XXW A;  3IB0 A;  3MPL A;  2Y7R A;  3K2D A;  3PUY E;  1FTJ A;  4P0G A;  2DXR A;  3I5O A;  4PDH A;  3USD A;  3FUZ A;  1ZBM A;  1BK4 A;  1LFG A;  2KQZ A;  4P11 A;  2XX9 A;  3HO7 A;  2P3V A;  1FPK A;  2ESN A;  2DVC A;  2QVU A;  3A3C A;  5F7V A;  1B7H A;  1ZTY A;  1SW2 A;  4MEV A;  1NNT A;  3KOT A;  3K6U A;  1NV1 A;  1EZO A;  3IB1 A;  1NV3 A;  3BBR A;  5AE4 A;  4JDF A;  1ZMG A;  4GWS A;  4N6P A;  3RN8 A;  1Y1Z A;  3SEV A;  3IOU A;  4R9G A;  2A5S A;  2OWZ A;  4PAK A;  1P1U A;  1N76 A;  2R9J A;  5DEX B;  3R26 A;  3T22 A;  2DE4 A;  5I58 A;  5I2N B;  3HFU A;  5F1Q A;  1FTM A;  2PBW A;  4H8J A;  2NXO A;  4G2Z A;  4MMP A;  3C4M A;  3ILT B;  3T93 B;  2L5V A;  4MLQ A;  3EPE A;  4OWD A;  3RTW B;  4OXV A;  3KSJ A;  5FBP A;  5I58 B;  1B0H A;  5A5X A;  3NOH A;  1JNF A;  5I59 A;  2VD2 A;  4POX A;  3IR1 A;  5EQ7 A;  3OO8 A;  3ZKK A;  4H8I A;  1MPC A;  3PPN A;  3FJM A;  5I59 B;  5ELV A;  1P1Q A;  4NF6 A;  2HFB A;  1QJM A;  1DTG A;  2F34 A;  5ESY A;  4HE2 A;  4G8N A;  1EH3 A;  4IO2 A;  4WEP A;  3SEU A;  2DSF A;  2NUV A;  1LB8 A;  4N15 A;  1FCK A;  2M8C A;  1XVX A;  2REG A;  1MS7 A;  1LBW A;  2ONK E;  3JZJ A;  4X48 A;  2YPN A;  4KCD A;  2H99 A;  1B46 A;  2FIE A;  2Z8F A;  1NNK A;  1VDW A;  4QFP A;  3H6V A;  4NF8 A;  2OBG A;  3CI8 A;  2XHD A;  3BIG A;  1B7U A;  3D4G A;  3PU5 A;  1EZP A;  4KPT A;  1BP5 A;  2I4B A;  1UTH B;  5I56 B;  4NF4 B;  4F22 A;  4YB6 A;  3C9H A;  4KYS A;  1NV6 A;  3BFU A;  3GZG A;  1IXC A;  1A8E A;  2HZK A;  4C1U A;  1MQG A;  3PPO A;  3VV5 A;  4IB2 A;  1PC3 A;  1MXX A;  1B58 A;  4R9F A;  4DCX A;  2MKZ A;  2OJT A;  2F5X A;  1IMA A;  2BJI A;  4LAT A;  2I0C A;  4NED A;  3G7W A;  3VVF A;  3FVO A;  4GX3 A;  2ANJ A;  2DE3 A;  5TPA A;  5ISU A;  4YB5 A;  2O84 X;  2NVU B;  3I3V A;  1DMB A;  4QSD A;  1Y4C A;  3O28 A;  3S9M C;  1PB9 A;  2I48 A;  4DCY A;  1DSN A;  2GHB A;  1GV8 A;  2VGQ A;  3KSX A;  1LCF A;  4GXA A;  3DP4 A;  1D3K A;  4DDD A;  2ZYN A;  1Z7M E;  2I4C A;  1A7L A;  3FGS A;  2RCB A;  1T0K A;  1FSA A;  2VP1 A;  3H03 A;  1YYZ A;  4N6K A;  4QHQ A;  3VLW A;  4QFO A;  4R74 A;  1Q1K A;  1SD3 A;  5LDZ A;  4N4U A;  2W7Y A;  3FXR A;  3KZG A;  3CFX A;  3SEW A;  3UIF A;  5KDT A;  5L9O A;  3O66 A;  1IMF A;  3B50 A;  3H4Z A;  3FZV A;  3IOW A;  1YAE A;  4WKM A;  5IKB A;  1BLF A;  1Q9D A;  5DT6 A;  4JSD A;  2HXR A;  1SW4 A;  4PF8 A;  1FTA A;  4Q0C A;  3T9H B;  1N0T A;  2QVR A;  3PUV E;  2ZZW A;  3K1M A;  3MP8 A;  3IX1 A;  1URG A;  2GFE A;  2WX9 A;  4IR8 A;  5I57 B;  4LZ7 A;  4LON B;  3D4C A;  5H8F A;  3KG2 A;  3R6U A;  1FBF A;  2UVJ A;  1DK4 A;  2F3B A;  4I3E A;  3ECR A;  1FPI A;  5EHS A;  3MST A;  1B3H A;  3D1R A;  4O7I A;  3UGW A;  1P1W A;  1XOC A;  1FPF A;  4IGR A;  4MLV A;  4P3L A;  1QKA A;  3MWB A;  1AH5 A;  2Y7K A;  2ZNU A;  5H8H B;  4IO7 A;  1O7T A;  3E79 A;  4RK9 A;  1FBP A;  1GGG A;  2HEU A;  3G3H A;  5HM4 B;  3G3F A;  4YKP A;  3FIR A;  5I7I A;  1XI6 A;  1PBQ A;  3DLN A;  3V5A A;  5IAI A;  1B5J A;  4MHF A;  4GWO A;  3MJN A;  3SZP A;  3CSB A;  4KD5 A;  1LB9 A;  1SI0 A;  4AQ4 A;  4ZS9 A;  3C32 A;  2V3Q A;  3TKD A;  3TFL A;  3K0V A;  4YIC A;  2QFL A;  2XXK A;  4THI A;  1FBG A;  2F7C A;  4LVQ A;  3ZKL A;  4H0W A;  3MW0 A;  2OX3 A;  4UA8 A;  4UAC A;  1PB8 A;  2VPN A;  5IZ3 B;  4PDD A;  5FHO A;  2ZYO A;  4OVJ A;  1A40 A;  3TEL A;  3RLF E;  2XXI A;  4P1L A;  1OLA A;  3MVZ A;  2D21 A;  4JWY A;  3OEL A;  3DEL B;  4GD5 A;  4PFY A;  3T0J A;  1YZ0 A;  4Z0I A;  2D3I A;  1QUK A;  3B6W A;  1IXH A;  2AL4 A;  2LAO A;  5ET8 A;  3ZSF A;  3FXB A;  2DWA A;  3FXU A;  1MXU A;  5CBR A;  2F6G A;  4U21 A;  2XXR A;  2DXY A;  2V25 A;  2G29 A;  4HE1 A;  1WDN A;  4EDP A;  3Q28 A;  1B32 A;  1MM6 A;  4O8M A;  3N6T A;  2PMS A;  5ET7 A;  3K1N A;  4GWW A;  1HSJ A;  3TUS A;  4ZED A;  5DW8 A;  2ZZX A;  2X26 A;  4O3C A;  3IFA A;  1IME A;  1NUX A;  2DE2 A;  3LSF B;  5TPA B;  3CG3 A;  4MNP A;  1SQY A;  5IZ1 A;  1LCT A;  1USY H;  3E13 X;  2ZYK A;  1ZJL A;  1MXY A;  3RUM A;  3THI A;  4F31 B;  4QFN A;  3SKP A;  1IMB A;  1ZU0 A;  1LBY A;  4N17 A;  1OIB A;  4ZEC A;  1K9Z A;  4Q30 B;  3KC0 A;  4TLL B;  3VDF A;  3ZS6 A;  3TOD A;  3OD7 A;  2HAU A;  2FBP A;  2Q8M A;  2Y84 A;  1B1H A;  5ITP A;  3CRB A;  3EHS A;  2CZI A;  3IOV A;  3P7I A;  3MQ9 A;  2FVZ A;  4RY1 A;  5IGA A;  5JTY A;  3SEY A;  3U94 A;  3VLV A;  3GLB A;  4M1V A;  3B6T A;  4O3B A;  3M3F A;  4O7M A;  4JWO A;  2I49 A;  4BDL A;  1Y3P A;  4ZE8 A;  3U65 A;  1EU8 A;  4C0R A;  2VHA A;  4H5G A;  3C36 A;  1D9V A;  4MX6 A;  3TQL A;  5I5P A;  3QUJ A;  2UVH A;  2Z8E A;  4U2R A;  1DPP A;  4GX6 A;  3FVN A;  2NOO A;  2QSX A;  3EHT A;  4QFK A;  4OQO A;  3T96 B;  3LUZ A;  3PD9 A;  4P8B A;  4LZ8 A;  4R72 A;  4U1Z A;  1AIV A;  4ESW A;  1MXV A;  1JET A;  3VFJ A;  5I2K B;  4EQB A;  3O6G A;  5HBC A;  4ZZA A;  2WBD A;  1CB6 A;  2O51 A;  5J16 A;  2Y5L A;  4JVI A;  3VXB A;  3KGC A;  4PC9 A;  4H5F A;  3EF7 A;  4P1E A;  2THI A;  1Y9U A;  4QSE A;  4OET A;  1DPE A;  3KOS A;  2AL5 A;  5KZT A;  4X9T A;  2CEY A;  2PX1 A;  5H8F B;  2CZL A;  2B3F A;  4H65 A;  3M3K A;  1Y20 A;  1A55 A;  3QUF A;  5T3J A;  3W9V A;  4GWX A;  2AIX A;  4BDR A;  4YKJ A;  3GXA A;  1QUI A;  1LEV A;  4GIZ A;  3HHF A;  5BWJ A;  1B6H A;  4F39 A;  1JW5 A;  2F36 A;  4NTL A;  2FYI A;  5KDT B;  3FBP A;  5CMC A;  2OK2 A;  2RCA A;  5L8D A;  2XD3 A;  3HCQ A;  1N3W A;  3FD3 A;  4F29 A;  1KA0 A;  4PGN A;  3IJO B;  2H9B A;  1MH4 A;  2RF1 A;  4G8H A;  4PFI A;  3GYY A;  3GBB A;  1LLS A;  1I6Q A;  4ELR A;  4HCW A;  3K6X A;  3RPL B;  1ANF A;  4GF8 A;  1Z7N E;  4WED A;  1H45 A;  1INP A;  1AOV A;  4YB7 A;  3IK6 B;  2QRY A;  3E9X A;  4F1V A;  4GBV A;  2BJJ X;  4YKK A;  1MQI A;  4OVS A;  4ZEK A;  2HXW A;  1D4N A;  4XKP A;  2RC9 A;  3PPQ A;  3PMW A;  1FJ6 A;  4KYD A;  4POW A;  1DTZ A;  2Q89 A;  3SEX A;  1YPN A;  2V4C A;  3TTN A;  5AA2 D;  3CFZ A;  1A54 A;  2F97 A;  3N94 A;  4YAH X;  5CM6 A;  2XXQ A;  1JEU A;  3BKI B;  4GWY A;  3Q25 A;  4IO6 A;  1SBP A;  1FQD A;  3TCF A;  2REJ A;  4Q5T A;  1I6B A;  4GRK A;  1OQG A;  2A5T A;  3AXF A;  4AS4 A;  3IL1 B;  2H25 A;  2UYF A;  4RPN A;  5KCJ A;  3V83 A;  2FNC A;  2Y5K A;  3QYT A;  3KEI A;  1I69 A;  4KQP A;  5CMK A;  1EZ9 A;  3WAE A;  2JJK A;  1FBE A;  1UIU A;  2O6A A;  4JXI A;  2HZL A;  1M5F A;  1URS A;  4MF3 A;  1B3E A;  4G68 A;  4GQO A;  4RJZ A;  2AYS A;  3K00 A;  3ONM A;  3S9N C;  1LGB C;  5DVJ A;  4PQJ A;  3Q26 A;  3TDJ A;  1POY 1;  4KCC A;  4MCO A;  4P47 A;  2PCR A;  3T9U A;  1LBB A;  1NI9 A;  4PFR A;  4OTE A;  5CBS A;  3UN6 A;  2F8D A;  3TPA A;  4DZ1 A;  1MDP 1;  4OVR A;  4XEQ A;  3E78 A;  3K6W A;  4I8C A;  3LSL A;  5IZ3 A;  3KBR A;  2XD2 A;  2DWH A;  3O29 A;  3PGF A;  2CZH A;  1S9T A;  4HE0 A;  4FE8 A;  4GOT A;  4TLM B;  2PFY A;  3LR1 A;  2R6G E;  1MQD A;  2V3T A;  4PF6 A;  1XHY A;  1NMU A;  3S9E A;  1VE4 A;  3RT6 B;  3IAZ A;  3KC1 A;  1VSO A;  4U4X A;  1A8F A;  3CHG A;  1UQW A;  1H44 A;  2QS4 A;  1JW4 A;  1FTK A;  1S7Y A;  1B3F A;  3LBS A;  4F3S A;  3I6V A;  2I58 A;  4PE3 A;  1P99 A;  1SPI A;  3PTY A;  5LTC A;  5FTH A;  2HAV A;  2PFZ A;  1N7W A;  2XXY A;  3LSX A;  3LV0 A;  4XKR A;  1CE2 A;  5TP9 B;  2XXT A;  3PUW E;  1B05 A;  4DI4 B;  3EN3 A;  4FIM A;  3VE1 B;  4R2B A;  2H98 A;  3K1P A;  4GFR A;  3KN7 A;  2FIX A;  3L6G A;  4R2F A;  3VLU A;  3U1O A;  4XXU A;  2Q9T A;  1LFI A;  3UK4 A;  3T9X B;  2Q8J A;  4FAT A;  4IO4 A;  4PAI A;  1Y3N A;  4PFT A;  4YMB A;  1YTV A;  2VOZ A;  2VPO A;  3ODB A;  5K2X A;  2DDK A;  4NQ8 A;  4H67 A;  2WYK A;  4GLI A;  2WEF A;  4QRZ A;  3RPL A;  3E3K A;  1MM7 A;  4PP0 A;  2RIN A;  2O7U A;  4MJO A;  1NNP A;  4NN3 A;  1NNF A;  1BTJ A;  3FAT A;  3PPR A;  2B3B A;  4OFO A;  1LBC A;  1MQH A;  4BLA A;  1JQF A;  3R7X A;  4GVO A;  4F19 A;  1JVY A;  5ET6 A;  1MRP A;  1NV2 A;  4NWD A;  2P2A A;  5AA2 A;  1MY3 A;  3TTR A;  2P3N A;  4GWU A;  4BDQ A;  2O68 A;  4E0X A;  2Y7W A;  4X8R A;  4NAP A;  3HV1 A;  1NUY A;  1K9Y A;  3RNN A;  3IOT A;  3IO6 A;  4P0I A;  4FJP A;  5AA1 A;  4JVD A;  2QS3 A;  4DE8 A;  1FQE A;  4NHB A;  4OHN A;  4F18 A;  4ZZE A;  3PMX A;  1AWB A;  1KWH A;  1MG1 A;  5H8N B;  1GVC A;  2P1S A;  4RK2 A;  3W15 C;  2O1M A;  3MAM A;  1B5I A;  4X04 A;  2P0S A;  1ELJ A;  3CFL A;  4LA9 A;  4WXJ A;  5IZZ A;  3RTF B;  5JEI A;  1XS5 A;  4F3B A;  3EHU A;  4ISU A;  4E0W A;  2R8T A;  1MY2 A;  3OMB A;  4KR5 A;  4FEC A;  5H8H A;  2ZNT A;  4LN5 A;  5H8Q A;  4P9K A;  3L6H A;  1TWY A;  4YZZ A;  3FXQ A;  4FAJ A;  3TQW A;  4OEV A;  3Q29 A;  5ICT A;  2IEE A;  3A09 A;  3SER A;  3TZA A;  1SYI A;  2Q74 A;  4XTC Q;  1WVJ A;  1NUZ A;  2CZK A;  3HPI A;  4MFI A;  4RPO A;  1VFD A;  2ALU A;  4N07 A;  4U1O A;  3C33 A;  2OZZ A;  1G0I A;  1OVB A;  4JBZ A;  1QUL A;  1LAF E;  4NG7 A;  3OO6 A;  5TP9 A;  4ELO A;  3F11 A;  5A5L A;  2HPG A;  3FJG A;  1P1O A;  2F3D A;  3FJ7 A;  4OMB A;  1NH7 A;  3JV9 A;  4YU0 A;  3QXM A;  5EYH A;  4PAF A;  3PD8 A;  4QF9 A;  1QVS A;  1MY1 A;  3RPW A;  3RGY A;  4FED A;  4NF6 B;  4G68 C;  2GH9 A;  3T9V A;  1OMP A;  1ZIU A;  1IMC A;  4PET A;  5I56 A;  1FTO A;  2UXA A;  4F3P A;  4MH5 A;  1II5 A;  1J1N A;  2XX7 A;  2XXU A;  4L17 A;  1RDX A;  1USY E;  4PGP A;  1IXI A;  1N3X A;  4O94 A;  3QIM A;  2I0B A;  5H8N A;  1ZKB A;  2XWO A;  4JWX A;  1GTK A;  4F3G A;  4QBA A;  1ATG A;  4U22 A;  2FHY A;  5FHM A;  3VVD A;  1F9B A;  1FJ9 A;  1PBP A;  4KXP A;  4PFB A;  4OES A;  1SVX B;  1UTH A;  4QSC A;  1H76 A;  4TOZ A;  1N84 A;  3LSW A;  4MNC A;  4H45 A;  4GL8 A;  3OOA A;  3N5L A;  1MXW A;  3CVG A;  5I2N A;  3C31 A;  3HST A;  5A5X B;  3A3U A;  5IM2 A;  3IB2 A;  1B40 A;  4N8Y A;  1FBC A;  3MBP A;  5KCJ B;  1LBX A;  2F7A A;  3K02 A;  3RYD A;  4H46 A;  3SET A;  1LBV A;  4AB5 A;  1IUD A;  3B7D A;  4N91 A;  4F2Q A;  1SYH A;  3TAJ A;  5DVI A;  2XWV A;  3PV0 E;  4NF0 A;  1R9Q A;  4NF4 A;  1FBD A;  4ND9 A;  1JW1 A;  1IXG A;  1MY4 A;  4R6Y A;  2RC7 A;  5CMB A;  2I3W A;  1GR2 A;  3OSR A;  3TTL A;  4ESX A;  3IOR A;  3MZ1 A;  2QS2 A;  3Q27 A;  1S50 A;  2ZNS A;  3U72 A;  4PFW A;  4C1T A;  1IMD A;  1NV0 A;  4IO5 A;  1RYO A;  3QAX A;  4ELQ A;  4EF1 A;  1M5B A;  4I1D A;  1FPL A;  3V89 B;  4OER A;  2XXX A;  3CR9 A;  4NF5 A;  4N6D A;  4G4P A;  1LAG E;  3TCG A;  1IQ7 A;  1FPE A;  1FQC A;  2E1S A;  4I3Y A;  1R1N A;  4PBH A;  1B1X A;  1JEV A;  5CRY A;  1B51 A;  4IO3 A;  3FV2 A;  3TTM A;  4R73 A;  1HSE A;  1QW0 A;  1YCJ A;  4NX1 A;  2XXV A;  3VXC A;  3G3K A;  1B4Z A;  4RA1 A;  2A5T B;  1NL5 A;  3M3L A;  3JYR A;  2XWK A;  4N13 A;  1IIT A;  3N6U A;  4I9D A;  4PFU A;  1QKB A;  4GX4 A;  4M4G A;  4BDO A;  2GHA A;  2CEX A;  1TT1 A;  4O3A A;  2F78 A;  1US5 A;  1DOT A;  2UYE A;  1NKX A;  4HTG A;  2X7P A;  4I62 A;  5AA3 A;  2WBB A;  1UTB A;  3MVW A;  4FOR A;  2Q88 A;  3ROJ A;  3PUX E;  5DTB A;  1Y3Q A;  3SDF A;  2HCA A;  2Z8D A;  4NE4 A;  1B9J A;  1B3G A;  2GQ1 A;  2WKY A;  2DWI A;  1EYI A;  4LZ5 A;  3ISP A;  1O64 A;  5CC2 A;  2WYP A;  1FQF A;  3OXN A;  3MYU A;  1Q35 A;  1FQA A;  1M5D A;  4RXL A;  3PMV A;  5AA2 B;  4BDN A;  3K6V A;  2DWJ A;  4DLD A;  2IA4 A;  1XVY A;  1SW5 A;  1UTB B;  3E4R A;  2PVU A;  3B6Q A;  4FEB A;  4OAN A;  1SW1 A;  2F35 A;  2XXP A;  4LP2 B;  3MP1 A;  3DP8 A;  4NF5 B;  3RQT A;  3UOR A;  4U23 A;  1NV7 A;  3MUQ A;  4IY5 A;  1TFA A;  3S9L C;  5FHN A;  1JVX A;  3U8Q A;  3DM0 A;  2GRV A;  2I6E A;  2Z23 A;  1NV4 A;  3VVE A;  3MZB A;  4DXB A;  4N8G A;  4PCD A;  4GWZ A;  4ONY A;  1POT A;  3V8X B;  5TU0 A;  3TTK A;  1L5T A;  2I3V A;  5I3S A;  1SDX A;  2QL3 A;  2Q2C A;  4Q8R A;  3UA8 A;  3W9W A;  2H5Y A;  5CMM A;  4ELP A;  2RC8 A;  1D9Y A;  2KLF A;  4H6D A;  2DS9 A;  4OEU A;  3CIJ A;  2R71 A;  4LUB A;  4ZDM A;  2ZYM A;  4GL0 A;  3ILU B;  1RDZ A;  2OLB A;  4KHZ E;  4R6H A;  5M2V A;  1B7Z A;  2V93 A;  4G8M A;  1TXF A;  2QJE A;  2PYY A;  1EYJ A;  3IFC A;  4JSO A;  1CNQ A;  4AS5 A;  1B3L A;  3SES A;  2E0S A;  5ET5 A;  4OFL A;  1R6Z A;  2Z22 A;  1MQJ A;  4ZEI A;  1B0L A;  3H7M A;  3U92 A;  3LUY A;  3MPK A;  5JTY B;  3H06 B;  2QPQ A;  5EYF A;  2NWJ A;  3IJX B;  5K2Y A;  3FVG A;  1KZ8 A;  4OYV A;  2OWT A;  2Y7P A;  3KN8 A;  4H1X A;  3KFM A;  1FBH A;  1YXI A;  4MNI A;  4XIG Q;  1LBZ A;  3MC2 A; 
#chains in the Genus database with same CATH homology
 5H8Q A;  5HBC A;  4ZZA A;  3L6H A;  1CB6 A;  1TWY A;  1FCK A;  2M8C A;  1XVX A;  2REG A;  1MS7 A;  2PT1 A;  3FXQ A;  4OEV A;  1NFT A;  3KJT A;  3Q29 A;  2ONK E;  3TQW A;  4FAJ A;  2O51 A;  3JZJ A;  2FA7 A;  5ICT A;  2HQ0 A;  2IEE A;  3A09 A;  4X48 A;  3SER A;  2YPN A;  3DP6 A;  2H99 A;  1SYI A;  4KCD A;  4XTC Q;  1B46 A;  3TZA A;  1WVJ A;  2QMW A;  3KGC A;  2UVI A;  2Z8F A;  1NNK A;  3VXB A;  4H5F A;  4R6K A;  3HPI A;  4QFP A;  3H6V A;  4NF8 A;  2OBG A;  3EF7 A;  3CI8 A;  2XHD A;  2THI A;  3MVY A;  4MFI A;  3TMG A;  4RPO A;  5L9M A;  1VFD A;  1Y9U A;  2CMO A;  4QSE A;  4OET A;  4ZEF A;  2ALU A;  1B7U A;  1DPE A;  3KOS A;  3D4G A;  2B65 A;  3PU5 A;  3G3G A;  4N07 A;  2AL5 A;  4KPT A;  4U1O A;  3C33 A;  4EF2 A;  5B70 A;  5KZT A;  2OZZ A;  4X9T A;  1BP5 A;  1OVB A;  2H4I A;  4JBZ A;  4F1U A;  1QUL A;  2PX1 A;  1LAF E;  3OO6 A;  5H8F B;  4AB6 A;  2I4B A;  5TP9 A;  2CZL A;  2B3F A;  1UTH B;  4ELO A;  5I56 B;  4NF4 B;  4GXS B;  3F11 A;  1QUJ A;  4F22 A;  4YB6 A;  4LQ2 A;  3C9H A;  4KYS A;  4H65 A;  3M3K A;  4KYE A;  1Y20 A;  1A55 A;  3QUF A;  3W9V A;  3FJG A;  1P1O A;  3BFU A;  3GZG A;  3FJ7 A;  4OMB A;  3RT8 A;  1NH7 A;  3JV9 A;  2AIX A;  4YU0 A;  3QXM A;  1IXC A;  1A8E A;  1URD A;  4BDR A;  2HZK A;  4C1U A;  4YKJ A;  1MQG A;  3PPO A;  3GXA A;  1QUI A;  1VR5 A;  3VV5 A;  4DIG A;  5I84 A;  4GIZ A;  3HHF A;  3PD8 A;  4IB2 A;  1QVS A;  4QF9 A;  1PC3 A;  3RY3 A;  5BWJ A;  1B6H A;  1MY1 A;  1MXX A;  1B58 A;  4R9F A;  4NMY A;  4EQ9 A;  1O63 A;  3RPW A;  3RGY A;  4DCX A;  3BFT A;  4F39 A;  1FQB A;  2G93 A;  1JW5 A;  2OJT A;  3KJ7 A;  4X1B A;  5ICQ A;  2F5X A;  4FED A;  4NF6 B;  2F36 A;  4NTL A;  2FYI A;  2XXH A;  4G68 C;  1WOD A;  5ITO A;  5KDT B;  4LAT A;  2I0C A;  2GH9 A;  4NED A;  3T9V A;  5CMC A;  2OK2 A;  3G7W A;  2RCA A;  2DQV A;  3VVF A;  5L8D A;  1A99 A;  2RKM A;  3FVO A;  2XD3 A;  3O97 A;  1OMP A;  1ZIU A;  3HCQ A;  1N3W A;  2ANJ A;  2DE3 A;  3FD3 A;  4PET A;  3OSQ A;  5I56 A;  1FTO A;  2UXA A;  4F3P A;  4MH5 A;  1Y4T A;  5TPA A;  1II5 A;  5ISU A;  4F29 A;  5J1D A;  1J1N A;  1VFE A;  4YB5 A;  2O84 X;  2NVU B;  3UP9 A;  2XX7 A;  2XXU A;  3I3V A;  2H9B A;  2V84 A;  1DMB A;  1MH4 A;  1Y4C A;  3IJO B;  2RF1 A;  4L17 A;  4OFJ A;  1USY E;  4QSD A;  4X1D A;  4EQ7 A;  3O28 A;  3S9M C;  1PB9 A;  4G8H A;  2I48 A;  1EZP A;  1IXI A;  1N3X A;  3TYH A;  4DCY A;  3QIM A;  1I6A A;  1DSN A;  2ZMB A;  3GBB A;  1LLS A;  1I6Q A;  3HHG A;  2GHB A;  1GV8 A;  2VGQ A;  1HSL A;  2I0B A;  3H6T A;  3K6X A;  1ANF A;  1LCF A;  1ZLQ A;  3KSX A;  2DOJ A;  4GXA A;  3DP4 A;  5H8N A;  4GF8 A;  1D3K A;  4DDD A;  3PPP A;  3HN0 A;  1Z7N E;  1ZKB A;  3K01 A;  5HPQ A;  4JWX A;  4WED A;  1GTK A;  1PB7 A;  4F3G A;  1H45 A;  3VDF A;  3LC8 A;  3PUZ E;  2ZYN A;  3OO7 A;  1ATG A;  4U22 A;  5FHM A;  3WAF A;  1Z7M E;  1AOV A;  1LAH E;  4YB7 A;  2I4C A;  1A7L A;  3FGS A;  2RCB A;  3H3G A;  1T0K A;  4IGT A;  3IK6 B;  3TCH A;  3VVD A;  1F9B A;  2QRY A;  2VP1 A;  3E9X A;  4G68 B;  4MBP A;  4F1V A;  1XT8 A;  3H03 A;  3OEN A;  4PE5 B;  1PBP A;  4OES A;  2BJJ X;  3OEK A;  1SVX B;  4YKK A;  3K4U A;  1UTH A;  4QHQ A;  1MQI A;  4QSC A;  3VLW A;  1XC1 A;  1H76 A;  4TOZ A;  1LAX A;  1N84 A;  4QFO A;  5CI5 A;  4ZEK A;  2YJP A;  4DXU A;  4R74 A;  2HXW A;  3LSW A;  1Q1K A;  1SD3 A;  1D4N A;  3GBA A;  3U93 A;  2W7Y A;  4XKP A;  2RC9 A;  3PPQ A;  5DEX A;  5AA4 B;  3FXR A;  3PMW A;  3KZG A;  3CFX A;  5DYH A;  2V3U A;  3SEW A;  3UIF A;  5KDT A;  4KYD A;  3O66 A;  4GL8 A;  4POW A;  3FVK A;  5CBS A;  1DTZ A;  3OOA A;  5L9O A;  2Q89 A;  3SEX A;  5JK4 A;  1YPN A;  1OLC A;  3H4Z A;  3FZV A;  1MXW A;  3N5L A;  3IOW A;  1B52 A;  2OCU A;  4G77 A;  1YAE A;  3TTN A;  3CVG A;  3EQ1 A;  5AA2 D;  3CFZ A;  3G3I A;  1A54 A;  4WKM A;  1MPD A;  4BDM A;  5IKB A;  5I2N A;  2F97 A;  5AA4 A;  1US4 A;  3KN3 A;  3N94 A;  4YAH X;  5CM6 A;  3C31 A;  1BLF A;  2XXQ A;  3HST A;  3QK6 A;  5A5X B;  3A3U A;  5DT6 A;  1JEU A;  3BKI B;  3IB2 A;  1B40 A;  4JB7 A;  4XKQ A;  4JSD A;  1OQH A;  1SW4 A;  3MBP A;  4XKN A;  4Q0C A;  2O7I A;  3O9P A;  3T9H B;  5KCJ B;  2F7A A;  3Q25 A;  4IO6 A;  1MPB A;  1SBP A;  1N0T A;  3PUV E;  3K02 A;  5L9S A;  3SET A;  1FQD A;  3K1M A;  3MP8 A;  3IX1 A;  1URG A;  3TCF A;  4AB5 A;  2REJ A;  1IUD A;  3G3J A;  4Q5T A;  3B7D A;  1I6B A;  3OO9 A;  4GRK A;  4F2Q A;  1OQG A;  2A5T A;  1AMF A;  1SYH A;  4KFQ A;  2GFE A;  3TAJ A;  5DVI A;  3AXF A;  4LQ5 A;  3PV0 E;  1IIW A;  3IL1 B;  3MVX A;  1R9Q A;  1PEB A;  5I57 B;  4LZ7 A;  3O6I A;  4LON B;  4NF4 A;  1JW1 A;  3D4C A;  2H25 A;  2UYF A;  4ND9 A;  4QFL A;  1IXG A;  5H8F A;  4RPN A;  3KG2 A;  1MY4 A;  4R6Y A;  3H6W A;  4EXL A;  3R6U A;  2RC7 A;  5CMB A;  2I3W A;  4KI0 E;  5KCJ A;  1GR2 A;  1MDQ A;  1PDA A;  2Q2A A;  1Y1M A;  3OSR A;  3V83 A;  1P1N A;  3TTL A;  4ESX A;  2FNC A;  3IOR A;  2QS2 A;  3MZ1 A;  2UVJ A;  3Q27 A;  4U4S A;  1S50 A;  2ZNS A;  4YKI A;  3QYT A;  3KEI A;  3ECR A;  4HS7 A;  4PFW A;  1I69 A;  5EHS A;  3U72 A;  4C1T A;  1B3H A;  4KQP A;  1N7X A;  2QS1 A;  2D5W A;  4IO5 A;  5BUU A;  1RYO A;  5CMK A;  3QAX A;  1MXZ A;  1EZ9 A;  4ELQ A;  3WAE A;  2OWS A;  1UIU A;  5I2K A;  2O6A A;  5EHM A;  1BKA A;  1P1W A;  3UGW A;  4JXI A;  2HZL A;  1M5B A;  1IZ1 A;  1M5F A;  1TFD A;  1XOC A;  2X7Q A;  3M8U A;  2UVG A;  3MP6 A;  1H43 A;  1URS A;  4IY6 A;  4MF3 A;  3V89 B;  2VD3 A;  4ECF A;  3ZS6 A;  1SI1 A;  4IGR A;  4MLV A;  1B3E A;  2YLN A;  4OER A;  4G68 A;  4RYA A;  2XXX A;  3CR9 A;  4GQO A;  1QKA A;  4NF5 A;  4RJZ A;  2AYS A;  3K00 A;  3MWB A;  1B2H A;  3ONM A;  1AH5 A;  2Y7K A;  2ZNU A;  3N26 A;  4TQU Q;  3S9N C;  5H8H B;  1LGB C;  5DVJ A;  3Q26 A;  3QSL A;  1O7T A;  1POY 1;  4IO7 A;  4G4P A;  4KCC A;  4PQJ A;  4RK9 A;  1GGG A;  2HEU A;  1LAG E;  3G3H A;  5HM4 B;  3G3F A;  3TCG A;  4YKP A;  1IQ7 A;  3T9U A;  3FIR A;  4ELR A;  1FQC A;  1LBB A;  2E1S A;  1R1N A;  3OEM A;  1AL3 A;  4HCW A;  1PBQ A;  1B1X A;  3DLN A;  3V5A A;  5IAI A;  1JEV A;  2ABH A;  1LST A;  4OZ9 A;  1B5J A;  4OTE A;  2F8D A;  5CRY A;  4GWO A;  3UN6 A;  3MJN A;  1B51 A;  4IO3 A;  3FV2 A;  3TTM A;  3TPA A;  3CSB A;  1R9L A;  4DZ1 A;  1MDP 1;  2DYX A;  4R73 A;  4KD5 A;  1LB9 A;  1HSE A;  1QW0 A;  1SI0 A;  4AQ4 A;  4ZS9 A;  3K6W A;  3C32 A;  4I8C A;  3LSL A;  1YCJ A;  2V3Q A;  4F1Y A;  4YZZ A;  5LOM A;  3KBR A;  2XD2 A;  2Y7I A;  3TKD A;  4EUO A;  3TFL A;  2DWH A;  3O29 A;  5DVF A;  3K0V A;  4YIC A;  3PGF A;  5FTI A;  4THI A;  4Z7E A;  5I57 A;  3S2V A;  2XXV A;  1S9T A;  3VLU A;  3VXC A;  1LFH A;  2F7C A;  3G3K A;  1RKM A;  1B4Z A;  4LVQ A;  1MH3 A;  4FE8 A;  2A5T B;  3H6U A;  1OVT A;  4RA1 A;  2PT2 A;  3ZKL A;  1BIY A;  2QMX A;  3MZ9 A;  4GOT A;  4TLM B;  1NL5 A;  1IEJ A;  3LR1 A;  3M3L A;  3JYR A;  2R6G E;  1NH8 A;  4H0W A;  4YMA A;  1MQD A;  3MW0 A;  2V3T A;  4N13 A;  1IIT A;  3N6U A;  4NWC A;  4I9D A;  1FTL A;  4UAC A;  4UA8 A;  4PFU A;  1QKB A;  1PB8 A;  4OEN A;  4M4G A;  5FHO A;  1XHY A;  2ZXT A;  1NMU A;  3S9E A;  2ZYO A;  3C35 A;  4BDO A;  4OVJ A;  2GHA A;  1VE4 A;  3C34 A;  1A40 A;  1TT1 A;  3TEL A;  4HW8 A;  3RLF E;  4O3A A;  2F78 A;  3RT6 B;  2XXI A;  1US5 A;  1DOT A;  2UYE A;  1FW0 A;  1M5E A;  1NKX A;  2F7B A;  1OLA A;  3IAZ A;  3FAS A;  3O6H A;  4HTG A;  1VSO A;  4U4X A;  1A8F A;  5JTY A;  3MVZ A;  1M5C A;  2D21 A;  3IO4 A;  3CG1 A;  3OEL A;  2X7P A;  3DEL B;  4GD5 A;  4I62 A;  4JWY A;  4PFY A;  5AA3 A;  1UQW A;  4R75 A;  1H44 A;  1RYX A;  2ONS A;  4RNS A;  2QS4 A;  2D3I A;  1B4H A;  1JW4 A;  1UTB A;  1FTK A;  1IXH A;  1B5H A;  1QUK A;  1S7Y A;  1N04 A;  2AL4 A;  3B6W A;  1B3F A;  2O1L A;  2Q88 A;  3LBS A;  4F3S A;  2LAO A;  3I6V A;  3PUX E;  4EXK A;  2I58 A;  3ZSF A;  1P99 A;  5B7D A;  2DWA A;  3FXU A;  5DTB A;  3TEP A;  1Y3Q A;  5FTH A;  2HCA A;  1UIV A;  2HAV A;  4Z0I A;  3SDF A;  1MXU A;  2Z8D A;  4NE4 A;  2F6G A;  1B9J A;  5CBR A;  1N7W A;  4U21 A;  2XXR A;  2DXY A;  2XXY A;  2V25 A;  2G29 A;  4ZEB A;  1B3G A;  3LSX A;  5H8S A;  4XKR A;  3O2A A;  1WDN A;  2WKY A;  1CE2 A;  2DWI A;  5TP9 B;  2XXT A;  4LZ5 A;  4EDP A;  3Q28 A;  3FV1 A;  4ZE9 A;  4EF1 A;  1O64 A;  4HCY A;  1B32 A;  5CC2 A;  1FQF A;  2O69 A;  1MM6 A;  3OXN A;  3PUW E;  1Q35 A;  1B05 A;  1FQA A;  1H3D A;  3EN3 A;  4FIM A;  3VE1 B;  4R2B A;  4F2O A;  2H98 A;  1M5D A;  2DVZ A;  2PMS A;  3N6T A;  3K1N A;  3PMV A;  4RXL A;  5H8Q B;  1HSJ A;  5AA2 B;  3TUS A;  2ONR A;  2XX8 A;  3K1P A;  4GFR A;  4BDN A;  3K6V A;  4NF8 B;  3CSG A;  3KN7 A;  4ZED A;  2DWJ A;  4K3F A;  4DLD A;  2IA4 A;  1XVY A;  3L6G A;  2F6P A;  1SW5 A;  1MY0 A;  1UTB B;  2PVU A;  2X26 A;  3E4R A;  4R2F A;  3U1O A;  3T66 A;  2DP8 A;  3S4U A;  3UK4 A;  2XXW A;  4O3C A;  4XXU A;  3B6Q A;  4FEB A;  2F35 A;  1SW1 A;  1LFI A;  2Q9T A;  2XXP A;  3IB0 A;  4LP2 B;  3MP1 A;  3MPL A;  2Y7R A;  2DE2 A;  3K2D A;  3T9X B;  3LSF B;  3PUY E;  3DP8 A;  1FTJ A;  4NF5 B;  3RQT A;  5TPA B;  2Q8J A;  3CG3 A;  3UOR A;  1SQY A;  4FAT A;  4IO4 A;  1LCT A;  1USY H;  4P0G A;  3E13 X;  2DXR A;  2ZYK A;  4U23 A;  3I5O A;  1Y3N A;  4PFT A;  3MUQ A;  1ZJL A;  4YMB A;  3USD A;  3FUZ A;  1ZBM A;  1TFA A;  1YTV A;  4IY5 A;  3S9L C;  1MXY A;  2VOZ A;  3RUM A;  5FHN A;  3THI A;  5H8N B;  1JVX A;  4F31 B;  3U8Q A;  3ODB A;  4QFN A;  3SKP A;  3DM0 A;  2GRV A;  5K2X A;  1ZU0 A;  2I6E A;  2Z23 A;  1LFG A;  4H67 A;  4P11 A;  2XX9 A;  4GLI A;  3VVE A;  3HO7 A;  4QRZ A;  3MZB A;  1OIB A;  2ESN A;  4DXB A;  4ZEC A;  3E3K A;  1MM7 A;  2DVC A;  3A3C A;  4PP0 A;  2RIN A;  5F7V A;  4ONY A;  1POT A;  2O7U A;  3O6G A;  3V8X B;  5TU0 A;  1B7H A;  1NNP A;  4Q30 B;  1L5T A;  3TTK A;  1ZTY A;  1NNF A;  1BTJ A;  1SW2 A;  2I3V A;  3FAT A;  4TLL B;  1SDX A;  1NNT A;  2QL3 A;  3PPR A;  2B3B A;  3KOT A;  3TOD A;  2Q2C A;  2HAU A;  3K6U A;  3OD7 A;  3IB1 A;  4OFO A;  4Q8R A;  3UA8 A;  3W9W A;  1EZO A;  1LBC A;  2H5Y A;  1MQH A;  2Y84 A;  3BBR A;  1B1H A;  5CMM A;  5AE4 A;  4JDF A;  4ELP A;  4BLA A;  1JQF A;  2RC8 A;  1D9Y A;  3R7X A;  2KLF A;  4GVO A;  4H6D A;  2DS9 A;  4OEU A;  4F19 A;  5ITP A;  1JVY A;  1ZMG A;  3CRB A;  3CIJ A;  1MRP A;  2R71 A;  3EHS A;  4N6P A;  3RN8 A;  3MVW A;  4NWD A;  1Y1Z A;  3IOV A;  3P7I A;  4LUB A;  3SEV A;  3IOU A;  3MQ9 A;  2P2A A;  4R9G A;  2A5S A;  4ZDM A;  5AA2 A;  1MY3 A;  4RY1 A;  2ZYM A;  3TTR A;  4GL0 A;  4BDQ A;  3ILU B;  3SEY A;  2OLB A;  4R6H A;  1P1U A;  1N76 A;  2O68 A;  2R9J A;  1B7Z A;  4KHZ E;  2V93 A;  5M2V A;  3U94 A;  5DEX B;  3R26 A;  2Y7W A;  3GLB A;  4G8M A;  3T22 A;  3VLV A;  4M1V A;  1TXF A;  3HV1 A;  2DE4 A;  5I58 A;  5I2N B;  3B6T A;  4O3B A;  5F1Q A;  2QJE A;  1FTM A;  4DXC A;  3M3F A;  3RNN A;  2PYY A;  4JWO A;  2PBW A;  4H8J A;  4JSO A;  2NXO A;  1B3L A;  4G2Z A;  2I49 A;  3IOT A;  3SES A;  1Y3P A;  2E0S A;  4BDL A;  3IO6 A;  3C4M A;  3ILT B;  3T93 B;  4P0I A;  4ZE8 A;  4FJP A;  4MLQ A;  3EPE A;  4OWD A;  5AA1 A;  2QS3 A;  4OFL A;  1EU8 A;  4OXV A;  3RTW B;  1R6Z A;  4C0R A;  4DE8 A;  4E0X A;  3KSJ A;  3TDJ A;  1FQE A;  2VHA A;  1MQJ A;  2Z22 A;  4H5G A;  1B0H A;  4ZEI A;  1B0L A;  5I58 B;  5A5X A;  3C36 A;  1JNF A;  4OHN A;  4F18 A;  3H7M A;  1D9V A;  4ZZE A;  3U92 A;  3LUY A;  3PMX A;  5I59 A;  3MPK A;  2VD2 A;  4POX A;  3H06 B;  3IR1 A;  5JTY B;  3TQL A;  4I1D A;  1KWH A;  1MG1 A;  2QPQ A;  3OO8 A;  5EYF A;  2P1S A;  3QUJ A;  2UVH A;  4RK2 A;  1GVC A;  2NWJ A;  3W15 C;  2O1M A;  4H8I A;  2Z8E A;  3IJX B;  4U2R A;  1DPP A;  3MAM A;  1MPC A;  5K2Y A;  3PPN A;  3FVN A;  1B5I A;  2NOO A;  3FJM A;  3ZKK A;  2P0S A;  5I59 B;  1ELJ A;  2QSX A;  3CFL A;  3EHT A;  3FVG A;  4QFK A;  4LA9 A;  5ELV A;  1P1Q A;  4OYV A;  2OWT A;  4NF6 A;  4WXJ A;  2HFB A;  1QJM A;  4FOR A;  4OQO A;  3PD9 A;  1DTG A;  3RTF B;  2F34 A;  1XS5 A;  3T96 B;  2Y7P A;  3KN8 A;  4H1X A;  5JEI A;  4LZ8 A;  4F3B A;  4G8N A;  3EHU A;  3KFM A;  1EH3 A;  4ISU A;  4R72 A;  4U1Z A;  4IO2 A;  4WEP A;  4E0W A;  1AIV A;  3SEU A;  4ESW A;  1MY2 A;  2DSF A;  3OMB A;  1MXV A;  1JET A;  2NUV A;  4KR5 A;  3VFJ A;  4FEC A;  5H8H A;  5I2K B;  4XIG Q;  2ZNT A;  4EQB A;  3MC2 A;  1LB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...