1S50A

X-ray structure of the glur6 ligand binding core (s1s2a) in complex with glutamate at 1.65 a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
SNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate Receptor 6
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: Molecular mechanisms underlying kainate receptor selectivity
pubmed doi rcsb
source organism Rattus norvegicus
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2004-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s50A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s50A02
3QAXA 3E4RA 4OZ9A 2RF1A 4DCYA 3A09A 3ZS6A 1FTKA 2XHDA 3S2VA 1USYH 4NF4B 1TFDA 1JVYA 2ONSA 5I84A 4M4GA 1B9JA 4ND9A 4F2QA 3CFLA 2O51A 2Z8DA 3GZGA 4P0IA 3CSBA 4K3FA 2DWIA 4FEDA 1NNPA 2AL4A 3WAEA 2XXUA 1WDNA 1QKBA 5FHOA 2CMOA 3UN6A 4F31B 4OFJA 2O1MA 3U94A 1LAGE 5DVIA 3EPEA 3C4MA 3RTFB 4RA1A 5I2KA 3KN8A 1FQBA 3JV9A 3BFUA 2V3TA 3TTRA 1I6QA 3QSLA 3TELA 3MWBA 1VR5A 4KYDA 4GFRA 4KYSA 2Q89A 4GWOA 1SYIA 1S7YA 3G3JA 4RK9A 4Q8RA 3PPQA 1GV8A 1B1HA 1FTMA 4OETA 4ECFA 1QUIA 2O68A 2OJTA 1A8FA 2ANJA 1NL5A 2H4IA 1ZMGA 4G8NA 4KHZE 1SI1A 2Q8JA 1NMUA 3K6XA 5I57A 1EZOA 3K6VA 1MPBA 1FQFA 1MXXA 4JBZA 3TTNA 3JZJA 1H76A 1DOTA 3LBSA 2F5XA 2HZKA 3K00A 2XXHA 5DVFA 3V89B 5DTBA 4GXSB 4YMAA 1MQJA 2XXYA 1N3XA 1B3HA 1TWYA 1DPEA 3R7XA 1PB9A 3MP1A 4F3SA 3UA8A 1OLAA 2VD3A 1N0TA 4JSDA 3S9LC 4KR5A 4IGRA 3CG1A 3KSJA 3IOWA 1XHYA 4HCWA 2QSXA 3MVYA 1IXCA 3V5AA 5H8QA 3Q25A 5BWJA 2V25A 4JWOA 1JNFA 2FYIA 4LP2B 1AMFA 4RK2A 3K02A 2NXOA 4BDRA 2Y7PA 1IIWA 4NF4A 3H4ZA 3AXFA 1DTGA 3TTKA 3LUYA 3C9HA 4YKPA 3MAMA 5I56B 1FW0A 1BIYA 1LBCA 4X48A 1MQHA 3SEXA 2QS3A 4E0WA 1OMPA 3RQTA 1LFIA 3KEIA 3EHUA 3DP8A 1Y3NA 2UVHA 2XD3A 4H8IA 4U2RA 4OVJA 4U1OA 4POXA 4YB7A 3S9NC 3O29A 4PETA 3RTWB 3B6TA 4FORA 2V3QA 4H6DA 4YAHX 2ALUA 3O6IA 5F1QA 1B3FA 4YB5A 4KPTA 4U4XA 1R1NA 3GBAA 2GHAA 1MDQA 1Y20A 2ZYKA 5I59A 4R6HA 3LC8A 2V3UA 1LAHE 2WKYA 3TPAA 3MBPA 4F29A 1D4NA 4R6KA 2RCBA 3TODA 4FE8A 4EF1A 4RY1A 2OZZA 4OEVA 3CG3A 1N84A 2YJPA 3M3FA 2QRYA 1B1XA 3MW0A 2I4BA 1QJMA 3U92A 3PPOA 3VLVA 5AA2B 3TMGA 2XXRA 5I2NA 5DVJA 3IB2A 2GFEA 4Z0IA 1J1NA 1QW0A 4R9FA 3Q29A 1RYXA 5CC2A 2R71A 3H6TA 1A40A 4QFPA 3MVWA 1VE4A 4ZEBA 1FTJA 2DS9A 2PBWA 1URSA 5FTIA 3OMBA 4YKJA 1H44A 2DE4A 4GF8A 3RT8A 1MQDA 4WEPA 2D5WA 3H03A 4YU0A 4X1DA 1UTHA 5L8DA 1PB8A 2P1SA 2GH9A 4LQ2A 2ONKE 3CI8A 2DSFA 2G93A 1N76A 5L9OA 3FXRA 5LOMA 1JW1A 1ZLQA 4PFTA 1MXUA 3OSQA 3MZ1A 1A99A 2Q2CA 3CSGA 3T93B 5I56A 3UIFA 4M1VA 2XXPA 5K2XA 3H6WA 4KCDA 3FATA 2NUVA 2VOZA 2DWAA 3VFJA 5KCJA 1NNFA 3C36A 1MY0A 4N13A 2XD2A 3SEWA 4U21A 3FV1A 2UVGA 5HM4B 1MH4A 1B5HA 3M3LA 3DM0A 4P11A 1PC3A 5EHMA 4LVQA 4IO5A 3QUJA 2B3BA 1PBPA 1PDAA 3S9EA 4PFYA 5DEXB 1MPDA 2Q88A 4IO3A 1R9QA 3KJ7A 3PMVA 1A54A 2R9JA 2F35A 1N04A 4O3CA 3HSTA 2E1SA 1B7HA 5JTYB 3KGCA 3M8UA 4U23A 4ZDMA 1JEVA 4U1ZA 3R6UA 5CRYA 4Q30B 4F19A 4JWYA 2PVUA 3FIRA 1OQHA 4IO6A 1T0KA 1M5EA 1B3LA 4QF9A 2B65A 5AA2A 4EDPA 1WVJA 3RY3A 1MDP1 3RGYA 5HPQA 1O63A 1B5JA 3TDJA 1B2HA 4YKIA 2I49A 2I58A 2OCUA 2QS4A 2O6AA 1A8EA 2XXIA 2B3FA 3B7DA 4GXAA 1LAFE 3MP6A 3FVGA 1LGBC 3FV2A 1SI0A 3FXUA 2F7CA 2REJA 3H7MA 5H8HA 1SDXA 3IO4A 1QULA 3RT6B 2XX8A 2O7IA 3PUWE 2THIA 3DELB 4IY5A 1MM6A 2QPQA 1YCJA 5HBCA 4G68B 2QS2A 3SETA 1F9BA 5H8NA 1H3DA 4XXUA 2KLFA 3IOUA 1SBPA 5ELVA 3L6GA 4TOZA 3K1NA 2FA7A 1PB7A 3QIMA 1Y1MA 2H25A 4IO7A 1O7TA 4BDNA 4MF3A 2XX7A 4KFQA 3PV0E 3MVZA 1BP5A 1UTBB 4YB6A 5H8FB 1OIBA 5TP9A 4HCYA 4R75A 4FIMA 4QFOA 5CMMA 1EU8A 2I48A 5AA4B 5BUUA 2I3VA 1B46A 1ANFA 1SW1A 2F6GA 1B7UA 1DMBA 3KOSA 4XKPA 1Y3QA 3KFMA 4FECA 3LSFB 2VD2A 3EN3A 3ILTB 1M5DA 3VLUA 3N6UA 3O97A 4C1TA 2DOJA 1LLSA 3T9VA 4FEBA 1TFAA 3S4UA 4NF8B 4TLLB 1LCTA 5DT6A 4KQPA 1EZ9A 2DXRA 3VVFA 1II5A 3QUFA 4C1UA 2X26A 1XVYA 3G3GA 3N94A 1MY2A 3VVDA 2VP1A 4ZEIA 3VVEA 1D9VA 4UA8A 3PMXA 4NF6B 4KYEA 5TPAA 4THIA 1NH8A 3A3UA 4H8JA 3KOTA 3T9UA 1UIUA 2M8CA 3K6UA 4N6PA 2PYYA 1Y3PA 4ESXA 1S9TA 2XXWA 1IXIA 1QUKA 2ESNA 3T9XB 2F34A 5A5XB 3K0VA 3TEPA 1JVXA 1RYOA 4XKRA 3FJMA 3FVOA 5ICQA 2RKMA 2X7PA 1IXHA 2VGQA 5AA3A 4KI0E 2O1LA 4OXVA 3K1MA 3TYHA 1MQIA 1A7LA 3C31A 1IITA 3TCGA 2Y7RA 3EHSA 4WXJA 1M5FA 1M5CA 3H6VA 3O66A 5I58B 1IZ1A 1NNKA 1YPNA 2E0SA 4LZ8A 2QMWA 5DYHA 4AQ4A 1LSTA 3Q26A 2NWJA 1B52A 2ZXTA 4G8MA 1EH3A 3IORA 4OYVA 3VXBA 4GD5A 2RC8A 1B0HA 3OO8A 4DCXA 1B0LA 2DWHA 4JXIA 4ZZAA 3SEVA 1ATGA 1BTJA 1US5A 3PPNA 4YICA 1NKXA 4R2FA 4BLAA 2Z8EA 3PMWA 1UTBA 4F2OA 2RC9A 1JQFA 2XXVA 5ITPA 2ZNUA 3THIA 4POWA 1LCFA 4EXKA 1JW5A 3DP6A 4NF5B 1GR2A 4PFUA 3WAFA 1UQWA 3MJNA 4Q0CA 3HN0A 1B7ZA 4YKKA 2PX1A 2ABHA 4GL0A 3HHGA 1ZBMA 5M2VA 3W15C 2HZLA 2I0CA 1ZJLA 1YAEA 2F7BA 2ZYNA 5AA2D 3USDA 4NF8A 3LSXA 4Q5TA 3HHFA 5J1DA 2HFBA 2UVJA 3G3FA 4TQUQ 1MPCA 1VFEA 3TAJA 1MS7A 3GXAA 5H8SA 3RUMA 3S9MC 4I62A 1IXGA 2Y7WA 4H0WA 3IL1B 4HS7A 1SYHA 2Y7KA 1HSEA 2P0SA 3MP8A 5IKBA 4OENA 4R9GA 2FNCA 2HCAA 4DXBA 4P0GA 2UYEA 3SEYA 1MY4A 5CBSA 4KD5A 4ELPA 2A5SA 1B4HA 4FJPA 3C34A 4QRZA 3ZKKA 1Y9UA 3KBRA 3SDFA 3HO7A 1FTOA 3H06B 4I1DA 3IB0A 2Z23A 1MXZA 3OO7A 5AE4A 3IR1A 5FHNA 2F78A 3W9WA 4H65A 3FGSA 4QFKA 2DQVA 1AIVA 2I3WA 2F7AA 2ZYMA 1MG1A 2W7YA 5B70A 1SQYA 4RJZA 3VE1B 1RKMA 1B5IA 2H98A 4X9TA 2BJJX 3TKDA 1PBQA 3U93A 1LFGA 4IO2A 2AIXA 1YTVA 2NVUB 3K2DA 4PQJA 3MZ9A 4F3BA 4RPOA 3TUSA 5B7DA 3PUXE 2HQ0A 3MUQA 3PU5A 3O6HA 1NFTA 4Z7EA 1Y1ZA 2Z22A 1IUDA 3HV1A 4EF2A 1XC1A 1ZU0A 3IK6B 2OWSA 3G3KA 2NOOA 1FQAA 4ONYA 4MH5A 4PE5B 2YLNA 4JWXA 2HAUA 4NF5A 4ELQA 5KZTA 1JEUA 3ZKLA 3O9PA 3OXNA 4MBPA 4F1VA 1SW2A 3FUZA 1HSJA 4WEDA 1OQGA 3PUVE 5EHSA 4LZ5A 4ZEKA 4OEUA 2REGA 4QSCA 3TZAA 3HPIA 4BDMA 2ONRA 4R74A 4F22A 1GGGA 3UK4A 4PFWA 4ESWA 2XXQA 2Y7IA 1QVSA 5TU0A 4L17A 2ZYOA 3KG2A 4TLMB 2VHAA 3I6VA 3QXMA 4HW8A 4FAJA 4IY6A 3K01A 3CR9A 3MVXA 2F97A 5H8QB 4F3PA 1SW4A 3U1OA 2A5TB 3FASA 4GOTA 3ONMA 3IOTA 4LA9A 4XTCQ 3FJ7A 2RCAA 4ZEDA 4G77A 1EZPA 2OLBA 4DDDA 1MH3A 5L9MA 4G2ZA 3PUZE 4DE8A 1Q1KA 2QJEA 1B05A 3PPRA 4IO4A 4F39A 2ZNSA 3IX1A 3F11A 4YMBA 3D4CA 3JYRA 1JETA 5AA1A 3G7WA 1H43A 2IA4A 3C35A 2OWTA 1URDA 4OMBA 3G3HA 2G29A 5CMBA 2LAOA 4DXCA 1CB6A 2XXTA 3L6HA 5KDTB 1DPPA 4F18A 2YPNA 1MM7A 4JB7A 4ZEFA 4NWCA 2RC7A 2O7UA 1D9YA 3SERA 2F36A 2HAVA 4GQOA 1M5BA 1TXFA 2PMSA 3U72A 1L5TA 5I59B 1B51A 3H3GA 4RYAA 1WODA 2P2AA 4R2BA 4ZS9A 3OOAA 1R6ZA 4EXLA 3P7IA 1MY3A 1QUJA 1AH5A 4F3GA 5DEXA 4ZECA 3CVGA 3LR1A 5CM6A 4E0XA 4QHQA 4R72A 3V8XB 1FQEA 3BFTA 2UVIA 1O64A 3MPLA 3SKPA 3PPPA 1OVTA 1B4ZA 1LAXA 3N6TA 2ZNTA 5I2NB 5ISUA 2I6EA 3OSRA 4OFLA 5JTYA 3OELA 3UP9A 2QS1A 1HSLA 4YZZA 4GLIA 4OHNA 4F1YA 4ZE8A 1Z7ME 4C0RA 1P1OA 3OEKA 4BDOA 5JEIA 1OVBA 3O28A 3G3IA 4XKNA 1MY1A 1MXYA 1PEBA 1VSOA 3T66A 5ITOA 3EHTA 4LUBA 1P1QA 3PD8A 4QSEA 3Q28A 2I4CA 2PT2A 3VDFA 3E9XA 3PUYE 3FXQA 3V83A 2DVZA 4G8HA 4EQ7A 5EYFA 1UTHB 1N7WA 3CIJA 3IJOB 3GLBA 4QSDA 1I69A 2DE2A 2UXAA 2Z8FA 3CFXA 3IB1A 2A5TA 4QFNA 3SEUA 1LBBA 4MFIA 1P1NA 2IEEA 3GBBA 1B32A 3FZVA 4G68A 4H5GA 4OTEA 1UIVA 4ELRA 3OEMA 1SW5A 2Q9TA 3KN3A 1B40A 3OO6A 4R73A 1DTZA 1IQ7A 3C32A 1OLCA 2GRVA 4R6YA 4OWDA 2DXYA 1TT1A 3ILUB 2UYFA 3W9VA 1B3EA 2D3IA 4PP0A 2ZMBA 5KCJB 1P99A 3C33A 1KWHA 4UACA 2GHBA 4OFOA 1US4A 3EF7A 2D21A 4IB2A 3PGFA 1S50A 5H8FA 1CE2A 5KDTA 3LSLA 4G4PA 5F7VA 3DLNA 1ZKBA 1B3GA 1I6AA 3MQ9A 5AA4A 3MC2A 3I5OA 3MPKA 2V93A 1LFHA 4U4SA 4KCCA 4FATA 1POTA 4XKQA 3OO9A 2Y84A 4ZZEA 3KZGA 3OENA 2DP8A 3FD3A 3RPWA 3UGWA 1N3WA 2F6PA 3LSWA 1MQGA 1LB8A 3CRBA 4NWDA 4O3BA 2XX9A 2OK2A 1NNTA 1P1WA 1MXVA 2AYSA 2QMXA 1DSNA 4QFLA 3T96B 2H99A 4DLDA 1LB9A 1H45A 1D3KA 3ZSFA 1ZTYA 1QKAA 1SD3A 3N5LA 5CBRA 1MXWA 2Q2AA 3Q27A 1NH7A 4IGTA 3RLFE 1Q35A 4DXUA 2V84A 2PT1A 4G68C 1FCKA 4NF6A 3E3KA 4F1UA 1USYE 4GRKA 3TCFA 1URGA 3R26A 4EQBA 2DVCA 1Y4TA 4RXLA 4RPNA 3FVKA 3DP4A 4JDFA 5H8HB 3K6WA 1XVXA 2HEUA 1XOCA 5ICTA 1XT8A 4MLQA 3TQLA 5FHMA 4HTGA 4AB5A 3QK6A 3SESA 5A5XA 3K1PA 1JW4A 2XXXA 3RN8A 1Y4CA 2RINA 3K4UA 3KN7A 3IOVA 4NEDA 2DWJA 2I0BA 3M3KA 3IO6A 4LONB 1N7XA 3UORA 5H8NB 5I58A 1VFDA 3I3VA 4X1BA 4EUOA 3B6WA 1GVCA 1FQDA 4LQ5A 3VV5A 5I2KB 5K2YA 2OBGA 3TTMA 2DYXA 1XS5A 4ISUA 5CMKA 5TP9B 2CZLA 2H9BA 3FJGA 1A55A 1AOVA 4EQ9A 4DIGA 2DE3A 5CI5A 4GIZA 4ELOA 3IAZA 3OD7A 1R9LA 3B6QA 1Z7NE 3E13X 4AB6A 3ODBA 3O6GA 3TQWA 3KSXA 4NE4A 5L9SA 4XIGQ 2AL5A 4BDQA 3T22A 4GL8A 4LATA 2O69A 3TTLA 3CFZA 4N07A 5CMCA 3TFLA 4NMYA 3D4GA 4OESA 3BKIB 4OQOA 1B6HA 3EQ1A 3IJXB 4OERA 4I8CA 4H67A 2O84X 1AL3A 1I6BA 1SVXB 1GTKA 4GVOA 4U22A 3TCHA 2F8DA 3FVNA 1IEJA 1POY1 2H5YA 4I9DA 4LZ7A 3PD9A 3A3CA 5JK4A 5IAIA 5I57B 4JSOA 3T9HB 3U8QA 3MZBA 3RNNA 3VLWA 1FQCA 3N26A 2X7QA 3QYTA 1BLFA 1FTLA 3O2AA 4NTLA 3HCQA 5FTHA 1MRPA 4ZE9A 3VXCA 4O3AA 4MLVA 4WKMA 4RNSA 1BKAA 5TPAB 3ECRA 4H1XA 1P1UA 3H6UA 2QL3A 1B58A 4BDLA 3BBRA 2R6GE 1ELJA 3KJTA 4DZ1A 1ZIUA 4H5FA 2HXWA
chains in the Genus database with same CATH superfamily
3QAXA 3E4RA 4OZ9A 2HPGA 2RF1A 5IZ3B 1NV5A 4DCYA 3A09A 3ZS6A 2WYPA 1FTKA 2XHDA 4NQ8A 3S2VA 1USYH 4NF4B 1TFDA 1JVYA 2ONSA 5I84A 4M4GA 4I3EA 1B9JA 4ND9A 4F2QA 3CFLA 2O51A 1NV6A 2Z8DA 3GZGA 2FHYA 4P0IA 3CSBA 4K3FA 3B50A 2DWIA 4FEDA 1NNPA 5IZ1A 2AL4A 3WAEA 2XXUA 1IMCA 5EQ8A 2FIXA 5T3JA 1WDNA 4PGPA 1QKBA 5FHOA 2CMOA 5FBPA 3UN6A 4F31B 4OFJA 2O1MA 3U94A 1FPDA 1LAGE 5DVIA 3EPEA 3C4MA 1NV3A 3RTFB 2OX3A 4RA1A 5I2KA 3KN8A 2XWKA 1FQBA 3JV9A 3BFUA 2V3TA 3TTRA 1I6QA 1EYJA 3QSLA 3TELA 3MWBA 1VR5A 4KYDA 4PC9A 4GFRA 4KYSA 2Q89A 4GWOA 1FJ6A 1SYIA 1S7YA 3G3JA 4DI4B 4RK9A 4Q8RA 3PPQA 1GV8A 1B1HA 1FTMA 4OETA 4ECFA 1QUIA 2O68A 2OJTA 1A8FA 2ANJA 2R8TA 1NL5A 2H4IA 1ZMGA 4NF0A 4G8NA 4KHZE 1SI1A 2P3NA 2Q8JA 1NUXA 1NMUA 3K6XA 5I57A 1EZOA 3K6VA 1MPBA 1FQFA 2F3BA 1MXXA 4JBZA 3TTNA 3JZJA 1H76A 1K9ZA 1DOTA 3LBSA 2F5XA 2HZKA 3K00A 2XXHA 5DVFA 3V89B 5DTBA 4GXSB 4YMAA 1MQJA 2XXYA 1N3XA 1B3HA 1FPFA 1TWYA 2MKZA 1DPEA 3R7XA 1PB9A 3MP1A 4F3SA 3UA8A 1OLAA 2VD3A 1N0TA 4JSDA 3S9LC 4KR5A 4IGRA 2GQ1A 3CG1A 3KSJA 3IOWA 1XHYA 4HCWA 2QSXA 3MVYA 1IXCA 3V5AA 5H8QA 3Q25A 5BWJA 2KR0A 2V25A 4JWOA 1JNFA 2FYIA 4LP2B 5EQ9A 1AMFA 4RK2A 3E78A 3K02A 2NXOA 4BDRA 2Y7PA 1IIWA 4NF4A 2FBPA 3H4ZA 3AXFA 1DTGA 3TTKA 3LV0A 3LUYA 3C9HA 4YKPA 3MAMA 5I56B 1FW0A 1BIYA 1LBCA 4X48A 1MQHA 3SEXA 1LBYA 2QS3A 4E0WA 1OMPA 3RQTA 1LFIA 3KEIA 3EHUA 3DP8A 1Y3NA 2B4LA 4I40A 4MCOA 2UVHA 2XD3A 4H8IA 4U2RA 4OVJA 4U1OA 4POXA 4YB7A 3S9NC 3O29A 4PETA 3RTWB 3B6TA 4FORA 2V3QA 4H6DA 4YAHX 2ALUA 3O6IA 2XWVA 5F1QA 1B3FA 4YB5A 4KPTA 4U4XA 1R1NA 3GBAA 2GHAA 4PAKA 1MDQA 3RPLB 1Y20A 2ZYKA 5I59A 4R6HA 5F24A 1FBEA 3LC8A 4PE3A 2V3UA 1LAHE 4NAPA 5I3SA 2WKYA 3TPAA 3MBPA 4F29A 2BJIA 1D4NA 4R6KA 2RCBA 3TODA 4FE8A 4EF1A 5A5LA 4RY1A 2B4MA 2OZZA 4OEVA 3CG3A 1N84A 2YJPA 3M3FA 2QRYA 1B1XA 3MW0A 1NUYA 2I4BA 1QJMA 4XFEA 3U92A 2XXKA 3PPOA 3VLVA 5AA2B 3TMGA 2XXRA 5I2NA 4PCDA 5DVJA 3HFUA 3IB2A 2GFEA 2OWZA 4Z0IA 3PTYA 1J1NA 1QW0A 4R9FA 4QBAA 3Q29A 1RYXA 2XWOA 4N17A 5CC2A 2R71A 3H6TA 1A40A 4QFPA 4MIJA 3MVWA 1VE4A 4ZEBA 4JVDA 2QVRA 1FTJA 2DS9A 2PBWA 1URSA 5FTIA 3OMBA 4YKJA 1H44A 2DE4A 4GF8A 3RT8A 1MQDA 4WEPA 2V4CA 2VPNA 2D5WA 3H03A 4YU0A 2ZZXA 4X1DA 1UTHA 5L8DA 1PB8A 2P1SA 2GH9A 4LQ2A 2ONKE 4GX3A 3CI8A 2DSFA 2G93A 1N76A 5L9OA 3FXRA 5LOMA 1JW1A 1ZLQA 4PFTA 1MXUA 2WEFA 3OSQA 1LBXA 4PDDA 4HE2A 5ET6A 3MZ1A 1A99A 2Q2CA 3CSGA 3ISPA 3T93B 5I56A 2P3VA 3UIFA 4M1VA 2XXPA 5K2XA 3H6WA 4KCDA 1NV4A 3FATA 2NUVA 2VOZA 2DWAA 3VFJA 5KCJA 1NNFA 3C36A 1MY0A 4OA4A 4N13A 2XD2A 3SEWA 2Q8MA 3GYYA 4U21A 3FV1A 2UVGA 5HM4B 1MH4A 1B5HA 3M3LA 3DM0A 4P11A 1PC3A 5EHMA 4LVQA 4IO5A 3QUJA 2B3BA 1PBPA 1PDAA 4XF5A 3S9EA 4PFYA 5DEXB 1MPDA 2Q88A 4IO3A 3RPLA 4PFIA 2WBDA 1R9QA 3KJ7A 3PMVA 1A54A 2R9JA 2F35A 1N04A 4O3CA 3HSTA 2E1SA 1B7HA 3D1RA 5JTYB 3KGCA 3M8UA 4U23A 4ZDMA 1JEVA 4U1ZA 3R6UA 4N15A 5CRYA 4Q30B 4F19A 1FBCA 4JWYA 3E79A 2PVUA 3FIRA 1OQHA 4IO6A 3FBPA 1T0KA 1M5EA 1B3LA 4MAGA 4QF9A 2B65A 5AA2A 4O8MA 4EDPA 1WVJA 3RY3A 1MDP1 3RGYA 1RDZA 5HPQA 1O63A 1B5JA 3TDJA 1B2HA 4YKIA 2I49A 2I58A 2OCUA 2QS4A 1FPGA 2O6AA 1A8EA 2XXIA 2B3FA 3B7DA 4GXAA 1LAFE 3MP6A 3FVGA 1LGBC 3FV2A 1SI0A 3FXUA 2F7CA 4NN3A 2REJA 3H7MA 3KC0A 5H8HA 1SDXA 4PBQA 1FPIA 3IO4A 4JVCA 1QULA 3RT6B 2XX8A 2O7IA 3PUWE 1CNQA 2THIA 3DELB 4IY5A 1MM6A 2QPQA 1YCJA 4NG7A 1LBZA 1NUZA 5HBCA 4G68B 4GWZA 1IMEA 2QS2A 3SETA 1F9BA 4XXUA 1H3DA 4OVTA 2KLFA 5H8NA 3IOUA 1SBPA 5ELVA 3L6GA 4TOZA 3K1NA 2FA7A 1VDWA 1PB7A 3QIMA 1Y1MA 2H25A 4IO7A 1BK4A 1O7TA 4BDNA 4MF3A 2XX7A 2QVUA 4GWYA 1LBWA 2XWIA 4KFQA 3PV0E 3MVZA 1BP5A 1EYIA 1UTBB 4P8BA 4YB6A 5H8FB 4PFBA 1OIBA 5TP9A 4HXVA 2WX9A 4MHFA 4HCYA 4N81A 4R75A 4FIMA 4QFOA 5CMMA 5DW8A 1EU8A 2I48A 1NV1A 5AA4B 5BUUA 2I3VA 4MEVA 1B46A 1ANFA 1SW1A 2F6GA 5LDZA 1B7UA 4GWXA 1DMBA 3KOSA 4XKPA 1Y3QA 3KFMA 4FECA 3LSFB 4MNPA 2VD2A 3EN3A 3ILTB 1M5DA 2WYKA 3VLUA 2HHMA 3N6UA 3O97A 4C1TA 2DOJA 1LLSA 3T9VA 4FEBA 1TFAA 3S4UA 4NF8B 4N4UA 4TLLB 1LCTA 1KA1A 5DT6A 4X04A 4KQPA 1EZ9A 2DXRA 3VVFA 1II5A 3QUFA 4C1UA 2X26A 1LBVA 1XVYA 3G3GA 3N94A 1FTAA 4MMPA 1MY2A 3VVDA 2VP1A 4MX6A 4ZEIA 5I5PA 4NX1A 4H45A 2JJKA 3VVEA 1D9VA 1FSAA 4UA8A 3PMXA 4NF6B 4KYEA 5TPAA 4THIA 2QFLA 1NH8A 3A3UA 4H8JA 3KOTA 3T9UA 3U65A 1UIUA 2M8CA 3K6UA 4N6PA 2PYYA 1Y3PA 1IMDA 4ESXA 1S9TA 2XXWA 1IXIA 1QUKA 2ESNA 3T9XB 2F34A 5A5XB 3K0VA 3TEPA 1JVXA 1RYOA 4XKRA 3FJMA 3FVOA 5IZ3A 4PGNA 5ICQA 4OVSA 2F3DA 4GWWA 2RKMA 2X7PA 2ZZVA 1IXHA 2VGQA 5AA3A 4KI0E 4P56A 3LUZA 2O1LA 4OXVA 3K1MA 3TYHA 1MQIA 1A7LA 3C31A 1IITA 3TCGA 4P9KA 2Y7RA 3EHSA 2KQZA 4WXJA 1M5FA 1M5CA 1FPJA 3H6VA 3O66A 5I58B 1IZ1A 4X8RA 1NNKA 1YPNA 2E0SA 5EQ7A 4LZ8A 2QMWA 5DYHA 4AQ4A 1LSTA 3Q26A 2NWJA 1B52A 2ZXTA 4G8MA 1EH3A 3IORA 4OYVA 3VXBA 4GD5A 2RC8A 4MJOA 1B0HA 3OO8A 4OANA 4N8YA 4DCXA 1B0LA 2DWHA 4PTKA 4JXIA 4ZZAA 3SEVA 1ATGA 4OVPA 1IMAA 1BTJA 4PF8A 1US5A 3PPNA 1FJ9A 4YICA 1NKXA 4R2FA 4BLAA 2Z8EA 3PMWA 2PFZA 1UTBA 4F2OA 2RC9A 1JQFA 2XXVA 5ITPA 2ZNUA 3THIA 4POWA 1LCFA 4EXKA 1JW5A 3DP6A 4NF5B 1GR2A 4PFUA 3WAFA 1UQWA 1LEVA 3MJNA 4GX6A 4Q0CA 3HN0A 1B7ZA 4YKKA 2PX1A 2ABHA 4GL0A 1FPKA 3HHGA 1ZBMA 4O7IA 5M2VA 3W15C 4GX4A 2HZLA 2I0CA 1ZJLA 1YAEA 1KZ8A 1SPIA 2F7BA 2ZYNA 5AA2D 3USDA 4NF8A 3LSXA 4Q5TA 3HHFA 5J1DA 2HFBA 2UVJA 3G3FA 4TQUQ 1MPCA 1VFEA 3TAJA 1MS7A 2ZZWA 3GXAA 5H8SA 4HE1A 3RUMA 3S9MC 4I62A 1IXGA 1FBGA 2Y7WA 1D9QA 4H0WA 3IL1B 4HS7A 3EKIA 1SYHA 2Y7KA 1HSEA 2P0SA 3MP8A 4DI3D 5IKBA 4OENA 4R9GA 2FNCA 2HCAA 4DXBA 4P0GA 2UYEA 3SEYA 4AS4A 1MY4A 5CBSA 1FBDA 4KD5A 5J16A 2A5SA 1B4HA 4FJPA 4QRZA 3C34A 3ZKKA 4ELPA 1Y9UA 3KBRA 3SDFA 3HO7A 1FTOA 1YXIA 3H06B 4I1DA 3IB0A 2Z23A 1MXZA 3OO7A 4N6KA 5AE4A 3IR1A 5FHNA 4N8GA 1NI9A 2F78A 3W9WA 4H65A 2Y5KA 2FIEA 1G0IA 3FGSA 4QFKA 2DQVA 1AIVA 2I3WA 2F7AA 2ZYMA 1MG1A 2W7YA 5B70A 4PF6A 1SQYA 1INPA 4RJZA 3VE1B 1RKMA 1B5IA 2H98A 4X9TA 2BJJX 3TKDA 1PBQA 3QMFA 4OVRA 4IR8A 3U93A 1LFGA 4G61A 4IO2A 1NV0A 1FBFA 2AIXA 1YTVA 2NVUB 3K2DA 4PQJA 3MZ9A 4F3BA 4RPOA 3TUSA 5B7DA 3PUXE 1YYZA 2HQ0A 3MUQA 1NV2A 3PU5A 3O6HA 1NFTA 4Z7EA 2CEXA 1Y1ZA 2Z22A 3CHGA 1IUDA 3HV1A 4EF2A 1XC1A 1ZU0A 3IK6B 2OWSA 3G3KA 2NOOA 1FQAA 4ONYA 4MH5A 4PE5B 3KC1A 2YLNA 4JWXA 2HAUA 4NF5A 4ELQA 4O94A 5KZTA 1JEUA 3ZKLA 5IGAA 3O9PA 3OXNA 4MBPA 4F1VA 1SW2A 3FUZA 1HSJA 4WEDA 1OQGA 3PUVE 5EHSA 4LZ5A 4ZEKA 4OEUA 2REGA 4QSCA 3TZAA 3HPIA 4BDMA 2ONRA 4R74A 4F22A 1GGGA 3UK4A 1IMBA 3KBZA 1FBPA 3NOHA 4PFWA 4ESWA 2XXQA 1IMFA 1QVSA 2Y7IA 5TU0A 4L17A 2ZYOA 3KG2A 4TLMB 2VHAA 2VPOA 3I6VA 3QXMA 4HW8A 4FAJA 4IY6A 3K01A 3SZPA 2L5VA 3CR9A 3MVXA 2F97A 5H8QB 4F3PA 1SW4A 4H46A 3U1OA 2A5TB 3FASA 4GOTA 3ONMA 3IOTA 4LA9A 4XTCQ 1DCUA 3FJ7A 2RCAA 4ZEDA 4G77A 1EZPA 2OLBA 4DDDA 4LN5A 1MH3A 5L9MA 4G2ZA 3PUZE 4DE8A 1Q1KA 2QJEA 1B05A 3PPRA 4IO4A 4F39A 2ZNSA 1QGXA 3IX1A 3F11A 4YMBA 3D4CA 4UABA 3JYRA 1JETA 5AA1A 3G7WA 1H43A 2IA4A 3C35A 2OWTA 1URDA 4OMBA 3G3HA 2G29A 5CMBA 1DBZA 4O7MA 2CZIA 2LAOA 4DXCA 2Y5LA 1CB6A 2XXTA 3L6HA 5KDTB 1DPPA 4F18A 2YPNA 1MM7A 4JB7A 4ZEFA 4NWCA 2RC7A 2O7UA 1D9YA 3SERA 2F36A 2HAVA 4GQOA 1M5BA 1TXFA 2PMSA 3U72A 1L5TA 5I59B 1B51A 3H3GA 4RYAA 1WODA 2P2AA 2PCRA 4R2BA 4ZS9A 4I3YA 1AWBA 2CZHA 3OOAA 1R6ZA 4EXLA 2HXRA 3P7IA 1MY3A 1FPEA 1QUJA 1AH5A 4F3GA 5DEXA 4ZECA 3CVGA 3LR1A 5CM6A 4E0XA 4QHQA 4R72A 3V8XB 1FQEA 3BFTA 2UVIA 1O64A 3MPLA 3SKPA 3PPPA 1OVTA 1B4ZA 1LAXA 3N6TA 5I7IA 2ZNTA 5I2NB 5ISUA 2I6EA 3OSRA 4OFLA 5JTYA 3OELA 3UP9A 2QS1A 1HSLA 3IFCA 4YZZA 4GLIA 4OHNA 4MNIA 5LTCA 4F1YA 4ZE8A 1Z7ME 4C0RA 1P1OA 3OEKA 4BDOA 5JEIA 1OVBA 3O28A 4AS5A 3G3IA 3MSTA 4XKNA 1MY1A 1MXYA 1PEBA 1VSOA 3T66A 5ITOA 3EHTA 4LUBA 1KA0A 3B8BA 1P1QA 3PD8A 4QSEA 5EYGA 3Q28A 4JVIA 2I4CA 2PT2A 3VDFA 3E9XA 2FVZA 3PUYE 1XI6A 3FXQA 3V83A 2DVZA 4G8HA 4EQ7A 1FPLA 5EYFA 1UTHB 1N7WA 3CIJA 3IJOB 3GLBA 4OVQA 4QSDA 1I69A 2DE2A 2UXAA 2Z8FA 3CFXA 3IB1A 5ESYA 2A5TA 2PFYA 4QFNA 3SEUA 4GBVA 1LBBA 4MFIA 1P1NA 2IEEA 3GBBA 1B32A 3FZVA 4G68A 4H5GA 4OTEA 1UIVA 1DK4A 4ELRA 3OEMA 1SW5A 1RDXA 2Q9TA 3KN3A 1B40A 3OO6A 4R73A 1DTZA 1IQ7A 3C32A 3ROJA 1OLCA 2GRVA 4HE0A 4R6YA 4OWDA 2DXYA 3IFAA 1TT1A 3ILUB 2UYFA 3W9VA 5ET5A 1B3EA 2DDKA 2D3IA 4PP0A 2ZMBA 5KCJB 5EYHA 4N91A 1P99A 3BIHA 5ET8A 3C33A 1KWHA 4UACA 1YZ0A 2GHBA 4OFOA 1US4A 3EF7A 4FBPA 2D21A 4GWUA 4IB2A 3PGFA 1S50A 3FXBA 4NHBA 5H8FA 1CE2A 5KDTA 3LSLA 4G4PA 5F7VA 3A29A 3DLNA 1ZKBA 1B3GA 1I6AA 2CZKA 3MQ9A 5AA4A 1FPBA 2CEYA 3T0JA 1NUWA 3MC2A 3I5OA 3MPKA 4P1LA 2V93A 1LFHA 4U4SA 4KCCA 3BIGA 4FATA 1POTA 4PAFA 2Q74A 4XKQA 3OO9A 2Y84A 4ZZEA 3KZGA 3OENA 2DP8A 3FD3A 3RPWA 3UGWA 1N3WA 4GBWA 4P3LA 2F6PA 2XA5A 3LSWA 1MQGA 1LB8A 3CRBA 4NWDA 5IZZA 4O3BA 2XX9A 2OK2A 1NNTA 1P1WA 1MXVA 2AYSA 2QMXA 1DSNA 4P47A 4PAIA 4QFLA 3T96B 1K9YA 2H99A 4N6DA 4DLDA 1LB9A 1EYKA 1H45A 1NV7A 1D3KA 3ZSFA 1ZTYA 1QKAA 1SD3A 3N5LA 5CBRA 1MXWA 2Q2AA 3Q27A 1NH7A 4PFRA 4IGTA 3RLFE 1Q35A 4DXUA 2V84A 2PT1A 4G68C 1FCKA 4GWSA 4NF6A 3E3KA 5IM2A 4F1UA 1USYE 4GRKA 3TCFA 1URGA 3R26A 5ET7A 4EQBA 2DVCA 1Y4TA 1G0HA 4RXLA 4RPNA 3FVKA 3DP4A 4JDFA 5H8HB 3K6WA 1XVXA 2HEUA 1XOCA 5ICTA 5EQAA 1XT8A 4MLQA 3TQLA 3MYUA 5FHMA 4HTGA 4AB5A 3QK6A 3SESA 5A5XA 3K1PA 1JW4A 2XXXA 3RN8A 1Y4CA 2RINA 3K4UA 3KN7A 3IOVA 4KXPA 4NEDA 2DWJA 4PDHA 2I0BA 3M3KA 3IO6A 4LONB 1N7XA 3UORA 5H8NB 5I58A 1FBHA 1VFDA 3I3VA 4X1BA 4EUOA 3B6WA 1GVCA 1FQDA 4LQ5A 2QVVA 3VV5A 5I2KB 4QXDA 5K2YA 2OBGA 3TTMA 2DYXA 1XS5A 4ISUA 4P1EA 4MNCA 5TP9B 5CMKA 2CZLA 2H9BA 3FJGA 1A55A 4XEQA 1AOVA 4EQ9A 4DIGA 1FRPA 2DE3A 5CI5A 4GIZA 4ELOA 3IAZA 3OD7A 1R9LA 3B6QA 1Z7NE 3E13X 4AB6A 3ODBA 3O6GA 3TQWA 1JP4A 1RDYA 3KSXA 4NE4A 5L9SA 4XIGQ 4PBHA 2AL5A 4BDQA 4GL8A 4LATA 3T22A 2O69A 3TTLA 3CFZA 4N07A 5CMCA 3TFLA 4NMYA 3D4GA 4OESA 4OQOA 3BKIB 1B6HA 3EQ1A 3IJXB 4OERA 4I8CA 4H67A 2O84X 1AL3A 1I6BA 1SVXB 1GTKA 4GVOA 4U22A 3TCHA 2F8DA 3FVNA 1IEJA 1POY1 2H5YA 3RYDA 4I9DA 4LZ7A 3PD9A 3A3CA 5JK4A 5IAIA 5I57B 4JSOA 3T9HB 1Q9DA 3U8QA 3MZBA 2WBBA 3RNNA 3VLWA 4NGUA 1FQCA 3N26A 2X7QA 3QYTA 1BLFA 1FTLA 3O2AA 4NTLA 3HCQA 5FTHA 1MRPA 4ZE9A 3VXCA 4O3AA 4MLVA 4WKMA 4RNSA 1BKAA 5TPAB 3ECRA 4H1XA 1P1UA 2VT5A 3H6UA 2QL3A 1B58A 3T1BA 4BDLA 3BBRA 2R6GE 1ELJA 3KJTA 4DZ1A 1ZIUA 4H5FA 2HXWA
chains in the Genus database with same CATH topology
3QAXA 3E4RA 4OZ9A 2RF1A 4DCYA 3A09A 3ZS6A 1FTKA 2XHDA 3S2VA 1USYH 4NF4B 1TFDA 1JVYA 2ONSA 5I84A 4M4GA 1B9JA 4ND9A 4F2QA 3CFLA 2O51A 2Z8DA 3GZGA 4P0IA 3CSBA 4K3FA 2DWIA 4FEDA 1NNPA 2AL4A 3WAEA 2XXUA 1WDNA 1QKBA 5FHOA 2CMOA 3UN6A 4F31B 4OFJA 2O1MA 3U94A 1LAGE 5DVIA 3EPEA 3C4MA 3RTFB 4RA1A 5I2KA 3KN8A 1FQBA 3JV9A 3BFUA 2V3TA 3TTRA 1I6QA 3QSLA 3TELA 3MWBA 1VR5A 4KYDA 4GFRA 4KYSA 2Q89A 4GWOA 1SYIA 1S7YA 3G3JA 4RK9A 4Q8RA 3PPQA 1GV8A 1B1HA 1FTMA 4OETA 4ECFA 1QUIA 2O68A 2OJTA 1A8FA 2ANJA 1NL5A 2H4IA 1ZMGA 4G8NA 4KHZE 1SI1A 2Q8JA 1NMUA 3K6XA 5I57A 1EZOA 3K6VA 1MPBA 1FQFA 1MXXA 4JBZA 3TTNA 3JZJA 1H76A 1DOTA 3LBSA 2F5XA 2HZKA 3K00A 2XXHA 5DVFA 3V89B 5DTBA 4GXSB 4YMAA 1MQJA 2XXYA 1N3XA 1B3HA 1TWYA 1DPEA 3R7XA 1PB9A 3MP1A 4F3SA 3UA8A 1OLAA 2VD3A 1N0TA 4JSDA 3S9LC 4KR5A 4IGRA 3CG1A 3KSJA 3IOWA 1XHYA 4HCWA 2QSXA 3MVYA 1IXCA 3V5AA 5H8QA 3Q25A 5BWJA 2V25A 4JWOA 1JNFA 2FYIA 4LP2B 1AMFA 4RK2A 3K02A 2NXOA 4BDRA 2Y7PA 1IIWA 4NF4A 3H4ZA 3AXFA 1DTGA 3TTKA 3LUYA 3C9HA 4YKPA 3MAMA 5I56B 1FW0A 1BIYA 1LBCA 4X48A 1MQHA 3SEXA 2QS3A 4E0WA 1OMPA 3RQTA 1LFIA 3KEIA 3EHUA 3DP8A 1Y3NA 2UVHA 2XD3A 4H8IA 4U2RA 4OVJA 4U1OA 4POXA 4YB7A 3S9NC 3O29A 4PETA 3RTWB 3B6TA 4FORA 2V3QA 4H6DA 4YAHX 2ALUA 3O6IA 5F1QA 1B3FA 4YB5A 4KPTA 4U4XA 1R1NA 3GBAA 2GHAA 1MDQA 1Y20A 2ZYKA 5I59A 4R6HA 3LC8A 2V3UA 1LAHE 2WKYA 3TPAA 3MBPA 4F29A 1D4NA 4R6KA 2RCBA 3TODA 4FE8A 4EF1A 4RY1A 2OZZA 4OEVA 3CG3A 1N84A 2YJPA 3M3FA 2QRYA 1B1XA 3MW0A 2I4BA 1QJMA 3U92A 3PPOA 3VLVA 5AA2B 3TMGA 2XXRA 5I2NA 5DVJA 3IB2A 2GFEA 4Z0IA 1J1NA 1QW0A 4R9FA 3Q29A 1RYXA 5CC2A 2R71A 3H6TA 1A40A 4QFPA 3MVWA 1VE4A 4ZEBA 1FTJA 2DS9A 2PBWA 1URSA 5FTIA 3OMBA 4YKJA 1H44A 2DE4A 4GF8A 3RT8A 1MQDA 4WEPA 2D5WA 3H03A 4YU0A 4X1DA 1UTHA 5L8DA 1PB8A 2P1SA 2GH9A 4LQ2A 2ONKE 3CI8A 2DSFA 2G93A 1N76A 5L9OA 3FXRA 5LOMA 1JW1A 1ZLQA 4PFTA 1MXUA 3OSQA 3MZ1A 1A99A 2Q2CA 3CSGA 3T93B 5I56A 3UIFA 4M1VA 2XXPA 5K2XA 3H6WA 4KCDA 3FATA 2NUVA 2VOZA 2DWAA 3VFJA 5KCJA 1NNFA 3C36A 1MY0A 4N13A 2XD2A 3SEWA 4U21A 3FV1A 2UVGA 5HM4B 1MH4A 1B5HA 3M3LA 3DM0A 4P11A 1PC3A 5EHMA 4LVQA 4IO5A 3QUJA 2B3BA 1PBPA 1PDAA 3S9EA 4PFYA 5DEXB 1MPDA 2Q88A 4IO3A 1R9QA 3KJ7A 3PMVA 1A54A 2R9JA 2F35A 1N04A 4O3CA 3HSTA 2E1SA 1B7HA 5JTYB 3KGCA 3M8UA 4U23A 4ZDMA 1JEVA 4U1ZA 3R6UA 5CRYA 4Q30B 4F19A 4JWYA 2PVUA 3FIRA 1OQHA 4IO6A 1T0KA 1M5EA 1B3LA 4QF9A 2B65A 5AA2A 4EDPA 1WVJA 3RY3A 1MDP1 3RGYA 5HPQA 1O63A 1B5JA 3TDJA 1B2HA 4YKIA 2I49A 2I58A 2OCUA 2QS4A 2O6AA 1A8EA 2XXIA 2B3FA 3B7DA 4GXAA 1LAFE 3MP6A 3FVGA 1LGBC 3FV2A 1SI0A 3FXUA 2F7CA 2REJA 3H7MA 5H8HA 1SDXA 3IO4A 1QULA 3RT6B 2XX8A 2O7IA 3PUWE 2THIA 3DELB 4IY5A 1MM6A 2QPQA 1YCJA 5HBCA 4G68B 2QS2A 3SETA 1F9BA 5H8NA 1H3DA 4XXUA 2KLFA 3IOUA 1SBPA 5ELVA 3L6GA 4TOZA 3K1NA 2FA7A 1PB7A 3QIMA 1Y1MA 2H25A 4IO7A 1O7TA 4BDNA 4MF3A 2XX7A 4KFQA 3PV0E 3MVZA 1BP5A 1UTBB 4YB6A 5H8FB 1OIBA 5TP9A 4HCYA 4R75A 4FIMA 4QFOA 5CMMA 1EU8A 2I48A 5AA4B 5BUUA 2I3VA 1B46A 1ANFA 1SW1A 2F6GA 1B7UA 1DMBA 3KOSA 4XKPA 1Y3QA 3KFMA 4FECA 3LSFB 2VD2A 3EN3A 3ILTB 1M5DA 3VLUA 3N6UA 3O97A 4C1TA 2DOJA 1LLSA 3T9VA 4FEBA 1TFAA 3S4UA 4NF8B 4TLLB 1LCTA 5DT6A 4KQPA 1EZ9A 2DXRA 3VVFA 1II5A 3QUFA 4C1UA 2X26A 1XVYA 3G3GA 3N94A 1MY2A 3VVDA 2VP1A 4ZEIA 3VVEA 1D9VA 4UA8A 3PMXA 4NF6B 4KYEA 5TPAA 4THIA 1NH8A 3A3UA 4H8JA 3KOTA 3T9UA 1UIUA 2M8CA 3K6UA 4N6PA 2PYYA 1Y3PA 4ESXA 1S9TA 2XXWA 1IXIA 1QUKA 2ESNA 3T9XB 2F34A 5A5XB 3K0VA 3TEPA 1JVXA 1RYOA 4XKRA 3FJMA 3FVOA 5ICQA 2RKMA 2X7PA 1IXHA 2VGQA 5AA3A 4KI0E 2O1LA 4OXVA 3K1MA 3TYHA 1MQIA 1A7LA 3C31A 1IITA 3TCGA 2Y7RA 3EHSA 4WXJA 1M5FA 1M5CA 3H6VA 3O66A 5I58B 1IZ1A 1NNKA 1YPNA 2E0SA 4LZ8A 2QMWA 5DYHA 4AQ4A 1LSTA 3Q26A 2NWJA 1B52A 2ZXTA 4G8MA 1EH3A 3IORA 4OYVA 3VXBA 4GD5A 2RC8A 1B0HA 3OO8A 4DCXA 1B0LA 2DWHA 4JXIA 4ZZAA 3SEVA 1ATGA 1BTJA 1US5A 3PPNA 4YICA 1NKXA 4R2FA 4BLAA 2Z8EA 3PMWA 1UTBA 4F2OA 2RC9A 1JQFA 2XXVA 5ITPA 2ZNUA 3THIA 4POWA 1LCFA 4EXKA 1JW5A 3DP6A 4NF5B 1GR2A 4PFUA 3WAFA 1UQWA 3MJNA 4Q0CA 3HN0A 1B7ZA 4YKKA 2PX1A 2ABHA 4GL0A 3HHGA 1ZBMA 5M2VA 3W15C 2HZLA 2I0CA 1ZJLA 1YAEA 2F7BA 2ZYNA 5AA2D 3USDA 4NF8A 3LSXA 4Q5TA 3HHFA 5J1DA 2HFBA 2UVJA 3G3FA 4TQUQ 1MPCA 1VFEA 3TAJA 1MS7A 3GXAA 5H8SA 3RUMA 3S9MC 4I62A 1IXGA 2Y7WA 4H0WA 3IL1B 4HS7A 1SYHA 2Y7KA 1HSEA 2P0SA 3MP8A 5IKBA 4OENA 4R9GA 2FNCA 2HCAA 4DXBA 4P0GA 2UYEA 3SEYA 1MY4A 5CBSA 4KD5A 4ELPA 2A5SA 1B4HA 4FJPA 3C34A 4QRZA 3ZKKA 1Y9UA 3KBRA 3SDFA 3HO7A 1FTOA 3H06B 4I1DA 3IB0A 2Z23A 1MXZA 3OO7A 5AE4A 3IR1A 5FHNA 2F78A 3W9WA 4H65A 3FGSA 4QFKA 2DQVA 1AIVA 2I3WA 2F7AA 2ZYMA 1MG1A 2W7YA 5B70A 1SQYA 4RJZA 3VE1B 1RKMA 1B5IA 2H98A 4X9TA 2BJJX 3TKDA 1PBQA 3U93A 1LFGA 4IO2A 2AIXA 1YTVA 2NVUB 3K2DA 4PQJA 3MZ9A 4F3BA 4RPOA 3TUSA 5B7DA 3PUXE 2HQ0A 3MUQA 3PU5A 3O6HA 1NFTA 4Z7EA 1Y1ZA 2Z22A 1IUDA 3HV1A 4EF2A 1XC1A 1ZU0A 3IK6B 2OWSA 3G3KA 2NOOA 1FQAA 4ONYA 4MH5A 4PE5B 2YLNA 4JWXA 2HAUA 4NF5A 4ELQA 5KZTA 1JEUA 3ZKLA 3O9PA 3OXNA 4MBPA 4F1VA 1SW2A 3FUZA 1HSJA 4WEDA 1OQGA 3PUVE 5EHSA 4LZ5A 4ZEKA 4OEUA 2REGA 4QSCA 3TZAA 3HPIA 4BDMA 2ONRA 4R74A 4F22A 1GGGA 3UK4A 4PFWA 4ESWA 2XXQA 2Y7IA 1QVSA 5TU0A 4L17A 2ZYOA 3KG2A 4TLMB 2VHAA 3I6VA 3QXMA 4HW8A 4FAJA 4IY6A 3K01A 3CR9A 3MVXA 2F97A 5H8QB 4F3PA 1SW4A 3U1OA 2A5TB 3FASA 4GOTA 3ONMA 3IOTA 4LA9A 4XTCQ 3FJ7A 2RCAA 4ZEDA 4G77A 1EZPA 2OLBA 4DDDA 1MH3A 5L9MA 4G2ZA 3PUZE 4DE8A 1Q1KA 2QJEA 1B05A 3PPRA 4IO4A 4F39A 2ZNSA 3IX1A 3F11A 4YMBA 3D4CA 3JYRA 1JETA 5AA1A 3G7WA 1H43A 2IA4A 3C35A 2OWTA 1URDA 4OMBA 3G3HA 2G29A 5CMBA 2LAOA 4DXCA 1CB6A 2XXTA 3L6HA 5KDTB 1DPPA 4F18A 2YPNA 1MM7A 4JB7A 4ZEFA 4NWCA 2RC7A 2O7UA 1D9YA 3SERA 2F36A 2HAVA 4GQOA 1M5BA 1TXFA 2PMSA 3U72A 1L5TA 5I59B 1B51A 3H3GA 4RYAA 1WODA 2P2AA 4R2BA 4ZS9A 3OOAA 1R6ZA 4EXLA 3P7IA 1MY3A 1QUJA 1AH5A 4F3GA 5DEXA 4ZECA 3CVGA 3LR1A 5CM6A 4E0XA 4QHQA 4R72A 3V8XB 1FQEA 3BFTA 2UVIA 1O64A 3MPLA 3SKPA 3PPPA 1OVTA 1B4ZA 1LAXA 3N6TA 2ZNTA 5I2NB 5ISUA 2I6EA 3OSRA 4OFLA 5JTYA 3OELA 3UP9A 2QS1A 1HSLA 4YZZA 4GLIA 4OHNA 4F1YA 4ZE8A 1Z7ME 4C0RA 1P1OA 3OEKA 4BDOA 5JEIA 1OVBA 3O28A 3G3IA 4XKNA 1MY1A 1MXYA 1PEBA 1VSOA 3T66A 5ITOA 3EHTA 4LUBA 1P1QA 3PD8A 4QSEA 3Q28A 2I4CA 2PT2A 3VDFA 3E9XA 3PUYE 3FXQA 3V83A 2DVZA 4G8HA 4EQ7A 5EYFA 1UTHB 1N7WA 3CIJA 3IJOB 3GLBA 4QSDA 1I69A 2DE2A 2UXAA 2Z8FA 3CFXA 3IB1A 2A5TA 4QFNA 3SEUA 1LBBA 4MFIA 1P1NA 2IEEA 3GBBA 1B32A 3FZVA 4G68A 4H5GA 4OTEA 1UIVA 4ELRA 3OEMA 1SW5A 2Q9TA 3KN3A 1B40A 3OO6A 4R73A 1DTZA 1IQ7A 3C32A 1OLCA 2GRVA 4R6YA 4OWDA 2DXYA 1TT1A 3ILUB 2UYFA 3W9VA 1B3EA 2D3IA 4PP0A 2ZMBA 5KCJB 1P99A 3C33A 1KWHA 4UACA 2GHBA 4OFOA 1US4A 3EF7A 2D21A 4IB2A 3PGFA 1S50A 5H8FA 1CE2A 5KDTA 3LSLA 4G4PA 5F7VA 3DLNA 1ZKBA 1B3GA 1I6AA 3MQ9A 5AA4A 3MC2A 3I5OA 3MPKA 2V93A 1LFHA 4U4SA 4KCCA 4FATA 1POTA 4XKQA 3OO9A 2Y84A 4ZZEA 3KZGA 3OENA 2DP8A 3FD3A 3RPWA 3UGWA 1N3WA 2F6PA 3LSWA 1MQGA 1LB8A 3CRBA 4NWDA 4O3BA 2XX9A 2OK2A 1NNTA 1P1WA 1MXVA 2AYSA 2QMXA 1DSNA 4QFLA 3T96B 2H99A 4DLDA 1LB9A 1H45A 1D3KA 3ZSFA 1ZTYA 1QKAA 1SD3A 3N5LA 5CBRA 1MXWA 2Q2AA 3Q27A 1NH7A 4IGTA 3RLFE 1Q35A 4DXUA 2V84A 2PT1A 4G68C 1FCKA 4NF6A 3E3KA 4F1UA 1USYE 4GRKA 3TCFA 1URGA 3R26A 4EQBA 2DVCA 1Y4TA 4RXLA 4RPNA 3FVKA 3DP4A 4JDFA 5H8HB 3K6WA 1XVXA 2HEUA 1XOCA 5ICTA 1XT8A 4MLQA 3TQLA 5FHMA 4HTGA 4AB5A 3QK6A 3SESA 5A5XA 3K1PA 1JW4A 2XXXA 3RN8A 1Y4CA 2RINA 3K4UA 3KN7A 3IOVA 4NEDA 2DWJA 2I0BA 3M3KA 3IO6A 4LONB 1N7XA 3UORA 5H8NB 5I58A 1VFDA 3I3VA 4X1BA 4EUOA 3B6WA 1GVCA 1FQDA 4LQ5A 3VV5A 5I2KB 5K2YA 2OBGA 3TTMA 2DYXA 1XS5A 4ISUA 5CMKA 5TP9B 2CZLA 2H9BA 3FJGA 1A55A 1AOVA 4EQ9A 4DIGA 2DE3A 5CI5A 4GIZA 4ELOA 3IAZA 3OD7A 1R9LA 3B6QA 1Z7NE 3E13X 4AB6A 3ODBA 3O6GA 3TQWA 3KSXA 4NE4A 5L9SA 4XIGQ 2AL5A 4BDQA 3T22A 4GL8A 4LATA 2O69A 3TTLA 3CFZA 4N07A 5CMCA 3TFLA 4NMYA 3D4GA 4OESA 3BKIB 4OQOA 1B6HA 3EQ1A 3IJXB 4OERA 4I8CA 4H67A 2O84X 1AL3A 1I6BA 1SVXB 1GTKA 4GVOA 4U22A 3TCHA 2F8DA 3FVNA 1IEJA 1POY1 2H5YA 4I9DA 4LZ7A 3PD9A 3A3CA 5JK4A 5IAIA 5I57B 4JSOA 3T9HB 3U8QA 3MZBA 3RNNA 3VLWA 1FQCA 3N26A 2X7QA 3QYTA 1BLFA 1FTLA 3O2AA 4NTLA 3HCQA 5FTHA 1MRPA 4ZE9A 3VXCA 4O3AA 4MLVA 4WKMA 4RNSA 1BKAA 5TPAB 3ECRA 4H1XA 1P1UA 3H6UA 2QL3A 1B58A 4BDLA 3BBRA 2R6GE 1ELJA 3KJTA 4DZ1A 1ZIUA 4H5FA 2HXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAX A;  3E4R A;  4OZ9 A;  2RF1 A;  4DCY A;  3A09 A;  3ZS6 A;  1FTK A;  2XHD A;  3S2V A;  1USY H;  4NF4 B;  1TFD A;  1JVY A;  2ONS A;  5I84 A;  4M4G A;  1B9J A;  4ND9 A;  4F2Q A;  3CFL A;  2O51 A;  2Z8D A;  3GZG A;  4P0I A;  3CSB A;  4K3F A;  2DWI A;  4FED A;  1NNP A;  2AL4 A;  3WAE A;  2XXU A;  1WDN A;  1QKB A;  5FHO A;  2CMO A;  3UN6 A;  4F31 B;  4OFJ A;  2O1M A;  3U94 A;  1LAG E;  5DVI A;  3EPE A;  3C4M A;  3RTF B;  4RA1 A;  5I2K A;  3KN8 A;  1FQB A;  3JV9 A;  3BFU A;  2V3T A;  3TTR A;  1I6Q A;  3QSL A;  3TEL A;  3MWB A;  1VR5 A;  4KYD A;  4GFR A;  4KYS A;  2Q89 A;  4GWO A;  1SYI A;  1S7Y A;  3G3J A;  4RK9 A;  4Q8R A;  3PPQ A;  1GV8 A;  1B1H A;  1FTM A;  4OET A;  4ECF A;  1QUI A;  2O68 A;  2OJT A;  1A8F A;  2ANJ A;  1NL5 A;  2H4I A;  1ZMG A;  4G8N A;  4KHZ E;  1SI1 A;  2Q8J A;  1NMU A;  3K6X A;  5I57 A;  1EZO A;  3K6V A;  1MPB A;  1FQF A;  1MXX A;  4JBZ A;  3TTN A;  3JZJ A;  1H76 A;  1DOT A;  3LBS A;  2F5X A;  2HZK A;  3K00 A;  2XXH A;  5DVF A;  3V89 B;  5DTB A;  4GXS B;  4YMA A;  1MQJ A;  2XXY A;  1N3X A;  1B3H A;  1TWY A;  1DPE A;  3R7X A;  1PB9 A;  3MP1 A;  4F3S A;  3UA8 A;  1OLA A;  2VD3 A;  1N0T A;  4JSD A;  3S9L C;  4KR5 A;  4IGR A;  3CG1 A;  3KSJ A;  3IOW A;  1XHY A;  4HCW A;  2QSX A;  3MVY A;  1IXC A;  3V5A A;  5H8Q A;  3Q25 A;  5BWJ A;  2V25 A;  4JWO A;  1JNF A;  2FYI A;  4LP2 B;  1AMF A;  4RK2 A;  3K02 A;  2NXO A;  4BDR A;  2Y7P A;  1IIW A;  4NF4 A;  3H4Z A;  3AXF A;  1DTG A;  3TTK A;  3LUY A;  3C9H A;  4YKP A;  3MAM A;  5I56 B;  1FW0 A;  1BIY A;  1LBC A;  4X48 A;  1MQH A;  3SEX A;  2QS3 A;  4E0W A;  1OMP A;  3RQT A;  1LFI A;  3KEI A;  3EHU A;  3DP8 A;  1Y3N A;  2UVH A;  2XD3 A;  4H8I A;  4U2R A;  4OVJ A;  4U1O A;  4POX A;  4YB7 A;  3S9N C;  3O29 A;  4PET A;  3RTW B;  3B6T A;  4FOR A;  2V3Q A;  4H6D A;  4YAH X;  2ALU A;  3O6I A;  5F1Q A;  1B3F A;  4YB5 A;  4KPT A;  4U4X A;  1R1N A;  3GBA A;  2GHA A;  1MDQ A;  1Y20 A;  2ZYK A;  5I59 A;  4R6H A;  3LC8 A;  2V3U A;  1LAH E;  2WKY A;  3TPA A;  3MBP A;  4F29 A;  1D4N A;  4R6K A;  2RCB A;  3TOD A;  4FE8 A;  4EF1 A;  4RY1 A;  2OZZ A;  4OEV A;  3CG3 A;  1N84 A;  2YJP A;  3M3F A;  2QRY A;  1B1X A;  3MW0 A;  2I4B A;  1QJM A;  3U92 A;  3PPO A;  3VLV A;  5AA2 B;  3TMG A;  2XXR A;  5I2N A;  5DVJ A;  3IB2 A;  2GFE A;  4Z0I A;  1J1N A;  1QW0 A;  4R9F A;  3Q29 A;  1RYX A;  5CC2 A;  2R71 A;  3H6T A;  1A40 A;  4QFP A;  3MVW A;  1VE4 A;  4ZEB A;  1FTJ A;  2DS9 A;  2PBW A;  1URS A;  5FTI A;  3OMB A;  4YKJ A;  1H44 A;  2DE4 A;  4GF8 A;  3RT8 A;  1MQD A;  4WEP A;  2D5W A;  3H03 A;  4YU0 A;  4X1D A;  1UTH A;  5L8D A;  1PB8 A;  2P1S A;  2GH9 A;  4LQ2 A;  2ONK E;  3CI8 A;  2DSF A;  2G93 A;  1N76 A;  5L9O A;  3FXR A;  5LOM A;  1JW1 A;  1ZLQ A;  4PFT A;  1MXU A;  3OSQ A;  3MZ1 A;  1A99 A;  2Q2C A;  3CSG A;  3T93 B;  5I56 A;  3UIF A;  4M1V A;  2XXP A;  5K2X A;  3H6W A;  4KCD A;  3FAT A;  2NUV A;  2VOZ A;  2DWA A;  3VFJ A;  5KCJ A;  1NNF A;  3C36 A;  1MY0 A;  4N13 A;  2XD2 A;  3SEW A;  4U21 A;  3FV1 A;  2UVG A;  5HM4 B;  1MH4 A;  1B5H A;  3M3L A;  3DM0 A;  4P11 A;  1PC3 A;  5EHM A;  4LVQ A;  4IO5 A;  3QUJ A;  2B3B A;  1PBP A;  1PDA A;  3S9E A;  4PFY A;  5DEX B;  1MPD A;  2Q88 A;  4IO3 A;  1R9Q A;  3KJ7 A;  3PMV A;  1A54 A;  2R9J A;  2F35 A;  1N04 A;  4O3C A;  3HST A;  2E1S A;  1B7H A;  5JTY B;  3KGC A;  3M8U A;  4U23 A;  4ZDM A;  1JEV A;  4U1Z A;  3R6U A;  5CRY A;  4Q30 B;  4F19 A;  4JWY A;  2PVU A;  3FIR A;  1OQH A;  4IO6 A;  1T0K A;  1M5E A;  1B3L A;  4QF9 A;  2B65 A;  5AA2 A;  4EDP A;  1WVJ A;  3RY3 A;  1MDP 1;  3RGY A;  5HPQ A;  1O63 A;  1B5J A;  3TDJ A;  1B2H A;  4YKI A;  2I49 A;  2I58 A;  2OCU A;  2QS4 A;  2O6A A;  1A8E A;  2XXI A;  2B3F A;  3B7D A;  4GXA A;  1LAF E;  3MP6 A;  3FVG A;  1LGB C;  3FV2 A;  1SI0 A;  3FXU A;  2F7C A;  2REJ A;  3H7M A;  5H8H A;  1SDX A;  3IO4 A;  1QUL A;  3RT6 B;  2XX8 A;  2O7I A;  3PUW E;  2THI A;  3DEL B;  4IY5 A;  1MM6 A;  2QPQ A;  1YCJ A;  5HBC A;  4G68 B;  2QS2 A;  3SET A;  1F9B A;  5H8N A;  1H3D A;  4XXU A;  2KLF A;  3IOU A;  1SBP A;  5ELV A;  3L6G A;  4TOZ A;  3K1N A;  2FA7 A;  1PB7 A;  3QIM A;  1Y1M A;  2H25 A;  4IO7 A;  1O7T A;  4BDN A;  4MF3 A;  2XX7 A;  4KFQ A;  3PV0 E;  3MVZ A;  1BP5 A;  1UTB B;  4YB6 A;  5H8F B;  1OIB A;  5TP9 A;  4HCY A;  4R75 A;  4FIM A;  4QFO A;  5CMM A;  1EU8 A;  2I48 A;  5AA4 B;  5BUU A;  2I3V A;  1B46 A;  1ANF A;  1SW1 A;  2F6G A;  1B7U A;  1DMB A;  3KOS A;  4XKP A;  1Y3Q A;  3KFM A;  4FEC A;  3LSF B;  2VD2 A;  3EN3 A;  3ILT B;  1M5D A;  3VLU A;  3N6U A;  3O97 A;  4C1T A;  2DOJ A;  1LLS A;  3T9V A;  4FEB A;  1TFA A;  3S4U A;  4NF8 B;  4TLL B;  1LCT A;  5DT6 A;  4KQP A;  1EZ9 A;  2DXR A;  3VVF A;  1II5 A;  3QUF A;  4C1U A;  2X26 A;  1XVY A;  3G3G A;  3N94 A;  1MY2 A;  3VVD A;  2VP1 A;  4ZEI A;  3VVE A;  1D9V A;  4UA8 A;  3PMX A;  4NF6 B;  4KYE A;  5TPA A;  4THI A;  1NH8 A;  3A3U A;  4H8J A;  3KOT A;  3T9U A;  1UIU A;  2M8C A;  3K6U A;  4N6P A;  2PYY A;  1Y3P A;  4ESX A;  1S9T A;  2XXW A;  1IXI A;  1QUK A;  2ESN A;  3T9X B;  2F34 A;  5A5X B;  3K0V A;  3TEP A;  1JVX A;  1RYO A;  4XKR A;  3FJM A;  3FVO A;  5ICQ A;  2RKM A;  2X7P A;  1IXH A;  2VGQ A;  5AA3 A;  4KI0 E;  2O1L A;  4OXV A;  3K1M A;  3TYH A;  1MQI A;  1A7L A;  3C31 A;  1IIT A;  3TCG A;  2Y7R A;  3EHS A;  4WXJ A;  1M5F A;  1M5C A;  3H6V A;  3O66 A;  5I58 B;  1IZ1 A;  1NNK A;  1YPN A;  2E0S A;  4LZ8 A;  2QMW A;  5DYH A;  4AQ4 A;  1LST A;  3Q26 A;  2NWJ A;  1B52 A;  2ZXT A;  4G8M A;  1EH3 A;  3IOR A;  4OYV A;  3VXB A;  4GD5 A;  2RC8 A;  1B0H A;  3OO8 A;  4DCX A;  1B0L A;  2DWH A;  4JXI A;  4ZZA A;  3SEV A;  1ATG A;  1BTJ A;  1US5 A;  3PPN A;  4YIC A;  1NKX A;  4R2F A;  4BLA A;  2Z8E A;  3PMW A;  1UTB A;  4F2O A;  2RC9 A;  1JQF A;  2XXV A;  5ITP A;  2ZNU A;  3THI A;  4POW A;  1LCF A;  4EXK A;  1JW5 A;  3DP6 A;  4NF5 B;  1GR2 A;  4PFU A;  3WAF A;  1UQW A;  3MJN A;  4Q0C A;  3HN0 A;  1B7Z A;  4YKK A;  2PX1 A;  2ABH A;  4GL0 A;  3HHG A;  1ZBM A;  5M2V A;  3W15 C;  2HZL A;  2I0C A;  1ZJL A;  1YAE A;  2F7B A;  2ZYN A;  5AA2 D;  3USD A;  4NF8 A;  3LSX A;  4Q5T A;  3HHF A;  5J1D A;  2HFB A;  2UVJ A;  3G3F A;  4TQU Q;  1MPC A;  1VFE A;  3TAJ A;  1MS7 A;  3GXA A;  5H8S A;  3RUM A;  3S9M C;  4I62 A;  1IXG A;  2Y7W A;  4H0W A;  3IL1 B;  4HS7 A;  1SYH A;  2Y7K A;  1HSE A;  2P0S A;  3MP8 A;  5IKB A;  4OEN A;  4R9G A;  2FNC A;  2HCA A;  4DXB A;  4P0G A;  2UYE A;  3SEY A;  1MY4 A;  5CBS A;  4KD5 A;  4ELP A;  2A5S A;  1B4H A;  4FJP A;  3C34 A;  4QRZ A;  3ZKK A;  1Y9U A;  3KBR A;  3SDF A;  3HO7 A;  1FTO A;  3H06 B;  4I1D A;  3IB0 A;  2Z23 A;  1MXZ A;  3OO7 A;  5AE4 A;  3IR1 A;  5FHN A;  2F78 A;  3W9W A;  4H65 A;  3FGS A;  4QFK A;  2DQV A;  1AIV A;  2I3W A;  2F7A A;  2ZYM A;  1MG1 A;  2W7Y A;  5B70 A;  1SQY A;  4RJZ A;  3VE1 B;  1RKM A;  1B5I A;  2H98 A;  4X9T A;  2BJJ X;  3TKD A;  1PBQ A;  3U93 A;  1LFG A;  4IO2 A;  2AIX A;  1YTV A;  2NVU B;  3K2D A;  4PQJ A;  3MZ9 A;  4F3B A;  4RPO A;  3TUS A;  5B7D A;  3PUX E;  2HQ0 A;  3MUQ A;  3PU5 A;  3O6H A;  1NFT A;  4Z7E A;  1Y1Z A;  2Z22 A;  1IUD A;  3HV1 A;  4EF2 A;  1XC1 A;  1ZU0 A;  3IK6 B;  2OWS A;  3G3K A;  2NOO A;  1FQA A;  4ONY A;  4MH5 A;  4PE5 B;  2YLN A;  4JWX A;  2HAU A;  4NF5 A;  4ELQ A;  5KZT A;  1JEU A;  3ZKL A;  3O9P A;  3OXN A;  4MBP A;  4F1V A;  1SW2 A;  3FUZ A;  1HSJ A;  4WED A;  1OQG A;  3PUV E;  5EHS A;  4LZ5 A;  4ZEK A;  4OEU A;  2REG A;  4QSC A;  3TZA A;  3HPI A;  4BDM A;  2ONR A;  4R74 A;  4F22 A;  1GGG A;  3UK4 A;  4PFW A;  4ESW A;  2XXQ A;  2Y7I A;  1QVS A;  5TU0 A;  4L17 A;  2ZYO A;  3KG2 A;  4TLM B;  2VHA A;  3I6V A;  3QXM A;  4HW8 A;  4FAJ A;  4IY6 A;  3K01 A;  3CR9 A;  3MVX A;  2F97 A;  5H8Q B;  4F3P A;  1SW4 A;  3U1O A;  2A5T B;  3FAS A;  4GOT A;  3ONM A;  3IOT A;  4LA9 A;  4XTC Q;  3FJ7 A;  2RCA A;  4ZED A;  4G77 A;  1EZP A;  2OLB A;  4DDD A;  1MH3 A;  5L9M A;  4G2Z A;  3PUZ E;  4DE8 A;  1Q1K A;  2QJE A;  1B05 A;  3PPR A;  4IO4 A;  4F39 A;  2ZNS A;  3IX1 A;  3F11 A;  4YMB A;  3D4C A;  3JYR A;  1JET A;  5AA1 A;  3G7W A;  1H43 A;  2IA4 A;  3C35 A;  2OWT A;  1URD A;  4OMB A;  3G3H A;  2G29 A;  5CMB A;  2LAO A;  4DXC A;  1CB6 A;  2XXT A;  3L6H A;  5KDT B;  1DPP A;  4F18 A;  2YPN A;  1MM7 A;  4JB7 A;  4ZEF A;  4NWC A;  2RC7 A;  2O7U A;  1D9Y A;  3SER A;  2F36 A;  2HAV A;  4GQO A;  1M5B A;  1TXF A;  2PMS A;  3U72 A;  1L5T A;  5I59 B;  1B51 A;  3H3G A;  4RYA A;  1WOD A;  2P2A A;  4R2B A;  4ZS9 A;  3OOA A;  1R6Z A;  4EXL A;  3P7I A;  1MY3 A;  1QUJ A;  1AH5 A;  4F3G A;  5DEX A;  4ZEC A;  3CVG A;  3LR1 A;  5CM6 A;  4E0X A;  4QHQ A;  4R72 A;  3V8X B;  1FQE A;  3BFT A;  2UVI A;  1O64 A;  3MPL A;  3SKP A;  3PPP A;  1OVT A;  1B4Z A;  1LAX A;  3N6T A;  2ZNT A;  5I2N B;  5ISU A;  2I6E A;  3OSR A;  4OFL A;  5JTY A;  3OEL A;  3UP9 A;  2QS1 A;  1HSL A;  4YZZ A;  4GLI A;  4OHN A;  4F1Y A;  4ZE8 A;  1Z7M E;  4C0R A;  1P1O A;  3OEK A;  4BDO A;  5JEI A;  1OVB A;  3O28 A;  3G3I A;  4XKN A;  1MY1 A;  1MXY A;  1PEB A;  1VSO A;  3T66 A;  5ITO A;  3EHT A;  4LUB A;  1P1Q A;  3PD8 A;  4QSE A;  3Q28 A;  2I4C A;  2PT2 A;  3VDF A;  3E9X A;  3PUY E;  3FXQ A;  3V83 A;  2DVZ A;  4G8H A;  4EQ7 A;  5EYF A;  1UTH B;  1N7W A;  3CIJ A;  3IJO B;  3GLB A;  4QSD A;  1I69 A;  2DE2 A;  2UXA A;  2Z8F A;  3CFX A;  3IB1 A;  2A5T A;  4QFN A;  3SEU A;  1LBB A;  4MFI A;  1P1N A;  2IEE A;  3GBB A;  1B32 A;  3FZV A;  4G68 A;  4H5G A;  4OTE A;  1UIV A;  4ELR A;  3OEM A;  1SW5 A;  2Q9T A;  3KN3 A;  1B40 A;  3OO6 A;  4R73 A;  1DTZ A;  1IQ7 A;  3C32 A;  1OLC A;  2GRV A;  4R6Y A;  4OWD A;  2DXY A;  1TT1 A;  3ILU B;  2UYF A;  3W9V A;  1B3E A;  2D3I A;  4PP0 A;  2ZMB A;  5KCJ B;  1P99 A;  3C33 A;  1KWH A;  4UAC A;  2GHB A;  4OFO A;  1US4 A;  3EF7 A;  2D21 A;  4IB2 A;  3PGF A;  1S50 A;  5H8F A;  1CE2 A;  5KDT A;  3LSL A;  4G4P A;  5F7V A;  3DLN A;  1ZKB A;  1B3G A;  1I6A A;  3MQ9 A;  5AA4 A;  3MC2 A;  3I5O A;  3MPK A;  2V93 A;  1LFH A;  4U4S A;  4KCC A;  4FAT A;  1POT A;  4XKQ A;  3OO9 A;  2Y84 A;  4ZZE A;  3KZG A;  3OEN A;  2DP8 A;  3FD3 A;  3RPW A;  3UGW A;  1N3W A;  2F6P A;  3LSW A;  1MQG A;  1LB8 A;  3CRB A;  4NWD A;  4O3B A;  2XX9 A;  2OK2 A;  1NNT A;  1P1W A;  1MXV A;  2AYS A;  2QMX A;  1DSN A;  4QFL A;  3T96 B;  2H99 A;  4DLD A;  1LB9 A;  1H45 A;  1D3K A;  3ZSF A;  1ZTY A;  1QKA A;  1SD3 A;  3N5L A;  5CBR A;  1MXW A;  2Q2A A;  3Q27 A;  1NH7 A;  4IGT A;  3RLF E;  1Q35 A;  4DXU A;  2V84 A;  2PT1 A;  4G68 C;  1FCK A;  4NF6 A;  3E3K A;  4F1U A;  1USY E;  4GRK A;  3TCF A;  1URG A;  3R26 A;  4EQB A;  2DVC A;  1Y4T A;  4RXL A;  4RPN A;  3FVK A;  3DP4 A;  4JDF A;  5H8H B;  3K6W A;  1XVX A;  2HEU A;  1XOC A;  5ICT A;  1XT8 A;  4MLQ A;  3TQL A;  5FHM A;  4HTG A;  4AB5 A;  3QK6 A;  3SES A;  5A5X A;  3K1P A;  1JW4 A;  2XXX A;  3RN8 A;  1Y4C A;  2RIN A;  3K4U A;  3KN7 A;  3IOV A;  4NED A;  2DWJ A;  2I0B A;  3M3K A;  3IO6 A;  4LON B;  1N7X A;  3UOR A;  5H8N B;  5I58 A;  1VFD A;  3I3V A;  4X1B A;  4EUO A;  3B6W A;  1GVC A;  1FQD A;  4LQ5 A;  3VV5 A;  5I2K B;  5K2Y A;  2OBG A;  3TTM A;  2DYX A;  1XS5 A;  4ISU A;  5CMK A;  5TP9 B;  2CZL A;  2H9B A;  3FJG A;  1A55 A;  1AOV A;  4EQ9 A;  4DIG A;  2DE3 A;  5CI5 A;  4GIZ A;  4ELO A;  3IAZ A;  3OD7 A;  1R9L A;  3B6Q A;  1Z7N E;  3E13 X;  4AB6 A;  3ODB A;  3O6G A;  3TQW A;  3KSX A;  4NE4 A;  5L9S A;  4XIG Q;  2AL5 A;  4BDQ A;  3T22 A;  4GL8 A;  4LAT A;  2O69 A;  3TTL A;  3CFZ A;  4N07 A;  5CMC A;  3TFL A;  4NMY A;  3D4G A;  4OES A;  3BKI B;  4OQO A;  1B6H A;  3EQ1 A;  3IJX B;  4OER A;  4I8C A;  4H67 A;  2O84 X;  1AL3 A;  1I6B A;  1SVX B;  1GTK A;  4GVO A;  4U22 A;  3TCH A;  2F8D A;  3FVN A;  1IEJ A;  1POY 1;  2H5Y A;  4I9D A;  4LZ7 A;  3PD9 A;  3A3C A;  5JK4 A;  5IAI A;  5I57 B;  4JSO A;  3T9H B;  3U8Q A;  3MZB A;  3RNN A;  3VLW A;  1FQC A;  3N26 A;  2X7Q A;  3QYT A;  1BLF A;  1FTL A;  3O2A A;  4NTL A;  3HCQ A;  5FTH A;  1MRP A;  4ZE9 A;  3VXC A;  4O3A A;  4MLV A;  4WKM A;  4RNS A;  1BKA A;  5TPA B;  3ECR A;  4H1X A;  1P1U A;  3H6U A;  2QL3 A;  1B58 A;  4BDL A;  3BBR A;  2R6G E;  1ELJ A;  3KJT A;  4DZ1 A;  1ZIU A;  4H5F A;  2HXW A; 
#chains in the Genus database with same CATH topology
 3QAX A;  3E4R A;  4OZ9 A;  2HPG A;  2RF1 A;  5IZ3 B;  1NV5 A;  4DCY A;  3A09 A;  3ZS6 A;  2WYP A;  1FTK A;  2XHD A;  4NQ8 A;  3S2V A;  1USY H;  4NF4 B;  1TFD A;  1JVY A;  2ONS A;  5I84 A;  4M4G A;  4I3E A;  1B9J A;  4ND9 A;  4F2Q A;  3CFL A;  2O51 A;  1NV6 A;  2Z8D A;  3GZG A;  2FHY A;  4P0I A;  3CSB A;  4K3F A;  3B50 A;  2DWI A;  4FED A;  1NNP A;  5IZ1 A;  2AL4 A;  3WAE A;  2XXU A;  1IMC A;  5EQ8 A;  2FIX A;  5T3J A;  1WDN A;  4PGP A;  1QKB A;  5FHO A;  2CMO A;  5FBP A;  3UN6 A;  4F31 B;  4OFJ A;  2O1M A;  3U94 A;  1FPD A;  1LAG E;  5DVI A;  3EPE A;  3C4M A;  1NV3 A;  3RTF B;  2OX3 A;  4RA1 A;  5I2K A;  3KN8 A;  2XWK A;  1FQB A;  3JV9 A;  3BFU A;  2V3T A;  3TTR A;  1I6Q A;  1EYJ A;  3QSL A;  3TEL A;  3MWB A;  1VR5 A;  4KYD A;  4PC9 A;  4GFR A;  4KYS A;  2Q89 A;  4GWO A;  1FJ6 A;  1SYI A;  1S7Y A;  3G3J A;  4DI4 B;  4RK9 A;  4Q8R A;  3PPQ A;  1GV8 A;  1B1H A;  1FTM A;  4OET A;  4ECF A;  1QUI A;  2O68 A;  2OJT A;  1A8F A;  2ANJ A;  2R8T A;  1NL5 A;  2H4I A;  1ZMG A;  4NF0 A;  4G8N A;  4KHZ E;  1SI1 A;  2P3N A;  2Q8J A;  1NUX A;  1NMU A;  3K6X A;  5I57 A;  1EZO A;  3K6V A;  1MPB A;  1FQF A;  2F3B A;  1MXX A;  4JBZ A;  3TTN A;  3JZJ A;  1H76 A;  1K9Z A;  1DOT A;  3LBS A;  2F5X A;  2HZK A;  3K00 A;  2XXH A;  5DVF A;  3V89 B;  5DTB A;  4GXS B;  4YMA A;  1MQJ A;  2XXY A;  1N3X A;  1B3H A;  1FPF A;  1TWY A;  2MKZ A;  1DPE A;  3R7X A;  1PB9 A;  3MP1 A;  4F3S A;  3UA8 A;  1OLA A;  2VD3 A;  1N0T A;  4JSD A;  3S9L C;  4KR5 A;  4IGR A;  2GQ1 A;  3CG1 A;  3KSJ A;  3IOW A;  1XHY A;  4HCW A;  2QSX A;  3MVY A;  1IXC A;  3V5A A;  5H8Q A;  3Q25 A;  5BWJ A;  2KR0 A;  2V25 A;  4JWO A;  1JNF A;  2FYI A;  4LP2 B;  5EQ9 A;  1AMF A;  4RK2 A;  3E78 A;  3K02 A;  2NXO A;  4BDR A;  2Y7P A;  1IIW A;  4NF4 A;  2FBP A;  3H4Z A;  3AXF A;  1DTG A;  3TTK A;  3LV0 A;  3LUY A;  3C9H A;  4YKP A;  3MAM A;  5I56 B;  1FW0 A;  1BIY A;  1LBC A;  4X48 A;  1MQH A;  3SEX A;  1LBY A;  2QS3 A;  4E0W A;  1OMP A;  3RQT A;  1LFI A;  3KEI A;  3EHU A;  3DP8 A;  1Y3N A;  2B4L A;  4I40 A;  4MCO A;  2UVH A;  2XD3 A;  4H8I A;  4U2R A;  4OVJ A;  4U1O A;  4POX A;  4YB7 A;  3S9N C;  3O29 A;  4PET A;  3RTW B;  3B6T A;  4FOR A;  2V3Q A;  4H6D A;  4YAH X;  2ALU A;  3O6I A;  2XWV A;  5F1Q A;  1B3F A;  4YB5 A;  4KPT A;  4U4X A;  1R1N A;  3GBA A;  2GHA A;  4PAK A;  1MDQ A;  3RPL B;  1Y20 A;  2ZYK A;  5I59 A;  4R6H A;  5F24 A;  1FBE A;  3LC8 A;  4PE3 A;  2V3U A;  1LAH E;  4NAP A;  5I3S A;  2WKY A;  3TPA A;  3MBP A;  4F29 A;  2BJI A;  1D4N A;  4R6K A;  2RCB A;  3TOD A;  4FE8 A;  4EF1 A;  5A5L A;  4RY1 A;  2B4M A;  2OZZ A;  4OEV A;  3CG3 A;  1N84 A;  2YJP A;  3M3F A;  2QRY A;  1B1X A;  3MW0 A;  1NUY A;  2I4B A;  1QJM A;  4XFE A;  3U92 A;  2XXK A;  3PPO A;  3VLV A;  5AA2 B;  3TMG A;  2XXR A;  5I2N A;  4PCD A;  5DVJ A;  3HFU A;  3IB2 A;  2GFE A;  2OWZ A;  4Z0I A;  3PTY A;  1J1N A;  1QW0 A;  4R9F A;  4QBA A;  3Q29 A;  1RYX A;  2XWO A;  4N17 A;  5CC2 A;  2R71 A;  3H6T A;  1A40 A;  4QFP A;  4MIJ A;  3MVW A;  1VE4 A;  4ZEB A;  4JVD A;  2QVR A;  1FTJ A;  2DS9 A;  2PBW A;  1URS A;  5FTI A;  3OMB A;  4YKJ A;  1H44 A;  2DE4 A;  4GF8 A;  3RT8 A;  1MQD A;  4WEP A;  2V4C A;  2VPN A;  2D5W A;  3H03 A;  4YU0 A;  2ZZX A;  4X1D A;  1UTH A;  5L8D A;  1PB8 A;  2P1S A;  2GH9 A;  4LQ2 A;  2ONK E;  4GX3 A;  3CI8 A;  2DSF A;  2G93 A;  1N76 A;  5L9O A;  3FXR A;  5LOM A;  1JW1 A;  1ZLQ A;  4PFT A;  1MXU A;  2WEF A;  3OSQ A;  1LBX A;  4PDD A;  4HE2 A;  5ET6 A;  3MZ1 A;  1A99 A;  2Q2C A;  3CSG A;  3ISP A;  3T93 B;  5I56 A;  2P3V A;  3UIF A;  4M1V A;  2XXP A;  5K2X A;  3H6W A;  4KCD A;  1NV4 A;  3FAT A;  2NUV A;  2VOZ A;  2DWA A;  3VFJ A;  5KCJ A;  1NNF A;  3C36 A;  1MY0 A;  4OA4 A;  4N13 A;  2XD2 A;  3SEW A;  2Q8M A;  3GYY A;  4U21 A;  3FV1 A;  2UVG A;  5HM4 B;  1MH4 A;  1B5H A;  3M3L A;  3DM0 A;  4P11 A;  1PC3 A;  5EHM A;  4LVQ A;  4IO5 A;  3QUJ A;  2B3B A;  1PBP A;  1PDA A;  4XF5 A;  3S9E A;  4PFY A;  5DEX B;  1MPD A;  2Q88 A;  4IO3 A;  3RPL A;  4PFI A;  2WBD A;  1R9Q A;  3KJ7 A;  3PMV A;  1A54 A;  2R9J A;  2F35 A;  1N04 A;  4O3C A;  3HST A;  2E1S A;  1B7H A;  3D1R A;  5JTY B;  3KGC A;  3M8U A;  4U23 A;  4ZDM A;  1JEV A;  4U1Z A;  3R6U A;  4N15 A;  5CRY A;  4Q30 B;  4F19 A;  1FBC A;  4JWY A;  3E79 A;  2PVU A;  3FIR A;  1OQH A;  4IO6 A;  3FBP A;  1T0K A;  1M5E A;  1B3L A;  4MAG A;  4QF9 A;  2B65 A;  5AA2 A;  4O8M A;  4EDP A;  1WVJ A;  3RY3 A;  1MDP 1;  3RGY A;  1RDZ A;  5HPQ A;  1O63 A;  1B5J A;  3TDJ A;  1B2H A;  4YKI A;  2I49 A;  2I58 A;  2OCU A;  2QS4 A;  1FPG A;  2O6A A;  1A8E A;  2XXI A;  2B3F A;  3B7D A;  4GXA A;  1LAF E;  3MP6 A;  3FVG A;  1LGB C;  3FV2 A;  1SI0 A;  3FXU A;  2F7C A;  4NN3 A;  2REJ A;  3H7M A;  3KC0 A;  5H8H A;  1SDX A;  4PBQ A;  1FPI A;  3IO4 A;  4JVC A;  1QUL A;  3RT6 B;  2XX8 A;  2O7I A;  3PUW E;  1CNQ A;  2THI A;  3DEL B;  4IY5 A;  1MM6 A;  2QPQ A;  1YCJ A;  4NG7 A;  1LBZ A;  1NUZ A;  5HBC A;  4G68 B;  4GWZ A;  1IME A;  2QS2 A;  3SET A;  1F9B A;  4XXU A;  1H3D A;  4OVT A;  2KLF A;  5H8N A;  3IOU A;  1SBP A;  5ELV A;  3L6G A;  4TOZ A;  3K1N A;  2FA7 A;  1VDW A;  1PB7 A;  3QIM A;  1Y1M A;  2H25 A;  4IO7 A;  1BK4 A;  1O7T A;  4BDN A;  4MF3 A;  2XX7 A;  2QVU A;  4GWY A;  1LBW A;  2XWI A;  4KFQ A;  3PV0 E;  3MVZ A;  1BP5 A;  1EYI A;  1UTB B;  4P8B A;  4YB6 A;  5H8F B;  4PFB A;  1OIB A;  5TP9 A;  4HXV A;  2WX9 A;  4MHF A;  4HCY A;  4N81 A;  4R75 A;  4FIM A;  4QFO A;  5CMM A;  5DW8 A;  1EU8 A;  2I48 A;  1NV1 A;  5AA4 B;  5BUU A;  2I3V A;  4MEV A;  1B46 A;  1ANF A;  1SW1 A;  2F6G A;  5LDZ A;  1B7U A;  4GWX A;  1DMB A;  3KOS A;  4XKP A;  1Y3Q A;  3KFM A;  4FEC A;  3LSF B;  4MNP A;  2VD2 A;  3EN3 A;  3ILT B;  1M5D A;  2WYK A;  3VLU A;  2HHM A;  3N6U A;  3O97 A;  4C1T A;  2DOJ A;  1LLS A;  3T9V A;  4FEB A;  1TFA A;  3S4U A;  4NF8 B;  4N4U A;  4TLL B;  1LCT A;  1KA1 A;  5DT6 A;  4X04 A;  4KQP A;  1EZ9 A;  2DXR A;  3VVF A;  1II5 A;  3QUF A;  4C1U A;  2X26 A;  1LBV A;  1XVY A;  3G3G A;  3N94 A;  1FTA A;  4MMP A;  1MY2 A;  3VVD A;  2VP1 A;  4MX6 A;  4ZEI A;  5I5P A;  4NX1 A;  4H45 A;  2JJK A;  3VVE A;  1D9V A;  1FSA A;  4UA8 A;  3PMX A;  4NF6 B;  4KYE A;  5TPA A;  4THI A;  2QFL A;  1NH8 A;  3A3U A;  4H8J A;  3KOT A;  3T9U A;  3U65 A;  1UIU A;  2M8C A;  3K6U A;  4N6P A;  2PYY A;  1Y3P A;  1IMD A;  4ESX A;  1S9T A;  2XXW A;  1IXI A;  1QUK A;  2ESN A;  3T9X B;  2F34 A;  5A5X B;  3K0V A;  3TEP A;  1JVX A;  1RYO A;  4XKR A;  3FJM A;  3FVO A;  5IZ3 A;  4PGN A;  5ICQ A;  4OVS A;  2F3D A;  4GWW A;  2RKM A;  2X7P A;  2ZZV A;  1IXH A;  2VGQ A;  5AA3 A;  4KI0 E;  4P56 A;  3LUZ A;  2O1L A;  4OXV A;  3K1M A;  3TYH A;  1MQI A;  1A7L A;  3C31 A;  1IIT A;  3TCG A;  4P9K A;  2Y7R A;  3EHS A;  2KQZ A;  4WXJ A;  1M5F A;  1M5C A;  1FPJ A;  3H6V A;  3O66 A;  5I58 B;  1IZ1 A;  4X8R A;  1NNK A;  1YPN A;  2E0S A;  5EQ7 A;  4LZ8 A;  2QMW A;  5DYH A;  4AQ4 A;  1LST A;  3Q26 A;  2NWJ A;  1B52 A;  2ZXT A;  4G8M A;  1EH3 A;  3IOR A;  4OYV A;  3VXB A;  4GD5 A;  2RC8 A;  4MJO A;  1B0H A;  3OO8 A;  4OAN A;  4N8Y A;  4DCX A;  1B0L A;  2DWH A;  4PTK A;  4JXI A;  4ZZA A;  3SEV A;  1ATG A;  4OVP A;  1IMA A;  1BTJ A;  4PF8 A;  1US5 A;  3PPN A;  1FJ9 A;  4YIC A;  1NKX A;  4R2F A;  4BLA A;  2Z8E A;  3PMW A;  2PFZ A;  1UTB A;  4F2O A;  2RC9 A;  1JQF A;  2XXV A;  5ITP A;  2ZNU A;  3THI A;  4POW A;  1LCF A;  4EXK A;  1JW5 A;  3DP6 A;  4NF5 B;  1GR2 A;  4PFU A;  3WAF A;  1UQW A;  1LEV A;  3MJN A;  4GX6 A;  4Q0C A;  3HN0 A;  1B7Z A;  4YKK A;  2PX1 A;  2ABH A;  4GL0 A;  1FPK A;  3HHG A;  1ZBM A;  4O7I A;  5M2V A;  3W15 C;  4GX4 A;  2HZL A;  2I0C A;  1ZJL A;  1YAE A;  1KZ8 A;  1SPI A;  2F7B A;  2ZYN A;  5AA2 D;  3USD A;  4NF8 A;  3LSX A;  4Q5T A;  3HHF A;  5J1D A;  2HFB A;  2UVJ A;  3G3F A;  4TQU Q;  1MPC A;  1VFE A;  3TAJ A;  1MS7 A;  2ZZW A;  3GXA A;  5H8S A;  4HE1 A;  3RUM A;  3S9M C;  4I62 A;  1IXG A;  1FBG A;  2Y7W A;  1D9Q A;  4H0W A;  3IL1 B;  4HS7 A;  3EKI A;  1SYH A;  2Y7K A;  1HSE A;  2P0S A;  3MP8 A;  4DI3 D;  5IKB A;  4OEN A;  4R9G A;  2FNC A;  2HCA A;  4DXB A;  4P0G A;  2UYE A;  3SEY A;  4AS4 A;  1MY4 A;  5CBS A;  1FBD A;  4KD5 A;  5J16 A;  2A5S A;  1B4H A;  4FJP A;  4QRZ A;  3C34 A;  3ZKK A;  4ELP A;  1Y9U A;  3KBR A;  3SDF A;  3HO7 A;  1FTO A;  1YXI A;  3H06 B;  4I1D A;  3IB0 A;  2Z23 A;  1MXZ A;  3OO7 A;  4N6K A;  5AE4 A;  3IR1 A;  5FHN A;  4N8G A;  1NI9 A;  2F78 A;  3W9W A;  4H65 A;  2Y5K A;  2FIE A;  1G0I A;  3FGS A;  4QFK A;  2DQV A;  1AIV A;  2I3W A;  2F7A A;  2ZYM A;  1MG1 A;  2W7Y A;  5B70 A;  4PF6 A;  1SQY A;  1INP A;  4RJZ A;  3VE1 B;  1RKM A;  1B5I A;  2H98 A;  4X9T A;  2BJJ X;  3TKD A;  1PBQ A;  3QMF A;  4OVR A;  4IR8 A;  3U93 A;  1LFG A;  4G61 A;  4IO2 A;  1NV0 A;  1FBF A;  2AIX A;  1YTV A;  2NVU B;  3K2D A;  4PQJ A;  3MZ9 A;  4F3B A;  4RPO A;  3TUS A;  5B7D A;  3PUX E;  1YYZ A;  2HQ0 A;  3MUQ A;  1NV2 A;  3PU5 A;  3O6H A;  1NFT A;  4Z7E A;  2CEX A;  1Y1Z A;  2Z22 A;  3CHG A;  1IUD A;  3HV1 A;  4EF2 A;  1XC1 A;  1ZU0 A;  3IK6 B;  2OWS A;  3G3K A;  2NOO A;  1FQA A;  4ONY A;  4MH5 A;  4PE5 B;  3KC1 A;  2YLN A;  4JWX A;  2HAU A;  4NF5 A;  4ELQ A;  4O94 A;  5KZT A;  1JEU A;  3ZKL A;  5IGA A;  3O9P A;  3OXN A;  4MBP A;  4F1V A;  1SW2 A;  3FUZ A;  1HSJ A;  4WED A;  1OQG A;  3PUV E;  5EHS A;  4LZ5 A;  4ZEK A;  4OEU A;  2REG A;  4QSC A;  3TZA A;  3HPI A;  4BDM A;  2ONR A;  4R74 A;  4F22 A;  1GGG A;  3UK4 A;  1IMB A;  3KBZ A;  1FBP A;  3NOH A;  4PFW A;  4ESW A;  2XXQ A;  1IMF A;  1QVS A;  2Y7I A;  5TU0 A;  4L17 A;  2ZYO A;  3KG2 A;  4TLM B;  2VHA A;  2VPO A;  3I6V A;  3QXM A;  4HW8 A;  4FAJ A;  4IY6 A;  3K01 A;  3SZP A;  2L5V A;  3CR9 A;  3MVX A;  2F97 A;  5H8Q B;  4F3P A;  1SW4 A;  4H46 A;  3U1O A;  2A5T B;  3FAS A;  4GOT A;  3ONM A;  3IOT A;  4LA9 A;  4XTC Q;  1DCU A;  3FJ7 A;  2RCA A;  4ZED A;  4G77 A;  1EZP A;  2OLB A;  4DDD A;  4LN5 A;  1MH3 A;  5L9M A;  4G2Z A;  3PUZ E;  4DE8 A;  1Q1K A;  2QJE A;  1B05 A;  3PPR A;  4IO4 A;  4F39 A;  2ZNS A;  1QGX A;  3IX1 A;  3F11 A;  4YMB A;  3D4C A;  4UAB A;  3JYR A;  1JET A;  5AA1 A;  3G7W A;  1H43 A;  2IA4 A;  3C35 A;  2OWT A;  1URD A;  4OMB A;  3G3H A;  2G29 A;  5CMB A;  1DBZ A;  4O7M A;  2CZI A;  2LAO A;  4DXC A;  2Y5L A;  1CB6 A;  2XXT A;  3L6H A;  5KDT B;  1DPP A;  4F18 A;  2YPN A;  1MM7 A;  4JB7 A;  4ZEF A;  4NWC A;  2RC7 A;  2O7U A;  1D9Y A;  3SER A;  2F36 A;  2HAV A;  4GQO A;  1M5B A;  1TXF A;  2PMS A;  3U72 A;  1L5T A;  5I59 B;  1B51 A;  3H3G A;  4RYA A;  1WOD A;  2P2A A;  2PCR A;  4R2B A;  4ZS9 A;  4I3Y A;  1AWB A;  2CZH A;  3OOA A;  1R6Z A;  4EXL A;  2HXR A;  3P7I A;  1MY3 A;  1FPE A;  1QUJ A;  1AH5 A;  4F3G A;  5DEX A;  4ZEC A;  3CVG A;  3LR1 A;  5CM6 A;  4E0X A;  4QHQ A;  4R72 A;  3V8X B;  1FQE A;  3BFT A;  2UVI A;  1O64 A;  3MPL A;  3SKP A;  3PPP A;  1OVT A;  1B4Z A;  1LAX A;  3N6T A;  5I7I A;  2ZNT A;  5I2N B;  5ISU A;  2I6E A;  3OSR A;  4OFL A;  5JTY A;  3OEL A;  3UP9 A;  2QS1 A;  1HSL A;  3IFC A;  4YZZ A;  4GLI A;  4OHN A;  4MNI A;  5LTC A;  4F1Y A;  4ZE8 A;  1Z7M E;  4C0R A;  1P1O A;  3OEK A;  4BDO A;  5JEI A;  1OVB A;  3O28 A;  4AS5 A;  3G3I A;  3MST A;  4XKN A;  1MY1 A;  1MXY A;  1PEB A;  1VSO A;  3T66 A;  5ITO A;  3EHT A;  4LUB A;  1KA0 A;  3B8B A;  1P1Q A;  3PD8 A;  4QSE A;  5EYG A;  3Q28 A;  4JVI A;  2I4C A;  2PT2 A;  3VDF A;  3E9X A;  2FVZ A;  3PUY E;  1XI6 A;  3FXQ A;  3V83 A;  2DVZ A;  4G8H A;  4EQ7 A;  1FPL A;  5EYF A;  1UTH B;  1N7W A;  3CIJ A;  3IJO B;  3GLB A;  4OVQ A;  4QSD A;  1I69 A;  2DE2 A;  2UXA A;  2Z8F A;  3CFX A;  3IB1 A;  5ESY A;  2A5T A;  2PFY A;  4QFN A;  3SEU A;  4GBV A;  1LBB A;  4MFI A;  1P1N A;  2IEE A;  3GBB A;  1B32 A;  3FZV A;  4G68 A;  4H5G A;  4OTE A;  1UIV A;  1DK4 A;  4ELR A;  3OEM A;  1SW5 A;  1RDX A;  2Q9T A;  3KN3 A;  1B40 A;  3OO6 A;  4R73 A;  1DTZ A;  1IQ7 A;  3C32 A;  3ROJ A;  1OLC A;  2GRV A;  4HE0 A;  4R6Y A;  4OWD A;  2DXY A;  3IFA A;  1TT1 A;  3ILU B;  2UYF A;  3W9V A;  5ET5 A;  1B3E A;  2DDK A;  2D3I A;  4PP0 A;  2ZMB A;  5KCJ B;  5EYH A;  4N91 A;  1P99 A;  3BIH A;  5ET8 A;  3C33 A;  1KWH A;  4UAC A;  1YZ0 A;  2GHB A;  4OFO A;  1US4 A;  3EF7 A;  4FBP A;  2D21 A;  4GWU A;  4IB2 A;  3PGF A;  1S50 A;  3FXB A;  4NHB A;  5H8F A;  1CE2 A;  5KDT A;  3LSL A;  4G4P A;  5F7V A;  3A29 A;  3DLN A;  1ZKB A;  1B3G A;  1I6A A;  2CZK A;  3MQ9 A;  5AA4 A;  1FPB A;  2CEY A;  3T0J A;  1NUW A;  3MC2 A;  3I5O A;  3MPK A;  4P1L A;  2V93 A;  1LFH A;  4U4S A;  4KCC A;  3BIG A;  4FAT A;  1POT A;  4PAF A;  2Q74 A;  4XKQ A;  3OO9 A;  2Y84 A;  4ZZE A;  3KZG A;  3OEN A;  2DP8 A;  3FD3 A;  3RPW A;  3UGW A;  1N3W A;  4GBW A;  4P3L A;  2F6P A;  2XA5 A;  3LSW A;  1MQG A;  1LB8 A;  3CRB A;  4NWD A;  5IZZ A;  4O3B A;  2XX9 A;  2OK2 A;  1NNT A;  1P1W A;  1MXV A;  2AYS A;  2QMX A;  1DSN A;  4P47 A;  4PAI A;  4QFL A;  3T96 B;  1K9Y A;  2H99 A;  4N6D A;  4DLD A;  1LB9 A;  1EYK A;  1H45 A;  1NV7 A;  1D3K A;  3ZSF A;  1ZTY A;  1QKA A;  1SD3 A;  3N5L A;  5CBR A;  1MXW A;  2Q2A A;  3Q27 A;  1NH7 A;  4PFR A;  4IGT A;  3RLF E;  1Q35 A;  4DXU A;  2V84 A;  2PT1 A;  4G68 C;  1FCK A;  4GWS A;  4NF6 A;  3E3K A;  5IM2 A;  4F1U A;  1USY E;  4GRK A;  3TCF A;  1URG A;  3R26 A;  5ET7 A;  4EQB A;  2DVC A;  1Y4T A;  1G0H A;  4RXL A;  4RPN A;  3FVK A;  3DP4 A;  4JDF A;  5H8H B;  3K6W A;  1XVX A;  2HEU A;  1XOC A;  5ICT A;  5EQA A;  1XT8 A;  4MLQ A;  3TQL A;  3MYU A;  5FHM A;  4HTG A;  4AB5 A;  3QK6 A;  3SES A;  5A5X A;  3K1P A;  1JW4 A;  2XXX A;  3RN8 A;  1Y4C A;  2RIN A;  3K4U A;  3KN7 A;  3IOV A;  4KXP A;  4NED A;  2DWJ A;  4PDH A;  2I0B A;  3M3K A;  3IO6 A;  4LON B;  1N7X A;  3UOR A;  5H8N B;  5I58 A;  1FBH A;  1VFD A;  3I3V A;  4X1B A;  4EUO A;  3B6W A;  1GVC A;  1FQD A;  4LQ5 A;  2QVV A;  3VV5 A;  5I2K B;  4QXD A;  5K2Y A;  2OBG A;  3TTM A;  2DYX A;  1XS5 A;  4ISU A;  4P1E A;  4MNC A;  5TP9 B;  5CMK A;  2CZL A;  2H9B A;  3FJG A;  1A55 A;  4XEQ A;  1AOV A;  4EQ9 A;  4DIG A;  1FRP A;  2DE3 A;  5CI5 A;  4GIZ A;  4ELO A;  3IAZ A;  3OD7 A;  1R9L A;  3B6Q A;  1Z7N E;  3E13 X;  4AB6 A;  3ODB A;  3O6G A;  3TQW A;  1JP4 A;  1RDY A;  3KSX A;  4NE4 A;  5L9S A;  4XIG Q;  4PBH A;  2AL5 A;  4BDQ A;  4GL8 A;  4LAT A;  3T22 A;  2O69 A;  3TTL A;  3CFZ A;  4N07 A;  5CMC A;  3TFL A;  4NMY A;  3D4G A;  4OES A;  4OQO A;  3BKI B;  1B6H A;  3EQ1 A;  3IJX B;  4OER A;  4I8C A;  4H67 A;  2O84 X;  1AL3 A;  1I6B A;  1SVX B;  1GTK A;  4GVO A;  4U22 A;  3TCH A;  2F8D A;  3FVN A;  1IEJ A;  1POY 1;  2H5Y A;  3RYD A;  4I9D A;  4LZ7 A;  3PD9 A;  3A3C A;  5JK4 A;  5IAI A;  5I57 B;  4JSO A;  3T9H B;  1Q9D A;  3U8Q A;  3MZB A;  2WBB A;  3RNN A;  3VLW A;  4NGU A;  1FQC A;  3N26 A;  2X7Q A;  3QYT A;  1BLF A;  1FTL A;  3O2A A;  4NTL A;  3HCQ A;  5FTH A;  1MRP A;  4ZE9 A;  3VXC A;  4O3A A;  4MLV A;  4WKM A;  4RNS A;  1BKA A;  5TPA B;  3ECR A;  4H1X A;  1P1U A;  2VT5 A;  3H6U A;  2QL3 A;  1B58 A;  3T1B A;  4BDL A;  3BBR A;  2R6G E;  1ELJ A;  3KJT A;  4DZ1 A;  1ZIU A;  4H5F A;  2HXW A; 
#chains in the Genus database with same CATH homology
 3QAX A;  3E4R A;  4OZ9 A;  2RF1 A;  4DCY A;  3A09 A;  3ZS6 A;  1FTK A;  2XHD A;  3S2V A;  1USY H;  4NF4 B;  1TFD A;  1JVY A;  2ONS A;  5I84 A;  4M4G A;  1B9J A;  4ND9 A;  4F2Q A;  3CFL A;  2O51 A;  2Z8D A;  3GZG A;  4P0I A;  3CSB A;  4K3F A;  2DWI A;  4FED A;  1NNP A;  2AL4 A;  3WAE A;  2XXU A;  1WDN A;  1QKB A;  5FHO A;  2CMO A;  3UN6 A;  4F31 B;  4OFJ A;  2O1M A;  3U94 A;  1LAG E;  5DVI A;  3EPE A;  3C4M A;  3RTF B;  4RA1 A;  5I2K A;  3KN8 A;  1FQB A;  3JV9 A;  3BFU A;  2V3T A;  3TTR A;  1I6Q A;  3QSL A;  3TEL A;  3MWB A;  1VR5 A;  4KYD A;  4GFR A;  4KYS A;  2Q89 A;  4GWO A;  1SYI A;  1S7Y A;  3G3J A;  4RK9 A;  4Q8R A;  3PPQ A;  1GV8 A;  1B1H A;  1FTM A;  4OET A;  4ECF A;  1QUI A;  2O68 A;  2OJT A;  1A8F A;  2ANJ A;  1NL5 A;  2H4I A;  1ZMG A;  4G8N A;  4KHZ E;  1SI1 A;  2Q8J A;  1NMU A;  3K6X A;  5I57 A;  1EZO A;  3K6V A;  1MPB A;  1FQF A;  1MXX A;  4JBZ A;  3TTN A;  3JZJ A;  1H76 A;  1DOT A;  3LBS A;  2F5X A;  2HZK A;  3K00 A;  2XXH A;  5DVF A;  3V89 B;  5DTB A;  4GXS B;  4YMA A;  1MQJ A;  2XXY A;  1N3X A;  1B3H A;  1TWY A;  1DPE A;  3R7X A;  1PB9 A;  3MP1 A;  4F3S A;  3UA8 A;  1OLA A;  2VD3 A;  1N0T A;  4JSD A;  3S9L C;  4KR5 A;  4IGR A;  3CG1 A;  3KSJ A;  3IOW A;  1XHY A;  4HCW A;  2QSX A;  3MVY A;  1IXC A;  3V5A A;  5H8Q A;  3Q25 A;  5BWJ A;  2V25 A;  4JWO A;  1JNF A;  2FYI A;  4LP2 B;  1AMF A;  4RK2 A;  3K02 A;  2NXO A;  4BDR A;  2Y7P A;  1IIW A;  4NF4 A;  3H4Z A;  3AXF A;  1DTG A;  3TTK A;  3LUY A;  3C9H A;  4YKP A;  3MAM A;  5I56 B;  1FW0 A;  1BIY A;  1LBC A;  4X48 A;  1MQH A;  3SEX A;  2QS3 A;  4E0W A;  1OMP A;  3RQT A;  1LFI A;  3KEI A;  3EHU A;  3DP8 A;  1Y3N A;  2UVH A;  2XD3 A;  4H8I A;  4U2R A;  4OVJ A;  4U1O A;  4POX A;  4YB7 A;  3S9N C;  3O29 A;  4PET A;  3RTW B;  3B6T A;  4FOR A;  2V3Q A;  4H6D A;  4YAH X;  2ALU A;  3O6I A;  5F1Q A;  1B3F A;  4YB5 A;  4KPT A;  4U4X A;  1R1N A;  3GBA A;  2GHA A;  1MDQ A;  1Y20 A;  2ZYK A;  5I59 A;  4R6H A;  3LC8 A;  2V3U A;  1LAH E;  2WKY A;  3TPA A;  3MBP A;  4F29 A;  1D4N A;  4R6K A;  2RCB A;  3TOD A;  4FE8 A;  4EF1 A;  4RY1 A;  2OZZ A;  4OEV A;  3CG3 A;  1N84 A;  2YJP A;  3M3F A;  2QRY A;  1B1X A;  3MW0 A;  2I4B A;  1QJM A;  3U92 A;  3PPO A;  3VLV A;  5AA2 B;  3TMG A;  2XXR A;  5I2N A;  5DVJ A;  3IB2 A;  2GFE A;  4Z0I A;  1J1N A;  1QW0 A;  4R9F A;  3Q29 A;  1RYX A;  5CC2 A;  2R71 A;  3H6T A;  1A40 A;  4QFP A;  3MVW A;  1VE4 A;  4ZEB A;  1FTJ A;  2DS9 A;  2PBW A;  1URS A;  5FTI A;  3OMB A;  4YKJ A;  1H44 A;  2DE4 A;  4GF8 A;  3RT8 A;  1MQD A;  4WEP A;  2D5W A;  3H03 A;  4YU0 A;  4X1D A;  1UTH A;  5L8D A;  1PB8 A;  2P1S A;  2GH9 A;  4LQ2 A;  2ONK E;  3CI8 A;  2DSF A;  2G93 A;  1N76 A;  5L9O A;  3FXR A;  5LOM A;  1JW1 A;  1ZLQ A;  4PFT A;  1MXU A;  3OSQ A;  3MZ1 A;  1A99 A;  2Q2C A;  3CSG A;  3T93 B;  5I56 A;  3UIF A;  4M1V A;  2XXP A;  5K2X A;  3H6W A;  4KCD A;  3FAT A;  2NUV A;  2VOZ A;  2DWA A;  3VFJ A;  5KCJ A;  1NNF A;  3C36 A;  1MY0 A;  4N13 A;  2XD2 A;  3SEW A;  4U21 A;  3FV1 A;  2UVG A;  5HM4 B;  1MH4 A;  1B5H A;  3M3L A;  3DM0 A;  4P11 A;  1PC3 A;  5EHM A;  4LVQ A;  4IO5 A;  3QUJ A;  2B3B A;  1PBP A;  1PDA A;  3S9E A;  4PFY A;  5DEX B;  1MPD A;  2Q88 A;  4IO3 A;  1R9Q A;  3KJ7 A;  3PMV A;  1A54 A;  2R9J A;  2F35 A;  1N04 A;  4O3C A;  3HST A;  2E1S A;  1B7H A;  5JTY B;  3KGC A;  3M8U A;  4U23 A;  4ZDM A;  1JEV A;  4U1Z A;  3R6U A;  5CRY A;  4Q30 B;  4F19 A;  4JWY A;  2PVU A;  3FIR A;  1OQH A;  4IO6 A;  1T0K A;  1M5E A;  1B3L A;  4QF9 A;  2B65 A;  5AA2 A;  4EDP A;  1WVJ A;  3RY3 A;  1MDP 1;  3RGY A;  5HPQ A;  1O63 A;  1B5J A;  3TDJ A;  1B2H A;  4YKI A;  2I49 A;  2I58 A;  2OCU A;  2QS4 A;  2O6A A;  1A8E A;  2XXI A;  2B3F A;  3B7D A;  4GXA A;  1LAF E;  3MP6 A;  3FVG A;  1LGB C;  3FV2 A;  1SI0 A;  3FXU A;  2F7C A;  2REJ A;  3H7M A;  5H8H A;  1SDX A;  3IO4 A;  1QUL A;  3RT6 B;  2XX8 A;  2O7I A;  3PUW E;  2THI A;  3DEL B;  4IY5 A;  1MM6 A;  2QPQ A;  1YCJ A;  5HBC A;  4G68 B;  2QS2 A;  3SET A;  1F9B A;  5H8N A;  1H3D A;  4XXU A;  2KLF A;  3IOU A;  1SBP A;  5ELV A;  3L6G A;  4TOZ A;  3K1N A;  2FA7 A;  1PB7 A;  3QIM A;  1Y1M A;  2H25 A;  4IO7 A;  1O7T A;  4BDN A;  4MF3 A;  2XX7 A;  4KFQ A;  3PV0 E;  3MVZ A;  1BP5 A;  1UTB B;  4YB6 A;  5H8F B;  1OIB A;  5TP9 A;  4HCY A;  4R75 A;  4FIM A;  4QFO A;  5CMM A;  1EU8 A;  2I48 A;  5AA4 B;  5BUU A;  2I3V A;  1B46 A;  1ANF A;  1SW1 A;  2F6G A;  1B7U A;  1DMB A;  3KOS A;  4XKP A;  1Y3Q A;  3KFM A;  4FEC A;  3LSF B;  2VD2 A;  3EN3 A;  3ILT B;  1M5D A;  3VLU A;  3N6U A;  3O97 A;  4C1T A;  2DOJ A;  1LLS A;  3T9V A;  4FEB A;  1TFA A;  3S4U A;  4NF8 B;  4TLL B;  1LCT A;  5DT6 A;  4KQP A;  1EZ9 A;  2DXR A;  3VVF A;  1II5 A;  3QUF A;  4C1U A;  2X26 A;  1XVY A;  3G3G A;  3N94 A;  1MY2 A;  3VVD A;  2VP1 A;  4ZEI A;  3VVE A;  1D9V A;  4UA8 A;  3PMX A;  4NF6 B;  4KYE A;  5TPA A;  4THI A;  1NH8 A;  3A3U A;  4H8J A;  3KOT A;  3T9U A;  1UIU A;  2M8C A;  3K6U A;  4N6P A;  2PYY A;  1Y3P A;  4ESX A;  1S9T A;  2XXW A;  1IXI A;  1QUK A;  2ESN A;  3T9X B;  2F34 A;  5A5X B;  3K0V A;  3TEP A;  1JVX A;  1RYO A;  4XKR A;  3FJM A;  3FVO A;  5ICQ A;  2RKM A;  2X7P A;  1IXH A;  2VGQ A;  5AA3 A;  4KI0 E;  2O1L A;  4OXV A;  3K1M A;  3TYH A;  1MQI A;  1A7L A;  3C31 A;  1IIT A;  3TCG A;  2Y7R A;  3EHS A;  4WXJ A;  1M5F A;  1M5C A;  3H6V A;  3O66 A;  5I58 B;  1IZ1 A;  1NNK A;  1YPN A;  2E0S A;  4LZ8 A;  2QMW A;  5DYH A;  4AQ4 A;  1LST A;  3Q26 A;  2NWJ A;  1B52 A;  2ZXT A;  4G8M A;  1EH3 A;  3IOR A;  4OYV A;  3VXB A;  4GD5 A;  2RC8 A;  1B0H A;  3OO8 A;  4DCX A;  1B0L A;  2DWH A;  4JXI A;  4ZZA A;  3SEV A;  1ATG A;  1BTJ A;  1US5 A;  3PPN A;  4YIC A;  1NKX A;  4R2F A;  4BLA A;  2Z8E A;  3PMW A;  1UTB A;  4F2O A;  2RC9 A;  1JQF A;  2XXV A;  5ITP A;  2ZNU A;  3THI A;  4POW A;  1LCF A;  4EXK A;  1JW5 A;  3DP6 A;  4NF5 B;  1GR2 A;  4PFU A;  3WAF A;  1UQW A;  3MJN A;  4Q0C A;  3HN0 A;  1B7Z A;  4YKK A;  2PX1 A;  2ABH A;  4GL0 A;  3HHG A;  1ZBM A;  5M2V A;  3W15 C;  2HZL A;  2I0C A;  1ZJL A;  1YAE A;  2F7B A;  2ZYN A;  5AA2 D;  3USD A;  4NF8 A;  3LSX A;  4Q5T A;  3HHF A;  5J1D A;  2HFB A;  2UVJ A;  3G3F A;  4TQU Q;  1MPC A;  1VFE A;  3TAJ A;  1MS7 A;  3GXA A;  5H8S A;  3RUM A;  3S9M C;  4I62 A;  1IXG A;  2Y7W A;  4H0W A;  3IL1 B;  4HS7 A;  1SYH A;  2Y7K A;  1HSE A;  2P0S A;  3MP8 A;  5IKB A;  4OEN A;  4R9G A;  2FNC A;  2HCA A;  4DXB A;  4P0G A;  2UYE A;  3SEY A;  1MY4 A;  5CBS A;  4KD5 A;  4ELP A;  2A5S A;  1B4H A;  4FJP A;  3C34 A;  4QRZ A;  3ZKK A;  1Y9U A;  3KBR A;  3SDF A;  3HO7 A;  1FTO A;  3H06 B;  4I1D A;  3IB0 A;  2Z23 A;  1MXZ A;  3OO7 A;  5AE4 A;  3IR1 A;  5FHN A;  2F78 A;  3W9W A;  4H65 A;  3FGS A;  4QFK A;  2DQV A;  1AIV A;  2I3W A;  2F7A A;  2ZYM A;  1MG1 A;  2W7Y A;  5B70 A;  1SQY A;  4RJZ A;  3VE1 B;  1RKM A;  1B5I A;  2H98 A;  4X9T A;  2BJJ X;  3TKD A;  1PBQ A;  3U93 A;  1LFG A;  4IO2 A;  2AIX A;  1YTV A;  2NVU B;  3K2D A;  4PQJ A;  3MZ9 A;  4F3B A;  4RPO A;  3TUS A;  5B7D A;  3PUX E;  2HQ0 A;  3MUQ A;  3PU5 A;  3O6H A;  1NFT A;  4Z7E A;  1Y1Z A;  2Z22 A;  1IUD A;  3HV1 A;  4EF2 A;  1XC1 A;  1ZU0 A;  3IK6 B;  2OWS A;  3G3K A;  2NOO A;  1FQA A;  4ONY A;  4MH5 A;  4PE5 B;  2YLN A;  4JWX A;  2HAU A;  4NF5 A;  4ELQ A;  5KZT A;  1JEU A;  3ZKL A;  3O9P A;  3OXN A;  4MBP A;  4F1V A;  1SW2 A;  3FUZ A;  1HSJ A;  4WED A;  1OQG A;  3PUV E;  5EHS A;  4LZ5 A;  4ZEK A;  4OEU A;  2REG A;  4QSC A;  3TZA A;  3HPI A;  4BDM A;  2ONR A;  4R74 A;  4F22 A;  1GGG A;  3UK4 A;  4PFW A;  4ESW A;  2XXQ A;  2Y7I A;  1QVS A;  5TU0 A;  4L17 A;  2ZYO A;  3KG2 A;  4TLM B;  2VHA A;  3I6V A;  3QXM A;  4HW8 A;  4FAJ A;  4IY6 A;  3K01 A;  3CR9 A;  3MVX A;  2F97 A;  5H8Q B;  4F3P A;  1SW4 A;  3U1O A;  2A5T B;  3FAS A;  4GOT A;  3ONM A;  3IOT A;  4LA9 A;  4XTC Q;  3FJ7 A;  2RCA A;  4ZED A;  4G77 A;  1EZP A;  2OLB A;  4DDD A;  1MH3 A;  5L9M A;  4G2Z A;  3PUZ E;  4DE8 A;  1Q1K A;  2QJE A;  1B05 A;  3PPR A;  4IO4 A;  4F39 A;  2ZNS A;  3IX1 A;  3F11 A;  4YMB A;  3D4C A;  3JYR A;  1JET A;  5AA1 A;  3G7W A;  1H43 A;  2IA4 A;  3C35 A;  2OWT A;  1URD A;  4OMB A;  3G3H A;  2G29 A;  5CMB A;  2LAO A;  4DXC A;  1CB6 A;  2XXT A;  3L6H A;  5KDT B;  1DPP A;  4F18 A;  2YPN A;  1MM7 A;  4JB7 A;  4ZEF A;  4NWC A;  2RC7 A;  2O7U A;  1D9Y A;  3SER A;  2F36 A;  2HAV A;  4GQO A;  1M5B A;  1TXF A;  2PMS A;  3U72 A;  1L5T A;  5I59 B;  1B51 A;  3H3G A;  4RYA A;  1WOD A;  2P2A A;  4R2B A;  4ZS9 A;  3OOA A;  1R6Z A;  4EXL A;  3P7I A;  1MY3 A;  1QUJ A;  1AH5 A;  4F3G A;  5DEX A;  4ZEC A;  3CVG A;  3LR1 A;  5CM6 A;  4E0X A;  4QHQ A;  4R72 A;  3V8X B;  1FQE A;  3BFT A;  2UVI A;  1O64 A;  3MPL A;  3SKP A;  3PPP A;  1OVT A;  1B4Z A;  1LAX A;  3N6T A;  2ZNT A;  5I2N B;  5ISU A;  2I6E A;  3OSR A;  4OFL A;  5JTY A;  3OEL A;  3UP9 A;  2QS1 A;  1HSL A;  4YZZ A;  4GLI A;  4OHN A;  4F1Y A;  4ZE8 A;  1Z7M E;  4C0R A;  1P1O A;  3OEK A;  4BDO A;  5JEI A;  1OVB A;  3O28 A;  3G3I A;  4XKN A;  1MY1 A;  1MXY A;  1PEB A;  1VSO A;  3T66 A;  5ITO A;  3EHT A;  4LUB A;  1P1Q A;  3PD8 A;  4QSE A;  3Q28 A;  2I4C A;  2PT2 A;  3VDF A;  3E9X A;  3PUY E;  3FXQ A;  3V83 A;  2DVZ A;  4G8H A;  4EQ7 A;  5EYF A;  1UTH B;  1N7W A;  3CIJ A;  3IJO B;  3GLB A;  4QSD A;  1I69 A;  2DE2 A;  2UXA A;  2Z8F A;  3CFX A;  3IB1 A;  2A5T A;  4QFN A;  3SEU A;  1LBB A;  4MFI A;  1P1N A;  2IEE A;  3GBB A;  1B32 A;  3FZV A;  4G68 A;  4H5G A;  4OTE A;  1UIV A;  4ELR A;  3OEM A;  1SW5 A;  2Q9T A;  3KN3 A;  1B40 A;  3OO6 A;  4R73 A;  1DTZ A;  1IQ7 A;  3C32 A;  1OLC A;  2GRV A;  4R6Y A;  4OWD A;  2DXY A;  1TT1 A;  3ILU B;  2UYF A;  3W9V A;  1B3E A;  2D3I A;  4PP0 A;  2ZMB A;  5KCJ B;  1P99 A;  3C33 A;  1KWH A;  4UAC A;  2GHB A;  4OFO A;  1US4 A;  3EF7 A;  2D21 A;  4IB2 A;  3PGF A;  1S50 A;  5H8F A;  1CE2 A;  5KDT A;  3LSL A;  4G4P A;  5F7V A;  3DLN A;  1ZKB A;  1B3G A;  1I6A A;  3MQ9 A;  5AA4 A;  3MC2 A;  3I5O A;  3MPK A;  2V93 A;  1LFH A;  4U4S A;  4KCC A;  4FAT A;  1POT A;  4XKQ A;  3OO9 A;  2Y84 A;  4ZZE A;  3KZG A;  3OEN A;  2DP8 A;  3FD3 A;  3RPW A;  3UGW A;  1N3W A;  2F6P A;  3LSW A;  1MQG A;  1LB8 A;  3CRB A;  4NWD A;  4O3B A;  2XX9 A;  2OK2 A;  1NNT A;  1P1W A;  1MXV A;  2AYS A;  2QMX A;  1DSN A;  4QFL A;  3T96 B;  2H99 A;  4DLD A;  1LB9 A;  1H45 A;  1D3K A;  3ZSF A;  1ZTY A;  1QKA A;  1SD3 A;  3N5L A;  5CBR A;  1MXW A;  2Q2A A;  3Q27 A;  1NH7 A;  4IGT A;  3RLF E;  1Q35 A;  4DXU A;  2V84 A;  2PT1 A;  4G68 C;  1FCK A;  4NF6 A;  3E3K A;  4F1U A;  1USY E;  4GRK A;  3TCF A;  1URG A;  3R26 A;  4EQB A;  2DVC A;  1Y4T A;  4RXL A;  4RPN A;  3FVK A;  3DP4 A;  4JDF A;  5H8H B;  3K6W A;  1XVX A;  2HEU A;  1XOC A;  5ICT A;  1XT8 A;  4MLQ A;  3TQL A;  5FHM A;  4HTG A;  4AB5 A;  3QK6 A;  3SES A;  5A5X A;  3K1P A;  1JW4 A;  2XXX A;  3RN8 A;  1Y4C A;  2RIN A;  3K4U A;  3KN7 A;  3IOV A;  4NED A;  2DWJ A;  2I0B A;  3M3K A;  3IO6 A;  4LON B;  1N7X A;  3UOR A;  5H8N B;  5I58 A;  1VFD A;  3I3V A;  4X1B A;  4EUO A;  3B6W A;  1GVC A;  1FQD A;  4LQ5 A;  3VV5 A;  5I2K B;  5K2Y A;  2OBG A;  3TTM A;  2DYX A;  1XS5 A;  4ISU A;  5CMK A;  5TP9 B;  2CZL A;  2H9B A;  3FJG A;  1A55 A;  1AOV A;  4EQ9 A;  4DIG A;  2DE3 A;  5CI5 A;  4GIZ A;  4ELO A;  3IAZ A;  3OD7 A;  1R9L A;  3B6Q A;  1Z7N E;  3E13 X;  4AB6 A;  3ODB A;  3O6G A;  3TQW A;  3KSX A;  4NE4 A;  5L9S A;  4XIG Q;  2AL5 A;  4BDQ A;  3T22 A;  4GL8 A;  4LAT A;  2O69 A;  3TTL A;  3CFZ A;  4N07 A;  5CMC A;  3TFL A;  4NMY A;  3D4G A;  4OES A;  3BKI B;  4OQO A;  1B6H A;  3EQ1 A;  3IJX B;  4OER A;  4I8C A;  4H67 A;  2O84 X;  1AL3 A;  1I6B A;  1SVX B;  1GTK A;  4GVO A;  4U22 A;  3TCH A;  2F8D A;  3FVN A;  1IEJ A;  1POY 1;  2H5Y A;  4I9D A;  4LZ7 A;  3PD9 A;  3A3C A;  5JK4 A;  5IAI A;  5I57 B;  4JSO A;  3T9H B;  3U8Q A;  3MZB A;  3RNN A;  3VLW A;  1FQC A;  3N26 A;  2X7Q A;  3QYT A;  1BLF A;  1FTL A;  3O2A A;  4NTL A;  3HCQ A;  5FTH A;  1MRP A;  4ZE9 A;  3VXC A;  4O3A A;  4MLV A;  4WKM A;  4RNS A;  1BKA A;  5TPA B;  3ECR A;  4H1X A;  1P1U A;  3H6U A;  2QL3 A;  1B58 A;  4BDL A;  3BBR A;  2R6G E;  1ELJ A;  3KJT A;  4DZ1 A;  1ZIU A;  4H5F A;  2HXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...