1S50A

X-ray structure of the glur6 ligand binding core (s1s2a) in complex with glutamate at 1.65 a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
SNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: Molecular mechanisms underlying kainate receptor selectivity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate Receptor 6
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2004-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s50A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s50A02
2D21A 2I4BA 4HS7A 1PBPA 1FTKA 5CBSA 2RC8A 3RY3A 4JBZA 1IXHA 4QFNA 4TLMB 4XIGQ 1ZBMA 3OO6A 3O6HA 4GIZA 3SEXA 3CI8A 4ESWA 4LATA 3CSBA 2FYIA 3FVKA 3QIMA 4JWYA 5CMMA 1R1NA 5DYHA 3S2VA 1MQIA 3RT6B 3T96B 5I2NA 1KWHA 1B5IA 3TPAA 3MWBA 2HZKA 3SEYA 4WEDA 1N04A 1S50A 2HCAA 2XXUA 3K0VA 4R73A 3RTWB 4PFUA 5FTHA 4F39A 1OQGA 1FQFA 3DP8A 4EF1A 2DE2A 3F11A 3EHUA 3WAEA 1OIBA 2XXWA 4U23A 4THIA 4X9TA 2P0SA 1M5DA 2F7BA 2FNCA 3OD7A 1QW0A 3CSGA 1A8FA 4ZS9A 4H6DA 5AA4B 2DP8A 2V84A 4MLVA 4GLIA 4F3GA 3A3CA 5JEIA 5F7VA 2Z23A 1US4A 2VGQA 4RK2A 2F97A 1FQBA 4GL0A 2UYFA 4N07A 5AA2B 5ELVA 5ITOA 3FJGA 3M3FA 4R2BA 4H8IA 1LFHA 1B3HA 2AIXA 3M3KA 3Q27A 4EQ9A 4PFYA 1A7LA 1FQCA 1B4ZA 2NWJA 2ZYOA 3IX1A 1MDQA 2Y7WA 1A8EA 3B6QA 2XXXA 3FZVA 1B58A 1XC1A 2HEUA 2YPNA 1LGBC 1FQEA 1Q1KA 2I4CA 4FIMA 3PU5A 4LZ5A 4R6HA 3T9HB 3UGWA 4JSOA 4E0XA 3LSXA 2PT2A 3T22A 1Y4CA 3U8QA 1PB7A 1A55A 1LAGE 1EZPA 1Y3PA 1DTZA 3LC8A 5FHNA 4ELPA 1QUJA 4L17A 1PBQA 3PPOA 4X1BA 4GL8A 3K2DA 3RNNA 2HXWA 4TOZA 3SETA 1FQDA 2PT1A 4NF5A 2AL4A 4ELQA 1VR5A 5M2VA 5H8FA 3VFJA 2F7CA 4G8MA 3FXUA 4ISUA 3SESA 1MM7A 1H44A 3BKIB 3HPIA 4G4PA 3CVGA 1QKBA 2R6GE 5I59B 1QVSA 4EQBA 1SW1A 5I57B 3L6GA 2G29A 2ONRA 3OEMA 4OEVA 1Y9UA 1FTJA 1D3KA 1B32A 3FIRA 2ZMBA 3IL1B 4HTGA 2Q2AA 1P1OA 1Y3QA 5I2KA 3RPWA 3N26A 3MVXA 1GGGA 1XT8A 3OO8A 1URDA 2XXHA 1VFEA 4PQJA 5L9OA 3IOUA 4QSDA 2DXYA 4YICA 3N6TA 1NNPA 3H4ZA 2XX8A 2OWSA 1B0LA 3CR9A 3OOAA 3TQWA 2GH9A 3KFMA 3FATA 3N94A 4X1DA 3TUSA 1T0KA 2D5WA 3MJNA 1B51A 2O51A 3O6IA 1LCFA 1M5BA 3IB1A 2H5YA 3PUWE 4OENA 4GXAA 3Q29A 1Z7NE 2H9BA 4KI0E 4EF2A 3OENA 2V3UA 4H1XA 5J1DA 2V93A 3OXNA 4WEPA 5I2KB 3S9NC 4R9GA 3EHSA 1B1HA 3BFTA 4LUBA 3VV5A 2RF1A 1M5FA 1UTHA 2FA7A 3THIA 3I5OA 3V5AA 1MG1A 1YTVA 3EQ1A 4NE4A 4YMAA 5IAIA 3PPPA 2RCAA 3PUZE 5TP9A 4HCYA 4IO2A 4LP2B 4NWDA 1N3WA 3VLVA 2Q9TA 3MZBA 5AA3A 3E13X 4NTLA 3T9UA 1B7ZA 3JZJA 4DXCA 5I56A 4YZZA 3FVNA 1P1UA 3VXBA 2Y7RA 1Y3NA 2OZZA 3GLBA 3V83A 5H8NA 3V89B 3TDJA 5DEXA 3CIJA 3QXMA 4G77A 3ZKLA 3DELB 1DMBA 5AA1A 2OBGA 3E9XA 3IK6B 3K00A 5CMKA 2Y7IA 5F1QA 1YCJA 4POXA 1B3GA 4RK9A 3K6WA 4U4XA 3TTKA 4Q8RA 2DOJA 3O97A 4BDMA 3TEPA 1N84A 3MPKA 3K4UA 4DZ1A 3HHGA 3LSFB 2A5SA 2CMOA 1LAXA 2X7PA 3P7IA 2DVCA 3FUZA 3QAXA 4R2FA 5AA2A 5I84A 4U21A 1WODA 1MXZA 1H3DA 1RYXA 3KZGA 2O7UA 4QRZA 3VLUA 4KYEA 4RNSA 4JWOA 1MY0A 1XS5A 4UACA 4GXSB 4IY6A 4DIGA 3TCHA 2I3WA 3U92A 4NF5B 2ZYMA 4PP0A 3TMGA 1SYIA 3R6UA 1MXVA 1MQDA 5KCJA 4F1VA 5HM4B 1N7XA 2QS1A 1WVJA 3S9EA 3G3KA 2O69A 2QSXA 3SERA 4EQ7A 5A5XB 1MH3A 2ALUA 3E4RA 3H03A 5A5XA 3EHTA 3IORA 4FEBA 4MH5A 1QJMA 3GBBA 1B9JA 2Q2CA 3G3JA 3LR1A 4OYVA 5CI5A 3B7DA 3TCGA 5ICTA 4G8HA 5H8SA 1IZ1A 4YB5A 4BDOA 1MDP1 1Y1MA 4QFLA 1A40A 3W9VA 4DLDA 4KYDA 1B5JA 1LBCA 3RTFB 3S9LC 2DWHA 2F8DA 4JWXA 3USDA 3O6GA 4U2RA 1R9LA 2GRVA 3KJTA 3TTLA 2Y7KA 4F18A 1LFGA 4LVQA 4F3SA 1NNKA 3LSLA 1N76A 3PPRA 3RN8A 5TP9B 3GZGA 4BDNA 3K01A 5CMCA 5IKBA 3IO6A 2GFEA 4ZECA 4NF8B 1EU8A 2AYSA 4LQ5A 4POWA 5FHMA 1JETA 1US5A 3JV9A 1AOVA 3TTNA 1AL3A 4GD5A 1R9QA 4GQOA 4GVOA 1MQJA 1XHYA 3TAJA 1QKAA 2I6EA 4OFJA 4ECFA 2QS2A 3DM0A 3HCQA 1FTLA 3EN3A 1H43A 1FTMA 3HO7A 4U1OA 5L9SA 4NF4A 3E3KA 3RQTA 3PUYE 4F22A 1ELJA 4OWDA 5CM6A 4P11A 1HSJA 3D4GA 5L8DA 2RINA 4H5GA 5H8HB 1YAEA 4TQUQ 1TFAA 3R7XA 4OTEA 3TFLA 1L5TA 1SVXB 2REGA 4QFKA 4EUOA 1B40A 3K6UA 3PPNA 3T66A 1OVBA 4UA8A 1SYHA 2UXAA 4X48A 2RC9A 1IXGA 5LOMA 5EHMA 5BWJA 4F1YA 4G68B 4KCCA 2DWAA 4FATA 2HFBA 1I6AA 4FAJA 2XD2A 3N6UA 3RUMA 2PBWA 4LA9A 1POY1 3C34A 5DTBA 4GFRA 1JQFA 2M8CA 2QS4A 2F6PA 5B7DA 1ATGA 3C33A 4H8JA 1VE4A 2DYXA 3PD8A 3CG3A 3FVGA 4R74A 4RXLA 2Q8JA 3ONMA 3MQ9A 1PDAA 3HHFA 4BDRA 4GWOA 3ZKKA 1LBBA 1B6HA 1OLAA 1NH8A 4PE5B 1DOTA 3C36A 2O6AA 2LAOA 3UIFA 4ZE9A 4R6KA 1GR2A 3BBRA 3CRBA 1NMUA 1A99A 1B4HA 1SBPA 1USYH 3DP6A 4G68A 2O84X 4ZZEA 2VD2A 3H6WA 5DT6A 4DCYA 5AA2D 3QYTA 1ZIUA 3KN7A 1FTOA 2O7IA 4M1VA 4M4GA 4U22A 1GVCA 1P1WA 1SDXA 3TTMA 3KBRA 1XVYA 1IUDA 4G2ZA 3OSRA 3H6UA 4KYSA 1EH3A 5HBCA 4Z7EA 5EHSA 5DVFA 3VLWA 3WAFA 2I49A 3BFUA 2PMSA 3TELA 2XXPA 1FQAA 4IY5A 4YMBA 1MY4A 1A54A 1B52A 2ZYNA 3OSQA 2NOOA 4JB7A 3UN6A 2WKYA 5K2XA 1TWYA 4OVJA 4DDDA 1QUIA 5H8NB 2DQVA 4ZEIA 3UA8A 1ZLQA 2ANJA 2QS3A 3O29A 4RJZA 2DWJA 2DE3A 1B2HA 2YLNA 1MPBA 1LSTA 2HZLA 4H65A 4KQPA 4FORA 2I58A 2W7YA 3IR1A 2ESNA 1ANFA 4FE8A 1P99A 4MLQA 2AL5A 4QFOA 5TPAA 1MS7A 3RGYA 4Z0IA 2NVUB 1P1NA 2QMXA 3G3FA 4DE8A 1UTBB 3FJMA 3UK4A 2XHDA 2F34A 4OMBA 4YKPA 4EXLA 3TYHA 5I58B 1D4NA 1TT1A 1HSLA 1PC3A 3ILTB 3CFZA 3W9WA 1IQ7A 4DXBA 1LB9A 1JNFA 1WDNA 4IO6A 4ZEKA 1SI1A 2OCUA 4FECA 1RKMA 2ZYKA 3MZ1A 5I2NB 4NF4B 3PMVA 4TLLB 4U1ZA 4KR5A 2F36A 3I3VA 4ONYA 2D3IA 4OZ9A 4ZE8A 1UIUA 3IOWA 4F2OA 1Y4TA 1BTJA 1QULA 3PUVE 2XXVA 2GHBA 2GHAA 3VVFA 2H99A 4OHNA 3VE1B 2DXRA 4WKMA 2Y7PA 1UTBA 3A3UA 4H0WA 1MH4A 1CE2A 1ZU0A 2UVIA 3KOTA 1QUKA 3IJXB 5DVJA 4C1UA 5AA4A 1D9VA 3HV1A 5ICQA 3K6VA 1AMFA 4XKPA 3TZAA 1JW4A 4IGRA 2QPQA 1TFDA 4MBPA 3T93B 3DLNA 3O66A 3K6XA 2DS9A 4N13A 4OESA 1N0TA 3TKDA 4F29A 2HAUA 4Q5TA 3OEKA 3T9VA 4F2QA 4XKNA 2Z8FA 1MXYA 1B5HA 2OWTA 3H6TA 1N3XA 4PFWA 3RT8A 4ZDMA 3PMXA 3FXQA 4BDLA 2XD3A 2OJTA 4N6PA 2VP1A 4NEDA 4LZ7A 1AH5A 2A5TA 3FGSA 4NF6B 5FHOA 5JTYB 3O2AA 4EDPA 2UVGA 2IEEA 2R71A 3V8XB 1JEVA 1P1QA 4KD5A 4LONB 1MQHA 1NFTA 2OLBA 4E0WA 3S9MC 3KGCA 5DEXB 2XX7A 3U1OA 3CG1A 1N7WA 3KN3A 1SI0A 2P2AA 4IO3A 4R9FA 1AIVA 3MVYA 4H5FA 2V3TA 4OEUA 5AE4A 1XVXA 2QMWA 3VDFA 3H7MA 4BLAA 4AB5A 3MW0A 1JW1A 2H25A 2DE4A 4RPOA 4I9DA 2XXYA 3IAZA 3CFXA 1GV8A 1DPPA 4Q0CA 5KDTB 2P1SA 2E0SA 2B3FA 3S4UA 4IGTA 1ZTYA 2IA4A 3ECRA 5KDTA 3H3GA 3U94A 4AB6A 3B6WA 3IB0A 2G93A 4C0RA 2O1MA 4R72A 3IB2A 4YAHX 5I57A 5ITPA 1D9YA 2XXRA 2OK2A 4H67A 4G8NA 3I6VA 4O3CA 1B7HA 4OFLA 4I8CA 4YKKA 5TU0A 3T9XB 4ZEDA 5HPQA 5JK4A 3MUQA 3MBPA 4AQ4A 3SKPA 4DCXA 4XTCQ 2Q89A 3TQLA 4XKRA 1LAHE 5CC2A 1B0HA 1O63A 4I1DA 2CZLA 1OVTA 4QFPA 4P0IA 4R75A 3TTRA 4RA1A 4JSDA 3UORA 3G7WA 3VXCA 3PGFA 5TPAB 3G3GA 3FXRA 2UVJA 3O28A 1Y1ZA 4IO4A 4ESXA 1CB6A 1URSA 3FASA 4NF6A 5JTYA 1DTGA 2PVUA 1URGA 2X26A 1B3FA 1MXWA 2ZNSA 3KEIA 4QF9A 4O3BA 2RC7A 4F31B 5KZTA 1J1NA 1JEUA 3ILUB 1PB8A 3JYRA 4OETA 1GTKA 4R6YA 4YKJA 4ELRA 3MC2A 1I6QA 1HSEA 2O1LA 3A09A 4YU0A 2DSFA 3M8UA 4IO5A 5H8QB 4GOTA 2HQ0A 2XXQA 3IJOB 3Q28A 1NH7A 2H4IA 3Q25A 4QSCA 3K1MA 3SEWA 3C31A 3LSWA 3OMBA 1MXUA 4RPNA 5L9MA 2XXTA 1MM6A 3PV0E 1PEBA 5CBRA 1ZJLA 3DP4A 2X7QA 1B46A 4G68C 4EXKA 1JW5A 2V25A 2V3QA 1IXCA 2PYYA 2VHAA 2XX9A 3C4MA 3FV2A 2F35A 2H98A 3MP1A 1II5A 1LLSA 1VSOA 2Q88A 3MZ9A 4WXJA 3VVEA 3OO9A 1MRPA 4K3FA 5K2YA 4O3AA 2QL3A 2F5XA 3Q26A 1NNTA 3LBSA 5H8HA 4FEDA 1JVXA 4YB7A 3R26A 5ISUA 4ND9A 4ELOA 1MY3A 1MQGA 4GF8A 4KPTA 3TCFA 2ZNTA 1MY2A 2F7AA 1JVYA 1POTA 1M5CA 2I0CA 2NUVA 3H06B 1IXIA 3QSLA 1USYE 4PFTA 2ABHA 2Z8EA 4OQOA 4C1TA 2ONKE 3KOSA 2UYEA 3QK6A 1IEJA 1DPEA 3QUJA 5DVIA 3GBAA 3MAMA 1IITA 2DVZA 2NXOA 2E1SA 3FVOA 4U4SA 3N5LA 1H76A 4OXVA 2THIA 3K02A 3FD3A 3MPLA 1B7UA 4IB2A 1NNFA 3IOVA 1MY1A 3LUYA 4P0GA 1BLFA 4QHQA 5EYFA 2R9JA 3ODBA 2BJJX 3KG2A 4KHZE 3RLFE 1SW5A 2I0BA 1SW2A 2Y84A 3KSXA 4LZ8A 2B65A 4Q30B 3KN8A 4NMYA 4ZZAA 1MXXA 1MPCA 1DSNA 1LCTA 1RYOA 2A5TB 3MP6A 5I56B 3M3LA 2Z8DA 4MFIA 4RY1A 3TODA 1FCKA 2VD3A 4F3PA 1EZOA 2RCBA 4LQ2A 2ONSA 3W15C 3C32A 3MVZA 3H6VA 4JXIA 3KSJA 2KLFA 3AXFA 1SW4A 3PUXE 5CRYA 3PPQA 1EZ9A 1PB9A 1S9TA 4XKQA 1LFIA 1M5EA 3U72A 3ZS6A 2I3VA 2QRYA 1VFDA 5KCJB 5B70A 5CMBA 4F3BA 1NL5A 3U93A 4NF8A 4ZEFA 1FW0A 2HAVA 1ZMGA 3EF7A 2I48A 2ZNUA 3HSTA 3K1PA 1S7YA 1B1XA 1Q35A 1SD3A 1YPNA 3FJ7A 3KJ7A 3ZSFA 1LB8A 3SEVA 4BDQA 3SEUA 1BIYA 4F19A 1BKAA 4OFOA 1UTHB 1I6BA 2O68A 1OQHA 1UQWA 1BP5A 3FV1A 3OELA 3C9HA 3K1NA 3D4CA 5BUUA 5FTIA 3O9PA 4GRKA 3CFLA 1LAFE 1TXFA 3B6TA 4HW8A 2ZXTA 4KCDA 2DWIA 1Y20A 3EPEA 3L6HA 3SDFA 1UIVA 3HN0A 1OLCA 1H45A 1B3EA 2PX1A 3IOTA 3MP8A 3PD9A 3QUFA 1O64A 4JDFA 4QSEA 3OO7A 4YB6A 4ZEBA 1B3LA 2XXIA 3IO4A 1ZKBA 3MVWA 4FJPA 5I58A 5I59A 1NKXA 4I62A 1I69A 1MPDA 3VVDA 4PETA 4DXUA 1B05A 4F1UA 3UP9A 3C35A 3G3IA 1O7TA 2B3BA 2F6GA 2QJEA 3PMWA 1IIWA 4RYAA 3G3HA 4MF3A 2RKMA 2YJPA 1SQYA 4XXUA 1Z7ME 5H8QA 1XOCA 5H8FB 4YKIA 2REJA 2Z22A 4OERA 2UVHA 1OMPA 1F9BA 4HCWA 4KFQA 3GXAA 2F78A 4IO7A 2VOZA 1R6ZA 4NWCA
chains in the Genus database with same CATH superfamily
1FTKA 2RC8A 3RY3A 3BIGA 1NI9A 4QFNA 1ZBMA 3O6HA 4GIZA 3SEXA 3CI8A 3CSBA 4JWYA 5CMMA 2HZKA 3SEYA 2XWVA 4WEDA 1N04A 1S50A 2XXUA 3K0VA 4NHBA 4R73A 3RTWB 4F39A 4EF1A 2XA5A 1OIBA 2XXWA 4U23A 1NUXA 5ET8A 2FNCA 3OD7A 4ZS9A 4GL0A 5ELVA 3M3FA 1LFHA 4NG7A 4PFYA 3IX1A 3B6QA 3FZVA 3UK4A 1XC1A 5F7VA 1LGBC 3T9HB 4LZ5A 3LSXA 2PT2A 1NV4A 1QUJA 1PBQA 1FBHA 2PT1A 1IMAA 4NF5A 2F7CA 3FXUA 4G4PA 4JVCA 1QVSA 1SW1A 5I57B 3L6GA 2ONRA 3IL1B 2FVZA 4PQJA 1NNPA 3CR9A 3FATA 3TUSA 1B51A 3O6IA 2WBBA 1Z7NE 2V3UA 3MYUA 1FBGA 3S9NC 4LUBA 3VV5A 3THIA 1YTVA 2RCAA 3PUZE 4LP2B 3V89B 3QXMA 4GWXA 2Y7IA 4POXA 1B3GA 5F24A 4BDMA 3K4UA 5IZ3B 3FUZA 3QAXA 1MXZA 2DDKA 2O7UA 3VLUA 1XS5A 5ET5A 4GX4A 2I3WA 1SYIA 1MQDA 2ALUA 5A5XA 3IORA 4PE3A 1QJMA 4MNIA 1RDYA 5ICTA 3TCGA 3B7DA 4GWYA 3S9LC 2DWHA 3USDA 2GRVA 3KJTA 3RPLA 4LVQA 4BDNA 3IO6A 2AYSA 4P47A 1AOVA 4GBVA 1XHYA 5L9SA 4NF4A 4N81A 1ELJA 4OWDA 4P11A 5L8DA 4TQUQ 1SVXB 2REGA 3T66A 2V4CA 3K6UA 1SYHA 2RC9A 2XD2A 4LA9A 1POY1 3C34A 3C33A 1VE4A 3FVGA 3ONMA 1NH8A 1NV5A 2O6AA 2LAOA 3UIFA 1A99A 1B4HA 3DP6A 4ZZEA 1ZIUA 2O7IA 4M1VA 1XVYA 1IUDA 4KYSA 3VLWA 3LV0A 2XXPA 1FQAA 4IY5A 3OSQA 2ZYNA 2WKYA 1TWYA 1QUIA 1ZLQA 2ANJA 2QS3A 4RJZA 2DWJA 1LSTA 4KQPA 3IR1A 2ESNA 4FE8A 4MLQA 2AL5A 3RGYA 2NVUB 2QMXA 4PCDA 2XHDA 3EKIA 3TYHA 1G0IA 1IQ7A 4F2OA 1JNFA 1SI1A 2OCUA 4NF4B 4U1ZA 4ZE8A 1UIUA 2XXVA 1IMDA 1K9ZA 5DVJA 5ET7A 4XKPA 1JW4A 4DI4B 4IGRA 3DLNA 3K6XA 5I5PA 2Z8FA 2OWTA 1B5HA 3FXQA 2XD3A 4N6PA 4LZ7A 2UVGA 3V8XB 1JEVA 2OLBA 3S9MC 2XX7A 3U1OA 4R9FA 3MVYA 4AB5A 4RPOA 3IAZA 2B3FA 4IGTA 2VPNA 2IA4A 4AB6A 1EZPA 4R72A 4YKKA 5TU0A 4ZEDA 4HXVA 2Q89A 1O63A 4QFPA 4R75A 1OVTA 2WYPA 3UORA 3FXRA 1NV0A 3KC1A 5LTCA 4ESXA 1MXWA 3KEIA 4F31B 5KZTA 4NX1A 5IZZA 4OETA 1GTKA 4ELRA 2O1LA 3NOHA 3IJOB 3Q28A 5I3SA 3K1MA 1MXUA 2XXTA 3PV0E 1PEBA 4EXKA 2VHAA 4PFBA 2F35A 2H98A 1LLSA 1VSOA 2Q88A 4WXJA 3OO9A 2QL3A 4FEDA 1JVXA 5ISUA 2ZNTA 1MY2A 5DW8A 1POTA 4C1TA 2Z8EA 1IEJA 3QUJA 4JVIA 3MAMA 4GWUA 1LEVA 4O7IA 2R9JA 3ODBA 3KG2A 3RLFE 3KSXA 4LZ8A 1NV7A 4GWSA 4N8GA 5I56B 3M3LA 2KQZA 1FCKA 2VD3A 2VT5A 2ONSA 2FHYA 1SW4A 5CRYA 4XKQA 2I3VA 1NV6A 3EF7A 2PCRA 3HSTA 3K1PA 1S7YA 3SEVA 1UTHB 1I6BA 2O68A 1OQHA 4N17A 1LAFE 1TXFA 3B6TA 4MIJA 1Y20A 3HN0A 1B3EA 4ZEBA 4QSEA 5I58A 4I62A 1MPDA 3VVDA 2F6GA 1SQYA 2HHMA 4MNCA 5H8QA 5H8FB 1F9BA 3GXAA 1LBXA 1R6ZA 3RPWA 2I4BA 1PBPA 5CBSA 4ESWA 3FVKA 1MQIA 3RT6B 1B5IA 1OQGA 3DP8A 4PDDA 3WAEA 4AS5A 1FPKA 1QW0A 1A8FA 5AA4B 4H6DA 2V84A 5JEIA 1DK4A 1IMBA 2Z23A 2QVVA 4RK2A 5ITOA 3FJGA 2AIXA 3M3KA 1A7LA 1MDQA 2B4MA 1A8EA 1B58A 5I59A 2YPNA 2I4CA 3PU5A 3UGWA 4JSOA 1PB7A 5EYGA 4X1BA 4GL8A 3K2DA 2B4LA 3SETA 1FQDA 5H8FA 5M2VA 1QKBA 2G29A 4OEVA 1FTJA 1D3KA 1Y9UA 1B32A 2Q2AA 5I2KA 1GGGA 3OO8A 1VFEA 1YZ0A 4QSDA 3H4ZA 3OOAA 1T0KA 1LCFA 3IB1A 3PUWE 1FPIA 3Q29A 2H9BA 4KI0E 5J1DA 3OENA 3OXNA 4WEPA 3EHSA 2MKZA 1UTHA 1INPA 1VDWA 5IAIA 4YMAA 1XI6A 4P9KA 3PPPA 5TP9A 4IO2A 4NWDA 4O7MA 2Y5KA 3T9UA 4DXCA 5I56A 4YZZA 3FVNA 2Y7RA 3V83A 5H8NA 1NV3A 3E9XA 3IK6B 3K00A 4HE1A 4I3YA 1YCJA 4PGPA 1EYKA 3TEPA 1N84A 2A5SA 2CMOA 3P7IA 2DVCA 1RYXA 1H3DA 1MY0A 4GXSB 5KCJA 3GYYA 4GX6A 1N7XA 2QS1A 1WVJA 5HM4B 4PFRA 3S9EA 2QSXA 3E4RA 3H03A 2Q8MA 3EHTA 4OYVA 4MH5A 1B9JA 2Q2CA 3G3JA 5CI5A 5H8SA 1IZ1A 4YB5A 4BDOA 1MDP1 1Y1MA 4QFLA 1B5JA 3RTFB 2F8DA 4JWXA 3K01A 5CMCA 4POWA 1EU8A 1US5A 3TTNA 1AL3A 5AE4A 1MQJA 1QKAA 2QS2A 4U1OA 3HO7A 1RDZA 3RQTA 3D4GA 2RINA 2XWOA 3R7XA 1FPLA 3TFLA 1B40A 3PPNA 1OVBA 2XWIA 3D1RA 3CHGA 2UXAA 5LOMA 4FATA 2HFBA 1I6AA 2P3VA 3RUMA 2CZHA 5DTBA 1SPIA 1G0HA 2F6PA 5B7DA 4R74A 2DYXA 2XXKA 1PDAA 4P8BA 4GWOA 4BDRA 1LBBA 4PE5B 1GR2A 1NMUA 1GVCA 3KN7A 4N8YA 4XEQA 5HBCA 4Z7EA 1EH3A 3WAFA 2I49A 2PMSA 1MY4A 3UN6A 5ESYA 2NOOA 5K2XA 2CEYA 4OVJA 3UA8A 1MPBA 4NAPA 4I3EA 2F3DA 1ANFA 3FJMA 4YKPA 5I58B 3ILTB 3CFZA 4ZEKA 1RKMA 3SZPA 2F36A 2D3IA 4PC9A 1LBZA 5EQ7A 1FBFA 4OHNA 1LBVA 3A3UA 1MH4A 1CE2A 1ZU0A 3KOTA 3IJXB 5AA4A 1D9VA 3O66A 4N13A 4F29A 4MJOA 3T9VA 2OX3A 4PFWA 4NEDA 4NF6B 3FGSA 5JTYB 4EDPA 2R71A 4OVTA 1P1QA 4KD5A 1N7WA 5J16A 3QMFA 2V3TA 1XVXA 3VDFA 4BLAA 2DE4A 1YXIA 2XXYA 1GV8A 4Q0CA 5KDTB 2P1SA 3S4UA 1ZTYA 3U94A 3B6WA 4C0RA 4YAHX 1D9YA 3T9XB 3I6VA 5JK4A 5HPQA 3SKPA 4MX6A 1B0HA 3TTRA 3G3GA 1CB6A 2PVUA 2WEFA 4QF9A 4O3BA 2RC7A 3ILUB 3JYRA 4YU0A 1HSEA 3M8UA 4HE2A 4NGUA 3LSWA 4RPNA 5L9MA 1MM6A 5CBRA 5IZ3A 1B46A 4G68C 3C4MA 3VVEA 3MZ9A 5K2YA 4MNPA 2F5XA 5H8HA 4YB7A 1MY3A 1MQGA 4KPTA 1JVYA 3QSLA 2UYEA 1IITA 2E1SA 3N5LA 4OXVA 3K02A 3MPLA 1B7UA 4IB2A 1NNFA 3IOVA 3LUYA 1BLFA 2BJJX 1SW5A 2I0BA 2Y84A 1DSNA 1LCTA 4RY1A 3TODA 4F3PA 2RCBA 4LQ2A 2F3BA 3PUXE 1EZ9A 3U72A 3ZS6A 1LFIA 2QRYA 5KCJB 5CMBA 1NL5A 4ZEFA 1FW0A 2I48A 2ZNUA 3FV1A 3C9HA 5EQ9A 5BUUA 5FTIA 4GRKA 3MP8A 1K9YA 3IOTA 3QUFA 3OO7A 1FPDA 2XXIA 3MVWA 1ZKBA 4DXUA 4PETA 1B05A 4F1UA 3G3IA 3PMWA 4X04A 1IIWA 4RYAA 2YJPA 4XXUA 2XWKA 4YKIA 2REJA 2Z22A 4IO7A 2F78A 2BJIA 1IXHA 4TLMB 4XIGQ 3OO6A 2FYIA 5I2NA 1R1NA 5DYHA 1FPEA 1KWHA 3TPAA 3MWBA 4JVDA 2HCAA 5FTHA 2DE2A 3EHUA 2PFZA 4THIA 4X9TA 2P0SA 3CSGA 3KC0A 2DP8A 4MLVA 4F3GA 3A3CA 5AA2B 1FQBA 4H8IA 1FQCA 2ZYOA 4N6DA 2XXXA 2CEXA 4F2QA 1FQEA 4R6HA 1NUZA 4E0XA 2QFLA 3T22A 1Y4CA 1LAGE 3LC8A 1DTZA 5FHNA 4PBHA 4XF5A 4MMPA 2HXWA 4TOZA 2AL4A 3ISPA 4ELQA 3VFJA 4G8MA 4ISUA 1H44A 5I59B 3CVGA 2R6GE 4EQBA 3FIRA 2ZMBA 4HTGA 1NV2A 1P1OA 1Y3QA 3N26A 2XXHA 5L9OA 2DXYA 4YICA 3N6TA 1B0LA 3TQWA 2GH9A 3KFMA 2ZZWA 2D5WA 3MJNA 2CZIA 1FBPA 4EF2A 2V93A 4R9GA 1IMFA 1B1HA 3BFTA 2RF1A 5ET6A 3I5OA 1MG1A 4P3LA 2P3NA 4DI3D 4NTLA 1B7ZA 3JZJA 4OVPA 3VXBA 1Y3NA 3GLBA 5DEXA 3DELB 4QXDA 4H46A 5CMKA 2FIEA 4RK9A 3TTKA 4Q8RA 4PAIA 4DZ1A 3HHGA 2X7PA 5AA2A 4QRZA 4RNSA 4JWOA 4PBQA 4PGNA 4PP0A 1AWBA 4F1VA 3T0JA 3G3KA 2O69A 3SERA 5A5XB 1MH3A 4FEBA 3GBBA 3LR1A 1NUYA 4G8HA 4P56A 4MAGA 4DLDA 4IR8A 4U2RA 1R9LA 3TTLA 2Y7KA 4F18A 1NNKA 3LSLA 1N76A 3PPRA 3RN8A 5IKBA 3E78A 2GFEA 4ZECA 4NF8B 4LQ5A 5FHMA 4GVOA 1R9QA 2I6EA 4ECFA 4OFJA 3DM0A 3EN3A 1H43A 3E3KA 4O94A 3PUYE 1HSJA 5H8HB 1YAEA 1TFAA 3ROJA 4HE0A 4XFEA 1IXGA 5EHMA 4G68B 4KCCA 2DWAA 1JP4A 2PBWA 4X8RA 4GFRA 1JQFA 2M8CA 2QS4A 1ATGA 4H8JA 1B6HA 1OLAA 1DOTA 4R6KA 4EQ7A 2O84X 4DCYA 1IMCA 5AA2D 3QYTA 1FTOA 4U22A 4G2ZA 4GBWA 3H6UA 5DVFA 3BFUA 3TELA 4YMBA 4DDDA 3O29A 2R8TA 2DE3A 2YLNA 2HZLA 4H65A 1P99A 1MS7A 4DE8A 3G3FA 4OVSA 4OMBA 4EXLA 1D4NA 1CNQA 5H8NB 4IO6A 4FECA 2ZYKA 5I2NB 4TLLB 3I3VA 4ONYA 4OZ9A 1Y4TA 1BTJA 1QULA 2JJKA 3PUVE 4P1LA 2GHBA 2GHAA 3VVFA 2H99A 1YYZA 2DXRA 4NF0A 4WKMA 2Y7PA 1UTBA 3HV1A 1BK4A 1FBEA 4MBPA 1DBZA 3HFUA 3T93B 5LDZA 4OESA 3TKDA 2HAUA 4Q5TA 3OEKA 1MXYA 3E79A 1KZ8A 2OJTA 3A29A 2VP1A 5FHOA 2A5TA 1MQHA 3KGCA 3CG1A 2P2AA 4OEUA 2QMWA 3H7MA 3MW0A 1JW1A 2H25A 4I9DA 1DPPA 2E0SA 2G93A 5ITPA 2XXRA 4H67A 4G8NA 4AS4A 3MBPA 4XTCQ 3TQLA 4XKRA 1IMEA 5CC2A 1FPGA 2CZLA 4JSDA 3G7WA 3O28A 4I40A 4NF6A 5JTYA 1URGA 1B3FA 1FJ9A 4R6YA 4KXPA 4OVRA 3A09A 2DSFA 4IO5A 1Q9DA 4N91A 2HQ0A 1NH7A 2H4IA 3Q25A 3SEWA 3C31A 3OMBA 1NUWA 1ZJLA 1JW5A 2V25A 2V3QA 2WYKA 2XX9A 3FV2A 3MP1A 1QGXA 4K3FA 4O3AA 1NNTA 4ND9A 4GF8A 2I0CA 1M5CA 2NUVA 3H06B 2VPOA 1USYE 3KOSA 1DPEA 3GBAA 4MCOA 4U4SA 1H76A 2CZKA 2THIA 2L5VA 3FD3A 4P0GA 1MY1A 4LN5A 4Q30B 5I7IA 3KN8A 4MHFA 2WX9A 1RYOA 3MP6A 2Z8DA 1EZOA 5IZ1A 3C32A 2FIXA 3MVZA 3H6VA 4JXIA 3KSJA 4PTKA 3AXFA 5B70A 1FRPA 2FBPA 2HAVA 1ZMGA 1YPNA 1LB8A 3SEUA 1BIYA 4F19A 4OFOA 1UQWA 1BP5A 3K1NA 3D4CA 3O9PA 3CFLA 2QVUA 2ZXTA 4NN3A 2DWIA 3SDFA 3EPEA 4KFQA 1H45A 2PX1A 4JDFA 1O64A 4FJPA 4PF8A 1LBWA 3C35A 1O7TA 4MF3A 2RKMA 1Z7ME 4HCWA 4NWCA 2D21A 4HS7A 3LUZA 4JBZA 4LATA 3QIMA 3S2VA 3IFAA 4OVQA 3T96B 4GWZA 4PFUA 1FQFA 3F11A 1FPJA 1M5DA 2F7BA 4GLIA 1US4A 2VGQA 2F97A 4N07A 1FPBA 2UYFA 4R2BA 1B3HA 3Q27A 4EQ9A 1B4ZA 2NWJA 2Y7WA 2HEUA 1Q1KA 4FIMA 4H45A 3U8QA 2OWZA 1A55A 1Y3PA 4ELPA 5FBPA 4L17A 3PPOA 3RNNA 1VR5A 4N15A 3SESA 1MM7A 3BKIB 3HPIA 4P1EA 3OEMA 3MVXA 1XT8A 1URDA 3IOUA 5EQ8A 2XX8A 2OWSA 3N94A 4X1DA 2O51A 1M5BA 2Y5LA 2H5YA 4OENA 1RDXA 4GXAA 4H1XA 5I2KB 1M5FA 2FA7A 3V5AA 4NE4A 3EQ1A 4HCYA 1N3WA 3VLVA 2Q9TA 3MZBA 5AA3A 3E13X 1P1UA 2OZZA 2Q74A 3TDJA 3CIJA 4G77A 4PF6A 5EYHA 3ZKLA 5AA1A 1DMBA 2OBGA 5F1QA 3K6WA 4U4XA 2DOJA 3O97A 3MPKA 3LSFB 2QVRA 1LAXA 4R2FA 5I84A 4U21A 1WODA 3KZGA 4KYEA 4UACA 4IY6A 4DIGA 3TCHA 3U92A 4NF5B 2ZYMA 3TMGA 3R6UA 1MXVA 3KBZA 3T1BA 1A40A 3W9VA 4KYDA 1LBCA 3O6GA 4F3SA 1LFGA 5TP9B 3GZGA 1JETA 3JV9A 4GD5A 4GQOA 3TAJA 3HCQA 1FTLA 1FTMA 5CM6A 4F22A 3RYDA 4PDHA 4H5GA 4OTEA 1L5TA 4QFKA 4EUOA 4UA8A 4X48A 4PAFA 5BWJA 4F1YA 4GWWA 4FAJA 3N6UA 4NQ8A 3PD8A 4N4UA 4RXLA 3CG3A 2Q8JA 1EYIA 3MQ9A 3HHFA 3ZKKA 3C36A 4ZE9A 3BBRA 3CRBA 3MSTA 1SBPA 3BIHA 1USYH 4G68A 2VD2A 3H6WA 4G61A 5DT6A 4M4GA 3TTMA 1P1WA 1SDXA 1D9QA 3KBRA 3PTYA 3OSRA 5EHSA 1A54A 1B52A 4JB7A 2DQVA 4ZEIA 4PAKA 1B2HA 4FORA 2I58A 2W7YA 1KA1A 1FSAA 5TPAA 4QFOA 4Z0IA 1P1NA 1UTBB 1LBYA 2F34A 1TT1A 1HSLA 1PC3A 1KA0A 3W9WA 4DXBA 1LB9A 1WDNA 5T3JA 2HXRA 3MZ1A 3PMVA 4KR5A 1FTAA 3IOWA 3VE1B 4H0WA 2UVIA 1QUKA 4C1UA 5ICQA 3K6VA 1AMFA 3FXBA 2HPGA 3TZAA 2QPQA 1TFDA 2DS9A 1N0TA 5EQAA 1FBCA 4XKNA 3H6TA 1N3XA 3RT8A 4ZDMA 3PMXA 4BDLA 1AH5A 3O2AA 2IEEA 4LONB 1NFTA 4E0WA 5DEXB 3KN3A 1SI0A 4IO3A 1AIVA 4H5FA 3CFXA 5IGAA 5KDTA 1DCUA 3ECRA 3H3GA 3IB0A 2O1MA 3U65A 3IB2A 5I57A 2OK2A 4O3CA 1B7HA 4OFLA 4I8CA 3MUQA 4MEVA 4AQ4A 4DCXA 1LAHE 4I1DA 4P0IA 4RA1A 4OA4A 3VXCA 3PGFA 5TPAB 2UVJA 1Y1ZA 4IO4A 3FASA 1URSA 1DTGA 2X26A 2ZNSA 4O8MA 1J1NA 1JEUA 1PB8A 4YKJA 3MC2A 1I6QA 2KR0A 5H8QB 4GOTA 2XXQA 4QSCA 3DP4A 2X7QA 1IXCA 2PYYA 3B8BA 1II5A 1FJ6A 3FBPA 1MRPA 4N6KA 4UABA 3Q26A 3LBSA 3R26A 4ELOA 3TCFA 2F7AA 4PFTA 1IXIA 2ABHA 4FBPA 4OQOA 2ONKE 3QK6A 5DVIA 2DVZA 2NXOA 3FVOA 4QBAA 2ZZXA 3B50A 4QHQA 5EYFA 4KHZE 2GQ1A 1SW2A 4ZZAA 5A5LA 2B65A 4NMYA 1MXXA 1MPCA 2A5TB 2PFYA 4MFIA 3W15C 1FBDA 2KLFA 3PPQA 1S9TA 1PB9A 1M5EA 1VFDA 4F3BA 3U93A 4NF8A 3IFCA 5IM2A 1B1XA 1Q35A 1SD3A 3FJ7A 3KJ7A 3ZSFA 2ZZVA 4BDQA 1EYJA 1BKAA 3OELA 1NV1A 1FPFA 4HW8A 4KCDA 3L6HA 1UIVA 1OLCA 3PD9A 4YB6A 1B3LA 3IO4A 1NKXA 1I69A 3UP9A 2B3BA 2QJEA 3G3HA 1XOCA 4GX3A 4OERA 2WBDA 3RPLB 2UVHA 1OMPA 4PFIA 2VOZA 4OANA
chains in the Genus database with same CATH topology
2D21A 2I4BA 4HS7A 1PBPA 1FTKA 5CBSA 2RC8A 3RY3A 4JBZA 1IXHA 4QFNA 4TLMB 4XIGQ 1ZBMA 3OO6A 3O6HA 4GIZA 3SEXA 3CI8A 4ESWA 4LATA 3CSBA 2FYIA 3FVKA 3QIMA 4JWYA 5CMMA 1R1NA 5DYHA 3S2VA 1MQIA 3RT6B 3T96B 5I2NA 1KWHA 1B5IA 3TPAA 3MWBA 2HZKA 3SEYA 4WEDA 1N04A 1S50A 2HCAA 2XXUA 3K0VA 4R73A 3RTWB 4PFUA 5FTHA 4F39A 1OQGA 1FQFA 3DP8A 4EF1A 2DE2A 3F11A 3EHUA 3WAEA 1OIBA 2XXWA 4U23A 4THIA 4X9TA 2P0SA 1M5DA 2F7BA 2FNCA 3OD7A 1QW0A 3CSGA 1A8FA 4ZS9A 4H6DA 5AA4B 2DP8A 2V84A 4MLVA 4GLIA 4F3GA 3A3CA 5JEIA 5F7VA 2Z23A 1US4A 2VGQA 4RK2A 2F97A 1FQBA 4GL0A 2UYFA 4N07A 5AA2B 5ELVA 5ITOA 3FJGA 3M3FA 4R2BA 4H8IA 1LFHA 1B3HA 2AIXA 3M3KA 3Q27A 4EQ9A 4PFYA 1A7LA 1FQCA 1B4ZA 2NWJA 2ZYOA 3IX1A 1MDQA 2Y7WA 1A8EA 3B6QA 2XXXA 3FZVA 1B58A 1XC1A 2HEUA 2YPNA 1LGBC 1FQEA 1Q1KA 2I4CA 4FIMA 3PU5A 4LZ5A 4R6HA 3T9HB 3UGWA 4JSOA 4E0XA 3LSXA 2PT2A 3T22A 1Y4CA 3U8QA 1PB7A 1A55A 1LAGE 1EZPA 1Y3PA 1DTZA 3LC8A 5FHNA 4ELPA 1QUJA 4L17A 1PBQA 3PPOA 4X1BA 4GL8A 3K2DA 3RNNA 2HXWA 4TOZA 3SETA 1FQDA 2PT1A 4NF5A 2AL4A 4ELQA 1VR5A 5M2VA 5H8FA 3VFJA 2F7CA 4G8MA 3FXUA 4ISUA 3SESA 1MM7A 1H44A 3BKIB 3HPIA 4G4PA 3CVGA 1QKBA 2R6GE 5I59B 1QVSA 4EQBA 1SW1A 5I57B 3L6GA 2G29A 2ONRA 3OEMA 4OEVA 1Y9UA 1FTJA 1D3KA 1B32A 3FIRA 2ZMBA 3IL1B 4HTGA 2Q2AA 1P1OA 1Y3QA 5I2KA 3RPWA 3N26A 3MVXA 1GGGA 1XT8A 3OO8A 1URDA 2XXHA 1VFEA 4PQJA 5L9OA 3IOUA 4QSDA 2DXYA 4YICA 3N6TA 1NNPA 3H4ZA 2XX8A 2OWSA 1B0LA 3CR9A 3OOAA 3TQWA 2GH9A 3KFMA 3FATA 3N94A 4X1DA 3TUSA 1T0KA 2D5WA 3MJNA 1B51A 2O51A 3O6IA 1LCFA 1M5BA 3IB1A 2H5YA 3PUWE 4OENA 4GXAA 3Q29A 1Z7NE 2H9BA 4KI0E 4EF2A 3OENA 2V3UA 4H1XA 5J1DA 2V93A 3OXNA 4WEPA 5I2KB 3S9NC 4R9GA 3EHSA 1B1HA 3BFTA 4LUBA 3VV5A 2RF1A 1M5FA 1UTHA 2FA7A 3THIA 3I5OA 3V5AA 1MG1A 1YTVA 3EQ1A 4NE4A 4YMAA 5IAIA 3PPPA 2RCAA 3PUZE 5TP9A 4HCYA 4IO2A 4LP2B 4NWDA 1N3WA 3VLVA 2Q9TA 3MZBA 5AA3A 3E13X 4NTLA 3T9UA 1B7ZA 3JZJA 4DXCA 5I56A 4YZZA 3FVNA 1P1UA 3VXBA 2Y7RA 1Y3NA 2OZZA 3GLBA 3V83A 5H8NA 3V89B 3TDJA 5DEXA 3CIJA 3QXMA 4G77A 3ZKLA 3DELB 1DMBA 5AA1A 2OBGA 3E9XA 3IK6B 3K00A 5CMKA 2Y7IA 5F1QA 1YCJA 4POXA 1B3GA 4RK9A 3K6WA 4U4XA 3TTKA 4Q8RA 2DOJA 3O97A 4BDMA 3TEPA 1N84A 3MPKA 3K4UA 4DZ1A 3HHGA 3LSFB 2A5SA 2CMOA 1LAXA 2X7PA 3P7IA 2DVCA 3FUZA 3QAXA 4R2FA 5AA2A 5I84A 4U21A 1WODA 1MXZA 1H3DA 1RYXA 3KZGA 2O7UA 4QRZA 3VLUA 4KYEA 4RNSA 4JWOA 1MY0A 1XS5A 4UACA 4GXSB 4IY6A 4DIGA 3TCHA 2I3WA 3U92A 4NF5B 2ZYMA 4PP0A 3TMGA 1SYIA 3R6UA 1MXVA 1MQDA 5KCJA 4F1VA 5HM4B 1N7XA 2QS1A 1WVJA 3S9EA 3G3KA 2O69A 2QSXA 3SERA 4EQ7A 5A5XB 1MH3A 2ALUA 3E4RA 3H03A 5A5XA 3EHTA 3IORA 4FEBA 4MH5A 1QJMA 3GBBA 1B9JA 2Q2CA 3G3JA 3LR1A 4OYVA 5CI5A 3B7DA 3TCGA 5ICTA 4G8HA 5H8SA 1IZ1A 4YB5A 4BDOA 1MDP1 1Y1MA 4QFLA 1A40A 3W9VA 4DLDA 4KYDA 1B5JA 1LBCA 3RTFB 3S9LC 2DWHA 2F8DA 4JWXA 3USDA 3O6GA 4U2RA 1R9LA 2GRVA 3KJTA 3TTLA 2Y7KA 4F18A 1LFGA 4LVQA 4F3SA 1NNKA 3LSLA 1N76A 3PPRA 3RN8A 5TP9B 3GZGA 4BDNA 3K01A 5CMCA 5IKBA 3IO6A 2GFEA 4ZECA 4NF8B 1EU8A 2AYSA 4LQ5A 4POWA 5FHMA 1JETA 1US5A 3JV9A 1AOVA 3TTNA 1AL3A 4GD5A 1R9QA 4GQOA 4GVOA 1MQJA 1XHYA 3TAJA 1QKAA 2I6EA 4OFJA 4ECFA 2QS2A 3DM0A 3HCQA 1FTLA 3EN3A 1H43A 1FTMA 3HO7A 4U1OA 5L9SA 4NF4A 3E3KA 3RQTA 3PUYE 4F22A 1ELJA 4OWDA 5CM6A 4P11A 1HSJA 3D4GA 5L8DA 2RINA 4H5GA 5H8HB 1YAEA 4TQUQ 1TFAA 3R7XA 4OTEA 3TFLA 1L5TA 1SVXB 2REGA 4QFKA 4EUOA 1B40A 3K6UA 3PPNA 3T66A 1OVBA 4UA8A 1SYHA 2UXAA 4X48A 2RC9A 1IXGA 5LOMA 5EHMA 5BWJA 4F1YA 4G68B 4KCCA 2DWAA 4FATA 2HFBA 1I6AA 4FAJA 2XD2A 3N6UA 3RUMA 2PBWA 4LA9A 1POY1 3C34A 5DTBA 4GFRA 1JQFA 2M8CA 2QS4A 2F6PA 5B7DA 1ATGA 3C33A 4H8JA 1VE4A 2DYXA 3PD8A 3CG3A 3FVGA 4R74A 4RXLA 2Q8JA 3ONMA 3MQ9A 1PDAA 3HHFA 4BDRA 4GWOA 3ZKKA 1LBBA 1B6HA 1OLAA 1NH8A 4PE5B 1DOTA 3C36A 2O6AA 2LAOA 3UIFA 4ZE9A 4R6KA 1GR2A 3BBRA 3CRBA 1NMUA 1A99A 1B4HA 1SBPA 1USYH 3DP6A 4G68A 2O84X 4ZZEA 2VD2A 3H6WA 5DT6A 4DCYA 5AA2D 3QYTA 1ZIUA 3KN7A 1FTOA 2O7IA 4M1VA 4M4GA 4U22A 1GVCA 1P1WA 1SDXA 3TTMA 3KBRA 1XVYA 1IUDA 4G2ZA 3OSRA 3H6UA 4KYSA 1EH3A 5HBCA 4Z7EA 5EHSA 5DVFA 3VLWA 3WAFA 2I49A 3BFUA 2PMSA 3TELA 2XXPA 1FQAA 4IY5A 4YMBA 1MY4A 1A54A 1B52A 2ZYNA 3OSQA 2NOOA 4JB7A 3UN6A 2WKYA 5K2XA 1TWYA 4OVJA 4DDDA 1QUIA 5H8NB 2DQVA 4ZEIA 3UA8A 1ZLQA 2ANJA 2QS3A 3O29A 4RJZA 2DWJA 2DE3A 1B2HA 2YLNA 1MPBA 1LSTA 2HZLA 4H65A 4KQPA 4FORA 2I58A 2W7YA 3IR1A 2ESNA 1ANFA 4FE8A 1P99A 4MLQA 2AL5A 4QFOA 5TPAA 1MS7A 3RGYA 4Z0IA 2NVUB 1P1NA 2QMXA 3G3FA 4DE8A 1UTBB 3FJMA 3UK4A 2XHDA 2F34A 4OMBA 4YKPA 4EXLA 3TYHA 5I58B 1D4NA 1TT1A 1HSLA 1PC3A 3ILTB 3CFZA 3W9WA 1IQ7A 4DXBA 1LB9A 1JNFA 1WDNA 4IO6A 4ZEKA 1SI1A 2OCUA 4FECA 1RKMA 2ZYKA 3MZ1A 5I2NB 4NF4B 3PMVA 4TLLB 4U1ZA 4KR5A 2F36A 3I3VA 4ONYA 2D3IA 4OZ9A 4ZE8A 1UIUA 3IOWA 4F2OA 1Y4TA 1BTJA 1QULA 3PUVE 2XXVA 2GHBA 2GHAA 3VVFA 2H99A 4OHNA 3VE1B 2DXRA 4WKMA 2Y7PA 1UTBA 3A3UA 4H0WA 1MH4A 1CE2A 1ZU0A 2UVIA 3KOTA 1QUKA 3IJXB 5DVJA 4C1UA 5AA4A 1D9VA 3HV1A 5ICQA 3K6VA 1AMFA 4XKPA 3TZAA 1JW4A 4IGRA 2QPQA 1TFDA 4MBPA 3T93B 3DLNA 3O66A 3K6XA 2DS9A 4N13A 4OESA 1N0TA 3TKDA 4F29A 2HAUA 4Q5TA 3OEKA 3T9VA 4F2QA 4XKNA 2Z8FA 1MXYA 1B5HA 2OWTA 3H6TA 1N3XA 4PFWA 3RT8A 4ZDMA 3PMXA 3FXQA 4BDLA 2XD3A 2OJTA 4N6PA 2VP1A 4NEDA 4LZ7A 1AH5A 2A5TA 3FGSA 4NF6B 5FHOA 5JTYB 3O2AA 4EDPA 2UVGA 2IEEA 2R71A 3V8XB 1JEVA 1P1QA 4KD5A 4LONB 1MQHA 1NFTA 2OLBA 4E0WA 3S9MC 3KGCA 5DEXB 2XX7A 3U1OA 3CG1A 1N7WA 3KN3A 1SI0A 2P2AA 4IO3A 4R9FA 1AIVA 3MVYA 4H5FA 2V3TA 4OEUA 5AE4A 1XVXA 2QMWA 3VDFA 3H7MA 4BLAA 4AB5A 3MW0A 1JW1A 2H25A 2DE4A 4RPOA 4I9DA 2XXYA 3IAZA 3CFXA 1GV8A 1DPPA 4Q0CA 5KDTB 2P1SA 2E0SA 2B3FA 3S4UA 4IGTA 1ZTYA 2IA4A 3ECRA 5KDTA 3H3GA 3U94A 4AB6A 3B6WA 3IB0A 2G93A 4C0RA 2O1MA 4R72A 3IB2A 4YAHX 5I57A 5ITPA 1D9YA 2XXRA 2OK2A 4H67A 4G8NA 3I6VA 4O3CA 1B7HA 4OFLA 4I8CA 4YKKA 5TU0A 3T9XB 4ZEDA 5HPQA 5JK4A 3MUQA 3MBPA 4AQ4A 3SKPA 4DCXA 4XTCQ 2Q89A 3TQLA 4XKRA 1LAHE 5CC2A 1B0HA 1O63A 4I1DA 2CZLA 1OVTA 4QFPA 4P0IA 4R75A 3TTRA 4RA1A 4JSDA 3UORA 3G7WA 3VXCA 3PGFA 5TPAB 3G3GA 3FXRA 2UVJA 3O28A 1Y1ZA 4IO4A 4ESXA 1CB6A 1URSA 3FASA 4NF6A 5JTYA 1DTGA 2PVUA 1URGA 2X26A 1B3FA 1MXWA 2ZNSA 3KEIA 4QF9A 4O3BA 2RC7A 4F31B 5KZTA 1J1NA 1JEUA 3ILUB 1PB8A 3JYRA 4OETA 1GTKA 4R6YA 4YKJA 4ELRA 3MC2A 1I6QA 1HSEA 2O1LA 3A09A 4YU0A 2DSFA 3M8UA 4IO5A 5H8QB 4GOTA 2HQ0A 2XXQA 3IJOB 3Q28A 1NH7A 2H4IA 3Q25A 4QSCA 3K1MA 3SEWA 3C31A 3LSWA 3OMBA 1MXUA 4RPNA 5L9MA 2XXTA 1MM6A 3PV0E 1PEBA 5CBRA 1ZJLA 3DP4A 2X7QA 1B46A 4G68C 4EXKA 1JW5A 2V25A 2V3QA 1IXCA 2PYYA 2VHAA 2XX9A 3C4MA 3FV2A 2F35A 2H98A 3MP1A 1II5A 1LLSA 1VSOA 2Q88A 3MZ9A 4WXJA 3VVEA 3OO9A 1MRPA 4K3FA 5K2YA 4O3AA 2QL3A 2F5XA 3Q26A 1NNTA 3LBSA 5H8HA 4FEDA 1JVXA 4YB7A 3R26A 5ISUA 4ND9A 4ELOA 1MY3A 1MQGA 4GF8A 4KPTA 3TCFA 2ZNTA 1MY2A 2F7AA 1JVYA 1POTA 1M5CA 2I0CA 2NUVA 3H06B 1IXIA 3QSLA 1USYE 4PFTA 2ABHA 2Z8EA 4OQOA 4C1TA 2ONKE 3KOSA 2UYEA 3QK6A 1IEJA 1DPEA 3QUJA 5DVIA 3GBAA 3MAMA 1IITA 2DVZA 2NXOA 2E1SA 3FVOA 4U4SA 3N5LA 1H76A 4OXVA 2THIA 3K02A 3FD3A 3MPLA 1B7UA 4IB2A 1NNFA 3IOVA 1MY1A 3LUYA 4P0GA 1BLFA 4QHQA 5EYFA 2R9JA 3ODBA 2BJJX 3KG2A 4KHZE 3RLFE 1SW5A 2I0BA 1SW2A 2Y84A 3KSXA 4LZ8A 2B65A 4Q30B 3KN8A 4NMYA 4ZZAA 1MXXA 1MPCA 1DSNA 1LCTA 1RYOA 2A5TB 3MP6A 5I56B 3M3LA 2Z8DA 4MFIA 4RY1A 3TODA 1FCKA 2VD3A 4F3PA 1EZOA 2RCBA 4LQ2A 2ONSA 3W15C 3C32A 3MVZA 3H6VA 4JXIA 3KSJA 2KLFA 3AXFA 1SW4A 3PUXE 5CRYA 3PPQA 1EZ9A 1PB9A 1S9TA 4XKQA 1LFIA 1M5EA 3U72A 3ZS6A 2I3VA 2QRYA 1VFDA 5KCJB 5B70A 5CMBA 4F3BA 1NL5A 3U93A 4NF8A 4ZEFA 1FW0A 2HAVA 1ZMGA 3EF7A 2I48A 2ZNUA 3HSTA 3K1PA 1S7YA 1B1XA 1Q35A 1SD3A 1YPNA 3FJ7A 3KJ7A 3ZSFA 1LB8A 3SEVA 4BDQA 3SEUA 1BIYA 4F19A 1BKAA 4OFOA 1UTHB 1I6BA 2O68A 1OQHA 1UQWA 1BP5A 3FV1A 3OELA 3C9HA 3K1NA 3D4CA 5BUUA 5FTIA 3O9PA 4GRKA 3CFLA 1LAFE 1TXFA 3B6TA 4HW8A 2ZXTA 4KCDA 2DWIA 1Y20A 3EPEA 3L6HA 3SDFA 1UIVA 3HN0A 1OLCA 1H45A 1B3EA 2PX1A 3IOTA 3MP8A 3PD9A 3QUFA 1O64A 4JDFA 4QSEA 3OO7A 4YB6A 4ZEBA 1B3LA 2XXIA 3IO4A 1ZKBA 3MVWA 4FJPA 5I58A 5I59A 1NKXA 4I62A 1I69A 1MPDA 3VVDA 4PETA 4DXUA 1B05A 4F1UA 3UP9A 3C35A 3G3IA 1O7TA 2B3BA 2F6GA 2QJEA 3PMWA 1IIWA 4RYAA 3G3HA 4MF3A 2RKMA 2YJPA 1SQYA 4XXUA 1Z7ME 5H8QA 1XOCA 5H8FB 4YKIA 2REJA 2Z22A 4OERA 2UVHA 1OMPA 1F9BA 4HCWA 4KFQA 3GXAA 2F78A 4IO7A 2VOZA 1R6ZA 4NWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D21 A;  2I4B A;  4HS7 A;  1PBP A;  1FTK A;  5CBS A;  2RC8 A;  3RY3 A;  4JBZ A;  1IXH A;  4QFN A;  4TLM B;  4XIG Q;  1ZBM A;  3OO6 A;  3O6H A;  4GIZ A;  3SEX A;  3CI8 A;  4ESW A;  4LAT A;  3CSB A;  2FYI A;  3FVK A;  3QIM A;  4JWY A;  5CMM A;  1R1N A;  5DYH A;  3S2V A;  1MQI A;  3RT6 B;  3T96 B;  5I2N A;  1KWH A;  1B5I A;  3TPA A;  3MWB A;  2HZK A;  3SEY A;  4WED A;  1N04 A;  1S50 A;  2HCA A;  2XXU A;  3K0V A;  4R73 A;  3RTW B;  4PFU A;  5FTH A;  4F39 A;  1OQG A;  1FQF A;  3DP8 A;  4EF1 A;  2DE2 A;  3F11 A;  3EHU A;  3WAE A;  1OIB A;  2XXW A;  4U23 A;  4THI A;  4X9T A;  2P0S A;  1M5D A;  2F7B A;  2FNC A;  3OD7 A;  1QW0 A;  3CSG A;  1A8F A;  4ZS9 A;  4H6D A;  5AA4 B;  2DP8 A;  2V84 A;  4MLV A;  4GLI A;  4F3G A;  3A3C A;  5JEI A;  5F7V A;  2Z23 A;  1US4 A;  2VGQ A;  4RK2 A;  2F97 A;  1FQB A;  4GL0 A;  2UYF A;  4N07 A;  5AA2 B;  5ELV A;  5ITO A;  3FJG A;  3M3F A;  4R2B A;  4H8I A;  1LFH A;  1B3H A;  2AIX A;  3M3K A;  3Q27 A;  4EQ9 A;  4PFY A;  1A7L A;  1FQC A;  1B4Z A;  2NWJ A;  2ZYO A;  3IX1 A;  1MDQ A;  2Y7W A;  1A8E A;  3B6Q A;  2XXX A;  3FZV A;  1B58 A;  1XC1 A;  2HEU A;  2YPN A;  1LGB C;  1FQE A;  1Q1K A;  2I4C A;  4FIM A;  3PU5 A;  4LZ5 A;  4R6H A;  3T9H B;  3UGW A;  4JSO A;  4E0X A;  3LSX A;  2PT2 A;  3T22 A;  1Y4C A;  3U8Q A;  1PB7 A;  1A55 A;  1LAG E;  1EZP A;  1Y3P A;  1DTZ A;  3LC8 A;  5FHN A;  4ELP A;  1QUJ A;  4L17 A;  1PBQ A;  3PPO A;  4X1B A;  4GL8 A;  3K2D A;  3RNN A;  2HXW A;  4TOZ A;  3SET A;  1FQD A;  2PT1 A;  4NF5 A;  2AL4 A;  4ELQ A;  1VR5 A;  5M2V A;  5H8F A;  3VFJ A;  2F7C A;  4G8M A;  3FXU A;  4ISU A;  3SES A;  1MM7 A;  1H44 A;  3BKI B;  3HPI A;  4G4P A;  3CVG A;  1QKB A;  2R6G E;  5I59 B;  1QVS A;  4EQB A;  1SW1 A;  5I57 B;  3L6G A;  2G29 A;  2ONR A;  3OEM A;  4OEV A;  1Y9U A;  1FTJ A;  1D3K A;  1B32 A;  3FIR A;  2ZMB A;  3IL1 B;  4HTG A;  2Q2A A;  1P1O A;  1Y3Q A;  5I2K A;  3RPW A;  3N26 A;  3MVX A;  1GGG A;  1XT8 A;  3OO8 A;  1URD A;  2XXH A;  1VFE A;  4PQJ A;  5L9O A;  3IOU A;  4QSD A;  2DXY A;  4YIC A;  3N6T A;  1NNP A;  3H4Z A;  2XX8 A;  2OWS A;  1B0L A;  3CR9 A;  3OOA A;  3TQW A;  2GH9 A;  3KFM A;  3FAT A;  3N94 A;  4X1D A;  3TUS A;  1T0K A;  2D5W A;  3MJN A;  1B51 A;  2O51 A;  3O6I A;  1LCF A;  1M5B A;  3IB1 A;  2H5Y A;  3PUW E;  4OEN A;  4GXA A;  3Q29 A;  1Z7N E;  2H9B A;  4KI0 E;  4EF2 A;  3OEN A;  2V3U A;  4H1X A;  5J1D A;  2V93 A;  3OXN A;  4WEP A;  5I2K B;  3S9N C;  4R9G A;  3EHS A;  1B1H A;  3BFT A;  4LUB A;  3VV5 A;  2RF1 A;  1M5F A;  1UTH A;  2FA7 A;  3THI A;  3I5O A;  3V5A A;  1MG1 A;  1YTV A;  3EQ1 A;  4NE4 A;  4YMA A;  5IAI A;  3PPP A;  2RCA A;  3PUZ E;  5TP9 A;  4HCY A;  4IO2 A;  4LP2 B;  4NWD A;  1N3W A;  3VLV A;  2Q9T A;  3MZB A;  5AA3 A;  3E13 X;  4NTL A;  3T9U A;  1B7Z A;  3JZJ A;  4DXC A;  5I56 A;  4YZZ A;  3FVN A;  1P1U A;  3VXB A;  2Y7R A;  1Y3N A;  2OZZ A;  3GLB A;  3V83 A;  5H8N A;  3V89 B;  3TDJ A;  5DEX A;  3CIJ A;  3QXM A;  4G77 A;  3ZKL A;  3DEL B;  1DMB A;  5AA1 A;  2OBG A;  3E9X A;  3IK6 B;  3K00 A;  5CMK A;  2Y7I A;  5F1Q A;  1YCJ A;  4POX A;  1B3G A;  4RK9 A;  3K6W A;  4U4X A;  3TTK A;  4Q8R A;  2DOJ A;  3O97 A;  4BDM A;  3TEP A;  1N84 A;  3MPK A;  3K4U A;  4DZ1 A;  3HHG A;  3LSF B;  2A5S A;  2CMO A;  1LAX A;  2X7P A;  3P7I A;  2DVC A;  3FUZ A;  3QAX A;  4R2F A;  5AA2 A;  5I84 A;  4U21 A;  1WOD A;  1MXZ A;  1H3D A;  1RYX A;  3KZG A;  2O7U A;  4QRZ A;  3VLU A;  4KYE A;  4RNS A;  4JWO A;  1MY0 A;  1XS5 A;  4UAC A;  4GXS B;  4IY6 A;  4DIG A;  3TCH A;  2I3W A;  3U92 A;  4NF5 B;  2ZYM A;  4PP0 A;  3TMG A;  1SYI A;  3R6U A;  1MXV A;  1MQD A;  5KCJ A;  4F1V A;  5HM4 B;  1N7X A;  2QS1 A;  1WVJ A;  3S9E A;  3G3K A;  2O69 A;  2QSX A;  3SER A;  4EQ7 A;  5A5X B;  1MH3 A;  2ALU A;  3E4R A;  3H03 A;  5A5X A;  3EHT A;  3IOR A;  4FEB A;  4MH5 A;  1QJM A;  3GBB A;  1B9J A;  2Q2C A;  3G3J A;  3LR1 A;  4OYV A;  5CI5 A;  3B7D A;  3TCG A;  5ICT A;  4G8H A;  5H8S A;  1IZ1 A;  4YB5 A;  4BDO A;  1MDP 1;  1Y1M A;  4QFL A;  1A40 A;  3W9V A;  4DLD A;  4KYD A;  1B5J A;  1LBC A;  3RTF B;  3S9L C;  2DWH A;  2F8D A;  4JWX A;  3USD A;  3O6G A;  4U2R A;  1R9L A;  2GRV A;  3KJT A;  3TTL A;  2Y7K A;  4F18 A;  1LFG A;  4LVQ A;  4F3S A;  1NNK A;  3LSL A;  1N76 A;  3PPR A;  3RN8 A;  5TP9 B;  3GZG A;  4BDN A;  3K01 A;  5CMC A;  5IKB A;  3IO6 A;  2GFE A;  4ZEC A;  4NF8 B;  1EU8 A;  2AYS A;  4LQ5 A;  4POW A;  5FHM A;  1JET A;  1US5 A;  3JV9 A;  1AOV A;  3TTN A;  1AL3 A;  4GD5 A;  1R9Q A;  4GQO A;  4GVO A;  1MQJ A;  1XHY A;  3TAJ A;  1QKA A;  2I6E A;  4OFJ A;  4ECF A;  2QS2 A;  3DM0 A;  3HCQ A;  1FTL A;  3EN3 A;  1H43 A;  1FTM A;  3HO7 A;  4U1O A;  5L9S A;  4NF4 A;  3E3K A;  3RQT A;  3PUY E;  4F22 A;  1ELJ A;  4OWD A;  5CM6 A;  4P11 A;  1HSJ A;  3D4G A;  5L8D A;  2RIN A;  4H5G A;  5H8H B;  1YAE A;  4TQU Q;  1TFA A;  3R7X A;  4OTE A;  3TFL A;  1L5T A;  1SVX B;  2REG A;  4QFK A;  4EUO A;  1B40 A;  3K6U A;  3PPN A;  3T66 A;  1OVB A;  4UA8 A;  1SYH A;  2UXA A;  4X48 A;  2RC9 A;  1IXG A;  5LOM A;  5EHM A;  5BWJ A;  4F1Y A;  4G68 B;  4KCC A;  2DWA A;  4FAT A;  2HFB A;  1I6A A;  4FAJ A;  2XD2 A;  3N6U A;  3RUM A;  2PBW A;  4LA9 A;  1POY 1;  3C34 A;  5DTB A;  4GFR A;  1JQF A;  2M8C A;  2QS4 A;  2F6P A;  5B7D A;  1ATG A;  3C33 A;  4H8J A;  1VE4 A;  2DYX A;  3PD8 A;  3CG3 A;  3FVG A;  4R74 A;  4RXL A;  2Q8J A;  3ONM A;  3MQ9 A;  1PDA A;  3HHF A;  4BDR A;  4GWO A;  3ZKK A;  1LBB A;  1B6H A;  1OLA A;  1NH8 A;  4PE5 B;  1DOT A;  3C36 A;  2O6A A;  2LAO A;  3UIF A;  4ZE9 A;  4R6K A;  1GR2 A;  3BBR A;  3CRB A;  1NMU A;  1A99 A;  1B4H A;  1SBP A;  1USY H;  3DP6 A;  4G68 A;  2O84 X;  4ZZE A;  2VD2 A;  3H6W A;  5DT6 A;  4DCY A;  5AA2 D;  3QYT A;  1ZIU A;  3KN7 A;  1FTO A;  2O7I A;  4M1V A;  4M4G A;  4U22 A;  1GVC A;  1P1W A;  1SDX A;  3TTM A;  3KBR A;  1XVY A;  1IUD A;  4G2Z A;  3OSR A;  3H6U A;  4KYS A;  1EH3 A;  5HBC A;  4Z7E A;  5EHS A;  5DVF A;  3VLW A;  3WAF A;  2I49 A;  3BFU A;  2PMS A;  3TEL A;  2XXP A;  1FQA A;  4IY5 A;  4YMB A;  1MY4 A;  1A54 A;  1B52 A;  2ZYN A;  3OSQ A;  2NOO A;  4JB7 A;  3UN6 A;  2WKY A;  5K2X A;  1TWY A;  4OVJ A;  4DDD A;  1QUI A;  5H8N B;  2DQV A;  4ZEI A;  3UA8 A;  1ZLQ A;  2ANJ A;  2QS3 A;  3O29 A;  4RJZ A;  2DWJ A;  2DE3 A;  1B2H A;  2YLN A;  1MPB A;  1LST A;  2HZL A;  4H65 A;  4KQP A;  4FOR A;  2I58 A;  2W7Y A;  3IR1 A;  2ESN A;  1ANF A;  4FE8 A;  1P99 A;  4MLQ A;  2AL5 A;  4QFO A;  5TPA A;  1MS7 A;  3RGY A;  4Z0I A;  2NVU B;  1P1N A;  2QMX A;  3G3F A;  4DE8 A;  1UTB B;  3FJM A;  3UK4 A;  2XHD A;  2F34 A;  4OMB A;  4YKP A;  4EXL A;  3TYH A;  5I58 B;  1D4N A;  1TT1 A;  1HSL A;  1PC3 A;  3ILT B;  3CFZ A;  3W9W A;  1IQ7 A;  4DXB A;  1LB9 A;  1JNF A;  1WDN A;  4IO6 A;  4ZEK A;  1SI1 A;  2OCU A;  4FEC A;  1RKM A;  2ZYK A;  3MZ1 A;  5I2N B;  4NF4 B;  3PMV A;  4TLL B;  4U1Z A;  4KR5 A;  2F36 A;  3I3V A;  4ONY A;  2D3I A;  4OZ9 A;  4ZE8 A;  1UIU A;  3IOW A;  4F2O A;  1Y4T A;  1BTJ A;  1QUL A;  3PUV E;  2XXV A;  2GHB A;  2GHA A;  3VVF A;  2H99 A;  4OHN A;  3VE1 B;  2DXR A;  4WKM A;  2Y7P A;  1UTB A;  3A3U A;  4H0W A;  1MH4 A;  1CE2 A;  1ZU0 A;  2UVI A;  3KOT A;  1QUK A;  3IJX B;  5DVJ A;  4C1U A;  5AA4 A;  1D9V A;  3HV1 A;  5ICQ A;  3K6V A;  1AMF A;  4XKP A;  3TZA A;  1JW4 A;  4IGR A;  2QPQ A;  1TFD A;  4MBP A;  3T93 B;  3DLN A;  3O66 A;  3K6X A;  2DS9 A;  4N13 A;  4OES A;  1N0T A;  3TKD A;  4F29 A;  2HAU A;  4Q5T A;  3OEK A;  3T9V A;  4F2Q A;  4XKN A;  2Z8F A;  1MXY A;  1B5H A;  2OWT A;  3H6T A;  1N3X A;  4PFW A;  3RT8 A;  4ZDM A;  3PMX A;  3FXQ A;  4BDL A;  2XD3 A;  2OJT A;  4N6P A;  2VP1 A;  4NED A;  4LZ7 A;  1AH5 A;  2A5T A;  3FGS A;  4NF6 B;  5FHO A;  5JTY B;  3O2A A;  4EDP A;  2UVG A;  2IEE A;  2R71 A;  3V8X B;  1JEV A;  1P1Q A;  4KD5 A;  4LON B;  1MQH A;  1NFT A;  2OLB A;  4E0W A;  3S9M C;  3KGC A;  5DEX B;  2XX7 A;  3U1O A;  3CG1 A;  1N7W A;  3KN3 A;  1SI0 A;  2P2A A;  4IO3 A;  4R9F A;  1AIV A;  3MVY A;  4H5F A;  2V3T A;  4OEU A;  5AE4 A;  1XVX A;  2QMW A;  3VDF A;  3H7M A;  4BLA A;  4AB5 A;  3MW0 A;  1JW1 A;  2H25 A;  2DE4 A;  4RPO A;  4I9D A;  2XXY A;  3IAZ A;  3CFX A;  1GV8 A;  1DPP A;  4Q0C A;  5KDT B;  2P1S A;  2E0S A;  2B3F A;  3S4U A;  4IGT A;  1ZTY A;  2IA4 A;  3ECR A;  5KDT A;  3H3G A;  3U94 A;  4AB6 A;  3B6W A;  3IB0 A;  2G93 A;  4C0R A;  2O1M A;  4R72 A;  3IB2 A;  4YAH X;  5I57 A;  5ITP A;  1D9Y A;  2XXR A;  2OK2 A;  4H67 A;  4G8N A;  3I6V A;  4O3C A;  1B7H A;  4OFL A;  4I8C A;  4YKK A;  5TU0 A;  3T9X B;  4ZED A;  5HPQ A;  5JK4 A;  3MUQ A;  3MBP A;  4AQ4 A;  3SKP A;  4DCX A;  4XTC Q;  2Q89 A;  3TQL A;  4XKR A;  1LAH E;  5CC2 A;  1B0H A;  1O63 A;  4I1D A;  2CZL A;  1OVT A;  4QFP A;  4P0I A;  4R75 A;  3TTR A;  4RA1 A;  4JSD A;  3UOR A;  3G7W A;  3VXC A;  3PGF A;  5TPA B;  3G3G A;  3FXR A;  2UVJ A;  3O28 A;  1Y1Z A;  4IO4 A;  4ESX A;  1CB6 A;  1URS A;  3FAS A;  4NF6 A;  5JTY A;  1DTG A;  2PVU A;  1URG A;  2X26 A;  1B3F A;  1MXW A;  2ZNS A;  3KEI A;  4QF9 A;  4O3B A;  2RC7 A;  4F31 B;  5KZT A;  1J1N A;  1JEU A;  3ILU B;  1PB8 A;  3JYR A;  4OET A;  1GTK A;  4R6Y A;  4YKJ A;  4ELR A;  3MC2 A;  1I6Q A;  1HSE A;  2O1L A;  3A09 A;  4YU0 A;  2DSF A;  3M8U A;  4IO5 A;  5H8Q B;  4GOT A;  2HQ0 A;  2XXQ A;  3IJO B;  3Q28 A;  1NH7 A;  2H4I A;  3Q25 A;  4QSC A;  3K1M A;  3SEW A;  3C31 A;  3LSW A;  3OMB A;  1MXU A;  4RPN A;  5L9M A;  2XXT A;  1MM6 A;  3PV0 E;  1PEB A;  5CBR A;  1ZJL A;  3DP4 A;  2X7Q A;  1B46 A;  4G68 C;  4EXK A;  1JW5 A;  2V25 A;  2V3Q A;  1IXC A;  2PYY A;  2VHA A;  2XX9 A;  3C4M A;  3FV2 A;  2F35 A;  2H98 A;  3MP1 A;  1II5 A;  1LLS A;  1VSO A;  2Q88 A;  3MZ9 A;  4WXJ A;  3VVE A;  3OO9 A;  1MRP A;  4K3F A;  5K2Y A;  4O3A A;  2QL3 A;  2F5X A;  3Q26 A;  1NNT A;  3LBS A;  5H8H A;  4FED A;  1JVX A;  4YB7 A;  3R26 A;  5ISU A;  4ND9 A;  4ELO A;  1MY3 A;  1MQG A;  4GF8 A;  4KPT A;  3TCF A;  2ZNT A;  1MY2 A;  2F7A A;  1JVY A;  1POT A;  1M5C A;  2I0C A;  2NUV A;  3H06 B;  1IXI A;  3QSL A;  1USY E;  4PFT A;  2ABH A;  2Z8E A;  4OQO A;  4C1T A;  2ONK E;  3KOS A;  2UYE A;  3QK6 A;  1IEJ A;  1DPE A;  3QUJ A;  5DVI A;  3GBA A;  3MAM A;  1IIT A;  2DVZ A;  2NXO A;  2E1S A;  3FVO A;  4U4S A;  3N5L A;  1H76 A;  4OXV A;  2THI A;  3K02 A;  3FD3 A;  3MPL A;  1B7U A;  4IB2 A;  1NNF A;  3IOV A;  1MY1 A;  3LUY A;  4P0G A;  1BLF A;  4QHQ A;  5EYF A;  2R9J A;  3ODB A;  2BJJ X;  3KG2 A;  4KHZ E;  3RLF E;  1SW5 A;  2I0B A;  1SW2 A;  2Y84 A;  3KSX A;  4LZ8 A;  2B65 A;  4Q30 B;  3KN8 A;  4NMY A;  4ZZA A;  1MXX A;  1MPC A;  1DSN A;  1LCT A;  1RYO A;  2A5T B;  3MP6 A;  5I56 B;  3M3L A;  2Z8D A;  4MFI A;  4RY1 A;  3TOD A;  1FCK A;  2VD3 A;  4F3P A;  1EZO A;  2RCB A;  4LQ2 A;  2ONS A;  3W15 C;  3C32 A;  3MVZ A;  3H6V A;  4JXI A;  3KSJ A;  2KLF A;  3AXF A;  1SW4 A;  3PUX E;  5CRY A;  3PPQ A;  1EZ9 A;  1PB9 A;  1S9T A;  4XKQ A;  1LFI A;  1M5E A;  3U72 A;  3ZS6 A;  2I3V A;  2QRY A;  1VFD A;  5KCJ B;  5B70 A;  5CMB A;  4F3B A;  1NL5 A;  3U93 A;  4NF8 A;  4ZEF A;  1FW0 A;  2HAV A;  1ZMG A;  3EF7 A;  2I48 A;  2ZNU A;  3HST A;  3K1P A;  1S7Y A;  1B1X A;  1Q35 A;  1SD3 A;  1YPN A;  3FJ7 A;  3KJ7 A;  3ZSF A;  1LB8 A;  3SEV A;  4BDQ A;  3SEU A;  1BIY A;  4F19 A;  1BKA A;  4OFO A;  1UTH B;  1I6B A;  2O68 A;  1OQH A;  1UQW A;  1BP5 A;  3FV1 A;  3OEL A;  3C9H A;  3K1N A;  3D4C A;  5BUU A;  5FTI A;  3O9P A;  4GRK A;  3CFL A;  1LAF E;  1TXF A;  3B6T A;  4HW8 A;  2ZXT A;  4KCD A;  2DWI A;  1Y20 A;  3EPE A;  3L6H A;  3SDF A;  1UIV A;  3HN0 A;  1OLC A;  1H45 A;  1B3E A;  2PX1 A;  3IOT A;  3MP8 A;  3PD9 A;  3QUF A;  1O64 A;  4JDF A;  4QSE A;  3OO7 A;  4YB6 A;  4ZEB A;  1B3L A;  2XXI A;  3IO4 A;  1ZKB A;  3MVW A;  4FJP A;  5I58 A;  5I59 A;  1NKX A;  4I62 A;  1I69 A;  1MPD A;  3VVD A;  4PET A;  4DXU A;  1B05 A;  4F1U A;  3UP9 A;  3C35 A;  3G3I A;  1O7T A;  2B3B A;  2F6G A;  2QJE A;  3PMW A;  1IIW A;  4RYA A;  3G3H A;  4MF3 A;  2RKM A;  2YJP A;  1SQY A;  4XXU A;  1Z7M E;  5H8Q A;  1XOC A;  5H8F B;  4YKI A;  2REJ A;  2Z22 A;  4OER A;  2UVH A;  1OMP A;  1F9B A;  4HCW A;  4KFQ A;  3GXA A;  2F78 A;  4IO7 A;  2VOZ A;  1R6Z A;  4NWC A; 
#chains in the Genus database with same CATH topology
 1FTK A;  2RC8 A;  3RY3 A;  3BIG A;  1NI9 A;  4QFN A;  1ZBM A;  3O6H A;  4GIZ A;  3SEX A;  3CI8 A;  3CSB A;  4JWY A;  5CMM A;  2HZK A;  3SEY A;  2XWV A;  4WED A;  1N04 A;  1S50 A;  2XXU A;  3K0V A;  4NHB A;  4R73 A;  3RTW B;  4F39 A;  4EF1 A;  2XA5 A;  1OIB A;  2XXW A;  4U23 A;  1NUX A;  5ET8 A;  2FNC A;  3OD7 A;  4ZS9 A;  4GL0 A;  5ELV A;  3M3F A;  1LFH A;  4NG7 A;  4PFY A;  3IX1 A;  3B6Q A;  3FZV A;  3UK4 A;  1XC1 A;  5F7V A;  1LGB C;  3T9H B;  4LZ5 A;  3LSX A;  2PT2 A;  1NV4 A;  1QUJ A;  1PBQ A;  1FBH A;  2PT1 A;  1IMA A;  4NF5 A;  2F7C A;  3FXU A;  4G4P A;  4JVC A;  1QVS A;  1SW1 A;  5I57 B;  3L6G A;  2ONR A;  3IL1 B;  2FVZ A;  4PQJ A;  1NNP A;  3CR9 A;  3FAT A;  3TUS A;  1B51 A;  3O6I A;  2WBB A;  1Z7N E;  2V3U A;  3MYU A;  1FBG A;  3S9N C;  4LUB A;  3VV5 A;  3THI A;  1YTV A;  2RCA A;  3PUZ E;  4LP2 B;  3V89 B;  3QXM A;  4GWX A;  2Y7I A;  4POX A;  1B3G A;  5F24 A;  4BDM A;  3K4U A;  5IZ3 B;  3FUZ A;  3QAX A;  1MXZ A;  2DDK A;  2O7U A;  3VLU A;  1XS5 A;  5ET5 A;  4GX4 A;  2I3W A;  1SYI A;  1MQD A;  2ALU A;  5A5X A;  3IOR A;  4PE3 A;  1QJM A;  4MNI A;  1RDY A;  5ICT A;  3TCG A;  3B7D A;  4GWY A;  3S9L C;  2DWH A;  3USD A;  2GRV A;  3KJT A;  3RPL A;  4LVQ A;  4BDN A;  3IO6 A;  2AYS A;  4P47 A;  1AOV A;  4GBV A;  1XHY A;  5L9S A;  4NF4 A;  4N81 A;  1ELJ A;  4OWD A;  4P11 A;  5L8D A;  4TQU Q;  1SVX B;  2REG A;  3T66 A;  2V4C A;  3K6U A;  1SYH A;  2RC9 A;  2XD2 A;  4LA9 A;  1POY 1;  3C34 A;  3C33 A;  1VE4 A;  3FVG A;  3ONM A;  1NH8 A;  1NV5 A;  2O6A A;  2LAO A;  3UIF A;  1A99 A;  1B4H A;  3DP6 A;  4ZZE A;  1ZIU A;  2O7I A;  4M1V A;  1XVY A;  1IUD A;  4KYS A;  3VLW A;  3LV0 A;  2XXP A;  1FQA A;  4IY5 A;  3OSQ A;  2ZYN A;  2WKY A;  1TWY A;  1QUI A;  1ZLQ A;  2ANJ A;  2QS3 A;  4RJZ A;  2DWJ A;  1LST A;  4KQP A;  3IR1 A;  2ESN A;  4FE8 A;  4MLQ A;  2AL5 A;  3RGY A;  2NVU B;  2QMX A;  4PCD A;  2XHD A;  3EKI A;  3TYH A;  1G0I A;  1IQ7 A;  4F2O A;  1JNF A;  1SI1 A;  2OCU A;  4NF4 B;  4U1Z A;  4ZE8 A;  1UIU A;  2XXV A;  1IMD A;  1K9Z A;  5DVJ A;  5ET7 A;  4XKP A;  1JW4 A;  4DI4 B;  4IGR A;  3DLN A;  3K6X A;  5I5P A;  2Z8F A;  2OWT A;  1B5H A;  3FXQ A;  2XD3 A;  4N6P A;  4LZ7 A;  2UVG A;  3V8X B;  1JEV A;  2OLB A;  3S9M C;  2XX7 A;  3U1O A;  4R9F A;  3MVY A;  4AB5 A;  4RPO A;  3IAZ A;  2B3F A;  4IGT A;  2VPN A;  2IA4 A;  4AB6 A;  1EZP A;  4R72 A;  4YKK A;  5TU0 A;  4ZED A;  4HXV A;  2Q89 A;  1O63 A;  4QFP A;  4R75 A;  1OVT A;  2WYP A;  3UOR A;  3FXR A;  1NV0 A;  3KC1 A;  5LTC A;  4ESX A;  1MXW A;  3KEI A;  4F31 B;  5KZT A;  4NX1 A;  5IZZ A;  4OET A;  1GTK A;  4ELR A;  2O1L A;  3NOH A;  3IJO B;  3Q28 A;  5I3S A;  3K1M A;  1MXU A;  2XXT A;  3PV0 E;  1PEB A;  4EXK A;  2VHA A;  4PFB A;  2F35 A;  2H98 A;  1LLS A;  1VSO A;  2Q88 A;  4WXJ A;  3OO9 A;  2QL3 A;  4FED A;  1JVX A;  5ISU A;  2ZNT A;  1MY2 A;  5DW8 A;  1POT A;  4C1T A;  2Z8E A;  1IEJ A;  3QUJ A;  4JVI A;  3MAM A;  4GWU A;  1LEV A;  4O7I A;  2R9J A;  3ODB A;  3KG2 A;  3RLF E;  3KSX A;  4LZ8 A;  1NV7 A;  4GWS A;  4N8G A;  5I56 B;  3M3L A;  2KQZ A;  1FCK A;  2VD3 A;  2VT5 A;  2ONS A;  2FHY A;  1SW4 A;  5CRY A;  4XKQ A;  2I3V A;  1NV6 A;  3EF7 A;  2PCR A;  3HST A;  3K1P A;  1S7Y A;  3SEV A;  1UTH B;  1I6B A;  2O68 A;  1OQH A;  4N17 A;  1LAF E;  1TXF A;  3B6T A;  4MIJ A;  1Y20 A;  3HN0 A;  1B3E A;  4ZEB A;  4QSE A;  5I58 A;  4I62 A;  1MPD A;  3VVD A;  2F6G A;  1SQY A;  2HHM A;  4MNC A;  5H8Q A;  5H8F B;  1F9B A;  3GXA A;  1LBX A;  1R6Z A;  3RPW A;  2I4B A;  1PBP A;  5CBS A;  4ESW A;  3FVK A;  1MQI A;  3RT6 B;  1B5I A;  1OQG A;  3DP8 A;  4PDD A;  3WAE A;  4AS5 A;  1FPK A;  1QW0 A;  1A8F A;  5AA4 B;  4H6D A;  2V84 A;  5JEI A;  1DK4 A;  1IMB A;  2Z23 A;  2QVV A;  4RK2 A;  5ITO A;  3FJG A;  2AIX A;  3M3K A;  1A7L A;  1MDQ A;  2B4M A;  1A8E A;  1B58 A;  5I59 A;  2YPN A;  2I4C A;  3PU5 A;  3UGW A;  4JSO A;  1PB7 A;  5EYG A;  4X1B A;  4GL8 A;  3K2D A;  2B4L A;  3SET A;  1FQD A;  5H8F A;  5M2V A;  1QKB A;  2G29 A;  4OEV A;  1FTJ A;  1D3K A;  1Y9U A;  1B32 A;  2Q2A A;  5I2K A;  1GGG A;  3OO8 A;  1VFE A;  1YZ0 A;  4QSD A;  3H4Z A;  3OOA A;  1T0K A;  1LCF A;  3IB1 A;  3PUW E;  1FPI A;  3Q29 A;  2H9B A;  4KI0 E;  5J1D A;  3OEN A;  3OXN A;  4WEP A;  3EHS A;  2MKZ A;  1UTH A;  1INP A;  1VDW A;  5IAI A;  4YMA A;  1XI6 A;  4P9K A;  3PPP A;  5TP9 A;  4IO2 A;  4NWD A;  4O7M A;  2Y5K A;  3T9U A;  4DXC A;  5I56 A;  4YZZ A;  3FVN A;  2Y7R A;  3V83 A;  5H8N A;  1NV3 A;  3E9X A;  3IK6 B;  3K00 A;  4HE1 A;  4I3Y A;  1YCJ A;  4PGP A;  1EYK A;  3TEP A;  1N84 A;  2A5S A;  2CMO A;  3P7I A;  2DVC A;  1RYX A;  1H3D A;  1MY0 A;  4GXS B;  5KCJ A;  3GYY A;  4GX6 A;  1N7X A;  2QS1 A;  1WVJ A;  5HM4 B;  4PFR A;  3S9E A;  2QSX A;  3E4R A;  3H03 A;  2Q8M A;  3EHT A;  4OYV A;  4MH5 A;  1B9J A;  2Q2C A;  3G3J A;  5CI5 A;  5H8S A;  1IZ1 A;  4YB5 A;  4BDO A;  1MDP 1;  1Y1M A;  4QFL A;  1B5J A;  3RTF B;  2F8D A;  4JWX A;  3K01 A;  5CMC A;  4POW A;  1EU8 A;  1US5 A;  3TTN A;  1AL3 A;  5AE4 A;  1MQJ A;  1QKA A;  2QS2 A;  4U1O A;  3HO7 A;  1RDZ A;  3RQT A;  3D4G A;  2RIN A;  2XWO A;  3R7X A;  1FPL A;  3TFL A;  1B40 A;  3PPN A;  1OVB A;  2XWI A;  3D1R A;  3CHG A;  2UXA A;  5LOM A;  4FAT A;  2HFB A;  1I6A A;  2P3V A;  3RUM A;  2CZH A;  5DTB A;  1SPI A;  1G0H A;  2F6P A;  5B7D A;  4R74 A;  2DYX A;  2XXK A;  1PDA A;  4P8B A;  4GWO A;  4BDR A;  1LBB A;  4PE5 B;  1GR2 A;  1NMU A;  1GVC A;  3KN7 A;  4N8Y A;  4XEQ A;  5HBC A;  4Z7E A;  1EH3 A;  3WAF A;  2I49 A;  2PMS A;  1MY4 A;  3UN6 A;  5ESY A;  2NOO A;  5K2X A;  2CEY A;  4OVJ A;  3UA8 A;  1MPB A;  4NAP A;  4I3E A;  2F3D A;  1ANF A;  3FJM A;  4YKP A;  5I58 B;  3ILT B;  3CFZ A;  4ZEK A;  1RKM A;  3SZP A;  2F36 A;  2D3I A;  4PC9 A;  1LBZ A;  5EQ7 A;  1FBF A;  4OHN A;  1LBV A;  3A3U A;  1MH4 A;  1CE2 A;  1ZU0 A;  3KOT A;  3IJX B;  5AA4 A;  1D9V A;  3O66 A;  4N13 A;  4F29 A;  4MJO A;  3T9V A;  2OX3 A;  4PFW A;  4NED A;  4NF6 B;  3FGS A;  5JTY B;  4EDP A;  2R71 A;  4OVT A;  1P1Q A;  4KD5 A;  1N7W A;  5J16 A;  3QMF A;  2V3T A;  1XVX A;  3VDF A;  4BLA A;  2DE4 A;  1YXI A;  2XXY A;  1GV8 A;  4Q0C A;  5KDT B;  2P1S A;  3S4U A;  1ZTY A;  3U94 A;  3B6W A;  4C0R A;  4YAH X;  1D9Y A;  3T9X B;  3I6V A;  5JK4 A;  5HPQ A;  3SKP A;  4MX6 A;  1B0H A;  3TTR A;  3G3G A;  1CB6 A;  2PVU A;  2WEF A;  4QF9 A;  4O3B A;  2RC7 A;  3ILU B;  3JYR A;  4YU0 A;  1HSE A;  3M8U A;  4HE2 A;  4NGU A;  3LSW A;  4RPN A;  5L9M A;  1MM6 A;  5CBR A;  5IZ3 A;  1B46 A;  4G68 C;  3C4M A;  3VVE A;  3MZ9 A;  5K2Y A;  4MNP A;  2F5X A;  5H8H A;  4YB7 A;  1MY3 A;  1MQG A;  4KPT A;  1JVY A;  3QSL A;  2UYE A;  1IIT A;  2E1S A;  3N5L A;  4OXV A;  3K02 A;  3MPL A;  1B7U A;  4IB2 A;  1NNF A;  3IOV A;  3LUY A;  1BLF A;  2BJJ X;  1SW5 A;  2I0B A;  2Y84 A;  1DSN A;  1LCT A;  4RY1 A;  3TOD A;  4F3P A;  2RCB A;  4LQ2 A;  2F3B A;  3PUX E;  1EZ9 A;  3U72 A;  3ZS6 A;  1LFI A;  2QRY A;  5KCJ B;  5CMB A;  1NL5 A;  4ZEF A;  1FW0 A;  2I48 A;  2ZNU A;  3FV1 A;  3C9H A;  5EQ9 A;  5BUU A;  5FTI A;  4GRK A;  3MP8 A;  1K9Y A;  3IOT A;  3QUF A;  3OO7 A;  1FPD A;  2XXI A;  3MVW A;  1ZKB A;  4DXU A;  4PET A;  1B05 A;  4F1U A;  3G3I A;  3PMW A;  4X04 A;  1IIW A;  4RYA A;  2YJP A;  4XXU A;  2XWK A;  4YKI A;  2REJ A;  2Z22 A;  4IO7 A;  2F78 A;  2BJI A;  1IXH A;  4TLM B;  4XIG Q;  3OO6 A;  2FYI A;  5I2N A;  1R1N A;  5DYH A;  1FPE A;  1KWH A;  3TPA A;  3MWB A;  4JVD A;  2HCA A;  5FTH A;  2DE2 A;  3EHU A;  2PFZ A;  4THI A;  4X9T A;  2P0S A;  3CSG A;  3KC0 A;  2DP8 A;  4MLV A;  4F3G A;  3A3C A;  5AA2 B;  1FQB A;  4H8I A;  1FQC A;  2ZYO A;  4N6D A;  2XXX A;  2CEX A;  4F2Q A;  1FQE A;  4R6H A;  1NUZ A;  4E0X A;  2QFL A;  3T22 A;  1Y4C A;  1LAG E;  3LC8 A;  1DTZ A;  5FHN A;  4PBH A;  4XF5 A;  4MMP A;  2HXW A;  4TOZ A;  2AL4 A;  3ISP A;  4ELQ A;  3VFJ A;  4G8M A;  4ISU A;  1H44 A;  5I59 B;  3CVG A;  2R6G E;  4EQB A;  3FIR A;  2ZMB A;  4HTG A;  1NV2 A;  1P1O A;  1Y3Q A;  3N26 A;  2XXH A;  5L9O A;  2DXY A;  4YIC A;  3N6T A;  1B0L A;  3TQW A;  2GH9 A;  3KFM A;  2ZZW A;  2D5W A;  3MJN A;  2CZI A;  1FBP A;  4EF2 A;  2V93 A;  4R9G A;  1IMF A;  1B1H A;  3BFT A;  2RF1 A;  5ET6 A;  3I5O A;  1MG1 A;  4P3L A;  2P3N A;  4DI3 D;  4NTL A;  1B7Z A;  3JZJ A;  4OVP A;  3VXB A;  1Y3N A;  3GLB A;  5DEX A;  3DEL B;  4QXD A;  4H46 A;  5CMK A;  2FIE A;  4RK9 A;  3TTK A;  4Q8R A;  4PAI A;  4DZ1 A;  3HHG A;  2X7P A;  5AA2 A;  4QRZ A;  4RNS A;  4JWO A;  4PBQ A;  4PGN A;  4PP0 A;  1AWB A;  4F1V A;  3T0J A;  3G3K A;  2O69 A;  3SER A;  5A5X B;  1MH3 A;  4FEB A;  3GBB A;  3LR1 A;  1NUY A;  4G8H A;  4P56 A;  4MAG A;  4DLD A;  4IR8 A;  4U2R A;  1R9L A;  3TTL A;  2Y7K A;  4F18 A;  1NNK A;  3LSL A;  1N76 A;  3PPR A;  3RN8 A;  5IKB A;  3E78 A;  2GFE A;  4ZEC A;  4NF8 B;  4LQ5 A;  5FHM A;  4GVO A;  1R9Q A;  2I6E A;  4ECF A;  4OFJ A;  3DM0 A;  3EN3 A;  1H43 A;  3E3K A;  4O94 A;  3PUY E;  1HSJ A;  5H8H B;  1YAE A;  1TFA A;  3ROJ A;  4HE0 A;  4XFE A;  1IXG A;  5EHM A;  4G68 B;  4KCC A;  2DWA A;  1JP4 A;  2PBW A;  4X8R A;  4GFR A;  1JQF A;  2M8C A;  2QS4 A;  1ATG A;  4H8J A;  1B6H A;  1OLA A;  1DOT A;  4R6K A;  4EQ7 A;  2O84 X;  4DCY A;  1IMC A;  5AA2 D;  3QYT A;  1FTO A;  4U22 A;  4G2Z A;  4GBW A;  3H6U A;  5DVF A;  3BFU A;  3TEL A;  4YMB A;  4DDD A;  3O29 A;  2R8T A;  2DE3 A;  2YLN A;  2HZL A;  4H65 A;  1P99 A;  1MS7 A;  4DE8 A;  3G3F A;  4OVS A;  4OMB A;  4EXL A;  1D4N A;  1CNQ A;  5H8N B;  4IO6 A;  4FEC A;  2ZYK A;  5I2N B;  4TLL B;  3I3V A;  4ONY A;  4OZ9 A;  1Y4T A;  1BTJ A;  1QUL A;  2JJK A;  3PUV E;  4P1L A;  2GHB A;  2GHA A;  3VVF A;  2H99 A;  1YYZ A;  2DXR A;  4NF0 A;  4WKM A;  2Y7P A;  1UTB A;  3HV1 A;  1BK4 A;  1FBE A;  4MBP A;  1DBZ A;  3HFU A;  3T93 B;  5LDZ A;  4OES A;  3TKD A;  2HAU A;  4Q5T A;  3OEK A;  1MXY A;  3E79 A;  1KZ8 A;  2OJT A;  3A29 A;  2VP1 A;  5FHO A;  2A5T A;  1MQH A;  3KGC A;  3CG1 A;  2P2A A;  4OEU A;  2QMW A;  3H7M A;  3MW0 A;  1JW1 A;  2H25 A;  4I9D A;  1DPP A;  2E0S A;  2G93 A;  5ITP A;  2XXR A;  4H67 A;  4G8N A;  4AS4 A;  3MBP A;  4XTC Q;  3TQL A;  4XKR A;  1IME A;  5CC2 A;  1FPG A;  2CZL A;  4JSD A;  3G7W A;  3O28 A;  4I40 A;  4NF6 A;  5JTY A;  1URG A;  1B3F A;  1FJ9 A;  4R6Y A;  4KXP A;  4OVR A;  3A09 A;  2DSF A;  4IO5 A;  1Q9D A;  4N91 A;  2HQ0 A;  1NH7 A;  2H4I A;  3Q25 A;  3SEW A;  3C31 A;  3OMB A;  1NUW A;  1ZJL A;  1JW5 A;  2V25 A;  2V3Q A;  2WYK A;  2XX9 A;  3FV2 A;  3MP1 A;  1QGX A;  4K3F A;  4O3A A;  1NNT A;  4ND9 A;  4GF8 A;  2I0C A;  1M5C A;  2NUV A;  3H06 B;  2VPO A;  1USY E;  3KOS A;  1DPE A;  3GBA A;  4MCO A;  4U4S A;  1H76 A;  2CZK A;  2THI A;  2L5V A;  3FD3 A;  4P0G A;  1MY1 A;  4LN5 A;  4Q30 B;  5I7I A;  3KN8 A;  4MHF A;  2WX9 A;  1RYO A;  3MP6 A;  2Z8D A;  1EZO A;  5IZ1 A;  3C32 A;  2FIX A;  3MVZ A;  3H6V A;  4JXI A;  3KSJ A;  4PTK A;  3AXF A;  5B70 A;  1FRP A;  2FBP A;  2HAV A;  1ZMG A;  1YPN A;  1LB8 A;  3SEU A;  1BIY A;  4F19 A;  4OFO A;  1UQW A;  1BP5 A;  3K1N A;  3D4C A;  3O9P A;  3CFL A;  2QVU A;  2ZXT A;  4NN3 A;  2DWI A;  3SDF A;  3EPE A;  4KFQ A;  1H45 A;  2PX1 A;  4JDF A;  1O64 A;  4FJP A;  4PF8 A;  1LBW A;  3C35 A;  1O7T A;  4MF3 A;  2RKM A;  1Z7M E;  4HCW A;  4NWC A;  2D21 A;  4HS7 A;  3LUZ A;  4JBZ A;  4LAT A;  3QIM A;  3S2V A;  3IFA A;  4OVQ A;  3T96 B;  4GWZ A;  4PFU A;  1FQF A;  3F11 A;  1FPJ A;  1M5D A;  2F7B A;  4GLI A;  1US4 A;  2VGQ A;  2F97 A;  4N07 A;  1FPB A;  2UYF A;  4R2B A;  1B3H A;  3Q27 A;  4EQ9 A;  1B4Z A;  2NWJ A;  2Y7W A;  2HEU A;  1Q1K A;  4FIM A;  4H45 A;  3U8Q A;  2OWZ A;  1A55 A;  1Y3P A;  4ELP A;  5FBP A;  4L17 A;  3PPO A;  3RNN A;  1VR5 A;  4N15 A;  3SES A;  1MM7 A;  3BKI B;  3HPI A;  4P1E A;  3OEM A;  3MVX A;  1XT8 A;  1URD A;  3IOU A;  5EQ8 A;  2XX8 A;  2OWS A;  3N94 A;  4X1D A;  2O51 A;  1M5B A;  2Y5L A;  2H5Y A;  4OEN A;  1RDX A;  4GXA A;  4H1X A;  5I2K B;  1M5F A;  2FA7 A;  3V5A A;  4NE4 A;  3EQ1 A;  4HCY A;  1N3W A;  3VLV A;  2Q9T A;  3MZB A;  5AA3 A;  3E13 X;  1P1U A;  2OZZ A;  2Q74 A;  3TDJ A;  3CIJ A;  4G77 A;  4PF6 A;  5EYH A;  3ZKL A;  5AA1 A;  1DMB A;  2OBG A;  5F1Q A;  3K6W A;  4U4X A;  2DOJ A;  3O97 A;  3MPK A;  3LSF B;  2QVR A;  1LAX A;  4R2F A;  5I84 A;  4U21 A;  1WOD A;  3KZG A;  4KYE A;  4UAC A;  4IY6 A;  4DIG A;  3TCH A;  3U92 A;  4NF5 B;  2ZYM A;  3TMG A;  3R6U A;  1MXV A;  3KBZ A;  3T1B A;  1A40 A;  3W9V A;  4KYD A;  1LBC A;  3O6G A;  4F3S A;  1LFG A;  5TP9 B;  3GZG A;  1JET A;  3JV9 A;  4GD5 A;  4GQO A;  3TAJ A;  3HCQ A;  1FTL A;  1FTM A;  5CM6 A;  4F22 A;  3RYD A;  4PDH A;  4H5G A;  4OTE A;  1L5T A;  4QFK A;  4EUO A;  4UA8 A;  4X48 A;  4PAF A;  5BWJ A;  4F1Y A;  4GWW A;  4FAJ A;  3N6U A;  4NQ8 A;  3PD8 A;  4N4U A;  4RXL A;  3CG3 A;  2Q8J A;  1EYI A;  3MQ9 A;  3HHF A;  3ZKK A;  3C36 A;  4ZE9 A;  3BBR A;  3CRB A;  3MST A;  1SBP A;  3BIH A;  1USY H;  4G68 A;  2VD2 A;  3H6W A;  4G61 A;  5DT6 A;  4M4G A;  3TTM A;  1P1W A;  1SDX A;  1D9Q A;  3KBR A;  3PTY A;  3OSR A;  5EHS A;  1A54 A;  1B52 A;  4JB7 A;  2DQV A;  4ZEI A;  4PAK A;  1B2H A;  4FOR A;  2I58 A;  2W7Y A;  1KA1 A;  1FSA A;  5TPA A;  4QFO A;  4Z0I A;  1P1N A;  1UTB B;  1LBY A;  2F34 A;  1TT1 A;  1HSL A;  1PC3 A;  1KA0 A;  3W9W A;  4DXB A;  1LB9 A;  1WDN A;  5T3J A;  2HXR A;  3MZ1 A;  3PMV A;  4KR5 A;  1FTA A;  3IOW A;  3VE1 B;  4H0W A;  2UVI A;  1QUK A;  4C1U A;  5ICQ A;  3K6V A;  1AMF A;  3FXB A;  2HPG A;  3TZA A;  2QPQ A;  1TFD A;  2DS9 A;  1N0T A;  5EQA A;  1FBC A;  4XKN A;  3H6T A;  1N3X A;  3RT8 A;  4ZDM A;  3PMX A;  4BDL A;  1AH5 A;  3O2A A;  2IEE A;  4LON B;  1NFT A;  4E0W A;  5DEX B;  3KN3 A;  1SI0 A;  4IO3 A;  1AIV A;  4H5F A;  3CFX A;  5IGA A;  5KDT A;  1DCU A;  3ECR A;  3H3G A;  3IB0 A;  2O1M A;  3U65 A;  3IB2 A;  5I57 A;  2OK2 A;  4O3C A;  1B7H A;  4OFL A;  4I8C A;  3MUQ A;  4MEV A;  4AQ4 A;  4DCX A;  1LAH E;  4I1D A;  4P0I A;  4RA1 A;  4OA4 A;  3VXC A;  3PGF A;  5TPA B;  2UVJ A;  1Y1Z A;  4IO4 A;  3FAS A;  1URS A;  1DTG A;  2X26 A;  2ZNS A;  4O8M A;  1J1N A;  1JEU A;  1PB8 A;  4YKJ A;  3MC2 A;  1I6Q A;  2KR0 A;  5H8Q B;  4GOT A;  2XXQ A;  4QSC A;  3DP4 A;  2X7Q A;  1IXC A;  2PYY A;  3B8B A;  1II5 A;  1FJ6 A;  3FBP A;  1MRP A;  4N6K A;  4UAB A;  3Q26 A;  3LBS A;  3R26 A;  4ELO A;  3TCF A;  2F7A A;  4PFT A;  1IXI A;  2ABH A;  4FBP A;  4OQO A;  2ONK E;  3QK6 A;  5DVI A;  2DVZ A;  2NXO A;  3FVO A;  4QBA A;  2ZZX A;  3B50 A;  4QHQ A;  5EYF A;  4KHZ E;  2GQ1 A;  1SW2 A;  4ZZA A;  5A5L A;  2B65 A;  4NMY A;  1MXX A;  1MPC A;  2A5T B;  2PFY A;  4MFI A;  3W15 C;  1FBD A;  2KLF A;  3PPQ A;  1S9T A;  1PB9 A;  1M5E A;  1VFD A;  4F3B A;  3U93 A;  4NF8 A;  3IFC A;  5IM2 A;  1B1X A;  1Q35 A;  1SD3 A;  3FJ7 A;  3KJ7 A;  3ZSF A;  2ZZV A;  4BDQ A;  1EYJ A;  1BKA A;  3OEL A;  1NV1 A;  1FPF A;  4HW8 A;  4KCD A;  3L6H A;  1UIV A;  1OLC A;  3PD9 A;  4YB6 A;  1B3L A;  3IO4 A;  1NKX A;  1I69 A;  3UP9 A;  2B3B A;  2QJE A;  3G3H A;  1XOC A;  4GX3 A;  4OER A;  2WBD A;  3RPL B;  2UVH A;  1OMP A;  4PFI A;  2VOZ A;  4OAN A; 
#chains in the Genus database with same CATH homology
 2D21 A;  2I4B A;  4HS7 A;  1PBP A;  1FTK A;  5CBS A;  2RC8 A;  3RY3 A;  4JBZ A;  1IXH A;  4QFN A;  4TLM B;  4XIG Q;  1ZBM A;  3OO6 A;  3O6H A;  4GIZ A;  3SEX A;  3CI8 A;  4ESW A;  4LAT A;  3CSB A;  2FYI A;  3FVK A;  3QIM A;  4JWY A;  5CMM A;  1R1N A;  5DYH A;  3S2V A;  1MQI A;  3RT6 B;  3T96 B;  5I2N A;  1KWH A;  1B5I A;  3TPA A;  3MWB A;  2HZK A;  3SEY A;  4WED A;  1N04 A;  1S50 A;  2HCA A;  2XXU A;  3K0V A;  4R73 A;  3RTW B;  4PFU A;  5FTH A;  4F39 A;  1OQG A;  1FQF A;  3DP8 A;  4EF1 A;  2DE2 A;  3F11 A;  3EHU A;  3WAE A;  1OIB A;  2XXW A;  4U23 A;  4THI A;  4X9T A;  2P0S A;  1M5D A;  2F7B A;  2FNC A;  3OD7 A;  1QW0 A;  3CSG A;  1A8F A;  4ZS9 A;  4H6D A;  5AA4 B;  2DP8 A;  2V84 A;  4MLV A;  4GLI A;  4F3G A;  3A3C A;  5JEI A;  5F7V A;  2Z23 A;  1US4 A;  2VGQ A;  4RK2 A;  2F97 A;  1FQB A;  4GL0 A;  2UYF A;  4N07 A;  5AA2 B;  5ELV A;  5ITO A;  3FJG A;  3M3F A;  4R2B A;  4H8I A;  1LFH A;  1B3H A;  2AIX A;  3M3K A;  3Q27 A;  4EQ9 A;  4PFY A;  1A7L A;  1FQC A;  1B4Z A;  2NWJ A;  2ZYO A;  3IX1 A;  1MDQ A;  2Y7W A;  1A8E A;  3B6Q A;  2XXX A;  3FZV A;  1B58 A;  1XC1 A;  2HEU A;  2YPN A;  1LGB C;  1FQE A;  1Q1K A;  2I4C A;  4FIM A;  3PU5 A;  4LZ5 A;  4R6H A;  3T9H B;  3UGW A;  4JSO A;  4E0X A;  3LSX A;  2PT2 A;  3T22 A;  1Y4C A;  3U8Q A;  1PB7 A;  1A55 A;  1LAG E;  1EZP A;  1Y3P A;  1DTZ A;  3LC8 A;  5FHN A;  4ELP A;  1QUJ A;  4L17 A;  1PBQ A;  3PPO A;  4X1B A;  4GL8 A;  3K2D A;  3RNN A;  2HXW A;  4TOZ A;  3SET A;  1FQD A;  2PT1 A;  4NF5 A;  2AL4 A;  4ELQ A;  1VR5 A;  5M2V A;  5H8F A;  3VFJ A;  2F7C A;  4G8M A;  3FXU A;  4ISU A;  3SES A;  1MM7 A;  1H44 A;  3BKI B;  3HPI A;  4G4P A;  3CVG A;  1QKB A;  2R6G E;  5I59 B;  1QVS A;  4EQB A;  1SW1 A;  5I57 B;  3L6G A;  2G29 A;  2ONR A;  3OEM A;  4OEV A;  1Y9U A;  1FTJ A;  1D3K A;  1B32 A;  3FIR A;  2ZMB A;  3IL1 B;  4HTG A;  2Q2A A;  1P1O A;  1Y3Q A;  5I2K A;  3RPW A;  3N26 A;  3MVX A;  1GGG A;  1XT8 A;  3OO8 A;  1URD A;  2XXH A;  1VFE A;  4PQJ A;  5L9O A;  3IOU A;  4QSD A;  2DXY A;  4YIC A;  3N6T A;  1NNP A;  3H4Z A;  2XX8 A;  2OWS A;  1B0L A;  3CR9 A;  3OOA A;  3TQW A;  2GH9 A;  3KFM A;  3FAT A;  3N94 A;  4X1D A;  3TUS A;  1T0K A;  2D5W A;  3MJN A;  1B51 A;  2O51 A;  3O6I A;  1LCF A;  1M5B A;  3IB1 A;  2H5Y A;  3PUW E;  4OEN A;  4GXA A;  3Q29 A;  1Z7N E;  2H9B A;  4KI0 E;  4EF2 A;  3OEN A;  2V3U A;  4H1X A;  5J1D A;  2V93 A;  3OXN A;  4WEP A;  5I2K B;  3S9N C;  4R9G A;  3EHS A;  1B1H A;  3BFT A;  4LUB A;  3VV5 A;  2RF1 A;  1M5F A;  1UTH A;  2FA7 A;  3THI A;  3I5O A;  3V5A A;  1MG1 A;  1YTV A;  3EQ1 A;  4NE4 A;  4YMA A;  5IAI A;  3PPP A;  2RCA A;  3PUZ E;  5TP9 A;  4HCY A;  4IO2 A;  4LP2 B;  4NWD A;  1N3W A;  3VLV A;  2Q9T A;  3MZB A;  5AA3 A;  3E13 X;  4NTL A;  3T9U A;  1B7Z A;  3JZJ A;  4DXC A;  5I56 A;  4YZZ A;  3FVN A;  1P1U A;  3VXB A;  2Y7R A;  1Y3N A;  2OZZ A;  3GLB A;  3V83 A;  5H8N A;  3V89 B;  3TDJ A;  5DEX A;  3CIJ A;  3QXM A;  4G77 A;  3ZKL A;  3DEL B;  1DMB A;  5AA1 A;  2OBG A;  3E9X A;  3IK6 B;  3K00 A;  5CMK A;  2Y7I A;  5F1Q A;  1YCJ A;  4POX A;  1B3G A;  4RK9 A;  3K6W A;  4U4X A;  3TTK A;  4Q8R A;  2DOJ A;  3O97 A;  4BDM A;  3TEP A;  1N84 A;  3MPK A;  3K4U A;  4DZ1 A;  3HHG A;  3LSF B;  2A5S A;  2CMO A;  1LAX A;  2X7P A;  3P7I A;  2DVC A;  3FUZ A;  3QAX A;  4R2F A;  5AA2 A;  5I84 A;  4U21 A;  1WOD A;  1MXZ A;  1H3D A;  1RYX A;  3KZG A;  2O7U A;  4QRZ A;  3VLU A;  4KYE A;  4RNS A;  4JWO A;  1MY0 A;  1XS5 A;  4UAC A;  4GXS B;  4IY6 A;  4DIG A;  3TCH A;  2I3W A;  3U92 A;  4NF5 B;  2ZYM A;  4PP0 A;  3TMG A;  1SYI A;  3R6U A;  1MXV A;  1MQD A;  5KCJ A;  4F1V A;  5HM4 B;  1N7X A;  2QS1 A;  1WVJ A;  3S9E A;  3G3K A;  2O69 A;  2QSX A;  3SER A;  4EQ7 A;  5A5X B;  1MH3 A;  2ALU A;  3E4R A;  3H03 A;  5A5X A;  3EHT A;  3IOR A;  4FEB A;  4MH5 A;  1QJM A;  3GBB A;  1B9J A;  2Q2C A;  3G3J A;  3LR1 A;  4OYV A;  5CI5 A;  3B7D A;  3TCG A;  5ICT A;  4G8H A;  5H8S A;  1IZ1 A;  4YB5 A;  4BDO A;  1MDP 1;  1Y1M A;  4QFL A;  1A40 A;  3W9V A;  4DLD A;  4KYD A;  1B5J A;  1LBC A;  3RTF B;  3S9L C;  2DWH A;  2F8D A;  4JWX A;  3USD A;  3O6G A;  4U2R A;  1R9L A;  2GRV A;  3KJT A;  3TTL A;  2Y7K A;  4F18 A;  1LFG A;  4LVQ A;  4F3S A;  1NNK A;  3LSL A;  1N76 A;  3PPR A;  3RN8 A;  5TP9 B;  3GZG A;  4BDN A;  3K01 A;  5CMC A;  5IKB A;  3IO6 A;  2GFE A;  4ZEC A;  4NF8 B;  1EU8 A;  2AYS A;  4LQ5 A;  4POW A;  5FHM A;  1JET A;  1US5 A;  3JV9 A;  1AOV A;  3TTN A;  1AL3 A;  4GD5 A;  1R9Q A;  4GQO A;  4GVO A;  1MQJ A;  1XHY A;  3TAJ A;  1QKA A;  2I6E A;  4OFJ A;  4ECF A;  2QS2 A;  3DM0 A;  3HCQ A;  1FTL A;  3EN3 A;  1H43 A;  1FTM A;  3HO7 A;  4U1O A;  5L9S A;  4NF4 A;  3E3K A;  3RQT A;  3PUY E;  4F22 A;  1ELJ A;  4OWD A;  5CM6 A;  4P11 A;  1HSJ A;  3D4G A;  5L8D A;  2RIN A;  4H5G A;  5H8H B;  1YAE A;  4TQU Q;  1TFA A;  3R7X A;  4OTE A;  3TFL A;  1L5T A;  1SVX B;  2REG A;  4QFK A;  4EUO A;  1B40 A;  3K6U A;  3PPN A;  3T66 A;  1OVB A;  4UA8 A;  1SYH A;  2UXA A;  4X48 A;  2RC9 A;  1IXG A;  5LOM A;  5EHM A;  5BWJ A;  4F1Y A;  4G68 B;  4KCC A;  2DWA A;  4FAT A;  2HFB A;  1I6A A;  4FAJ A;  2XD2 A;  3N6U A;  3RUM A;  2PBW A;  4LA9 A;  1POY 1;  3C34 A;  5DTB A;  4GFR A;  1JQF A;  2M8C A;  2QS4 A;  2F6P A;  5B7D A;  1ATG A;  3C33 A;  4H8J A;  1VE4 A;  2DYX A;  3PD8 A;  3CG3 A;  3FVG A;  4R74 A;  4RXL A;  2Q8J A;  3ONM A;  3MQ9 A;  1PDA A;  3HHF A;  4BDR A;  4GWO A;  3ZKK A;  1LBB A;  1B6H A;  1OLA A;  1NH8 A;  4PE5 B;  1DOT A;  3C36 A;  2O6A A;  2LAO A;  3UIF A;  4ZE9 A;  4R6K A;  1GR2 A;  3BBR A;  3CRB A;  1NMU A;  1A99 A;  1B4H A;  1SBP A;  1USY H;  3DP6 A;  4G68 A;  2O84 X;  4ZZE A;  2VD2 A;  3H6W A;  5DT6 A;  4DCY A;  5AA2 D;  3QYT A;  1ZIU A;  3KN7 A;  1FTO A;  2O7I A;  4M1V A;  4M4G A;  4U22 A;  1GVC A;  1P1W A;  1SDX A;  3TTM A;  3KBR A;  1XVY A;  1IUD A;  4G2Z A;  3OSR A;  3H6U A;  4KYS A;  1EH3 A;  5HBC A;  4Z7E A;  5EHS A;  5DVF A;  3VLW A;  3WAF A;  2I49 A;  3BFU A;  2PMS A;  3TEL A;  2XXP A;  1FQA A;  4IY5 A;  4YMB A;  1MY4 A;  1A54 A;  1B52 A;  2ZYN A;  3OSQ A;  2NOO A;  4JB7 A;  3UN6 A;  2WKY A;  5K2X A;  1TWY A;  4OVJ A;  4DDD A;  1QUI A;  5H8N B;  2DQV A;  4ZEI A;  3UA8 A;  1ZLQ A;  2ANJ A;  2QS3 A;  3O29 A;  4RJZ A;  2DWJ A;  2DE3 A;  1B2H A;  2YLN A;  1MPB A;  1LST A;  2HZL A;  4H65 A;  4KQP A;  4FOR A;  2I58 A;  2W7Y A;  3IR1 A;  2ESN A;  1ANF A;  4FE8 A;  1P99 A;  4MLQ A;  2AL5 A;  4QFO A;  5TPA A;  1MS7 A;  3RGY A;  4Z0I A;  2NVU B;  1P1N A;  2QMX A;  3G3F A;  4DE8 A;  1UTB B;  3FJM A;  3UK4 A;  2XHD A;  2F34 A;  4OMB A;  4YKP A;  4EXL A;  3TYH A;  5I58 B;  1D4N A;  1TT1 A;  1HSL A;  1PC3 A;  3ILT B;  3CFZ A;  3W9W A;  1IQ7 A;  4DXB A;  1LB9 A;  1JNF A;  1WDN A;  4IO6 A;  4ZEK A;  1SI1 A;  2OCU A;  4FEC A;  1RKM A;  2ZYK A;  3MZ1 A;  5I2N B;  4NF4 B;  3PMV A;  4TLL B;  4U1Z A;  4KR5 A;  2F36 A;  3I3V A;  4ONY A;  2D3I A;  4OZ9 A;  4ZE8 A;  1UIU A;  3IOW A;  4F2O A;  1Y4T A;  1BTJ A;  1QUL A;  3PUV E;  2XXV A;  2GHB A;  2GHA A;  3VVF A;  2H99 A;  4OHN A;  3VE1 B;  2DXR A;  4WKM A;  2Y7P A;  1UTB A;  3A3U A;  4H0W A;  1MH4 A;  1CE2 A;  1ZU0 A;  2UVI A;  3KOT A;  1QUK A;  3IJX B;  5DVJ A;  4C1U A;  5AA4 A;  1D9V A;  3HV1 A;  5ICQ A;  3K6V A;  1AMF A;  4XKP A;  3TZA A;  1JW4 A;  4IGR A;  2QPQ A;  1TFD A;  4MBP A;  3T93 B;  3DLN A;  3O66 A;  3K6X A;  2DS9 A;  4N13 A;  4OES A;  1N0T A;  3TKD A;  4F29 A;  2HAU A;  4Q5T A;  3OEK A;  3T9V A;  4F2Q A;  4XKN A;  2Z8F A;  1MXY A;  1B5H A;  2OWT A;  3H6T A;  1N3X A;  4PFW A;  3RT8 A;  4ZDM A;  3PMX A;  3FXQ A;  4BDL A;  2XD3 A;  2OJT A;  4N6P A;  2VP1 A;  4NED A;  4LZ7 A;  1AH5 A;  2A5T A;  3FGS A;  4NF6 B;  5FHO A;  5JTY B;  3O2A A;  4EDP A;  2UVG A;  2IEE A;  2R71 A;  3V8X B;  1JEV A;  1P1Q A;  4KD5 A;  4LON B;  1MQH A;  1NFT A;  2OLB A;  4E0W A;  3S9M C;  3KGC A;  5DEX B;  2XX7 A;  3U1O A;  3CG1 A;  1N7W A;  3KN3 A;  1SI0 A;  2P2A A;  4IO3 A;  4R9F A;  1AIV A;  3MVY A;  4H5F A;  2V3T A;  4OEU A;  5AE4 A;  1XVX A;  2QMW A;  3VDF A;  3H7M A;  4BLA A;  4AB5 A;  3MW0 A;  1JW1 A;  2H25 A;  2DE4 A;  4RPO A;  4I9D A;  2XXY A;  3IAZ A;  3CFX A;  1GV8 A;  1DPP A;  4Q0C A;  5KDT B;  2P1S A;  2E0S A;  2B3F A;  3S4U A;  4IGT A;  1ZTY A;  2IA4 A;  3ECR A;  5KDT A;  3H3G A;  3U94 A;  4AB6 A;  3B6W A;  3IB0 A;  2G93 A;  4C0R A;  2O1M A;  4R72 A;  3IB2 A;  4YAH X;  5I57 A;  5ITP A;  1D9Y A;  2XXR A;  2OK2 A;  4H67 A;  4G8N A;  3I6V A;  4O3C A;  1B7H A;  4OFL A;  4I8C A;  4YKK A;  5TU0 A;  3T9X B;  4ZED A;  5HPQ A;  5JK4 A;  3MUQ A;  3MBP A;  4AQ4 A;  3SKP A;  4DCX A;  4XTC Q;  2Q89 A;  3TQL A;  4XKR A;  1LAH E;  5CC2 A;  1B0H A;  1O63 A;  4I1D A;  2CZL A;  1OVT A;  4QFP A;  4P0I A;  4R75 A;  3TTR A;  4RA1 A;  4JSD A;  3UOR A;  3G7W A;  3VXC A;  3PGF A;  5TPA B;  3G3G A;  3FXR A;  2UVJ A;  3O28 A;  1Y1Z A;  4IO4 A;  4ESX A;  1CB6 A;  1URS A;  3FAS A;  4NF6 A;  5JTY A;  1DTG A;  2PVU A;  1URG A;  2X26 A;  1B3F A;  1MXW A;  2ZNS A;  3KEI A;  4QF9 A;  4O3B A;  2RC7 A;  4F31 B;  5KZT A;  1J1N A;  1JEU A;  3ILU B;  1PB8 A;  3JYR A;  4OET A;  1GTK A;  4R6Y A;  4YKJ A;  4ELR A;  3MC2 A;  1I6Q A;  1HSE A;  2O1L A;  3A09 A;  4YU0 A;  2DSF A;  3M8U A;  4IO5 A;  5H8Q B;  4GOT A;  2HQ0 A;  2XXQ A;  3IJO B;  3Q28 A;  1NH7 A;  2H4I A;  3Q25 A;  4QSC A;  3K1M A;  3SEW A;  3C31 A;  3LSW A;  3OMB A;  1MXU A;  4RPN A;  5L9M A;  2XXT A;  1MM6 A;  3PV0 E;  1PEB A;  5CBR A;  1ZJL A;  3DP4 A;  2X7Q A;  1B46 A;  4G68 C;  4EXK A;  1JW5 A;  2V25 A;  2V3Q A;  1IXC A;  2PYY A;  2VHA A;  2XX9 A;  3C4M A;  3FV2 A;  2F35 A;  2H98 A;  3MP1 A;  1II5 A;  1LLS A;  1VSO A;  2Q88 A;  3MZ9 A;  4WXJ A;  3VVE A;  3OO9 A;  1MRP A;  4K3F A;  5K2Y A;  4O3A A;  2QL3 A;  2F5X A;  3Q26 A;  1NNT A;  3LBS A;  5H8H A;  4FED A;  1JVX A;  4YB7 A;  3R26 A;  5ISU A;  4ND9 A;  4ELO A;  1MY3 A;  1MQG A;  4GF8 A;  4KPT A;  3TCF A;  2ZNT A;  1MY2 A;  2F7A A;  1JVY A;  1POT A;  1M5C A;  2I0C A;  2NUV A;  3H06 B;  1IXI A;  3QSL A;  1USY E;  4PFT A;  2ABH A;  2Z8E A;  4OQO A;  4C1T A;  2ONK E;  3KOS A;  2UYE A;  3QK6 A;  1IEJ A;  1DPE A;  3QUJ A;  5DVI A;  3GBA A;  3MAM A;  1IIT A;  2DVZ A;  2NXO A;  2E1S A;  3FVO A;  4U4S A;  3N5L A;  1H76 A;  4OXV A;  2THI A;  3K02 A;  3FD3 A;  3MPL A;  1B7U A;  4IB2 A;  1NNF A;  3IOV A;  1MY1 A;  3LUY A;  4P0G A;  1BLF A;  4QHQ A;  5EYF A;  2R9J A;  3ODB A;  2BJJ X;  3KG2 A;  4KHZ E;  3RLF E;  1SW5 A;  2I0B A;  1SW2 A;  2Y84 A;  3KSX A;  4LZ8 A;  2B65 A;  4Q30 B;  3KN8 A;  4NMY A;  4ZZA A;  1MXX A;  1MPC A;  1DSN A;  1LCT A;  1RYO A;  2A5T B;  3MP6 A;  5I56 B;  3M3L A;  2Z8D A;  4MFI A;  4RY1 A;  3TOD A;  1FCK A;  2VD3 A;  4F3P A;  1EZO A;  2RCB A;  4LQ2 A;  2ONS A;  3W15 C;  3C32 A;  3MVZ A;  3H6V A;  4JXI A;  3KSJ A;  2KLF A;  3AXF A;  1SW4 A;  3PUX E;  5CRY A;  3PPQ A;  1EZ9 A;  1PB9 A;  1S9T A;  4XKQ A;  1LFI A;  1M5E A;  3U72 A;  3ZS6 A;  2I3V A;  2QRY A;  1VFD A;  5KCJ B;  5B70 A;  5CMB A;  4F3B A;  1NL5 A;  3U93 A;  4NF8 A;  4ZEF A;  1FW0 A;  2HAV A;  1ZMG A;  3EF7 A;  2I48 A;  2ZNU A;  3HST A;  3K1P A;  1S7Y A;  1B1X A;  1Q35 A;  1SD3 A;  1YPN A;  3FJ7 A;  3KJ7 A;  3ZSF A;  1LB8 A;  3SEV A;  4BDQ A;  3SEU A;  1BIY A;  4F19 A;  1BKA A;  4OFO A;  1UTH B;  1I6B A;  2O68 A;  1OQH A;  1UQW A;  1BP5 A;  3FV1 A;  3OEL A;  3C9H A;  3K1N A;  3D4C A;  5BUU A;  5FTI A;  3O9P A;  4GRK A;  3CFL A;  1LAF E;  1TXF A;  3B6T A;  4HW8 A;  2ZXT A;  4KCD A;  2DWI A;  1Y20 A;  3EPE A;  3L6H A;  3SDF A;  1UIV A;  3HN0 A;  1OLC A;  1H45 A;  1B3E A;  2PX1 A;  3IOT A;  3MP8 A;  3PD9 A;  3QUF A;  1O64 A;  4JDF A;  4QSE A;  3OO7 A;  4YB6 A;  4ZEB A;  1B3L A;  2XXI A;  3IO4 A;  1ZKB A;  3MVW A;  4FJP A;  5I58 A;  5I59 A;  1NKX A;  4I62 A;  1I69 A;  1MPD A;  3VVD A;  4PET A;  4DXU A;  1B05 A;  4F1U A;  3UP9 A;  3C35 A;  3G3I A;  1O7T A;  2B3B A;  2F6G A;  2QJE A;  3PMW A;  1IIW A;  4RYA A;  3G3H A;  4MF3 A;  2RKM A;  2YJP A;  1SQY A;  4XXU A;  1Z7M E;  5H8Q A;  1XOC A;  5H8F B;  4YKI A;  2REJ A;  2Z22 A;  4OER A;  2UVH A;  1OMP A;  1F9B A;  4HCW A;  4KFQ A;  3GXA A;  2F78 A;  4IO7 A;  2VOZ A;  1R6Z A;  4NWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...