3VVFA

Crystal structure of ttc0807 complexed with arginine
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
241
Chain Sequence
GGSEFQVRSFEEIKRSGEIRIGTEGAFPPFNYFDERNQLTGFEVDLGNAIAERLGLKPRWIAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVSRKGGPRTAKDLQGKVVGVQVGTTYMEAAQKIPGIKEVRTYQRDPDALQDLLAGRIDTWITDRFVAKEAIKERKLENTLQVGELVFQERVAMAVAKGNKSLLDALNRALAELMQDGTYARISQKWFGEDVRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, binding protein
publication title Two ATP-Binding Cassette Transporters Involved in (S)-2-Aminoethyl-Cysteine Uptake in Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
total genus 90
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vvfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vvfA02
4HTGA 2ZYMA 5IAIA 3E4RA 3KGCA 2VD3A 4ISUA 1OVTA 3O9PA 1A54A 1B52A 4AB5A 5AA2A 2Q89A 4LZ8A 5A5XB 2QMWA 4I62A 3S2VA 1LB8A 4NF8A 4GXAA 4H5FA 4AQ4A 4GQOA 2THIA 3IOTA 3H6WA 1N0TA 1LCTA 1PB8A 1XVXA 3H3GA 5JK4A 1JQFA 4YKPA 2PX1A 1OIBA 1UTBA 2V84A 3CRBA 5CMMA 1FQAA 1B58A 3EF7A 4C1UA 3MJNA 2QPQA 4X1BA 4QSCA 3UP9A 3B7DA 4LVQA 3FJ7A 4P11A 1SVXB 1HSLA 3VVFA 4RK2A 5EYFA 2I4BA 4R74A 3PU5A 4YMAA 1IEJA 1A40A 2UVIA 2V3TA 3RN8A 5CBRA 3DLNA 4U4SA 1ZIUA 2DS9A 1B32A 1JNFA 4JBZA 3CR9A 1Z7NE 2XXWA 4QSDA 2YPNA 4LUBA 3N6TA 3KG2A 1CB6A 3OEMA 4RNSA 1M5DA 2YLNA 4G68C 3B6QA 1MQIA 3QYTA 3PUVE 2F97A 3T9VA 1O64A 4IO2A 3DP8A 5CMKA 3WAEA 3SEVA 3FJMA 3FUZA 5ICQA 4ZEIA 1QW0A 1SYIA 1EZ9A 1MQJA 4N13A 4RYAA 1S7YA 4X48A 4KHZE 4LZ5A 3C4MA 1PDAA 3UIFA 3W9WA 1A8EA 4E0XA 3T66A 3C34A 3U1OA 1XS5A 5H8HA 4XKNA 4OWDA 1N7WA 3RTWB 1IUDA 3KOSA 3T96B 3RTFB 5I59A 4MF3A 1B0HA 3CG1A 4DLDA 4NEDA 1Y20A 5CC2A 1MM6A 4OFLA 3MPKA 3G7WA 2F35A 1NH7A 1USYH 1A55A 1B05A 1IITA 2VD2A 3CI8A 3L6GA 1B6HA 3A3UA 2O1MA 4LP2B 5AA4B 2Z8DA 1QULA 1IIWA 1LAXA 2RC8A 3IORA 1MH4A 5BUUA 2DE2A 1QVSA 2QJEA 4MBPA 3FXQA 4EXLA 1JW4A 3PPOA 5B70A 4OEUA 2A5SA 2H9BA 3V89B 2Y7PA 2Z8FA 3JYRA 3FXRA 3K1NA 1MQDA 3FVGA 4I9DA 3MVYA 2BJJX 1EU8A 3K1PA 5KDTB 4FECA 4FJPA 2HEUA 1IZ1A 3MUQA 5H8FB 3K01A 3PUWE 1NH8A 3LSFB 2Y84A 4UACA 3RPWA 4XTCQ 5DEXB 3N26A 1LBCA 2XXTA 4R6YA 1N3XA 1FTOA 2UXAA 3SKPA 2YJPA 2DWIA 4DDDA 3EN3A 3DP6A 4OFOA 3OEKA 1Q1KA 1MY2A 1MY0A 2AYSA 2HAVA 3ZKLA 4GXSB 4KPTA 2G29A 3IB0A 3DM0A 3V8XB 4PETA 4POXA 3QAXA 3Q27A 2X26A 4DCXA 4ZE8A 2R6GE 3CFZA 2QRYA 2UVGA 3PPRA 3K02A 4P0IA 4YAHX 3EHSA 5KCJA 1VR5A 1FTMA 5K2YA 1ZTYA 1P1QA 2ZYNA 5CM6A 3B6TA 2OWSA 1QKAA 2QS2A 4H8JA 4TLLB 1DPPA 3C33A 3TKDA 2DYXA 3U72A 4X9TA 1A8FA 3UA8A 1B51A 4E0WA 2HXWA 3H4ZA 1YAEA 1MH3A 3UGWA 1QUIA 5BWJA 3FV1A 5I57B 2DXYA 2B65A 4HCWA 1MXVA 3G3JA 5FTHA 1TFAA 3VXCA 2XXYA 3MP6A 1DTGA 1LB9A 2XD3A 4ELRA 2UYFA 1ANFA 1UIUA 4F19A 4R75A 5M2VA 3MAMA 3PMVA 2OZZA 3S9MC 2UYEA 2NOOA 4NF5A 2ANJA 2VHAA 1DMBA 5JTYA 2PT2A 4NWDA 2HZLA 4JWYA 3MP1A 1AOVA 1US4A 3SETA 1MRPA 4FIMA 4OETA 1O7TA 4OERA 1XVYA 3VV5A 1FTKA 4LQ5A 2DSFA 4O3CA 4G2ZA 2DE3A 4OTEA 5CMBA 2OJTA 3VFJA 1D9YA 1BTJA 2A5TA 1BIYA 1FCKA 2DWAA 4JSOA 1SQYA 1P1NA 1ATGA 3HPIA 1B46A 3ONMA 1OQGA 5CMCA 3LSXA 4HS7A 1B4ZA 3CSBA 4GL0A 3KSJA 1EZOA 3LSWA 3TZAA 3CSGA 1LAGE 4UA8A 2NWJA 3O29A 1ZLQA 5L9SA 3FIRA 4ELOA 2FYIA 2D3IA 5TP9B 2XX9A 1Y3NA 4F39A 1R6ZA 3MVXA 3O97A 2XXPA 5L9OA 3MPLA 5H8NB 2R9JA 3RLFE 2Y7IA 1R9QA 4U2RA 2GFEA 4DXCA 3HHGA 2RINA 1WDNA 4YB6A 1A99A 4IY6A 3RGYA 1POTA 3HSTA 1JEUA 3IJOB 4RY1A 3THIA 2B3FA 1P1WA 2V25A 3GZGA 2D5WA 4FATA 1N7XA 2I3VA 1N3WA 1Y1ZA 3W15C 4GLIA 3M8UA 5AA3A 5I2NA 1ZKBA 2F6GA 3K6WA 5I56A 4U1ZA 4KCCA 1MXYA 2Y7WA 3TPAA 1WODA 2VOZA 4IGRA 2REJA 1US5A 1OMPA 1UQWA 2Z8EA 5ELVA 1Y9UA 1B3FA 2UVHA 1LCFA 1LSTA 4I8CA 4Z0IA 3A09A 2H98A 1UTHB 1DTZA 1MDQA 4BDOA 4MLQA 1B1HA 1LBBA 3R6UA 4EXKA 1YPNA 3RY3A 4U23A 2O68A 3MP8A 5H8QA 5DTBA 5F1QA 1MPBA 1GVCA 4ZDMA 2X7PA 3RT6B 3OD7A 2I49A 5DVJA 3UK4A 4ESWA 4EQBA 4NF6A 3USDA 4ZEKA 3GXAA 4H65A 4FEBA 1SYHA 3PPQA 2P0SA 4HCYA 1S9TA 1HSEA 1H44A 3S9NC 3KN3A 4DXUA 3R26A 3O6HA 2RC7A 3VE1B 4HW8A 3SEUA 2DVZA 1OVBA 1YCJA 2XXHA 4DIGA 4F1YA 5K2XA 3TCGA 3IX1A 3BKIB 4TOZA 4DXBA 4LQ2A 2GH9A 4GL8A 4ZECA 1YTVA 1II5A 1M5EA 3TTKA 1FTJA 3OO9A 4IB2A 3C36A 1NNTA 1Y4CA 1ELJA 4R72A 4LONB 3C32A 2XXVA 4ZZAA 4I1DA 4YU0A 2P2AA 1B7HA 3GBBA 1HSJA 4FORA 1XT8A 4QFNA 1MQHA 4G68A 4U4XA 3O2AA 4IO5A 2PBWA 1RYXA 1XOCA 5B7DA 5I2KA 3L6HA 5JEIA 2Y7KA 3K6UA 1MXXA 2OBGA 1AL3A 3ZSFA 2XX8A 1D9VA 2VP1A 2OWTA 3H7MA 3VLWA 1I69A 2ONRA 3N6UA 3GBAA 2B3BA 3RNNA 2V93A 2R71A 3FASA 3MVZA 5I58B 2ZNSA 5TPAA 5I84A 2HQ0A 3OO6A 1M5CA 2CMOA 3RQTA 3IK6B 1L5TA 1IXIA 1ZJLA 3K2DA 3EHTA 4C0RA 1FQCA 2OK2A 3BFUA 2H4IA 3VLUA 3PGFA 5AA2D 3O6GA 4Q0CA 1MDP1 1OLCA 4QFKA 4WEDA 3K0VA 1VFEA 4DZ1A 2F6PA 1TWYA 2PMSA 4ONYA 4QFOA 2F78A 2IEEA 1BP5A 3E3KA 1IXGA 1TFDA 4NTLA 2XD2A 2OCUA 3MC2A 3OELA 2RCAA 3JV9A 4NF4A 1B40A 3K1MA 4EDPA 4YKJA 4R73A 4POWA 3O28A 1URGA 1MXZA 2NVUB 4Q30B 1B3EA 3ODBA 2W7YA 5AA2B 2HFBA 4KYDA 3FVOA 1N04A 4PQJA 3U92A 3KN7A 3TFLA 3HV1A 3KFMA 5L9MA 4NF8B 3KJ7A 3TTLA 5TU0A 4R9GA 2F7AA 4XIGQ 1EZPA 4LZ7A 4EQ7A 3C35A 4QFPA 4NMYA 2O1LA 1T0KA 1B4HA 1UTBB 4RPNA 1SW4A 3IOUA 2H25A 4F3GA 2RF1A 3OENA 1B7UA 5CRYA 5FTIA 2REGA 3SEXA 1B5HA 4MFIA 3MVWA 5A5XA 3ILTB 4EQ9A 2G93A 4OHNA 4BDNA 2Z23A 3OOAA 2AIXA 3U94A 4F31B 1NNKA 3Q28A 3S4UA 1Y4TA 2QS1A 3EPEA 1SW5A 5H8SA 3IL1B 1B5IA 2D21A 3D4CA 2F7CA 2ZNUA 4IO7A 5IKBA 2O6AA 4H8IA 1LFHA 3FJGA 5EHSA 4H0WA 1LAHE 5DYHA 3TCHA 2O84X 1FQEA 1KWHA 1SI0A 3IJXB 5EHMA 2F34A 2O7UA 3TTNA 1MPDA 3SEYA 4Z7EA 4H5GA 5LOMA 1J1NA 1GR2A 4GRKA 1ZMGA 3B6WA 1I6QA 3CVGA 4JB7A 4IO6A 4MH5A 1JVYA 4R6HA 3IO4A 3V5AA 1AMFA 3BBRA 4QRZA 3ZS6A 3V83A 1JW5A 3IO6A 4ZZEA 2I6EA 2XXRA 3IOVA 2ABHA 4OXVA 1LLSA 3U8QA 5H8HB 1A7LA 4YICA 4L17A 4YB5A 1XHYA 4KD5A 1UIVA 3VXBA 4F2QA 3H6TA 5I59B 2I3WA 3MZ9A 1H45A 1AH5A 4GF8A 4Q5TA 1Y3PA 3CFLA 4K3FA 1BLFA 5F7VA 3HO7A 1SW1A 2KLFA 3PUZE 3TDJA 3UORA 2FA7A 4OESA 3EHUA 3Q29A 4ELPA 4GWOA 3OO7A 3G3IA 2RCBA 4OEVA 3I3VA 4IY5A 1MS7A 3TCFA 3T9UA 1R9LA 2ONKE 4WEPA 2ONSA 4NE4A 4IO3A 2I58A 4XKPA 3QUJA 1N76A 2PVUA 1QUJA 4XKRA 1IXHA 3K6VA 3G3GA 3KBRA 1MXUA 1M5FA 4YB7A 3FXUA 3TYHA 4THIA 2V3QA 4F22A 3EQ1A 3I5OA 2ZYKA 5AA4A 2F7BA 4F1VA 5HPQA 3SESA 2F5XA 3JZJA 3TTRA 4ESXA 1H43A 4FE8A 3IAZA 1FQBA 3MW0A 3OSQA 1Y1MA 1QKBA 2DOJA 4BLAA 2RKMA 4U21A 2GHBA 2XXUA 3P7IA 4Q8RA 4F29A 3KSXA 3T9XB 3LC8A 3H03A 4RK9A 2CZLA 3O6IA 3PUXE 3Q25A 4GVOA 2XHDA 1N84A 2WKYA 5KDTA 3TTMA 4KFQA 3C9HA 2DVCA 4KI0E 2DQVA 1MY1A 3FVNA 3PUYE 2OLBA 5CBSA 3KJTA 4KYEA 4JWOA 5H8FA 1B3GA 1Q35A 1WVJA 4H67A 1S50A 4F1UA 4QF9A 1M5BA 1SI1A 2QS3A 4IGTA 4O3BA 5DEXA 4BDMA 1LFGA 3MZBA 4PFTA 3OSRA 5DVFA 3LSLA 5KCJB 3WAFA 1XC1A 1O63A 2DE4A 3GLBA 1FTLA 2QSXA 1DPEA 1B9JA 3SDFA 2Q2AA 4OMBA 3QXMA 4OZ9A 2ZNTA 4G4PA 2H5YA 2HAUA 3CG3A 1VE4A 1B7ZA 2O51A 3FV2A 4C1TA 2ZYOA 4U22A 4DE8A 4QSEA 4KR5A 1AIVA 1FQDA 4PE5B 1DSNA 3RUMA 1JEVA 2V3UA 2HZKA 5HBCA 3UN6A 1TXFA 4P0GA 4F3SA 1P1UA 3S9EA 1B5JA 4TQUQ 3TEPA 3FVKA 1USYE 4R2BA 4XXUA 1URDA 3IB2A 4OYVA 1MPCA 1D4NA 4ECFA 5J1DA 3W9VA 4NF5B 4N07A 1GTKA 1PC3A 3BFTA 5JTYB 3TQWA 1OQHA 3PV0E 3VVDA 4M4GA 1URSA 3FZVA 4BDRA 4XKQA 5ISUA 4KQPA 4YMBA 5I57A 2O69A 2Q9TA 2A5TB 2ZMBA 2Z22A 4FAJA 2QMXA 4F3BA 3HN0A 1VFDA 4MLVA 3MWBA 3TAJA 4JDFA 3T9HB 2PT1A 1TT1A 1PEBA 2P1SA 5L8DA 1JVXA 2DWHA 2LAOA 2H99A 2E0SA 3D4GA 5DVIA 5ITPA 2UVJA 2X7QA 4DCYA 1GV8A 3SEWA 2ESNA 4ZEDA 2Q8JA 3QIMA 2I0BA 4AB6A 3PPNA 4G8HA 4RPOA 2F36A 2ZXTA 3M3FA 3MQ9A 4EF2A 3MZ1A 1MY4A 1Y3QA 4F18A 1GGGA 4R6KA 3Q26A 5FHOA 3RT8A 2GHAA 1BKAA 1NFTA 3N5LA 3PMXA 5AA1A 2DP8A 1MG1A 1D3KA 4R9FA 3MBPA 4N6PA 3IB1A 1RKMA 1R1NA 5TP9A 2E1SA 4RJZA 5I2NB 3VVEA 1Z7ME 4WXJA 2DXRA 4G8NA 5I56B 4GOTA 4TLMB 5H8NA 1SW2A 1B2HA 3QUFA 2RC9A 3C31A 2AL4A 4X1DA 4U1OA 4JSDA 3ECRA 4O3AA 1NKXA 4BDLA 2I4CA 4NWCA 1I6BA 1MQGA 3KN8A 4PFYA 3IR1A 3IOWA 4PFWA 3CFXA 5H8QB 1QUKA 3FGSA 3PMWA 2I0CA 2Q88A 1MM7A 1DOTA 2XX7A 3M3KA 4FEDA 4NF6B 3G3KA 3H06B 3LBSA 4QFLA 2DWJA 3H6VA 3HCQA 3OXNA 1UTHA 1PBPA 2IA4A 3U93A 3K00A 1F9BA 2Y7RA 1ZU0A 2NXOA 3O66A 3KOTA 4LATA 1CE2A 4OENA 4YKKA 1POY1 1LGBC 2F8DA 4QHQA 4ELQA 4ZE9A 1SDXA 3LR1A 1NNFA 5ICTA 1NMUA 3QSLA 2M8CA 1B3LA 1P99A 2FNCA 4EF1A 4F2OA 3KZGA 1QJMA 4KCDA 1IQ7A 4JXIA 4OFJA 3TODA 4BDQA 1SBPA 1P1OA 4PP0A 5CI5A 1LFIA 3VLVA 4KYSA 3I6VA 4RA1A 3G3FA 4G68B 1PB7A 1MY3A 2ALUA 1EH3A 1PB9A 4ZS9A 3N94A 5I2KB 5HM4B 4GFRA 3PD9A 3QK6A 1ZBMA 2Q2CA 4PFUA 4ZEBA 1JW1A 4G77A 5ITOA 3OO8A 4H6DA 3T93B 1FW0A 2QS4A 4YKIA 1LAFE 3F11A 2QL3A 4G8MA 4JWXA 5FHMA 3E13X 2I48A 3R7XA 4OQOA 3DELB 1IXCA 3ZKKA 1NL5A 3PPPA 2PYYA 5TPAB 2XXQA 2XXXA 4ZEFA 1I6AA 4YZZA 3H6UA 3PD8A 4IO4A 3S9LC 2HCAA 4ND9A 1JETA 1SD3A 3TMGA 1H3DA 4GD5A 5KZTA 1PBQA 1B3HA 3M3LA 3HHFA 3FD3A 3T22A 1FQFA 1NNPA 5DT6A 3KEIA 5I58A 2AL5A 1MXWA 1RYOA 4H1XA 2NUVA 2O7IA 4NF4B 4LA9A 3TUSA 3SERA 3AXFA 3CIJA 3TELA 4R2FA 3A3CA 3E9XA 3ILUB 2VGQA 4RXLA 1OLAA 4F3PA 3K4UA 2XXIA 4M1VA 3DP4A 4EUOA 3FATA 5FHNA 4OVJA 3TQLA 5AE4A 1VSOA 3OMBA 4WKMA 4GIZA 1B1XA 3LUYA 1H76A 3VDFA 1B0LA 2GRVA 3K6XA 3G3HA
chains in the Genus database with same CATH superfamily
4HTGA 4XF5A 2ZYMA 5IAIA 3E4RA 3KGCA 2VD3A 4ISUA 1OVTA 3O9PA 1A54A 1B52A 4AB5A 5AA2A 2Q89A 4LZ8A 5A5XB 2QMWA 4GX6A 4I62A 4I40A 3S2VA 5A5LA 2ZZXA 1NV1A 1LB8A 4NF8A 4GXAA 4H5FA 4AQ4A 4GQOA 2THIA 3IOTA 3H6WA 1N0TA 1LCTA 1PB8A 1XVXA 1FJ6A 3H3GA 5JK4A 1JQFA 4YKPA 2PX1A 4I3YA 1OIBA 1UTBA 2V84A 3CRBA 5CMMA 1FQAA 1B58A 3T1BA 3EF7A 4C1UA 3MJNA 1NV2A 2QPQA 4X1BA 4QSCA 3UP9A 3B7DA 4LVQA 3FJ7A 1NV0A 4P11A 1SVXB 1FBGA 1HSLA 3VVFA 4RK2A 5EYFA 4HE0A 2I4BA 4R74A 4PFIA 3PU5A 4YMAA 2OWZA 4MCOA 1IEJA 1A40A 4OVTA 1G0HA 2UVIA 2V3TA 3RN8A 5CBRA 1YXIA 4NN3A 3DLNA 4U4SA 1ZIUA 2DS9A 1B32A 1JNFA 4JBZA 2CEXA 3CR9A 1Z7NE 2XXWA 4QSDA 2YPNA 4LUBA 3N6TA 3KG2A 1CB6A 3OEMA 4RNSA 1M5DA 2YLNA 4G68C 3B6QA 1MQIA 2CZHA 1FBFA 3QYTA 3PUVE 2F97A 3T9VA 1NUYA 1O64A 4IO2A 3DP8A 4OVQA 5CMKA 3WAEA 3SEVA 3FJMA 3FUZA 5ICQA 4ZEIA 1QW0A 1SYIA 1EZ9A 1MQJA 4N13A 4RYAA 1S7YA 1FBEA 4X48A 4KHZE 4LZ5A 3C4MA 1LBVA 1PDAA 3UIFA 3W9WA 1A8EA 2B4LA 4E0XA 3T66A 3C34A 3RYDA 3U1OA 1XS5A 5H8HA 4XKNA 4OWDA 1IMBA 1N7WA 3RTWB 1IUDA 3KOSA 2MKZA 3T96B 3RTFB 1VDWA 3E79A 4FBPA 2QVRA 5I59A 1KA1A 4MF3A 1B0HA 3CG1A 4DLDA 4NEDA 1Y20A 5CC2A 1MM6A 4OFLA 3MPKA 3G7WA 4GX3A 4OVSA 2F35A 1NH7A 1USYH 1KA0A 1A55A 1B05A 1IITA 2VD2A 3CI8A 3L6GA 2Q8MA 1B6HA 3A3UA 1LBYA 2O1MA 4LP2B 5AA4B 2Z8DA 1RDZA 1QULA 1IIWA 1LAXA 2RC8A 3IORA 1MH4A 5BUUA 2DE2A 1QVSA 2QJEA 4MBPA 3FXQA 4EXLA 1JW4A 1IMCA 3PPOA 3MSTA 5B70A 4MHFA 4OEUA 2A5SA 2H9BA 3V89B 2Y7PA 2Z8FA 4PTKA 3JYRA 3FXRA 3K1NA 1MQDA 3FVGA 4I9DA 3MVYA 2BJJX 3SZPA 5EYGA 1EU8A 3K1PA 5KDTB 4FECA 4FJPA 2HEUA 1IZ1A 3MUQA 4P3LA 4N17A 4N8GA 5H8FB 3K01A 1FBPA 3PUWE 1NH8A 3LSFB 2Y84A 4UACA 3RPWA 5J16A 1FBDA 4XTCQ 5DEXB 3N26A 1LBCA 2XXTA 4LN5A 4R6YA 4X8RA 4PAFA 1N3XA 1FTOA 2FIXA 2UXAA 3SKPA 2YJPA 2DWIA 4DDDA 3EN3A 3DP6A 4OFOA 1IMFA 3OEKA 1Q1KA 4P1EA 1DBZA 1MY2A 1MY0A 2AYSA 2HAVA 3ZKLA 4P9KA 4GXSB 4KPTA 4MMPA 2G29A 1FBCA 3IB0A 3DM0A 4AS4A 3V8XB 4PETA 4POXA 3QAXA 3Q27A 2X26A 3B8BA 4DCXA 4ZE8A 2R6GE 3CFZA 4NX1A 2QRYA 2BJIA 2UVGA 3PPRA 3K02A 4P0IA 4YAHX 3EHSA 5KCJA 1VR5A 1FTMA 5K2YA 1ZTYA 1P1QA 2ZYNA 5CM6A 4JVCA 3B6TA 2OWSA 1QKAA 2QS2A 4H8JA 4TLLB 4GWWA 1DPPA 1FJ9A 3C33A 3TKDA 5EYHA 2DYXA 3U72A 4X9TA 1A8FA 3UA8A 1B51A 4E0WA 2HXWA 3H4ZA 1YAEA 1MH3A 3UGWA 1QUIA 5BWJA 3FV1A 5I57B 2DXYA 2B65A 4HCWA 1MXVA 3G3JA 5FTHA 1TFAA 3VXCA 2XXYA 3MP6A 1DTGA 1LB9A 2XD3A 4ELRA 2UYFA 1ANFA 4OANA 1UIUA 4F19A 3BIGA 4R75A 5M2VA 3MAMA 3PMVA 2OZZA 3S9MC 2UYEA 2NOOA 4NF5A 4PE3A 2ANJA 2VHAA 1DMBA 5JTYA 2PT2A 4NWDA 2HZLA 4JWYA 3MP1A 1AOVA 1US4A 3SETA 1MRPA 4FIMA 4OETA 1O7TA 4OERA 4H46A 1XVYA 3VV5A 1NV4A 4PGPA 5IZZA 1FTKA 4LQ5A 2DSFA 4O3CA 3D1RA 2F3BA 2WBBA 3A29A 4G2ZA 2DE3A 4OTEA 5CMBA 2OJTA 3RPLA 3VFJA 1D9YA 1BTJA 2A5TA 4PGNA 1BIYA 4P1LA 1FCKA 2DWAA 4JSOA 1SQYA 1P1NA 1ATGA 4P56A 3HPIA 1NV6A 1B46A 3ONMA 1OQGA 5CMCA 1NUWA 4O94A 3LSXA 1LBXA 4HS7A 1B4ZA 3CSBA 4GL0A 4GWUA 3KSJA 1EZOA 3LSWA 3TZAA 4O7MA 3CSGA 1LAGE 4UA8A 5IM2A 2NWJA 5ET6A 3O29A 1ZLQA 5L9SA 1BK4A 2F3DA 1SPIA 3FIRA 4ELOA 3IFAA 2FYIA 4PFBA 2D3IA 5TP9B 2XX9A 1DCUA 1Y3NA 4F39A 1R6ZA 3MVXA 3O97A 2XXPA 5L9OA 3MPLA 5H8NB 2R9JA 3RLFE 1EYJA 2Y7IA 1R9QA 4U2RA 2GFEA 4DXCA 3HHGA 2RINA 1WDNA 4YB6A 2P3VA 1A99A 4IY6A 3RGYA 1POTA 3HSTA 1JEUA 3IJOB 4RY1A 3THIA 2B3FA 1P1WA 2V25A 3GZGA 2D5WA 5ESYA 4FATA 5ET8A 1N7XA 2I3VA 1N3WA 1Y1ZA 3W15C 2Y5LA 4GLIA 3M8UA 5AA3A 5I2NA 1ZKBA 2F6GA 3K6WA 2CEYA 5I56A 4U1ZA 4KCCA 4P47A 1MXYA 2Y7WA 3TPAA 1WODA 2VOZA 4IGRA 2REJA 1US5A 5LDZA 1OMPA 5I5PA 1UQWA 2Z8EA 5ELVA 1Y9UA 1B3FA 1FPGA 2UVHA 1LCFA 1LSTA 4I8CA 4Z0IA 3A09A 2XA5A 2H98A 1UTHB 1DTZA 1MDQA 4BDOA 4MLQA 1B1HA 4DI4B 4X04A 1LBBA 3R6UA 4EXKA 1YPNA 3RY3A 4NQ8A 1YZ0A 4U23A 1RDYA 2O68A 4PAIA 3MP8A 5H8QA 5DTBA 5F1QA 1MPBA 1GVCA 4ZDMA 2X7PA 3RT6B 3OD7A 2I49A 1NUZA 5DVJA 3UK4A 4KXPA 5ET7A 4ESWA 4EQBA 4NF6A 3USDA 4ZEKA 3GXAA 4H65A 4FEBA 1SYHA 3PPQA 2P0SA 4HCYA 1S9TA 4OA4A 1HSEA 1H44A 4O8MA 3S9NC 3KN3A 4DXUA 3R26A 3O6HA 2RC7A 2XWOA 3VE1B 4HW8A 4MAGA 3SEUA 2DVZA 1OVBA 1YCJA 2XXHA 4DIGA 4F1YA 5K2XA 3TCGA 3IX1A 3BKIB 4TOZA 4DXBA 4LQ2A 2GH9A 3FXBA 4GL8A 4ZECA 1YTVA 1II5A 1M5EA 3TTKA 1FTJA 3OO9A 4IB2A 3C36A 3KC1A 1NNTA 1Y4CA 1ELJA 4R72A 4LONB 3C32A 2XXVA 2CZKA 4ZZAA 4I1DA 4YU0A 2P2AA 1B7HA 3GBBA 4PC9A 1HSJA 4FORA 1XT8A 4XEQA 4QFNA 3KBZA 1MQHA 2HPGA 4G68A 4MNCA 4U4XA 3O2AA 4N6DA 4IO5A 2PBWA 1EYIA 1RYXA 1XOCA 5B7DA 5I2KA 3L6HA 5JEIA 2Y7KA 3K6UA 1MXXA 2OBGA 1AL3A 3ZSFA 2XX8A 1D9VA 2VP1A 2OWTA 3H7MA 1FRPA 3VLWA 1I69A 2ONRA 3N6UA 3GBAA 2B3BA 3RNNA 2V93A 1KZ8A 2R71A 3FASA 4NF0A 1JP4A 3MVZA 5I58B 2ZNSA 5TPAA 5I84A 2HQ0A 3OO6A 1M5CA 2CMOA 3RQTA 3IK6B 3IFCA 5IZ3A 1L5TA 1IXIA 1ZJLA 3K2DA 3EHTA 4C0RA 1FQCA 2OK2A 3BFUA 2H4IA 3VLUA 3PGFA 5AA2D 3O6GA 4Q0CA 4DI3D 1MDP1 1OLCA 4QFKA 4WEDA 3K0VA 1VFEA 4DZ1A 2F6PA 1TWYA 2PMSA 4ONYA 4QFOA 2F78A 2IEEA 1BP5A 3E3KA 1IXGA 1TFDA 4NTLA 2XD2A 2OCUA 2KR0A 3MC2A 3OELA 2RCAA 3JV9A 4NF4A 2HHMA 1B40A 3K1MA 4EDPA 4YKJA 4R73A 4POWA 4MNIA 3O28A 1FPKA 1MXZA 1URGA 2XWVA 2NVUB 4Q30B 1AWBA 2FIEA 1B3EA 3ODBA 2W7YA 1IMEA 5DW8A 5AA2B 2HFBA 4KYDA 4GWSA 3FVOA 1N04A 4PQJA 3U92A 3KN7A 3TFLA 3HV1A 3KFMA 5L9MA 4NF8B 3KJ7A 3TTLA 5TU0A 4R9GA 2F7AA 4XIGQ 1EZPA 4LZ7A 4EQ7A 3C35A 4QFPA 4NMYA 2O1LA 1T0KA 1B4HA 1UTBB 4RPNA 1SW4A 3IOUA 2H25A 4F3GA 2RF1A 3U65A 3OENA 1B7UA 5CRYA 5FTIA 2REGA 3SEXA 1B5HA 4MFIA 3MVWA 5A5XA 3ILTB 2VPNA 4EQ9A 2G93A 4OHNA 2ZZWA 2OX3A 4BDNA 2Z23A 3OOAA 2AIXA 3U94A 4F31B 1NNKA 5EQAA 3Q28A 3S4UA 4I3EA 1Y4TA 2QS1A 3EPEA 4MNPA 1SW5A 5H8SA 5F24A 3IL1B 1B5IA 2D21A 3D4CA 2F7CA 2ZNUA 2Q74A 4IO7A 5IKBA 2O6AA 4H8IA 1LFHA 3CHGA 3FJGA 5EHSA 4H0WA 1LAHE 5DYHA 3TCHA 2O84X 1FQEA 1KWHA 1SI0A 4HE2A 3IJXB 5EHMA 4MIJA 2F34A 2O7UA 3TTNA 1MPDA 3SEYA 4Z7EA 4H5GA 4NAPA 5LOMA 1J1NA 1GR2A 4GRKA 1ZMGA 2XWIA 4GWZA 3B6WA 2PFYA 1I6QA 3CVGA 4JB7A 4PFRA 4IO6A 4MH5A 1JVYA 4R6HA 3IO4A 1NV5A 2P3NA 3V5AA 1AMFA 3BBRA 4QRZA 1EYKA 3ZS6A 3V83A 3LV0A 1JW5A 3IO6A 4ZZEA 4N8YA 5IGAA 2I6EA 2XXRA 3IOVA 2ABHA 4OXVA 1LLSA 4QXDA 3U8QA 5H8HB 1A7LA 3ISPA 4YICA 4L17A 4PBHA 4YB5A 1XHYA 4KD5A 1UIVA 3VXBA 4F2QA 3PTYA 3H6TA 4N4UA 2I3WA 3MZ9A 5I59B 1H45A 1XI6A 1AH5A 4GF8A 4Q5TA 1Y3PA 3CFLA 4K3FA 1BLFA 5F7VA 3HO7A 1SW1A 2KLFA 3PUZE 3TDJA 3UORA 2FA7A 2B4MA 4OESA 3EHUA 3Q29A 4NG7A 4ELPA 3LUZA 4GWOA 4UABA 3OO7A 3G3IA 2RCBA 4OEVA 3I3VA 4IY5A 1MS7A 3TCFA 1NV7A 3T9UA 1R9LA 4GWXA 4PDDA 2ONKE 4WEPA 4N81A 2ONSA 4NHBA 4NE4A 4IO3A 2I58A 4XKPA 3QUJA 2R8TA 1FPJA 1N76A 2PVUA 2FVZA 1QUJA 4XKRA 1IXHA 3K6VA 4AS5A 3G3GA 1FPEA 3KBRA 1MXUA 1M5FA 4YB7A 3FXUA 3TYHA 4THIA 2V3QA 4F22A 2FHYA 3EQ1A 3I5OA 2ZYKA 1FSAA 5AA4A 2F7BA 4F1VA 5HPQA 3SESA 5ET5A 2F5XA 2ZZVA 3JZJA 3TTRA 4ESXA 1H43A 4FE8A 3IAZA 1FQBA 3MW0A 3OSQA 1Y1MA 1QKBA 2DOJA 4BLAA 2RKMA 4U21A 2GHBA 2XWKA 2XXUA 1FTAA 3P7IA 4Q8RA 4F29A 3KSXA 3T9XB 3LC8A 2VT5A 3H03A 4RK9A 2CZLA 3O6IA 3PUXE 3Q25A 4GVOA 2XHDA 1N84A 2WKYA 5KDTA 3TTMA 4KFQA 3C9HA 1NI9A 2DVCA 4KI0E 2DQVA 1MY1A 2WYKA 3FVNA 3PUYE 2OLBA 5CBSA 1G0IA 2WX9A 3KJTA 4KYEA 4JWOA 5H8FA 1D9QA 1B3GA 1FPIA 1Q35A 1WVJA 4H67A 1S50A 4F1UA 1LBWA 4QF9A 3KC0A 2KQZA 1M5BA 1SI1A 2QS3A 4IGTA 4O3BA 5DEXA 3T0JA 4BDMA 1LFGA 3MZBA 4PFTA 3ROJA 1NV3A 3OSRA 5DVFA 3LSLA 2PCRA 5KCJB 3WAFA 1Q9DA 2QVVA 1XC1A 1O63A 2DE4A 3GLBA 1FTLA 2QSXA 4OVPA 1DPEA 1B9JA 3SDFA 2Q2AA 4OMBA 3QXMA 4OZ9A 2ZNTA 4G4PA 2H5YA 2HAUA 3CG3A 1VE4A 1B7ZA 2QVUA 2O51A 3FV2A 4C1TA 3NOHA 2ZYOA 4U22A 4DE8A 4MX6A 4QSEA 4KR5A 1AIVA 1FQDA 4PE5B 1DSNA 1IMAA 3RUMA 1JEVA 2V3UA 2HZKA 5HBCA 3UN6A 1TXFA 4P0GA 4F3SA 1QGXA 1P1UA 3S9EA 1B5JA 4TQUQ 3TEPA 3FVKA 1USYE 4R2BA 1NUXA 4XXUA 1URDA 2V4CA 3IB2A 4OYVA 1MPCA 5IZ1A 1D4NA 4ECFA 5J1DA 3W9VA 4NF5B 4N07A 1GTKA 1PC3A 3BFTA 5JTYB 2VPOA 3TQWA 1OQHA 3PV0E 3VVDA 4OVRA 4M4GA 2DDKA 1URSA 3FBPA 3FZVA 4BDRA 4XKQA 5ISUA 1FPBA 4KQPA 4YMBA 4PAKA 1LEVA 5I57A 4PDHA 2O69A 3RPLB 2Q9TA 2A5TB 4G61A 2ZMBA 2Z22A 4FAJA 2QMXA 4F3BA 3HN0A 2GQ1A 1VFDA 3B50A 4MLVA 3MWBA 5EQ7A 3TAJA 4JDFA 3T9HB 2PT1A 1TT1A 1PEBA 2P1SA 5L8DA 1JVXA 3BIHA 2DWHA 2LAOA 1K9ZA 2H99A 2E0SA 1FPFA 3D4GA 1FPDA 5DVIA 4N91A 5ITPA 2UVJA 2X7QA 4O7IA 4DCYA 5EQ8A 1GV8A 3SEWA 2ESNA 4ZEDA 2Q8JA 3QIMA 2I0BA 4AB6A 3PPNA 4G8HA 4RPOA 4XFEA 2F36A 2ZXTA 3M3FA 3MQ9A 4EF2A 3MZ1A 1YYZA 1MY4A 1Y3QA 3E78A 4F18A 1GGGA 4R6KA 3Q26A 5EQ9A 5FHOA 3RT8A 2GHAA 1BKAA 1NFTA 3N5LA 3PMXA 5AA1A 2DP8A 1RDXA 1MG1A 1D3KA 4R9FA 3MBPA 4N6PA 3EKIA 3IB1A 1RKMA 1R1NA 5TP9A 2E1SA 4RJZA 5I2NB 3VVEA 1Z7ME 4WXJA 2DXRA 4G8NA 5I56B 4GOTA 4TLMB 5H8NA 4N15A 1SW2A 1B2HA 3HFUA 3QUFA 2RC9A 3C31A 2AL4A 1K9YA 4X1DA 4U1OA 4JSDA 1INPA 3ECRA 4O3AA 4H45A 1NKXA 4BDLA 4PCDA 2I4CA 3GYYA 4NWCA 1IMDA 1I6BA 1MQGA 3KN8A 4PFYA 3IR1A 3IOWA 4P8BA 2FBPA 4PFWA 3CFXA 5H8QB 1QUKA 3FGSA 3PMWA 2I0CA 1LBZA 2Q88A 1MM7A 1DOTA 2XX7A 3M3KA 4JVIA 4FEDA 4NF6B 3G3KA 3H06B 4NGUA 3LBSA 4QFLA 4GX4A 2DWJA 3H6VA 3HCQA 3OXNA 1FBHA 1UTHA 1PBPA 2IA4A 3U93A 3K00A 1F9BA 2PFZA 2Y7RA 1ZU0A 2NXOA 2WBDA 4MEVA 3O66A 3KOTA 4LATA 1CE2A 4OENA 4YKKA 1POY1 1LGBC 2F8DA 4N6KA 4QHQA 4ELQA 4ZE9A 1SDXA 3LR1A 1NNFA 5ICTA 1NMUA 5T3JA 3QSLA 2M8CA 1B3LA 1P99A 2FNCA 4EF1A 4F2OA 3KZGA 1QJMA 4KCDA 2CZIA 1IQ7A 4JXIA 4OFJA 3TODA 4BDQA 1SBPA 1P1OA 2Y5KA 4PP0A 5CI5A 1LFIA 3VLVA 5LTCA 4KYSA 4HE1A 3I6VA 4RA1A 2QFLA 3G3FA 4G68B 1PB7A 1MY3A 2ALUA 1EH3A 1PB9A 4ZS9A 3N94A 3MYUA 5I2KB 5HM4B 4GFRA 3PD9A 3QK6A 1ZBMA 2Q2CA 4PFUA 4ZEBA 1JW1A 4G77A 5ITOA 3OO8A 4H6DA 3T93B 2WYPA 1FW0A 2QS4A 4YKIA 1LAFE 3F11A 2QL3A 4G8MA 4JWXA 5FHMA 3E13X 2I48A 3R7XA 4GBWA 4OQOA 3DELB 1IXCA 3ZKKA 1NL5A 3PPPA 2PYYA 5I3SA 2WEFA 5TPAB 2XXQA 2XXXA 2XXKA 4GBVA 4ZEFA 1I6AA 4YZZA 3H6UA 3PD8A 5IZ3B 4PF8A 4IO4A 3S9LC 2HCAA 4ND9A 1JETA 1SD3A 3TMGA 1H3DA 4GD5A 5KZTA 3QMFA 1PBQA 1B3HA 3M3LA 3HHFA 4PBQA 3FD3A 3T22A 1FQFA 4MJOA 1NNPA 5DT6A 1FPLA 3KEIA 5I58A 2AL5A 1MXWA 1RYOA 4JVDA 4H1XA 2NUVA 2O7IA 4NF4B 2L5VA 2JJKA 4LA9A 4PF6A 3TUSA 3SERA 1DK4A 3AXFA 3CIJA 3TELA 4R2FA 1CNQA 4IR8A 3A3CA 3E9XA 3ILUB 2VGQA 4HXVA 4RXLA 5I7IA 1OLAA 4F3PA 3K4UA 4M1VA 2XXIA 3DP4A 4EUOA 4GWYA 3FATA 5FHNA 4OVJA 3TQLA 5AE4A 1VSOA 5FBPA 3OMBA 4WKMA 4GIZA 1B1XA 3LUYA 1H76A 3VDFA 1B0LA 2GRVA 3K6XA 3G3HA 2HXRA 4QBAA
chains in the Genus database with same CATH topology
4HTGA 2ZYMA 5IAIA 3E4RA 3KGCA 2VD3A 4ISUA 1OVTA 3O9PA 1A54A 1B52A 4AB5A 5AA2A 2Q89A 4LZ8A 5A5XB 2QMWA 4I62A 3S2VA 1LB8A 4NF8A 4GXAA 4H5FA 4AQ4A 4GQOA 2THIA 3IOTA 3H6WA 1N0TA 1LCTA 1PB8A 1XVXA 3H3GA 5JK4A 1JQFA 4YKPA 2PX1A 1OIBA 1UTBA 2V84A 3CRBA 5CMMA 1FQAA 1B58A 3EF7A 4C1UA 3MJNA 2QPQA 4X1BA 4QSCA 3UP9A 3B7DA 4LVQA 3FJ7A 4P11A 1SVXB 1HSLA 3VVFA 4RK2A 5EYFA 2I4BA 4R74A 3PU5A 4YMAA 1IEJA 1A40A 2UVIA 2V3TA 3RN8A 5CBRA 3DLNA 4U4SA 1ZIUA 2DS9A 1B32A 1JNFA 4JBZA 3CR9A 1Z7NE 2XXWA 4QSDA 2YPNA 4LUBA 3N6TA 3KG2A 1CB6A 3OEMA 4RNSA 1M5DA 2YLNA 4G68C 3B6QA 1MQIA 3QYTA 3PUVE 2F97A 3T9VA 1O64A 4IO2A 3DP8A 5CMKA 3WAEA 3SEVA 3FJMA 3FUZA 5ICQA 4ZEIA 1QW0A 1SYIA 1EZ9A 1MQJA 4N13A 4RYAA 1S7YA 4X48A 4KHZE 4LZ5A 3C4MA 1PDAA 3UIFA 3W9WA 1A8EA 4E0XA 3T66A 3C34A 3U1OA 1XS5A 5H8HA 4XKNA 4OWDA 1N7WA 3RTWB 1IUDA 3KOSA 3T96B 3RTFB 5I59A 4MF3A 1B0HA 3CG1A 4DLDA 4NEDA 1Y20A 5CC2A 1MM6A 4OFLA 3MPKA 3G7WA 2F35A 1NH7A 1USYH 1A55A 1B05A 1IITA 2VD2A 3CI8A 3L6GA 1B6HA 3A3UA 2O1MA 4LP2B 5AA4B 2Z8DA 1QULA 1IIWA 1LAXA 2RC8A 3IORA 1MH4A 5BUUA 2DE2A 1QVSA 2QJEA 4MBPA 3FXQA 4EXLA 1JW4A 3PPOA 5B70A 4OEUA 2A5SA 2H9BA 3V89B 2Y7PA 2Z8FA 3JYRA 3FXRA 3K1NA 1MQDA 3FVGA 4I9DA 3MVYA 2BJJX 1EU8A 3K1PA 5KDTB 4FECA 4FJPA 2HEUA 1IZ1A 3MUQA 5H8FB 3K01A 3PUWE 1NH8A 3LSFB 2Y84A 4UACA 3RPWA 4XTCQ 5DEXB 3N26A 1LBCA 2XXTA 4R6YA 1N3XA 1FTOA 2UXAA 3SKPA 2YJPA 2DWIA 4DDDA 3EN3A 3DP6A 4OFOA 3OEKA 1Q1KA 1MY2A 1MY0A 2AYSA 2HAVA 3ZKLA 4GXSB 4KPTA 2G29A 3IB0A 3DM0A 3V8XB 4PETA 4POXA 3QAXA 3Q27A 2X26A 4DCXA 4ZE8A 2R6GE 3CFZA 2QRYA 2UVGA 3PPRA 3K02A 4P0IA 4YAHX 3EHSA 5KCJA 1VR5A 1FTMA 5K2YA 1ZTYA 1P1QA 2ZYNA 5CM6A 3B6TA 2OWSA 1QKAA 2QS2A 4H8JA 4TLLB 1DPPA 3C33A 3TKDA 2DYXA 3U72A 4X9TA 1A8FA 3UA8A 1B51A 4E0WA 2HXWA 3H4ZA 1YAEA 1MH3A 3UGWA 1QUIA 5BWJA 3FV1A 5I57B 2DXYA 2B65A 4HCWA 1MXVA 3G3JA 5FTHA 1TFAA 3VXCA 2XXYA 3MP6A 1DTGA 1LB9A 2XD3A 4ELRA 2UYFA 1ANFA 1UIUA 4F19A 4R75A 5M2VA 3MAMA 3PMVA 2OZZA 3S9MC 2UYEA 2NOOA 4NF5A 2ANJA 2VHAA 1DMBA 5JTYA 2PT2A 4NWDA 2HZLA 4JWYA 3MP1A 1AOVA 1US4A 3SETA 1MRPA 4FIMA 4OETA 1O7TA 4OERA 1XVYA 3VV5A 1FTKA 4LQ5A 2DSFA 4O3CA 4G2ZA 2DE3A 4OTEA 5CMBA 2OJTA 3VFJA 1D9YA 1BTJA 2A5TA 1BIYA 1FCKA 2DWAA 4JSOA 1SQYA 1P1NA 1ATGA 3HPIA 1B46A 3ONMA 1OQGA 5CMCA 3LSXA 4HS7A 1B4ZA 3CSBA 4GL0A 3KSJA 1EZOA 3LSWA 3TZAA 3CSGA 1LAGE 4UA8A 2NWJA 3O29A 1ZLQA 5L9SA 3FIRA 4ELOA 2FYIA 2D3IA 5TP9B 2XX9A 1Y3NA 4F39A 1R6ZA 3MVXA 3O97A 2XXPA 5L9OA 3MPLA 5H8NB 2R9JA 3RLFE 2Y7IA 1R9QA 4U2RA 2GFEA 4DXCA 3HHGA 2RINA 1WDNA 4YB6A 1A99A 4IY6A 3RGYA 1POTA 3HSTA 1JEUA 3IJOB 4RY1A 3THIA 2B3FA 1P1WA 2V25A 3GZGA 2D5WA 4FATA 1N7XA 2I3VA 1N3WA 1Y1ZA 3W15C 4GLIA 3M8UA 5AA3A 5I2NA 1ZKBA 2F6GA 3K6WA 5I56A 4U1ZA 4KCCA 1MXYA 2Y7WA 3TPAA 1WODA 2VOZA 4IGRA 2REJA 1US5A 1OMPA 1UQWA 2Z8EA 5ELVA 1Y9UA 1B3FA 2UVHA 1LCFA 1LSTA 4I8CA 4Z0IA 3A09A 2H98A 1UTHB 1DTZA 1MDQA 4BDOA 4MLQA 1B1HA 1LBBA 3R6UA 4EXKA 1YPNA 3RY3A 4U23A 2O68A 3MP8A 5H8QA 5DTBA 5F1QA 1MPBA 1GVCA 4ZDMA 2X7PA 3RT6B 3OD7A 2I49A 5DVJA 3UK4A 4ESWA 4EQBA 4NF6A 3USDA 4ZEKA 3GXAA 4H65A 4FEBA 1SYHA 3PPQA 2P0SA 4HCYA 1S9TA 1HSEA 1H44A 3S9NC 3KN3A 4DXUA 3R26A 3O6HA 2RC7A 3VE1B 4HW8A 3SEUA 2DVZA 1OVBA 1YCJA 2XXHA 4DIGA 4F1YA 5K2XA 3TCGA 3IX1A 3BKIB 4TOZA 4DXBA 4LQ2A 2GH9A 4GL8A 4ZECA 1YTVA 1II5A 1M5EA 3TTKA 1FTJA 3OO9A 4IB2A 3C36A 1NNTA 1Y4CA 1ELJA 4R72A 4LONB 3C32A 2XXVA 4ZZAA 4I1DA 4YU0A 2P2AA 1B7HA 3GBBA 1HSJA 4FORA 1XT8A 4QFNA 1MQHA 4G68A 4U4XA 3O2AA 4IO5A 2PBWA 1RYXA 1XOCA 5B7DA 5I2KA 3L6HA 5JEIA 2Y7KA 3K6UA 1MXXA 2OBGA 1AL3A 3ZSFA 2XX8A 1D9VA 2VP1A 2OWTA 3H7MA 3VLWA 1I69A 2ONRA 3N6UA 3GBAA 2B3BA 3RNNA 2V93A 2R71A 3FASA 3MVZA 5I58B 2ZNSA 5TPAA 5I84A 2HQ0A 3OO6A 1M5CA 2CMOA 3RQTA 3IK6B 1L5TA 1IXIA 1ZJLA 3K2DA 3EHTA 4C0RA 1FQCA 2OK2A 3BFUA 2H4IA 3VLUA 3PGFA 5AA2D 3O6GA 4Q0CA 1MDP1 1OLCA 4QFKA 4WEDA 3K0VA 1VFEA 4DZ1A 2F6PA 1TWYA 2PMSA 4ONYA 4QFOA 2F78A 2IEEA 1BP5A 3E3KA 1IXGA 1TFDA 4NTLA 2XD2A 2OCUA 3MC2A 3OELA 2RCAA 3JV9A 4NF4A 1B40A 3K1MA 4EDPA 4YKJA 4R73A 4POWA 3O28A 1URGA 1MXZA 2NVUB 4Q30B 1B3EA 3ODBA 2W7YA 5AA2B 2HFBA 4KYDA 3FVOA 1N04A 4PQJA 3U92A 3KN7A 3TFLA 3HV1A 3KFMA 5L9MA 4NF8B 3KJ7A 3TTLA 5TU0A 4R9GA 2F7AA 4XIGQ 1EZPA 4LZ7A 4EQ7A 3C35A 4QFPA 4NMYA 2O1LA 1T0KA 1B4HA 1UTBB 4RPNA 1SW4A 3IOUA 2H25A 4F3GA 2RF1A 3OENA 1B7UA 5CRYA 5FTIA 2REGA 3SEXA 1B5HA 4MFIA 3MVWA 5A5XA 3ILTB 4EQ9A 2G93A 4OHNA 4BDNA 2Z23A 3OOAA 2AIXA 3U94A 4F31B 1NNKA 3Q28A 3S4UA 1Y4TA 2QS1A 3EPEA 1SW5A 5H8SA 3IL1B 1B5IA 2D21A 3D4CA 2F7CA 2ZNUA 4IO7A 5IKBA 2O6AA 4H8IA 1LFHA 3FJGA 5EHSA 4H0WA 1LAHE 5DYHA 3TCHA 2O84X 1FQEA 1KWHA 1SI0A 3IJXB 5EHMA 2F34A 2O7UA 3TTNA 1MPDA 3SEYA 4Z7EA 4H5GA 5LOMA 1J1NA 1GR2A 4GRKA 1ZMGA 3B6WA 1I6QA 3CVGA 4JB7A 4IO6A 4MH5A 1JVYA 4R6HA 3IO4A 3V5AA 1AMFA 3BBRA 4QRZA 3ZS6A 3V83A 1JW5A 3IO6A 4ZZEA 2I6EA 2XXRA 3IOVA 2ABHA 4OXVA 1LLSA 3U8QA 5H8HB 1A7LA 4YICA 4L17A 4YB5A 1XHYA 4KD5A 1UIVA 3VXBA 4F2QA 3H6TA 5I59B 2I3WA 3MZ9A 1H45A 1AH5A 4GF8A 4Q5TA 1Y3PA 3CFLA 4K3FA 1BLFA 5F7VA 3HO7A 1SW1A 2KLFA 3PUZE 3TDJA 3UORA 2FA7A 4OESA 3EHUA 3Q29A 4ELPA 4GWOA 3OO7A 3G3IA 2RCBA 4OEVA 3I3VA 4IY5A 1MS7A 3TCFA 3T9UA 1R9LA 2ONKE 4WEPA 2ONSA 4NE4A 4IO3A 2I58A 4XKPA 3QUJA 1N76A 2PVUA 1QUJA 4XKRA 1IXHA 3K6VA 3G3GA 3KBRA 1MXUA 1M5FA 4YB7A 3FXUA 3TYHA 4THIA 2V3QA 4F22A 3EQ1A 3I5OA 2ZYKA 5AA4A 2F7BA 4F1VA 5HPQA 3SESA 2F5XA 3JZJA 3TTRA 4ESXA 1H43A 4FE8A 3IAZA 1FQBA 3MW0A 3OSQA 1Y1MA 1QKBA 2DOJA 4BLAA 2RKMA 4U21A 2GHBA 2XXUA 3P7IA 4Q8RA 4F29A 3KSXA 3T9XB 3LC8A 3H03A 4RK9A 2CZLA 3O6IA 3PUXE 3Q25A 4GVOA 2XHDA 1N84A 2WKYA 5KDTA 3TTMA 4KFQA 3C9HA 2DVCA 4KI0E 2DQVA 1MY1A 3FVNA 3PUYE 2OLBA 5CBSA 3KJTA 4KYEA 4JWOA 5H8FA 1B3GA 1Q35A 1WVJA 4H67A 1S50A 4F1UA 4QF9A 1M5BA 1SI1A 2QS3A 4IGTA 4O3BA 5DEXA 4BDMA 1LFGA 3MZBA 4PFTA 3OSRA 5DVFA 3LSLA 5KCJB 3WAFA 1XC1A 1O63A 2DE4A 3GLBA 1FTLA 2QSXA 1DPEA 1B9JA 3SDFA 2Q2AA 4OMBA 3QXMA 4OZ9A 2ZNTA 4G4PA 2H5YA 2HAUA 3CG3A 1VE4A 1B7ZA 2O51A 3FV2A 4C1TA 2ZYOA 4U22A 4DE8A 4QSEA 4KR5A 1AIVA 1FQDA 4PE5B 1DSNA 3RUMA 1JEVA 2V3UA 2HZKA 5HBCA 3UN6A 1TXFA 4P0GA 4F3SA 1P1UA 3S9EA 1B5JA 4TQUQ 3TEPA 3FVKA 1USYE 4R2BA 4XXUA 1URDA 3IB2A 4OYVA 1MPCA 1D4NA 4ECFA 5J1DA 3W9VA 4NF5B 4N07A 1GTKA 1PC3A 3BFTA 5JTYB 3TQWA 1OQHA 3PV0E 3VVDA 4M4GA 1URSA 3FZVA 4BDRA 4XKQA 5ISUA 4KQPA 4YMBA 5I57A 2O69A 2Q9TA 2A5TB 2ZMBA 2Z22A 4FAJA 2QMXA 4F3BA 3HN0A 1VFDA 4MLVA 3MWBA 3TAJA 4JDFA 3T9HB 2PT1A 1TT1A 1PEBA 2P1SA 5L8DA 1JVXA 2DWHA 2LAOA 2H99A 2E0SA 3D4GA 5DVIA 5ITPA 2UVJA 2X7QA 4DCYA 1GV8A 3SEWA 2ESNA 4ZEDA 2Q8JA 3QIMA 2I0BA 4AB6A 3PPNA 4G8HA 4RPOA 2F36A 2ZXTA 3M3FA 3MQ9A 4EF2A 3MZ1A 1MY4A 1Y3QA 4F18A 1GGGA 4R6KA 3Q26A 5FHOA 3RT8A 2GHAA 1BKAA 1NFTA 3N5LA 3PMXA 5AA1A 2DP8A 1MG1A 1D3KA 4R9FA 3MBPA 4N6PA 3IB1A 1RKMA 1R1NA 5TP9A 2E1SA 4RJZA 5I2NB 3VVEA 1Z7ME 4WXJA 2DXRA 4G8NA 5I56B 4GOTA 4TLMB 5H8NA 1SW2A 1B2HA 3QUFA 2RC9A 3C31A 2AL4A 4X1DA 4U1OA 4JSDA 3ECRA 4O3AA 1NKXA 4BDLA 2I4CA 4NWCA 1I6BA 1MQGA 3KN8A 4PFYA 3IR1A 3IOWA 4PFWA 3CFXA 5H8QB 1QUKA 3FGSA 3PMWA 2I0CA 2Q88A 1MM7A 1DOTA 2XX7A 3M3KA 4FEDA 4NF6B 3G3KA 3H06B 3LBSA 4QFLA 2DWJA 3H6VA 3HCQA 3OXNA 1UTHA 1PBPA 2IA4A 3U93A 3K00A 1F9BA 2Y7RA 1ZU0A 2NXOA 3O66A 3KOTA 4LATA 1CE2A 4OENA 4YKKA 1POY1 1LGBC 2F8DA 4QHQA 4ELQA 4ZE9A 1SDXA 3LR1A 1NNFA 5ICTA 1NMUA 3QSLA 2M8CA 1B3LA 1P99A 2FNCA 4EF1A 4F2OA 3KZGA 1QJMA 4KCDA 1IQ7A 4JXIA 4OFJA 3TODA 4BDQA 1SBPA 1P1OA 4PP0A 5CI5A 1LFIA 3VLVA 4KYSA 3I6VA 4RA1A 3G3FA 4G68B 1PB7A 1MY3A 2ALUA 1EH3A 1PB9A 4ZS9A 3N94A 5I2KB 5HM4B 4GFRA 3PD9A 3QK6A 1ZBMA 2Q2CA 4PFUA 4ZEBA 1JW1A 4G77A 5ITOA 3OO8A 4H6DA 3T93B 1FW0A 2QS4A 4YKIA 1LAFE 3F11A 2QL3A 4G8MA 4JWXA 5FHMA 3E13X 2I48A 3R7XA 4OQOA 3DELB 1IXCA 3ZKKA 1NL5A 3PPPA 2PYYA 5TPAB 2XXQA 2XXXA 4ZEFA 1I6AA 4YZZA 3H6UA 3PD8A 4IO4A 3S9LC 2HCAA 4ND9A 1JETA 1SD3A 3TMGA 1H3DA 4GD5A 5KZTA 1PBQA 1B3HA 3M3LA 3HHFA 3FD3A 3T22A 1FQFA 1NNPA 5DT6A 3KEIA 5I58A 2AL5A 1MXWA 1RYOA 4H1XA 2NUVA 2O7IA 4NF4B 4LA9A 3TUSA 3SERA 3AXFA 3CIJA 3TELA 4R2FA 3A3CA 3E9XA 3ILUB 2VGQA 4RXLA 1OLAA 4F3PA 3K4UA 2XXIA 4M1VA 3DP4A 4EUOA 3FATA 5FHNA 4OVJA 3TQLA 5AE4A 1VSOA 3OMBA 4WKMA 4GIZA 1B1XA 3LUYA 1H76A 3VDFA 1B0LA 2GRVA 3K6XA 3G3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTG A;  2ZYM A;  5IAI A;  3E4R A;  3KGC A;  2VD3 A;  4ISU A;  1OVT A;  3O9P A;  1A54 A;  1B52 A;  4AB5 A;  5AA2 A;  2Q89 A;  4LZ8 A;  5A5X B;  2QMW A;  4I62 A;  3S2V A;  1LB8 A;  4NF8 A;  4GXA A;  4H5F A;  4AQ4 A;  4GQO A;  2THI A;  3IOT A;  3H6W A;  1N0T A;  1LCT A;  1PB8 A;  1XVX A;  3H3G A;  5JK4 A;  1JQF A;  4YKP A;  2PX1 A;  1OIB A;  1UTB A;  2V84 A;  3CRB A;  5CMM A;  1FQA A;  1B58 A;  3EF7 A;  4C1U A;  3MJN A;  2QPQ A;  4X1B A;  4QSC A;  3UP9 A;  3B7D A;  4LVQ A;  3FJ7 A;  4P11 A;  1SVX B;  1HSL A;  3VVF A;  4RK2 A;  5EYF A;  2I4B A;  4R74 A;  3PU5 A;  4YMA A;  1IEJ A;  1A40 A;  2UVI A;  2V3T A;  3RN8 A;  5CBR A;  3DLN A;  4U4S A;  1ZIU A;  2DS9 A;  1B32 A;  1JNF A;  4JBZ A;  3CR9 A;  1Z7N E;  2XXW A;  4QSD A;  2YPN A;  4LUB A;  3N6T A;  3KG2 A;  1CB6 A;  3OEM A;  4RNS A;  1M5D A;  2YLN A;  4G68 C;  3B6Q A;  1MQI A;  3QYT A;  3PUV E;  2F97 A;  3T9V A;  1O64 A;  4IO2 A;  3DP8 A;  5CMK A;  3WAE A;  3SEV A;  3FJM A;  3FUZ A;  5ICQ A;  4ZEI A;  1QW0 A;  1SYI A;  1EZ9 A;  1MQJ A;  4N13 A;  4RYA A;  1S7Y A;  4X48 A;  4KHZ E;  4LZ5 A;  3C4M A;  1PDA A;  3UIF A;  3W9W A;  1A8E A;  4E0X A;  3T66 A;  3C34 A;  3U1O A;  1XS5 A;  5H8H A;  4XKN A;  4OWD A;  1N7W A;  3RTW B;  1IUD A;  3KOS A;  3T96 B;  3RTF B;  5I59 A;  4MF3 A;  1B0H A;  3CG1 A;  4DLD A;  4NED A;  1Y20 A;  5CC2 A;  1MM6 A;  4OFL A;  3MPK A;  3G7W A;  2F35 A;  1NH7 A;  1USY H;  1A55 A;  1B05 A;  1IIT A;  2VD2 A;  3CI8 A;  3L6G A;  1B6H A;  3A3U A;  2O1M A;  4LP2 B;  5AA4 B;  2Z8D A;  1QUL A;  1IIW A;  1LAX A;  2RC8 A;  3IOR A;  1MH4 A;  5BUU A;  2DE2 A;  1QVS A;  2QJE A;  4MBP A;  3FXQ A;  4EXL A;  1JW4 A;  3PPO A;  5B70 A;  4OEU A;  2A5S A;  2H9B A;  3V89 B;  2Y7P A;  2Z8F A;  3JYR A;  3FXR A;  3K1N A;  1MQD A;  3FVG A;  4I9D A;  3MVY A;  2BJJ X;  1EU8 A;  3K1P A;  5KDT B;  4FEC A;  4FJP A;  2HEU A;  1IZ1 A;  3MUQ A;  5H8F B;  3K01 A;  3PUW E;  1NH8 A;  3LSF B;  2Y84 A;  4UAC A;  3RPW A;  4XTC Q;  5DEX B;  3N26 A;  1LBC A;  2XXT A;  4R6Y A;  1N3X A;  1FTO A;  2UXA A;  3SKP A;  2YJP A;  2DWI A;  4DDD A;  3EN3 A;  3DP6 A;  4OFO A;  3OEK A;  1Q1K A;  1MY2 A;  1MY0 A;  2AYS A;  2HAV A;  3ZKL A;  4GXS B;  4KPT A;  2G29 A;  3IB0 A;  3DM0 A;  3V8X B;  4PET A;  4POX A;  3QAX A;  3Q27 A;  2X26 A;  4DCX A;  4ZE8 A;  2R6G E;  3CFZ A;  2QRY A;  2UVG A;  3PPR A;  3K02 A;  4P0I A;  4YAH X;  3EHS A;  5KCJ A;  1VR5 A;  1FTM A;  5K2Y A;  1ZTY A;  1P1Q A;  2ZYN A;  5CM6 A;  3B6T A;  2OWS A;  1QKA A;  2QS2 A;  4H8J A;  4TLL B;  1DPP A;  3C33 A;  3TKD A;  2DYX A;  3U72 A;  4X9T A;  1A8F A;  3UA8 A;  1B51 A;  4E0W A;  2HXW A;  3H4Z A;  1YAE A;  1MH3 A;  3UGW A;  1QUI A;  5BWJ A;  3FV1 A;  5I57 B;  2DXY A;  2B65 A;  4HCW A;  1MXV A;  3G3J A;  5FTH A;  1TFA A;  3VXC A;  2XXY A;  3MP6 A;  1DTG A;  1LB9 A;  2XD3 A;  4ELR A;  2UYF A;  1ANF A;  1UIU A;  4F19 A;  4R75 A;  5M2V A;  3MAM A;  3PMV A;  2OZZ A;  3S9M C;  2UYE A;  2NOO A;  4NF5 A;  2ANJ A;  2VHA A;  1DMB A;  5JTY A;  2PT2 A;  4NWD A;  2HZL A;  4JWY A;  3MP1 A;  1AOV A;  1US4 A;  3SET A;  1MRP A;  4FIM A;  4OET A;  1O7T A;  4OER A;  1XVY A;  3VV5 A;  1FTK A;  4LQ5 A;  2DSF A;  4O3C A;  4G2Z A;  2DE3 A;  4OTE A;  5CMB A;  2OJT A;  3VFJ A;  1D9Y A;  1BTJ A;  2A5T A;  1BIY A;  1FCK A;  2DWA A;  4JSO A;  1SQY A;  1P1N A;  1ATG A;  3HPI A;  1B46 A;  3ONM A;  1OQG A;  5CMC A;  3LSX A;  4HS7 A;  1B4Z A;  3CSB A;  4GL0 A;  3KSJ A;  1EZO A;  3LSW A;  3TZA A;  3CSG A;  1LAG E;  4UA8 A;  2NWJ A;  3O29 A;  1ZLQ A;  5L9S A;  3FIR A;  4ELO A;  2FYI A;  2D3I A;  5TP9 B;  2XX9 A;  1Y3N A;  4F39 A;  1R6Z A;  3MVX A;  3O97 A;  2XXP A;  5L9O A;  3MPL A;  5H8N B;  2R9J A;  3RLF E;  2Y7I A;  1R9Q A;  4U2R A;  2GFE A;  4DXC A;  3HHG A;  2RIN A;  1WDN A;  4YB6 A;  1A99 A;  4IY6 A;  3RGY A;  1POT A;  3HST A;  1JEU A;  3IJO B;  4RY1 A;  3THI A;  2B3F A;  1P1W A;  2V25 A;  3GZG A;  2D5W A;  4FAT A;  1N7X A;  2I3V A;  1N3W A;  1Y1Z A;  3W15 C;  4GLI A;  3M8U A;  5AA3 A;  5I2N A;  1ZKB A;  2F6G A;  3K6W A;  5I56 A;  4U1Z A;  4KCC A;  1MXY A;  2Y7W A;  3TPA A;  1WOD A;  2VOZ A;  4IGR A;  2REJ A;  1US5 A;  1OMP A;  1UQW A;  2Z8E A;  5ELV A;  1Y9U A;  1B3F A;  2UVH A;  1LCF A;  1LST A;  4I8C A;  4Z0I A;  3A09 A;  2H98 A;  1UTH B;  1DTZ A;  1MDQ A;  4BDO A;  4MLQ A;  1B1H A;  1LBB A;  3R6U A;  4EXK A;  1YPN A;  3RY3 A;  4U23 A;  2O68 A;  3MP8 A;  5H8Q A;  5DTB A;  5F1Q A;  1MPB A;  1GVC A;  4ZDM A;  2X7P A;  3RT6 B;  3OD7 A;  2I49 A;  5DVJ A;  3UK4 A;  4ESW A;  4EQB A;  4NF6 A;  3USD A;  4ZEK A;  3GXA A;  4H65 A;  4FEB A;  1SYH A;  3PPQ A;  2P0S A;  4HCY A;  1S9T A;  1HSE A;  1H44 A;  3S9N C;  3KN3 A;  4DXU A;  3R26 A;  3O6H A;  2RC7 A;  3VE1 B;  4HW8 A;  3SEU A;  2DVZ A;  1OVB A;  1YCJ A;  2XXH A;  4DIG A;  4F1Y A;  5K2X A;  3TCG A;  3IX1 A;  3BKI B;  4TOZ A;  4DXB A;  4LQ2 A;  2GH9 A;  4GL8 A;  4ZEC A;  1YTV A;  1II5 A;  1M5E A;  3TTK A;  1FTJ A;  3OO9 A;  4IB2 A;  3C36 A;  1NNT A;  1Y4C A;  1ELJ A;  4R72 A;  4LON B;  3C32 A;  2XXV A;  4ZZA A;  4I1D A;  4YU0 A;  2P2A A;  1B7H A;  3GBB A;  1HSJ A;  4FOR A;  1XT8 A;  4QFN A;  1MQH A;  4G68 A;  4U4X A;  3O2A A;  4IO5 A;  2PBW A;  1RYX A;  1XOC A;  5B7D A;  5I2K A;  3L6H A;  5JEI A;  2Y7K A;  3K6U A;  1MXX A;  2OBG A;  1AL3 A;  3ZSF A;  2XX8 A;  1D9V A;  2VP1 A;  2OWT A;  3H7M A;  3VLW A;  1I69 A;  2ONR A;  3N6U A;  3GBA A;  2B3B A;  3RNN A;  2V93 A;  2R71 A;  3FAS A;  3MVZ A;  5I58 B;  2ZNS A;  5TPA A;  5I84 A;  2HQ0 A;  3OO6 A;  1M5C A;  2CMO A;  3RQT A;  3IK6 B;  1L5T A;  1IXI A;  1ZJL A;  3K2D A;  3EHT A;  4C0R A;  1FQC A;  2OK2 A;  3BFU A;  2H4I A;  3VLU A;  3PGF A;  5AA2 D;  3O6G A;  4Q0C A;  1MDP 1;  1OLC A;  4QFK A;  4WED A;  3K0V A;  1VFE A;  4DZ1 A;  2F6P A;  1TWY A;  2PMS A;  4ONY A;  4QFO A;  2F78 A;  2IEE A;  1BP5 A;  3E3K A;  1IXG A;  1TFD A;  4NTL A;  2XD2 A;  2OCU A;  3MC2 A;  3OEL A;  2RCA A;  3JV9 A;  4NF4 A;  1B40 A;  3K1M A;  4EDP A;  4YKJ A;  4R73 A;  4POW A;  3O28 A;  1URG A;  1MXZ A;  2NVU B;  4Q30 B;  1B3E A;  3ODB A;  2W7Y A;  5AA2 B;  2HFB A;  4KYD A;  3FVO A;  1N04 A;  4PQJ A;  3U92 A;  3KN7 A;  3TFL A;  3HV1 A;  3KFM A;  5L9M A;  4NF8 B;  3KJ7 A;  3TTL A;  5TU0 A;  4R9G A;  2F7A A;  4XIG Q;  1EZP A;  4LZ7 A;  4EQ7 A;  3C35 A;  4QFP A;  4NMY A;  2O1L A;  1T0K A;  1B4H A;  1UTB B;  4RPN A;  1SW4 A;  3IOU A;  2H25 A;  4F3G A;  2RF1 A;  3OEN A;  1B7U A;  5CRY A;  5FTI A;  2REG A;  3SEX A;  1B5H A;  4MFI A;  3MVW A;  5A5X A;  3ILT B;  4EQ9 A;  2G93 A;  4OHN A;  4BDN A;  2Z23 A;  3OOA A;  2AIX A;  3U94 A;  4F31 B;  1NNK A;  3Q28 A;  3S4U A;  1Y4T A;  2QS1 A;  3EPE A;  1SW5 A;  5H8S A;  3IL1 B;  1B5I A;  2D21 A;  3D4C A;  2F7C A;  2ZNU A;  4IO7 A;  5IKB A;  2O6A A;  4H8I A;  1LFH A;  3FJG A;  5EHS A;  4H0W A;  1LAH E;  5DYH A;  3TCH A;  2O84 X;  1FQE A;  1KWH A;  1SI0 A;  3IJX B;  5EHM A;  2F34 A;  2O7U A;  3TTN A;  1MPD A;  3SEY A;  4Z7E A;  4H5G A;  5LOM A;  1J1N A;  1GR2 A;  4GRK A;  1ZMG A;  3B6W A;  1I6Q A;  3CVG A;  4JB7 A;  4IO6 A;  4MH5 A;  1JVY A;  4R6H A;  3IO4 A;  3V5A A;  1AMF A;  3BBR A;  4QRZ A;  3ZS6 A;  3V83 A;  1JW5 A;  3IO6 A;  4ZZE A;  2I6E A;  2XXR A;  3IOV A;  2ABH A;  4OXV A;  1LLS A;  3U8Q A;  5H8H B;  1A7L A;  4YIC A;  4L17 A;  4YB5 A;  1XHY A;  4KD5 A;  1UIV A;  3VXB A;  4F2Q A;  3H6T A;  5I59 B;  2I3W A;  3MZ9 A;  1H45 A;  1AH5 A;  4GF8 A;  4Q5T A;  1Y3P A;  3CFL A;  4K3F A;  1BLF A;  5F7V A;  3HO7 A;  1SW1 A;  2KLF A;  3PUZ E;  3TDJ A;  3UOR A;  2FA7 A;  4OES A;  3EHU A;  3Q29 A;  4ELP A;  4GWO A;  3OO7 A;  3G3I A;  2RCB A;  4OEV A;  3I3V A;  4IY5 A;  1MS7 A;  3TCF A;  3T9U A;  1R9L A;  2ONK E;  4WEP A;  2ONS A;  4NE4 A;  4IO3 A;  2I58 A;  4XKP A;  3QUJ A;  1N76 A;  2PVU A;  1QUJ A;  4XKR A;  1IXH A;  3K6V A;  3G3G A;  3KBR A;  1MXU A;  1M5F A;  4YB7 A;  3FXU A;  3TYH A;  4THI A;  2V3Q A;  4F22 A;  3EQ1 A;  3I5O A;  2ZYK A;  5AA4 A;  2F7B A;  4F1V A;  5HPQ A;  3SES A;  2F5X A;  3JZJ A;  3TTR A;  4ESX A;  1H43 A;  4FE8 A;  3IAZ A;  1FQB A;  3MW0 A;  3OSQ A;  1Y1M A;  1QKB A;  2DOJ A;  4BLA A;  2RKM A;  4U21 A;  2GHB A;  2XXU A;  3P7I A;  4Q8R A;  4F29 A;  3KSX A;  3T9X B;  3LC8 A;  3H03 A;  4RK9 A;  2CZL A;  3O6I A;  3PUX E;  3Q25 A;  4GVO A;  2XHD A;  1N84 A;  2WKY A;  5KDT A;  3TTM A;  4KFQ A;  3C9H A;  2DVC A;  4KI0 E;  2DQV A;  1MY1 A;  3FVN A;  3PUY E;  2OLB A;  5CBS A;  3KJT A;  4KYE A;  4JWO A;  5H8F A;  1B3G A;  1Q35 A;  1WVJ A;  4H67 A;  1S50 A;  4F1U A;  4QF9 A;  1M5B A;  1SI1 A;  2QS3 A;  4IGT A;  4O3B A;  5DEX A;  4BDM A;  1LFG A;  3MZB A;  4PFT A;  3OSR A;  5DVF A;  3LSL A;  5KCJ B;  3WAF A;  1XC1 A;  1O63 A;  2DE4 A;  3GLB A;  1FTL A;  2QSX A;  1DPE A;  1B9J A;  3SDF A;  2Q2A A;  4OMB A;  3QXM A;  4OZ9 A;  2ZNT A;  4G4P A;  2H5Y A;  2HAU A;  3CG3 A;  1VE4 A;  1B7Z A;  2O51 A;  3FV2 A;  4C1T A;  2ZYO A;  4U22 A;  4DE8 A;  4QSE A;  4KR5 A;  1AIV A;  1FQD A;  4PE5 B;  1DSN A;  3RUM A;  1JEV A;  2V3U A;  2HZK A;  5HBC A;  3UN6 A;  1TXF A;  4P0G A;  4F3S A;  1P1U A;  3S9E A;  1B5J A;  4TQU Q;  3TEP A;  3FVK A;  1USY E;  4R2B A;  4XXU A;  1URD A;  3IB2 A;  4OYV A;  1MPC A;  1D4N A;  4ECF A;  5J1D A;  3W9V A;  4NF5 B;  4N07 A;  1GTK A;  1PC3 A;  3BFT A;  5JTY B;  3TQW A;  1OQH A;  3PV0 E;  3VVD A;  4M4G A;  1URS A;  3FZV A;  4BDR A;  4XKQ A;  5ISU A;  4KQP A;  4YMB A;  5I57 A;  2O69 A;  2Q9T A;  2A5T B;  2ZMB A;  2Z22 A;  4FAJ A;  2QMX A;  4F3B A;  3HN0 A;  1VFD A;  4MLV A;  3MWB A;  3TAJ A;  4JDF A;  3T9H B;  2PT1 A;  1TT1 A;  1PEB A;  2P1S A;  5L8D A;  1JVX A;  2DWH A;  2LAO A;  2H99 A;  2E0S A;  3D4G A;  5DVI A;  5ITP A;  2UVJ A;  2X7Q A;  4DCY A;  1GV8 A;  3SEW A;  2ESN A;  4ZED A;  2Q8J A;  3QIM A;  2I0B A;  4AB6 A;  3PPN A;  4G8H A;  4RPO A;  2F36 A;  2ZXT A;  3M3F A;  3MQ9 A;  4EF2 A;  3MZ1 A;  1MY4 A;  1Y3Q A;  4F18 A;  1GGG A;  4R6K A;  3Q26 A;  5FHO A;  3RT8 A;  2GHA A;  1BKA A;  1NFT A;  3N5L A;  3PMX A;  5AA1 A;  2DP8 A;  1MG1 A;  1D3K A;  4R9F A;  3MBP A;  4N6P A;  3IB1 A;  1RKM A;  1R1N A;  5TP9 A;  2E1S A;  4RJZ A;  5I2N B;  3VVE A;  1Z7M E;  4WXJ A;  2DXR A;  4G8N A;  5I56 B;  4GOT A;  4TLM B;  5H8N A;  1SW2 A;  1B2H A;  3QUF A;  2RC9 A;  3C31 A;  2AL4 A;  4X1D A;  4U1O A;  4JSD A;  3ECR A;  4O3A A;  1NKX A;  4BDL A;  2I4C A;  4NWC A;  1I6B A;  1MQG A;  3KN8 A;  4PFY A;  3IR1 A;  3IOW A;  4PFW A;  3CFX A;  5H8Q B;  1QUK A;  3FGS A;  3PMW A;  2I0C A;  2Q88 A;  1MM7 A;  1DOT A;  2XX7 A;  3M3K A;  4FED A;  4NF6 B;  3G3K A;  3H06 B;  3LBS A;  4QFL A;  2DWJ A;  3H6V A;  3HCQ A;  3OXN A;  1UTH A;  1PBP A;  2IA4 A;  3U93 A;  3K00 A;  1F9B A;  2Y7R A;  1ZU0 A;  2NXO A;  3O66 A;  3KOT A;  4LAT A;  1CE2 A;  4OEN A;  4YKK A;  1POY 1;  1LGB C;  2F8D A;  4QHQ A;  4ELQ A;  4ZE9 A;  1SDX A;  3LR1 A;  1NNF A;  5ICT A;  1NMU A;  3QSL A;  2M8C A;  1B3L A;  1P99 A;  2FNC A;  4EF1 A;  4F2O A;  3KZG A;  1QJM A;  4KCD A;  1IQ7 A;  4JXI A;  4OFJ A;  3TOD A;  4BDQ A;  1SBP A;  1P1O A;  4PP0 A;  5CI5 A;  1LFI A;  3VLV A;  4KYS A;  3I6V A;  4RA1 A;  3G3F A;  4G68 B;  1PB7 A;  1MY3 A;  2ALU A;  1EH3 A;  1PB9 A;  4ZS9 A;  3N94 A;  5I2K B;  5HM4 B;  4GFR A;  3PD9 A;  3QK6 A;  1ZBM A;  2Q2C A;  4PFU A;  4ZEB A;  1JW1 A;  4G77 A;  5ITO A;  3OO8 A;  4H6D A;  3T93 B;  1FW0 A;  2QS4 A;  4YKI A;  1LAF E;  3F11 A;  2QL3 A;  4G8M A;  4JWX A;  5FHM A;  3E13 X;  2I48 A;  3R7X A;  4OQO A;  3DEL B;  1IXC A;  3ZKK A;  1NL5 A;  3PPP A;  2PYY A;  5TPA B;  2XXQ A;  2XXX A;  4ZEF A;  1I6A A;  4YZZ A;  3H6U A;  3PD8 A;  4IO4 A;  3S9L C;  2HCA A;  4ND9 A;  1JET A;  1SD3 A;  3TMG A;  1H3D A;  4GD5 A;  5KZT A;  1PBQ A;  1B3H A;  3M3L A;  3HHF A;  3FD3 A;  3T22 A;  1FQF A;  1NNP A;  5DT6 A;  3KEI A;  5I58 A;  2AL5 A;  1MXW A;  1RYO A;  4H1X A;  2NUV A;  2O7I A;  4NF4 B;  4LA9 A;  3TUS A;  3SER A;  3AXF A;  3CIJ A;  3TEL A;  4R2F A;  3A3C A;  3E9X A;  3ILU B;  2VGQ A;  4RXL A;  1OLA A;  4F3P A;  3K4U A;  2XXI A;  4M1V A;  3DP4 A;  4EUO A;  3FAT A;  5FHN A;  4OVJ A;  3TQL A;  5AE4 A;  1VSO A;  3OMB A;  4WKM A;  4GIZ A;  1B1X A;  3LUY A;  1H76 A;  3VDF A;  1B0L A;  2GRV A;  3K6X A;  3G3H A; 
#chains in the Genus database with same CATH topology
 4HTG A;  4XF5 A;  2ZYM A;  5IAI A;  3E4R A;  3KGC A;  2VD3 A;  4ISU A;  1OVT A;  3O9P A;  1A54 A;  1B52 A;  4AB5 A;  5AA2 A;  2Q89 A;  4LZ8 A;  5A5X B;  2QMW A;  4GX6 A;  4I62 A;  4I40 A;  3S2V A;  5A5L A;  2ZZX A;  1NV1 A;  1LB8 A;  4NF8 A;  4GXA A;  4H5F A;  4AQ4 A;  4GQO A;  2THI A;  3IOT A;  3H6W A;  1N0T A;  1LCT A;  1PB8 A;  1XVX A;  1FJ6 A;  3H3G A;  5JK4 A;  1JQF A;  4YKP A;  2PX1 A;  4I3Y A;  1OIB A;  1UTB A;  2V84 A;  3CRB A;  5CMM A;  1FQA A;  1B58 A;  3T1B A;  3EF7 A;  4C1U A;  3MJN A;  1NV2 A;  2QPQ A;  4X1B A;  4QSC A;  3UP9 A;  3B7D A;  4LVQ A;  3FJ7 A;  1NV0 A;  4P11 A;  1SVX B;  1FBG A;  1HSL A;  3VVF A;  4RK2 A;  5EYF A;  4HE0 A;  2I4B A;  4R74 A;  4PFI A;  3PU5 A;  4YMA A;  2OWZ A;  4MCO A;  1IEJ A;  1A40 A;  4OVT A;  1G0H A;  2UVI A;  2V3T A;  3RN8 A;  5CBR A;  1YXI A;  4NN3 A;  3DLN A;  4U4S A;  1ZIU A;  2DS9 A;  1B32 A;  1JNF A;  4JBZ A;  2CEX A;  3CR9 A;  1Z7N E;  2XXW A;  4QSD A;  2YPN A;  4LUB A;  3N6T A;  3KG2 A;  1CB6 A;  3OEM A;  4RNS A;  1M5D A;  2YLN A;  4G68 C;  3B6Q A;  1MQI A;  2CZH A;  1FBF A;  3QYT A;  3PUV E;  2F97 A;  3T9V A;  1NUY A;  1O64 A;  4IO2 A;  3DP8 A;  4OVQ A;  5CMK A;  3WAE A;  3SEV A;  3FJM A;  3FUZ A;  5ICQ A;  4ZEI A;  1QW0 A;  1SYI A;  1EZ9 A;  1MQJ A;  4N13 A;  4RYA A;  1S7Y A;  1FBE A;  4X48 A;  4KHZ E;  4LZ5 A;  3C4M A;  1LBV A;  1PDA A;  3UIF A;  3W9W A;  1A8E A;  2B4L A;  4E0X A;  3T66 A;  3C34 A;  3RYD A;  3U1O A;  1XS5 A;  5H8H A;  4XKN A;  4OWD A;  1IMB A;  1N7W A;  3RTW B;  1IUD A;  3KOS A;  2MKZ A;  3T96 B;  3RTF B;  1VDW A;  3E79 A;  4FBP A;  2QVR A;  5I59 A;  1KA1 A;  4MF3 A;  1B0H A;  3CG1 A;  4DLD A;  4NED A;  1Y20 A;  5CC2 A;  1MM6 A;  4OFL A;  3MPK A;  3G7W A;  4GX3 A;  4OVS A;  2F35 A;  1NH7 A;  1USY H;  1KA0 A;  1A55 A;  1B05 A;  1IIT A;  2VD2 A;  3CI8 A;  3L6G A;  2Q8M A;  1B6H A;  3A3U A;  1LBY A;  2O1M A;  4LP2 B;  5AA4 B;  2Z8D A;  1RDZ A;  1QUL A;  1IIW A;  1LAX A;  2RC8 A;  3IOR A;  1MH4 A;  5BUU A;  2DE2 A;  1QVS A;  2QJE A;  4MBP A;  3FXQ A;  4EXL A;  1JW4 A;  1IMC A;  3PPO A;  3MST A;  5B70 A;  4MHF A;  4OEU A;  2A5S A;  2H9B A;  3V89 B;  2Y7P A;  2Z8F A;  4PTK A;  3JYR A;  3FXR A;  3K1N A;  1MQD A;  3FVG A;  4I9D A;  3MVY A;  2BJJ X;  3SZP A;  5EYG A;  1EU8 A;  3K1P A;  5KDT B;  4FEC A;  4FJP A;  2HEU A;  1IZ1 A;  3MUQ A;  4P3L A;  4N17 A;  4N8G A;  5H8F B;  3K01 A;  1FBP A;  3PUW E;  1NH8 A;  3LSF B;  2Y84 A;  4UAC A;  3RPW A;  5J16 A;  1FBD A;  4XTC Q;  5DEX B;  3N26 A;  1LBC A;  2XXT A;  4LN5 A;  4R6Y A;  4X8R A;  4PAF A;  1N3X A;  1FTO A;  2FIX A;  2UXA A;  3SKP A;  2YJP A;  2DWI A;  4DDD A;  3EN3 A;  3DP6 A;  4OFO A;  1IMF A;  3OEK A;  1Q1K A;  4P1E A;  1DBZ A;  1MY2 A;  1MY0 A;  2AYS A;  2HAV A;  3ZKL A;  4P9K A;  4GXS B;  4KPT A;  4MMP A;  2G29 A;  1FBC A;  3IB0 A;  3DM0 A;  4AS4 A;  3V8X B;  4PET A;  4POX A;  3QAX A;  3Q27 A;  2X26 A;  3B8B A;  4DCX A;  4ZE8 A;  2R6G E;  3CFZ A;  4NX1 A;  2QRY A;  2BJI A;  2UVG A;  3PPR A;  3K02 A;  4P0I A;  4YAH X;  3EHS A;  5KCJ A;  1VR5 A;  1FTM A;  5K2Y A;  1ZTY A;  1P1Q A;  2ZYN A;  5CM6 A;  4JVC A;  3B6T A;  2OWS A;  1QKA A;  2QS2 A;  4H8J A;  4TLL B;  4GWW A;  1DPP A;  1FJ9 A;  3C33 A;  3TKD A;  5EYH A;  2DYX A;  3U72 A;  4X9T A;  1A8F A;  3UA8 A;  1B51 A;  4E0W A;  2HXW A;  3H4Z A;  1YAE A;  1MH3 A;  3UGW A;  1QUI A;  5BWJ A;  3FV1 A;  5I57 B;  2DXY A;  2B65 A;  4HCW A;  1MXV A;  3G3J A;  5FTH A;  1TFA A;  3VXC A;  2XXY A;  3MP6 A;  1DTG A;  1LB9 A;  2XD3 A;  4ELR A;  2UYF A;  1ANF A;  4OAN A;  1UIU A;  4F19 A;  3BIG A;  4R75 A;  5M2V A;  3MAM A;  3PMV A;  2OZZ A;  3S9M C;  2UYE A;  2NOO A;  4NF5 A;  4PE3 A;  2ANJ A;  2VHA A;  1DMB A;  5JTY A;  2PT2 A;  4NWD A;  2HZL A;  4JWY A;  3MP1 A;  1AOV A;  1US4 A;  3SET A;  1MRP A;  4FIM A;  4OET A;  1O7T A;  4OER A;  4H46 A;  1XVY A;  3VV5 A;  1NV4 A;  4PGP A;  5IZZ A;  1FTK A;  4LQ5 A;  2DSF A;  4O3C A;  3D1R A;  2F3B A;  2WBB A;  3A29 A;  4G2Z A;  2DE3 A;  4OTE A;  5CMB A;  2OJT A;  3RPL A;  3VFJ A;  1D9Y A;  1BTJ A;  2A5T A;  4PGN A;  1BIY A;  4P1L A;  1FCK A;  2DWA A;  4JSO A;  1SQY A;  1P1N A;  1ATG A;  4P56 A;  3HPI A;  1NV6 A;  1B46 A;  3ONM A;  1OQG A;  5CMC A;  1NUW A;  4O94 A;  3LSX A;  1LBX A;  4HS7 A;  1B4Z A;  3CSB A;  4GL0 A;  4GWU A;  3KSJ A;  1EZO A;  3LSW A;  3TZA A;  4O7M A;  3CSG A;  1LAG E;  4UA8 A;  5IM2 A;  2NWJ A;  5ET6 A;  3O29 A;  1ZLQ A;  5L9S A;  1BK4 A;  2F3D A;  1SPI A;  3FIR A;  4ELO A;  3IFA A;  2FYI A;  4PFB A;  2D3I A;  5TP9 B;  2XX9 A;  1DCU A;  1Y3N A;  4F39 A;  1R6Z A;  3MVX A;  3O97 A;  2XXP A;  5L9O A;  3MPL A;  5H8N B;  2R9J A;  3RLF E;  1EYJ A;  2Y7I A;  1R9Q A;  4U2R A;  2GFE A;  4DXC A;  3HHG A;  2RIN A;  1WDN A;  4YB6 A;  2P3V A;  1A99 A;  4IY6 A;  3RGY A;  1POT A;  3HST A;  1JEU A;  3IJO B;  4RY1 A;  3THI A;  2B3F A;  1P1W A;  2V25 A;  3GZG A;  2D5W A;  5ESY A;  4FAT A;  5ET8 A;  1N7X A;  2I3V A;  1N3W A;  1Y1Z A;  3W15 C;  2Y5L A;  4GLI A;  3M8U A;  5AA3 A;  5I2N A;  1ZKB A;  2F6G A;  3K6W A;  2CEY A;  5I56 A;  4U1Z A;  4KCC A;  4P47 A;  1MXY A;  2Y7W A;  3TPA A;  1WOD A;  2VOZ A;  4IGR A;  2REJ A;  1US5 A;  5LDZ A;  1OMP A;  5I5P A;  1UQW A;  2Z8E A;  5ELV A;  1Y9U A;  1B3F A;  1FPG A;  2UVH A;  1LCF A;  1LST A;  4I8C A;  4Z0I A;  3A09 A;  2XA5 A;  2H98 A;  1UTH B;  1DTZ A;  1MDQ A;  4BDO A;  4MLQ A;  1B1H A;  4DI4 B;  4X04 A;  1LBB A;  3R6U A;  4EXK A;  1YPN A;  3RY3 A;  4NQ8 A;  1YZ0 A;  4U23 A;  1RDY A;  2O68 A;  4PAI A;  3MP8 A;  5H8Q A;  5DTB A;  5F1Q A;  1MPB A;  1GVC A;  4ZDM A;  2X7P A;  3RT6 B;  3OD7 A;  2I49 A;  1NUZ A;  5DVJ A;  3UK4 A;  4KXP A;  5ET7 A;  4ESW A;  4EQB A;  4NF6 A;  3USD A;  4ZEK A;  3GXA A;  4H65 A;  4FEB A;  1SYH A;  3PPQ A;  2P0S A;  4HCY A;  1S9T A;  4OA4 A;  1HSE A;  1H44 A;  4O8M A;  3S9N C;  3KN3 A;  4DXU A;  3R26 A;  3O6H A;  2RC7 A;  2XWO A;  3VE1 B;  4HW8 A;  4MAG A;  3SEU A;  2DVZ A;  1OVB A;  1YCJ A;  2XXH A;  4DIG A;  4F1Y A;  5K2X A;  3TCG A;  3IX1 A;  3BKI B;  4TOZ A;  4DXB A;  4LQ2 A;  2GH9 A;  3FXB A;  4GL8 A;  4ZEC A;  1YTV A;  1II5 A;  1M5E A;  3TTK A;  1FTJ A;  3OO9 A;  4IB2 A;  3C36 A;  3KC1 A;  1NNT A;  1Y4C A;  1ELJ A;  4R72 A;  4LON B;  3C32 A;  2XXV A;  2CZK A;  4ZZA A;  4I1D A;  4YU0 A;  2P2A A;  1B7H A;  3GBB A;  4PC9 A;  1HSJ A;  4FOR A;  1XT8 A;  4XEQ A;  4QFN A;  3KBZ A;  1MQH A;  2HPG A;  4G68 A;  4MNC A;  4U4X A;  3O2A A;  4N6D A;  4IO5 A;  2PBW A;  1EYI A;  1RYX A;  1XOC A;  5B7D A;  5I2K A;  3L6H A;  5JEI A;  2Y7K A;  3K6U A;  1MXX A;  2OBG A;  1AL3 A;  3ZSF A;  2XX8 A;  1D9V A;  2VP1 A;  2OWT A;  3H7M A;  1FRP A;  3VLW A;  1I69 A;  2ONR A;  3N6U A;  3GBA A;  2B3B A;  3RNN A;  2V93 A;  1KZ8 A;  2R71 A;  3FAS A;  4NF0 A;  1JP4 A;  3MVZ A;  5I58 B;  2ZNS A;  5TPA A;  5I84 A;  2HQ0 A;  3OO6 A;  1M5C A;  2CMO A;  3RQT A;  3IK6 B;  3IFC A;  5IZ3 A;  1L5T A;  1IXI A;  1ZJL A;  3K2D A;  3EHT A;  4C0R A;  1FQC A;  2OK2 A;  3BFU A;  2H4I A;  3VLU A;  3PGF A;  5AA2 D;  3O6G A;  4Q0C A;  4DI3 D;  1MDP 1;  1OLC A;  4QFK A;  4WED A;  3K0V A;  1VFE A;  4DZ1 A;  2F6P A;  1TWY A;  2PMS A;  4ONY A;  4QFO A;  2F78 A;  2IEE A;  1BP5 A;  3E3K A;  1IXG A;  1TFD A;  4NTL A;  2XD2 A;  2OCU A;  2KR0 A;  3MC2 A;  3OEL A;  2RCA A;  3JV9 A;  4NF4 A;  2HHM A;  1B40 A;  3K1M A;  4EDP A;  4YKJ A;  4R73 A;  4POW A;  4MNI A;  3O28 A;  1FPK A;  1MXZ A;  1URG A;  2XWV A;  2NVU B;  4Q30 B;  1AWB A;  2FIE A;  1B3E A;  3ODB A;  2W7Y A;  1IME A;  5DW8 A;  5AA2 B;  2HFB A;  4KYD A;  4GWS A;  3FVO A;  1N04 A;  4PQJ A;  3U92 A;  3KN7 A;  3TFL A;  3HV1 A;  3KFM A;  5L9M A;  4NF8 B;  3KJ7 A;  3TTL A;  5TU0 A;  4R9G A;  2F7A A;  4XIG Q;  1EZP A;  4LZ7 A;  4EQ7 A;  3C35 A;  4QFP A;  4NMY A;  2O1L A;  1T0K A;  1B4H A;  1UTB B;  4RPN A;  1SW4 A;  3IOU A;  2H25 A;  4F3G A;  2RF1 A;  3U65 A;  3OEN A;  1B7U A;  5CRY A;  5FTI A;  2REG A;  3SEX A;  1B5H A;  4MFI A;  3MVW A;  5A5X A;  3ILT B;  2VPN A;  4EQ9 A;  2G93 A;  4OHN A;  2ZZW A;  2OX3 A;  4BDN A;  2Z23 A;  3OOA A;  2AIX A;  3U94 A;  4F31 B;  1NNK A;  5EQA A;  3Q28 A;  3S4U A;  4I3E A;  1Y4T A;  2QS1 A;  3EPE A;  4MNP A;  1SW5 A;  5H8S A;  5F24 A;  3IL1 B;  1B5I A;  2D21 A;  3D4C A;  2F7C A;  2ZNU A;  2Q74 A;  4IO7 A;  5IKB A;  2O6A A;  4H8I A;  1LFH A;  3CHG A;  3FJG A;  5EHS A;  4H0W A;  1LAH E;  5DYH A;  3TCH A;  2O84 X;  1FQE A;  1KWH A;  1SI0 A;  4HE2 A;  3IJX B;  5EHM A;  4MIJ A;  2F34 A;  2O7U A;  3TTN A;  1MPD A;  3SEY A;  4Z7E A;  4H5G A;  4NAP A;  5LOM A;  1J1N A;  1GR2 A;  4GRK A;  1ZMG A;  2XWI A;  4GWZ A;  3B6W A;  2PFY A;  1I6Q A;  3CVG A;  4JB7 A;  4PFR A;  4IO6 A;  4MH5 A;  1JVY A;  4R6H A;  3IO4 A;  1NV5 A;  2P3N A;  3V5A A;  1AMF A;  3BBR A;  4QRZ A;  1EYK A;  3ZS6 A;  3V83 A;  3LV0 A;  1JW5 A;  3IO6 A;  4ZZE A;  4N8Y A;  5IGA A;  2I6E A;  2XXR A;  3IOV A;  2ABH A;  4OXV A;  1LLS A;  4QXD A;  3U8Q A;  5H8H B;  1A7L A;  3ISP A;  4YIC A;  4L17 A;  4PBH A;  4YB5 A;  1XHY A;  4KD5 A;  1UIV A;  3VXB A;  4F2Q A;  3PTY A;  3H6T A;  4N4U A;  2I3W A;  3MZ9 A;  5I59 B;  1H45 A;  1XI6 A;  1AH5 A;  4GF8 A;  4Q5T A;  1Y3P A;  3CFL A;  4K3F A;  1BLF A;  5F7V A;  3HO7 A;  1SW1 A;  2KLF A;  3PUZ E;  3TDJ A;  3UOR A;  2FA7 A;  2B4M A;  4OES A;  3EHU A;  3Q29 A;  4NG7 A;  4ELP A;  3LUZ A;  4GWO A;  4UAB A;  3OO7 A;  3G3I A;  2RCB A;  4OEV A;  3I3V A;  4IY5 A;  1MS7 A;  3TCF A;  1NV7 A;  3T9U A;  1R9L A;  4GWX A;  4PDD A;  2ONK E;  4WEP A;  4N81 A;  2ONS A;  4NHB A;  4NE4 A;  4IO3 A;  2I58 A;  4XKP A;  3QUJ A;  2R8T A;  1FPJ A;  1N76 A;  2PVU A;  2FVZ A;  1QUJ A;  4XKR A;  1IXH A;  3K6V A;  4AS5 A;  3G3G A;  1FPE A;  3KBR A;  1MXU A;  1M5F A;  4YB7 A;  3FXU A;  3TYH A;  4THI A;  2V3Q A;  4F22 A;  2FHY A;  3EQ1 A;  3I5O A;  2ZYK A;  1FSA A;  5AA4 A;  2F7B A;  4F1V A;  5HPQ A;  3SES A;  5ET5 A;  2F5X A;  2ZZV A;  3JZJ A;  3TTR A;  4ESX A;  1H43 A;  4FE8 A;  3IAZ A;  1FQB A;  3MW0 A;  3OSQ A;  1Y1M A;  1QKB A;  2DOJ A;  4BLA A;  2RKM A;  4U21 A;  2GHB A;  2XWK A;  2XXU A;  1FTA A;  3P7I A;  4Q8R A;  4F29 A;  3KSX A;  3T9X B;  3LC8 A;  2VT5 A;  3H03 A;  4RK9 A;  2CZL A;  3O6I A;  3PUX E;  3Q25 A;  4GVO A;  2XHD A;  1N84 A;  2WKY A;  5KDT A;  3TTM A;  4KFQ A;  3C9H A;  1NI9 A;  2DVC A;  4KI0 E;  2DQV A;  1MY1 A;  2WYK A;  3FVN A;  3PUY E;  2OLB A;  5CBS A;  1G0I A;  2WX9 A;  3KJT A;  4KYE A;  4JWO A;  5H8F A;  1D9Q A;  1B3G A;  1FPI A;  1Q35 A;  1WVJ A;  4H67 A;  1S50 A;  4F1U A;  1LBW A;  4QF9 A;  3KC0 A;  2KQZ A;  1M5B A;  1SI1 A;  2QS3 A;  4IGT A;  4O3B A;  5DEX A;  3T0J A;  4BDM A;  1LFG A;  3MZB A;  4PFT A;  3ROJ A;  1NV3 A;  3OSR A;  5DVF A;  3LSL A;  2PCR A;  5KCJ B;  3WAF A;  1Q9D A;  2QVV A;  1XC1 A;  1O63 A;  2DE4 A;  3GLB A;  1FTL A;  2QSX A;  4OVP A;  1DPE A;  1B9J A;  3SDF A;  2Q2A A;  4OMB A;  3QXM A;  4OZ9 A;  2ZNT A;  4G4P A;  2H5Y A;  2HAU A;  3CG3 A;  1VE4 A;  1B7Z A;  2QVU A;  2O51 A;  3FV2 A;  4C1T A;  3NOH A;  2ZYO A;  4U22 A;  4DE8 A;  4MX6 A;  4QSE A;  4KR5 A;  1AIV A;  1FQD A;  4PE5 B;  1DSN A;  1IMA A;  3RUM A;  1JEV A;  2V3U A;  2HZK A;  5HBC A;  3UN6 A;  1TXF A;  4P0G A;  4F3S A;  1QGX A;  1P1U A;  3S9E A;  1B5J A;  4TQU Q;  3TEP A;  3FVK A;  1USY E;  4R2B A;  1NUX A;  4XXU A;  1URD A;  2V4C A;  3IB2 A;  4OYV A;  1MPC A;  5IZ1 A;  1D4N A;  4ECF A;  5J1D A;  3W9V A;  4NF5 B;  4N07 A;  1GTK A;  1PC3 A;  3BFT A;  5JTY B;  2VPO A;  3TQW A;  1OQH A;  3PV0 E;  3VVD A;  4OVR A;  4M4G A;  2DDK A;  1URS A;  3FBP A;  3FZV A;  4BDR A;  4XKQ A;  5ISU A;  1FPB A;  4KQP A;  4YMB A;  4PAK A;  1LEV A;  5I57 A;  4PDH A;  2O69 A;  3RPL B;  2Q9T A;  2A5T B;  4G61 A;  2ZMB A;  2Z22 A;  4FAJ A;  2QMX A;  4F3B A;  3HN0 A;  2GQ1 A;  1VFD A;  3B50 A;  4MLV A;  3MWB A;  5EQ7 A;  3TAJ A;  4JDF A;  3T9H B;  2PT1 A;  1TT1 A;  1PEB A;  2P1S A;  5L8D A;  1JVX A;  3BIH A;  2DWH A;  2LAO A;  1K9Z A;  2H99 A;  2E0S A;  1FPF A;  3D4G A;  1FPD A;  5DVI A;  4N91 A;  5ITP A;  2UVJ A;  2X7Q A;  4O7I A;  4DCY A;  5EQ8 A;  1GV8 A;  3SEW A;  2ESN A;  4ZED A;  2Q8J A;  3QIM A;  2I0B A;  4AB6 A;  3PPN A;  4G8H A;  4RPO A;  4XFE A;  2F36 A;  2ZXT A;  3M3F A;  3MQ9 A;  4EF2 A;  3MZ1 A;  1YYZ A;  1MY4 A;  1Y3Q A;  3E78 A;  4F18 A;  1GGG A;  4R6K A;  3Q26 A;  5EQ9 A;  5FHO A;  3RT8 A;  2GHA A;  1BKA A;  1NFT A;  3N5L A;  3PMX A;  5AA1 A;  2DP8 A;  1RDX A;  1MG1 A;  1D3K A;  4R9F A;  3MBP A;  4N6P A;  3EKI A;  3IB1 A;  1RKM A;  1R1N A;  5TP9 A;  2E1S A;  4RJZ A;  5I2N B;  3VVE A;  1Z7M E;  4WXJ A;  2DXR A;  4G8N A;  5I56 B;  4GOT A;  4TLM B;  5H8N A;  4N15 A;  1SW2 A;  1B2H A;  3HFU A;  3QUF A;  2RC9 A;  3C31 A;  2AL4 A;  1K9Y A;  4X1D A;  4U1O A;  4JSD A;  1INP A;  3ECR A;  4O3A A;  4H45 A;  1NKX A;  4BDL A;  4PCD A;  2I4C A;  3GYY A;  4NWC A;  1IMD A;  1I6B A;  1MQG A;  3KN8 A;  4PFY A;  3IR1 A;  3IOW A;  4P8B A;  2FBP A;  4PFW A;  3CFX A;  5H8Q B;  1QUK A;  3FGS A;  3PMW A;  2I0C A;  1LBZ A;  2Q88 A;  1MM7 A;  1DOT A;  2XX7 A;  3M3K A;  4JVI A;  4FED A;  4NF6 B;  3G3K A;  3H06 B;  4NGU A;  3LBS A;  4QFL A;  4GX4 A;  2DWJ A;  3H6V A;  3HCQ A;  3OXN A;  1FBH A;  1UTH A;  1PBP A;  2IA4 A;  3U93 A;  3K00 A;  1F9B A;  2PFZ A;  2Y7R A;  1ZU0 A;  2NXO A;  2WBD A;  4MEV A;  3O66 A;  3KOT A;  4LAT A;  1CE2 A;  4OEN A;  4YKK A;  1POY 1;  1LGB C;  2F8D A;  4N6K A;  4QHQ A;  4ELQ A;  4ZE9 A;  1SDX A;  3LR1 A;  1NNF A;  5ICT A;  1NMU A;  5T3J A;  3QSL A;  2M8C A;  1B3L A;  1P99 A;  2FNC A;  4EF1 A;  4F2O A;  3KZG A;  1QJM A;  4KCD A;  2CZI A;  1IQ7 A;  4JXI A;  4OFJ A;  3TOD A;  4BDQ A;  1SBP A;  1P1O A;  2Y5K A;  4PP0 A;  5CI5 A;  1LFI A;  3VLV A;  5LTC A;  4KYS A;  4HE1 A;  3I6V A;  4RA1 A;  2QFL A;  3G3F A;  4G68 B;  1PB7 A;  1MY3 A;  2ALU A;  1EH3 A;  1PB9 A;  4ZS9 A;  3N94 A;  3MYU A;  5I2K B;  5HM4 B;  4GFR A;  3PD9 A;  3QK6 A;  1ZBM A;  2Q2C A;  4PFU A;  4ZEB A;  1JW1 A;  4G77 A;  5ITO A;  3OO8 A;  4H6D A;  3T93 B;  2WYP A;  1FW0 A;  2QS4 A;  4YKI A;  1LAF E;  3F11 A;  2QL3 A;  4G8M A;  4JWX A;  5FHM A;  3E13 X;  2I48 A;  3R7X A;  4GBW A;  4OQO A;  3DEL B;  1IXC A;  3ZKK A;  1NL5 A;  3PPP A;  2PYY A;  5I3S A;  2WEF A;  5TPA B;  2XXQ A;  2XXX A;  2XXK A;  4GBV A;  4ZEF A;  1I6A A;  4YZZ A;  3H6U A;  3PD8 A;  5IZ3 B;  4PF8 A;  4IO4 A;  3S9L C;  2HCA A;  4ND9 A;  1JET A;  1SD3 A;  3TMG A;  1H3D A;  4GD5 A;  5KZT A;  3QMF A;  1PBQ A;  1B3H A;  3M3L A;  3HHF A;  4PBQ A;  3FD3 A;  3T22 A;  1FQF A;  4MJO A;  1NNP A;  5DT6 A;  1FPL A;  3KEI A;  5I58 A;  2AL5 A;  1MXW A;  1RYO A;  4JVD A;  4H1X A;  2NUV A;  2O7I A;  4NF4 B;  2L5V A;  2JJK A;  4LA9 A;  4PF6 A;  3TUS A;  3SER A;  1DK4 A;  3AXF A;  3CIJ A;  3TEL A;  4R2F A;  1CNQ A;  4IR8 A;  3A3C A;  3E9X A;  3ILU B;  2VGQ A;  4HXV A;  4RXL A;  5I7I A;  1OLA A;  4F3P A;  3K4U A;  4M1V A;  2XXI A;  3DP4 A;  4EUO A;  4GWY A;  3FAT A;  5FHN A;  4OVJ A;  3TQL A;  5AE4 A;  1VSO A;  5FBP A;  3OMB A;  4WKM A;  4GIZ A;  1B1X A;  3LUY A;  1H76 A;  3VDF A;  1B0L A;  2GRV A;  3K6X A;  3G3H A;  2HXR A;  4QBA A; 
#chains in the Genus database with same CATH homology
 4HTG A;  2ZYM A;  5IAI A;  3E4R A;  3KGC A;  2VD3 A;  4ISU A;  1OVT A;  3O9P A;  1A54 A;  1B52 A;  4AB5 A;  5AA2 A;  2Q89 A;  4LZ8 A;  5A5X B;  2QMW A;  4I62 A;  3S2V A;  1LB8 A;  4NF8 A;  4GXA A;  4H5F A;  4AQ4 A;  4GQO A;  2THI A;  3IOT A;  3H6W A;  1N0T A;  1LCT A;  1PB8 A;  1XVX A;  3H3G A;  5JK4 A;  1JQF A;  4YKP A;  2PX1 A;  1OIB A;  1UTB A;  2V84 A;  3CRB A;  5CMM A;  1FQA A;  1B58 A;  3EF7 A;  4C1U A;  3MJN A;  2QPQ A;  4X1B A;  4QSC A;  3UP9 A;  3B7D A;  4LVQ A;  3FJ7 A;  4P11 A;  1SVX B;  1HSL A;  3VVF A;  4RK2 A;  5EYF A;  2I4B A;  4R74 A;  3PU5 A;  4YMA A;  1IEJ A;  1A40 A;  2UVI A;  2V3T A;  3RN8 A;  5CBR A;  3DLN A;  4U4S A;  1ZIU A;  2DS9 A;  1B32 A;  1JNF A;  4JBZ A;  3CR9 A;  1Z7N E;  2XXW A;  4QSD A;  2YPN A;  4LUB A;  3N6T A;  3KG2 A;  1CB6 A;  3OEM A;  4RNS A;  1M5D A;  2YLN A;  4G68 C;  3B6Q A;  1MQI A;  3QYT A;  3PUV E;  2F97 A;  3T9V A;  1O64 A;  4IO2 A;  3DP8 A;  5CMK A;  3WAE A;  3SEV A;  3FJM A;  3FUZ A;  5ICQ A;  4ZEI A;  1QW0 A;  1SYI A;  1EZ9 A;  1MQJ A;  4N13 A;  4RYA A;  1S7Y A;  4X48 A;  4KHZ E;  4LZ5 A;  3C4M A;  1PDA A;  3UIF A;  3W9W A;  1A8E A;  4E0X A;  3T66 A;  3C34 A;  3U1O A;  1XS5 A;  5H8H A;  4XKN A;  4OWD A;  1N7W A;  3RTW B;  1IUD A;  3KOS A;  3T96 B;  3RTF B;  5I59 A;  4MF3 A;  1B0H A;  3CG1 A;  4DLD A;  4NED A;  1Y20 A;  5CC2 A;  1MM6 A;  4OFL A;  3MPK A;  3G7W A;  2F35 A;  1NH7 A;  1USY H;  1A55 A;  1B05 A;  1IIT A;  2VD2 A;  3CI8 A;  3L6G A;  1B6H A;  3A3U A;  2O1M A;  4LP2 B;  5AA4 B;  2Z8D A;  1QUL A;  1IIW A;  1LAX A;  2RC8 A;  3IOR A;  1MH4 A;  5BUU A;  2DE2 A;  1QVS A;  2QJE A;  4MBP A;  3FXQ A;  4EXL A;  1JW4 A;  3PPO A;  5B70 A;  4OEU A;  2A5S A;  2H9B A;  3V89 B;  2Y7P A;  2Z8F A;  3JYR A;  3FXR A;  3K1N A;  1MQD A;  3FVG A;  4I9D A;  3MVY A;  2BJJ X;  1EU8 A;  3K1P A;  5KDT B;  4FEC A;  4FJP A;  2HEU A;  1IZ1 A;  3MUQ A;  5H8F B;  3K01 A;  3PUW E;  1NH8 A;  3LSF B;  2Y84 A;  4UAC A;  3RPW A;  4XTC Q;  5DEX B;  3N26 A;  1LBC A;  2XXT A;  4R6Y A;  1N3X A;  1FTO A;  2UXA A;  3SKP A;  2YJP A;  2DWI A;  4DDD A;  3EN3 A;  3DP6 A;  4OFO A;  3OEK A;  1Q1K A;  1MY2 A;  1MY0 A;  2AYS A;  2HAV A;  3ZKL A;  4GXS B;  4KPT A;  2G29 A;  3IB0 A;  3DM0 A;  3V8X B;  4PET A;  4POX A;  3QAX A;  3Q27 A;  2X26 A;  4DCX A;  4ZE8 A;  2R6G E;  3CFZ A;  2QRY A;  2UVG A;  3PPR A;  3K02 A;  4P0I A;  4YAH X;  3EHS A;  5KCJ A;  1VR5 A;  1FTM A;  5K2Y A;  1ZTY A;  1P1Q A;  2ZYN A;  5CM6 A;  3B6T A;  2OWS A;  1QKA A;  2QS2 A;  4H8J A;  4TLL B;  1DPP A;  3C33 A;  3TKD A;  2DYX A;  3U72 A;  4X9T A;  1A8F A;  3UA8 A;  1B51 A;  4E0W A;  2HXW A;  3H4Z A;  1YAE A;  1MH3 A;  3UGW A;  1QUI A;  5BWJ A;  3FV1 A;  5I57 B;  2DXY A;  2B65 A;  4HCW A;  1MXV A;  3G3J A;  5FTH A;  1TFA A;  3VXC A;  2XXY A;  3MP6 A;  1DTG A;  1LB9 A;  2XD3 A;  4ELR A;  2UYF A;  1ANF A;  1UIU A;  4F19 A;  4R75 A;  5M2V A;  3MAM A;  3PMV A;  2OZZ A;  3S9M C;  2UYE A;  2NOO A;  4NF5 A;  2ANJ A;  2VHA A;  1DMB A;  5JTY A;  2PT2 A;  4NWD A;  2HZL A;  4JWY A;  3MP1 A;  1AOV A;  1US4 A;  3SET A;  1MRP A;  4FIM A;  4OET A;  1O7T A;  4OER A;  1XVY A;  3VV5 A;  1FTK A;  4LQ5 A;  2DSF A;  4O3C A;  4G2Z A;  2DE3 A;  4OTE A;  5CMB A;  2OJT A;  3VFJ A;  1D9Y A;  1BTJ A;  2A5T A;  1BIY A;  1FCK A;  2DWA A;  4JSO A;  1SQY A;  1P1N A;  1ATG A;  3HPI A;  1B46 A;  3ONM A;  1OQG A;  5CMC A;  3LSX A;  4HS7 A;  1B4Z A;  3CSB A;  4GL0 A;  3KSJ A;  1EZO A;  3LSW A;  3TZA A;  3CSG A;  1LAG E;  4UA8 A;  2NWJ A;  3O29 A;  1ZLQ A;  5L9S A;  3FIR A;  4ELO A;  2FYI A;  2D3I A;  5TP9 B;  2XX9 A;  1Y3N A;  4F39 A;  1R6Z A;  3MVX A;  3O97 A;  2XXP A;  5L9O A;  3MPL A;  5H8N B;  2R9J A;  3RLF E;  2Y7I A;  1R9Q A;  4U2R A;  2GFE A;  4DXC A;  3HHG A;  2RIN A;  1WDN A;  4YB6 A;  1A99 A;  4IY6 A;  3RGY A;  1POT A;  3HST A;  1JEU A;  3IJO B;  4RY1 A;  3THI A;  2B3F A;  1P1W A;  2V25 A;  3GZG A;  2D5W A;  4FAT A;  1N7X A;  2I3V A;  1N3W A;  1Y1Z A;  3W15 C;  4GLI A;  3M8U A;  5AA3 A;  5I2N A;  1ZKB A;  2F6G A;  3K6W A;  5I56 A;  4U1Z A;  4KCC A;  1MXY A;  2Y7W A;  3TPA A;  1WOD A;  2VOZ A;  4IGR A;  2REJ A;  1US5 A;  1OMP A;  1UQW A;  2Z8E A;  5ELV A;  1Y9U A;  1B3F A;  2UVH A;  1LCF A;  1LST A;  4I8C A;  4Z0I A;  3A09 A;  2H98 A;  1UTH B;  1DTZ A;  1MDQ A;  4BDO A;  4MLQ A;  1B1H A;  1LBB A;  3R6U A;  4EXK A;  1YPN A;  3RY3 A;  4U23 A;  2O68 A;  3MP8 A;  5H8Q A;  5DTB A;  5F1Q A;  1MPB A;  1GVC A;  4ZDM A;  2X7P A;  3RT6 B;  3OD7 A;  2I49 A;  5DVJ A;  3UK4 A;  4ESW A;  4EQB A;  4NF6 A;  3USD A;  4ZEK A;  3GXA A;  4H65 A;  4FEB A;  1SYH A;  3PPQ A;  2P0S A;  4HCY A;  1S9T A;  1HSE A;  1H44 A;  3S9N C;  3KN3 A;  4DXU A;  3R26 A;  3O6H A;  2RC7 A;  3VE1 B;  4HW8 A;  3SEU A;  2DVZ A;  1OVB A;  1YCJ A;  2XXH A;  4DIG A;  4F1Y A;  5K2X A;  3TCG A;  3IX1 A;  3BKI B;  4TOZ A;  4DXB A;  4LQ2 A;  2GH9 A;  4GL8 A;  4ZEC A;  1YTV A;  1II5 A;  1M5E A;  3TTK A;  1FTJ A;  3OO9 A;  4IB2 A;  3C36 A;  1NNT A;  1Y4C A;  1ELJ A;  4R72 A;  4LON B;  3C32 A;  2XXV A;  4ZZA A;  4I1D A;  4YU0 A;  2P2A A;  1B7H A;  3GBB A;  1HSJ A;  4FOR A;  1XT8 A;  4QFN A;  1MQH A;  4G68 A;  4U4X A;  3O2A A;  4IO5 A;  2PBW A;  1RYX A;  1XOC A;  5B7D A;  5I2K A;  3L6H A;  5JEI A;  2Y7K A;  3K6U A;  1MXX A;  2OBG A;  1AL3 A;  3ZSF A;  2XX8 A;  1D9V A;  2VP1 A;  2OWT A;  3H7M A;  3VLW A;  1I69 A;  2ONR A;  3N6U A;  3GBA A;  2B3B A;  3RNN A;  2V93 A;  2R71 A;  3FAS A;  3MVZ A;  5I58 B;  2ZNS A;  5TPA A;  5I84 A;  2HQ0 A;  3OO6 A;  1M5C A;  2CMO A;  3RQT A;  3IK6 B;  1L5T A;  1IXI A;  1ZJL A;  3K2D A;  3EHT A;  4C0R A;  1FQC A;  2OK2 A;  3BFU A;  2H4I A;  3VLU A;  3PGF A;  5AA2 D;  3O6G A;  4Q0C A;  1MDP 1;  1OLC A;  4QFK A;  4WED A;  3K0V A;  1VFE A;  4DZ1 A;  2F6P A;  1TWY A;  2PMS A;  4ONY A;  4QFO A;  2F78 A;  2IEE A;  1BP5 A;  3E3K A;  1IXG A;  1TFD A;  4NTL A;  2XD2 A;  2OCU A;  3MC2 A;  3OEL A;  2RCA A;  3JV9 A;  4NF4 A;  1B40 A;  3K1M A;  4EDP A;  4YKJ A;  4R73 A;  4POW A;  3O28 A;  1URG A;  1MXZ A;  2NVU B;  4Q30 B;  1B3E A;  3ODB A;  2W7Y A;  5AA2 B;  2HFB A;  4KYD A;  3FVO A;  1N04 A;  4PQJ A;  3U92 A;  3KN7 A;  3TFL A;  3HV1 A;  3KFM A;  5L9M A;  4NF8 B;  3KJ7 A;  3TTL A;  5TU0 A;  4R9G A;  2F7A A;  4XIG Q;  1EZP A;  4LZ7 A;  4EQ7 A;  3C35 A;  4QFP A;  4NMY A;  2O1L A;  1T0K A;  1B4H A;  1UTB B;  4RPN A;  1SW4 A;  3IOU A;  2H25 A;  4F3G A;  2RF1 A;  3OEN A;  1B7U A;  5CRY A;  5FTI A;  2REG A;  3SEX A;  1B5H A;  4MFI A;  3MVW A;  5A5X A;  3ILT B;  4EQ9 A;  2G93 A;  4OHN A;  4BDN A;  2Z23 A;  3OOA A;  2AIX A;  3U94 A;  4F31 B;  1NNK A;  3Q28 A;  3S4U A;  1Y4T A;  2QS1 A;  3EPE A;  1SW5 A;  5H8S A;  3IL1 B;  1B5I A;  2D21 A;  3D4C A;  2F7C A;  2ZNU A;  4IO7 A;  5IKB A;  2O6A A;  4H8I A;  1LFH A;  3FJG A;  5EHS A;  4H0W A;  1LAH E;  5DYH A;  3TCH A;  2O84 X;  1FQE A;  1KWH A;  1SI0 A;  3IJX B;  5EHM A;  2F34 A;  2O7U A;  3TTN A;  1MPD A;  3SEY A;  4Z7E A;  4H5G A;  5LOM A;  1J1N A;  1GR2 A;  4GRK A;  1ZMG A;  3B6W A;  1I6Q A;  3CVG A;  4JB7 A;  4IO6 A;  4MH5 A;  1JVY A;  4R6H A;  3IO4 A;  3V5A A;  1AMF A;  3BBR A;  4QRZ A;  3ZS6 A;  3V83 A;  1JW5 A;  3IO6 A;  4ZZE A;  2I6E A;  2XXR A;  3IOV A;  2ABH A;  4OXV A;  1LLS A;  3U8Q A;  5H8H B;  1A7L A;  4YIC A;  4L17 A;  4YB5 A;  1XHY A;  4KD5 A;  1UIV A;  3VXB A;  4F2Q A;  3H6T A;  5I59 B;  2I3W A;  3MZ9 A;  1H45 A;  1AH5 A;  4GF8 A;  4Q5T A;  1Y3P A;  3CFL A;  4K3F A;  1BLF A;  5F7V A;  3HO7 A;  1SW1 A;  2KLF A;  3PUZ E;  3TDJ A;  3UOR A;  2FA7 A;  4OES A;  3EHU A;  3Q29 A;  4ELP A;  4GWO A;  3OO7 A;  3G3I A;  2RCB A;  4OEV A;  3I3V A;  4IY5 A;  1MS7 A;  3TCF A;  3T9U A;  1R9L A;  2ONK E;  4WEP A;  2ONS A;  4NE4 A;  4IO3 A;  2I58 A;  4XKP A;  3QUJ A;  1N76 A;  2PVU A;  1QUJ A;  4XKR A;  1IXH A;  3K6V A;  3G3G A;  3KBR A;  1MXU A;  1M5F A;  4YB7 A;  3FXU A;  3TYH A;  4THI A;  2V3Q A;  4F22 A;  3EQ1 A;  3I5O A;  2ZYK A;  5AA4 A;  2F7B A;  4F1V A;  5HPQ A;  3SES A;  2F5X A;  3JZJ A;  3TTR A;  4ESX A;  1H43 A;  4FE8 A;  3IAZ A;  1FQB A;  3MW0 A;  3OSQ A;  1Y1M A;  1QKB A;  2DOJ A;  4BLA A;  2RKM A;  4U21 A;  2GHB A;  2XXU A;  3P7I A;  4Q8R A;  4F29 A;  3KSX A;  3T9X B;  3LC8 A;  3H03 A;  4RK9 A;  2CZL A;  3O6I A;  3PUX E;  3Q25 A;  4GVO A;  2XHD A;  1N84 A;  2WKY A;  5KDT A;  3TTM A;  4KFQ A;  3C9H A;  2DVC A;  4KI0 E;  2DQV A;  1MY1 A;  3FVN A;  3PUY E;  2OLB A;  5CBS A;  3KJT A;  4KYE A;  4JWO A;  5H8F A;  1B3G A;  1Q35 A;  1WVJ A;  4H67 A;  1S50 A;  4F1U A;  4QF9 A;  1M5B A;  1SI1 A;  2QS3 A;  4IGT A;  4O3B A;  5DEX A;  4BDM A;  1LFG A;  3MZB A;  4PFT A;  3OSR A;  5DVF A;  3LSL A;  5KCJ B;  3WAF A;  1XC1 A;  1O63 A;  2DE4 A;  3GLB A;  1FTL A;  2QSX A;  1DPE A;  1B9J A;  3SDF A;  2Q2A A;  4OMB A;  3QXM A;  4OZ9 A;  2ZNT A;  4G4P A;  2H5Y A;  2HAU A;  3CG3 A;  1VE4 A;  1B7Z A;  2O51 A;  3FV2 A;  4C1T A;  2ZYO A;  4U22 A;  4DE8 A;  4QSE A;  4KR5 A;  1AIV A;  1FQD A;  4PE5 B;  1DSN A;  3RUM A;  1JEV A;  2V3U A;  2HZK A;  5HBC A;  3UN6 A;  1TXF A;  4P0G A;  4F3S A;  1P1U A;  3S9E A;  1B5J A;  4TQU Q;  3TEP A;  3FVK A;  1USY E;  4R2B A;  4XXU A;  1URD A;  3IB2 A;  4OYV A;  1MPC A;  1D4N A;  4ECF A;  5J1D A;  3W9V A;  4NF5 B;  4N07 A;  1GTK A;  1PC3 A;  3BFT A;  5JTY B;  3TQW A;  1OQH A;  3PV0 E;  3VVD A;  4M4G A;  1URS A;  3FZV A;  4BDR A;  4XKQ A;  5ISU A;  4KQP A;  4YMB A;  5I57 A;  2O69 A;  2Q9T A;  2A5T B;  2ZMB A;  2Z22 A;  4FAJ A;  2QMX A;  4F3B A;  3HN0 A;  1VFD A;  4MLV A;  3MWB A;  3TAJ A;  4JDF A;  3T9H B;  2PT1 A;  1TT1 A;  1PEB A;  2P1S A;  5L8D A;  1JVX A;  2DWH A;  2LAO A;  2H99 A;  2E0S A;  3D4G A;  5DVI A;  5ITP A;  2UVJ A;  2X7Q A;  4DCY A;  1GV8 A;  3SEW A;  2ESN A;  4ZED A;  2Q8J A;  3QIM A;  2I0B A;  4AB6 A;  3PPN A;  4G8H A;  4RPO A;  2F36 A;  2ZXT A;  3M3F A;  3MQ9 A;  4EF2 A;  3MZ1 A;  1MY4 A;  1Y3Q A;  4F18 A;  1GGG A;  4R6K A;  3Q26 A;  5FHO A;  3RT8 A;  2GHA A;  1BKA A;  1NFT A;  3N5L A;  3PMX A;  5AA1 A;  2DP8 A;  1MG1 A;  1D3K A;  4R9F A;  3MBP A;  4N6P A;  3IB1 A;  1RKM A;  1R1N A;  5TP9 A;  2E1S A;  4RJZ A;  5I2N B;  3VVE A;  1Z7M E;  4WXJ A;  2DXR A;  4G8N A;  5I56 B;  4GOT A;  4TLM B;  5H8N A;  1SW2 A;  1B2H A;  3QUF A;  2RC9 A;  3C31 A;  2AL4 A;  4X1D A;  4U1O A;  4JSD A;  3ECR A;  4O3A A;  1NKX A;  4BDL A;  2I4C A;  4NWC A;  1I6B A;  1MQG A;  3KN8 A;  4PFY A;  3IR1 A;  3IOW A;  4PFW A;  3CFX A;  5H8Q B;  1QUK A;  3FGS A;  3PMW A;  2I0C A;  2Q88 A;  1MM7 A;  1DOT A;  2XX7 A;  3M3K A;  4FED A;  4NF6 B;  3G3K A;  3H06 B;  3LBS A;  4QFL A;  2DWJ A;  3H6V A;  3HCQ A;  3OXN A;  1UTH A;  1PBP A;  2IA4 A;  3U93 A;  3K00 A;  1F9B A;  2Y7R A;  1ZU0 A;  2NXO A;  3O66 A;  3KOT A;  4LAT A;  1CE2 A;  4OEN A;  4YKK A;  1POY 1;  1LGB C;  2F8D A;  4QHQ A;  4ELQ A;  4ZE9 A;  1SDX A;  3LR1 A;  1NNF A;  5ICT A;  1NMU A;  3QSL A;  2M8C A;  1B3L A;  1P99 A;  2FNC A;  4EF1 A;  4F2O A;  3KZG A;  1QJM A;  4KCD A;  1IQ7 A;  4JXI A;  4OFJ A;  3TOD A;  4BDQ A;  1SBP A;  1P1O A;  4PP0 A;  5CI5 A;  1LFI A;  3VLV A;  4KYS A;  3I6V A;  4RA1 A;  3G3F A;  4G68 B;  1PB7 A;  1MY3 A;  2ALU A;  1EH3 A;  1PB9 A;  4ZS9 A;  3N94 A;  5I2K B;  5HM4 B;  4GFR A;  3PD9 A;  3QK6 A;  1ZBM A;  2Q2C A;  4PFU A;  4ZEB A;  1JW1 A;  4G77 A;  5ITO A;  3OO8 A;  4H6D A;  3T93 B;  1FW0 A;  2QS4 A;  4YKI A;  1LAF E;  3F11 A;  2QL3 A;  4G8M A;  4JWX A;  5FHM A;  3E13 X;  2I48 A;  3R7X A;  4OQO A;  3DEL B;  1IXC A;  3ZKK A;  1NL5 A;  3PPP A;  2PYY A;  5TPA B;  2XXQ A;  2XXX A;  4ZEF A;  1I6A A;  4YZZ A;  3H6U A;  3PD8 A;  4IO4 A;  3S9L C;  2HCA A;  4ND9 A;  1JET A;  1SD3 A;  3TMG A;  1H3D A;  4GD5 A;  5KZT A;  1PBQ A;  1B3H A;  3M3L A;  3HHF A;  3FD3 A;  3T22 A;  1FQF A;  1NNP A;  5DT6 A;  3KEI A;  5I58 A;  2AL5 A;  1MXW A;  1RYO A;  4H1X A;  2NUV A;  2O7I A;  4NF4 B;  4LA9 A;  3TUS A;  3SER A;  3AXF A;  3CIJ A;  3TEL A;  4R2F A;  3A3C A;  3E9X A;  3ILU B;  2VGQ A;  4RXL A;  1OLA A;  4F3P A;  3K4U A;  2XXI A;  4M1V A;  3DP4 A;  4EUO A;  3FAT A;  5FHN A;  4OVJ A;  3TQL A;  5AE4 A;  1VSO A;  3OMB A;  4WKM A;  4GIZ A;  1B1X A;  3LUY A;  1H76 A;  3VDF A;  1B0L A;  2GRV A;  3K6X A;  3G3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...