3VVFA

Crystal structure of ttc0807 complexed with arginine
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
241
Chain Sequence
GGSEFQVRSFEEIKRSGEIRIGTEGAFPPFNYFDERNQLTGFEVDLGNAIAERLGLKPRWIAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVSRKGGPRTAKDLQGKVVGVQVGTTYMEAAQKIPGIKEVRTYQRDPDALQDLLAGRIDTWITDRFVAKEAIKERKLENTLQVGELVFQERVAMAVAKGNKSLLDALNRALAELMQDGTYARISQKWFGEDVRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two ATP-Binding Cassette Transporters Involved in (S)-2-Aminoethyl-Cysteine Uptake in Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, binding protein
total genus 90
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vvfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vvfA02
3VVFA 3UORA 1UIUA 3K6VA 2UVGA 1M5EA 2IA4A 5AA2D 1D4NA 3KGCA 3VFJA 1H43A 1HSLA 3O29A 4BDOA 2HAVA 2RC7A 1P1WA 3LR1A 2ANJA 5AE4A 3H4ZA 1P1QA 1MQJA 4RK9A 1I6AA 1Q1KA 3ODBA 3RPWA 3R26A 4R2FA 4ND9A 4EXKA 5IAIA 2F5XA 5BUUA 4GXSB 3B6WA 3K6WA 2F35A 2FA7A 3TQLA 1XOCA 2E1SA 3HCQA 1EZ9A 3PPOA 4ZE8A 3IJXB 1DSNA 4ZDMA 2F6GA 3PPPA 1B1XA 4G4PA 4I1DA 3T9HB 3MBPA 1MPDA 4YKIA 4G68A 1B3LA 3K6XA 1MDP1 3PD9A 4POWA 4YAHX 3H6VA 1PB8A 1LCFA 3BFTA 3U72A 3RN8A 1B2HA 3VV5A 4U21A 3TMGA 1TFDA 2B65A 2XD2A 1B4ZA 3D4CA 1B9JA 3KJ7A 3TTKA 4PFTA 1PB9A 2NWJA 1FQAA 4XKNA 4JBZA 3FASA 3ECRA 3KOTA 1FTOA 4G8HA 1IEJA 2DQVA 1M5FA 2G93A 2RC8A 4KI0E 1IIWA 4YB5A 1BLFA 1P1UA 3MQ9A 2Z8FA 1WVJA 2XXTA 1VFDA 2UVHA 3E3KA 3O2AA 4H67A 4ELQA 1VFEA 3BBRA 1ZMGA 4H5FA 2F34A 3H03A 1LGBC 2DVZA 3A09A 4HTGA 4IO6A 4OFOA 3RTWB 2REGA 2O7IA 1S7YA 2ZYMA 2I6EA 4H8JA 2Q8JA 3RUMA 4GVOA 4M4GA 1MQIA 1MY0A 4Z7EA 1CB6A 3M8UA 2B3FA 4ZEKA 2Q2AA 2ZYKA 3MPLA 3T9XB 1QUKA 3IB0A 2XX7A 5H8NA 1NH8A 1M5BA 3C33A 1HSJA 5JEIA 3M3LA 5K2YA 3ZSFA 4X1DA 2FYIA 4H65A 3K01A 2O84X 4FORA 4MLQA 5CC2A 3V83A 1MRPA 2R6GE 3H7MA 1J1NA 1JVYA 1TT1A 1S50A 2H99A 1D9VA 3DP8A 3TTLA 1SQYA 1MH4A 1JNFA 1P1OA 2A5TB 4QFNA 4Q0CA 1ZLQA 3QAXA 3R6UA 4GF8A 1MS7A 2GFEA 2RINA 3LSFB 3MZ1A 4WKMA 4F1UA 1EH3A 1FTMA 2KLFA 3KN3A 4NEDA 3ILTB 4GQOA 4O3BA 1P1NA 5M2VA 1O7TA 1XS5A 1VE4A 2YLNA 4JSOA 4MH5A 4NF6B 4DLDA 5AA3A 1B32A 3C34A 3MZ9A 3MJNA 4JWXA 4F1VA 2H5YA 4ELPA 1TWYA 2QS3A 4DDDA 4LQ2A 1EU8A 1MXUA 1PC3A 3SETA 5CI5A 4BLAA 1URDA 2ALUA 5K2XA 5F1QA 3UN6A 2UXAA 3IORA 1FQFA 1MQGA 5J1DA 4XIGQ 3FV1A 3KOSA 1JQFA 2W7YA 2Y7KA 4EXLA 4ZE9A 4ECFA 2THIA 3IAZA 3KG2A 5DEXA 3K1MA 1BP5A 4F2OA 3OXNA 2OWSA 4RJZA 3HSTA 2QJEA 2HFBA 2Y7PA 4QFPA 3V8XB 1KWHA 5JTYA 4FEDA 2X7PA 3HPIA 3FXRA 5I2NA 4IO5A 3R7XA 1LBCA 1B7HA 2XXYA 4MF3A 5H8FA 3K6UA 2QL3A 4ZEBA 1RKMA 2AIXA 4QSEA 2Z8EA 4DZ1A 4KR5A 4TLLB 3CVGA 4H1XA 4U1OA 3TDJA 1MXYA 1LB9A 1MXZA 3H6TA 5I57B 1H44A 3EHUA 4YMAA 4LUBA 4KYEA 4UA8A 3RTFB 1ATGA 3K0VA 5CMMA 4PP0A 4G77A 1MM7A 1MY3A 1XHYA 2OZZA 3RNNA 4BDRA 3G3KA 1YPNA 3E4RA 3I6VA 3K02A 3QSLA 1B3HA 1B0HA 3PMXA 1Y4TA 3DM0A 1LLSA 1NFTA 5TP9B 1B58A 4ISUA 5I84A 1SW1A 3LSXA 4GWOA 4LZ8A 1OMPA 2XXVA 2D3IA 3MC2A 4NF4A 4NMYA 4O3AA 4HCWA 5KDTA 1JW1A 4Z0IA 5H8FB 1A99A 4POXA 1MPCA 2DXYA 3CRBA 3PGFA 5TU0A 1B0LA 3SEWA 3T93B 4XKRA 2NOOA 4OFLA 3VE1B 4F18A 1FQCA 2Z23A 5DYHA 3GBAA 4THIA 3W15C 1NL5A 3LSWA 1LFGA 4DIGA 2REJA 1URSA 2DE3A 2O69A 2OWTA 2PYYA 4MFIA 1AMFA 2P1SA 4U4SA 4YU0A 3VLWA 2Y7WA 4MLVA 4R2BA 3SDFA 3UK4A 4QFOA 5ICTA 3O6GA 3GLBA 2BJJX 2GRVA 3IOUA 2DE2A 3CIJA 2QS1A 2HEUA 1Y9UA 2IEEA 3FJGA 3TPAA 3TTNA 3V5AA 4EDPA 4ELRA 3PPNA 1FQEA 2VD2A 3D4GA 4BDQA 3H6WA 3V89B 3VVDA 5A5XA 3ZKKA 2F7AA 3TELA 4ZZAA 3OO9A 1IZ1A 5FTHA 3FD3A 1LAHE 5KZTA 1A40A 4OQOA 1Q35A 1IXGA 2DXRA 1PEBA 1ZIUA 1H45A 2B3BA 3KN8A 4GL0A 4GL8A 3T96B 3O97A 2Q9TA 5AA2B 3G3GA 4TOZA 1A55A 3KSXA 1OVBA 3O66A 2ONRA 1B46A 3DELB 1LAXA 1II5A 1NNFA 1OLAA 2O7UA 1Y3NA 2OJTA 4JB7A 4LZ7A 5H8QB 1MPBA 3Q26A 1B4HA 2XXPA 3EF7A 1POTA 4PFUA 3TCHA 3Q28A 4R9FA 2ABHA 4EQ9A 5CMBA 2XXUA 3MUQA 4G8MA 5H8HB 2V3QA 3FVNA 2WKYA 3OO8A 4HCYA 4I62A 3IK6B 3VLVA 2XXRA 3N6UA 1T0KA 3O28A 4R6HA 4E0XA 2QMWA 4LP2B 2P0SA 4YKKA 2I4BA 3IB1A 3HHGA 2HZLA 2XXHA 3UIFA 1F9BA 1JEVA 3KZGA 2OK2A 1P99A 3BFUA 3G3HA 1OQHA 1ELJA 2F8DA 4OEUA 2AL5A 1I69A 3WAFA 1UQWA 1IXIA 4FE8A 4OENA 3QK6A 4KQPA 4R72A 3SEXA 2Z8DA 3C35A 4AB6A 5B7DA 1SBPA 4ZS9A 4BDNA 4ONYA 2H9BA 4U23A 3UGWA 4R6KA 1Z7ME 2HAUA 3OD7A 1N3XA 2RCAA 3U8QA 1LSTA 3U93A 3IOVA 2I3VA 2XX8A 4JXIA 3C32A 3K2DA 2D21A 3AXFA 3PPRA 3PUYE 4LVQA 4QSDA 3THIA 4AB5A 2I0CA 3N26A 4RA1A 4QFLA 3KFMA 1B5JA 3CFLA 1B40A 1PDAA 3MP8A 4LA9A 1Y1ZA 4IO3A 3K1PA 4U22A 3TAJA 4RNSA 3PUZE 1SD3A 2DYXA 1OVTA 2HZKA 1JEUA 1B3GA 1NNKA 4H8IA 5F7VA 2VHAA 3CG3A 4NTLA 4ZZEA 1B05A 2DWHA 3FXQA 3L6HA 2LAOA 4DXBA 3TEPA 4G8NA 3OEMA 1HSEA 1TFAA 4P0IA 2CZLA 2DE4A 2PT1A 4NF8A 3QYTA 3Q29A 4EQ7A 1NKXA 3TYHA 4F3GA 3BKIB 2QS4A 4KYDA 4NF5A 3USDA 1LFHA 3TCGA 2QPQA 4JWYA 4NWDA 3T66A 3M3FA 2XHDA 2UYFA 3P7IA 4QF9A 2I48A 3ONMA 3RGYA 5I2KA 2VOZA 2XD3A 4MBPA 1US5A 4RXLA 4N6PA 2GH9A 1A7LA 1VR5A 2D5WA 1QUJA 3QXMA 3QUFA 1B6HA 1SI0A 1OLCA 1PBPA 4GLIA 1YTVA 1MXWA 5ELVA 1N76A 3B6TA 5I59B 3Q25A 3RLFE 3DP6A 1MM6A 3H06B 1B52A 1H3DA 1Z7NE 5JTYB 5LOMA 4FJPA 4ZEFA 5AA4A 1GR2A 1AOVA 3PMWA 1NH7A 4NWCA 1LB8A 2DWJA 2O51A 2H4IA 4YKPA 3T22A 3S9MC 5ISUA 4OVJA 1B3FA 3E13X 3UA8A 3E9XA 3MVXA 1QKBA 3CG1A 1NNTA 5BWJA 1PB7A 2DOJA 3CI8A 5EYFA 4F1YA 4FATA 1CE2A 1FW0A 2H98A 1I6BA 2CMOA 3M3KA 3MWBA 3OMBA 4FEBA 5H8SA 4OWDA 3VVEA 1VSOA 4F29A 1GVCA 4LONB 4AQ4A 2GHBA 2XXWA 4G68C 3IX1A 3C31A 4QRZA 3G3IA 2VGQA 3FIRA 3PPQA 3MP1A 4TLMB 1GV8A 3FVKA 4IO7A 2ZNTA 3FUZA 3PUVE 5FHOA 5I58B 4C0RA 5L9SA 4PETA 1BKAA 1Y4CA 1URGA 3JYRA 1ZKBA 3TQWA 4PFYA 2E0SA 4DCYA 4F3SA 4FAJA 1R9QA 1XC1A 2OLBA 4H6DA 4OXVA 4R6YA 2YJPA 1IXHA 1DOTA 3CFXA 4LATA 2I58A 2ONSA 4OMBA 5FTIA 4FECA 2OBGA 1XVYA 3CSBA 3EHSA 5HBCA 1JVXA 5CBRA 4EUOA 3O9PA 4R9GA 3ZKLA 4R74A 4YMBA 1MDQA 2DWAA 4OYVA 3C4MA 3SERA 3VXBA 4P11A 4Q5TA 1USYE 5DVJA 2UVIA 3RQTA 2F78A 2ZYNA 2O1MA 1LFIA 1IXCA 4NE4A 1IQ7A 4OHNA 4OESA 3IO4A 4XKPA 2F7BA 2Y7IA 3MVWA 5DTBA 4ELOA 1UTBB 3GXAA 4F39A 1MY1A 4X48A 4YZZA 3ZS6A 1UTHA 3TFLA 1H76A 1MG1A 2QRYA 4R73A 4WEDA 3SESA 3UP9A 1ZTYA 4FIMA 4H5GA 2V93A 4PQJA 3SKPA 4WXJA 5EHMA 1YCJA 3KSJA 2ONKE 4LZ5A 4U4XA 3I5OA 2ZNSA 2RF1A 3EHTA 1MQDA 3DLNA 3OENA 1FTJA 1MQHA 1OIBA 4HW8A 3MAMA 3U94A 1EZPA 1QW0A 3ILUB 5TP9A 2UVJA 2ZMBA 4HS7A 1SYIA 1B5IA 1DPPA 3O6IA 5DT6A 4NF4B 3OSQA 5AA2A 2F6PA 3C9HA 4KD5A 4EF2A 3VXCA 4KPTA 1OQGA 3LUYA 4XTCQ 1MXVA 4NF6A 4YB7A 3G7WA 3IB2A 4IY6A 3SEYA 1O63A 4L17A 3IOWA 1FTLA 1R9LA 1MY4A 4IY5A 5FHMA 1UIVA 2I3WA 3IJOB 3HV1A 4G68B 3HN0A 4GIZA 1A8FA 3KBRA 1JW4A 3TCFA 1AIVA 2V84A 1GTKA 3OSRA 1B7UA 3JV9A 3S9LC 3FVOA 3H3GA 1USYH 2DVCA 1N04A 3PU5A 1SVXB 4OTEA 3S9EA 4QFKA 5ICQA 2QS2A 5CBSA 4UACA 1POY1 2X26A 1UTHB 2G29A 1QJMA 3CFZA 1B5HA 2HCAA 3A3CA 4K3FA 2RC9A 4OETA 5DVFA 5DVIA 1SDXA 1DMBA 3PMVA 5DEXB 3LC8A 3WAEA 4KYSA 5CMCA 3IL1B 1ZU0A 2UYEA 3TTMA 3MVYA 1O64A 4IGRA 2VP1A 2O68A 1WDNA 4JSDA 1LAGE 1TXFA 3L6GA 2NVUB 1M5CA 4QSCA 4OERA 4OZ9A 3CR9A 5HM4B 3H6UA 1N7WA 3OEKA 4R75A 4ZEDA 1R6ZA 1S9TA 3GBBA 2QSXA 3A3UA 4NF8B 1FTKA 5I56B 1RYXA 3KN7A 3FJ7A 5CRYA 1SW2A 4F3BA 2AL4A 3F11A 2R9JA 2R71A 3DP4A 2A5TA 5FHNA 4RPNA 3Q27A 2NUVA 3T9UA 4GRKA 5B70A 3GZGA 4C1TA 1LBBA 4RK2A 5KCJA 2PMSA 1B3EA 3K1NA 4F3PA 3CSGA 1DTGA 2I0BA 3LSLA 3QIMA 2I49A 2DP8A 3IOTA 1UTBA 2PT2A 3EN3A 3MVZA 4KHZE 5ITPA 2V3UA 4N13A 4JWOA 2PX1A 1DTZA 1XVXA 2XXXA 4YB6A 2Q88A 2VD3A 5TPAB 5HPQA 5I59A 4N07A 5H8HA 1AL3A 2H25A 1SW4A 1IUDA 1WODA 2M8CA 4GOTA 1QKAA 2V3TA 1BIYA 1SI1A 4JDFA 2V25A 3KJTA 4U1ZA 5TPAA 1IITA 3LBSA 3RT8A 3S4UA 4I9DA 4RPOA 2XX9A 2A5SA 4LQ5A 3W9WA 1A8EA 4H0WA 4IO2A 2FNCA 5CMKA 5L8DA 1Y3QA 1MH3A 1RYOA 3HHFA 1L5TA 3TODA 1ZBMA 3OOAA 1I6QA 3RT6B 2YPNA 3FATA 2NXOA 1ANFA 1MY2A 3FGSA 3IO6A 4GXAA 4BDLA 5I58A 2PVUA 2O1LA 4X1BA 2DS9A 3TZAA 5CM6A 2ESNA 3SEUA 5A5XB 3K00A 3OELA 5H8QA 1ZJLA 5L9OA 3QUJA 1LCTA 1QVSA 4DXCA 4ESXA 1SW5A 1Y3PA 2PBWA 4I8CA 4Q8RA 5I56A 3C36A 3HO7A 1N7XA 2X7QA 3K4UA 3MW0A 4GFRA 5L9MA 2OCUA 3SEVA 3FXUA 3T9VA 2GHAA 4XKQA 5I2NB 2P2AA 3PUWE 1N0TA 3PUXE 5I57A 3EPEA 4EF1A 4GD5A 5AA4B 1B7ZA 1D3KA 2Y84A 3PD8A 2RKMA 3VLUA 4EQBA 4F2QA 2HQ0A 4F19A 4U2RA 1B51A 1DPEA 4KCCA 1JETA 1N3WA 4O3CA 1FQBA 3B7DA 3G3JA 5EHSA 1FQDA 1FCKA 4BDMA 1NMUA 3TUSA 3EQ1A 5KDTB 3MPKA 1Y20A 3N94A 2DSFA 2F7CA 4DCXA 4Q30B 2F97A 4F22A 1EZOA 4IGTA 4YICA 3RY3A 3TKDA 2Y7RA 2F36A 2XXQA 1US4A 4G2ZA 5I2KB 1N84A 4C1UA 3JZJA 3N5LA 1YAEA 4QHQA 4XXUA 1R1NA 1BTJA 4KCDA 1MXXA 2ZXTA 1M5DA 1D9YA 2ZYOA 3N6TA 1PBQA 4IO4A 1QUIA 4NF5B 3S2VA 4ESWA 3PV0E 1XT8A 2I4CA 4OFJA 3FZVA 4DXUA 3MZBA 4F31B 4RY1A 4E0WA 1QULA 3B6QA 3FVGA 3O6HA 4YKJA 4ZEIA 1B1HA 5AA1A 4PE5B 4DE8A 2Q89A 4IB2A 2ZNUA 3U92A 4ZECA 3S9NC 3FV2A 2QMXA 2O6AA 3MP6A 4PFWA 3U1OA 4OEVA 1LAFE 3W9VA 2HXWA 2Q2CA 3I3VA 3TTRA 3KEIA 5IKBA 2Z22A 4KFQA 3VDFA 4M1VA 1NNPA 3OO6A 5H8NB 5JK4A 4WEPA 5KCJB 1AH5A 3FJMA 3G3FA 2DWIA 2XXIA 1JW5A 4TQUQ 1GGGA 1A54A 3IR1A 4RYAA 2AYSA 4X9TA 3OO7A 2RCBA 1Y1MA 1SYHA 4P0GA 5ITOA
chains in the Genus database with same CATH superfamily
1M5EA 1D4NA 4BDOA 4OANA 1P1WA 5AE4A 2ANJA 4MCOA 1P1QA 3ODBA 4PCDA 4R2FA 2F5XA 3B6WA 2FA7A 4ZE8A 4ZDMA 4G4PA 1MPDA 4YKIA 3U72A 3RN8A 3TMGA 2B65A 1B4ZA 4PFTA 3ECRA 1FTOA 4NG7A 4I40A 2G93A 1P1UA 3MQ9A 1WVJA 2UVHA 1ZMGA 4H5FA 3H03A 3A09A 2DVZA 3RTWB 5IZ1A 1DCUA 1CB6A 5EQAA 2Q2AA 2ZYKA 3MPLA 2XX7A 4OVTA 3C33A 1HSJA 4JVCA 2F3DA 4MLQA 5CC2A 3H7MA 3DP8A 4QFNA 1JNFA 3CHGA 3R6UA 1MS7A 4F1UA 5KCJA 1BK4A 1EH3A 1FTMA 3ILTB 1P1NA 4DLDA 5AA3A 3C34A 4F1VA 2XXKA 5EQ7A 4DDDA 1EU8A 3SETA 2XWIA 3IORA 1FQFA 3KOSA 1BP5A 2Y5LA 3OXNA 5JTYA 3D1RA 1LBCA 3K6UA 2Z8EA 4KR5A 4TLLB 5LTCA 3EHUA 1ATGA 5CMMA 4GWXA 1MM7A 4IR8A 2OZZA 3DM0A 1LLSA 4MNPA 3LSXA 4Z0IA 5H8FB 4POXA 3SEWA 1FQCA 2Z23A 5DYHA 3GBAA 4THIA 2OWTA 4YU0A 3SDFA 3IOUA 4QBAA 3TPAA 4ZEDA 1FBPA 3PPNA 4I3YA 4PDDA 3H6WA 4PC9A 3FD3A 2CEXA 3ROJA 3KN8A 2Q9TA 5AA2B 1A55A 3KSXA 1B46A 5CBRA 1OLAA 5H8QB 2OJTA 1MPBA 4PFUA 4R9FA 4G8MA 5ESYA 2V3QA 3FVNA 2B4MA 4R6HA 4LP2B 4MAGA 3IB1A 2XXHA 1JEVA 2FBPA 3G3HA 1OQHA 5ET5A 1I69A 4OENA 4P8BA 4P9KA 4BDNA 1Z7ME 2HAUA 3SZPA 2I3VA 2XX8A 4JXIA 3C32A 3AXFA 3KFMA 5LDZA 3MP8A 4RNSA 1SD3A 2DYXA 1NNKA 1B3GA 1LBXA 3TEPA 2LAOA 1HSEA 4P0IA 2PT1A 1EYIA 3BKIB 3M3FA 3RGYA 5I2KA 4MBPA 4N6PA 2D5WA 2CZKA 4GLIA 2P3VA 4N17A 1GR2A 1AOVA 4NWCA 2O51A 4YKPA 5ISUA 1IMBA 3S9MC 3E9XA 1NNTA 3CI8A 3EKIA 1I6BA 3OMBA 1VSOA 1GVCA 4LONB 4QRZA 4NN3A 3PPQA 1GV8A 4IO7A 2ZNTA 3PUVE 1URGA 4DCYA 4R6YA 1DOTA 3CSBA 5HBCA 4R74A 1MDQA 2DWAA 2CEYA 5DVJA 3RQTA 4NE4A 4OHNA 4XKPA 2Y7IA 3MVWA 4F39A 4WEDA 3UP9A 4FIMA 4H5GA 2V93A 5EHMA 3KSJA 4LZ5A 3I5OA 4NQ8A 4HW8A 1OIBA 3U94A 5TP9A 1B5IA 4NF4B 3OSQA 5AA2A 3VXCA 4KPTA 4X04A 1FBDA 1MXVA 4PGPA 4IY6A 1FPGA 1FBGA 4IY5A 2FIEA 5I3SA 3PU5A 4DI3D 1D9QA 1YZ0A 1DBZA 5ICQA 5CBSA 5DVFA 2RC9A 5DVIA 3PMVA 5DEXB 3IL1B 4GWSA 3TTMA 4JSDA 1FBEA 4QSCA 3LV0A 4R75A 1R6ZA 1S9TA 4MMPA 3GBBA 2QSXA 1FBHA 4P56A 3F11A 2R71A 3DP4A 1XI6A 4RPNA 2NUVA 5B70A 4MJOA 1B3EA 3RPLA 2KQZA 3QIMA 3MVZA 4HXVA 3EN3A 4N13A 2HXRA 5TPAB 2VD3A 5HPQA 3U65A 1AL3A 1SW4A 4GOTA 2M8CA 1QKAA 4U1ZA 3S4UA 1A8EA 4IO2A 5CMKA 1IMEA 1Y3QA 1MH3A 1RYOA 1G0HA 2NXOA 3FGSA 5I58A 3TZAA 2DS9A 5CM6A 3SEUA 5A5XB 4NX1A 3OELA 3SEVA 2VPOA 3HO7A 2X7QA 3MW0A 5I7IA 2GHAA 4XKQA 2PCRA 2P2AA 3PUWE 4MHFA 4PFBA 1D3KA 2HQ0A 4U2RA 1B51A 5EHSA 1FQDA 1FSAA 3MPKA 2DSFA 4AS4A 2FVZA 2F97A 3RY3A 2F36A 2XXQA 3N5LA 1BTJA 4KCDA 2ZYOA 4F31B 2B4LA 3FZVA 3B6QA 2QMXA 3HFUA 3U1OA 4OEVA 1LAFE 3W9VA 3I3VA 3VDFA 4M1VA 3OO6A 5H8NB 3KC0A 3G3FA 1A54A 3IR1A 1IMFA 5AA2D 2WYPA 2IA4A 3KGCA 3VFJA 4RK9A 5DW8A 5IAIA 5BUUA 2E1SA 3HCQA 1EZ9A 1DSNA 1B1XA 1B3LA 3K6XA 3PD9A 4YAHX 3H6VA 1PB8A 4PBQA 1NV6A 3D4CA 1B9JA 2NWJA 4JBZA 3FASA 2R8TA 4PTKA 4KI0E 4YB5A 1BLFA 3E3KA 2XXTA 1VFDA 4ELQA 4H67A 2F34A 1LGBC 4OFOA 2REGA 2O7IA 1S7YA 2ZYMA 2DDKA 3RUMA 4M4GA 4Z7EA 4ZEKA 4GWWA 1IMAA 5JEIA 4H65A 3K01A 2O84X 1D9VA 5EQ8A 3LSFB 4NEDA 4GQOA 1VE4A 2XWOA 2H5YA 1TWYA 2QS3A 4LQ2A 1PC3A 4BLAA 1URDA 2ALUA 5F1QA 3UN6A 4N15A 1JQFA 4ZE9A 3KG2A 4F2OA 4RJZA 2HFBA 2Y7PA 1KWHA 4FEDA 5I2NA 4MF3A 4OVQA 4U1OA 4H1XA 1MXYA 5I57B 1H44A 4YMAA 4KYEA 3RTFB 3K0VA 1NV1A 3BIHA 1MY3A 1YPNA 5TP9B 5I84A 4GWOA 1OMPA 2XXVA 4NF4A 4O3AA 4HCWA 4N8YA 1B0LA 4O94A 3IFCA 3W15C 1NL5A 1URSA 2DE3A 2PYYA 3VLWA 3O6GA 4H45A 2HEUA 1Y9UA 3FJGA 1JP4A 4BDQA 3V89B 1YXIA 5A5XA 2JJKA 3ZKKA 3OO9A 1IZ1A 2B3BA 4PGNA 3O97A 1FPKA 3G3GA 4TOZA 2ONRA 1NNFA 1II5A 2PFZA 4JB7A 1Y3NA 4LZ7A 3Q26A 3TCHA 1POTA 3Q28A 2XXUA 4FBPA 3OO8A 4HCYA 1T0KA 2P0SA 4YKKA 2I4BA 1P99A 4NF0A 3WAFA 1IXIA 4FE8A 3QK6A 3SEXA 4AB6A 4ZS9A 3UGWA 4R6KA 2HHMA 3T0JA 1LSTA 3U93A 3IOVA 3PUYE 4LVQA 3THIA 4QSDA 2I0CA 1B40A 3TAJA 3K1PA 4U22A 4H46A 2HZKA 1JEUA 4H8IA 5F7VA 5EYGA 2DWHA 4DXBA 3OEMA 4NF8A 3Q29A 1FPBA 4F3GA 2QS4A 2QPQA 4JWYA 4NWDA 2UYFA 3ONMA 2VOZA 2XD3A 4RXLA 1A7LA 1VR5A 3QXMA 3QUFA 5IZ3A 1PBPA 5I59B 3DP6A 1H3DA 5JTYB 1Z7NE 4FJPA 3PMWA 1NH7A 2DWJA 2H4IA 1B3FA 5ET7A 2PFYA 1LBVA 1QKBA 4FATA 5EQ9A 4XEQA 3M3KA 4FEBA 4OWDA 2Q8MA 2WX9A 3C31A 3G3IA 4DI4B 1LEVA 1BKAA 3TQWA 4FAJA 1XC1A 4E0WA 3VVDA 3CFXA 4GWZA 5FTIA 2I58A 2OBGA 1XVYA 3EHSA 4OYVA 3SERA 1FPJA 3VXBA 4P11A 4Q5TA 1USYE 3MYUA 2F78A 2ZYNA 2OX3A 2F7BA 3GXAA 1MY1A 4PQJA 1YCJA 3FBPA 5IZ3B 2ZNSA 3DLNA 1QW0A 4AS5A 2F6PA 3C9HA 3G7WA 3IB2A 4L17A 3IOWA 1R9LA 1MY4A 2I3WA 3IJOB 3GYYA 3HV1A 4G68B 1A8FA 5F24A 2FIXA 1GTKA 1B7UA 3JV9A 3S9LC 3H3GA 4MNIA 1SVXB 4QFKA 4OA4A 2QS2A 4UACA 1UTHB 3CFZA 4K3FA 3LC8A 3WAEA 4KYSA 4JVDA 5CMCA 2UYEA 3MVYA 2VP1A 2O68A 1LAGE 3L6GA 1M5CA 4P47A 4OERA 1IMDA 3CR9A 4OZ9A 4GWYA 5HM4B 1N7WA 3A3UA 1RYXA 3FJ7A 2AL4A 3T9UA 4GRKA 3GZGA 4RK2A 4PE3A 3K1NA 1DTGA 2DP8A 2PT2A 1YYZA 1DTZA 1XVXA 4YB6A 2Q88A 1IMCA 5H8HA 1IUDA 2V3TA 5TPAA 3IFAA 2XX9A 3W9WA 3RPLB 3HHFA 1ZBMA 4PAIA 3RT6B 2CZHA 1MY2A 4X1BA 3K00A 1G0IA 3QUJA 1LCTA 4DXCA 1SW5A 4Q8RA 1FBFA 1FPDA 4GFRA 2OCUA 3T9VA 5I2NB 4GX6A 5I57A 4GBVA 5J16A 4EF1A 4GD5A 5AA4B 1B7ZA 2Y84A 2RKMA 5T3JA 1JETA 1FQBA 3B7DA 3TUSA 4OVPA 3EQ1A 1Y20A 3N94A 2GQ1A 4F22A 1EZOA 4YICA 1NV0A 1US4A 3ISPA 1N84A 3JZJA 4QHQA 4XXUA 1R1NA 1MXXA 4NF5B 3S2VA 1PBQA 4ESWA 4DXUA 1KA1A 4ZEIA 2Q89A 4IB2A 2ZNUA 3U92A 3S9NC 5IKBA 4KFQA 1INPA 2KR0A 1NNPA 4WEPA 1AH5A 1Y1MA 4P0GA 5ITOA 3VVFA 1H43A 2HAVA 3LR1A 1FJ6A 3H4ZA 1I6AA 1Q1KA 3R26A 4GXSB 1FJ9A 3T1BA 1FBCA 2F6GA 4I1DA 4G68A 1LBZA 1LCFA 3BFTA 4U21A 2XD2A 3TTKA 1FQAA 3KOTA 1IEJA 1RDZA 2Z8FA 1VFEA 3BBRA 4HTGA 4IO6A 2I6EA 1MY0A 4N8GA 3T9XB 3IB0A 5H8NA 1M5BA 3M3LA 5K2YA 3ZSFA 2FYIA 4FORA 1MRPA 2H99A 1S50A 3TTLA 2A5TB 1P1OA 2RINA 3MZ1A 4WKMA 2KLFA 4O3BA 5M2VA 1O7TA 1XS5A 2YLNA 4JSOA 4MH5A 4NF6B 3MZ9A 5EYHA 3MJNA 4ELPA 3NOHA 1MXUA 2UXAA 1MQGA 3FV1A 4ECFA 2THIA 3IAZA 2CZIA 2OWSA 3HSTA 2QJEA 4QFPA 3V8XB 1FPIA 3HPIA 4IO5A 3R7XA 1B7HA 5H8FA 2QL3A 4ZEBA 4QSEA 4DZ1A 3CVGA 3TDJA 1MXZA 1LB9A 4PF6A 4NAPA 1QGXA 3RNNA 3G3KA 3E4RA 2F3BA 1B3HA 1B0HA 1Y4TA 1B58A 1SW1A 4LZ8A 2D3IA 1JW1A 1A99A 2DXYA 3CRBA 3T93B 4XKRA 2NOOA 1Q9DA 4OFLA 1LFGA 4DIGA 4MFIA 1AMFA 2P1SA 4MLVA 3UK4A 4GBWA 5ICTA 3GLBA 2BJJX 2GRVA 2DE2A 3TTNA 3V5AA 3D4GA 1A40A 4OQOA 1IXGA 2DXRA 1ZIUA 4GL0A 4KXPA 1OVBA 3DELB 1LAXA 4HE2A 3EF7A 3MUQA 5H8HB 4UABA 2WKYA 4I62A 3IK6B 3O28A 4E0XA 2HZLA 1F9BA 5FHOA 3BFUA 1ELJA 2AL5A 5IM2A 1UQWA 1FPLA 1SBPA 2H9BA 1LBYA 3OD7A 1N3XA 3U8QA 2D21A 4RA1A 3FXBA 3CFLA 1PDAA 1Y1ZA 3PUZE 1OVTA 4NTLA 1B05A 3L6HA 4G8NA 5IZZA 2CZLA 2DE4A 2WBBA 4EQ7A 3TYHA 4KYDA 3USDA 4LN5A 3T66A 3P7IA 4QF9A 2I48A 2GH9A 1QUJA 1B6HA 1YTVA 1MXWA 1NV4A 1N76A 3Q25A 3RLFE 1B52A 4OVRA 4ZEFA 3T22A 4OVJA 3E13X 3UA8A 3MVXA 3CG1A 5BWJA 1PB7A 5EYFA 1NI9A 2H98A 2ZZWA 3VVEA 4P1EA 4F29A 4AQ4A 4G68C 2VGQA 3MP1A 3FUZA 5I58B 4G61A 5L9SA 4PETA 4F3SA 1Y4CA 1ZKBA 2OLBA 3E79A 4H6DA 4OXVA 4OMBA 2YJPA 1IXHA 1VDWA 2ONSA 4FECA 1JVXA 3ZKLA 1LFIA 4PFRA 1IXCA 5DTBA 1UTHA 3TFLA 2QRYA 4R73A 3SESA 2VPNA 3SKPA 2ONKE 4U4XA 2RF1A 3EHTA 1FTJA 1MQHA 1EZPA 1SYIA 3O6IA 1DPPA 4EF2A 4KD5A 4JVIA 1OQGA 4NF6A 2QFLA 3SEYA 1O63A 1SPIA 5FHMA 1UIVA 4GIZA 3HN0A 3KBRA 1JW4A 1AIVA 4NHBA 3A29A 3FVOA 1USYH 2DVCA 1N04A 4OTEA 4O7IA 1NUZA 1POY1 2X26A 1QJMA 5IGAA 5I5PA 1ZU0A 4IGRA 1WDNA 4X8RA 3OEKA 4NF8B 5I56B 3KN7A 5CRYA 3Q27A 1LBBA 2PMSA 3CSGA 3IOTA 5A5LA 4JWOA 2PX1A 5I59A 4N07A 2H25A 4JDFA 2V25A 1IITA 4I9DA 4RPOA 2FNCA 3BIGA 5ET6A 2WEFA 3OOAA 1I6QA 2YPNA 3FATA 1ANFA 4BDLA 2PVUA 2O1LA 2QVVA 1K9ZA 1ZJLA 5L9OA 3KC1A 4ESXA 1Y3PA 4I8CA 3C36A 1N7XA 2WYKA 3FXUA 4N91A 1N0TA 3PUXE 4P3LA 3VLUA 4F2QA 4BDMA 4EXKA 5KDTB 2F7CA 4DCXA 4O8MA 5I2KB 1NUYA 2ZXTA 1M5DA 1D9YA 3PV0E 2I4CA 4OFJA 1AWBA 4RY1A 1QULA 4DE8A 5AA1A 1B1HA 4PE5B 4ZECA 3MP6A 2HXWA 1FRPA 2Q2CA 3TTRA 1FPFA 5JK4A 5KCJB 4PAFA 4XF5A 2DWIA 2XXIA 2VT5A 4RYAA 2RCBA 1SYHA 4YKJA 1IIWA 3UORA 1UIUA 3K6VA 2UVGA 1HSLA 3O29A 2RC7A 1MQJA 4ND9A 1NV5A 2FHYA 3K6WA 1RDYA 2F35A 3TQLA 1XOCA 3PPOA 3IJXB 2Q74A 3PPPA 3T9HB 3MBPA 4N81A 4GX4A 1MDP1 4POWA 1B2HA 3VV5A 1TFDA 3KJ7A 2QVUA 1PB9A 4XKNA 4G8HA 2DQVA 1M5FA 4PFIA 2RC8A 3O2AA 3QMFA 4H8JA 2Q8JA 4GVOA 1MQIA 3M8UA 2B3FA 1QUKA 1NH8A 4X1DA 3V83A 2R6GE 1J1NA 1JVYA 1TT1A 4N6KA 1SQYA 1MH4A 4Q0CA 1ZLQA 3QAXA 4GF8A 2GFEA 3KN3A 2P3NA 1B32A 4JWXA 2XA5A 5CI5A 5K2XA 2XWVA 5J1DA 4XIGQ 2W7YA 2Y7KA 4EXLA 5DEXA 3K1MA 4MIJA 2X7PA 3FXRA 2XXYA 4PDHA 1RKMA 2OWZA 2AIXA 3H6TA 4LUBA 4UA8A 4GWUA 4PP0A 4G77A 1XHYA 4BDRA 3I6VA 3K02A 3QSLA 3PMXA 1NFTA 4ISUA 4NMYA 3MC2A 4N6DA 5KDTA 1MPCA 3PGFA 5TU0A 1NV7A 4F18A 3VE1B 3LUZA 4I3EA 3LSWA 2REJA 2O69A 4U4SA 2Y7WA 4R2BA 4QFOA 5KZTA 3CIJA 2QS1A 2IEEA 5FBPA 1KA0A 4EDPA 4ELRA 1FQEA 2VD2A 4XFEA 2BJIA 2F7AA 3TELA 4ZZAA 5FTHA 1LAHE 1Q35A 1PEBA 1H45A 4GL8A 3T96B 2MKZA 3O66A 2O7UA 1B4HA 2XXPA 1RDXA 4OVSA 2ABHA 4EQ9A 5CMBA 2Y5KA 3VLVA 2XXRA 3N6UA 2QMWA 3HHGA 3UIFA 4OEUA 3KZGA 2OK2A 1NUWA 2F8DA 4R72A 4KQPA 4NGUA 1NUXA 2Z8DA 3C35A 5B7DA 4ONYA 4U23A 2RCAA 4N4UA 3K2DA 3PPRA 4AB5A 3N26A 4QFLA 1B5JA 4LA9A 4IO3A 3PTYA 2VHAA 1DK4A 3CG3A 4ZZEA 1EYJA 3FXQA 3B50A 1TFAA 3QYTA 1NKXA 4NF5A 3TCGA 2XHDA 4MX6A 3RYDA 1US5A 1SI0A 1OLCA 5ELVA 3B6TA 1MM6A 3H06B 5LOMA 3B8BA 5AA4A 1LB8A 1K9YA 2DOJA 4F1YA 1CE2A 1FW0A 1LBWA 5H8SA 2CMOA 3MWBA 1FTAA 2GHBA 2XXWA 3IX1A 3FIRA 4TLMB 3FVKA 4C0RA 3JYRA 4PFYA 2E0SA 1R9QA 3RPWA 4LATA 4MEVA 4EUOA 3O9PA 4R9GA 4YMBA 3C4MA 4GX3A 2UVIA 2O1MA 1IQ7A 4OESA 3IO4A 4ELOA 1UTBB 2V4CA 4X48A 4YZZA 3ZS6A 1H76A 1MG1A 1ZTYA 4WXJA 1MQDA 3OENA 3MAMA 3ILUB 2UVJA 2ZMBA 4HS7A 5DT6A 1CNQA 3LUYA 1KZ8A 4XTCQ 4YB7A 4O7MA 4PAKA 1FTLA 2XWKA 2L5VA 3TCFA 2V84A 3OSRA 3S9EA 4HE1A 2G29A 1B5HA 2HCAA 3A3CA 4OETA 1SDXA 1DMBA 4QXDA 1NV3A 1O64A 1TXFA 2NVUB 3H6UA 4MNCA 1FTKA 2ZZXA 1SW2A 4F3BA 2WBDA 2R9JA 2A5TA 5FHNA 3E78A 4C1TA 4F3PA 2I0BA 3LSLA 2I49A 5ITPA 1UTBA 4KHZE 2V3UA 2XXXA 1NV2A 1WODA 1BIYA 1SI1A 3KJTA 3LBSA 3RT8A 2QVRA 1FPEA 2A5SA 4LQ5A 4H0WA 3KBZA 5L8DA 1L5TA 3TODA 4GXAA 3IO6A 1EYKA 2ESNA 5H8QA 4PBHA 1QVSA 5I56A 2PBWA 5L9MA 4HE0A 3K4UA 5ET8A 3MSTA 3EPEA 3PD8A 4EQBA 4F19A 2HPGA 1DPEA 4KCCA 1N3WA 4O3CA 3G3JA 1FCKA 1NMUA 4Q30B 4IGTA 3TKDA 2Y7RA 4G2ZA 4C1UA 1YAEA 4P1LA 3N6TA 4IO4A 1QUIA 1XT8A 3MZBA 3FVGA 3O6HA 3FV2A 2ZZVA 2O6AA 4PFWA 3KEIA 2Z22A 3FJMA 1JW5A 4TQUQ 1GGGA 2AYSA 4X9TA 3OO7A 1LFHA 4PF8A
chains in the Genus database with same CATH topology
3VVFA 3UORA 1UIUA 3K6VA 2UVGA 1M5EA 2IA4A 5AA2D 1D4NA 3KGCA 3VFJA 1H43A 1HSLA 3O29A 4BDOA 2HAVA 2RC7A 1P1WA 3LR1A 2ANJA 5AE4A 3H4ZA 1P1QA 1MQJA 4RK9A 1I6AA 1Q1KA 3ODBA 3RPWA 3R26A 4R2FA 4ND9A 4EXKA 5IAIA 2F5XA 5BUUA 4GXSB 3B6WA 3K6WA 2F35A 2FA7A 3TQLA 1XOCA 2E1SA 3HCQA 1EZ9A 3PPOA 4ZE8A 3IJXB 1DSNA 4ZDMA 2F6GA 3PPPA 1B1XA 4G4PA 4I1DA 3T9HB 3MBPA 1MPDA 4YKIA 4G68A 1B3LA 3K6XA 1MDP1 3PD9A 4POWA 4YAHX 3H6VA 1PB8A 1LCFA 3BFTA 3U72A 3RN8A 1B2HA 3VV5A 4U21A 3TMGA 1TFDA 2B65A 2XD2A 1B4ZA 3D4CA 1B9JA 3KJ7A 3TTKA 4PFTA 1PB9A 2NWJA 1FQAA 4XKNA 4JBZA 3FASA 3ECRA 3KOTA 1FTOA 4G8HA 1IEJA 2DQVA 1M5FA 2G93A 2RC8A 4KI0E 1IIWA 4YB5A 1BLFA 1P1UA 3MQ9A 2Z8FA 1WVJA 2XXTA 1VFDA 2UVHA 3E3KA 3O2AA 4H67A 4ELQA 1VFEA 3BBRA 1ZMGA 4H5FA 2F34A 3H03A 1LGBC 2DVZA 3A09A 4HTGA 4IO6A 4OFOA 3RTWB 2REGA 2O7IA 1S7YA 2ZYMA 2I6EA 4H8JA 2Q8JA 3RUMA 4GVOA 4M4GA 1MQIA 1MY0A 4Z7EA 1CB6A 3M8UA 2B3FA 4ZEKA 2Q2AA 2ZYKA 3MPLA 3T9XB 1QUKA 3IB0A 2XX7A 5H8NA 1NH8A 1M5BA 3C33A 1HSJA 5JEIA 3M3LA 5K2YA 3ZSFA 4X1DA 2FYIA 4H65A 3K01A 2O84X 4FORA 4MLQA 5CC2A 3V83A 1MRPA 2R6GE 3H7MA 1J1NA 1JVYA 1TT1A 1S50A 2H99A 1D9VA 3DP8A 3TTLA 1SQYA 1MH4A 1JNFA 1P1OA 2A5TB 4QFNA 4Q0CA 1ZLQA 3QAXA 3R6UA 4GF8A 1MS7A 2GFEA 2RINA 3LSFB 3MZ1A 4WKMA 4F1UA 1EH3A 1FTMA 2KLFA 3KN3A 4NEDA 3ILTB 4GQOA 4O3BA 1P1NA 5M2VA 1O7TA 1XS5A 1VE4A 2YLNA 4JSOA 4MH5A 4NF6B 4DLDA 5AA3A 1B32A 3C34A 3MZ9A 3MJNA 4JWXA 4F1VA 2H5YA 4ELPA 1TWYA 2QS3A 4DDDA 4LQ2A 1EU8A 1MXUA 1PC3A 3SETA 5CI5A 4BLAA 1URDA 2ALUA 5K2XA 5F1QA 3UN6A 2UXAA 3IORA 1FQFA 1MQGA 5J1DA 4XIGQ 3FV1A 3KOSA 1JQFA 2W7YA 2Y7KA 4EXLA 4ZE9A 4ECFA 2THIA 3IAZA 3KG2A 5DEXA 3K1MA 1BP5A 4F2OA 3OXNA 2OWSA 4RJZA 3HSTA 2QJEA 2HFBA 2Y7PA 4QFPA 3V8XB 1KWHA 5JTYA 4FEDA 2X7PA 3HPIA 3FXRA 5I2NA 4IO5A 3R7XA 1LBCA 1B7HA 2XXYA 4MF3A 5H8FA 3K6UA 2QL3A 4ZEBA 1RKMA 2AIXA 4QSEA 2Z8EA 4DZ1A 4KR5A 4TLLB 3CVGA 4H1XA 4U1OA 3TDJA 1MXYA 1LB9A 1MXZA 3H6TA 5I57B 1H44A 3EHUA 4YMAA 4LUBA 4KYEA 4UA8A 3RTFB 1ATGA 3K0VA 5CMMA 4PP0A 4G77A 1MM7A 1MY3A 1XHYA 2OZZA 3RNNA 4BDRA 3G3KA 1YPNA 3E4RA 3I6VA 3K02A 3QSLA 1B3HA 1B0HA 3PMXA 1Y4TA 3DM0A 1LLSA 1NFTA 5TP9B 1B58A 4ISUA 5I84A 1SW1A 3LSXA 4GWOA 4LZ8A 1OMPA 2XXVA 2D3IA 3MC2A 4NF4A 4NMYA 4O3AA 4HCWA 5KDTA 1JW1A 4Z0IA 5H8FB 1A99A 4POXA 1MPCA 2DXYA 3CRBA 3PGFA 5TU0A 1B0LA 3SEWA 3T93B 4XKRA 2NOOA 4OFLA 3VE1B 4F18A 1FQCA 2Z23A 5DYHA 3GBAA 4THIA 3W15C 1NL5A 3LSWA 1LFGA 4DIGA 2REJA 1URSA 2DE3A 2O69A 2OWTA 2PYYA 4MFIA 1AMFA 2P1SA 4U4SA 4YU0A 3VLWA 2Y7WA 4MLVA 4R2BA 3SDFA 3UK4A 4QFOA 5ICTA 3O6GA 3GLBA 2BJJX 2GRVA 3IOUA 2DE2A 3CIJA 2QS1A 2HEUA 1Y9UA 2IEEA 3FJGA 3TPAA 3TTNA 3V5AA 4EDPA 4ELRA 3PPNA 1FQEA 2VD2A 3D4GA 4BDQA 3H6WA 3V89B 3VVDA 5A5XA 3ZKKA 2F7AA 3TELA 4ZZAA 3OO9A 1IZ1A 5FTHA 3FD3A 1LAHE 5KZTA 1A40A 4OQOA 1Q35A 1IXGA 2DXRA 1PEBA 1ZIUA 1H45A 2B3BA 3KN8A 4GL0A 4GL8A 3T96B 3O97A 2Q9TA 5AA2B 3G3GA 4TOZA 1A55A 3KSXA 1OVBA 3O66A 2ONRA 1B46A 3DELB 1LAXA 1II5A 1NNFA 1OLAA 2O7UA 1Y3NA 2OJTA 4JB7A 4LZ7A 5H8QB 1MPBA 3Q26A 1B4HA 2XXPA 3EF7A 1POTA 4PFUA 3TCHA 3Q28A 4R9FA 2ABHA 4EQ9A 5CMBA 2XXUA 3MUQA 4G8MA 5H8HB 2V3QA 3FVNA 2WKYA 3OO8A 4HCYA 4I62A 3IK6B 3VLVA 2XXRA 3N6UA 1T0KA 3O28A 4R6HA 4E0XA 2QMWA 4LP2B 2P0SA 4YKKA 2I4BA 3IB1A 3HHGA 2HZLA 2XXHA 3UIFA 1F9BA 1JEVA 3KZGA 2OK2A 1P99A 3BFUA 3G3HA 1OQHA 1ELJA 2F8DA 4OEUA 2AL5A 1I69A 3WAFA 1UQWA 1IXIA 4FE8A 4OENA 3QK6A 4KQPA 4R72A 3SEXA 2Z8DA 3C35A 4AB6A 5B7DA 1SBPA 4ZS9A 4BDNA 4ONYA 2H9BA 4U23A 3UGWA 4R6KA 1Z7ME 2HAUA 3OD7A 1N3XA 2RCAA 3U8QA 1LSTA 3U93A 3IOVA 2I3VA 2XX8A 4JXIA 3C32A 3K2DA 2D21A 3AXFA 3PPRA 3PUYE 4LVQA 4QSDA 3THIA 4AB5A 2I0CA 3N26A 4RA1A 4QFLA 3KFMA 1B5JA 3CFLA 1B40A 1PDAA 3MP8A 4LA9A 1Y1ZA 4IO3A 3K1PA 4U22A 3TAJA 4RNSA 3PUZE 1SD3A 2DYXA 1OVTA 2HZKA 1JEUA 1B3GA 1NNKA 4H8IA 5F7VA 2VHAA 3CG3A 4NTLA 4ZZEA 1B05A 2DWHA 3FXQA 3L6HA 2LAOA 4DXBA 3TEPA 4G8NA 3OEMA 1HSEA 1TFAA 4P0IA 2CZLA 2DE4A 2PT1A 4NF8A 3QYTA 3Q29A 4EQ7A 1NKXA 3TYHA 4F3GA 3BKIB 2QS4A 4KYDA 4NF5A 3USDA 1LFHA 3TCGA 2QPQA 4JWYA 4NWDA 3T66A 3M3FA 2XHDA 2UYFA 3P7IA 4QF9A 2I48A 3ONMA 3RGYA 5I2KA 2VOZA 2XD3A 4MBPA 1US5A 4RXLA 4N6PA 2GH9A 1A7LA 1VR5A 2D5WA 1QUJA 3QXMA 3QUFA 1B6HA 1SI0A 1OLCA 1PBPA 4GLIA 1YTVA 1MXWA 5ELVA 1N76A 3B6TA 5I59B 3Q25A 3RLFE 3DP6A 1MM6A 3H06B 1B52A 1H3DA 1Z7NE 5JTYB 5LOMA 4FJPA 4ZEFA 5AA4A 1GR2A 1AOVA 3PMWA 1NH7A 4NWCA 1LB8A 2DWJA 2O51A 2H4IA 4YKPA 3T22A 3S9MC 5ISUA 4OVJA 1B3FA 3E13X 3UA8A 3E9XA 3MVXA 1QKBA 3CG1A 1NNTA 5BWJA 1PB7A 2DOJA 3CI8A 5EYFA 4F1YA 4FATA 1CE2A 1FW0A 2H98A 1I6BA 2CMOA 3M3KA 3MWBA 3OMBA 4FEBA 5H8SA 4OWDA 3VVEA 1VSOA 4F29A 1GVCA 4LONB 4AQ4A 2GHBA 2XXWA 4G68C 3IX1A 3C31A 4QRZA 3G3IA 2VGQA 3FIRA 3PPQA 3MP1A 4TLMB 1GV8A 3FVKA 4IO7A 2ZNTA 3FUZA 3PUVE 5FHOA 5I58B 4C0RA 5L9SA 4PETA 1BKAA 1Y4CA 1URGA 3JYRA 1ZKBA 3TQWA 4PFYA 2E0SA 4DCYA 4F3SA 4FAJA 1R9QA 1XC1A 2OLBA 4H6DA 4OXVA 4R6YA 2YJPA 1IXHA 1DOTA 3CFXA 4LATA 2I58A 2ONSA 4OMBA 5FTIA 4FECA 2OBGA 1XVYA 3CSBA 3EHSA 5HBCA 1JVXA 5CBRA 4EUOA 3O9PA 4R9GA 3ZKLA 4R74A 4YMBA 1MDQA 2DWAA 4OYVA 3C4MA 3SERA 3VXBA 4P11A 4Q5TA 1USYE 5DVJA 2UVIA 3RQTA 2F78A 2ZYNA 2O1MA 1LFIA 1IXCA 4NE4A 1IQ7A 4OHNA 4OESA 3IO4A 4XKPA 2F7BA 2Y7IA 3MVWA 5DTBA 4ELOA 1UTBB 3GXAA 4F39A 1MY1A 4X48A 4YZZA 3ZS6A 1UTHA 3TFLA 1H76A 1MG1A 2QRYA 4R73A 4WEDA 3SESA 3UP9A 1ZTYA 4FIMA 4H5GA 2V93A 4PQJA 3SKPA 4WXJA 5EHMA 1YCJA 3KSJA 2ONKE 4LZ5A 4U4XA 3I5OA 2ZNSA 2RF1A 3EHTA 1MQDA 3DLNA 3OENA 1FTJA 1MQHA 1OIBA 4HW8A 3MAMA 3U94A 1EZPA 1QW0A 3ILUB 5TP9A 2UVJA 2ZMBA 4HS7A 1SYIA 1B5IA 1DPPA 3O6IA 5DT6A 4NF4B 3OSQA 5AA2A 2F6PA 3C9HA 4KD5A 4EF2A 3VXCA 4KPTA 1OQGA 3LUYA 4XTCQ 1MXVA 4NF6A 4YB7A 3G7WA 3IB2A 4IY6A 3SEYA 1O63A 4L17A 3IOWA 1FTLA 1R9LA 1MY4A 4IY5A 5FHMA 1UIVA 2I3WA 3IJOB 3HV1A 4G68B 3HN0A 4GIZA 1A8FA 3KBRA 1JW4A 3TCFA 1AIVA 2V84A 1GTKA 3OSRA 1B7UA 3JV9A 3S9LC 3FVOA 3H3GA 1USYH 2DVCA 1N04A 3PU5A 1SVXB 4OTEA 3S9EA 4QFKA 5ICQA 2QS2A 5CBSA 4UACA 1POY1 2X26A 1UTHB 2G29A 1QJMA 3CFZA 1B5HA 2HCAA 3A3CA 4K3FA 2RC9A 4OETA 5DVFA 5DVIA 1SDXA 1DMBA 3PMVA 5DEXB 3LC8A 3WAEA 4KYSA 5CMCA 3IL1B 1ZU0A 2UYEA 3TTMA 3MVYA 1O64A 4IGRA 2VP1A 2O68A 1WDNA 4JSDA 1LAGE 1TXFA 3L6GA 2NVUB 1M5CA 4QSCA 4OERA 4OZ9A 3CR9A 5HM4B 3H6UA 1N7WA 3OEKA 4R75A 4ZEDA 1R6ZA 1S9TA 3GBBA 2QSXA 3A3UA 4NF8B 1FTKA 5I56B 1RYXA 3KN7A 3FJ7A 5CRYA 1SW2A 4F3BA 2AL4A 3F11A 2R9JA 2R71A 3DP4A 2A5TA 5FHNA 4RPNA 3Q27A 2NUVA 3T9UA 4GRKA 5B70A 3GZGA 4C1TA 1LBBA 4RK2A 5KCJA 2PMSA 1B3EA 3K1NA 4F3PA 3CSGA 1DTGA 2I0BA 3LSLA 3QIMA 2I49A 2DP8A 3IOTA 1UTBA 2PT2A 3EN3A 3MVZA 4KHZE 5ITPA 2V3UA 4N13A 4JWOA 2PX1A 1DTZA 1XVXA 2XXXA 4YB6A 2Q88A 2VD3A 5TPAB 5HPQA 5I59A 4N07A 5H8HA 1AL3A 2H25A 1SW4A 1IUDA 1WODA 2M8CA 4GOTA 1QKAA 2V3TA 1BIYA 1SI1A 4JDFA 2V25A 3KJTA 4U1ZA 5TPAA 1IITA 3LBSA 3RT8A 3S4UA 4I9DA 4RPOA 2XX9A 2A5SA 4LQ5A 3W9WA 1A8EA 4H0WA 4IO2A 2FNCA 5CMKA 5L8DA 1Y3QA 1MH3A 1RYOA 3HHFA 1L5TA 3TODA 1ZBMA 3OOAA 1I6QA 3RT6B 2YPNA 3FATA 2NXOA 1ANFA 1MY2A 3FGSA 3IO6A 4GXAA 4BDLA 5I58A 2PVUA 2O1LA 4X1BA 2DS9A 3TZAA 5CM6A 2ESNA 3SEUA 5A5XB 3K00A 3OELA 5H8QA 1ZJLA 5L9OA 3QUJA 1LCTA 1QVSA 4DXCA 4ESXA 1SW5A 1Y3PA 2PBWA 4I8CA 4Q8RA 5I56A 3C36A 3HO7A 1N7XA 2X7QA 3K4UA 3MW0A 4GFRA 5L9MA 2OCUA 3SEVA 3FXUA 3T9VA 2GHAA 4XKQA 5I2NB 2P2AA 3PUWE 1N0TA 3PUXE 5I57A 3EPEA 4EF1A 4GD5A 5AA4B 1B7ZA 1D3KA 2Y84A 3PD8A 2RKMA 3VLUA 4EQBA 4F2QA 2HQ0A 4F19A 4U2RA 1B51A 1DPEA 4KCCA 1JETA 1N3WA 4O3CA 1FQBA 3B7DA 3G3JA 5EHSA 1FQDA 1FCKA 4BDMA 1NMUA 3TUSA 3EQ1A 5KDTB 3MPKA 1Y20A 3N94A 2DSFA 2F7CA 4DCXA 4Q30B 2F97A 4F22A 1EZOA 4IGTA 4YICA 3RY3A 3TKDA 2Y7RA 2F36A 2XXQA 1US4A 4G2ZA 5I2KB 1N84A 4C1UA 3JZJA 3N5LA 1YAEA 4QHQA 4XXUA 1R1NA 1BTJA 4KCDA 1MXXA 2ZXTA 1M5DA 1D9YA 2ZYOA 3N6TA 1PBQA 4IO4A 1QUIA 4NF5B 3S2VA 4ESWA 3PV0E 1XT8A 2I4CA 4OFJA 3FZVA 4DXUA 3MZBA 4F31B 4RY1A 4E0WA 1QULA 3B6QA 3FVGA 3O6HA 4YKJA 4ZEIA 1B1HA 5AA1A 4PE5B 4DE8A 2Q89A 4IB2A 2ZNUA 3U92A 4ZECA 3S9NC 3FV2A 2QMXA 2O6AA 3MP6A 4PFWA 3U1OA 4OEVA 1LAFE 3W9VA 2HXWA 2Q2CA 3I3VA 3TTRA 3KEIA 5IKBA 2Z22A 4KFQA 3VDFA 4M1VA 1NNPA 3OO6A 5H8NB 5JK4A 4WEPA 5KCJB 1AH5A 3FJMA 3G3FA 2DWIA 2XXIA 1JW5A 4TQUQ 1GGGA 1A54A 3IR1A 4RYAA 2AYSA 4X9TA 3OO7A 2RCBA 1Y1MA 1SYHA 4P0GA 5ITOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VVF A;  3UOR A;  1UIU A;  3K6V A;  2UVG A;  1M5E A;  2IA4 A;  5AA2 D;  1D4N A;  3KGC A;  3VFJ A;  1H43 A;  1HSL A;  3O29 A;  4BDO A;  2HAV A;  2RC7 A;  1P1W A;  3LR1 A;  2ANJ A;  5AE4 A;  3H4Z A;  1P1Q A;  1MQJ A;  4RK9 A;  1I6A A;  1Q1K A;  3ODB A;  3RPW A;  3R26 A;  4R2F A;  4ND9 A;  4EXK A;  5IAI A;  2F5X A;  5BUU A;  4GXS B;  3B6W A;  3K6W A;  2F35 A;  2FA7 A;  3TQL A;  1XOC A;  2E1S A;  3HCQ A;  1EZ9 A;  3PPO A;  4ZE8 A;  3IJX B;  1DSN A;  4ZDM A;  2F6G A;  3PPP A;  1B1X A;  4G4P A;  4I1D A;  3T9H B;  3MBP A;  1MPD A;  4YKI A;  4G68 A;  1B3L A;  3K6X A;  1MDP 1;  3PD9 A;  4POW A;  4YAH X;  3H6V A;  1PB8 A;  1LCF A;  3BFT A;  3U72 A;  3RN8 A;  1B2H A;  3VV5 A;  4U21 A;  3TMG A;  1TFD A;  2B65 A;  2XD2 A;  1B4Z A;  3D4C A;  1B9J A;  3KJ7 A;  3TTK A;  4PFT A;  1PB9 A;  2NWJ A;  1FQA A;  4XKN A;  4JBZ A;  3FAS A;  3ECR A;  3KOT A;  1FTO A;  4G8H A;  1IEJ A;  2DQV A;  1M5F A;  2G93 A;  2RC8 A;  4KI0 E;  1IIW A;  4YB5 A;  1BLF A;  1P1U A;  3MQ9 A;  2Z8F A;  1WVJ A;  2XXT A;  1VFD A;  2UVH A;  3E3K A;  3O2A A;  4H67 A;  4ELQ A;  1VFE A;  3BBR A;  1ZMG A;  4H5F A;  2F34 A;  3H03 A;  1LGB C;  2DVZ A;  3A09 A;  4HTG A;  4IO6 A;  4OFO A;  3RTW B;  2REG A;  2O7I A;  1S7Y A;  2ZYM A;  2I6E A;  4H8J A;  2Q8J A;  3RUM A;  4GVO A;  4M4G A;  1MQI A;  1MY0 A;  4Z7E A;  1CB6 A;  3M8U A;  2B3F A;  4ZEK A;  2Q2A A;  2ZYK A;  3MPL A;  3T9X B;  1QUK A;  3IB0 A;  2XX7 A;  5H8N A;  1NH8 A;  1M5B A;  3C33 A;  1HSJ A;  5JEI A;  3M3L A;  5K2Y A;  3ZSF A;  4X1D A;  2FYI A;  4H65 A;  3K01 A;  2O84 X;  4FOR A;  4MLQ A;  5CC2 A;  3V83 A;  1MRP A;  2R6G E;  3H7M A;  1J1N A;  1JVY A;  1TT1 A;  1S50 A;  2H99 A;  1D9V A;  3DP8 A;  3TTL A;  1SQY A;  1MH4 A;  1JNF A;  1P1O A;  2A5T B;  4QFN A;  4Q0C A;  1ZLQ A;  3QAX A;  3R6U A;  4GF8 A;  1MS7 A;  2GFE A;  2RIN A;  3LSF B;  3MZ1 A;  4WKM A;  4F1U A;  1EH3 A;  1FTM A;  2KLF A;  3KN3 A;  4NED A;  3ILT B;  4GQO A;  4O3B A;  1P1N A;  5M2V A;  1O7T A;  1XS5 A;  1VE4 A;  2YLN A;  4JSO A;  4MH5 A;  4NF6 B;  4DLD A;  5AA3 A;  1B32 A;  3C34 A;  3MZ9 A;  3MJN A;  4JWX A;  4F1V A;  2H5Y A;  4ELP A;  1TWY A;  2QS3 A;  4DDD A;  4LQ2 A;  1EU8 A;  1MXU A;  1PC3 A;  3SET A;  5CI5 A;  4BLA A;  1URD A;  2ALU A;  5K2X A;  5F1Q A;  3UN6 A;  2UXA A;  3IOR A;  1FQF A;  1MQG A;  5J1D A;  4XIG Q;  3FV1 A;  3KOS A;  1JQF A;  2W7Y A;  2Y7K A;  4EXL A;  4ZE9 A;  4ECF A;  2THI A;  3IAZ A;  3KG2 A;  5DEX A;  3K1M A;  1BP5 A;  4F2O A;  3OXN A;  2OWS A;  4RJZ A;  3HST A;  2QJE A;  2HFB A;  2Y7P A;  4QFP A;  3V8X B;  1KWH A;  5JTY A;  4FED A;  2X7P A;  3HPI A;  3FXR A;  5I2N A;  4IO5 A;  3R7X A;  1LBC A;  1B7H A;  2XXY A;  4MF3 A;  5H8F A;  3K6U A;  2QL3 A;  4ZEB A;  1RKM A;  2AIX A;  4QSE A;  2Z8E A;  4DZ1 A;  4KR5 A;  4TLL B;  3CVG A;  4H1X A;  4U1O A;  3TDJ A;  1MXY A;  1LB9 A;  1MXZ A;  3H6T A;  5I57 B;  1H44 A;  3EHU A;  4YMA A;  4LUB A;  4KYE A;  4UA8 A;  3RTF B;  1ATG A;  3K0V A;  5CMM A;  4PP0 A;  4G77 A;  1MM7 A;  1MY3 A;  1XHY A;  2OZZ A;  3RNN A;  4BDR A;  3G3K A;  1YPN A;  3E4R A;  3I6V A;  3K02 A;  3QSL A;  1B3H A;  1B0H A;  3PMX A;  1Y4T A;  3DM0 A;  1LLS A;  1NFT A;  5TP9 B;  1B58 A;  4ISU A;  5I84 A;  1SW1 A;  3LSX A;  4GWO A;  4LZ8 A;  1OMP A;  2XXV A;  2D3I A;  3MC2 A;  4NF4 A;  4NMY A;  4O3A A;  4HCW A;  5KDT A;  1JW1 A;  4Z0I A;  5H8F B;  1A99 A;  4POX A;  1MPC A;  2DXY A;  3CRB A;  3PGF A;  5TU0 A;  1B0L A;  3SEW A;  3T93 B;  4XKR A;  2NOO A;  4OFL A;  3VE1 B;  4F18 A;  1FQC A;  2Z23 A;  5DYH A;  3GBA A;  4THI A;  3W15 C;  1NL5 A;  3LSW A;  1LFG A;  4DIG A;  2REJ A;  1URS A;  2DE3 A;  2O69 A;  2OWT A;  2PYY A;  4MFI A;  1AMF A;  2P1S A;  4U4S A;  4YU0 A;  3VLW A;  2Y7W A;  4MLV A;  4R2B A;  3SDF A;  3UK4 A;  4QFO A;  5ICT A;  3O6G A;  3GLB A;  2BJJ X;  2GRV A;  3IOU A;  2DE2 A;  3CIJ A;  2QS1 A;  2HEU A;  1Y9U A;  2IEE A;  3FJG A;  3TPA A;  3TTN A;  3V5A A;  4EDP A;  4ELR A;  3PPN A;  1FQE A;  2VD2 A;  3D4G A;  4BDQ A;  3H6W A;  3V89 B;  3VVD A;  5A5X A;  3ZKK A;  2F7A A;  3TEL A;  4ZZA A;  3OO9 A;  1IZ1 A;  5FTH A;  3FD3 A;  1LAH E;  5KZT A;  1A40 A;  4OQO A;  1Q35 A;  1IXG A;  2DXR A;  1PEB A;  1ZIU A;  1H45 A;  2B3B A;  3KN8 A;  4GL0 A;  4GL8 A;  3T96 B;  3O97 A;  2Q9T A;  5AA2 B;  3G3G A;  4TOZ A;  1A55 A;  3KSX A;  1OVB A;  3O66 A;  2ONR A;  1B46 A;  3DEL B;  1LAX A;  1II5 A;  1NNF A;  1OLA A;  2O7U A;  1Y3N A;  2OJT A;  4JB7 A;  4LZ7 A;  5H8Q B;  1MPB A;  3Q26 A;  1B4H A;  2XXP A;  3EF7 A;  1POT A;  4PFU A;  3TCH A;  3Q28 A;  4R9F A;  2ABH A;  4EQ9 A;  5CMB A;  2XXU A;  3MUQ A;  4G8M A;  5H8H B;  2V3Q A;  3FVN A;  2WKY A;  3OO8 A;  4HCY A;  4I62 A;  3IK6 B;  3VLV A;  2XXR A;  3N6U A;  1T0K A;  3O28 A;  4R6H A;  4E0X A;  2QMW A;  4LP2 B;  2P0S A;  4YKK A;  2I4B A;  3IB1 A;  3HHG A;  2HZL A;  2XXH A;  3UIF A;  1F9B A;  1JEV A;  3KZG A;  2OK2 A;  1P99 A;  3BFU A;  3G3H A;  1OQH A;  1ELJ A;  2F8D A;  4OEU A;  2AL5 A;  1I69 A;  3WAF A;  1UQW A;  1IXI A;  4FE8 A;  4OEN A;  3QK6 A;  4KQP A;  4R72 A;  3SEX A;  2Z8D A;  3C35 A;  4AB6 A;  5B7D A;  1SBP A;  4ZS9 A;  4BDN A;  4ONY A;  2H9B A;  4U23 A;  3UGW A;  4R6K A;  1Z7M E;  2HAU A;  3OD7 A;  1N3X A;  2RCA A;  3U8Q A;  1LST A;  3U93 A;  3IOV A;  2I3V A;  2XX8 A;  4JXI A;  3C32 A;  3K2D A;  2D21 A;  3AXF A;  3PPR A;  3PUY E;  4LVQ A;  4QSD A;  3THI A;  4AB5 A;  2I0C A;  3N26 A;  4RA1 A;  4QFL A;  3KFM A;  1B5J A;  3CFL A;  1B40 A;  1PDA A;  3MP8 A;  4LA9 A;  1Y1Z A;  4IO3 A;  3K1P A;  4U22 A;  3TAJ A;  4RNS A;  3PUZ E;  1SD3 A;  2DYX A;  1OVT A;  2HZK A;  1JEU A;  1B3G A;  1NNK A;  4H8I A;  5F7V A;  2VHA A;  3CG3 A;  4NTL A;  4ZZE A;  1B05 A;  2DWH A;  3FXQ A;  3L6H A;  2LAO A;  4DXB A;  3TEP A;  4G8N A;  3OEM A;  1HSE A;  1TFA A;  4P0I A;  2CZL A;  2DE4 A;  2PT1 A;  4NF8 A;  3QYT A;  3Q29 A;  4EQ7 A;  1NKX A;  3TYH A;  4F3G A;  3BKI B;  2QS4 A;  4KYD A;  4NF5 A;  3USD A;  1LFH A;  3TCG A;  2QPQ A;  4JWY A;  4NWD A;  3T66 A;  3M3F A;  2XHD A;  2UYF A;  3P7I A;  4QF9 A;  2I48 A;  3ONM A;  3RGY A;  5I2K A;  2VOZ A;  2XD3 A;  4MBP A;  1US5 A;  4RXL A;  4N6P A;  2GH9 A;  1A7L A;  1VR5 A;  2D5W A;  1QUJ A;  3QXM A;  3QUF A;  1B6H A;  1SI0 A;  1OLC A;  1PBP A;  4GLI A;  1YTV A;  1MXW A;  5ELV A;  1N76 A;  3B6T A;  5I59 B;  3Q25 A;  3RLF E;  3DP6 A;  1MM6 A;  3H06 B;  1B52 A;  1H3D A;  1Z7N E;  5JTY B;  5LOM A;  4FJP A;  4ZEF A;  5AA4 A;  1GR2 A;  1AOV A;  3PMW A;  1NH7 A;  4NWC A;  1LB8 A;  2DWJ A;  2O51 A;  2H4I A;  4YKP A;  3T22 A;  3S9M C;  5ISU A;  4OVJ A;  1B3F A;  3E13 X;  3UA8 A;  3E9X A;  3MVX A;  1QKB A;  3CG1 A;  1NNT A;  5BWJ A;  1PB7 A;  2DOJ A;  3CI8 A;  5EYF A;  4F1Y A;  4FAT A;  1CE2 A;  1FW0 A;  2H98 A;  1I6B A;  2CMO A;  3M3K A;  3MWB A;  3OMB A;  4FEB A;  5H8S A;  4OWD A;  3VVE A;  1VSO A;  4F29 A;  1GVC A;  4LON B;  4AQ4 A;  2GHB A;  2XXW A;  4G68 C;  3IX1 A;  3C31 A;  4QRZ A;  3G3I A;  2VGQ A;  3FIR A;  3PPQ A;  3MP1 A;  4TLM B;  1GV8 A;  3FVK A;  4IO7 A;  2ZNT A;  3FUZ A;  3PUV E;  5FHO A;  5I58 B;  4C0R A;  5L9S A;  4PET A;  1BKA A;  1Y4C A;  1URG A;  3JYR A;  1ZKB A;  3TQW A;  4PFY A;  2E0S A;  4DCY A;  4F3S A;  4FAJ A;  1R9Q A;  1XC1 A;  2OLB A;  4H6D A;  4OXV A;  4R6Y A;  2YJP A;  1IXH A;  1DOT A;  3CFX A;  4LAT A;  2I58 A;  2ONS A;  4OMB A;  5FTI A;  4FEC A;  2OBG A;  1XVY A;  3CSB A;  3EHS A;  5HBC A;  1JVX A;  5CBR A;  4EUO A;  3O9P A;  4R9G A;  3ZKL A;  4R74 A;  4YMB A;  1MDQ A;  2DWA A;  4OYV A;  3C4M A;  3SER A;  3VXB A;  4P11 A;  4Q5T A;  1USY E;  5DVJ A;  2UVI A;  3RQT A;  2F78 A;  2ZYN A;  2O1M A;  1LFI A;  1IXC A;  4NE4 A;  1IQ7 A;  4OHN A;  4OES A;  3IO4 A;  4XKP A;  2F7B A;  2Y7I A;  3MVW A;  5DTB A;  4ELO A;  1UTB B;  3GXA A;  4F39 A;  1MY1 A;  4X48 A;  4YZZ A;  3ZS6 A;  1UTH A;  3TFL A;  1H76 A;  1MG1 A;  2QRY A;  4R73 A;  4WED A;  3SES A;  3UP9 A;  1ZTY A;  4FIM A;  4H5G A;  2V93 A;  4PQJ A;  3SKP A;  4WXJ A;  5EHM A;  1YCJ A;  3KSJ A;  2ONK E;  4LZ5 A;  4U4X A;  3I5O A;  2ZNS A;  2RF1 A;  3EHT A;  1MQD A;  3DLN A;  3OEN A;  1FTJ A;  1MQH A;  1OIB A;  4HW8 A;  3MAM A;  3U94 A;  1EZP A;  1QW0 A;  3ILU B;  5TP9 A;  2UVJ A;  2ZMB A;  4HS7 A;  1SYI A;  1B5I A;  1DPP A;  3O6I A;  5DT6 A;  4NF4 B;  3OSQ A;  5AA2 A;  2F6P A;  3C9H A;  4KD5 A;  4EF2 A;  3VXC A;  4KPT A;  1OQG A;  3LUY A;  4XTC Q;  1MXV A;  4NF6 A;  4YB7 A;  3G7W A;  3IB2 A;  4IY6 A;  3SEY A;  1O63 A;  4L17 A;  3IOW A;  1FTL A;  1R9L A;  1MY4 A;  4IY5 A;  5FHM A;  1UIV A;  2I3W A;  3IJO B;  3HV1 A;  4G68 B;  3HN0 A;  4GIZ A;  1A8F A;  3KBR A;  1JW4 A;  3TCF A;  1AIV A;  2V84 A;  1GTK A;  3OSR A;  1B7U A;  3JV9 A;  3S9L C;  3FVO A;  3H3G A;  1USY H;  2DVC A;  1N04 A;  3PU5 A;  1SVX B;  4OTE A;  3S9E A;  4QFK A;  5ICQ A;  2QS2 A;  5CBS A;  4UAC A;  1POY 1;  2X26 A;  1UTH B;  2G29 A;  1QJM A;  3CFZ A;  1B5H A;  2HCA A;  3A3C A;  4K3F A;  2RC9 A;  4OET A;  5DVF A;  5DVI A;  1SDX A;  1DMB A;  3PMV A;  5DEX B;  3LC8 A;  3WAE A;  4KYS A;  5CMC A;  3IL1 B;  1ZU0 A;  2UYE A;  3TTM A;  3MVY A;  1O64 A;  4IGR A;  2VP1 A;  2O68 A;  1WDN A;  4JSD A;  1LAG E;  1TXF A;  3L6G A;  2NVU B;  1M5C A;  4QSC A;  4OER A;  4OZ9 A;  3CR9 A;  5HM4 B;  3H6U A;  1N7W A;  3OEK A;  4R75 A;  4ZED A;  1R6Z A;  1S9T A;  3GBB A;  2QSX A;  3A3U A;  4NF8 B;  1FTK A;  5I56 B;  1RYX A;  3KN7 A;  3FJ7 A;  5CRY A;  1SW2 A;  4F3B A;  2AL4 A;  3F11 A;  2R9J A;  2R71 A;  3DP4 A;  2A5T A;  5FHN A;  4RPN A;  3Q27 A;  2NUV A;  3T9U A;  4GRK A;  5B70 A;  3GZG A;  4C1T A;  1LBB A;  4RK2 A;  5KCJ A;  2PMS A;  1B3E A;  3K1N A;  4F3P A;  3CSG A;  1DTG A;  2I0B A;  3LSL A;  3QIM A;  2I49 A;  2DP8 A;  3IOT A;  1UTB A;  2PT2 A;  3EN3 A;  3MVZ A;  4KHZ E;  5ITP A;  2V3U A;  4N13 A;  4JWO A;  2PX1 A;  1DTZ A;  1XVX A;  2XXX A;  4YB6 A;  2Q88 A;  2VD3 A;  5TPA B;  5HPQ A;  5I59 A;  4N07 A;  5H8H A;  1AL3 A;  2H25 A;  1SW4 A;  1IUD A;  1WOD A;  2M8C A;  4GOT A;  1QKA A;  2V3T A;  1BIY A;  1SI1 A;  4JDF A;  2V25 A;  3KJT A;  4U1Z A;  5TPA A;  1IIT A;  3LBS A;  3RT8 A;  3S4U A;  4I9D A;  4RPO A;  2XX9 A;  2A5S A;  4LQ5 A;  3W9W A;  1A8E A;  4H0W A;  4IO2 A;  2FNC A;  5CMK A;  5L8D A;  1Y3Q A;  1MH3 A;  1RYO A;  3HHF A;  1L5T A;  3TOD A;  1ZBM A;  3OOA A;  1I6Q A;  3RT6 B;  2YPN A;  3FAT A;  2NXO A;  1ANF A;  1MY2 A;  3FGS A;  3IO6 A;  4GXA A;  4BDL A;  5I58 A;  2PVU A;  2O1L A;  4X1B A;  2DS9 A;  3TZA A;  5CM6 A;  2ESN A;  3SEU A;  5A5X B;  3K00 A;  3OEL A;  5H8Q A;  1ZJL A;  5L9O A;  3QUJ A;  1LCT A;  1QVS A;  4DXC A;  4ESX A;  1SW5 A;  1Y3P A;  2PBW A;  4I8C A;  4Q8R A;  5I56 A;  3C36 A;  3HO7 A;  1N7X A;  2X7Q A;  3K4U A;  3MW0 A;  4GFR A;  5L9M A;  2OCU A;  3SEV A;  3FXU A;  3T9V A;  2GHA A;  4XKQ A;  5I2N B;  2P2A A;  3PUW E;  1N0T A;  3PUX E;  5I57 A;  3EPE A;  4EF1 A;  4GD5 A;  5AA4 B;  1B7Z A;  1D3K A;  2Y84 A;  3PD8 A;  2RKM A;  3VLU A;  4EQB A;  4F2Q A;  2HQ0 A;  4F19 A;  4U2R A;  1B51 A;  1DPE A;  4KCC A;  1JET A;  1N3W A;  4O3C A;  1FQB A;  3B7D A;  3G3J A;  5EHS A;  1FQD A;  1FCK A;  4BDM A;  1NMU A;  3TUS A;  3EQ1 A;  5KDT B;  3MPK A;  1Y20 A;  3N94 A;  2DSF A;  2F7C A;  4DCX A;  4Q30 B;  2F97 A;  4F22 A;  1EZO A;  4IGT A;  4YIC A;  3RY3 A;  3TKD A;  2Y7R A;  2F36 A;  2XXQ A;  1US4 A;  4G2Z A;  5I2K B;  1N84 A;  4C1U A;  3JZJ A;  3N5L A;  1YAE A;  4QHQ A;  4XXU A;  1R1N A;  1BTJ A;  4KCD A;  1MXX A;  2ZXT A;  1M5D A;  1D9Y A;  2ZYO A;  3N6T A;  1PBQ A;  4IO4 A;  1QUI A;  4NF5 B;  3S2V A;  4ESW A;  3PV0 E;  1XT8 A;  2I4C A;  4OFJ A;  3FZV A;  4DXU A;  3MZB A;  4F31 B;  4RY1 A;  4E0W A;  1QUL A;  3B6Q A;  3FVG A;  3O6H A;  4YKJ A;  4ZEI A;  1B1H A;  5AA1 A;  4PE5 B;  4DE8 A;  2Q89 A;  4IB2 A;  2ZNU A;  3U92 A;  4ZEC A;  3S9N C;  3FV2 A;  2QMX A;  2O6A A;  3MP6 A;  4PFW A;  3U1O A;  4OEV A;  1LAF E;  3W9V A;  2HXW A;  2Q2C A;  3I3V A;  3TTR A;  3KEI A;  5IKB A;  2Z22 A;  4KFQ A;  3VDF A;  4M1V A;  1NNP A;  3OO6 A;  5H8N B;  5JK4 A;  4WEP A;  5KCJ B;  1AH5 A;  3FJM A;  3G3F A;  2DWI A;  2XXI A;  1JW5 A;  4TQU Q;  1GGG A;  1A54 A;  3IR1 A;  4RYA A;  2AYS A;  4X9T A;  3OO7 A;  2RCB A;  1Y1M A;  1SYH A;  4P0G A;  5ITO A; 
#chains in the Genus database with same CATH topology
 1M5E A;  1D4N A;  4BDO A;  4OAN A;  1P1W A;  5AE4 A;  2ANJ A;  4MCO A;  1P1Q A;  3ODB A;  4PCD A;  4R2F A;  2F5X A;  3B6W A;  2FA7 A;  4ZE8 A;  4ZDM A;  4G4P A;  1MPD A;  4YKI A;  3U72 A;  3RN8 A;  3TMG A;  2B65 A;  1B4Z A;  4PFT A;  3ECR A;  1FTO A;  4NG7 A;  4I40 A;  2G93 A;  1P1U A;  3MQ9 A;  1WVJ A;  2UVH A;  1ZMG A;  4H5F A;  3H03 A;  3A09 A;  2DVZ A;  3RTW B;  5IZ1 A;  1DCU A;  1CB6 A;  5EQA A;  2Q2A A;  2ZYK A;  3MPL A;  2XX7 A;  4OVT A;  3C33 A;  1HSJ A;  4JVC A;  2F3D A;  4MLQ A;  5CC2 A;  3H7M A;  3DP8 A;  4QFN A;  1JNF A;  3CHG A;  3R6U A;  1MS7 A;  4F1U A;  5KCJ A;  1BK4 A;  1EH3 A;  1FTM A;  3ILT B;  1P1N A;  4DLD A;  5AA3 A;  3C34 A;  4F1V A;  2XXK A;  5EQ7 A;  4DDD A;  1EU8 A;  3SET A;  2XWI A;  3IOR A;  1FQF A;  3KOS A;  1BP5 A;  2Y5L A;  3OXN A;  5JTY A;  3D1R A;  1LBC A;  3K6U A;  2Z8E A;  4KR5 A;  4TLL B;  5LTC A;  3EHU A;  1ATG A;  5CMM A;  4GWX A;  1MM7 A;  4IR8 A;  2OZZ A;  3DM0 A;  1LLS A;  4MNP A;  3LSX A;  4Z0I A;  5H8F B;  4POX A;  3SEW A;  1FQC A;  2Z23 A;  5DYH A;  3GBA A;  4THI A;  2OWT A;  4YU0 A;  3SDF A;  3IOU A;  4QBA A;  3TPA A;  4ZED A;  1FBP A;  3PPN A;  4I3Y A;  4PDD A;  3H6W A;  4PC9 A;  3FD3 A;  2CEX A;  3ROJ A;  3KN8 A;  2Q9T A;  5AA2 B;  1A55 A;  3KSX A;  1B46 A;  5CBR A;  1OLA A;  5H8Q B;  2OJT A;  1MPB A;  4PFU A;  4R9F A;  4G8M A;  5ESY A;  2V3Q A;  3FVN A;  2B4M A;  4R6H A;  4LP2 B;  4MAG A;  3IB1 A;  2XXH A;  1JEV A;  2FBP A;  3G3H A;  1OQH A;  5ET5 A;  1I69 A;  4OEN A;  4P8B A;  4P9K A;  4BDN A;  1Z7M E;  2HAU A;  3SZP A;  2I3V A;  2XX8 A;  4JXI A;  3C32 A;  3AXF A;  3KFM A;  5LDZ A;  3MP8 A;  4RNS A;  1SD3 A;  2DYX A;  1NNK A;  1B3G A;  1LBX A;  3TEP A;  2LAO A;  1HSE A;  4P0I A;  2PT1 A;  1EYI A;  3BKI B;  3M3F A;  3RGY A;  5I2K A;  4MBP A;  4N6P A;  2D5W A;  2CZK A;  4GLI A;  2P3V A;  4N17 A;  1GR2 A;  1AOV A;  4NWC A;  2O51 A;  4YKP A;  5ISU A;  1IMB A;  3S9M C;  3E9X A;  1NNT A;  3CI8 A;  3EKI A;  1I6B A;  3OMB A;  1VSO A;  1GVC A;  4LON B;  4QRZ A;  4NN3 A;  3PPQ A;  1GV8 A;  4IO7 A;  2ZNT A;  3PUV E;  1URG A;  4DCY A;  4R6Y A;  1DOT A;  3CSB A;  5HBC A;  4R74 A;  1MDQ A;  2DWA A;  2CEY A;  5DVJ A;  3RQT A;  4NE4 A;  4OHN A;  4XKP A;  2Y7I A;  3MVW A;  4F39 A;  4WED A;  3UP9 A;  4FIM A;  4H5G A;  2V93 A;  5EHM A;  3KSJ A;  4LZ5 A;  3I5O A;  4NQ8 A;  4HW8 A;  1OIB A;  3U94 A;  5TP9 A;  1B5I A;  4NF4 B;  3OSQ A;  5AA2 A;  3VXC A;  4KPT A;  4X04 A;  1FBD A;  1MXV A;  4PGP A;  4IY6 A;  1FPG A;  1FBG A;  4IY5 A;  2FIE A;  5I3S A;  3PU5 A;  4DI3 D;  1D9Q A;  1YZ0 A;  1DBZ A;  5ICQ A;  5CBS A;  5DVF A;  2RC9 A;  5DVI A;  3PMV A;  5DEX B;  3IL1 B;  4GWS A;  3TTM A;  4JSD A;  1FBE A;  4QSC A;  3LV0 A;  4R75 A;  1R6Z A;  1S9T A;  4MMP A;  3GBB A;  2QSX A;  1FBH A;  4P56 A;  3F11 A;  2R71 A;  3DP4 A;  1XI6 A;  4RPN A;  2NUV A;  5B70 A;  4MJO A;  1B3E A;  3RPL A;  2KQZ A;  3QIM A;  3MVZ A;  4HXV A;  3EN3 A;  4N13 A;  2HXR A;  5TPA B;  2VD3 A;  5HPQ A;  3U65 A;  1AL3 A;  1SW4 A;  4GOT A;  2M8C A;  1QKA A;  4U1Z A;  3S4U A;  1A8E A;  4IO2 A;  5CMK A;  1IME A;  1Y3Q A;  1MH3 A;  1RYO A;  1G0H A;  2NXO A;  3FGS A;  5I58 A;  3TZA A;  2DS9 A;  5CM6 A;  3SEU A;  5A5X B;  4NX1 A;  3OEL A;  3SEV A;  2VPO A;  3HO7 A;  2X7Q A;  3MW0 A;  5I7I A;  2GHA A;  4XKQ A;  2PCR A;  2P2A A;  3PUW E;  4MHF A;  4PFB A;  1D3K A;  2HQ0 A;  4U2R A;  1B51 A;  5EHS A;  1FQD A;  1FSA A;  3MPK A;  2DSF A;  4AS4 A;  2FVZ A;  2F97 A;  3RY3 A;  2F36 A;  2XXQ A;  3N5L A;  1BTJ A;  4KCD A;  2ZYO A;  4F31 B;  2B4L A;  3FZV A;  3B6Q A;  2QMX A;  3HFU A;  3U1O A;  4OEV A;  1LAF E;  3W9V A;  3I3V A;  3VDF A;  4M1V A;  3OO6 A;  5H8N B;  3KC0 A;  3G3F A;  1A54 A;  3IR1 A;  1IMF A;  5AA2 D;  2WYP A;  2IA4 A;  3KGC A;  3VFJ A;  4RK9 A;  5DW8 A;  5IAI A;  5BUU A;  2E1S A;  3HCQ A;  1EZ9 A;  1DSN A;  1B1X A;  1B3L A;  3K6X A;  3PD9 A;  4YAH X;  3H6V A;  1PB8 A;  4PBQ A;  1NV6 A;  3D4C A;  1B9J A;  2NWJ A;  4JBZ A;  3FAS A;  2R8T A;  4PTK A;  4KI0 E;  4YB5 A;  1BLF A;  3E3K A;  2XXT A;  1VFD A;  4ELQ A;  4H67 A;  2F34 A;  1LGB C;  4OFO A;  2REG A;  2O7I A;  1S7Y A;  2ZYM A;  2DDK A;  3RUM A;  4M4G A;  4Z7E A;  4ZEK A;  4GWW A;  1IMA A;  5JEI A;  4H65 A;  3K01 A;  2O84 X;  1D9V A;  5EQ8 A;  3LSF B;  4NED A;  4GQO A;  1VE4 A;  2XWO A;  2H5Y A;  1TWY A;  2QS3 A;  4LQ2 A;  1PC3 A;  4BLA A;  1URD A;  2ALU A;  5F1Q A;  3UN6 A;  4N15 A;  1JQF A;  4ZE9 A;  3KG2 A;  4F2O A;  4RJZ A;  2HFB A;  2Y7P A;  1KWH A;  4FED A;  5I2N A;  4MF3 A;  4OVQ A;  4U1O A;  4H1X A;  1MXY A;  5I57 B;  1H44 A;  4YMA A;  4KYE A;  3RTF B;  3K0V A;  1NV1 A;  3BIH A;  1MY3 A;  1YPN A;  5TP9 B;  5I84 A;  4GWO A;  1OMP A;  2XXV A;  4NF4 A;  4O3A A;  4HCW A;  4N8Y A;  1B0L A;  4O94 A;  3IFC A;  3W15 C;  1NL5 A;  1URS A;  2DE3 A;  2PYY A;  3VLW A;  3O6G A;  4H45 A;  2HEU A;  1Y9U A;  3FJG A;  1JP4 A;  4BDQ A;  3V89 B;  1YXI A;  5A5X A;  2JJK A;  3ZKK A;  3OO9 A;  1IZ1 A;  2B3B A;  4PGN A;  3O97 A;  1FPK A;  3G3G A;  4TOZ A;  2ONR A;  1NNF A;  1II5 A;  2PFZ A;  4JB7 A;  1Y3N A;  4LZ7 A;  3Q26 A;  3TCH A;  1POT A;  3Q28 A;  2XXU A;  4FBP A;  3OO8 A;  4HCY A;  1T0K A;  2P0S A;  4YKK A;  2I4B A;  1P99 A;  4NF0 A;  3WAF A;  1IXI A;  4FE8 A;  3QK6 A;  3SEX A;  4AB6 A;  4ZS9 A;  3UGW A;  4R6K A;  2HHM A;  3T0J A;  1LST A;  3U93 A;  3IOV A;  3PUY E;  4LVQ A;  3THI A;  4QSD A;  2I0C A;  1B40 A;  3TAJ A;  3K1P A;  4U22 A;  4H46 A;  2HZK A;  1JEU A;  4H8I A;  5F7V A;  5EYG A;  2DWH A;  4DXB A;  3OEM A;  4NF8 A;  3Q29 A;  1FPB A;  4F3G A;  2QS4 A;  2QPQ A;  4JWY A;  4NWD A;  2UYF A;  3ONM A;  2VOZ A;  2XD3 A;  4RXL A;  1A7L A;  1VR5 A;  3QXM A;  3QUF A;  5IZ3 A;  1PBP A;  5I59 B;  3DP6 A;  1H3D A;  5JTY B;  1Z7N E;  4FJP A;  3PMW A;  1NH7 A;  2DWJ A;  2H4I A;  1B3F A;  5ET7 A;  2PFY A;  1LBV A;  1QKB A;  4FAT A;  5EQ9 A;  4XEQ A;  3M3K A;  4FEB A;  4OWD A;  2Q8M A;  2WX9 A;  3C31 A;  3G3I A;  4DI4 B;  1LEV A;  1BKA A;  3TQW A;  4FAJ A;  1XC1 A;  4E0W A;  3VVD A;  3CFX A;  4GWZ A;  5FTI A;  2I58 A;  2OBG A;  1XVY A;  3EHS A;  4OYV A;  3SER A;  1FPJ A;  3VXB A;  4P11 A;  4Q5T A;  1USY E;  3MYU A;  2F78 A;  2ZYN A;  2OX3 A;  2F7B A;  3GXA A;  1MY1 A;  4PQJ A;  1YCJ A;  3FBP A;  5IZ3 B;  2ZNS A;  3DLN A;  1QW0 A;  4AS5 A;  2F6P A;  3C9H A;  3G7W A;  3IB2 A;  4L17 A;  3IOW A;  1R9L A;  1MY4 A;  2I3W A;  3IJO B;  3GYY A;  3HV1 A;  4G68 B;  1A8F A;  5F24 A;  2FIX A;  1GTK A;  1B7U A;  3JV9 A;  3S9L C;  3H3G A;  4MNI A;  1SVX B;  4QFK A;  4OA4 A;  2QS2 A;  4UAC A;  1UTH B;  3CFZ A;  4K3F A;  3LC8 A;  3WAE A;  4KYS A;  4JVD A;  5CMC A;  2UYE A;  3MVY A;  2VP1 A;  2O68 A;  1LAG E;  3L6G A;  1M5C A;  4P47 A;  4OER A;  1IMD A;  3CR9 A;  4OZ9 A;  4GWY A;  5HM4 B;  1N7W A;  3A3U A;  1RYX A;  3FJ7 A;  2AL4 A;  3T9U A;  4GRK A;  3GZG A;  4RK2 A;  4PE3 A;  3K1N A;  1DTG A;  2DP8 A;  2PT2 A;  1YYZ A;  1DTZ A;  1XVX A;  4YB6 A;  2Q88 A;  1IMC A;  5H8H A;  1IUD A;  2V3T A;  5TPA A;  3IFA A;  2XX9 A;  3W9W A;  3RPL B;  3HHF A;  1ZBM A;  4PAI A;  3RT6 B;  2CZH A;  1MY2 A;  4X1B A;  3K00 A;  1G0I A;  3QUJ A;  1LCT A;  4DXC A;  1SW5 A;  4Q8R A;  1FBF A;  1FPD A;  4GFR A;  2OCU A;  3T9V A;  5I2N B;  4GX6 A;  5I57 A;  4GBV A;  5J16 A;  4EF1 A;  4GD5 A;  5AA4 B;  1B7Z A;  2Y84 A;  2RKM A;  5T3J A;  1JET A;  1FQB A;  3B7D A;  3TUS A;  4OVP A;  3EQ1 A;  1Y20 A;  3N94 A;  2GQ1 A;  4F22 A;  1EZO A;  4YIC A;  1NV0 A;  1US4 A;  3ISP A;  1N84 A;  3JZJ A;  4QHQ A;  4XXU A;  1R1N A;  1MXX A;  4NF5 B;  3S2V A;  1PBQ A;  4ESW A;  4DXU A;  1KA1 A;  4ZEI A;  2Q89 A;  4IB2 A;  2ZNU A;  3U92 A;  3S9N C;  5IKB A;  4KFQ A;  1INP A;  2KR0 A;  1NNP A;  4WEP A;  1AH5 A;  1Y1M A;  4P0G A;  5ITO A;  3VVF A;  1H43 A;  2HAV A;  3LR1 A;  1FJ6 A;  3H4Z A;  1I6A A;  1Q1K A;  3R26 A;  4GXS B;  1FJ9 A;  3T1B A;  1FBC A;  2F6G A;  4I1D A;  4G68 A;  1LBZ A;  1LCF A;  3BFT A;  4U21 A;  2XD2 A;  3TTK A;  1FQA A;  3KOT A;  1IEJ A;  1RDZ A;  2Z8F A;  1VFE A;  3BBR A;  4HTG A;  4IO6 A;  2I6E A;  1MY0 A;  4N8G A;  3T9X B;  3IB0 A;  5H8N A;  1M5B A;  3M3L A;  5K2Y A;  3ZSF A;  2FYI A;  4FOR A;  1MRP A;  2H99 A;  1S50 A;  3TTL A;  2A5T B;  1P1O A;  2RIN A;  3MZ1 A;  4WKM A;  2KLF A;  4O3B A;  5M2V A;  1O7T A;  1XS5 A;  2YLN A;  4JSO A;  4MH5 A;  4NF6 B;  3MZ9 A;  5EYH A;  3MJN A;  4ELP A;  3NOH A;  1MXU A;  2UXA A;  1MQG A;  3FV1 A;  4ECF A;  2THI A;  3IAZ A;  2CZI A;  2OWS A;  3HST A;  2QJE A;  4QFP A;  3V8X B;  1FPI A;  3HPI A;  4IO5 A;  3R7X A;  1B7H A;  5H8F A;  2QL3 A;  4ZEB A;  4QSE A;  4DZ1 A;  3CVG A;  3TDJ A;  1MXZ A;  1LB9 A;  4PF6 A;  4NAP A;  1QGX A;  3RNN A;  3G3K A;  3E4R A;  2F3B A;  1B3H A;  1B0H A;  1Y4T A;  1B58 A;  1SW1 A;  4LZ8 A;  2D3I A;  1JW1 A;  1A99 A;  2DXY A;  3CRB A;  3T93 B;  4XKR A;  2NOO A;  1Q9D A;  4OFL A;  1LFG A;  4DIG A;  4MFI A;  1AMF A;  2P1S A;  4MLV A;  3UK4 A;  4GBW A;  5ICT A;  3GLB A;  2BJJ X;  2GRV A;  2DE2 A;  3TTN A;  3V5A A;  3D4G A;  1A40 A;  4OQO A;  1IXG A;  2DXR A;  1ZIU A;  4GL0 A;  4KXP A;  1OVB A;  3DEL B;  1LAX A;  4HE2 A;  3EF7 A;  3MUQ A;  5H8H B;  4UAB A;  2WKY A;  4I62 A;  3IK6 B;  3O28 A;  4E0X A;  2HZL A;  1F9B A;  5FHO A;  3BFU A;  1ELJ A;  2AL5 A;  5IM2 A;  1UQW A;  1FPL A;  1SBP A;  2H9B A;  1LBY A;  3OD7 A;  1N3X A;  3U8Q A;  2D21 A;  4RA1 A;  3FXB A;  3CFL A;  1PDA A;  1Y1Z A;  3PUZ E;  1OVT A;  4NTL A;  1B05 A;  3L6H A;  4G8N A;  5IZZ A;  2CZL A;  2DE4 A;  2WBB A;  4EQ7 A;  3TYH A;  4KYD A;  3USD A;  4LN5 A;  3T66 A;  3P7I A;  4QF9 A;  2I48 A;  2GH9 A;  1QUJ A;  1B6H A;  1YTV A;  1MXW A;  1NV4 A;  1N76 A;  3Q25 A;  3RLF E;  1B52 A;  4OVR A;  4ZEF A;  3T22 A;  4OVJ A;  3E13 X;  3UA8 A;  3MVX A;  3CG1 A;  5BWJ A;  1PB7 A;  5EYF A;  1NI9 A;  2H98 A;  2ZZW A;  3VVE A;  4P1E A;  4F29 A;  4AQ4 A;  4G68 C;  2VGQ A;  3MP1 A;  3FUZ A;  5I58 B;  4G61 A;  5L9S A;  4PET A;  4F3S A;  1Y4C A;  1ZKB A;  2OLB A;  3E79 A;  4H6D A;  4OXV A;  4OMB A;  2YJP A;  1IXH A;  1VDW A;  2ONS A;  4FEC A;  1JVX A;  3ZKL A;  1LFI A;  4PFR A;  1IXC A;  5DTB A;  1UTH A;  3TFL A;  2QRY A;  4R73 A;  3SES A;  2VPN A;  3SKP A;  2ONK E;  4U4X A;  2RF1 A;  3EHT A;  1FTJ A;  1MQH A;  1EZP A;  1SYI A;  3O6I A;  1DPP A;  4EF2 A;  4KD5 A;  4JVI A;  1OQG A;  4NF6 A;  2QFL A;  3SEY A;  1O63 A;  1SPI A;  5FHM A;  1UIV A;  4GIZ A;  3HN0 A;  3KBR A;  1JW4 A;  1AIV A;  4NHB A;  3A29 A;  3FVO A;  1USY H;  2DVC A;  1N04 A;  4OTE A;  4O7I A;  1NUZ A;  1POY 1;  2X26 A;  1QJM A;  5IGA A;  5I5P A;  1ZU0 A;  4IGR A;  1WDN A;  4X8R A;  3OEK A;  4NF8 B;  5I56 B;  3KN7 A;  5CRY A;  3Q27 A;  1LBB A;  2PMS A;  3CSG A;  3IOT A;  5A5L A;  4JWO A;  2PX1 A;  5I59 A;  4N07 A;  2H25 A;  4JDF A;  2V25 A;  1IIT A;  4I9D A;  4RPO A;  2FNC A;  3BIG A;  5ET6 A;  2WEF A;  3OOA A;  1I6Q A;  2YPN A;  3FAT A;  1ANF A;  4BDL A;  2PVU A;  2O1L A;  2QVV A;  1K9Z A;  1ZJL A;  5L9O A;  3KC1 A;  4ESX A;  1Y3P A;  4I8C A;  3C36 A;  1N7X A;  2WYK A;  3FXU A;  4N91 A;  1N0T A;  3PUX E;  4P3L A;  3VLU A;  4F2Q A;  4BDM A;  4EXK A;  5KDT B;  2F7C A;  4DCX A;  4O8M A;  5I2K B;  1NUY A;  2ZXT A;  1M5D A;  1D9Y A;  3PV0 E;  2I4C A;  4OFJ A;  1AWB A;  4RY1 A;  1QUL A;  4DE8 A;  5AA1 A;  1B1H A;  4PE5 B;  4ZEC A;  3MP6 A;  2HXW A;  1FRP A;  2Q2C A;  3TTR A;  1FPF A;  5JK4 A;  5KCJ B;  4PAF A;  4XF5 A;  2DWI A;  2XXI A;  2VT5 A;  4RYA A;  2RCB A;  1SYH A;  4YKJ A;  1IIW A;  3UOR A;  1UIU A;  3K6V A;  2UVG A;  1HSL A;  3O29 A;  2RC7 A;  1MQJ A;  4ND9 A;  1NV5 A;  2FHY A;  3K6W A;  1RDY A;  2F35 A;  3TQL A;  1XOC A;  3PPO A;  3IJX B;  2Q74 A;  3PPP A;  3T9H B;  3MBP A;  4N81 A;  4GX4 A;  1MDP 1;  4POW A;  1B2H A;  3VV5 A;  1TFD A;  3KJ7 A;  2QVU A;  1PB9 A;  4XKN A;  4G8H A;  2DQV A;  1M5F A;  4PFI A;  2RC8 A;  3O2A A;  3QMF A;  4H8J A;  2Q8J A;  4GVO A;  1MQI A;  3M8U A;  2B3F A;  1QUK A;  1NH8 A;  4X1D A;  3V83 A;  2R6G E;  1J1N A;  1JVY A;  1TT1 A;  4N6K A;  1SQY A;  1MH4 A;  4Q0C A;  1ZLQ A;  3QAX A;  4GF8 A;  2GFE A;  3KN3 A;  2P3N A;  1B32 A;  4JWX A;  2XA5 A;  5CI5 A;  5K2X A;  2XWV A;  5J1D A;  4XIG Q;  2W7Y A;  2Y7K A;  4EXL A;  5DEX A;  3K1M A;  4MIJ A;  2X7P A;  3FXR A;  2XXY A;  4PDH A;  1RKM A;  2OWZ A;  2AIX A;  3H6T A;  4LUB A;  4UA8 A;  4GWU A;  4PP0 A;  4G77 A;  1XHY A;  4BDR A;  3I6V A;  3K02 A;  3QSL A;  3PMX A;  1NFT A;  4ISU A;  4NMY A;  3MC2 A;  4N6D A;  5KDT A;  1MPC A;  3PGF A;  5TU0 A;  1NV7 A;  4F18 A;  3VE1 B;  3LUZ A;  4I3E A;  3LSW A;  2REJ A;  2O69 A;  4U4S A;  2Y7W A;  4R2B A;  4QFO A;  5KZT A;  3CIJ A;  2QS1 A;  2IEE A;  5FBP A;  1KA0 A;  4EDP A;  4ELR A;  1FQE A;  2VD2 A;  4XFE A;  2BJI A;  2F7A A;  3TEL A;  4ZZA A;  5FTH A;  1LAH E;  1Q35 A;  1PEB A;  1H45 A;  4GL8 A;  3T96 B;  2MKZ A;  3O66 A;  2O7U A;  1B4H A;  2XXP A;  1RDX A;  4OVS A;  2ABH A;  4EQ9 A;  5CMB A;  2Y5K A;  3VLV A;  2XXR A;  3N6U A;  2QMW A;  3HHG A;  3UIF A;  4OEU A;  3KZG A;  2OK2 A;  1NUW A;  2F8D A;  4R72 A;  4KQP A;  4NGU A;  1NUX A;  2Z8D A;  3C35 A;  5B7D A;  4ONY A;  4U23 A;  2RCA A;  4N4U A;  3K2D A;  3PPR A;  4AB5 A;  3N26 A;  4QFL A;  1B5J A;  4LA9 A;  4IO3 A;  3PTY A;  2VHA A;  1DK4 A;  3CG3 A;  4ZZE A;  1EYJ A;  3FXQ A;  3B50 A;  1TFA A;  3QYT A;  1NKX A;  4NF5 A;  3TCG A;  2XHD A;  4MX6 A;  3RYD A;  1US5 A;  1SI0 A;  1OLC A;  5ELV A;  3B6T A;  1MM6 A;  3H06 B;  5LOM A;  3B8B A;  5AA4 A;  1LB8 A;  1K9Y A;  2DOJ A;  4F1Y A;  1CE2 A;  1FW0 A;  1LBW A;  5H8S A;  2CMO A;  3MWB A;  1FTA A;  2GHB A;  2XXW A;  3IX1 A;  3FIR A;  4TLM B;  3FVK A;  4C0R A;  3JYR A;  4PFY A;  2E0S A;  1R9Q A;  3RPW A;  4LAT A;  4MEV A;  4EUO A;  3O9P A;  4R9G A;  4YMB A;  3C4M A;  4GX3 A;  2UVI A;  2O1M A;  1IQ7 A;  4OES A;  3IO4 A;  4ELO A;  1UTB B;  2V4C A;  4X48 A;  4YZZ A;  3ZS6 A;  1H76 A;  1MG1 A;  1ZTY A;  4WXJ A;  1MQD A;  3OEN A;  3MAM A;  3ILU B;  2UVJ A;  2ZMB A;  4HS7 A;  5DT6 A;  1CNQ A;  3LUY A;  1KZ8 A;  4XTC Q;  4YB7 A;  4O7M A;  4PAK A;  1FTL A;  2XWK A;  2L5V A;  3TCF A;  2V84 A;  3OSR A;  3S9E A;  4HE1 A;  2G29 A;  1B5H A;  2HCA A;  3A3C A;  4OET A;  1SDX A;  1DMB A;  4QXD A;  1NV3 A;  1O64 A;  1TXF A;  2NVU B;  3H6U A;  4MNC A;  1FTK A;  2ZZX A;  1SW2 A;  4F3B A;  2WBD A;  2R9J A;  2A5T A;  5FHN A;  3E78 A;  4C1T A;  4F3P A;  2I0B A;  3LSL A;  2I49 A;  5ITP A;  1UTB A;  4KHZ E;  2V3U A;  2XXX A;  1NV2 A;  1WOD A;  1BIY A;  1SI1 A;  3KJT A;  3LBS A;  3RT8 A;  2QVR A;  1FPE A;  2A5S A;  4LQ5 A;  4H0W A;  3KBZ A;  5L8D A;  1L5T A;  3TOD A;  4GXA A;  3IO6 A;  1EYK A;  2ESN A;  5H8Q A;  4PBH A;  1QVS A;  5I56 A;  2PBW A;  5L9M A;  4HE0 A;  3K4U A;  5ET8 A;  3MST A;  3EPE A;  3PD8 A;  4EQB A;  4F19 A;  2HPG A;  1DPE A;  4KCC A;  1N3W A;  4O3C A;  3G3J A;  1FCK A;  1NMU A;  4Q30 B;  4IGT A;  3TKD A;  2Y7R A;  4G2Z A;  4C1U A;  1YAE A;  4P1L A;  3N6T A;  4IO4 A;  1QUI A;  1XT8 A;  3MZB A;  3FVG A;  3O6H A;  3FV2 A;  2ZZV A;  2O6A A;  4PFW A;  3KEI A;  2Z22 A;  3FJM A;  1JW5 A;  4TQU Q;  1GGG A;  2AYS A;  4X9T A;  3OO7 A;  1LFH A;  4PF8 A; 
#chains in the Genus database with same CATH homology
 3VVF A;  3UOR A;  1UIU A;  3K6V A;  2UVG A;  1M5E A;  2IA4 A;  5AA2 D;  1D4N A;  3KGC A;  3VFJ A;  1H43 A;  1HSL A;  3O29 A;  4BDO A;  2HAV A;  2RC7 A;  1P1W A;  3LR1 A;  2ANJ A;  5AE4 A;  3H4Z A;  1P1Q A;  1MQJ A;  4RK9 A;  1I6A A;  1Q1K A;  3ODB A;  3RPW A;  3R26 A;  4R2F A;  4ND9 A;  4EXK A;  5IAI A;  2F5X A;  5BUU A;  4GXS B;  3B6W A;  3K6W A;  2F35 A;  2FA7 A;  3TQL A;  1XOC A;  2E1S A;  3HCQ A;  1EZ9 A;  3PPO A;  4ZE8 A;  3IJX B;  1DSN A;  4ZDM A;  2F6G A;  3PPP A;  1B1X A;  4G4P A;  4I1D A;  3T9H B;  3MBP A;  1MPD A;  4YKI A;  4G68 A;  1B3L A;  3K6X A;  1MDP 1;  3PD9 A;  4POW A;  4YAH X;  3H6V A;  1PB8 A;  1LCF A;  3BFT A;  3U72 A;  3RN8 A;  1B2H A;  3VV5 A;  4U21 A;  3TMG A;  1TFD A;  2B65 A;  2XD2 A;  1B4Z A;  3D4C A;  1B9J A;  3KJ7 A;  3TTK A;  4PFT A;  1PB9 A;  2NWJ A;  1FQA A;  4XKN A;  4JBZ A;  3FAS A;  3ECR A;  3KOT A;  1FTO A;  4G8H A;  1IEJ A;  2DQV A;  1M5F A;  2G93 A;  2RC8 A;  4KI0 E;  1IIW A;  4YB5 A;  1BLF A;  1P1U A;  3MQ9 A;  2Z8F A;  1WVJ A;  2XXT A;  1VFD A;  2UVH A;  3E3K A;  3O2A A;  4H67 A;  4ELQ A;  1VFE A;  3BBR A;  1ZMG A;  4H5F A;  2F34 A;  3H03 A;  1LGB C;  2DVZ A;  3A09 A;  4HTG A;  4IO6 A;  4OFO A;  3RTW B;  2REG A;  2O7I A;  1S7Y A;  2ZYM A;  2I6E A;  4H8J A;  2Q8J A;  3RUM A;  4GVO A;  4M4G A;  1MQI A;  1MY0 A;  4Z7E A;  1CB6 A;  3M8U A;  2B3F A;  4ZEK A;  2Q2A A;  2ZYK A;  3MPL A;  3T9X B;  1QUK A;  3IB0 A;  2XX7 A;  5H8N A;  1NH8 A;  1M5B A;  3C33 A;  1HSJ A;  5JEI A;  3M3L A;  5K2Y A;  3ZSF A;  4X1D A;  2FYI A;  4H65 A;  3K01 A;  2O84 X;  4FOR A;  4MLQ A;  5CC2 A;  3V83 A;  1MRP A;  2R6G E;  3H7M A;  1J1N A;  1JVY A;  1TT1 A;  1S50 A;  2H99 A;  1D9V A;  3DP8 A;  3TTL A;  1SQY A;  1MH4 A;  1JNF A;  1P1O A;  2A5T B;  4QFN A;  4Q0C A;  1ZLQ A;  3QAX A;  3R6U A;  4GF8 A;  1MS7 A;  2GFE A;  2RIN A;  3LSF B;  3MZ1 A;  4WKM A;  4F1U A;  1EH3 A;  1FTM A;  2KLF A;  3KN3 A;  4NED A;  3ILT B;  4GQO A;  4O3B A;  1P1N A;  5M2V A;  1O7T A;  1XS5 A;  1VE4 A;  2YLN A;  4JSO A;  4MH5 A;  4NF6 B;  4DLD A;  5AA3 A;  1B32 A;  3C34 A;  3MZ9 A;  3MJN A;  4JWX A;  4F1V A;  2H5Y A;  4ELP A;  1TWY A;  2QS3 A;  4DDD A;  4LQ2 A;  1EU8 A;  1MXU A;  1PC3 A;  3SET A;  5CI5 A;  4BLA A;  1URD A;  2ALU A;  5K2X A;  5F1Q A;  3UN6 A;  2UXA A;  3IOR A;  1FQF A;  1MQG A;  5J1D A;  4XIG Q;  3FV1 A;  3KOS A;  1JQF A;  2W7Y A;  2Y7K A;  4EXL A;  4ZE9 A;  4ECF A;  2THI A;  3IAZ A;  3KG2 A;  5DEX A;  3K1M A;  1BP5 A;  4F2O A;  3OXN A;  2OWS A;  4RJZ A;  3HST A;  2QJE A;  2HFB A;  2Y7P A;  4QFP A;  3V8X B;  1KWH A;  5JTY A;  4FED A;  2X7P A;  3HPI A;  3FXR A;  5I2N A;  4IO5 A;  3R7X A;  1LBC A;  1B7H A;  2XXY A;  4MF3 A;  5H8F A;  3K6U A;  2QL3 A;  4ZEB A;  1RKM A;  2AIX A;  4QSE A;  2Z8E A;  4DZ1 A;  4KR5 A;  4TLL B;  3CVG A;  4H1X A;  4U1O A;  3TDJ A;  1MXY A;  1LB9 A;  1MXZ A;  3H6T A;  5I57 B;  1H44 A;  3EHU A;  4YMA A;  4LUB A;  4KYE A;  4UA8 A;  3RTF B;  1ATG A;  3K0V A;  5CMM A;  4PP0 A;  4G77 A;  1MM7 A;  1MY3 A;  1XHY A;  2OZZ A;  3RNN A;  4BDR A;  3G3K A;  1YPN A;  3E4R A;  3I6V A;  3K02 A;  3QSL A;  1B3H A;  1B0H A;  3PMX A;  1Y4T A;  3DM0 A;  1LLS A;  1NFT A;  5TP9 B;  1B58 A;  4ISU A;  5I84 A;  1SW1 A;  3LSX A;  4GWO A;  4LZ8 A;  1OMP A;  2XXV A;  2D3I A;  3MC2 A;  4NF4 A;  4NMY A;  4O3A A;  4HCW A;  5KDT A;  1JW1 A;  4Z0I A;  5H8F B;  1A99 A;  4POX A;  1MPC A;  2DXY A;  3CRB A;  3PGF A;  5TU0 A;  1B0L A;  3SEW A;  3T93 B;  4XKR A;  2NOO A;  4OFL A;  3VE1 B;  4F18 A;  1FQC A;  2Z23 A;  5DYH A;  3GBA A;  4THI A;  3W15 C;  1NL5 A;  3LSW A;  1LFG A;  4DIG A;  2REJ A;  1URS A;  2DE3 A;  2O69 A;  2OWT A;  2PYY A;  4MFI A;  1AMF A;  2P1S A;  4U4S A;  4YU0 A;  3VLW A;  2Y7W A;  4MLV A;  4R2B A;  3SDF A;  3UK4 A;  4QFO A;  5ICT A;  3O6G A;  3GLB A;  2BJJ X;  2GRV A;  3IOU A;  2DE2 A;  3CIJ A;  2QS1 A;  2HEU A;  1Y9U A;  2IEE A;  3FJG A;  3TPA A;  3TTN A;  3V5A A;  4EDP A;  4ELR A;  3PPN A;  1FQE A;  2VD2 A;  3D4G A;  4BDQ A;  3H6W A;  3V89 B;  3VVD A;  5A5X A;  3ZKK A;  2F7A A;  3TEL A;  4ZZA A;  3OO9 A;  1IZ1 A;  5FTH A;  3FD3 A;  1LAH E;  5KZT A;  1A40 A;  4OQO A;  1Q35 A;  1IXG A;  2DXR A;  1PEB A;  1ZIU A;  1H45 A;  2B3B A;  3KN8 A;  4GL0 A;  4GL8 A;  3T96 B;  3O97 A;  2Q9T A;  5AA2 B;  3G3G A;  4TOZ A;  1A55 A;  3KSX A;  1OVB A;  3O66 A;  2ONR A;  1B46 A;  3DEL B;  1LAX A;  1II5 A;  1NNF A;  1OLA A;  2O7U A;  1Y3N A;  2OJT A;  4JB7 A;  4LZ7 A;  5H8Q B;  1MPB A;  3Q26 A;  1B4H A;  2XXP A;  3EF7 A;  1POT A;  4PFU A;  3TCH A;  3Q28 A;  4R9F A;  2ABH A;  4EQ9 A;  5CMB A;  2XXU A;  3MUQ A;  4G8M A;  5H8H B;  2V3Q A;  3FVN A;  2WKY A;  3OO8 A;  4HCY A;  4I62 A;  3IK6 B;  3VLV A;  2XXR A;  3N6U A;  1T0K A;  3O28 A;  4R6H A;  4E0X A;  2QMW A;  4LP2 B;  2P0S A;  4YKK A;  2I4B A;  3IB1 A;  3HHG A;  2HZL A;  2XXH A;  3UIF A;  1F9B A;  1JEV A;  3KZG A;  2OK2 A;  1P99 A;  3BFU A;  3G3H A;  1OQH A;  1ELJ A;  2F8D A;  4OEU A;  2AL5 A;  1I69 A;  3WAF A;  1UQW A;  1IXI A;  4FE8 A;  4OEN A;  3QK6 A;  4KQP A;  4R72 A;  3SEX A;  2Z8D A;  3C35 A;  4AB6 A;  5B7D A;  1SBP A;  4ZS9 A;  4BDN A;  4ONY A;  2H9B A;  4U23 A;  3UGW A;  4R6K A;  1Z7M E;  2HAU A;  3OD7 A;  1N3X A;  2RCA A;  3U8Q A;  1LST A;  3U93 A;  3IOV A;  2I3V A;  2XX8 A;  4JXI A;  3C32 A;  3K2D A;  2D21 A;  3AXF A;  3PPR A;  3PUY E;  4LVQ A;  4QSD A;  3THI A;  4AB5 A;  2I0C A;  3N26 A;  4RA1 A;  4QFL A;  3KFM A;  1B5J A;  3CFL A;  1B40 A;  1PDA A;  3MP8 A;  4LA9 A;  1Y1Z A;  4IO3 A;  3K1P A;  4U22 A;  3TAJ A;  4RNS A;  3PUZ E;  1SD3 A;  2DYX A;  1OVT A;  2HZK A;  1JEU A;  1B3G A;  1NNK A;  4H8I A;  5F7V A;  2VHA A;  3CG3 A;  4NTL A;  4ZZE A;  1B05 A;  2DWH A;  3FXQ A;  3L6H A;  2LAO A;  4DXB A;  3TEP A;  4G8N A;  3OEM A;  1HSE A;  1TFA A;  4P0I A;  2CZL A;  2DE4 A;  2PT1 A;  4NF8 A;  3QYT A;  3Q29 A;  4EQ7 A;  1NKX A;  3TYH A;  4F3G A;  3BKI B;  2QS4 A;  4KYD A;  4NF5 A;  3USD A;  1LFH A;  3TCG A;  2QPQ A;  4JWY A;  4NWD A;  3T66 A;  3M3F A;  2XHD A;  2UYF A;  3P7I A;  4QF9 A;  2I48 A;  3ONM A;  3RGY A;  5I2K A;  2VOZ A;  2XD3 A;  4MBP A;  1US5 A;  4RXL A;  4N6P A;  2GH9 A;  1A7L A;  1VR5 A;  2D5W A;  1QUJ A;  3QXM A;  3QUF A;  1B6H A;  1SI0 A;  1OLC A;  1PBP A;  4GLI A;  1YTV A;  1MXW A;  5ELV A;  1N76 A;  3B6T A;  5I59 B;  3Q25 A;  3RLF E;  3DP6 A;  1MM6 A;  3H06 B;  1B52 A;  1H3D A;  1Z7N E;  5JTY B;  5LOM A;  4FJP A;  4ZEF A;  5AA4 A;  1GR2 A;  1AOV A;  3PMW A;  1NH7 A;  4NWC A;  1LB8 A;  2DWJ A;  2O51 A;  2H4I A;  4YKP A;  3T22 A;  3S9M C;  5ISU A;  4OVJ A;  1B3F A;  3E13 X;  3UA8 A;  3E9X A;  3MVX A;  1QKB A;  3CG1 A;  1NNT A;  5BWJ A;  1PB7 A;  2DOJ A;  3CI8 A;  5EYF A;  4F1Y A;  4FAT A;  1CE2 A;  1FW0 A;  2H98 A;  1I6B A;  2CMO A;  3M3K A;  3MWB A;  3OMB A;  4FEB A;  5H8S A;  4OWD A;  3VVE A;  1VSO A;  4F29 A;  1GVC A;  4LON B;  4AQ4 A;  2GHB A;  2XXW A;  4G68 C;  3IX1 A;  3C31 A;  4QRZ A;  3G3I A;  2VGQ A;  3FIR A;  3PPQ A;  3MP1 A;  4TLM B;  1GV8 A;  3FVK A;  4IO7 A;  2ZNT A;  3FUZ A;  3PUV E;  5FHO A;  5I58 B;  4C0R A;  5L9S A;  4PET A;  1BKA A;  1Y4C A;  1URG A;  3JYR A;  1ZKB A;  3TQW A;  4PFY A;  2E0S A;  4DCY A;  4F3S A;  4FAJ A;  1R9Q A;  1XC1 A;  2OLB A;  4H6D A;  4OXV A;  4R6Y A;  2YJP A;  1IXH A;  1DOT A;  3CFX A;  4LAT A;  2I58 A;  2ONS A;  4OMB A;  5FTI A;  4FEC A;  2OBG A;  1XVY A;  3CSB A;  3EHS A;  5HBC A;  1JVX A;  5CBR A;  4EUO A;  3O9P A;  4R9G A;  3ZKL A;  4R74 A;  4YMB A;  1MDQ A;  2DWA A;  4OYV A;  3C4M A;  3SER A;  3VXB A;  4P11 A;  4Q5T A;  1USY E;  5DVJ A;  2UVI A;  3RQT A;  2F78 A;  2ZYN A;  2O1M A;  1LFI A;  1IXC A;  4NE4 A;  1IQ7 A;  4OHN A;  4OES A;  3IO4 A;  4XKP A;  2F7B A;  2Y7I A;  3MVW A;  5DTB A;  4ELO A;  1UTB B;  3GXA A;  4F39 A;  1MY1 A;  4X48 A;  4YZZ A;  3ZS6 A;  1UTH A;  3TFL A;  1H76 A;  1MG1 A;  2QRY A;  4R73 A;  4WED A;  3SES A;  3UP9 A;  1ZTY A;  4FIM A;  4H5G A;  2V93 A;  4PQJ A;  3SKP A;  4WXJ A;  5EHM A;  1YCJ A;  3KSJ A;  2ONK E;  4LZ5 A;  4U4X A;  3I5O A;  2ZNS A;  2RF1 A;  3EHT A;  1MQD A;  3DLN A;  3OEN A;  1FTJ A;  1MQH A;  1OIB A;  4HW8 A;  3MAM A;  3U94 A;  1EZP A;  1QW0 A;  3ILU B;  5TP9 A;  2UVJ A;  2ZMB A;  4HS7 A;  1SYI A;  1B5I A;  1DPP A;  3O6I A;  5DT6 A;  4NF4 B;  3OSQ A;  5AA2 A;  2F6P A;  3C9H A;  4KD5 A;  4EF2 A;  3VXC A;  4KPT A;  1OQG A;  3LUY A;  4XTC Q;  1MXV A;  4NF6 A;  4YB7 A;  3G7W A;  3IB2 A;  4IY6 A;  3SEY A;  1O63 A;  4L17 A;  3IOW A;  1FTL A;  1R9L A;  1MY4 A;  4IY5 A;  5FHM A;  1UIV A;  2I3W A;  3IJO B;  3HV1 A;  4G68 B;  3HN0 A;  4GIZ A;  1A8F A;  3KBR A;  1JW4 A;  3TCF A;  1AIV A;  2V84 A;  1GTK A;  3OSR A;  1B7U A;  3JV9 A;  3S9L C;  3FVO A;  3H3G A;  1USY H;  2DVC A;  1N04 A;  3PU5 A;  1SVX B;  4OTE A;  3S9E A;  4QFK A;  5ICQ A;  2QS2 A;  5CBS A;  4UAC A;  1POY 1;  2X26 A;  1UTH B;  2G29 A;  1QJM A;  3CFZ A;  1B5H A;  2HCA A;  3A3C A;  4K3F A;  2RC9 A;  4OET A;  5DVF A;  5DVI A;  1SDX A;  1DMB A;  3PMV A;  5DEX B;  3LC8 A;  3WAE A;  4KYS A;  5CMC A;  3IL1 B;  1ZU0 A;  2UYE A;  3TTM A;  3MVY A;  1O64 A;  4IGR A;  2VP1 A;  2O68 A;  1WDN A;  4JSD A;  1LAG E;  1TXF A;  3L6G A;  2NVU B;  1M5C A;  4QSC A;  4OER A;  4OZ9 A;  3CR9 A;  5HM4 B;  3H6U A;  1N7W A;  3OEK A;  4R75 A;  4ZED A;  1R6Z A;  1S9T A;  3GBB A;  2QSX A;  3A3U A;  4NF8 B;  1FTK A;  5I56 B;  1RYX A;  3KN7 A;  3FJ7 A;  5CRY A;  1SW2 A;  4F3B A;  2AL4 A;  3F11 A;  2R9J A;  2R71 A;  3DP4 A;  2A5T A;  5FHN A;  4RPN A;  3Q27 A;  2NUV A;  3T9U A;  4GRK A;  5B70 A;  3GZG A;  4C1T A;  1LBB A;  4RK2 A;  5KCJ A;  2PMS A;  1B3E A;  3K1N A;  4F3P A;  3CSG A;  1DTG A;  2I0B A;  3LSL A;  3QIM A;  2I49 A;  2DP8 A;  3IOT A;  1UTB A;  2PT2 A;  3EN3 A;  3MVZ A;  4KHZ E;  5ITP A;  2V3U A;  4N13 A;  4JWO A;  2PX1 A;  1DTZ A;  1XVX A;  2XXX A;  4YB6 A;  2Q88 A;  2VD3 A;  5TPA B;  5HPQ A;  5I59 A;  4N07 A;  5H8H A;  1AL3 A;  2H25 A;  1SW4 A;  1IUD A;  1WOD A;  2M8C A;  4GOT A;  1QKA A;  2V3T A;  1BIY A;  1SI1 A;  4JDF A;  2V25 A;  3KJT A;  4U1Z A;  5TPA A;  1IIT A;  3LBS A;  3RT8 A;  3S4U A;  4I9D A;  4RPO A;  2XX9 A;  2A5S A;  4LQ5 A;  3W9W A;  1A8E A;  4H0W A;  4IO2 A;  2FNC A;  5CMK A;  5L8D A;  1Y3Q A;  1MH3 A;  1RYO A;  3HHF A;  1L5T A;  3TOD A;  1ZBM A;  3OOA A;  1I6Q A;  3RT6 B;  2YPN A;  3FAT A;  2NXO A;  1ANF A;  1MY2 A;  3FGS A;  3IO6 A;  4GXA A;  4BDL A;  5I58 A;  2PVU A;  2O1L A;  4X1B A;  2DS9 A;  3TZA A;  5CM6 A;  2ESN A;  3SEU A;  5A5X B;  3K00 A;  3OEL A;  5H8Q A;  1ZJL A;  5L9O A;  3QUJ A;  1LCT A;  1QVS A;  4DXC A;  4ESX A;  1SW5 A;  1Y3P A;  2PBW A;  4I8C A;  4Q8R A;  5I56 A;  3C36 A;  3HO7 A;  1N7X A;  2X7Q A;  3K4U A;  3MW0 A;  4GFR A;  5L9M A;  2OCU A;  3SEV A;  3FXU A;  3T9V A;  2GHA A;  4XKQ A;  5I2N B;  2P2A A;  3PUW E;  1N0T A;  3PUX E;  5I57 A;  3EPE A;  4EF1 A;  4GD5 A;  5AA4 B;  1B7Z A;  1D3K A;  2Y84 A;  3PD8 A;  2RKM A;  3VLU A;  4EQB A;  4F2Q A;  2HQ0 A;  4F19 A;  4U2R A;  1B51 A;  1DPE A;  4KCC A;  1JET A;  1N3W A;  4O3C A;  1FQB A;  3B7D A;  3G3J A;  5EHS A;  1FQD A;  1FCK A;  4BDM A;  1NMU A;  3TUS A;  3EQ1 A;  5KDT B;  3MPK A;  1Y20 A;  3N94 A;  2DSF A;  2F7C A;  4DCX A;  4Q30 B;  2F97 A;  4F22 A;  1EZO A;  4IGT A;  4YIC A;  3RY3 A;  3TKD A;  2Y7R A;  2F36 A;  2XXQ A;  1US4 A;  4G2Z A;  5I2K B;  1N84 A;  4C1U A;  3JZJ A;  3N5L A;  1YAE A;  4QHQ A;  4XXU A;  1R1N A;  1BTJ A;  4KCD A;  1MXX A;  2ZXT A;  1M5D A;  1D9Y A;  2ZYO A;  3N6T A;  1PBQ A;  4IO4 A;  1QUI A;  4NF5 B;  3S2V A;  4ESW A;  3PV0 E;  1XT8 A;  2I4C A;  4OFJ A;  3FZV A;  4DXU A;  3MZB A;  4F31 B;  4RY1 A;  4E0W A;  1QUL A;  3B6Q A;  3FVG A;  3O6H A;  4YKJ A;  4ZEI A;  1B1H A;  5AA1 A;  4PE5 B;  4DE8 A;  2Q89 A;  4IB2 A;  2ZNU A;  3U92 A;  4ZEC A;  3S9N C;  3FV2 A;  2QMX A;  2O6A A;  3MP6 A;  4PFW A;  3U1O A;  4OEV A;  1LAF E;  3W9V A;  2HXW A;  2Q2C A;  3I3V A;  3TTR A;  3KEI A;  5IKB A;  2Z22 A;  4KFQ A;  3VDF A;  4M1V A;  1NNP A;  3OO6 A;  5H8N B;  5JK4 A;  4WEP A;  5KCJ B;  1AH5 A;  3FJM A;  3G3F A;  2DWI A;  2XXI A;  1JW5 A;  4TQU Q;  1GGG A;  1A54 A;  3IR1 A;  4RYA A;  2AYS A;  4X9T A;  3OO7 A;  2RCB A;  1Y1M A;  1SYH A;  4P0G A;  5ITO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...