3EN3A

Crystal structure of the glur4 ligand-binding domain in complex with kainate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
257
structure length
257
Chain Sequence
TVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor 4,Glutamate receptor
publication title Correlating AMPA receptor activation and cleft closure across subunits: crystal structures of the GluR4 ligand-binding domain in complex with full and partial agonists
pubmed doi rcsb
source organism Rattus norvegicus
total genus 76
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2008-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3en3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3en3A02
3EPEA 1GVCA 2QS3A 4NEDA 3K6UA 4X9TA 3OSRA 4ZZAA 1KWHA 2E0SA 2F7AA 5FHOA 4EQBA 4F1VA 4KYDA 4EF2A 3CFZA 1FQBA 1O7TA 1PB8A 4F31B 2P1SA 3CFLA 3QUJA 3UIFA 4YB7A 2XXXA 5AA3A 4Q5TA 4HS7A 4TLLB 2DWHA 2OK2A 3TFLA 3PPPA 3T66A 3L6GA 3PPNA 3FVKA 4EF1A 1MY3A 3O6IA 1TFAA 1UIUA 1B3GA 3T9HB 1LBCA 3Q26A 4NF6B 2IA4A 1FQFA 5DVIA 3RLFE 4OETA 2DVZA 3OSQA 5H8QB 4YICA 5BWJA 4U21A 3E9XA 1AOVA 3KZGA 1A40A 2O7UA 4LQ5A 1MS7A 1B52A 1US4A 2ANJA 4NF4B 2Z8FA 4BDOA 2QJEA 1MPCA 1FQAA 1MQJA 3C4MA 2QS1A 4WXJA 2XX8A 2I49A 1QUJA 2CZLA 2XXUA 5I57B 1JW4A 1TT1A 1B2HA 2XXYA 3DP6A 3K6WA 2REGA 1OLCA 2H9BA 1NNTA 1XVXA 3FV2A 4OENA 2Y7PA 2AYSA 4H5FA 3KJ7A 1A8EA 5JK4A 3HO7A 4ND9A 3B7DA 1XS5A 5ELVA 2NWJA 3QXMA 4DDDA 4KD5A 4POXA 4X48A 3T9XB 2I58A 1SBPA 2VD3A 5K2YA 2DWJA 4IB2A 1LAXA 1JQFA 4XKNA 2I48A 3G7WA 4TOZA 4XKPA 5F7VA 3DLNA 5FTIA 1N84A 5AA2B 5H8FB 1QW0A 3UA8A 1Y9UA 4KI0E 3M3FA 1DPEA 1MY2A 3TZAA 2G93A 2XXQA 2ONSA 4IGTA 3U72A 2OZZA 2HEUA 1IIWA 1PBQA 1SI1A 4GQOA 4R2BA 4U4SA 1A8FA 1MPDA 4IO3A 3S9MC 1ZIUA 4NF5B 1DTZA 1BKAA 1DSNA 3VVEA 2AL5A 4G8MA 1FW0A 3PUVE 3C35A 4GL8A 4RYAA 2RCBA 3IB0A 1M5FA 4F3GA 3VXBA 1HSLA 4MLQA 5A5XA 5KCJB 2XD2A 2P2AA 3MVYA 1D9YA 1IZ1A 4RA1A 1NL5A 3K0VA 4JWXA 2F6GA 4ZDMA 4RK9A 3RNNA 5H8HB 3M8UA 3D4GA 1Y20A 3IX1A 4NMYA 3QIMA 1BTJA 3KN8A 1IXHA 3OO6A 5I58B 4LP2B 2THIA 3EF7A 1MY4A 2Y7KA 4AB6A 2GFEA 3UK4A 1LLSA 4U1OA 3MQ9A 2GH9A 1XHYA 3LBSA 5L9MA 3N26A 3LSWA 4OESA 2VGQA 3H03A 3H6TA 1M5EA 1H45A 2HXWA 3SEVA 2Y7WA 1WODA 3MZ1A 2H5YA 2ZYNA 3KOTA 1B9JA 4JSDA 2W7YA 2O1MA 2OWSA 2Q89A 3K4UA 3KOSA 2XD3A 2QRYA 1NNPA 4IY6A 3FGSA 4H0WA 1PEBA 1MDQA 5K2XA 2Y7RA 4PFWA 4F1UA 3IO6A 2UVJA 5KZTA 3B6WA 4G68A 1S50A 2HCAA 3R26A 4GRKA 1URGA 3FVOA 5CMBA 4GXAA 4DLDA 3MVXA 3PUXE 2PVUA 5TPAA 4RXLA 2F8DA 4DE8A 1II5A 2I4CA 2F97A 3QK6A 3AXFA 5KDTA 4F3SA 1B6HA 3G3GA 4K3FA 4N07A 1SYIA 5H8NA 1MH4A 1B32A 2X7PA 1M5BA 4R72A 1B5JA 3KG2A 1B0LA 1N0TA 1Q1KA 4Z0IA 1B51A 4BDNA 3H6WA 1JW5A 2B3FA 2R9JA 4H67A 3GLBA 5DEXB 1Y4TA 2Y84A 1JNFA 1MXUA 4RNSA 1B40A 1Y3QA 3T9VA 3FVNA 2B3BA 3SEWA 1FCKA 1B3FA 5DYHA 3FXQA 1BIYA 2ONKE 2V3TA 4Q30B 4GFRA 3SETA 1NNFA 2XXHA 2QPQA 4QF9A 1NH7A 2ALUA 5FHNA 3IORA 5J1DA 4U2RA 1B1XA 4ZEDA 3M3KA 1B3HA 4ELRA 2OJTA 3C34A 2GHBA 3K1PA 1B5IA 1VFDA 1MQGA 4E0WA 4NWDA 1FTMA 3KGCA 4KHZE 2HAUA 5L8DA 3K6VA 2ZXTA 3FD3A 5HM4B 4O3AA 1UTHB 3BBRA 3KN3A 3H6UA 2R6GE 4U1ZA 4AQ4A 3OO9A 3W9WA 3Q28A 3ZSFA 1LFGA 3KEIA 5ICTA 4R73A 5CBSA 1QUIA 3CFXA 3HCQA 4TQUQ 3IO4A 3TMGA 4PQJA 4E0XA 3C33A 4P0GA 3T22A 4OWDA 3TQWA 1A55A 1N3WA 1OQGA 1AMFA 2Q2CA 1YTVA 1I6QA 1USYH 3QAXA 5L9SA 4O3CA 3U8QA 1AH5A 2QMWA 4OZ9A 1P1NA 3FZVA 3TDJA 3OENA 2XXIA 3TTMA 5I2NA 5EYFA 3FUZA 4QSDA 1DTGA 3C9HA 2OWTA 4YMAA 4GWOA 2YJPA 2H98A 3TTNA 4ECFA 3KN7A 4EQ9A 1B3EA 3GBAA 3OELA 4YKIA 4P11A 5JEIA 1LB9A 1GV8A 1DOTA 5ISUA 4F2OA 1JEUA 4NF8B 5HPQA 3O28A 5B70A 1LCTA 5I2KB 1OVTA 2UVIA 2I0BA 4IO4A 2PX1A 4R6KA 2P0SA 5I59A 1IITA 5I56B 2UXAA 2H4IA 4ELPA 4RK2A 2FYIA 1LSTA 2RINA 2XXWA 2R71A 4NE4A 3OO8A 1NH8A 1LFHA 3MUQA 4POWA 1MY1A 4GD5A 3FVGA 1XVYA 2YPNA 4X1BA 3SEYA 1ANFA 1SW4A 1N7XA 1S9TA 4YZZA 3E3KA 3N94A 4QFOA 4WEPA 4EUOA 3S9NC 1EZOA 4R6YA 4YB5A 4HTGA 5EHSA 1P1OA 2RCAA 4XKRA 2NVUB 3VFJA 4OYVA 3VVDA 1JETA 4R9FA 5DTBA 4I62A 4IO2A 1Y3NA 2Q8JA 3RGYA 3FJGA 4ZEIA 1MH3A 3IOVA 2DOJA 1IXCA 4GOTA 2UYEA 2DE2A 1N3XA 3OEKA 1SVXB 2A5TA 2ZNSA 4G77A 3TTRA 4JB7A 3ILTB 1QVSA 4F1YA 2O84X 4KYEA 1OIBA 5FHMA 3O6HA 4LVQA 3SERA 4KYSA 1LFIA 1DMBA 3MP6A 4G8HA 4G8NA 1UTBB 1XC1A 4GF8A 3L6HA 1AIVA 2F36A 5TP9A 3DM0A 3KFMA 3MPKA 1FTKA 1QKBA 1FTLA 3CI8A 3D4CA 1PB9A 3EHTA 1RYOA 3PMWA 3DP8A 4RY1A 4PFTA 4JDFA 2DQVA 4EDPA 4ESXA 3MVZA 3KBRA 1BLFA 2XXTA 3S9LC 3KSXA 4XTCQ 3PMXA 2DP8A 4JWYA 2KLFA 4YKPA 2WKYA 1SD3A 3CIJA 1B7UA 3O2AA 4JWOA 1MDP1 3ODBA 4R6HA 2D3IA 5AE4A 3U93A 2PBWA 5CI5A 3MPLA 1BP5A 4NTLA 3N6TA 4QSEA 1P1QA 1YCJA 2F34A 4OQOA 1LAFE 4IO5A 1MM6A 2DVCA 3E4RA 4HCYA 2DWAA 3H7MA 4JXIA 3MJNA 3A3CA 3OO7A 1IQ7A 3PUZE 1T0KA 5CC2A 3PUYE 5I84A 3MBPA 3K02A 5DT6A 2UYFA 4ZE8A 1NKXA 3VVFA 3WAEA 3O29A 3QYTA 1PB7A 1R9LA 2F35A 4C1TA 2F5XA 2Z22A 3HHFA 2A5SA 4RPOA 2ZMBA 3IR1A 4X1DA 1I6BA 3RTFB 3W15C 3F11A 4KR5A 2PYYA 3TPAA 4ZECA 3LSXA 4P0IA 4ZS9A 4THIA 3VE1B 4NF6A 1Y3PA 4IO6A 3B6QA 1UQWA 3TYHA 4R74A 3PPRA 3HHGA 3QUFA 4LONB 1S7YA 1A54A 3TCHA 1B3LA 1FTJA 4GIZA 1QULA 1B58A 3U92A 1US5A 2RC8A 4MBPA 4NF4A 3O9PA 4Q0CA 2D5WA 2VP1A 1CB6A 3MWBA 3ZKKA 4BDMA 3TQLA 4QFPA 1JVYA 3BFUA 1MM7A 2OCUA 4FEBA 3EHUA 5CMMA 4DZ1A 3CSGA 1URSA 3T9UA 1MXYA 3IB2A 1N04A 5I57A 1B7ZA 3M3LA 5CM6A 3MW0A 5ICQA 2V3QA 3ONMA 1B0HA 3Q25A 4GL0A 1B1HA 4EQ7A 3V8XB 3EHSA 1SW2A 1NFTA 3TTKA 4F3BA 4ESWA 4F18A 3MP1A 4I1DA 4LUBA 2Z8EA 1QUKA 3VDFA 3KJTA 3O66A 1NMUA 3VXCA 3C31A 1HSEA 3HPIA 1H43A 4MFIA 2O68A 1P1UA 4MLVA 4GVOA 4ZEFA 5AA2A 5H8FA 2VOZA 2UVGA 2OLBA 2XHDA 2HZKA 3HSTA 3H6VA 1GR2A 1O64A 4FEDA 2DXRA 3IB1A 3TKDA 1YPNA 1POTA 3TCFA 4FORA 3K00A 2ZYKA 4M4GA 1VSOA 5DVJA 5CRYA 4F2QA 5AA1A 4QFLA 2H25A 4NF5A 4F3PA 4MH5A 2RC9A 3DELB 4R2FA 2H99A 3ILUB 3IOTA 3IJXB 4OTEA 2HFBA 2GRVA 2AL4A 2GHAA 3LC8A 3TUSA 3HN0A 1SDXA 2F6PA 5KCJA 3FASA 3UN6A 4H1XA 3G3KA 3OXNA 2NUVA 2I3WA 4FE8A 4H65A 1URDA 1ELJA 1R1NA 5L9OA 4ELQA 3S9EA 2X26A 1MY0A 5H8HA 1D3KA 5EHMA 3VLUA 3PV0E 4IO7A 1SW5A 4DXCA 1H76A 4Z7EA 4FAJA 2I4BA 1ZBMA 2XXPA 4M1VA 3U94A 4RPNA 2X7QA 5I58A 3IAZA 3B6TA 3JZJA 4TLMB 1MQHA 2M8CA 3PGFA 3SKPA 2CMOA 4ZEKA 2DXYA 5H8SA 5IKBA 1TFDA 2I3VA 3LSLA 5CBRA 2XX9A 1ZJLA 4DXUA 3K6XA 4FATA 3TODA 4XXUA 2QMXA 4N13A 3IL1B 5A5XB 4PFUA 3OOAA 3RT6B 4G2ZA 2Y7IA 4LA9A 3ZKLA 1OQHA 4DCYA 3RN8A 4DCXA 1OLAA 3JYRA 2O1LA 4G4PA 2FA7A 4KFQA 1J1NA 3BKIB 2V84A 4GLIA 1Z7ME 1YAEA 3TTLA 3RTWB 3OEMA 2VHAA 2V3UA 1EU8A 4FIMA 5JTYA 1PDAA 2RF1A 3CRBA 4O3BA 2HAVA 4H6DA 1P99A 2ZNUA 1B46A 1A7LA 3PD8A 2VD2A 3O97A 3HV1A 4I8CA 2I0CA 5CMKA 4KCDA 4PFYA 3MC2A 1UIVA 3G3FA 1LAGE 2RKMA 2G29A 1EH3A 3H4ZA 2DWIA 5F1QA 4FECA 1AL3A 3VLVA 4LZ5A 3OMBA 2O7IA 3EN3A 4PETA 3GZGA 5ITPA 4C0RA 4LZ8A 5B7DA 1ZKBA 2QL3A 4IGRA 1ATGA 4G68B 4H5GA 3BFTA 4OFJA 5DEXA 2ZYMA 2PMSA 3UGWA 1LAHE 3SESA 3THIA 4AB5A 4F22A 3W9VA 4QSCA 3S4UA 5TPAB 3IJOB 2NOOA 2ONRA 1B4ZA 4I9DA 3CVGA 3H3GA 1LCFA 5KDTB 1M5DA 2YLNA 1N7WA 2Q9TA 5H8NB 4IY5A 3G3IA 4YKKA 2NXOA 2DYXA 1ZTYA 3R6UA 3VV5A 2DE4A 3CG3A 3N6UA 3UP9A 2Z23A 1DPPA 3PMVA 1SW1A 3CR9A 3FIRA 1F9BA 2ZYOA 2V25A 1O63A 5AA4A 4QHQA 1GGGA 1UTHA 4Q8RA 1WDNA 3JV9A 4H8IA 4BLAA 4WEDA 2REJA 4YU0A 1LB8A 1B5HA 1WVJA 4LZ7A 2F7CA 4EXKA 4JSOA 4L17A 4QFNA 2LAOA 1MXXA 3FXUA 1IXIA 3Q27A 3S2VA 3KSJA 4EXLA 5FTHA 1I6AA 2IEEA 4YAHX 4MF3A 1SYHA 1L5TA 3K01A 1XT8A 1Q35A 3MP8A 1HSJA 3H06B 4XKQA 1EZPA 2PT1A 5BUUA 4N6PA 1TXFA 5ITOA 4HCWA 3O6GA 3I6VA 4GXSB 4R9GA 2DSFA 3RUMA 3K1NA 3V83A 2DS9A 3PUWE 3A3UA 4LATA 3IK6B 2ZNTA 5LOMA 3GXAA 4ELOA 4ISUA 3LR1A 3TELA 3EQ1A 3K1MA 3FJ7A 2FNCA 5HBCA 2O69A 2B65A 3G3HA 4UA8A 1OMPA 1A99A 1CE2A 2XXRA 3WAFA 1H3DA 4YB6A 2XXVA 1EZ9A 4NF8A 2UVHA 2V93A 5I2KA 2XX7A 1I69A 3RY3A 1B05A 5DVFA 4PP0A 1JW1A 1H44A 5I2NB 5I56A 2QS4A 4KQPA 2Q88A 3A09A 4FJPA 1MRPA 1PBPA 4OMBA 3LSFB 1D4NA 1B7HA 3CG1A 2O51A 2QSXA 3E13X 4WKMA 5H8QA 2ABHA 5TU0A 4C1UA 5CMCA 3FATA 3MVWA 4OFLA 1MXWA 3DP4A 2O6AA 1RYXA 3FJMA 1ZMGA 3T96B 2F7BA 3V89B 3RT8A 2BJJX 4DIGA 4ZEBA 4U23A 5JTYB 2DE3A 3TCGA 3CSBA 5I59B 4PE5B 1FQCA 1RKMA 4LQ2A 2D21A 5IAIA 3G3JA 1QKAA 4OVJA 1MXZA 3MZ9A 1SQYA 1USYE 2Q2AA 2OBGA 3C32A 4KCCA 3I5OA 2F78A 4ONYA 1R9QA 3PPQA 3V5AA 1MPBA 3QSLA 3T93B 3IOWA 3PPOA 5AA2D 4YKJA 4QRZA 2ESNA 4HW8A 4UACA 4OXVA 3RQTA 1UTBA 3ZS6A 3USDA 3R7XA 1MG1A 3Q29A 1ZLQA 4KPTA 4F39A 3RPWA 4ZE9A 3N5LA 1OVBA 3SDFA 1IEJA 4YMBA 4R75A 3SEUA 1IXGA 1MQIA 4XIGQ 1FQDA 2QS2A 3PD9A 1LBBA 3GBBA 1GTKA 2AIXA 1R6ZA 1TWYA 3P7IA 4BDLA 2HZLA 3FXRA 3I3VA 1PC3A 4OEUA 1POY1 3TAJA 3UORA 4ZZEA 2A5TB 4H8JA 2RC7A 4JBZA 4OEVA 1P1WA 1Y1MA 3OD7A 2E1SA 4NWCA 1XOCA 1QJMA 1Y1ZA 2Z8DA 2I6EA 1VFEA 1MXVA 4OFOA 1Z7NE 1VE4A 3C36A 3SEXA 5TP9B 3TEPA 4OERA 1VR5A 3PU5A 4BDRA 3K2DA 1ZU0A 3VLWA 3FV1A 4U4XA 1MQDA 4U22A 1SI0A 1NNKA 5AA4B 1B4HA 4RJZA 1IUDA 1FQEA 3LUYA 3MAMA 1LGBC 1JEVA 4G68C 1D9VA 4F29A 4QFKA 1FTOA 3ECRA 2PT2A 4OHNA 5M2VA 3U1OA 4F19A 2HQ0A 1M5CA 1N76A 3IOUA 1Y4CA 3MZBA 4DXBA 4BDQA 1JVXA
chains in the Genus database with same CATH superfamily
3EPEA 5ET8A 1GVCA 2QS3A 4NEDA 3K6UA 4X9TA 3OSRA 4ZZAA 1KWHA 2E0SA 5ET5A 2F7AA 5FHOA 4EQBA 4F1VA 4KYDA 4EF2A 1BK4A 3CFZA 4GWYA 1FQBA 1O7TA 1PB8A 2P3NA 4F31B 2P1SA 4O7MA 3CFLA 3QUJA 3UIFA 2ZZVA 4YB7A 2XXXA 5AA3A 4Q5TA 1FPDA 4HS7A 4TLLB 2DWHA 2OK2A 3TFLA 3PPPA 4HE2A 3T66A 3L6GA 3PPNA 3FVKA 4EF1A 1YZ0A 1MY3A 4P9KA 3O6IA 1TFAA 4AS5A 1UIUA 1B3GA 3T9HB 1LBCA 3Q26A 4NF6B 2IA4A 2KQZA 4MJOA 1FQFA 4LN5A 5DVIA 3RLFE 4OETA 5EQ9A 3MSTA 2DVZA 3OSQA 1NUWA 5H8QB 4YICA 5BWJA 4U21A 3E9XA 1AOVA 3KZGA 4N17A 1NUZA 1A40A 2O7UA 4LQ5A 1MS7A 1B52A 2HHMA 1US4A 2ANJA 4NF4B 1Q9DA 2Z8FA 4BDOA 2QJEA 1MPCA 1FQAA 1MQJA 3C4MA 2XWOA 2QS1A 4WXJA 2XX8A 2I49A 1QUJA 2CZLA 2XXUA 5EQ8A 4DI3D 5I57B 1JW4A 1TT1A 1B2HA 1RDXA 2XXYA 3DP6A 1K9YA 3K6WA 2REGA 1OLCA 5I7IA 2H9BA 1NNTA 1XVXA 3FV2A 4OENA 2Y7PA 2AYSA 4H5FA 3KJ7A 1A8EA 5JK4A 3HO7A 4ND9A 3B7DA 1XS5A 4PF8A 5ELVA 2NWJA 3QXMA 4DDDA 4KD5A 4POXA 4X48A 1EYKA 3T9XB 2I58A 1SBPA 2VD3A 5K2YA 2DWJA 4IB2A 1LAXA 1JQFA 4XKNA 2I48A 3G7WA 4TOZA 4XKPA 5F7VA 3DLNA 5FTIA 1N84A 2HXRA 5AA2B 5H8FB 1QW0A 3UA8A 1Y9UA 4KI0E 3M3FA 1DPEA 1MY2A 3TZAA 2G93A 2XXQA 4O94A 4O7IA 2ONSA 4IGTA 4P1LA 3U72A 2OZZA 2HEUA 1IIWA 1PBQA 3U65A 1SI1A 4GQOA 4R2BA 4U4SA 1A8FA 1MPDA 4IO3A 5A5LA 3S9MC 3ROJA 1ZIUA 4NF5B 1QGXA 1DTZA 1BKAA 1DSNA 1LBWA 3VVEA 2AL5A 4G8MA 4OVTA 1FW0A 3PUVE 3C35A 4GL8A 4RYAA 2RCBA 3IB0A 1M5FA 4F3GA 3VXBA 1HSLA 4MLQA 5A5XA 5KCJB 2XD2A 2P2AA 3MVYA 1D9YA 1IZ1A 4RA1A 1NL5A 3K0VA 2VT5A 4JWXA 2F6GA 4ZDMA 4RK9A 3RNNA 1FBEA 2WEFA 5H8HB 3M8UA 3D4GA 1Y20A 3IX1A 4NMYA 3QIMA 2F3DA 1BTJA 2VPOA 3KN8A 3SZPA 1IXHA 1NI9A 3OO6A 5I58B 4LP2B 2THIA 3EF7A 1MY4A 2Y7KA 4AB6A 2GFEA 1FPFA 1NV2A 3UK4A 2KR0A 1LLSA 4U1OA 3MQ9A 2GH9A 1XHYA 3LBSA 5L9MA 3N26A 3LSWA 4OESA 3B50A 1NUYA 3MYUA 2VGQA 3H03A 3H6TA 1M5EA 1H45A 2HXWA 3SEVA 2Y7WA 1WODA 3MZ1A 4MNIA 4OA4A 2H5YA 2ZYNA 3KOTA 2Q74A 1B9JA 4P3LA 4JSDA 2W7YA 2O1MA 2OWSA 2Q89A 3K4UA 3KOSA 2XD3A 2QRYA 1NNPA 4IY6A 3FGSA 4H0WA 4NQ8A 1PEBA 1MDQA 5K2XA 2Y7RA 4PFWA 4F1UA 3IO6A 2UVJA 5KZTA 4IR8A 3B6WA 4G68A 2Q8MA 1S50A 2HCAA 4P47A 1EYJA 3R26A 5IZ3B 4GRKA 1URGA 3FVOA 5CMBA 4GXAA 5I3SA 2R8TA 4DLDA 3MVXA 3PUXE 4MX6A 2PVUA 5TPAA 1LBZA 4RXLA 4PGNA 2F8DA 4DE8A 1II5A 2I4CA 2F97A 3QK6A 4N6DA 3AXFA 5KDTA 4F3SA 1B6HA 3G3GA 4K3FA 4N07A 1SYIA 5H8NA 1MH4A 1B32A 2X7PA 1M5BA 4R72A 5ET6A 1B5JA 3KG2A 1B0LA 3FXBA 1N0TA 3KC0A 1Q1KA 4Z0IA 1B51A 4BDNA 3H6WA 1JW5A 4XF5A 2B3FA 2R9JA 4H67A 3GLBA 5DEXB 1Y4TA 2Y84A 1JNFA 1MXUA 4RNSA 1B40A 1Y3QA 2V4CA 3T9VA 1RDYA 3FVNA 2B3BA 3SEWA 1FCKA 3PTYA 1B3FA 5DYHA 3FXQA 1BIYA 4PE3A 2ONKE 2V3TA 4Q30B 4GFRA 3SETA 1NNFA 2XXHA 2QPQA 4QF9A 4GWXA 1NH7A 2ALUA 5FHNA 3IORA 2WBDA 5J1DA 2PFZA 4U2RA 1B1XA 4ZEDA 3M3KA 1B3HA 4ELRA 2OJTA 3C34A 2XWKA 2GHBA 3K1PA 1B5IA 1VFDA 1MQGA 2JJKA 4E0WA 4NWDA 1FTMA 3KC1A 3KGCA 4KHZE 2DDKA 2HAUA 5L8DA 3K6VA 5FBPA 4JVCA 2ZXTA 3FD3A 4QXDA 5HM4B 4O3AA 1UTHB 3BBRA 4JVDA 3KN3A 1SPIA 1FBPA 3H6UA 2R6GE 4U1ZA 4AQ4A 3OO9A 3W9WA 3Q28A 3ZSFA 2Y5LA 4PDHA 3EKIA 1LFGA 3KEIA 5ICTA 4H46A 4R73A 5CBSA 1QUIA 3CFXA 3HCQA 4TQUQ 3IO4A 3TMGA 4PQJA 3C33A 4P0GA 4MEVA 4E0XA 3T22A 4OWDA 3TQWA 1A55A 1N3WA 1OQGA 1AMFA 2Q2CA 1YTVA 1I6QA 1USYH 3QAXA 5L9SA 4O3CA 3U8QA 3D1RA 1AH5A 2QVUA 2QMWA 4OZ9A 4N8GA 1P1NA 3FZVA 3TDJA 4GWSA 3OENA 2XXIA 3TTMA 5I2NA 5EYFA 3FUZA 4QSDA 1DTGA 2FIEA 4P1EA 4GWZA 3C9HA 4N6KA 2OWTA 4YMAA 4GWOA 2YJPA 2H98A 3TTNA 5IZ1A 4ECFA 1LEVA 3KN7A 4EQ9A 2GQ1A 1B3EA 3GBAA 3OELA 4YKIA 4P11A 1YYZA 5JEIA 1LB9A 4PFIA 1GV8A 1DOTA 5ISUA 4F2OA 1JEUA 1FBHA 3T0JA 4NF8B 5DW8A 5HPQA 3O28A 5B70A 1LCTA 5I2KB 1OVTA 2UVIA 2I0BA 5F24A 4IO4A 2PX1A 4R6KA 1G0HA 1KA1A 2P0SA 2OWZA 5I59A 1IITA 5I56B 2UXAA 2H4IA 4PAFA 4ELPA 4RK2A 2FYIA 1LSTA 5J16A 4PGPA 2RINA 1FPLA 2XXWA 2R71A 4NE4A 3OO8A 1NH8A 1LFHA 4NG7A 3MUQA 4POWA 1MY1A 4GD5A 3FVGA 1XVYA 1DK4A 2YPNA 1NV5A 4X1BA 3SEYA 1ANFA 1SW4A 1N7XA 1S9TA 4YZZA 3E3KA 3QMFA 3N94A 4MMPA 4QFOA 2QFLA 4WEPA 4EUOA 3S9NC 3IFAA 1EZOA 4R6YA 4YB5A 4HTGA 5EHSA 1P1OA 2RCAA 4XKRA 5ET7A 2NVUB 3VFJA 4OYVA 3VVDA 1JETA 1JP4A 3FBPA 4R9FA 5DTBA 4I62A 4IO2A 1Y3NA 2BJIA 2Q8JA 3RGYA 3FJGA 4ZEIA 1MH3A 3IOVA 2DOJA 1LBYA 1IXCA 4GOTA 2UYEA 2DE2A 1N3XA 3OEKA 1SVXB 2A5TA 2ZNSA 4G77A 3TTRA 4JB7A 3ILTB 1QVSA 4F1YA 3RPLA 2O84X 4KYEA 1OIBA 5FHMA 3O6HA 4LVQA 3SERA 4KYSA 1LFIA 4GX4A 1DMBA 2XXKA 3MP6A 4G8HA 4G8NA 1UTBB 4MNPA 1XC1A 4GF8A 3L6HA 1AIVA 2F36A 5TP9A 5IGAA 3DM0A 3KFMA 4XFEA 3MPKA 4MCOA 1FTKA 1QKBA 1FTLA 3CI8A 3D4CA 1PB9A 3EHTA 1RYOA 3PMWA 3DP8A 3GYYA 4RY1A 2WBBA 4PFTA 1VDWA 4JDFA 2DQVA 3MVZA 4EDPA 4ESXA 3E78A 3KBRA 2XWVA 1BLFA 2XXTA 3S9LC 3KSXA 4XTCQ 3PMXA 2DP8A 4JWYA 2KLFA 4YKPA 2WKYA 1SD3A 3CIJA 1B7UA 4JWOA 2VPNA 1MDP1 3O2AA 3ODBA 5LTCA 4R6HA 2D3IA 5AE4A 3U93A 2PBWA 5CI5A 3MPLA 1BP5A 4NTLA 3N6TA 4QSEA 1P1QA 1YCJA 2F34A 4OQOA 1LAFE 4IO5A 1MM6A 2DVCA 3E4RA 4HCYA 2DWAA 3H7MA 3KBZA 4JXIA 3MJNA 3A3CA 3OO7A 1IQ7A 3PUZE 1T0KA 5CC2A 3PUYE 5I84A 3MBPA 3K02A 5DT6A 2UYFA 2ZZXA 4PBQA 4ZE8A 1FPKA 1NKXA 3VVFA 3WAEA 3O29A 3QYTA 4N91A 1PB7A 1R9LA 5I5PA 2F35A 4C1TA 1FPJA 2F5XA 2Z22A 3HHFA 2A5SA 4RPOA 2ZMBA 3IR1A 4PCDA 4X1DA 1I6BA 3RTFB 3W15C 3F11A 4KR5A 1NV7A 2PYYA 3TPAA 4ZECA 3LSXA 4P0IA 4ZS9A 4THIA 4MHFA 3VE1B 4NF6A 4OANA 1Y3PA 4IO6A 3B6QA 1IMEA 1UQWA 3TYHA 4R74A 3PPRA 3HHGA 3QUFA 4LONB 1S7YA 1A54A 3TCHA 1B3LA 1FTJA 4GIZA 1QULA 1B58A 1LBVA 3U92A 4PFRA 4FBPA 1US5A 1FTAA 1NUXA 2RC8A 4MBPA 4NF4A 3O9PA 4Q0CA 2D5WA 2VP1A 1CB6A 3MWBA 3ZKKA 4BDMA 3TQLA 4QFPA 1JVYA 3BFUA 1MM7A 2OCUA 4FEBA 3EHUA 5CMMA 4DZ1A 4KXPA 3CSGA 5EYGA 1URSA 3T9UA 1MXYA 3IB2A 1N04A 5I57A 1B7ZA 3M3LA 5CM6A 4NF0A 3MW0A 5ICQA 3ONMA 2V3QA 1B0HA 3Q25A 4GL0A 1B1HA 4EQ7A 3V8XB 3EHSA 3T1BA 1SW2A 1NFTA 3TTKA 3HFUA 4F3BA 4ESWA 4F18A 3MP1A 4I1DA 4LUBA 2Z8EA 1QUKA 3VDFA 3KJTA 3O66A 1NMUA 3VXCA 3C31A 3CHGA 1HSEA 3HPIA 1H43A 4MFIA 5T3JA 2O68A 1P1UA 4MLVA 4GVOA 4ZEFA 5AA2A 5H8FA 4OVQA 2WYPA 2VOZA 2UVGA 2OLBA 2XHDA 2HZKA 3HSTA 3H6VA 1GR2A 1O64A 4FEDA 2DXRA 3IB1A 3TKDA 1YPNA 1POTA 3TCFA 4FORA 3K00A 2ZYKA 4M4GA 1VSOA 5DVJA 5CRYA 4F2QA 5AA1A 4QFLA 2H25A 3A29A 4NF5A 4F3PA 4MH5A 2RC9A 3DELB 4HE1A 4R2FA 2FBPA 2H99A 4NX1A 3ILUB 3IOTA 3RPLB 2Y5KA 4AS4A 3IJXB 4OTEA 2CEXA 2HFBA 2GRVA 1FBDA 4H45A 2AL4A 2GHAA 3LC8A 4N4UA 1IMAA 3TUSA 3HN0A 1SDXA 4P8BA 2F6PA 1YXIA 5KCJA 2PFYA 3FASA 3UN6A 4H1XA 3G3KA 3OXNA 2NUVA 2I3WA 4FE8A 4H65A 1URDA 1ELJA 1R1NA 5L9OA 4ELQA 3S9EA 2X26A 4GBVA 2CEYA 1MY0A 5H8HA 1DCUA 1D3KA 5EHMA 3RYDA 3VLUA 3PV0E 4IO7A 1SW5A 4DXCA 1H76A 4Z7EA 4FAJA 2I4BA 1ZBMA 2XXPA 4M1VA 3U94A 4RPNA 2X7QA 5I58A 3IAZA 3B6TA 3JZJA 4TLMB 1MQHA 2M8CA 3PGFA 3SKPA 4OVRA 2CMOA 4ZEKA 2DXYA 2WYKA 1D9QA 5H8SA 5IKBA 1TFDA 2I3VA 3LSLA 5CBRA 2XX9A 1ZJLA 2F3BA 4DXUA 3K6XA 4FATA 3TODA 4XXUA 2QMXA 3ISPA 4N13A 3IL1B 5A5XB 2MKZA 4PFUA 3OOAA 3RT6B 4G2ZA 2Y7IA 4LA9A 5IM2A 3ZKLA 1OQHA 4DCYA 3RN8A 4DCXA 1OLAA 1LBXA 2O1LA 3JYRA 4G4PA 2FA7A 4I3EA 4KFQA 1FBCA 4PC9A 1J1NA 3NOHA 1XI6A 3BKIB 2V84A 4GLIA 1Z7ME 1YAEA 3TTLA 3RTWB 3OEMA 2VHAA 4HE0A 2V3UA 1EU8A 4GX3A 4FIMA 5JTYA 1PDAA 3E79A 2QVRA 5IZ3A 2RF1A 3CRBA 4O3BA 2HAVA 4H6DA 1P99A 2ZNUA 1B46A 1A7LA 5EYHA 3PD8A 2VD2A 3O97A 3HV1A 4I8CA 2I0CA 5CMKA 2FIXA 4KCDA 4PFYA 3MC2A 4X8RA 1UIVA 3G3FA 1LAGE 2RKMA 1DBZA 1INPA 1EH3A 2DWIA 2G29A 3H4ZA 4I3YA 5F1QA 4FECA 1AL3A 3VLVA 4LZ5A 3OMBA 2O7IA 4P56A 3EN3A 4PETA 3GZGA 5ITPA 4C0RA 4LZ8A 5B7DA 1FBGA 1ZKBA 4PAKA 2QL3A 4NAPA 1NV1A 4IGRA 1ATGA 4G68B 4H5GA 1FJ9A 3IFCA 1FJ6A 3BFTA 4OFJA 5DEXA 1RDZA 2ZZWA 4NGUA 4GWUA 2ZYMA 2PCRA 4NHBA 2HPGA 2PMSA 3UGWA 1LAHE 3SESA 3THIA 4AB5A 4F22A 3W9VA 3B8BA 4QSCA 3S4UA 5TPAB 3IJOB 2XA5A 2NOOA 2ONRA 1B4ZA 4I9DA 3CVGA 4PFBA 3H3GA 1LCFA 1NV0A 5KDTB 1M5DA 1IMCA 2YLNA 4MNCA 1N7WA 2Q9TA 5H8NB 4IY5A 3G3IA 1G0IA 2L5VA 4YKKA 2NXOA 2DYXA 3BIGA 1ZTYA 3R6UA 4I40A 3VV5A 2DE4A 1EYIA 3CG3A 3N6UA 3UP9A 2Z23A 1DPPA 3PMVA 1SW1A 3CR9A 3FIRA 1F9BA 2ZYOA 2V25A 1O63A 4PDDA 1CNQA 5AA4A 4QHQA 1GGGA 4OVSA 1UTHA 4Q8RA 1WDNA 3JV9A 4H8IA 4BLAA 4WEDA 2REJA 4YU0A 1LB8A 1B5HA 1WVJA 4LZ7A 2F7CA 4O8MA 4EXKA 4JSOA 4L17A 4QFNA 2LAOA 1MXXA 4QBAA 1IMDA 3FXUA 1IXIA 3Q27A 4PTKA 3S2VA 1FBFA 3KSJA 4EXLA 5FTHA 1I6AA 2WX9A 2IEEA 5LDZA 4YAHX 4MF3A 1SYHA 1L5TA 3K01A 1XT8A 1Q35A 3MP8A 1HSJA 3H06B 4XKQA 1EZPA 2PT1A 5BUUA 4N6PA 1TXFA 5ITOA 2FVZA 4HCWA 3O6GA 3I6VA 4GXSB 4R9GA 2DSFA 3RUMA 3K1NA 3V83A 2DS9A 3PUWE 3A3UA 4LATA 3IK6B 2ZNTA 5LOMA 3GXAA 4ELOA 4ISUA 1FPIA 3LR1A 3TELA 3EQ1A 3K1MA 3FJ7A 4GWWA 2FNCA 1NV6A 5ESYA 5HBCA 2O69A 2B65A 3G3HA 4UA8A 1OMPA 1A99A 2CZIA 1CE2A 2XXRA 3WAFA 1H3DA 4YB6A 2XXVA 1EZ9A 4NF8A 2UVHA 2V93A 5I2KA 2XX7A 1I69A 3RY3A 1B05A 2XWIA 4MAGA 4OVPA 5DVFA 4PP0A 1JW1A 1H44A 5I2NB 5I56A 1NV3A 2QS4A 4KQPA 4NN3A 2Q88A 3A09A 4FJPA 1MRPA 1PBPA 4OMBA 3LSFB 1D4NA 1B7HA 3CG1A 2O51A 2QSXA 4WKMA 3E13X 4N8YA 5H8QA 2ABHA 3LUZA 4N15A 4G61A 5TU0A 4C1UA 5CMCA 3FATA 3MVWA 4OFLA 1MXWA 1KA0A 3DP4A 2O6AA 1AWBA 1RYXA 3FJMA 1ZMGA 4PAIA 4DI4B 3T96B 2F7BA 1FPBA 3V89B 3RT8A 2BJJX 4DIGA 4X04A 4ZEBA 4U23A 5JTYB 2DE3A 3TCGA 1FSAA 3CSBA 5I59B 4PE5B 1FQCA 1RKMA 4LQ2A 2D21A 5IAIA 4GBWA 4JVIA 3G3JA 1QKAA 4OVJA 1MXZA 5IZZA 3MZ9A 1SQYA 1USYE 2Q2AA 2OBGA 3C32A 4KCCA 3I5OA 2F78A 4ONYA 1R9QA 4N81A 3PPQA 3V5AA 4HXVA 1MPBA 3QSLA 3T93B 3IOWA 1IMFA 3PPOA 5AA2D 4YKJA 4QRZA 1K9ZA 2ESNA 4HW8A 4UACA 4OXVA 3RQTA 1UTBA 2CZHA 4UABA 3ZS6A 3USDA 3R7XA 1KZ8A 1MG1A 1FPGA 3Q29A 1ZLQA 4KPTA 4F39A 3RPWA 4ZE9A 3N5LA 1OVBA 3SDFA 3LV0A 1IEJA 4YMBA 4R75A 3SEUA 1IXGA 1MQIA 4XIGQ 1FQDA 2QS2A 3PD9A 1LBBA 3GBBA 1GTKA 2AIXA 1R6ZA 1TWYA 3P7IA 5EQ7A 4BDLA 2HZLA 3FXRA 3I3VA 1PC3A 4OEUA 1POY1 3TAJA 3UORA 2P3VA 4PBHA 4ZZEA 2A5TB 4H8JA 2RC7A 2B4LA 4JBZA 3BIHA 4OEVA 1P1WA 1Y1MA 2OX3A 2QVVA 3OD7A 2E1SA 2FHYA 4NWCA 1XOCA 1QJMA 1Y1ZA 2Z8DA 4GX6A 2I6EA 1VFEA 1MXVA 4OFOA 1Z7NE 1VE4A 3C36A 3SEXA 5TP9B 3TEPA 4OERA 1NV4A 1VR5A 3PU5A 4BDRA 3K2DA 1ZU0A 4U4XA 3FV1A 3VLWA 1IMBA 4U22A 1MQDA 1SI0A 1NNKA 5AA4B 1B4HA 4RJZA 1IUDA 1FQEA 2B4MA 4XEQA 3LUYA 4PF6A 3MAMA 1LGBC 1JEVA 4G68C 1FRPA 1D9VA 4F29A 2CZKA 4QFKA 1FPEA 1FTOA 3ECRA 4MIJA 2PT2A 4OHNA 5M2VA 3U1OA 4F19A 2HQ0A 1M5CA 1N76A 3IOUA 1Y4CA 3MZBA 4DXBA 5EQAA 4BDQA 1JVXA
chains in the Genus database with same CATH topology
3EPEA 1GVCA 2QS3A 4NEDA 3K6UA 4X9TA 3OSRA 4ZZAA 1KWHA 2E0SA 2F7AA 5FHOA 4EQBA 4F1VA 4KYDA 4EF2A 3CFZA 1FQBA 1O7TA 1PB8A 4F31B 2P1SA 3CFLA 3QUJA 3UIFA 4YB7A 2XXXA 5AA3A 4Q5TA 4HS7A 4TLLB 2DWHA 2OK2A 3TFLA 3PPPA 3T66A 3L6GA 3PPNA 3FVKA 4EF1A 1MY3A 3O6IA 1TFAA 1UIUA 1B3GA 3T9HB 1LBCA 3Q26A 4NF6B 2IA4A 1FQFA 5DVIA 3RLFE 4OETA 2DVZA 3OSQA 5H8QB 4YICA 5BWJA 4U21A 3E9XA 1AOVA 3KZGA 1A40A 2O7UA 4LQ5A 1MS7A 1B52A 1US4A 2ANJA 4NF4B 2Z8FA 4BDOA 2QJEA 1MPCA 1FQAA 1MQJA 3C4MA 2QS1A 4WXJA 2XX8A 2I49A 1QUJA 2CZLA 2XXUA 5I57B 1JW4A 1TT1A 1B2HA 2XXYA 3DP6A 3K6WA 2REGA 1OLCA 2H9BA 1NNTA 1XVXA 3FV2A 4OENA 2Y7PA 2AYSA 4H5FA 3KJ7A 1A8EA 5JK4A 3HO7A 4ND9A 3B7DA 1XS5A 5ELVA 2NWJA 3QXMA 4DDDA 4KD5A 4POXA 4X48A 3T9XB 2I58A 1SBPA 2VD3A 5K2YA 2DWJA 4IB2A 1LAXA 1JQFA 4XKNA 2I48A 3G7WA 4TOZA 4XKPA 5F7VA 3DLNA 5FTIA 1N84A 5AA2B 5H8FB 1QW0A 3UA8A 1Y9UA 4KI0E 3M3FA 1DPEA 1MY2A 3TZAA 2G93A 2XXQA 2ONSA 4IGTA 3U72A 2OZZA 2HEUA 1IIWA 1PBQA 1SI1A 4GQOA 4R2BA 4U4SA 1A8FA 1MPDA 4IO3A 3S9MC 1ZIUA 4NF5B 1DTZA 1BKAA 1DSNA 3VVEA 2AL5A 4G8MA 1FW0A 3PUVE 3C35A 4GL8A 4RYAA 2RCBA 3IB0A 1M5FA 4F3GA 3VXBA 1HSLA 4MLQA 5A5XA 5KCJB 2XD2A 2P2AA 3MVYA 1D9YA 1IZ1A 4RA1A 1NL5A 3K0VA 4JWXA 2F6GA 4ZDMA 4RK9A 3RNNA 5H8HB 3M8UA 3D4GA 1Y20A 3IX1A 4NMYA 3QIMA 1BTJA 3KN8A 1IXHA 3OO6A 5I58B 4LP2B 2THIA 3EF7A 1MY4A 2Y7KA 4AB6A 2GFEA 3UK4A 1LLSA 4U1OA 3MQ9A 2GH9A 1XHYA 3LBSA 5L9MA 3N26A 3LSWA 4OESA 2VGQA 3H03A 3H6TA 1M5EA 1H45A 2HXWA 3SEVA 2Y7WA 1WODA 3MZ1A 2H5YA 2ZYNA 3KOTA 1B9JA 4JSDA 2W7YA 2O1MA 2OWSA 2Q89A 3K4UA 3KOSA 2XD3A 2QRYA 1NNPA 4IY6A 3FGSA 4H0WA 1PEBA 1MDQA 5K2XA 2Y7RA 4PFWA 4F1UA 3IO6A 2UVJA 5KZTA 3B6WA 4G68A 1S50A 2HCAA 3R26A 4GRKA 1URGA 3FVOA 5CMBA 4GXAA 4DLDA 3MVXA 3PUXE 2PVUA 5TPAA 4RXLA 2F8DA 4DE8A 1II5A 2I4CA 2F97A 3QK6A 3AXFA 5KDTA 4F3SA 1B6HA 3G3GA 4K3FA 4N07A 1SYIA 5H8NA 1MH4A 1B32A 2X7PA 1M5BA 4R72A 1B5JA 3KG2A 1B0LA 1N0TA 1Q1KA 4Z0IA 1B51A 4BDNA 3H6WA 1JW5A 2B3FA 2R9JA 4H67A 3GLBA 5DEXB 1Y4TA 2Y84A 1JNFA 1MXUA 4RNSA 1B40A 1Y3QA 3T9VA 3FVNA 2B3BA 3SEWA 1FCKA 1B3FA 5DYHA 3FXQA 1BIYA 2ONKE 2V3TA 4Q30B 4GFRA 3SETA 1NNFA 2XXHA 2QPQA 4QF9A 1NH7A 2ALUA 5FHNA 3IORA 5J1DA 4U2RA 1B1XA 4ZEDA 3M3KA 1B3HA 4ELRA 2OJTA 3C34A 2GHBA 3K1PA 1B5IA 1VFDA 1MQGA 4E0WA 4NWDA 1FTMA 3KGCA 4KHZE 2HAUA 5L8DA 3K6VA 2ZXTA 3FD3A 5HM4B 4O3AA 1UTHB 3BBRA 3KN3A 3H6UA 2R6GE 4U1ZA 4AQ4A 3OO9A 3W9WA 3Q28A 3ZSFA 1LFGA 3KEIA 5ICTA 4R73A 5CBSA 1QUIA 3CFXA 3HCQA 4TQUQ 3IO4A 3TMGA 4PQJA 4E0XA 3C33A 4P0GA 3T22A 4OWDA 3TQWA 1A55A 1N3WA 1OQGA 1AMFA 2Q2CA 1YTVA 1I6QA 1USYH 3QAXA 5L9SA 4O3CA 3U8QA 1AH5A 2QMWA 4OZ9A 1P1NA 3FZVA 3TDJA 3OENA 2XXIA 3TTMA 5I2NA 5EYFA 3FUZA 4QSDA 1DTGA 3C9HA 2OWTA 4YMAA 4GWOA 2YJPA 2H98A 3TTNA 4ECFA 3KN7A 4EQ9A 1B3EA 3GBAA 3OELA 4YKIA 4P11A 5JEIA 1LB9A 1GV8A 1DOTA 5ISUA 4F2OA 1JEUA 4NF8B 5HPQA 3O28A 5B70A 1LCTA 5I2KB 1OVTA 2UVIA 2I0BA 4IO4A 2PX1A 4R6KA 2P0SA 5I59A 1IITA 5I56B 2UXAA 2H4IA 4ELPA 4RK2A 2FYIA 1LSTA 2RINA 2XXWA 2R71A 4NE4A 3OO8A 1NH8A 1LFHA 3MUQA 4POWA 1MY1A 4GD5A 3FVGA 1XVYA 2YPNA 4X1BA 3SEYA 1ANFA 1SW4A 1N7XA 1S9TA 4YZZA 3E3KA 3N94A 4QFOA 4WEPA 4EUOA 3S9NC 1EZOA 4R6YA 4YB5A 4HTGA 5EHSA 1P1OA 2RCAA 4XKRA 2NVUB 3VFJA 4OYVA 3VVDA 1JETA 4R9FA 5DTBA 4I62A 4IO2A 1Y3NA 2Q8JA 3RGYA 3FJGA 4ZEIA 1MH3A 3IOVA 2DOJA 1IXCA 4GOTA 2UYEA 2DE2A 1N3XA 3OEKA 1SVXB 2A5TA 2ZNSA 4G77A 3TTRA 4JB7A 3ILTB 1QVSA 4F1YA 2O84X 4KYEA 1OIBA 5FHMA 3O6HA 4LVQA 3SERA 4KYSA 1LFIA 1DMBA 3MP6A 4G8HA 4G8NA 1UTBB 1XC1A 4GF8A 3L6HA 1AIVA 2F36A 5TP9A 3DM0A 3KFMA 3MPKA 1FTKA 1QKBA 1FTLA 3CI8A 3D4CA 1PB9A 3EHTA 1RYOA 3PMWA 3DP8A 4RY1A 4PFTA 4JDFA 2DQVA 4EDPA 4ESXA 3MVZA 3KBRA 1BLFA 2XXTA 3S9LC 3KSXA 4XTCQ 3PMXA 2DP8A 4JWYA 2KLFA 4YKPA 2WKYA 1SD3A 3CIJA 1B7UA 3O2AA 4JWOA 1MDP1 3ODBA 4R6HA 2D3IA 5AE4A 3U93A 2PBWA 5CI5A 3MPLA 1BP5A 4NTLA 3N6TA 4QSEA 1P1QA 1YCJA 2F34A 4OQOA 1LAFE 4IO5A 1MM6A 2DVCA 3E4RA 4HCYA 2DWAA 3H7MA 4JXIA 3MJNA 3A3CA 3OO7A 1IQ7A 3PUZE 1T0KA 5CC2A 3PUYE 5I84A 3MBPA 3K02A 5DT6A 2UYFA 4ZE8A 1NKXA 3VVFA 3WAEA 3O29A 3QYTA 1PB7A 1R9LA 2F35A 4C1TA 2F5XA 2Z22A 3HHFA 2A5SA 4RPOA 2ZMBA 3IR1A 4X1DA 1I6BA 3RTFB 3W15C 3F11A 4KR5A 2PYYA 3TPAA 4ZECA 3LSXA 4P0IA 4ZS9A 4THIA 3VE1B 4NF6A 1Y3PA 4IO6A 3B6QA 1UQWA 3TYHA 4R74A 3PPRA 3HHGA 3QUFA 4LONB 1S7YA 1A54A 3TCHA 1B3LA 1FTJA 4GIZA 1QULA 1B58A 3U92A 1US5A 2RC8A 4MBPA 4NF4A 3O9PA 4Q0CA 2D5WA 2VP1A 1CB6A 3MWBA 3ZKKA 4BDMA 3TQLA 4QFPA 1JVYA 3BFUA 1MM7A 2OCUA 4FEBA 3EHUA 5CMMA 4DZ1A 3CSGA 1URSA 3T9UA 1MXYA 3IB2A 1N04A 5I57A 1B7ZA 3M3LA 5CM6A 3MW0A 5ICQA 2V3QA 3ONMA 1B0HA 3Q25A 4GL0A 1B1HA 4EQ7A 3V8XB 3EHSA 1SW2A 1NFTA 3TTKA 4F3BA 4ESWA 4F18A 3MP1A 4I1DA 4LUBA 2Z8EA 1QUKA 3VDFA 3KJTA 3O66A 1NMUA 3VXCA 3C31A 1HSEA 3HPIA 1H43A 4MFIA 2O68A 1P1UA 4MLVA 4GVOA 4ZEFA 5AA2A 5H8FA 2VOZA 2UVGA 2OLBA 2XHDA 2HZKA 3HSTA 3H6VA 1GR2A 1O64A 4FEDA 2DXRA 3IB1A 3TKDA 1YPNA 1POTA 3TCFA 4FORA 3K00A 2ZYKA 4M4GA 1VSOA 5DVJA 5CRYA 4F2QA 5AA1A 4QFLA 2H25A 4NF5A 4F3PA 4MH5A 2RC9A 3DELB 4R2FA 2H99A 3ILUB 3IOTA 3IJXB 4OTEA 2HFBA 2GRVA 2AL4A 2GHAA 3LC8A 3TUSA 3HN0A 1SDXA 2F6PA 5KCJA 3FASA 3UN6A 4H1XA 3G3KA 3OXNA 2NUVA 2I3WA 4FE8A 4H65A 1URDA 1ELJA 1R1NA 5L9OA 4ELQA 3S9EA 2X26A 1MY0A 5H8HA 1D3KA 5EHMA 3VLUA 3PV0E 4IO7A 1SW5A 4DXCA 1H76A 4Z7EA 4FAJA 2I4BA 1ZBMA 2XXPA 4M1VA 3U94A 4RPNA 2X7QA 5I58A 3IAZA 3B6TA 3JZJA 4TLMB 1MQHA 2M8CA 3PGFA 3SKPA 2CMOA 4ZEKA 2DXYA 5H8SA 5IKBA 1TFDA 2I3VA 3LSLA 5CBRA 2XX9A 1ZJLA 4DXUA 3K6XA 4FATA 3TODA 4XXUA 2QMXA 4N13A 3IL1B 5A5XB 4PFUA 3OOAA 3RT6B 4G2ZA 2Y7IA 4LA9A 3ZKLA 1OQHA 4DCYA 3RN8A 4DCXA 1OLAA 3JYRA 2O1LA 4G4PA 2FA7A 4KFQA 1J1NA 3BKIB 2V84A 4GLIA 1Z7ME 1YAEA 3TTLA 3RTWB 3OEMA 2VHAA 2V3UA 1EU8A 4FIMA 5JTYA 1PDAA 2RF1A 3CRBA 4O3BA 2HAVA 4H6DA 1P99A 2ZNUA 1B46A 1A7LA 3PD8A 2VD2A 3O97A 3HV1A 4I8CA 2I0CA 5CMKA 4KCDA 4PFYA 3MC2A 1UIVA 3G3FA 1LAGE 2RKMA 2G29A 1EH3A 3H4ZA 2DWIA 5F1QA 4FECA 1AL3A 3VLVA 4LZ5A 3OMBA 2O7IA 3EN3A 4PETA 3GZGA 5ITPA 4C0RA 4LZ8A 5B7DA 1ZKBA 2QL3A 4IGRA 1ATGA 4G68B 4H5GA 3BFTA 4OFJA 5DEXA 2ZYMA 2PMSA 3UGWA 1LAHE 3SESA 3THIA 4AB5A 4F22A 3W9VA 4QSCA 3S4UA 5TPAB 3IJOB 2NOOA 2ONRA 1B4ZA 4I9DA 3CVGA 3H3GA 1LCFA 5KDTB 1M5DA 2YLNA 1N7WA 2Q9TA 5H8NB 4IY5A 3G3IA 4YKKA 2NXOA 2DYXA 1ZTYA 3R6UA 3VV5A 2DE4A 3CG3A 3N6UA 3UP9A 2Z23A 1DPPA 3PMVA 1SW1A 3CR9A 3FIRA 1F9BA 2ZYOA 2V25A 1O63A 5AA4A 4QHQA 1GGGA 1UTHA 4Q8RA 1WDNA 3JV9A 4H8IA 4BLAA 4WEDA 2REJA 4YU0A 1LB8A 1B5HA 1WVJA 4LZ7A 2F7CA 4EXKA 4JSOA 4L17A 4QFNA 2LAOA 1MXXA 3FXUA 1IXIA 3Q27A 3S2VA 3KSJA 4EXLA 5FTHA 1I6AA 2IEEA 4YAHX 4MF3A 1SYHA 1L5TA 3K01A 1XT8A 1Q35A 3MP8A 1HSJA 3H06B 4XKQA 1EZPA 2PT1A 5BUUA 4N6PA 1TXFA 5ITOA 4HCWA 3O6GA 3I6VA 4GXSB 4R9GA 2DSFA 3RUMA 3K1NA 3V83A 2DS9A 3PUWE 3A3UA 4LATA 3IK6B 2ZNTA 5LOMA 3GXAA 4ELOA 4ISUA 3LR1A 3TELA 3EQ1A 3K1MA 3FJ7A 2FNCA 5HBCA 2O69A 2B65A 3G3HA 4UA8A 1OMPA 1A99A 1CE2A 2XXRA 3WAFA 1H3DA 4YB6A 2XXVA 1EZ9A 4NF8A 2UVHA 2V93A 5I2KA 2XX7A 1I69A 3RY3A 1B05A 5DVFA 4PP0A 1JW1A 1H44A 5I2NB 5I56A 2QS4A 4KQPA 2Q88A 3A09A 4FJPA 1MRPA 1PBPA 4OMBA 3LSFB 1D4NA 1B7HA 3CG1A 2O51A 2QSXA 3E13X 4WKMA 5H8QA 2ABHA 5TU0A 4C1UA 5CMCA 3FATA 3MVWA 4OFLA 1MXWA 3DP4A 2O6AA 1RYXA 3FJMA 1ZMGA 3T96B 2F7BA 3V89B 3RT8A 2BJJX 4DIGA 4ZEBA 4U23A 5JTYB 2DE3A 3TCGA 3CSBA 5I59B 4PE5B 1FQCA 1RKMA 4LQ2A 2D21A 5IAIA 3G3JA 1QKAA 4OVJA 1MXZA 3MZ9A 1SQYA 1USYE 2Q2AA 2OBGA 3C32A 4KCCA 3I5OA 2F78A 4ONYA 1R9QA 3PPQA 3V5AA 1MPBA 3QSLA 3T93B 3IOWA 3PPOA 5AA2D 4YKJA 4QRZA 2ESNA 4HW8A 4UACA 4OXVA 3RQTA 1UTBA 3ZS6A 3USDA 3R7XA 1MG1A 3Q29A 1ZLQA 4KPTA 4F39A 3RPWA 4ZE9A 3N5LA 1OVBA 3SDFA 1IEJA 4YMBA 4R75A 3SEUA 1IXGA 1MQIA 4XIGQ 1FQDA 2QS2A 3PD9A 1LBBA 3GBBA 1GTKA 2AIXA 1R6ZA 1TWYA 3P7IA 4BDLA 2HZLA 3FXRA 3I3VA 1PC3A 4OEUA 1POY1 3TAJA 3UORA 4ZZEA 2A5TB 4H8JA 2RC7A 4JBZA 4OEVA 1P1WA 1Y1MA 3OD7A 2E1SA 4NWCA 1XOCA 1QJMA 1Y1ZA 2Z8DA 2I6EA 1VFEA 1MXVA 4OFOA 1Z7NE 1VE4A 3C36A 3SEXA 5TP9B 3TEPA 4OERA 1VR5A 3PU5A 4BDRA 3K2DA 1ZU0A 3VLWA 3FV1A 4U4XA 1MQDA 4U22A 1SI0A 1NNKA 5AA4B 1B4HA 4RJZA 1IUDA 1FQEA 3LUYA 3MAMA 1LGBC 1JEVA 4G68C 1D9VA 4F29A 4QFKA 1FTOA 3ECRA 2PT2A 4OHNA 5M2VA 3U1OA 4F19A 2HQ0A 1M5CA 1N76A 3IOUA 1Y4CA 3MZBA 4DXBA 4BDQA 1JVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPE A;  1GVC A;  2QS3 A;  4NED A;  3K6U A;  4X9T A;  3OSR A;  4ZZA A;  1KWH A;  2E0S A;  2F7A A;  5FHO A;  4EQB A;  4F1V A;  4KYD A;  4EF2 A;  3CFZ A;  1FQB A;  1O7T A;  1PB8 A;  4F31 B;  2P1S A;  3CFL A;  3QUJ A;  3UIF A;  4YB7 A;  2XXX A;  5AA3 A;  4Q5T A;  4HS7 A;  4TLL B;  2DWH A;  2OK2 A;  3TFL A;  3PPP A;  3T66 A;  3L6G A;  3PPN A;  3FVK A;  4EF1 A;  1MY3 A;  3O6I A;  1TFA A;  1UIU A;  1B3G A;  3T9H B;  1LBC A;  3Q26 A;  4NF6 B;  2IA4 A;  1FQF A;  5DVI A;  3RLF E;  4OET A;  2DVZ A;  3OSQ A;  5H8Q B;  4YIC A;  5BWJ A;  4U21 A;  3E9X A;  1AOV A;  3KZG A;  1A40 A;  2O7U A;  4LQ5 A;  1MS7 A;  1B52 A;  1US4 A;  2ANJ A;  4NF4 B;  2Z8F A;  4BDO A;  2QJE A;  1MPC A;  1FQA A;  1MQJ A;  3C4M A;  2QS1 A;  4WXJ A;  2XX8 A;  2I49 A;  1QUJ A;  2CZL A;  2XXU A;  5I57 B;  1JW4 A;  1TT1 A;  1B2H A;  2XXY A;  3DP6 A;  3K6W A;  2REG A;  1OLC A;  2H9B A;  1NNT A;  1XVX A;  3FV2 A;  4OEN A;  2Y7P A;  2AYS A;  4H5F A;  3KJ7 A;  1A8E A;  5JK4 A;  3HO7 A;  4ND9 A;  3B7D A;  1XS5 A;  5ELV A;  2NWJ A;  3QXM A;  4DDD A;  4KD5 A;  4POX A;  4X48 A;  3T9X B;  2I58 A;  1SBP A;  2VD3 A;  5K2Y A;  2DWJ A;  4IB2 A;  1LAX A;  1JQF A;  4XKN A;  2I48 A;  3G7W A;  4TOZ A;  4XKP A;  5F7V A;  3DLN A;  5FTI A;  1N84 A;  5AA2 B;  5H8F B;  1QW0 A;  3UA8 A;  1Y9U A;  4KI0 E;  3M3F A;  1DPE A;  1MY2 A;  3TZA A;  2G93 A;  2XXQ A;  2ONS A;  4IGT A;  3U72 A;  2OZZ A;  2HEU A;  1IIW A;  1PBQ A;  1SI1 A;  4GQO A;  4R2B A;  4U4S A;  1A8F A;  1MPD A;  4IO3 A;  3S9M C;  1ZIU A;  4NF5 B;  1DTZ A;  1BKA A;  1DSN A;  3VVE A;  2AL5 A;  4G8M A;  1FW0 A;  3PUV E;  3C35 A;  4GL8 A;  4RYA A;  2RCB A;  3IB0 A;  1M5F A;  4F3G A;  3VXB A;  1HSL A;  4MLQ A;  5A5X A;  5KCJ B;  2XD2 A;  2P2A A;  3MVY A;  1D9Y A;  1IZ1 A;  4RA1 A;  1NL5 A;  3K0V A;  4JWX A;  2F6G A;  4ZDM A;  4RK9 A;  3RNN A;  5H8H B;  3M8U A;  3D4G A;  1Y20 A;  3IX1 A;  4NMY A;  3QIM A;  1BTJ A;  3KN8 A;  1IXH A;  3OO6 A;  5I58 B;  4LP2 B;  2THI A;  3EF7 A;  1MY4 A;  2Y7K A;  4AB6 A;  2GFE A;  3UK4 A;  1LLS A;  4U1O A;  3MQ9 A;  2GH9 A;  1XHY A;  3LBS A;  5L9M A;  3N26 A;  3LSW A;  4OES A;  2VGQ A;  3H03 A;  3H6T A;  1M5E A;  1H45 A;  2HXW A;  3SEV A;  2Y7W A;  1WOD A;  3MZ1 A;  2H5Y A;  2ZYN A;  3KOT A;  1B9J A;  4JSD A;  2W7Y A;  2O1M A;  2OWS A;  2Q89 A;  3K4U A;  3KOS A;  2XD3 A;  2QRY A;  1NNP A;  4IY6 A;  3FGS A;  4H0W A;  1PEB A;  1MDQ A;  5K2X A;  2Y7R A;  4PFW A;  4F1U A;  3IO6 A;  2UVJ A;  5KZT A;  3B6W A;  4G68 A;  1S50 A;  2HCA A;  3R26 A;  4GRK A;  1URG A;  3FVO A;  5CMB A;  4GXA A;  4DLD A;  3MVX A;  3PUX E;  2PVU A;  5TPA A;  4RXL A;  2F8D A;  4DE8 A;  1II5 A;  2I4C A;  2F97 A;  3QK6 A;  3AXF A;  5KDT A;  4F3S A;  1B6H A;  3G3G A;  4K3F A;  4N07 A;  1SYI A;  5H8N A;  1MH4 A;  1B32 A;  2X7P A;  1M5B A;  4R72 A;  1B5J A;  3KG2 A;  1B0L A;  1N0T A;  1Q1K A;  4Z0I A;  1B51 A;  4BDN A;  3H6W A;  1JW5 A;  2B3F A;  2R9J A;  4H67 A;  3GLB A;  5DEX B;  1Y4T A;  2Y84 A;  1JNF A;  1MXU A;  4RNS A;  1B40 A;  1Y3Q A;  3T9V A;  3FVN A;  2B3B A;  3SEW A;  1FCK A;  1B3F A;  5DYH A;  3FXQ A;  1BIY A;  2ONK E;  2V3T A;  4Q30 B;  4GFR A;  3SET A;  1NNF A;  2XXH A;  2QPQ A;  4QF9 A;  1NH7 A;  2ALU A;  5FHN A;  3IOR A;  5J1D A;  4U2R A;  1B1X A;  4ZED A;  3M3K A;  1B3H A;  4ELR A;  2OJT A;  3C34 A;  2GHB A;  3K1P A;  1B5I A;  1VFD A;  1MQG A;  4E0W A;  4NWD A;  1FTM A;  3KGC A;  4KHZ E;  2HAU A;  5L8D A;  3K6V A;  2ZXT A;  3FD3 A;  5HM4 B;  4O3A A;  1UTH B;  3BBR A;  3KN3 A;  3H6U A;  2R6G E;  4U1Z A;  4AQ4 A;  3OO9 A;  3W9W A;  3Q28 A;  3ZSF A;  1LFG A;  3KEI A;  5ICT A;  4R73 A;  5CBS A;  1QUI A;  3CFX A;  3HCQ A;  4TQU Q;  3IO4 A;  3TMG A;  4PQJ A;  4E0X A;  3C33 A;  4P0G A;  3T22 A;  4OWD A;  3TQW A;  1A55 A;  1N3W A;  1OQG A;  1AMF A;  2Q2C A;  1YTV A;  1I6Q A;  1USY H;  3QAX A;  5L9S A;  4O3C A;  3U8Q A;  1AH5 A;  2QMW A;  4OZ9 A;  1P1N A;  3FZV A;  3TDJ A;  3OEN A;  2XXI A;  3TTM A;  5I2N A;  5EYF A;  3FUZ A;  4QSD A;  1DTG A;  3C9H A;  2OWT A;  4YMA A;  4GWO A;  2YJP A;  2H98 A;  3TTN A;  4ECF A;  3KN7 A;  4EQ9 A;  1B3E A;  3GBA A;  3OEL A;  4YKI A;  4P11 A;  5JEI A;  1LB9 A;  1GV8 A;  1DOT A;  5ISU A;  4F2O A;  1JEU A;  4NF8 B;  5HPQ A;  3O28 A;  5B70 A;  1LCT A;  5I2K B;  1OVT A;  2UVI A;  2I0B A;  4IO4 A;  2PX1 A;  4R6K A;  2P0S A;  5I59 A;  1IIT A;  5I56 B;  2UXA A;  2H4I A;  4ELP A;  4RK2 A;  2FYI A;  1LST A;  2RIN A;  2XXW A;  2R71 A;  4NE4 A;  3OO8 A;  1NH8 A;  1LFH A;  3MUQ A;  4POW A;  1MY1 A;  4GD5 A;  3FVG A;  1XVY A;  2YPN A;  4X1B A;  3SEY A;  1ANF A;  1SW4 A;  1N7X A;  1S9T A;  4YZZ A;  3E3K A;  3N94 A;  4QFO A;  4WEP A;  4EUO A;  3S9N C;  1EZO A;  4R6Y A;  4YB5 A;  4HTG A;  5EHS A;  1P1O A;  2RCA A;  4XKR A;  2NVU B;  3VFJ A;  4OYV A;  3VVD A;  1JET A;  4R9F A;  5DTB A;  4I62 A;  4IO2 A;  1Y3N A;  2Q8J A;  3RGY A;  3FJG A;  4ZEI A;  1MH3 A;  3IOV A;  2DOJ A;  1IXC A;  4GOT A;  2UYE A;  2DE2 A;  1N3X A;  3OEK A;  1SVX B;  2A5T A;  2ZNS A;  4G77 A;  3TTR A;  4JB7 A;  3ILT B;  1QVS A;  4F1Y A;  2O84 X;  4KYE A;  1OIB A;  5FHM A;  3O6H A;  4LVQ A;  3SER A;  4KYS A;  1LFI A;  1DMB A;  3MP6 A;  4G8H A;  4G8N A;  1UTB B;  1XC1 A;  4GF8 A;  3L6H A;  1AIV A;  2F36 A;  5TP9 A;  3DM0 A;  3KFM A;  3MPK A;  1FTK A;  1QKB A;  1FTL A;  3CI8 A;  3D4C A;  1PB9 A;  3EHT A;  1RYO A;  3PMW A;  3DP8 A;  4RY1 A;  4PFT A;  4JDF A;  2DQV A;  4EDP A;  4ESX A;  3MVZ A;  3KBR A;  1BLF A;  2XXT A;  3S9L C;  3KSX A;  4XTC Q;  3PMX A;  2DP8 A;  4JWY A;  2KLF A;  4YKP A;  2WKY A;  1SD3 A;  3CIJ A;  1B7U A;  3O2A A;  4JWO A;  1MDP 1;  3ODB A;  4R6H A;  2D3I A;  5AE4 A;  3U93 A;  2PBW A;  5CI5 A;  3MPL A;  1BP5 A;  4NTL A;  3N6T A;  4QSE A;  1P1Q A;  1YCJ A;  2F34 A;  4OQO A;  1LAF E;  4IO5 A;  1MM6 A;  2DVC A;  3E4R A;  4HCY A;  2DWA A;  3H7M A;  4JXI A;  3MJN A;  3A3C A;  3OO7 A;  1IQ7 A;  3PUZ E;  1T0K A;  5CC2 A;  3PUY E;  5I84 A;  3MBP A;  3K02 A;  5DT6 A;  2UYF A;  4ZE8 A;  1NKX A;  3VVF A;  3WAE A;  3O29 A;  3QYT A;  1PB7 A;  1R9L A;  2F35 A;  4C1T A;  2F5X A;  2Z22 A;  3HHF A;  2A5S A;  4RPO A;  2ZMB A;  3IR1 A;  4X1D A;  1I6B A;  3RTF B;  3W15 C;  3F11 A;  4KR5 A;  2PYY A;  3TPA A;  4ZEC A;  3LSX A;  4P0I A;  4ZS9 A;  4THI A;  3VE1 B;  4NF6 A;  1Y3P A;  4IO6 A;  3B6Q A;  1UQW A;  3TYH A;  4R74 A;  3PPR A;  3HHG A;  3QUF A;  4LON B;  1S7Y A;  1A54 A;  3TCH A;  1B3L A;  1FTJ A;  4GIZ A;  1QUL A;  1B58 A;  3U92 A;  1US5 A;  2RC8 A;  4MBP A;  4NF4 A;  3O9P A;  4Q0C A;  2D5W A;  2VP1 A;  1CB6 A;  3MWB A;  3ZKK A;  4BDM A;  3TQL A;  4QFP A;  1JVY A;  3BFU A;  1MM7 A;  2OCU A;  4FEB A;  3EHU A;  5CMM A;  4DZ1 A;  3CSG A;  1URS A;  3T9U A;  1MXY A;  3IB2 A;  1N04 A;  5I57 A;  1B7Z A;  3M3L A;  5CM6 A;  3MW0 A;  5ICQ A;  2V3Q A;  3ONM A;  1B0H A;  3Q25 A;  4GL0 A;  1B1H A;  4EQ7 A;  3V8X B;  3EHS A;  1SW2 A;  1NFT A;  3TTK A;  4F3B A;  4ESW A;  4F18 A;  3MP1 A;  4I1D A;  4LUB A;  2Z8E A;  1QUK A;  3VDF A;  3KJT A;  3O66 A;  1NMU A;  3VXC A;  3C31 A;  1HSE A;  3HPI A;  1H43 A;  4MFI A;  2O68 A;  1P1U A;  4MLV A;  4GVO A;  4ZEF A;  5AA2 A;  5H8F A;  2VOZ A;  2UVG A;  2OLB A;  2XHD A;  2HZK A;  3HST A;  3H6V A;  1GR2 A;  1O64 A;  4FED A;  2DXR A;  3IB1 A;  3TKD A;  1YPN A;  1POT A;  3TCF A;  4FOR A;  3K00 A;  2ZYK A;  4M4G A;  1VSO A;  5DVJ A;  5CRY A;  4F2Q A;  5AA1 A;  4QFL A;  2H25 A;  4NF5 A;  4F3P A;  4MH5 A;  2RC9 A;  3DEL B;  4R2F A;  2H99 A;  3ILU B;  3IOT A;  3IJX B;  4OTE A;  2HFB A;  2GRV A;  2AL4 A;  2GHA A;  3LC8 A;  3TUS A;  3HN0 A;  1SDX A;  2F6P A;  5KCJ A;  3FAS A;  3UN6 A;  4H1X A;  3G3K A;  3OXN A;  2NUV A;  2I3W A;  4FE8 A;  4H65 A;  1URD A;  1ELJ A;  1R1N A;  5L9O A;  4ELQ A;  3S9E A;  2X26 A;  1MY0 A;  5H8H A;  1D3K A;  5EHM A;  3VLU A;  3PV0 E;  4IO7 A;  1SW5 A;  4DXC A;  1H76 A;  4Z7E A;  4FAJ A;  2I4B A;  1ZBM A;  2XXP A;  4M1V A;  3U94 A;  4RPN A;  2X7Q A;  5I58 A;  3IAZ A;  3B6T A;  3JZJ A;  4TLM B;  1MQH A;  2M8C A;  3PGF A;  3SKP A;  2CMO A;  4ZEK A;  2DXY A;  5H8S A;  5IKB A;  1TFD A;  2I3V A;  3LSL A;  5CBR A;  2XX9 A;  1ZJL A;  4DXU A;  3K6X A;  4FAT A;  3TOD A;  4XXU A;  2QMX A;  4N13 A;  3IL1 B;  5A5X B;  4PFU A;  3OOA A;  3RT6 B;  4G2Z A;  2Y7I A;  4LA9 A;  3ZKL A;  1OQH A;  4DCY A;  3RN8 A;  4DCX A;  1OLA A;  3JYR A;  2O1L A;  4G4P A;  2FA7 A;  4KFQ A;  1J1N A;  3BKI B;  2V84 A;  4GLI A;  1Z7M E;  1YAE A;  3TTL A;  3RTW B;  3OEM A;  2VHA A;  2V3U A;  1EU8 A;  4FIM A;  5JTY A;  1PDA A;  2RF1 A;  3CRB A;  4O3B A;  2HAV A;  4H6D A;  1P99 A;  2ZNU A;  1B46 A;  1A7L A;  3PD8 A;  2VD2 A;  3O97 A;  3HV1 A;  4I8C A;  2I0C A;  5CMK A;  4KCD A;  4PFY A;  3MC2 A;  1UIV A;  3G3F A;  1LAG E;  2RKM A;  2G29 A;  1EH3 A;  3H4Z A;  2DWI A;  5F1Q A;  4FEC A;  1AL3 A;  3VLV A;  4LZ5 A;  3OMB A;  2O7I A;  3EN3 A;  4PET A;  3GZG A;  5ITP A;  4C0R A;  4LZ8 A;  5B7D A;  1ZKB A;  2QL3 A;  4IGR A;  1ATG A;  4G68 B;  4H5G A;  3BFT A;  4OFJ A;  5DEX A;  2ZYM A;  2PMS A;  3UGW A;  1LAH E;  3SES A;  3THI A;  4AB5 A;  4F22 A;  3W9V A;  4QSC A;  3S4U A;  5TPA B;  3IJO B;  2NOO A;  2ONR A;  1B4Z A;  4I9D A;  3CVG A;  3H3G A;  1LCF A;  5KDT B;  1M5D A;  2YLN A;  1N7W A;  2Q9T A;  5H8N B;  4IY5 A;  3G3I A;  4YKK A;  2NXO A;  2DYX A;  1ZTY A;  3R6U A;  3VV5 A;  2DE4 A;  3CG3 A;  3N6U A;  3UP9 A;  2Z23 A;  1DPP A;  3PMV A;  1SW1 A;  3CR9 A;  3FIR A;  1F9B A;  2ZYO A;  2V25 A;  1O63 A;  5AA4 A;  4QHQ A;  1GGG A;  1UTH A;  4Q8R A;  1WDN A;  3JV9 A;  4H8I A;  4BLA A;  4WED A;  2REJ A;  4YU0 A;  1LB8 A;  1B5H A;  1WVJ A;  4LZ7 A;  2F7C A;  4EXK A;  4JSO A;  4L17 A;  4QFN A;  2LAO A;  1MXX A;  3FXU A;  1IXI A;  3Q27 A;  3S2V A;  3KSJ A;  4EXL A;  5FTH A;  1I6A A;  2IEE A;  4YAH X;  4MF3 A;  1SYH A;  1L5T A;  3K01 A;  1XT8 A;  1Q35 A;  3MP8 A;  1HSJ A;  3H06 B;  4XKQ A;  1EZP A;  2PT1 A;  5BUU A;  4N6P A;  1TXF A;  5ITO A;  4HCW A;  3O6G A;  3I6V A;  4GXS B;  4R9G A;  2DSF A;  3RUM A;  3K1N A;  3V83 A;  2DS9 A;  3PUW E;  3A3U A;  4LAT A;  3IK6 B;  2ZNT A;  5LOM A;  3GXA A;  4ELO A;  4ISU A;  3LR1 A;  3TEL A;  3EQ1 A;  3K1M A;  3FJ7 A;  2FNC A;  5HBC A;  2O69 A;  2B65 A;  3G3H A;  4UA8 A;  1OMP A;  1A99 A;  1CE2 A;  2XXR A;  3WAF A;  1H3D A;  4YB6 A;  2XXV A;  1EZ9 A;  4NF8 A;  2UVH A;  2V93 A;  5I2K A;  2XX7 A;  1I69 A;  3RY3 A;  1B05 A;  5DVF A;  4PP0 A;  1JW1 A;  1H44 A;  5I2N B;  5I56 A;  2QS4 A;  4KQP A;  2Q88 A;  3A09 A;  4FJP A;  1MRP A;  1PBP A;  4OMB A;  3LSF B;  1D4N A;  1B7H A;  3CG1 A;  2O51 A;  2QSX A;  3E13 X;  4WKM A;  5H8Q A;  2ABH A;  5TU0 A;  4C1U A;  5CMC A;  3FAT A;  3MVW A;  4OFL A;  1MXW A;  3DP4 A;  2O6A A;  1RYX A;  3FJM A;  1ZMG A;  3T96 B;  2F7B A;  3V89 B;  3RT8 A;  2BJJ X;  4DIG A;  4ZEB A;  4U23 A;  5JTY B;  2DE3 A;  3TCG A;  3CSB A;  5I59 B;  4PE5 B;  1FQC A;  1RKM A;  4LQ2 A;  2D21 A;  5IAI A;  3G3J A;  1QKA A;  4OVJ A;  1MXZ A;  3MZ9 A;  1SQY A;  1USY E;  2Q2A A;  2OBG A;  3C32 A;  4KCC A;  3I5O A;  2F78 A;  4ONY A;  1R9Q A;  3PPQ A;  3V5A A;  1MPB A;  3QSL A;  3T93 B;  3IOW A;  3PPO A;  5AA2 D;  4YKJ A;  4QRZ A;  2ESN A;  4HW8 A;  4UAC A;  4OXV A;  3RQT A;  1UTB A;  3ZS6 A;  3USD A;  3R7X A;  1MG1 A;  3Q29 A;  1ZLQ A;  4KPT A;  4F39 A;  3RPW A;  4ZE9 A;  3N5L A;  1OVB A;  3SDF A;  1IEJ A;  4YMB A;  4R75 A;  3SEU A;  1IXG A;  1MQI A;  4XIG Q;  1FQD A;  2QS2 A;  3PD9 A;  1LBB A;  3GBB A;  1GTK A;  2AIX A;  1R6Z A;  1TWY A;  3P7I A;  4BDL A;  2HZL A;  3FXR A;  3I3V A;  1PC3 A;  4OEU A;  1POY 1;  3TAJ A;  3UOR A;  4ZZE A;  2A5T B;  4H8J A;  2RC7 A;  4JBZ A;  4OEV A;  1P1W A;  1Y1M A;  3OD7 A;  2E1S A;  4NWC A;  1XOC A;  1QJM A;  1Y1Z A;  2Z8D A;  2I6E A;  1VFE A;  1MXV A;  4OFO A;  1Z7N E;  1VE4 A;  3C36 A;  3SEX A;  5TP9 B;  3TEP A;  4OER A;  1VR5 A;  3PU5 A;  4BDR A;  3K2D A;  1ZU0 A;  3VLW A;  3FV1 A;  4U4X A;  1MQD A;  4U22 A;  1SI0 A;  1NNK A;  5AA4 B;  1B4H A;  4RJZ A;  1IUD A;  1FQE A;  3LUY A;  3MAM A;  1LGB C;  1JEV A;  4G68 C;  1D9V A;  4F29 A;  4QFK A;  1FTO A;  3ECR A;  2PT2 A;  4OHN A;  5M2V A;  3U1O A;  4F19 A;  2HQ0 A;  1M5C A;  1N76 A;  3IOU A;  1Y4C A;  3MZB A;  4DXB A;  4BDQ A;  1JVX A; 
#chains in the Genus database with same CATH topology
 3EPE A;  5ET8 A;  1GVC A;  2QS3 A;  4NED A;  3K6U A;  4X9T A;  3OSR A;  4ZZA A;  1KWH A;  2E0S A;  5ET5 A;  2F7A A;  5FHO A;  4EQB A;  4F1V A;  4KYD A;  4EF2 A;  1BK4 A;  3CFZ A;  4GWY A;  1FQB A;  1O7T A;  1PB8 A;  2P3N A;  4F31 B;  2P1S A;  4O7M A;  3CFL A;  3QUJ A;  3UIF A;  2ZZV A;  4YB7 A;  2XXX A;  5AA3 A;  4Q5T A;  1FPD A;  4HS7 A;  4TLL B;  2DWH A;  2OK2 A;  3TFL A;  3PPP A;  4HE2 A;  3T66 A;  3L6G A;  3PPN A;  3FVK A;  4EF1 A;  1YZ0 A;  1MY3 A;  4P9K A;  3O6I A;  1TFA A;  4AS5 A;  1UIU A;  1B3G A;  3T9H B;  1LBC A;  3Q26 A;  4NF6 B;  2IA4 A;  2KQZ A;  4MJO A;  1FQF A;  4LN5 A;  5DVI A;  3RLF E;  4OET A;  5EQ9 A;  3MST A;  2DVZ A;  3OSQ A;  1NUW A;  5H8Q B;  4YIC A;  5BWJ A;  4U21 A;  3E9X A;  1AOV A;  3KZG A;  4N17 A;  1NUZ A;  1A40 A;  2O7U A;  4LQ5 A;  1MS7 A;  1B52 A;  2HHM A;  1US4 A;  2ANJ A;  4NF4 B;  1Q9D A;  2Z8F A;  4BDO A;  2QJE A;  1MPC A;  1FQA A;  1MQJ A;  3C4M A;  2XWO A;  2QS1 A;  4WXJ A;  2XX8 A;  2I49 A;  1QUJ A;  2CZL A;  2XXU A;  5EQ8 A;  4DI3 D;  5I57 B;  1JW4 A;  1TT1 A;  1B2H A;  1RDX A;  2XXY A;  3DP6 A;  1K9Y A;  3K6W A;  2REG A;  1OLC A;  5I7I A;  2H9B A;  1NNT A;  1XVX A;  3FV2 A;  4OEN A;  2Y7P A;  2AYS A;  4H5F A;  3KJ7 A;  1A8E A;  5JK4 A;  3HO7 A;  4ND9 A;  3B7D A;  1XS5 A;  4PF8 A;  5ELV A;  2NWJ A;  3QXM A;  4DDD A;  4KD5 A;  4POX A;  4X48 A;  1EYK A;  3T9X B;  2I58 A;  1SBP A;  2VD3 A;  5K2Y A;  2DWJ A;  4IB2 A;  1LAX A;  1JQF A;  4XKN A;  2I48 A;  3G7W A;  4TOZ A;  4XKP A;  5F7V A;  3DLN A;  5FTI A;  1N84 A;  2HXR A;  5AA2 B;  5H8F B;  1QW0 A;  3UA8 A;  1Y9U A;  4KI0 E;  3M3F A;  1DPE A;  1MY2 A;  3TZA A;  2G93 A;  2XXQ A;  4O94 A;  4O7I A;  2ONS A;  4IGT A;  4P1L A;  3U72 A;  2OZZ A;  2HEU A;  1IIW A;  1PBQ A;  3U65 A;  1SI1 A;  4GQO A;  4R2B A;  4U4S A;  1A8F A;  1MPD A;  4IO3 A;  5A5L A;  3S9M C;  3ROJ A;  1ZIU A;  4NF5 B;  1QGX A;  1DTZ A;  1BKA A;  1DSN A;  1LBW A;  3VVE A;  2AL5 A;  4G8M A;  4OVT A;  1FW0 A;  3PUV E;  3C35 A;  4GL8 A;  4RYA A;  2RCB A;  3IB0 A;  1M5F A;  4F3G A;  3VXB A;  1HSL A;  4MLQ A;  5A5X A;  5KCJ B;  2XD2 A;  2P2A A;  3MVY A;  1D9Y A;  1IZ1 A;  4RA1 A;  1NL5 A;  3K0V A;  2VT5 A;  4JWX A;  2F6G A;  4ZDM A;  4RK9 A;  3RNN A;  1FBE A;  2WEF A;  5H8H B;  3M8U A;  3D4G A;  1Y20 A;  3IX1 A;  4NMY A;  3QIM A;  2F3D A;  1BTJ A;  2VPO A;  3KN8 A;  3SZP A;  1IXH A;  1NI9 A;  3OO6 A;  5I58 B;  4LP2 B;  2THI A;  3EF7 A;  1MY4 A;  2Y7K A;  4AB6 A;  2GFE A;  1FPF A;  1NV2 A;  3UK4 A;  2KR0 A;  1LLS A;  4U1O A;  3MQ9 A;  2GH9 A;  1XHY A;  3LBS A;  5L9M A;  3N26 A;  3LSW A;  4OES A;  3B50 A;  1NUY A;  3MYU A;  2VGQ A;  3H03 A;  3H6T A;  1M5E A;  1H45 A;  2HXW A;  3SEV A;  2Y7W A;  1WOD A;  3MZ1 A;  4MNI A;  4OA4 A;  2H5Y A;  2ZYN A;  3KOT A;  2Q74 A;  1B9J A;  4P3L A;  4JSD A;  2W7Y A;  2O1M A;  2OWS A;  2Q89 A;  3K4U A;  3KOS A;  2XD3 A;  2QRY A;  1NNP A;  4IY6 A;  3FGS A;  4H0W A;  4NQ8 A;  1PEB A;  1MDQ A;  5K2X A;  2Y7R A;  4PFW A;  4F1U A;  3IO6 A;  2UVJ A;  5KZT A;  4IR8 A;  3B6W A;  4G68 A;  2Q8M A;  1S50 A;  2HCA A;  4P47 A;  1EYJ A;  3R26 A;  5IZ3 B;  4GRK A;  1URG A;  3FVO A;  5CMB A;  4GXA A;  5I3S A;  2R8T A;  4DLD A;  3MVX A;  3PUX E;  4MX6 A;  2PVU A;  5TPA A;  1LBZ A;  4RXL A;  4PGN A;  2F8D A;  4DE8 A;  1II5 A;  2I4C A;  2F97 A;  3QK6 A;  4N6D A;  3AXF A;  5KDT A;  4F3S A;  1B6H A;  3G3G A;  4K3F A;  4N07 A;  1SYI A;  5H8N A;  1MH4 A;  1B32 A;  2X7P A;  1M5B A;  4R72 A;  5ET6 A;  1B5J A;  3KG2 A;  1B0L A;  3FXB A;  1N0T A;  3KC0 A;  1Q1K A;  4Z0I A;  1B51 A;  4BDN A;  3H6W A;  1JW5 A;  4XF5 A;  2B3F A;  2R9J A;  4H67 A;  3GLB A;  5DEX B;  1Y4T A;  2Y84 A;  1JNF A;  1MXU A;  4RNS A;  1B40 A;  1Y3Q A;  2V4C A;  3T9V A;  1RDY A;  3FVN A;  2B3B A;  3SEW A;  1FCK A;  3PTY A;  1B3F A;  5DYH A;  3FXQ A;  1BIY A;  4PE3 A;  2ONK E;  2V3T A;  4Q30 B;  4GFR A;  3SET A;  1NNF A;  2XXH A;  2QPQ A;  4QF9 A;  4GWX A;  1NH7 A;  2ALU A;  5FHN A;  3IOR A;  2WBD A;  5J1D A;  2PFZ A;  4U2R A;  1B1X A;  4ZED A;  3M3K A;  1B3H A;  4ELR A;  2OJT A;  3C34 A;  2XWK A;  2GHB A;  3K1P A;  1B5I A;  1VFD A;  1MQG A;  2JJK A;  4E0W A;  4NWD A;  1FTM A;  3KC1 A;  3KGC A;  4KHZ E;  2DDK A;  2HAU A;  5L8D A;  3K6V A;  5FBP A;  4JVC A;  2ZXT A;  3FD3 A;  4QXD A;  5HM4 B;  4O3A A;  1UTH B;  3BBR A;  4JVD A;  3KN3 A;  1SPI A;  1FBP A;  3H6U A;  2R6G E;  4U1Z A;  4AQ4 A;  3OO9 A;  3W9W A;  3Q28 A;  3ZSF A;  2Y5L A;  4PDH A;  3EKI A;  1LFG A;  3KEI A;  5ICT A;  4H46 A;  4R73 A;  5CBS A;  1QUI A;  3CFX A;  3HCQ A;  4TQU Q;  3IO4 A;  3TMG A;  4PQJ A;  3C33 A;  4P0G A;  4MEV A;  4E0X A;  3T22 A;  4OWD A;  3TQW A;  1A55 A;  1N3W A;  1OQG A;  1AMF A;  2Q2C A;  1YTV A;  1I6Q A;  1USY H;  3QAX A;  5L9S A;  4O3C A;  3U8Q A;  3D1R A;  1AH5 A;  2QVU A;  2QMW A;  4OZ9 A;  4N8G A;  1P1N A;  3FZV A;  3TDJ A;  4GWS A;  3OEN A;  2XXI A;  3TTM A;  5I2N A;  5EYF A;  3FUZ A;  4QSD A;  1DTG A;  2FIE A;  4P1E A;  4GWZ A;  3C9H A;  4N6K A;  2OWT A;  4YMA A;  4GWO A;  2YJP A;  2H98 A;  3TTN A;  5IZ1 A;  4ECF A;  1LEV A;  3KN7 A;  4EQ9 A;  2GQ1 A;  1B3E A;  3GBA A;  3OEL A;  4YKI A;  4P11 A;  1YYZ A;  5JEI A;  1LB9 A;  4PFI A;  1GV8 A;  1DOT A;  5ISU A;  4F2O A;  1JEU A;  1FBH A;  3T0J A;  4NF8 B;  5DW8 A;  5HPQ A;  3O28 A;  5B70 A;  1LCT A;  5I2K B;  1OVT A;  2UVI A;  2I0B A;  5F24 A;  4IO4 A;  2PX1 A;  4R6K A;  1G0H A;  1KA1 A;  2P0S A;  2OWZ A;  5I59 A;  1IIT A;  5I56 B;  2UXA A;  2H4I A;  4PAF A;  4ELP A;  4RK2 A;  2FYI A;  1LST A;  5J16 A;  4PGP A;  2RIN A;  1FPL A;  2XXW A;  2R71 A;  4NE4 A;  3OO8 A;  1NH8 A;  1LFH A;  4NG7 A;  3MUQ A;  4POW A;  1MY1 A;  4GD5 A;  3FVG A;  1XVY A;  1DK4 A;  2YPN A;  1NV5 A;  4X1B A;  3SEY A;  1ANF A;  1SW4 A;  1N7X A;  1S9T A;  4YZZ A;  3E3K A;  3QMF A;  3N94 A;  4MMP A;  4QFO A;  2QFL A;  4WEP A;  4EUO A;  3S9N C;  3IFA A;  1EZO A;  4R6Y A;  4YB5 A;  4HTG A;  5EHS A;  1P1O A;  2RCA A;  4XKR A;  5ET7 A;  2NVU B;  3VFJ A;  4OYV A;  3VVD A;  1JET A;  1JP4 A;  3FBP A;  4R9F A;  5DTB A;  4I62 A;  4IO2 A;  1Y3N A;  2BJI A;  2Q8J A;  3RGY A;  3FJG A;  4ZEI A;  1MH3 A;  3IOV A;  2DOJ A;  1LBY A;  1IXC A;  4GOT A;  2UYE A;  2DE2 A;  1N3X A;  3OEK A;  1SVX B;  2A5T A;  2ZNS A;  4G77 A;  3TTR A;  4JB7 A;  3ILT B;  1QVS A;  4F1Y A;  3RPL A;  2O84 X;  4KYE A;  1OIB A;  5FHM A;  3O6H A;  4LVQ A;  3SER A;  4KYS A;  1LFI A;  4GX4 A;  1DMB A;  2XXK A;  3MP6 A;  4G8H A;  4G8N A;  1UTB B;  4MNP A;  1XC1 A;  4GF8 A;  3L6H A;  1AIV A;  2F36 A;  5TP9 A;  5IGA A;  3DM0 A;  3KFM A;  4XFE A;  3MPK A;  4MCO A;  1FTK A;  1QKB A;  1FTL A;  3CI8 A;  3D4C A;  1PB9 A;  3EHT A;  1RYO A;  3PMW A;  3DP8 A;  3GYY A;  4RY1 A;  2WBB A;  4PFT A;  1VDW A;  4JDF A;  2DQV A;  3MVZ A;  4EDP A;  4ESX A;  3E78 A;  3KBR A;  2XWV A;  1BLF A;  2XXT A;  3S9L C;  3KSX A;  4XTC Q;  3PMX A;  2DP8 A;  4JWY A;  2KLF A;  4YKP A;  2WKY A;  1SD3 A;  3CIJ A;  1B7U A;  4JWO A;  2VPN A;  1MDP 1;  3O2A A;  3ODB A;  5LTC A;  4R6H A;  2D3I A;  5AE4 A;  3U93 A;  2PBW A;  5CI5 A;  3MPL A;  1BP5 A;  4NTL A;  3N6T A;  4QSE A;  1P1Q A;  1YCJ A;  2F34 A;  4OQO A;  1LAF E;  4IO5 A;  1MM6 A;  2DVC A;  3E4R A;  4HCY A;  2DWA A;  3H7M A;  3KBZ A;  4JXI A;  3MJN A;  3A3C A;  3OO7 A;  1IQ7 A;  3PUZ E;  1T0K A;  5CC2 A;  3PUY E;  5I84 A;  3MBP A;  3K02 A;  5DT6 A;  2UYF A;  2ZZX A;  4PBQ A;  4ZE8 A;  1FPK A;  1NKX A;  3VVF A;  3WAE A;  3O29 A;  3QYT A;  4N91 A;  1PB7 A;  1R9L A;  5I5P A;  2F35 A;  4C1T A;  1FPJ A;  2F5X A;  2Z22 A;  3HHF A;  2A5S A;  4RPO A;  2ZMB A;  3IR1 A;  4PCD A;  4X1D A;  1I6B A;  3RTF B;  3W15 C;  3F11 A;  4KR5 A;  1NV7 A;  2PYY A;  3TPA A;  4ZEC A;  3LSX A;  4P0I A;  4ZS9 A;  4THI A;  4MHF A;  3VE1 B;  4NF6 A;  4OAN A;  1Y3P A;  4IO6 A;  3B6Q A;  1IME A;  1UQW A;  3TYH A;  4R74 A;  3PPR A;  3HHG A;  3QUF A;  4LON B;  1S7Y A;  1A54 A;  3TCH A;  1B3L A;  1FTJ A;  4GIZ A;  1QUL A;  1B58 A;  1LBV A;  3U92 A;  4PFR A;  4FBP A;  1US5 A;  1FTA A;  1NUX A;  2RC8 A;  4MBP A;  4NF4 A;  3O9P A;  4Q0C A;  2D5W A;  2VP1 A;  1CB6 A;  3MWB A;  3ZKK A;  4BDM A;  3TQL A;  4QFP A;  1JVY A;  3BFU A;  1MM7 A;  2OCU A;  4FEB A;  3EHU A;  5CMM A;  4DZ1 A;  4KXP A;  3CSG A;  5EYG A;  1URS A;  3T9U A;  1MXY A;  3IB2 A;  1N04 A;  5I57 A;  1B7Z A;  3M3L A;  5CM6 A;  4NF0 A;  3MW0 A;  5ICQ A;  3ONM A;  2V3Q A;  1B0H A;  3Q25 A;  4GL0 A;  1B1H A;  4EQ7 A;  3V8X B;  3EHS A;  3T1B A;  1SW2 A;  1NFT A;  3TTK A;  3HFU A;  4F3B A;  4ESW A;  4F18 A;  3MP1 A;  4I1D A;  4LUB A;  2Z8E A;  1QUK A;  3VDF A;  3KJT A;  3O66 A;  1NMU A;  3VXC A;  3C31 A;  3CHG A;  1HSE A;  3HPI A;  1H43 A;  4MFI A;  5T3J A;  2O68 A;  1P1U A;  4MLV A;  4GVO A;  4ZEF A;  5AA2 A;  5H8F A;  4OVQ A;  2WYP A;  2VOZ A;  2UVG A;  2OLB A;  2XHD A;  2HZK A;  3HST A;  3H6V A;  1GR2 A;  1O64 A;  4FED A;  2DXR A;  3IB1 A;  3TKD A;  1YPN A;  1POT A;  3TCF A;  4FOR A;  3K00 A;  2ZYK A;  4M4G A;  1VSO A;  5DVJ A;  5CRY A;  4F2Q A;  5AA1 A;  4QFL A;  2H25 A;  3A29 A;  4NF5 A;  4F3P A;  4MH5 A;  2RC9 A;  3DEL B;  4HE1 A;  4R2F A;  2FBP A;  2H99 A;  4NX1 A;  3ILU B;  3IOT A;  3RPL B;  2Y5K A;  4AS4 A;  3IJX B;  4OTE A;  2CEX A;  2HFB A;  2GRV A;  1FBD A;  4H45 A;  2AL4 A;  2GHA A;  3LC8 A;  4N4U A;  1IMA A;  3TUS A;  3HN0 A;  1SDX A;  4P8B A;  2F6P A;  1YXI A;  5KCJ A;  2PFY A;  3FAS A;  3UN6 A;  4H1X A;  3G3K A;  3OXN A;  2NUV A;  2I3W A;  4FE8 A;  4H65 A;  1URD A;  1ELJ A;  1R1N A;  5L9O A;  4ELQ A;  3S9E A;  2X26 A;  4GBV A;  2CEY A;  1MY0 A;  5H8H A;  1DCU A;  1D3K A;  5EHM A;  3RYD A;  3VLU A;  3PV0 E;  4IO7 A;  1SW5 A;  4DXC A;  1H76 A;  4Z7E A;  4FAJ A;  2I4B A;  1ZBM A;  2XXP A;  4M1V A;  3U94 A;  4RPN A;  2X7Q A;  5I58 A;  3IAZ A;  3B6T A;  3JZJ A;  4TLM B;  1MQH A;  2M8C A;  3PGF A;  3SKP A;  4OVR A;  2CMO A;  4ZEK A;  2DXY A;  2WYK A;  1D9Q A;  5H8S A;  5IKB A;  1TFD A;  2I3V A;  3LSL A;  5CBR A;  2XX9 A;  1ZJL A;  2F3B A;  4DXU A;  3K6X A;  4FAT A;  3TOD A;  4XXU A;  2QMX A;  3ISP A;  4N13 A;  3IL1 B;  5A5X B;  2MKZ A;  4PFU A;  3OOA A;  3RT6 B;  4G2Z A;  2Y7I A;  4LA9 A;  5IM2 A;  3ZKL A;  1OQH A;  4DCY A;  3RN8 A;  4DCX A;  1OLA A;  1LBX A;  2O1L A;  3JYR A;  4G4P A;  2FA7 A;  4I3E A;  4KFQ A;  1FBC A;  4PC9 A;  1J1N A;  3NOH A;  1XI6 A;  3BKI B;  2V84 A;  4GLI A;  1Z7M E;  1YAE A;  3TTL A;  3RTW B;  3OEM A;  2VHA A;  4HE0 A;  2V3U A;  1EU8 A;  4GX3 A;  4FIM A;  5JTY A;  1PDA A;  3E79 A;  2QVR A;  5IZ3 A;  2RF1 A;  3CRB A;  4O3B A;  2HAV A;  4H6D A;  1P99 A;  2ZNU A;  1B46 A;  1A7L A;  5EYH A;  3PD8 A;  2VD2 A;  3O97 A;  3HV1 A;  4I8C A;  2I0C A;  5CMK A;  2FIX A;  4KCD A;  4PFY A;  3MC2 A;  4X8R A;  1UIV A;  3G3F A;  1LAG E;  2RKM A;  1DBZ A;  1INP A;  1EH3 A;  2DWI A;  2G29 A;  3H4Z A;  4I3Y A;  5F1Q A;  4FEC A;  1AL3 A;  3VLV A;  4LZ5 A;  3OMB A;  2O7I A;  4P56 A;  3EN3 A;  4PET A;  3GZG A;  5ITP A;  4C0R A;  4LZ8 A;  5B7D A;  1FBG A;  1ZKB A;  4PAK A;  2QL3 A;  4NAP A;  1NV1 A;  4IGR A;  1ATG A;  4G68 B;  4H5G A;  1FJ9 A;  3IFC A;  1FJ6 A;  3BFT A;  4OFJ A;  5DEX A;  1RDZ A;  2ZZW A;  4NGU A;  4GWU A;  2ZYM A;  2PCR A;  4NHB A;  2HPG A;  2PMS A;  3UGW A;  1LAH E;  3SES A;  3THI A;  4AB5 A;  4F22 A;  3W9V A;  3B8B A;  4QSC A;  3S4U A;  5TPA B;  3IJO B;  2XA5 A;  2NOO A;  2ONR A;  1B4Z A;  4I9D A;  3CVG A;  4PFB A;  3H3G A;  1LCF A;  1NV0 A;  5KDT B;  1M5D A;  1IMC A;  2YLN A;  4MNC A;  1N7W A;  2Q9T A;  5H8N B;  4IY5 A;  3G3I A;  1G0I A;  2L5V A;  4YKK A;  2NXO A;  2DYX A;  3BIG A;  1ZTY A;  3R6U A;  4I40 A;  3VV5 A;  2DE4 A;  1EYI A;  3CG3 A;  3N6U A;  3UP9 A;  2Z23 A;  1DPP A;  3PMV A;  1SW1 A;  3CR9 A;  3FIR A;  1F9B A;  2ZYO A;  2V25 A;  1O63 A;  4PDD A;  1CNQ A;  5AA4 A;  4QHQ A;  1GGG A;  4OVS A;  1UTH A;  4Q8R A;  1WDN A;  3JV9 A;  4H8I A;  4BLA A;  4WED A;  2REJ A;  4YU0 A;  1LB8 A;  1B5H A;  1WVJ A;  4LZ7 A;  2F7C A;  4O8M A;  4EXK A;  4JSO A;  4L17 A;  4QFN A;  2LAO A;  1MXX A;  4QBA A;  1IMD A;  3FXU A;  1IXI A;  3Q27 A;  4PTK A;  3S2V A;  1FBF A;  3KSJ A;  4EXL A;  5FTH A;  1I6A A;  2WX9 A;  2IEE A;  5LDZ A;  4YAH X;  4MF3 A;  1SYH A;  1L5T A;  3K01 A;  1XT8 A;  1Q35 A;  3MP8 A;  1HSJ A;  3H06 B;  4XKQ A;  1EZP A;  2PT1 A;  5BUU A;  4N6P A;  1TXF A;  5ITO A;  2FVZ A;  4HCW A;  3O6G A;  3I6V A;  4GXS B;  4R9G A;  2DSF A;  3RUM A;  3K1N A;  3V83 A;  2DS9 A;  3PUW E;  3A3U A;  4LAT A;  3IK6 B;  2ZNT A;  5LOM A;  3GXA A;  4ELO A;  4ISU A;  1FPI A;  3LR1 A;  3TEL A;  3EQ1 A;  3K1M A;  3FJ7 A;  4GWW A;  2FNC A;  1NV6 A;  5ESY A;  5HBC A;  2O69 A;  2B65 A;  3G3H A;  4UA8 A;  1OMP A;  1A99 A;  2CZI A;  1CE2 A;  2XXR A;  3WAF A;  1H3D A;  4YB6 A;  2XXV A;  1EZ9 A;  4NF8 A;  2UVH A;  2V93 A;  5I2K A;  2XX7 A;  1I69 A;  3RY3 A;  1B05 A;  2XWI A;  4MAG A;  4OVP A;  5DVF A;  4PP0 A;  1JW1 A;  1H44 A;  5I2N B;  5I56 A;  1NV3 A;  2QS4 A;  4KQP A;  4NN3 A;  2Q88 A;  3A09 A;  4FJP A;  1MRP A;  1PBP A;  4OMB A;  3LSF B;  1D4N A;  1B7H A;  3CG1 A;  2O51 A;  2QSX A;  4WKM A;  3E13 X;  4N8Y A;  5H8Q A;  2ABH A;  3LUZ A;  4N15 A;  4G61 A;  5TU0 A;  4C1U A;  5CMC A;  3FAT A;  3MVW A;  4OFL A;  1MXW A;  1KA0 A;  3DP4 A;  2O6A A;  1AWB A;  1RYX A;  3FJM A;  1ZMG A;  4PAI A;  4DI4 B;  3T96 B;  2F7B A;  1FPB A;  3V89 B;  3RT8 A;  2BJJ X;  4DIG A;  4X04 A;  4ZEB A;  4U23 A;  5JTY B;  2DE3 A;  3TCG A;  1FSA A;  3CSB A;  5I59 B;  4PE5 B;  1FQC A;  1RKM A;  4LQ2 A;  2D21 A;  5IAI A;  4GBW A;  4JVI A;  3G3J A;  1QKA A;  4OVJ A;  1MXZ A;  5IZZ A;  3MZ9 A;  1SQY A;  1USY E;  2Q2A A;  2OBG A;  3C32 A;  4KCC A;  3I5O A;  2F78 A;  4ONY A;  1R9Q A;  4N81 A;  3PPQ A;  3V5A A;  4HXV A;  1MPB A;  3QSL A;  3T93 B;  3IOW A;  1IMF A;  3PPO A;  5AA2 D;  4YKJ A;  4QRZ A;  1K9Z A;  2ESN A;  4HW8 A;  4UAC A;  4OXV A;  3RQT A;  1UTB A;  2CZH A;  4UAB A;  3ZS6 A;  3USD A;  3R7X A;  1KZ8 A;  1MG1 A;  1FPG A;  3Q29 A;  1ZLQ A;  4KPT A;  4F39 A;  3RPW A;  4ZE9 A;  3N5L A;  1OVB A;  3SDF A;  3LV0 A;  1IEJ A;  4YMB A;  4R75 A;  3SEU A;  1IXG A;  1MQI A;  4XIG Q;  1FQD A;  2QS2 A;  3PD9 A;  1LBB A;  3GBB A;  1GTK A;  2AIX A;  1R6Z A;  1TWY A;  3P7I A;  5EQ7 A;  4BDL A;  2HZL A;  3FXR A;  3I3V A;  1PC3 A;  4OEU A;  1POY 1;  3TAJ A;  3UOR A;  2P3V A;  4PBH A;  4ZZE A;  2A5T B;  4H8J A;  2RC7 A;  2B4L A;  4JBZ A;  3BIH A;  4OEV A;  1P1W A;  1Y1M A;  2OX3 A;  2QVV A;  3OD7 A;  2E1S A;  2FHY A;  4NWC A;  1XOC A;  1QJM A;  1Y1Z A;  2Z8D A;  4GX6 A;  2I6E A;  1VFE A;  1MXV A;  4OFO A;  1Z7N E;  1VE4 A;  3C36 A;  3SEX A;  5TP9 B;  3TEP A;  4OER A;  1NV4 A;  1VR5 A;  3PU5 A;  4BDR A;  3K2D A;  1ZU0 A;  4U4X A;  3FV1 A;  3VLW A;  1IMB A;  4U22 A;  1MQD A;  1SI0 A;  1NNK A;  5AA4 B;  1B4H A;  4RJZ A;  1IUD A;  1FQE A;  2B4M A;  4XEQ A;  3LUY A;  4PF6 A;  3MAM A;  1LGB C;  1JEV A;  4G68 C;  1FRP A;  1D9V A;  4F29 A;  2CZK A;  4QFK A;  1FPE A;  1FTO A;  3ECR A;  4MIJ A;  2PT2 A;  4OHN A;  5M2V A;  3U1O A;  4F19 A;  2HQ0 A;  1M5C A;  1N76 A;  3IOU A;  1Y4C A;  3MZB A;  4DXB A;  5EQA A;  4BDQ A;  1JVX A; 
#chains in the Genus database with same CATH homology
 3EPE A;  1GVC A;  2QS3 A;  4NED A;  3K6U A;  4X9T A;  3OSR A;  4ZZA A;  1KWH A;  2E0S A;  2F7A A;  5FHO A;  4EQB A;  4F1V A;  4KYD A;  4EF2 A;  3CFZ A;  1FQB A;  1O7T A;  1PB8 A;  4F31 B;  2P1S A;  3CFL A;  3QUJ A;  3UIF A;  4YB7 A;  2XXX A;  5AA3 A;  4Q5T A;  4HS7 A;  4TLL B;  2DWH A;  2OK2 A;  3TFL A;  3PPP A;  3T66 A;  3L6G A;  3PPN A;  3FVK A;  4EF1 A;  1MY3 A;  3O6I A;  1TFA A;  1UIU A;  1B3G A;  3T9H B;  1LBC A;  3Q26 A;  4NF6 B;  2IA4 A;  1FQF A;  5DVI A;  3RLF E;  4OET A;  2DVZ A;  3OSQ A;  5H8Q B;  4YIC A;  5BWJ A;  4U21 A;  3E9X A;  1AOV A;  3KZG A;  1A40 A;  2O7U A;  4LQ5 A;  1MS7 A;  1B52 A;  1US4 A;  2ANJ A;  4NF4 B;  2Z8F A;  4BDO A;  2QJE A;  1MPC A;  1FQA A;  1MQJ A;  3C4M A;  2QS1 A;  4WXJ A;  2XX8 A;  2I49 A;  1QUJ A;  2CZL A;  2XXU A;  5I57 B;  1JW4 A;  1TT1 A;  1B2H A;  2XXY A;  3DP6 A;  3K6W A;  2REG A;  1OLC A;  2H9B A;  1NNT A;  1XVX A;  3FV2 A;  4OEN A;  2Y7P A;  2AYS A;  4H5F A;  3KJ7 A;  1A8E A;  5JK4 A;  3HO7 A;  4ND9 A;  3B7D A;  1XS5 A;  5ELV A;  2NWJ A;  3QXM A;  4DDD A;  4KD5 A;  4POX A;  4X48 A;  3T9X B;  2I58 A;  1SBP A;  2VD3 A;  5K2Y A;  2DWJ A;  4IB2 A;  1LAX A;  1JQF A;  4XKN A;  2I48 A;  3G7W A;  4TOZ A;  4XKP A;  5F7V A;  3DLN A;  5FTI A;  1N84 A;  5AA2 B;  5H8F B;  1QW0 A;  3UA8 A;  1Y9U A;  4KI0 E;  3M3F A;  1DPE A;  1MY2 A;  3TZA A;  2G93 A;  2XXQ A;  2ONS A;  4IGT A;  3U72 A;  2OZZ A;  2HEU A;  1IIW A;  1PBQ A;  1SI1 A;  4GQO A;  4R2B A;  4U4S A;  1A8F A;  1MPD A;  4IO3 A;  3S9M C;  1ZIU A;  4NF5 B;  1DTZ A;  1BKA A;  1DSN A;  3VVE A;  2AL5 A;  4G8M A;  1FW0 A;  3PUV E;  3C35 A;  4GL8 A;  4RYA A;  2RCB A;  3IB0 A;  1M5F A;  4F3G A;  3VXB A;  1HSL A;  4MLQ A;  5A5X A;  5KCJ B;  2XD2 A;  2P2A A;  3MVY A;  1D9Y A;  1IZ1 A;  4RA1 A;  1NL5 A;  3K0V A;  4JWX A;  2F6G A;  4ZDM A;  4RK9 A;  3RNN A;  5H8H B;  3M8U A;  3D4G A;  1Y20 A;  3IX1 A;  4NMY A;  3QIM A;  1BTJ A;  3KN8 A;  1IXH A;  3OO6 A;  5I58 B;  4LP2 B;  2THI A;  3EF7 A;  1MY4 A;  2Y7K A;  4AB6 A;  2GFE A;  3UK4 A;  1LLS A;  4U1O A;  3MQ9 A;  2GH9 A;  1XHY A;  3LBS A;  5L9M A;  3N26 A;  3LSW A;  4OES A;  2VGQ A;  3H03 A;  3H6T A;  1M5E A;  1H45 A;  2HXW A;  3SEV A;  2Y7W A;  1WOD A;  3MZ1 A;  2H5Y A;  2ZYN A;  3KOT A;  1B9J A;  4JSD A;  2W7Y A;  2O1M A;  2OWS A;  2Q89 A;  3K4U A;  3KOS A;  2XD3 A;  2QRY A;  1NNP A;  4IY6 A;  3FGS A;  4H0W A;  1PEB A;  1MDQ A;  5K2X A;  2Y7R A;  4PFW A;  4F1U A;  3IO6 A;  2UVJ A;  5KZT A;  3B6W A;  4G68 A;  1S50 A;  2HCA A;  3R26 A;  4GRK A;  1URG A;  3FVO A;  5CMB A;  4GXA A;  4DLD A;  3MVX A;  3PUX E;  2PVU A;  5TPA A;  4RXL A;  2F8D A;  4DE8 A;  1II5 A;  2I4C A;  2F97 A;  3QK6 A;  3AXF A;  5KDT A;  4F3S A;  1B6H A;  3G3G A;  4K3F A;  4N07 A;  1SYI A;  5H8N A;  1MH4 A;  1B32 A;  2X7P A;  1M5B A;  4R72 A;  1B5J A;  3KG2 A;  1B0L A;  1N0T A;  1Q1K A;  4Z0I A;  1B51 A;  4BDN A;  3H6W A;  1JW5 A;  2B3F A;  2R9J A;  4H67 A;  3GLB A;  5DEX B;  1Y4T A;  2Y84 A;  1JNF A;  1MXU A;  4RNS A;  1B40 A;  1Y3Q A;  3T9V A;  3FVN A;  2B3B A;  3SEW A;  1FCK A;  1B3F A;  5DYH A;  3FXQ A;  1BIY A;  2ONK E;  2V3T A;  4Q30 B;  4GFR A;  3SET A;  1NNF A;  2XXH A;  2QPQ A;  4QF9 A;  1NH7 A;  2ALU A;  5FHN A;  3IOR A;  5J1D A;  4U2R A;  1B1X A;  4ZED A;  3M3K A;  1B3H A;  4ELR A;  2OJT A;  3C34 A;  2GHB A;  3K1P A;  1B5I A;  1VFD A;  1MQG A;  4E0W A;  4NWD A;  1FTM A;  3KGC A;  4KHZ E;  2HAU A;  5L8D A;  3K6V A;  2ZXT A;  3FD3 A;  5HM4 B;  4O3A A;  1UTH B;  3BBR A;  3KN3 A;  3H6U A;  2R6G E;  4U1Z A;  4AQ4 A;  3OO9 A;  3W9W A;  3Q28 A;  3ZSF A;  1LFG A;  3KEI A;  5ICT A;  4R73 A;  5CBS A;  1QUI A;  3CFX A;  3HCQ A;  4TQU Q;  3IO4 A;  3TMG A;  4PQJ A;  4E0X A;  3C33 A;  4P0G A;  3T22 A;  4OWD A;  3TQW A;  1A55 A;  1N3W A;  1OQG A;  1AMF A;  2Q2C A;  1YTV A;  1I6Q A;  1USY H;  3QAX A;  5L9S A;  4O3C A;  3U8Q A;  1AH5 A;  2QMW A;  4OZ9 A;  1P1N A;  3FZV A;  3TDJ A;  3OEN A;  2XXI A;  3TTM A;  5I2N A;  5EYF A;  3FUZ A;  4QSD A;  1DTG A;  3C9H A;  2OWT A;  4YMA A;  4GWO A;  2YJP A;  2H98 A;  3TTN A;  4ECF A;  3KN7 A;  4EQ9 A;  1B3E A;  3GBA A;  3OEL A;  4YKI A;  4P11 A;  5JEI A;  1LB9 A;  1GV8 A;  1DOT A;  5ISU A;  4F2O A;  1JEU A;  4NF8 B;  5HPQ A;  3O28 A;  5B70 A;  1LCT A;  5I2K B;  1OVT A;  2UVI A;  2I0B A;  4IO4 A;  2PX1 A;  4R6K A;  2P0S A;  5I59 A;  1IIT A;  5I56 B;  2UXA A;  2H4I A;  4ELP A;  4RK2 A;  2FYI A;  1LST A;  2RIN A;  2XXW A;  2R71 A;  4NE4 A;  3OO8 A;  1NH8 A;  1LFH A;  3MUQ A;  4POW A;  1MY1 A;  4GD5 A;  3FVG A;  1XVY A;  2YPN A;  4X1B A;  3SEY A;  1ANF A;  1SW4 A;  1N7X A;  1S9T A;  4YZZ A;  3E3K A;  3N94 A;  4QFO A;  4WEP A;  4EUO A;  3S9N C;  1EZO A;  4R6Y A;  4YB5 A;  4HTG A;  5EHS A;  1P1O A;  2RCA A;  4XKR A;  2NVU B;  3VFJ A;  4OYV A;  3VVD A;  1JET A;  4R9F A;  5DTB A;  4I62 A;  4IO2 A;  1Y3N A;  2Q8J A;  3RGY A;  3FJG A;  4ZEI A;  1MH3 A;  3IOV A;  2DOJ A;  1IXC A;  4GOT A;  2UYE A;  2DE2 A;  1N3X A;  3OEK A;  1SVX B;  2A5T A;  2ZNS A;  4G77 A;  3TTR A;  4JB7 A;  3ILT B;  1QVS A;  4F1Y A;  2O84 X;  4KYE A;  1OIB A;  5FHM A;  3O6H A;  4LVQ A;  3SER A;  4KYS A;  1LFI A;  1DMB A;  3MP6 A;  4G8H A;  4G8N A;  1UTB B;  1XC1 A;  4GF8 A;  3L6H A;  1AIV A;  2F36 A;  5TP9 A;  3DM0 A;  3KFM A;  3MPK A;  1FTK A;  1QKB A;  1FTL A;  3CI8 A;  3D4C A;  1PB9 A;  3EHT A;  1RYO A;  3PMW A;  3DP8 A;  4RY1 A;  4PFT A;  4JDF A;  2DQV A;  4EDP A;  4ESX A;  3MVZ A;  3KBR A;  1BLF A;  2XXT A;  3S9L C;  3KSX A;  4XTC Q;  3PMX A;  2DP8 A;  4JWY A;  2KLF A;  4YKP A;  2WKY A;  1SD3 A;  3CIJ A;  1B7U A;  3O2A A;  4JWO A;  1MDP 1;  3ODB A;  4R6H A;  2D3I A;  5AE4 A;  3U93 A;  2PBW A;  5CI5 A;  3MPL A;  1BP5 A;  4NTL A;  3N6T A;  4QSE A;  1P1Q A;  1YCJ A;  2F34 A;  4OQO A;  1LAF E;  4IO5 A;  1MM6 A;  2DVC A;  3E4R A;  4HCY A;  2DWA A;  3H7M A;  4JXI A;  3MJN A;  3A3C A;  3OO7 A;  1IQ7 A;  3PUZ E;  1T0K A;  5CC2 A;  3PUY E;  5I84 A;  3MBP A;  3K02 A;  5DT6 A;  2UYF A;  4ZE8 A;  1NKX A;  3VVF A;  3WAE A;  3O29 A;  3QYT A;  1PB7 A;  1R9L A;  2F35 A;  4C1T A;  2F5X A;  2Z22 A;  3HHF A;  2A5S A;  4RPO A;  2ZMB A;  3IR1 A;  4X1D A;  1I6B A;  3RTF B;  3W15 C;  3F11 A;  4KR5 A;  2PYY A;  3TPA A;  4ZEC A;  3LSX A;  4P0I A;  4ZS9 A;  4THI A;  3VE1 B;  4NF6 A;  1Y3P A;  4IO6 A;  3B6Q A;  1UQW A;  3TYH A;  4R74 A;  3PPR A;  3HHG A;  3QUF A;  4LON B;  1S7Y A;  1A54 A;  3TCH A;  1B3L A;  1FTJ A;  4GIZ A;  1QUL A;  1B58 A;  3U92 A;  1US5 A;  2RC8 A;  4MBP A;  4NF4 A;  3O9P A;  4Q0C A;  2D5W A;  2VP1 A;  1CB6 A;  3MWB A;  3ZKK A;  4BDM A;  3TQL A;  4QFP A;  1JVY A;  3BFU A;  1MM7 A;  2OCU A;  4FEB A;  3EHU A;  5CMM A;  4DZ1 A;  3CSG A;  1URS A;  3T9U A;  1MXY A;  3IB2 A;  1N04 A;  5I57 A;  1B7Z A;  3M3L A;  5CM6 A;  3MW0 A;  5ICQ A;  2V3Q A;  3ONM A;  1B0H A;  3Q25 A;  4GL0 A;  1B1H A;  4EQ7 A;  3V8X B;  3EHS A;  1SW2 A;  1NFT A;  3TTK A;  4F3B A;  4ESW A;  4F18 A;  3MP1 A;  4I1D A;  4LUB A;  2Z8E A;  1QUK A;  3VDF A;  3KJT A;  3O66 A;  1NMU A;  3VXC A;  3C31 A;  1HSE A;  3HPI A;  1H43 A;  4MFI A;  2O68 A;  1P1U A;  4MLV A;  4GVO A;  4ZEF A;  5AA2 A;  5H8F A;  2VOZ A;  2UVG A;  2OLB A;  2XHD A;  2HZK A;  3HST A;  3H6V A;  1GR2 A;  1O64 A;  4FED A;  2DXR A;  3IB1 A;  3TKD A;  1YPN A;  1POT A;  3TCF A;  4FOR A;  3K00 A;  2ZYK A;  4M4G A;  1VSO A;  5DVJ A;  5CRY A;  4F2Q A;  5AA1 A;  4QFL A;  2H25 A;  4NF5 A;  4F3P A;  4MH5 A;  2RC9 A;  3DEL B;  4R2F A;  2H99 A;  3ILU B;  3IOT A;  3IJX B;  4OTE A;  2HFB A;  2GRV A;  2AL4 A;  2GHA A;  3LC8 A;  3TUS A;  3HN0 A;  1SDX A;  2F6P A;  5KCJ A;  3FAS A;  3UN6 A;  4H1X A;  3G3K A;  3OXN A;  2NUV A;  2I3W A;  4FE8 A;  4H65 A;  1URD A;  1ELJ A;  1R1N A;  5L9O A;  4ELQ A;  3S9E A;  2X26 A;  1MY0 A;  5H8H A;  1D3K A;  5EHM A;  3VLU A;  3PV0 E;  4IO7 A;  1SW5 A;  4DXC A;  1H76 A;  4Z7E A;  4FAJ A;  2I4B A;  1ZBM A;  2XXP A;  4M1V A;  3U94 A;  4RPN A;  2X7Q A;  5I58 A;  3IAZ A;  3B6T A;  3JZJ A;  4TLM B;  1MQH A;  2M8C A;  3PGF A;  3SKP A;  2CMO A;  4ZEK A;  2DXY A;  5H8S A;  5IKB A;  1TFD A;  2I3V A;  3LSL A;  5CBR A;  2XX9 A;  1ZJL A;  4DXU A;  3K6X A;  4FAT A;  3TOD A;  4XXU A;  2QMX A;  4N13 A;  3IL1 B;  5A5X B;  4PFU A;  3OOA A;  3RT6 B;  4G2Z A;  2Y7I A;  4LA9 A;  3ZKL A;  1OQH A;  4DCY A;  3RN8 A;  4DCX A;  1OLA A;  3JYR A;  2O1L A;  4G4P A;  2FA7 A;  4KFQ A;  1J1N A;  3BKI B;  2V84 A;  4GLI A;  1Z7M E;  1YAE A;  3TTL A;  3RTW B;  3OEM A;  2VHA A;  2V3U A;  1EU8 A;  4FIM A;  5JTY A;  1PDA A;  2RF1 A;  3CRB A;  4O3B A;  2HAV A;  4H6D A;  1P99 A;  2ZNU A;  1B46 A;  1A7L A;  3PD8 A;  2VD2 A;  3O97 A;  3HV1 A;  4I8C A;  2I0C A;  5CMK A;  4KCD A;  4PFY A;  3MC2 A;  1UIV A;  3G3F A;  1LAG E;  2RKM A;  2G29 A;  1EH3 A;  3H4Z A;  2DWI A;  5F1Q A;  4FEC A;  1AL3 A;  3VLV A;  4LZ5 A;  3OMB A;  2O7I A;  3EN3 A;  4PET A;  3GZG A;  5ITP A;  4C0R A;  4LZ8 A;  5B7D A;  1ZKB A;  2QL3 A;  4IGR A;  1ATG A;  4G68 B;  4H5G A;  3BFT A;  4OFJ A;  5DEX A;  2ZYM A;  2PMS A;  3UGW A;  1LAH E;  3SES A;  3THI A;  4AB5 A;  4F22 A;  3W9V A;  4QSC A;  3S4U A;  5TPA B;  3IJO B;  2NOO A;  2ONR A;  1B4Z A;  4I9D A;  3CVG A;  3H3G A;  1LCF A;  5KDT B;  1M5D A;  2YLN A;  1N7W A;  2Q9T A;  5H8N B;  4IY5 A;  3G3I A;  4YKK A;  2NXO A;  2DYX A;  1ZTY A;  3R6U A;  3VV5 A;  2DE4 A;  3CG3 A;  3N6U A;  3UP9 A;  2Z23 A;  1DPP A;  3PMV A;  1SW1 A;  3CR9 A;  3FIR A;  1F9B A;  2ZYO A;  2V25 A;  1O63 A;  5AA4 A;  4QHQ A;  1GGG A;  1UTH A;  4Q8R A;  1WDN A;  3JV9 A;  4H8I A;  4BLA A;  4WED A;  2REJ A;  4YU0 A;  1LB8 A;  1B5H A;  1WVJ A;  4LZ7 A;  2F7C A;  4EXK A;  4JSO A;  4L17 A;  4QFN A;  2LAO A;  1MXX A;  3FXU A;  1IXI A;  3Q27 A;  3S2V A;  3KSJ A;  4EXL A;  5FTH A;  1I6A A;  2IEE A;  4YAH X;  4MF3 A;  1SYH A;  1L5T A;  3K01 A;  1XT8 A;  1Q35 A;  3MP8 A;  1HSJ A;  3H06 B;  4XKQ A;  1EZP A;  2PT1 A;  5BUU A;  4N6P A;  1TXF A;  5ITO A;  4HCW A;  3O6G A;  3I6V A;  4GXS B;  4R9G A;  2DSF A;  3RUM A;  3K1N A;  3V83 A;  2DS9 A;  3PUW E;  3A3U A;  4LAT A;  3IK6 B;  2ZNT A;  5LOM A;  3GXA A;  4ELO A;  4ISU A;  3LR1 A;  3TEL A;  3EQ1 A;  3K1M A;  3FJ7 A;  2FNC A;  5HBC A;  2O69 A;  2B65 A;  3G3H A;  4UA8 A;  1OMP A;  1A99 A;  1CE2 A;  2XXR A;  3WAF A;  1H3D A;  4YB6 A;  2XXV A;  1EZ9 A;  4NF8 A;  2UVH A;  2V93 A;  5I2K A;  2XX7 A;  1I69 A;  3RY3 A;  1B05 A;  5DVF A;  4PP0 A;  1JW1 A;  1H44 A;  5I2N B;  5I56 A;  2QS4 A;  4KQP A;  2Q88 A;  3A09 A;  4FJP A;  1MRP A;  1PBP A;  4OMB A;  3LSF B;  1D4N A;  1B7H A;  3CG1 A;  2O51 A;  2QSX A;  3E13 X;  4WKM A;  5H8Q A;  2ABH A;  5TU0 A;  4C1U A;  5CMC A;  3FAT A;  3MVW A;  4OFL A;  1MXW A;  3DP4 A;  2O6A A;  1RYX A;  3FJM A;  1ZMG A;  3T96 B;  2F7B A;  3V89 B;  3RT8 A;  2BJJ X;  4DIG A;  4ZEB A;  4U23 A;  5JTY B;  2DE3 A;  3TCG A;  3CSB A;  5I59 B;  4PE5 B;  1FQC A;  1RKM A;  4LQ2 A;  2D21 A;  5IAI A;  3G3J A;  1QKA A;  4OVJ A;  1MXZ A;  3MZ9 A;  1SQY A;  1USY E;  2Q2A A;  2OBG A;  3C32 A;  4KCC A;  3I5O A;  2F78 A;  4ONY A;  1R9Q A;  3PPQ A;  3V5A A;  1MPB A;  3QSL A;  3T93 B;  3IOW A;  3PPO A;  5AA2 D;  4YKJ A;  4QRZ A;  2ESN A;  4HW8 A;  4UAC A;  4OXV A;  3RQT A;  1UTB A;  3ZS6 A;  3USD A;  3R7X A;  1MG1 A;  3Q29 A;  1ZLQ A;  4KPT A;  4F39 A;  3RPW A;  4ZE9 A;  3N5L A;  1OVB A;  3SDF A;  1IEJ A;  4YMB A;  4R75 A;  3SEU A;  1IXG A;  1MQI A;  4XIG Q;  1FQD A;  2QS2 A;  3PD9 A;  1LBB A;  3GBB A;  1GTK A;  2AIX A;  1R6Z A;  1TWY A;  3P7I A;  4BDL A;  2HZL A;  3FXR A;  3I3V A;  1PC3 A;  4OEU A;  1POY 1;  3TAJ A;  3UOR A;  4ZZE A;  2A5T B;  4H8J A;  2RC7 A;  4JBZ A;  4OEV A;  1P1W A;  1Y1M A;  3OD7 A;  2E1S A;  4NWC A;  1XOC A;  1QJM A;  1Y1Z A;  2Z8D A;  2I6E A;  1VFE A;  1MXV A;  4OFO A;  1Z7N E;  1VE4 A;  3C36 A;  3SEX A;  5TP9 B;  3TEP A;  4OER A;  1VR5 A;  3PU5 A;  4BDR A;  3K2D A;  1ZU0 A;  3VLW A;  3FV1 A;  4U4X A;  1MQD A;  4U22 A;  1SI0 A;  1NNK A;  5AA4 B;  1B4H A;  4RJZ A;  1IUD A;  1FQE A;  3LUY A;  3MAM A;  1LGB C;  1JEV A;  4G68 C;  1D9V A;  4F29 A;  4QFK A;  1FTO A;  3ECR A;  2PT2 A;  4OHN A;  5M2V A;  3U1O A;  4F19 A;  2HQ0 A;  1M5C A;  1N76 A;  3IOU A;  1Y4C A;  3MZB A;  4DXB A;  4BDQ A;  1JVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...