1PBPA

Fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGDSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fine tuning the specificity of the periplasmic phosphate transport receptor. Site-directed mutagenesis, ligand binding, and crystallographic studies.
pubmed rcsb
source organism Escherichia coli
molecule tags Phosphate transport
molecule keywords PHOSPHATE-BINDING PROTEIN
total genus 112
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1994-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbpA02
3RN8A 4WEDA 1PB9A 3K6WA 4IO7A 5CC2A 1MG1A 1TWYA 3K6UA 5HM4B 3HSTA 3WAEA 2ZXTA 3K02A 4KYDA 4OMBA 1S7YA 4PFUA 2XXYA 2I58A 5H8HB 3DLNA 3GZGA 3ONMA 1Y3NA 3C9HA 1MQJA 5CMBA 5DTBA 2GFEA 4OESA 5AA4A 5L9OA 3L6HA 4RYAA 3LC8A 1IXGA 3HV1A 4QFLA 2I4BA 3H6UA 1OMPA 4LZ8A 4BLAA 4ELOA 3HHFA 2G29A 3IX1A 1B3LA 4BDQA 3TTLA 1Y1ZA 5CRYA 2DWIA 3MW0A 4H1XA 1P1NA 4Q0CA 5FTIA 3U92A 3PPNA 4R73A 5L8DA 2QS3A 3R26A 1M5FA 3G3IA 1AMFA 4JWYA 1EZ9A 1XVXA 3FV2A 4PFWA 1AL3A 3IO4A 1ZKBA 3OO8A 3V8XB 4ELPA 1NL5A 3MAMA 2I4CA 4G68B 3O6GA 1Y1MA 3SEUA 3KG2A 2ZNSA 3BBRA 1MQIA 3OEMA 1CE2A 3CSBA 3K00A 1XT8A 5TP9A 1XS5A 3MC2A 4N6PA 4LZ7A 1NH7A 1N0TA 3K01A 4GLIA 1D3KA 2XXHA 4GXSB 3VLWA 3PMXA 2DE2A 4I8CA 2DVZA 3HN0A 2QL3A 2VD2A 3MVZA 3SERA 3BFTA 1MH4A 1OLCA 3MP8A 3MZ1A 3SEYA 1MM6A 1USYE 2ALUA 3A3CA 4OXVA 4MBPA 5AA2B 1I6BA 2P2AA 4K3FA 3DP4A 1DTZA 1ZU0A 1QKAA 1LFGA 1M5BA 2DYXA 2HZLA 4THIA 1NFTA 4N13A 2XX9A 3DM0A 1M5EA 4DZ1A 5DT6A 3V5AA 5KDTB 1N3XA 2I49A 1I6QA 4YB7A 2XXRA 1D4NA 1B3GA 1PB7A 1LB9A 2HAVA 4LUBA 4R6KA 5CMCA 3LSFB 5KCJA 3L6GA 1IEJA 3FGSA 5F1QA 1LFHA 2QS1A 2F7CA 2XXXA 4DIGA 2ZYMA 3M8UA 2ZNTA 4TLMB 3SDFA 3IB2A 4FIMA 3G3FA 2VP1A 3PPPA 3FXRA 4GXAA 5EHMA 3S9LC 3V89B 2H9BA 4Q8RA 3UGWA 2RC7A 2XXTA 1MXYA 4HS7A 4UACA 1JQFA 1UQWA 1ZJLA 4P0GA 5FHOA 3SETA 1O64A 2YJPA 3TQLA 4F1UA 1URDA 3IK6B 1TFDA 3EF7A 4QSCA 3TZAA 5TPAA 4GOTA 2R6GE 1Q35A 3TDJA 4XKPA 2HQ0A 3FZVA 1ANFA 3EN3A 1JW4A 1RKMA 1PEBA 2OBGA 1MY4A 1IIWA 1B2HA 2XHDA 1R1NA 3M3LA 4LZ5A 3UN6A 4F2QA 5LOMA 2O68A 3T9XB 4ECFA 2AL5A 4GQOA 1B0HA 2Z8FA 4G8MA 1S9TA 3K1NA 1LAFE 1R6ZA 2NVUB 1OIBA 3VDFA 1ZMGA 3IJOB 3KJ7A 4IO3A 4EQBA 4YB5A 2E0SA 1R9LA 3B6QA 1LBBA 3PUVE 2LAOA 2G93A 3ECRA 3R6UA 5H8FA 3KBRA 1B4ZA 4IO6A 3FJMA 1URGA 2RF1A 5B70A 3RNNA 4LVQA 1H45A 3DP8A 2RC9A 4IO5A 2I3WA 4G68C 4NTLA 2PBWA 3U1OA 4GRKA 4IB2A 2Q2AA 4KR5A 1O63A 1ATGA 3O28A 3SESA 3VXBA 1MQDA 3IAZA 4ESXA 4H8JA 4NF5B 5CBSA 3KGCA 4KQPA 5HBCA 3IL1B 2PT2A 4M1VA 4NMYA 1FW0A 3TELA 4PQJA 4F31B 1MRPA 5I84A 4JB7A 1Y9UA 4YICA 2UVGA 4G68A 2B3FA 4GF8A 5H8FB 5H8QA 1OVBA 3LR1A 1SBPA 3K6XA 2Q88A 3OO9A 1A8EA 2H5YA 3A3UA 4N07A 5DVIA 2ABHA 3RLFE 2Q89A 5TP9B 4DLDA 1MXVA 4FATA 2QRYA 5DEXB 5L9SA 3IJXB 4FEDA 3PGFA 1FTJA 2F6PA 2GHAA 4IO2A 4H0WA 4JXIA 3GBBA 4KD5A 4ELRA 4ZECA 1JW5A 3JYRA 2UVHA 3H7MA 3K1PA 1SI1A 2ESNA 3OD7A 4FECA 4DCYA 1HSJA 4GWOA 4TOZA 2NUVA 2W7YA 4NF5A 3T93B 3EHTA 1M5CA 2F35A 4PFYA 1YAEA 3RTFB 3U93A 3GBAA 1JEVA 3K4UA 1L5TA 4KCCA 3KZGA 4YMAA 2VOZA 5AA3A 3HHGA 3SEWA 3N6UA 3RPWA 5BWJA 1J1NA 3C33A 2Q8JA 5M2VA 3B6WA 3S9EA 1MDP1 1NNTA 3DELB 2O69A 4WKMA 5DYHA 2AL4A 4YKIA 5DEXA 1HSEA 2QS2A 4H5GA 1LSTA 3IB1A 4QFOA 5KCJB 2ONRA 5TU0A 3LSXA 3MP1A 2F7AA 1LAXA 3Q27A 4OETA 1QVSA 3TTMA 1UTHA 2QS4A 2V3QA 1ELJA 1LCTA 3E13X 3O66A 4HTGA 1DPEA 4KI0E 4H67A 4NEDA 5AA1A 3VE1B 1Q1KA 2NXOA 2O7IA 4QFPA 3W9WA 1NH8A 3GXAA 4F29A 5I59A 2QSXA 4F3GA 1DPPA 2V84A 4L17A 2Z8EA 3UORA 3GLBA 3PUXE 1IUDA 2F5XA 2I6EA 4DE8A 3FASA 4YKPA 3T9HB 1A99A 2V3UA 3CRBA 1N76A 2H4IA 2Y7KA 2O51A 1H43A 3QUFA 3JZJA 1MXXA 1US4A 1B3EA 2OCUA 3FVOA 3O2AA 3PPQA 2RINA 4R74A 4XKQA 4NF8A 1B1XA 4JBZA 1FQDA 1NMUA 2RKMA 3JV9A 3TFLA 5IAIA 4WXJA 4Q30B 3CFZA 5KZTA 1Z7ME 1D9YA 1UTHB 3IOVA 1B32A 4BDOA 3BFUA 3IOUA 3PD9A 4ZS9A 4QHQA 3T9VA 3RUMA 1Y3PA 4JWXA 1QUIA 1B5HA 5I59B 1GGGA 1UIVA 2I48A 1SW5A 4R6HA 4DDDA 3H6WA 1MY1A 4OFOA 1PDAA 3PMWA 3ILTB 4Q5TA 2WKYA 4NE4A 4YU0A 1B0LA 3MVYA 2DXYA 3H6TA 3O29A 3F11A 3PD8A 3UP9A 1JVYA 4ZZEA 2DOJA 1POTA 3CI8A 3IORA 4X1BA 5CI5A 4ZZAA 4EF1A 3S4UA 1B7ZA 3I6VA 1SQYA 4E0WA 4YZZA 4F2OA 3B6TA 1JETA 3FXUA 1EU8A 3CFXA 1MXZA 4YKKA 3O97A 2GH9A 3G7WA 2XXQA 5JTYB 3W9VA 5CBRA 1MQHA 2O84X 2O6AA 4U22A 2Y7IA 5I2KA 1EZOA 1B4HA 2QPQA 4Z7EA 4H8IA 1GVCA 2DQVA 2GRVA 2OLBA 1XOCA 2ZYKA 3MPLA 1FQEA 1QULA 1LBCA 1USYH 3K6VA 3TTRA 2Q9TA 4LA9A 5H8QB 4F22A 1TT1A 1AIVA 1M5DA 2V3TA 5JEIA 1B46A 3VVFA 1LAHE 3ZKKA 2Y7RA 3PUWE 4OQOA 4I1DA 1D9VA 2F36A 3A09A 4G8HA 4ISUA 4DXBA 2UVJA 1P1UA 4QFNA 3U8QA 3U72A 3SKPA 4KFQA 3TTNA 2CZLA 4KPTA 5FHNA 3MWBA 4PFTA 1B1HA 1DSNA 1DOTA 2V93A 4P0IA 5FHMA 4ZE8A 2M8CA 4U23A 3Q29A 4U1OA 4EXLA 2ZMBA 1P1OA 4RA1A 3VXCA 3MZBA 2D3IA 4BDRA 1ZLQA 4R6YA 4E0XA 1SYIA 3CG1A 1VSOA 4RY1A 3VFJA 1B7UA 3E9XA 1SW1A 4EQ7A 5J1DA 2OWTA 2OWSA 3TPAA 3TCFA 3E3KA 3MQ9A 4U4XA 5IKBA 1P99A 4FEBA 2I0CA 3DP6A 4ZEFA 1LFIA 2O1MA 4DCXA 4HCYA 4C1UA 2VD3A 2DWJA 3FVNA 3OO6A 4RJZA 3MP6A 4FJPA 1LAGE 3M3FA 4GL8A 4X1DA 1WODA 3THIA 3U94A 4XXUA 3FXQA 1JEUA 3TCGA 3O6IA 3VVEA 5A5XA 1B5JA 2AYSA 1MH3A 1MPBA 2DE4A 2DP8A 3OO7A 4R75A 1JW1A 2XXVA 4IO4A 3RQTA 4U1ZA 3CSGA 4YB6A 5ISUA 3UIFA 1A55A 3PPRA 4UA8A 4AB5A 1UIUA 4G4PA 4ZE9A 3V83A 3EHUA 3K2DA 3IOWA 2REGA 4PP0A 3C31A 4C1TA 3T96B 1B52A 4LQ2A 1B40A 4YMBA 2FNCA 1NNPA 2H99A 3VV5A 2OJTA 4RPNA 3H03A 4IY5A 1S50A 4ZEDA 1TFAA 3CFLA 4NF6B 4HW8A 1VFDA 4OYVA 3TQWA 2Z23A 3MZ9A 2HZKA 4H6DA 4NF8B 2F78A 2X7QA 1QUKA 3KN8A 2UXAA 1DTGA 1SW2A 3O6HA 3PUZE 3H06B 3TTKA 1BP5A 3EQ1A 1JVXA 2VHAA 3LSWA 2RC8A 3C36A 4G77A 5HPQA 1B58A 1OQGA 2DWAA 3CG3A 4RNSA 4YKJA 1URSA 4FE8A 4IY6A 4R9GA 1FQFA 5B7DA 1Y3QA 1EH3A 3N5LA 3LUYA 5I2NB 5JTYA 3D4GA 2XD2A 4KCDA 5AA2D 1OLAA 5CMKA 2I3VA 4TQUQ 5DVJA 3RY3A 2QJEA 4DXUA 1LB8A 3TUSA 2Y7PA 4NF6A 1HSLA 4X9TA 3KSXA 4QSEA 4BDLA 4BDMA 3QYTA 4JSOA 3KSJA 1NNKA 1B51A 3FD3A 4JWOA 4MLVA 3N6TA 1XVYA 1XHYA 1P1QA 4F19A 4FORA 2NOOA 3MPKA 3K0VA 4OEUA 3N94A 5I2KB 2DS9A 1PB8A 4XTCQ 4EUOA 3S9MC 3VLVA 1LGBC 1R9QA 1MXUA 5H8NA 4KYEA 3G3JA 1N84A 5L9MA 4MFIA 5K2XA 3KN7A 2ZYOA 3MUQA 3QXMA 4JDFA 2OK2A 4TLLB 3FVGA 2XXUA 4M4GA 3PPOA 3C32A 4ND9A 1QKBA 2NWJA 4GL0A 4XKRA 1FTMA 5H8SA 2XXWA 3LSLA 4R2FA 3IR1A 2F34A 4C0RA 2XX8A 1WDNA 1DMBA 3FJGA 4IGRA 3G3KA 3OENA 4NF4B 1MPCA 4POWA 3S9NC 2GHBA 4O3BA 3RGYA 5ITOA 2DE3A 4U21A 5BUUA 3OELA 1YPNA 1RYOA 4OWDA 1IQ7A 4RK2A 2R9JA 1SVXB 5K2YA 1SD3A 4GVOA 1N3WA 4G8NA 5H8NB 4QFKA 2ONKE 3OXNA 1WVJA 4OFJA 3ZS6A 1VR5A 4R9FA 1BTJA 4XIGQ 4EQ9A 2DXRA 3C4MA 5ICQA 3PUYE 3G3GA 3IOTA 3PMVA 3VLUA 2QMXA 2XXIA 1SDXA 3UK4A 3N26A 3RTWB 3QK6A 2KLFA 4OHNA 2E1SA 1YTVA 1JNFA 1Z7NE 1GV8A 3B7DA 5ICTA 4QF9A 4H5FA 3EPEA 3G3HA 3TYHA 4MF3A 4POXA 3MJNA 4NF4A 2I0BA 4G2ZA 4Z0IA 2OZZA 3OSQA 3WAFA 5I56A 3KFMA 2XX7A 1IXIA 2IEEA 3RT8A 1BKAA 4NWCA 1YCJA 1Y4TA 2DWHA 3HO7A 5A5XB 2UVIA 3TKDA 1FCKA 4R2BA 2PMSA 3ZKLA 3UA8A 1LLSA 5I58B 1ZBMA 3KN3A 2Q2CA 1IITA 2F6GA 1O7TA 3HPIA 3IO6A 1MM7A 1MY2A 3EHSA 3QSLA 3TEPA 3T66A 4KHZE 1H44A 3FUZA 2AIXA 2F97A 1ZIUA 3QIMA 3ILUB 4F18A 3TMGA 4ELQA 3PU5A 4F1VA 2B3BA 3D4CA 1Y4CA 4EDPA 4OEVA 2REJA 3C35A 5DVFA 3IB0A 1I6AA 1FTOA 1NKXA 2ANJA 2D21A 3FATA 3TAJA 5I56B 2O7UA 1SI0A 2VGQA 3Q25A 1QUJA 1CB6A 1ZTYA 1B3HA 2X7PA 3SEXA 1FQCA 2UYEA 1KWHA 3KEIA 1BIYA 4MH5A 4AQ4A 1B9JA 1LCFA 3QAXA 1IXCA 5H8HA 1POY1 2DSFA 2CMOA 2HAUA 5I57A 3H4ZA 4LATA 4IGTA 3TCHA 2YPNA 3HCQA 1BLFA 1SW4A 2O1LA 3PV0E 2BJJX 5AA4B 1AH5A 4QRZA 3MVXA 4BDNA 1N7WA 4X48A 3VVDA 5I2NA 4ZEBA 1MY3A 3AXFA 3Q26A 1OVTA 5FTHA 4RPOA 1NNFA 1VFEA 4ZDMA 1US5A 1MXWA 1H3DA 2A5TB 1MQGA 4ZEIA 1N7XA 5CMMA 3R7XA 1UTBB 1GTKA 4DXCA 1MY0A 4R72A 4ESWA 4U2RA 4GIZA 3CR9A 3MVWA 3C34A 5I57B 2B65A 3OMBA 1AOVA 3T9UA 3E4RA 2HFBA 4JSDA 4RK9A 5F7VA 4ONYA 3OOAA 4EF2A 2ONSA 5EHSA 1P1WA 1FQAA 4LP2B 4KYSA 4I9DA 3I5OA 4O3AA 3RT6B 1FQBA 3FV1A 3OSRA 2RCBA 4WEPA 2V25A 2RCAA 4GD5A 3Q28A 4XKNA 1F9BA 4YAHX 4F39A 2FA7A 3FVKA 1MPDA 4OFLA 2A5TA 2P0SA 2ZYNA 4HCWA 1TXFA 3USDA 4F3PA 1II5A 1UTBA 1B3FA 4GFRA 4OVJA 1B7HA 1H76A 2PX1A 3H3GA 1B5IA 5AA2A 5CM6A 2PT1A 2XD3A 3S2VA 2Y7WA 2Y84A 2IA4A 5JK4A 1B6HA 1FTKA 2R71A 2Z22A 4O3CA 3H6VA 2QMWA 3K1MA 5KDTA 2YLNA 3ODBA 4OERA 3KOSA 3T22A 1A54A 3W15C 2HEUA 5EYFA 2F8DA 1XC1A 2F7BA 3BKIB 3FJ7A 3KOTA 3OEKA 4LQ5A 2P1SA 2XXPA 1IXHA 1PBPA 2FYIA 1MDQA 1IZ1A 4OTEA 2HCAA 2A5SA 4PE5B 3O9PA 4OZ9A 4RXLA 1PBQA 2PVUA 2H98A 3FIRA 3CIJA 1OQHA 4NWDA 4ZEKA 1A7LA 2PYYA 4LONB 4PETA 2THIA 4AB6A 4P11A 3QUJA 3I3VA 4F1YA 4EXKA 5I58A 1QJMA 2Z8DA 4F3SA 1QW0A 1SYHA 3M3KA 3P7IA 4OENA 4F3BA 1VE4A 1EZPA 1I69A 2DVCA 4MLQA 3ZSFA 4QSDA 3TODA 2HXWA 5TPAB 3KJTA 1GR2A 1Y20A 1T0KA 3SEVA 4FAJA 2D5WA 1B05A 3MBPA 1MS7A 5ELVA 5AE4A 1A40A 4U4SA 3LBSA 1PC3A 2ZNUA 2X26A 4H65A 4I62A 1N04A 1RYXA 2H25A 5ITPA 1FTLA 3CVGA 2UYFA 1A8FA
chains in the Genus database with same CATH superfamily
3K6WA 1TWYA 3K6UA 4GBWA 4KYDA 2XXYA 5H8HB 4IR8A 1MQJA 5AA4A 3LC8A 1IXGA 3HV1A 4BLAA 4BDQA 5CRYA 1P1NA 3U92A 3R26A 1EZ9A 1XVXA 3FV2A 1AL3A 3IO4A 1ZKBA 3OO8A 4HE1A 4JVDA 1NI9A 1MQIA 1CE2A 3K00A 1XT8A 3MC2A 4GXSB 2XXHA 5F24A 4I40A 2VD2A 3MVZA 3SERA 1USYE 3A3CA 4H46A 4PGPA 1I6BA 2P2AA 1M5BA 2DYXA 2HZLA 2XX9A 4H45A 5DT6A 1RDZA 1I6QA 2XXRA 3FGSA 2XXXA 2ZYMA 2F3DA 4TLMB 3IB2A 4FIMA 3PPPA 2H9BA 3UGWA 4UACA 1UQWA 4P0GA 4F1UA 3TQLA 1FPJA 1URDA 3IK6B 3EF7A 1D9QA 1EYJA 4GOTA 2R6GE 3TDJA 3FZVA 1ANFA 4OVTA 1JW4A 2OBGA 3M3LA 4N15A 1OIBA 4EQBA 1R9LA 1LBBA 3PUVE 3KBRA 1B4ZA 3FJMA 5B70A 4LVQA 1H45A 3DP8A 2RC9A 4IO5A 2PBWA 3O28A 4NF5B 5H8FB 5H8QA 2H5YA 3A3UA 4N07A 2F6PA 4ELRA 4O8MA 1JW5A 5IZ1A 4FECA 1NV5A 2NUVA 2F35A 2V4CA 1YAEA 3U93A 5BWJA 2AL4A 3LSXA 3MP1A 2F7AA 2V3QA 4FBPA 2L5VA 4O7IA 3W9WA 1NH8A 3A29A 4P3LA 2H4IA 1H43A 4R75A 3JZJA 4GWXA 4R74A 1LBXA 4XKQA 4NF8A 5KZTA 1NMUA 4Q30B 2FBPA 1D9YA 3RUMA 1QUIA 4R6HA 1K9YA 4Q5TA 1MY1A 3PMWA 4YU0A 1B0LA 3O29A 3H6TA 4MHFA 3UP9A 4ZZEA 3IORA 4ZZAA 4O94A 1SQYA 3W9VA 3G7WA 2QPQA 5ET5A 1GVCA 2ZYKA 3TTRA 1USYH 2B4MA 5H8QB 4F22A 1AIVA 5JEIA 2CZIA 4I1DA 1D9VA 4G8HA 4DXBA 4QFNA 3SKPA 4HE0A 4KPTA 4PFTA 1DSNA 3Q29A 4RA1A 4I3EA 3U65A 2D3IA 1ZLQA 1SYIA 2JJKA 1B7UA 1SW1A 2OWSA 3DP6A 4OANA 5I3SA 4ZEFA 2O1MA 2VD3A 4FJPA 1WODA 1FBDA 3TCGA 4JVCA 2DE4A 3RQTA 4U1ZA 4YB6A 5ISUA 3UIFA 1A55A 3PPRA 1UIUA 1NV6A 2REGA 4C1TA 3VV5A 3H03A 3CFLA 4H6DA 4NF8B 1QUKA 3KN8A 3EQ1A 1JVXA 2VHAA 3C36A 4G77A 1B58A 1OQGA 3CG3A 1URSA 4R9GA 3N5LA 4PBQA 2I3VA 2QJEA 4DXUA 1LB8A 4NF6A 1HSLA 4X9TA 3QYTA 4JWOA 2QVUA 4GWZA 1XHYA 1P1QA 4F19A 4FORA 3MPKA 4OEUA 3N94A 1PB8A 5EQ7A 3S9MC 1LGBC 1R9QA 5H8NA 3V5AA 5K2XA 4JDFA 3FVGA 2P3NA 5H8SA 4R2FA 4C0RA 1WDNA 4P1EA 3S9NC 1MPCA 3OELA 4RK2A 1IQ7A 4G8NA 4QFKA 2ONKE 4OFJA 4R9FA 3UK4A 3N26A 1YTVA 4P8BA 3G3HA 4Z0IA 3WAFA 4PTKA 3KFMA 2IEEA 1YCJA 3HO7A 2UVIA 2PMSA 1ZBMA 3KN3A 4GWWA 1O7TA 3IO6A 3TEPA 1H44A 3FUZA 2F97A 2ZZVA 4F18A 2REJA 1I6AA 2D21A 2O7UA 4OA4A 3Q25A 1CB6A 1FQCA 2DDKA 3KEIA 1IXCA 5DW8A 5I57A 3TCHA 2YPNA 2O1LA 1AH5A 2XWKA 1K9ZA 3Q26A 1OVTA 4RPOA 1US5A 4DI4B 1H3DA 1MQGA 1GTKA 4U2RA 3C34A 1AOVA 3T9UA 2ZZXA 4JSDA 5F7VA 4ONYA 2Q8MA 1FQBA 2GQ1A 2F3BA 2RCBA 4GD5A 1F9BA 2A5TA 1B3FA 2XA5A 2PX1A 3S2VA 2IA4A 4O3CA 2QMWA 5KDTA 2YLNA 3ODBA 3KOSA 3T22A 1XC1A 2F7BA 3BKIB 3FJ7A 1MDQA 4OTEA 2A5SA 4PAKA 2H98A 3FIRA 4NWDA 4ZEKA 4LONB 2THIA 1SYHA 1VE4A 3ZSFA 1GR2A 1Y20A 1T0KA 1BK4A 4I62A 1RYXA 3CVGA 3RN8A 4PAFA 4PDHA 1MG1A 3HSTA 3WAEA 3K02A 4PFUA 5IGAA 3ONMA 2PCRA 5EQAA 5DTBA 2GFEA 3L6HA 4QFLA 4LZ8A 1Y1ZA 5FTIA 5L8DA 3G3IA 4GX6A 4JWYA 4PE3A 4ELPA 1NL5A 2I4CA 3KG2A 4XF5A 3BBRA 4N8YA 1XS5A 4N6PA 1NH7A 3VLWA 5EQ8A 3HN0A 2QL3A 3BFTA 3SEYA 1MM6A 2ALUA 3DP4A 1DTZA 1ZU0A 1LFGA 5IM2A 5KDTB 1N3XA 1D4NA 5CMCA 3LSFB 3L6GA 1KA0A 1LFHA 2QS1A 2F7CA 3IFCA 2ZNTA 3SDFA 4GXAA 2VP1A 3FXRA 2XXTA 1MXYA 3QMFA 1JQFA 5FHOA 4OVPA 1INPA 4XKPA 4MMPA 1PEBA 1B2HA 3UN6A 4XEQA 2CZKA 2O68A 2AL5A 4JVIA 2Z8FA 4G8MA 1R6ZA 3VDFA 1ZMGA 4YB5A 2E0SA 3R6UA 5H8FA 2LAOA 3ECRA 3FBPA 1URGA 2RF1A 3RNNA 4G68C 1RDXA 3RYDA 4KR5A 1O63A 4NGUA 2CEYA 4KQPA 5HBCA 2QVRA 4PBHA 4XFEA 1FW0A 4PQJA 4GF8A 1A8EA 1Q9DA 3RLFE 3FXBA 1MXVA 2QRYA 3IJXB 1FTJA 2GHAA 4ZECA 3GBBA 3H7MA 3K1PA 4DCYA 3RTFB 3K4UA 1L5TA 4N6KA 3RPLB 4YMAA 3HHGA 1J1NA 3S9EA 2Q8JA 5M2VA 3B6WA 2WBBA 1NNTA 5DYHA 4YKIA 5DEXA 2QS2A 1LAXA 2QS4A 1LCTA 4H67A 2NXOA 2O7IA 4QFPA 3GXAA 4F29A 4F3GA 1DPPA 4L17A 4YKPA 4X8RA 3T9HB 2Y7KA 2XWIA 2OCUA 3O2AA 2RINA 1B1XA 1FQDA 3TFLA 2RKMA 4GX4A 4WXJA 3CFZA 3IOUA 4NF0A 4JWXA 5I59B 2Y5KA 2WKYA 4NE4A 3MVYA 5J16A 3S4UA 1B7ZA 3I6VA 1JETA 2GH9A 1MQHA 2O6AA 2Y7IA 4H8IA 2OLBA 1XOCA 1QULA 3K6VA 2Q9TA 4LA9A 3PUWE 4NQ8A 3T0JA 2F36A 1P1UA 3U72A 2OWZA 2CZLA 5FHNA 1B1HA 5FHMA 4U23A 4EXLA 4U1OA 4LN5A 1P1OA 3VXCA 3MZBA 4E0XA 3CG1A 4RY1A 3E9XA 5LTCA 3MQ9A 5IKBA 1P99A 1LFIA 4HCYA 4C1UA 3OO6A 4XXUA 3VVEA 3O6IA 5A5XA 1MH3A 3OO7A 4IO4A 4ZE9A 4AB5A 4NX1A 4G4PA 3K2DA 3C31A 4YMBA 4LQ2A 1B40A 1QGXA 4RPNA 2XWVA 1S50A 4NF6B 4HW8A 1VFDA 2Z23A 3MZ9A 2HZKA 4MEVA 3O6HA 2UXAA 1DTGA 2XXKA 1BP5A 1IMBA 2DWAA 4RNSA 4IY6A 3BIHA 4KCDA 3LUZA 4X04A 5DVJA 3B50A 2Y7PA 1G0IA 3KSXA 4BDLA 4BDMA 4JSOA 3KSJA 1B51A 3FD3A 4MLVA 3N6TA 1NUZA 1FPGA 3K0VA 3D1RA 2DS9A 2WEFA 5L9MA 2ZYOA 2OK2A 2NWJA 4GL0A 3IR1A 3G3KA 3RGYA 5BUUA 1SVXB 5K2YA 4GWYA 4XIGQ 1BTJA 2DXRA 3C4MA 5ICQA 3G3GA 3IOTA 3VLUA 2KLFA 1Z7NE 1GV8A 5EYGA 5LDZA 3EPEA 3TYHA 2OZZA 2XX7A 1IXIA 5A5XB 1FCKA 3ZKLA 3UA8A 1IITA 3ILUB 4ELQA 1Y4CA 3C35A 5DVFA 3MSTA 3IB0A 1FTOA 3TAJA 1SI0A 2CEXA 1B3HA 2X7PA 1IMCA 1BIYA 1FPEA 1POY1 4IGTA 1BLFA 1SW4A 2BJJX 4QRZA 4BDNA 1N7WA 1VFEA 1MXWA 2A5TB 1N7XA 4R72A 4ESWA 2WBDA 2B65A 2PFZA 3E4RA 4O7MA 4RK9A 4EF2A 1P1WA 1FQAA 4O3AA 3I5OA 3OSRA 4WEPA 2RCAA 2FIEA 3EKIA 1LEVA 1MPDA 4HCWA 1TXFA 3USDA 1II5A 5CM6A 5T3JA 1FTKA 2Z22A 3H6VA 3K1MA 4MNCA 4OERA 1A54A 3KOTA 2HXRA 2P1SA 4N91A 2FYIA 4RXLA 1A7LA 4PETA 4F1YA 3QUJA 3I3VA 4NAPA 3P7IA 2DVCA 4MLQA 1FPBA 3E78A 1NV7A 1B05A 3MBPA 5AE4A 1A40A 2X26A 1N04A 4NN3A 4WEDA 1PB9A 1FPIA 5HM4B 3CHGA 2ZXTA 1NV4A 2I58A 3GZGA 1Y3NA 3C9HA 5CMBA 1OMPA 2G29A 3TTLA 2DWIA 3MW0A 4Q0CA 3PPNA 5ICTA 4PFWA 2Y5LA 4G68B 3O6GA 1Y1MA 3SEUA 2ZNSA 1FBHA 3OEMA 3CSBA 5TP9A 3K01A 4GLIA 1D3KA 3PMXA 4I8CA 2DVZA 1MH4A 1DBZA 4OXVA 4MBPA 4K3FA 1NV1A 4THIA 1NFTA 4P47A 1RDYA 4YB7A 4F3SA 4R6KA 1B3GA 1PB7A 1LB9A 2HAVA 4LUBA 1IEJA 4DIGA 3M8UA 4AS5A 3G3FA 5EHMA 4GX3A 4Q8RA 4DI3D 4HS7A 3V89B 3SETA 1ZJLA 1O64A 2YJPA 4QSCA 1Q35A 2HQ0A 3EN3A 1RKMA 1MY4A 1IIWA 5LOMA 1R1NA 4F2QA 4LZ5A 3T9XB 4GQOA 1B0HA 1LAFE 3B6QA 2G93A 1FPLA 4GWSA 2CZHA 1G0HA 2I3WA 3U1OA 1ATGA 3SESA 3IAZA 5CBSA 3KGCA 4NMYA 1MRPA 1Y9UA 2UVGA 4G68A 3RPLA 1OVBA 3LR1A 1SBPA 3K6XA 2Q88A 4DLDA 2Q89A 5TP9B 4FATA 5DEXB 4JXIA 4KD5A 4H0WA 4EQ7A 2ESNA 4GWOA 3EHTA 1JEVA 5AA3A 3C33A 1MDP1 2O69A 4P56A 1LSTA 4QFOA 2ONRA 5TU0A 4MNIA 4OETA 1CNQA 3VE1B 1DPEA 5I59A 2QSXA 3GLBA 2F5XA 1EYIA 2I6EA 3FASA 1A99A 1N76A 3PPQA 1MXXA 3FVOA 3JV9A 5IAIA 1Z7ME 1UTHB 3IOVA 3BFUA 3PD9A 4QHQA 1Y3PA 1B5HA 1UIVA 1SW5A 4OFOA 1PDAA 3ILTB 4GBVA 5JTYB 3T96B 2DXYA 3F11A 1JVYA 2DOJA 4EF1A 5CI5A 3KBZA 3B6TA 3FXUA 4PFRA 1MXZA 4P1LA 2O84X 1EZOA 2GRVA 3MPLA 1LBCA 2VPOA 1TT1A 1M5DA 3VVFA 1LAHE 4OQOA 4PF6A 3U8QA 3MWBA 4P0IA 1LBYA 4R6YA 1VSOA 5J1DA 2OWTA 3TPAA 3E3KA 4U4XA 2DWJA 4RJZA 3U94A 4GL8A 3M3FA 4X1DA 3THIA 1JEUA 1B5JA 1MPBA 2DP8A 2R8TA 4PP0A 1B52A 2FNCA 2H99A 4IY5A 1TFAA 2PFYA 3TQWA 2X7QA 3PUZE 3TTKA 1EZPA 1FBGA 4MIJA 4NHBA 4PGNA 5HPQA 1VDWA 4FE8A 1EH3A 2OX3A 3LUYA 5I2NB 5JTYA 2XD2A 5AA2D 1OLAA 4TQUQ 3TUSA 2FIXA 4PDDA 4QSEA 4HE2A 4AS4A 1XVYA 4EUOA 1MXUA 3KN7A 4TLLB 3MUQA 2XXUA 4M4GA 1QKBA 1FTMA 2XX8A 4PFBA 4IGRA 1DK4A 4POWA 2GHBA 4O3BA 5A5LA 4OWDA 1RYOA 1SD3A 4GVOA 1N3WA 1WVJA 3ZS6A 1VR5A 1IMFA 3PUYE 2QMXA 2XXIA 4ESXA 1JNFA 4QF9A 4H5FA 4POXA 4NF4A 3RT8A 1BKAA 3TKDA 5ET7A 5I58B 2Q2CA 3GYYA 3EHSA 3T66A 4KHZE 4N6DA 2AIXA 3QIMA 3ROJA 2B3BA 4I3YA 3NOHA 2ANJA 3FATA 5I56B 1ZTYA 3SEXA 1KWHA 1B9JA 3QAXA 3H4ZA 3HCQA 3PV0E 2WYPA 2WYKA 4X48A 3VVDA 5I2NA 3ISPA 1MY3A 3KC0A 5FTHA 1NNFA 4UABA 4DXCA 5CMMA 1MY0A 5EYHA 3CR9A 5IZ3A 1FBEA 3OMBA 2HFBA 1XI6A 1DCUA 3OOAA 2ONSA 4MNPA 4KYSA 4I9DA 3RT6B 4XKNA 3FV1A 3Q28A 2FA7A 2ZYNA 1UTBA 4GFRA 4OVJA 1B7HA 1H76A 5AA2A 1B5IA 5FBPA 2PT1A 2Y84A 5JK4A 1IMAA 3W15C 2HEUA 5EYFA 2F8DA 4LQ5A 3OEKA 1IXHA 1PBPA 1LBVA 2HCAA 2P3VA 4OZ9A 3MYUA 1PBQA 2PVUA 1FRPA 2PYYA 5I58A 4EXKA 4GWUA 4OVRA 1QJMA 2Z8DA 3LV0A 4QSDA 2HXWA 5TPAB 3SEVA 4FAJA 2WX9A 2ZNUA 1NV0A 2H25A 5ITPA 3IB1A 2UYFA 5EQ9A 4IO3A 5CC2A 1KA1A 4IO7A 1FBFA 2BJIA 4OMBA 1S7YA 3DLNA 1IMEA 4OESA 4P9KA 5L9OA 4RYAA 2I4BA 3H6UA 4ELOA 3HHFA 3IX1A 1B3LA 4H1XA 5ESYA 4R73A 2QS3A 1M5FA 1AMFA 3V8XB 3MAMA 1FPKA 4LZ7A 1N0TA 1NUXA 2DE2A 1OLCA 3MP8A 4PC9A 3MZ1A 5AA2B 1QKAA 4N8GA 4N4UA 4N13A 3DM0A 4DZ1A 1M5EA 2I49A 5KCJA 5F1QA 1FJ9A 3S9LC 1NV2A 2RC7A 4G61A 3SEWA 1TFDA 3TZAA 5TPAA 1NUWA 4YZZA 2XHDA 4MAGA 4ECFA 1S9TA 3K1NA 1LBZA 2NVUB 1LBWA 3IJOB 3KJ7A 4IO6A 4NTLA 4GRKA 4IB2A 2Q2AA 3VXBA 1MQDA 4H8JA 4N81A 4OVSA 3IL1B 2PT2A 4M1VA 3TELA 5ET6A 5I84A 4F31B 4JB7A 4YICA 2B3FA 3OO9A 2QFLA 5DVIA 2ABHA 5L9SA 4FEDA 3PGFA 3BIGA 4IO2A 3JYRA 2UVHA 3OD7A 1SI1A 1HSJA 4TOZA 2W7YA 4NF5A 3T93B 4PFIA 1M5CA 4PFYA 3GBAA 4PF8A 4KCCA 3KZGA 2VOZA 3N6UA 3RPWA 3DELB 4WKMA 1HSEA 4H5GA 5KCJB 4MX6A 3Q27A 1QVSA 3TTMA 4HTGA 1UTHA 3E13X 1ELJA 5AA1A 4KI0E 3O66A 4NEDA 1Q1KA 1SPIA 2V84A 3UORA 2Z8EA 3PUXE 1YYZA 2KQZA 1IUDA 4DE8A 3PTYA 2V3UA 2ZZWA 3CRBA 2O51A 3QUFA 1US4A 1B3EA 4JBZA 1B32A 4BDOA 4ZS9A 3T9VA 2QVVA 1GGGA 2I48A 3SZPA 4DDDA 3H6WA 3HFUA 3PD8A 4X1BA 1POTA 3CI8A 3IFAA 4E0WA 4F2OA 1EU8A 3CFXA 4YKKA 5CBRA 3O97A 2XXQA 4U22A 5I2KA 1B4HA 1NUYA 4Z7EA 4HXVA 2DQVA 1FQEA 2V3TA 1B46A 3ZKKA 2Y7RA 3B8BA 3A09A 4ISUA 2UVJA 4KFQA 3TTNA 4ZE8A 2V93A 1DOTA 4N17A 2M8CA 2ZMBA 4BDRA 2FVZA 4PAIA 3VFJA 3TCFA 4FEBA 2I0CA 4DCXA 3FVNA 3MP6A 1LAGE 4QBAA 3FXQA 2AYSA 3KC1A 1JW1A 2XXVA 3CSGA 4UA8A 1YZ0A 3V83A 3EHUA 3IOWA 2B4LA 1NNPA 2OJTA 4ZEDA 4OYVA 2F78A 4KXPA 1SW2A 3H06B 3LSWA 2RC8A 4YKJA 5B7DA 4PCDA 1FQFA 1Y3QA 3D4GA 2VT5A 5CMKA 3RY3A 1FPFA 1FBPA 1NNKA 2NOOA 5I2KB 4XTCQ 2HHMA 3VLVA 3E79A 4KYEA 3G3JA 1N84A 4MFIA 3QXMA 2VPNA 3PPOA 3C32A 4ND9A 4XKRA 5ET8A 1FBCA 2XXWA 3LSLA 2F34A 1DMBA 3FJGA 1JP4A 3OENA 4NF4B 5ITOA 2DE3A 4U21A 1YPNA 2HPGA 2R9JA 4MCOA 5H8NB 3OXNA 4EQ9A 5I5PA 3PMVA 1SDXA 3RTWB 3QK6A 4OHNA 2E1SA 1EYKA 3B7DA 4MF3A 2Q74A 3MJNA 2I0BA 4G2ZA 4OVQA 3OSQA 5I56A 4NWCA 1Y4TA 2DWHA 4R2BA 1LLSA 2F6GA 3HPIA 1MM7A 1MY2A 3QSLA 1KZ8A 1ZIUA 3TMGA 3PU5A 4F1VA 3D4CA 4EDPA 4OEVA 1NKXA 2VGQA 1QUJA 2UYEA 4MH5A 4AQ4A 1LCFA 5H8HA 5IZ3B 2DSFA 2CMOA 2HAUA 4LATA 3T1BA 5AA4B 3MVXA 4QXDA 4ZEBA 3AXFA 1FPDA 4ZDMA 1NV3A 1YXIA 4ZEIA 1FTAA 3R7XA 1UTBB 2FHYA 4GIZA 3MVWA 5I57B 1FSAA 1AWBA 5EHSA 4LP2B 2V25A 4YAHX 4F39A 3FVKA 4OFLA 5I7IA 2P0SA 1FJ6A 4F3PA 1IMDA 3H3GA 2XD3A 2Y7WA 1B6HA 2R71A 4MJOA 2MKZA 2XXPA 2XWOA 1IZ1A 4PE5B 3O9PA 3CIJA 1OQHA 4AB6A 4P11A 1QW0A 4NG7A 3M3KA 4OENA 4F3BA 1I69A 3TODA 3KJTA 2D5WA 5ELVA 1MS7A 4U4SA 3LBSA 1PC3A 4H65A 5IZZA 2KR0A 1FTLA 1A8FA
chains in the Genus database with same CATH topology
3RN8A 4WEDA 1PB9A 3K6WA 4IO7A 5CC2A 1MG1A 1TWYA 3K6UA 5HM4B 3HSTA 3WAEA 2ZXTA 3K02A 4KYDA 4OMBA 1S7YA 4PFUA 2XXYA 2I58A 5H8HB 3DLNA 3GZGA 3ONMA 1Y3NA 3C9HA 1MQJA 5CMBA 5DTBA 2GFEA 4OESA 5AA4A 5L9OA 3L6HA 4RYAA 3LC8A 1IXGA 3HV1A 4QFLA 2I4BA 3H6UA 1OMPA 4LZ8A 4BLAA 4ELOA 3HHFA 2G29A 3IX1A 1B3LA 4BDQA 3TTLA 1Y1ZA 5CRYA 2DWIA 3MW0A 4H1XA 1P1NA 4Q0CA 5FTIA 3U92A 3PPNA 4R73A 5L8DA 2QS3A 3R26A 1M5FA 3G3IA 1AMFA 4JWYA 1EZ9A 1XVXA 3FV2A 4PFWA 1AL3A 3IO4A 1ZKBA 3OO8A 3V8XB 4ELPA 1NL5A 3MAMA 2I4CA 4G68B 3O6GA 1Y1MA 3SEUA 3KG2A 2ZNSA 3BBRA 1MQIA 3OEMA 1CE2A 3CSBA 3K00A 1XT8A 5TP9A 1XS5A 3MC2A 4N6PA 4LZ7A 1NH7A 1N0TA 3K01A 4GLIA 1D3KA 2XXHA 4GXSB 3VLWA 3PMXA 2DE2A 4I8CA 2DVZA 3HN0A 2QL3A 2VD2A 3MVZA 3SERA 3BFTA 1MH4A 1OLCA 3MP8A 3MZ1A 3SEYA 1MM6A 1USYE 2ALUA 3A3CA 4OXVA 4MBPA 5AA2B 1I6BA 2P2AA 4K3FA 3DP4A 1DTZA 1ZU0A 1QKAA 1LFGA 1M5BA 2DYXA 2HZLA 4THIA 1NFTA 4N13A 2XX9A 3DM0A 1M5EA 4DZ1A 5DT6A 3V5AA 5KDTB 1N3XA 2I49A 1I6QA 4YB7A 2XXRA 1D4NA 1B3GA 1PB7A 1LB9A 2HAVA 4LUBA 4R6KA 5CMCA 3LSFB 5KCJA 3L6GA 1IEJA 3FGSA 5F1QA 1LFHA 2QS1A 2F7CA 2XXXA 4DIGA 2ZYMA 3M8UA 2ZNTA 4TLMB 3SDFA 3IB2A 4FIMA 3G3FA 2VP1A 3PPPA 3FXRA 4GXAA 5EHMA 3S9LC 3V89B 2H9BA 4Q8RA 3UGWA 2RC7A 2XXTA 1MXYA 4HS7A 4UACA 1JQFA 1UQWA 1ZJLA 4P0GA 5FHOA 3SETA 1O64A 2YJPA 3TQLA 4F1UA 1URDA 3IK6B 1TFDA 3EF7A 4QSCA 3TZAA 5TPAA 4GOTA 2R6GE 1Q35A 3TDJA 4XKPA 2HQ0A 3FZVA 1ANFA 3EN3A 1JW4A 1RKMA 1PEBA 2OBGA 1MY4A 1IIWA 1B2HA 2XHDA 1R1NA 3M3LA 4LZ5A 3UN6A 4F2QA 5LOMA 2O68A 3T9XB 4ECFA 2AL5A 4GQOA 1B0HA 2Z8FA 4G8MA 1S9TA 3K1NA 1LAFE 1R6ZA 2NVUB 1OIBA 3VDFA 1ZMGA 3IJOB 3KJ7A 4IO3A 4EQBA 4YB5A 2E0SA 1R9LA 3B6QA 1LBBA 3PUVE 2LAOA 2G93A 3ECRA 3R6UA 5H8FA 3KBRA 1B4ZA 4IO6A 3FJMA 1URGA 2RF1A 5B70A 3RNNA 4LVQA 1H45A 3DP8A 2RC9A 4IO5A 2I3WA 4G68C 4NTLA 2PBWA 3U1OA 4GRKA 4IB2A 2Q2AA 4KR5A 1O63A 1ATGA 3O28A 3SESA 3VXBA 1MQDA 3IAZA 4ESXA 4H8JA 4NF5B 5CBSA 3KGCA 4KQPA 5HBCA 3IL1B 2PT2A 4M1VA 4NMYA 1FW0A 3TELA 4PQJA 4F31B 1MRPA 5I84A 4JB7A 1Y9UA 4YICA 2UVGA 4G68A 2B3FA 4GF8A 5H8FB 5H8QA 1OVBA 3LR1A 1SBPA 3K6XA 2Q88A 3OO9A 1A8EA 2H5YA 3A3UA 4N07A 5DVIA 2ABHA 3RLFE 2Q89A 5TP9B 4DLDA 1MXVA 4FATA 2QRYA 5DEXB 5L9SA 3IJXB 4FEDA 3PGFA 1FTJA 2F6PA 2GHAA 4IO2A 4H0WA 4JXIA 3GBBA 4KD5A 4ELRA 4ZECA 1JW5A 3JYRA 2UVHA 3H7MA 3K1PA 1SI1A 2ESNA 3OD7A 4FECA 4DCYA 1HSJA 4GWOA 4TOZA 2NUVA 2W7YA 4NF5A 3T93B 3EHTA 1M5CA 2F35A 4PFYA 1YAEA 3RTFB 3U93A 3GBAA 1JEVA 3K4UA 1L5TA 4KCCA 3KZGA 4YMAA 2VOZA 5AA3A 3HHGA 3SEWA 3N6UA 3RPWA 5BWJA 1J1NA 3C33A 2Q8JA 5M2VA 3B6WA 3S9EA 1MDP1 1NNTA 3DELB 2O69A 4WKMA 5DYHA 2AL4A 4YKIA 5DEXA 1HSEA 2QS2A 4H5GA 1LSTA 3IB1A 4QFOA 5KCJB 2ONRA 5TU0A 3LSXA 3MP1A 2F7AA 1LAXA 3Q27A 4OETA 1QVSA 3TTMA 1UTHA 2QS4A 2V3QA 1ELJA 1LCTA 3E13X 3O66A 4HTGA 1DPEA 4KI0E 4H67A 4NEDA 5AA1A 3VE1B 1Q1KA 2NXOA 2O7IA 4QFPA 3W9WA 1NH8A 3GXAA 4F29A 5I59A 2QSXA 4F3GA 1DPPA 2V84A 4L17A 2Z8EA 3UORA 3GLBA 3PUXE 1IUDA 2F5XA 2I6EA 4DE8A 3FASA 4YKPA 3T9HB 1A99A 2V3UA 3CRBA 1N76A 2H4IA 2Y7KA 2O51A 1H43A 3QUFA 3JZJA 1MXXA 1US4A 1B3EA 2OCUA 3FVOA 3O2AA 3PPQA 2RINA 4R74A 4XKQA 4NF8A 1B1XA 4JBZA 1FQDA 1NMUA 2RKMA 3JV9A 3TFLA 5IAIA 4WXJA 4Q30B 3CFZA 5KZTA 1Z7ME 1D9YA 1UTHB 3IOVA 1B32A 4BDOA 3BFUA 3IOUA 3PD9A 4ZS9A 4QHQA 3T9VA 3RUMA 1Y3PA 4JWXA 1QUIA 1B5HA 5I59B 1GGGA 1UIVA 2I48A 1SW5A 4R6HA 4DDDA 3H6WA 1MY1A 4OFOA 1PDAA 3PMWA 3ILTB 4Q5TA 2WKYA 4NE4A 4YU0A 1B0LA 3MVYA 2DXYA 3H6TA 3O29A 3F11A 3PD8A 3UP9A 1JVYA 4ZZEA 2DOJA 1POTA 3CI8A 3IORA 4X1BA 5CI5A 4ZZAA 4EF1A 3S4UA 1B7ZA 3I6VA 1SQYA 4E0WA 4YZZA 4F2OA 3B6TA 1JETA 3FXUA 1EU8A 3CFXA 1MXZA 4YKKA 3O97A 2GH9A 3G7WA 2XXQA 5JTYB 3W9VA 5CBRA 1MQHA 2O84X 2O6AA 4U22A 2Y7IA 5I2KA 1EZOA 1B4HA 2QPQA 4Z7EA 4H8IA 1GVCA 2DQVA 2GRVA 2OLBA 1XOCA 2ZYKA 3MPLA 1FQEA 1QULA 1LBCA 1USYH 3K6VA 3TTRA 2Q9TA 4LA9A 5H8QB 4F22A 1TT1A 1AIVA 1M5DA 2V3TA 5JEIA 1B46A 3VVFA 1LAHE 3ZKKA 2Y7RA 3PUWE 4OQOA 4I1DA 1D9VA 2F36A 3A09A 4G8HA 4ISUA 4DXBA 2UVJA 1P1UA 4QFNA 3U8QA 3U72A 3SKPA 4KFQA 3TTNA 2CZLA 4KPTA 5FHNA 3MWBA 4PFTA 1B1HA 1DSNA 1DOTA 2V93A 4P0IA 5FHMA 4ZE8A 2M8CA 4U23A 3Q29A 4U1OA 4EXLA 2ZMBA 1P1OA 4RA1A 3VXCA 3MZBA 2D3IA 4BDRA 1ZLQA 4R6YA 4E0XA 1SYIA 3CG1A 1VSOA 4RY1A 3VFJA 1B7UA 3E9XA 1SW1A 4EQ7A 5J1DA 2OWTA 2OWSA 3TPAA 3TCFA 3E3KA 3MQ9A 4U4XA 5IKBA 1P99A 4FEBA 2I0CA 3DP6A 4ZEFA 1LFIA 2O1MA 4DCXA 4HCYA 4C1UA 2VD3A 2DWJA 3FVNA 3OO6A 4RJZA 3MP6A 4FJPA 1LAGE 3M3FA 4GL8A 4X1DA 1WODA 3THIA 3U94A 4XXUA 3FXQA 1JEUA 3TCGA 3O6IA 3VVEA 5A5XA 1B5JA 2AYSA 1MH3A 1MPBA 2DE4A 2DP8A 3OO7A 4R75A 1JW1A 2XXVA 4IO4A 3RQTA 4U1ZA 3CSGA 4YB6A 5ISUA 3UIFA 1A55A 3PPRA 4UA8A 4AB5A 1UIUA 4G4PA 4ZE9A 3V83A 3EHUA 3K2DA 3IOWA 2REGA 4PP0A 3C31A 4C1TA 3T96B 1B52A 4LQ2A 1B40A 4YMBA 2FNCA 1NNPA 2H99A 3VV5A 2OJTA 4RPNA 3H03A 4IY5A 1S50A 4ZEDA 1TFAA 3CFLA 4NF6B 4HW8A 1VFDA 4OYVA 3TQWA 2Z23A 3MZ9A 2HZKA 4H6DA 4NF8B 2F78A 2X7QA 1QUKA 3KN8A 2UXAA 1DTGA 1SW2A 3O6HA 3PUZE 3H06B 3TTKA 1BP5A 3EQ1A 1JVXA 2VHAA 3LSWA 2RC8A 3C36A 4G77A 5HPQA 1B58A 1OQGA 2DWAA 3CG3A 4RNSA 4YKJA 1URSA 4FE8A 4IY6A 4R9GA 1FQFA 5B7DA 1Y3QA 1EH3A 3N5LA 3LUYA 5I2NB 5JTYA 3D4GA 2XD2A 4KCDA 5AA2D 1OLAA 5CMKA 2I3VA 4TQUQ 5DVJA 3RY3A 2QJEA 4DXUA 1LB8A 3TUSA 2Y7PA 4NF6A 1HSLA 4X9TA 3KSXA 4QSEA 4BDLA 4BDMA 3QYTA 4JSOA 3KSJA 1NNKA 1B51A 3FD3A 4JWOA 4MLVA 3N6TA 1XVYA 1XHYA 1P1QA 4F19A 4FORA 2NOOA 3MPKA 3K0VA 4OEUA 3N94A 5I2KB 2DS9A 1PB8A 4XTCQ 4EUOA 3S9MC 3VLVA 1LGBC 1R9QA 1MXUA 5H8NA 4KYEA 3G3JA 1N84A 5L9MA 4MFIA 5K2XA 3KN7A 2ZYOA 3MUQA 3QXMA 4JDFA 2OK2A 4TLLB 3FVGA 2XXUA 4M4GA 3PPOA 3C32A 4ND9A 1QKBA 2NWJA 4GL0A 4XKRA 1FTMA 5H8SA 2XXWA 3LSLA 4R2FA 3IR1A 2F34A 4C0RA 2XX8A 1WDNA 1DMBA 3FJGA 4IGRA 3G3KA 3OENA 4NF4B 1MPCA 4POWA 3S9NC 2GHBA 4O3BA 3RGYA 5ITOA 2DE3A 4U21A 5BUUA 3OELA 1YPNA 1RYOA 4OWDA 1IQ7A 4RK2A 2R9JA 1SVXB 5K2YA 1SD3A 4GVOA 1N3WA 4G8NA 5H8NB 4QFKA 2ONKE 3OXNA 1WVJA 4OFJA 3ZS6A 1VR5A 4R9FA 1BTJA 4XIGQ 4EQ9A 2DXRA 3C4MA 5ICQA 3PUYE 3G3GA 3IOTA 3PMVA 3VLUA 2QMXA 2XXIA 1SDXA 3UK4A 3N26A 3RTWB 3QK6A 2KLFA 4OHNA 2E1SA 1YTVA 1JNFA 1Z7NE 1GV8A 3B7DA 5ICTA 4QF9A 4H5FA 3EPEA 3G3HA 3TYHA 4MF3A 4POXA 3MJNA 4NF4A 2I0BA 4G2ZA 4Z0IA 2OZZA 3OSQA 3WAFA 5I56A 3KFMA 2XX7A 1IXIA 2IEEA 3RT8A 1BKAA 4NWCA 1YCJA 1Y4TA 2DWHA 3HO7A 5A5XB 2UVIA 3TKDA 1FCKA 4R2BA 2PMSA 3ZKLA 3UA8A 1LLSA 5I58B 1ZBMA 3KN3A 2Q2CA 1IITA 2F6GA 1O7TA 3HPIA 3IO6A 1MM7A 1MY2A 3EHSA 3QSLA 3TEPA 3T66A 4KHZE 1H44A 3FUZA 2AIXA 2F97A 1ZIUA 3QIMA 3ILUB 4F18A 3TMGA 4ELQA 3PU5A 4F1VA 2B3BA 3D4CA 1Y4CA 4EDPA 4OEVA 2REJA 3C35A 5DVFA 3IB0A 1I6AA 1FTOA 1NKXA 2ANJA 2D21A 3FATA 3TAJA 5I56B 2O7UA 1SI0A 2VGQA 3Q25A 1QUJA 1CB6A 1ZTYA 1B3HA 2X7PA 3SEXA 1FQCA 2UYEA 1KWHA 3KEIA 1BIYA 4MH5A 4AQ4A 1B9JA 1LCFA 3QAXA 1IXCA 5H8HA 1POY1 2DSFA 2CMOA 2HAUA 5I57A 3H4ZA 4LATA 4IGTA 3TCHA 2YPNA 3HCQA 1BLFA 1SW4A 2O1LA 3PV0E 2BJJX 5AA4B 1AH5A 4QRZA 3MVXA 4BDNA 1N7WA 4X48A 3VVDA 5I2NA 4ZEBA 1MY3A 3AXFA 3Q26A 1OVTA 5FTHA 4RPOA 1NNFA 1VFEA 4ZDMA 1US5A 1MXWA 1H3DA 2A5TB 1MQGA 4ZEIA 1N7XA 5CMMA 3R7XA 1UTBB 1GTKA 4DXCA 1MY0A 4R72A 4ESWA 4U2RA 4GIZA 3CR9A 3MVWA 3C34A 5I57B 2B65A 3OMBA 1AOVA 3T9UA 3E4RA 2HFBA 4JSDA 4RK9A 5F7VA 4ONYA 3OOAA 4EF2A 2ONSA 5EHSA 1P1WA 1FQAA 4LP2B 4KYSA 4I9DA 3I5OA 4O3AA 3RT6B 1FQBA 3FV1A 3OSRA 2RCBA 4WEPA 2V25A 2RCAA 4GD5A 3Q28A 4XKNA 1F9BA 4YAHX 4F39A 2FA7A 3FVKA 1MPDA 4OFLA 2A5TA 2P0SA 2ZYNA 4HCWA 1TXFA 3USDA 4F3PA 1II5A 1UTBA 1B3FA 4GFRA 4OVJA 1B7HA 1H76A 2PX1A 3H3GA 1B5IA 5AA2A 5CM6A 2PT1A 2XD3A 3S2VA 2Y7WA 2Y84A 2IA4A 5JK4A 1B6HA 1FTKA 2R71A 2Z22A 4O3CA 3H6VA 2QMWA 3K1MA 5KDTA 2YLNA 3ODBA 4OERA 3KOSA 3T22A 1A54A 3W15C 2HEUA 5EYFA 2F8DA 1XC1A 2F7BA 3BKIB 3FJ7A 3KOTA 3OEKA 4LQ5A 2P1SA 2XXPA 1IXHA 1PBPA 2FYIA 1MDQA 1IZ1A 4OTEA 2HCAA 2A5SA 4PE5B 3O9PA 4OZ9A 4RXLA 1PBQA 2PVUA 2H98A 3FIRA 3CIJA 1OQHA 4NWDA 4ZEKA 1A7LA 2PYYA 4LONB 4PETA 2THIA 4AB6A 4P11A 3QUJA 3I3VA 4F1YA 4EXKA 5I58A 1QJMA 2Z8DA 4F3SA 1QW0A 1SYHA 3M3KA 3P7IA 4OENA 4F3BA 1VE4A 1EZPA 1I69A 2DVCA 4MLQA 3ZSFA 4QSDA 3TODA 2HXWA 5TPAB 3KJTA 1GR2A 1Y20A 1T0KA 3SEVA 4FAJA 2D5WA 1B05A 3MBPA 1MS7A 5ELVA 5AE4A 1A40A 4U4SA 3LBSA 1PC3A 2ZNUA 2X26A 4H65A 4I62A 1N04A 1RYXA 2H25A 5ITPA 1FTLA 3CVGA 2UYFA 1A8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN8 A;  4WED A;  1PB9 A;  3K6W A;  4IO7 A;  5CC2 A;  1MG1 A;  1TWY A;  3K6U A;  5HM4 B;  3HST A;  3WAE A;  2ZXT A;  3K02 A;  4KYD A;  4OMB A;  1S7Y A;  4PFU A;  2XXY A;  2I58 A;  5H8H B;  3DLN A;  3GZG A;  3ONM A;  1Y3N A;  3C9H A;  1MQJ A;  5CMB A;  5DTB A;  2GFE A;  4OES A;  5AA4 A;  5L9O A;  3L6H A;  4RYA A;  3LC8 A;  1IXG A;  3HV1 A;  4QFL A;  2I4B A;  3H6U A;  1OMP A;  4LZ8 A;  4BLA A;  4ELO A;  3HHF A;  2G29 A;  3IX1 A;  1B3L A;  4BDQ A;  3TTL A;  1Y1Z A;  5CRY A;  2DWI A;  3MW0 A;  4H1X A;  1P1N A;  4Q0C A;  5FTI A;  3U92 A;  3PPN A;  4R73 A;  5L8D A;  2QS3 A;  3R26 A;  1M5F A;  3G3I A;  1AMF A;  4JWY A;  1EZ9 A;  1XVX A;  3FV2 A;  4PFW A;  1AL3 A;  3IO4 A;  1ZKB A;  3OO8 A;  3V8X B;  4ELP A;  1NL5 A;  3MAM A;  2I4C A;  4G68 B;  3O6G A;  1Y1M A;  3SEU A;  3KG2 A;  2ZNS A;  3BBR A;  1MQI A;  3OEM A;  1CE2 A;  3CSB A;  3K00 A;  1XT8 A;  5TP9 A;  1XS5 A;  3MC2 A;  4N6P A;  4LZ7 A;  1NH7 A;  1N0T A;  3K01 A;  4GLI A;  1D3K A;  2XXH A;  4GXS B;  3VLW A;  3PMX A;  2DE2 A;  4I8C A;  2DVZ A;  3HN0 A;  2QL3 A;  2VD2 A;  3MVZ A;  3SER A;  3BFT A;  1MH4 A;  1OLC A;  3MP8 A;  3MZ1 A;  3SEY A;  1MM6 A;  1USY E;  2ALU A;  3A3C A;  4OXV A;  4MBP A;  5AA2 B;  1I6B A;  2P2A A;  4K3F A;  3DP4 A;  1DTZ A;  1ZU0 A;  1QKA A;  1LFG A;  1M5B A;  2DYX A;  2HZL A;  4THI A;  1NFT A;  4N13 A;  2XX9 A;  3DM0 A;  1M5E A;  4DZ1 A;  5DT6 A;  3V5A A;  5KDT B;  1N3X A;  2I49 A;  1I6Q A;  4YB7 A;  2XXR A;  1D4N A;  1B3G A;  1PB7 A;  1LB9 A;  2HAV A;  4LUB A;  4R6K A;  5CMC A;  3LSF B;  5KCJ A;  3L6G A;  1IEJ A;  3FGS A;  5F1Q A;  1LFH A;  2QS1 A;  2F7C A;  2XXX A;  4DIG A;  2ZYM A;  3M8U A;  2ZNT A;  4TLM B;  3SDF A;  3IB2 A;  4FIM A;  3G3F A;  2VP1 A;  3PPP A;  3FXR A;  4GXA A;  5EHM A;  3S9L C;  3V89 B;  2H9B A;  4Q8R A;  3UGW A;  2RC7 A;  2XXT A;  1MXY A;  4HS7 A;  4UAC A;  1JQF A;  1UQW A;  1ZJL A;  4P0G A;  5FHO A;  3SET A;  1O64 A;  2YJP A;  3TQL A;  4F1U A;  1URD A;  3IK6 B;  1TFD A;  3EF7 A;  4QSC A;  3TZA A;  5TPA A;  4GOT A;  2R6G E;  1Q35 A;  3TDJ A;  4XKP A;  2HQ0 A;  3FZV A;  1ANF A;  3EN3 A;  1JW4 A;  1RKM A;  1PEB A;  2OBG A;  1MY4 A;  1IIW A;  1B2H A;  2XHD A;  1R1N A;  3M3L A;  4LZ5 A;  3UN6 A;  4F2Q A;  5LOM A;  2O68 A;  3T9X B;  4ECF A;  2AL5 A;  4GQO A;  1B0H A;  2Z8F A;  4G8M A;  1S9T A;  3K1N A;  1LAF E;  1R6Z A;  2NVU B;  1OIB A;  3VDF A;  1ZMG A;  3IJO B;  3KJ7 A;  4IO3 A;  4EQB A;  4YB5 A;  2E0S A;  1R9L A;  3B6Q A;  1LBB A;  3PUV E;  2LAO A;  2G93 A;  3ECR A;  3R6U A;  5H8F A;  3KBR A;  1B4Z A;  4IO6 A;  3FJM A;  1URG A;  2RF1 A;  5B70 A;  3RNN A;  4LVQ A;  1H45 A;  3DP8 A;  2RC9 A;  4IO5 A;  2I3W A;  4G68 C;  4NTL A;  2PBW A;  3U1O A;  4GRK A;  4IB2 A;  2Q2A A;  4KR5 A;  1O63 A;  1ATG A;  3O28 A;  3SES A;  3VXB A;  1MQD A;  3IAZ A;  4ESX A;  4H8J A;  4NF5 B;  5CBS A;  3KGC A;  4KQP A;  5HBC A;  3IL1 B;  2PT2 A;  4M1V A;  4NMY A;  1FW0 A;  3TEL A;  4PQJ A;  4F31 B;  1MRP A;  5I84 A;  4JB7 A;  1Y9U A;  4YIC A;  2UVG A;  4G68 A;  2B3F A;  4GF8 A;  5H8F B;  5H8Q A;  1OVB A;  3LR1 A;  1SBP A;  3K6X A;  2Q88 A;  3OO9 A;  1A8E A;  2H5Y A;  3A3U A;  4N07 A;  5DVI A;  2ABH A;  3RLF E;  2Q89 A;  5TP9 B;  4DLD A;  1MXV A;  4FAT A;  2QRY A;  5DEX B;  5L9S A;  3IJX B;  4FED A;  3PGF A;  1FTJ A;  2F6P A;  2GHA A;  4IO2 A;  4H0W A;  4JXI A;  3GBB A;  4KD5 A;  4ELR A;  4ZEC A;  1JW5 A;  3JYR A;  2UVH A;  3H7M A;  3K1P A;  1SI1 A;  2ESN A;  3OD7 A;  4FEC A;  4DCY A;  1HSJ A;  4GWO A;  4TOZ A;  2NUV A;  2W7Y A;  4NF5 A;  3T93 B;  3EHT A;  1M5C A;  2F35 A;  4PFY A;  1YAE A;  3RTF B;  3U93 A;  3GBA A;  1JEV A;  3K4U A;  1L5T A;  4KCC A;  3KZG A;  4YMA A;  2VOZ A;  5AA3 A;  3HHG A;  3SEW A;  3N6U A;  3RPW A;  5BWJ A;  1J1N A;  3C33 A;  2Q8J A;  5M2V A;  3B6W A;  3S9E A;  1MDP 1;  1NNT A;  3DEL B;  2O69 A;  4WKM A;  5DYH A;  2AL4 A;  4YKI A;  5DEX A;  1HSE A;  2QS2 A;  4H5G A;  1LST A;  3IB1 A;  4QFO A;  5KCJ B;  2ONR A;  5TU0 A;  3LSX A;  3MP1 A;  2F7A A;  1LAX A;  3Q27 A;  4OET A;  1QVS A;  3TTM A;  1UTH A;  2QS4 A;  2V3Q A;  1ELJ A;  1LCT A;  3E13 X;  3O66 A;  4HTG A;  1DPE A;  4KI0 E;  4H67 A;  4NED A;  5AA1 A;  3VE1 B;  1Q1K A;  2NXO A;  2O7I A;  4QFP A;  3W9W A;  1NH8 A;  3GXA A;  4F29 A;  5I59 A;  2QSX A;  4F3G A;  1DPP A;  2V84 A;  4L17 A;  2Z8E A;  3UOR A;  3GLB A;  3PUX E;  1IUD A;  2F5X A;  2I6E A;  4DE8 A;  3FAS A;  4YKP A;  3T9H B;  1A99 A;  2V3U A;  3CRB A;  1N76 A;  2H4I A;  2Y7K A;  2O51 A;  1H43 A;  3QUF A;  3JZJ A;  1MXX A;  1US4 A;  1B3E A;  2OCU A;  3FVO A;  3O2A A;  3PPQ A;  2RIN A;  4R74 A;  4XKQ A;  4NF8 A;  1B1X A;  4JBZ A;  1FQD A;  1NMU A;  2RKM A;  3JV9 A;  3TFL A;  5IAI A;  4WXJ A;  4Q30 B;  3CFZ A;  5KZT A;  1Z7M E;  1D9Y A;  1UTH B;  3IOV A;  1B32 A;  4BDO A;  3BFU A;  3IOU A;  3PD9 A;  4ZS9 A;  4QHQ A;  3T9V A;  3RUM A;  1Y3P A;  4JWX A;  1QUI A;  1B5H A;  5I59 B;  1GGG A;  1UIV A;  2I48 A;  1SW5 A;  4R6H A;  4DDD A;  3H6W A;  1MY1 A;  4OFO A;  1PDA A;  3PMW A;  3ILT B;  4Q5T A;  2WKY A;  4NE4 A;  4YU0 A;  1B0L A;  3MVY A;  2DXY A;  3H6T A;  3O29 A;  3F11 A;  3PD8 A;  3UP9 A;  1JVY A;  4ZZE A;  2DOJ A;  1POT A;  3CI8 A;  3IOR A;  4X1B A;  5CI5 A;  4ZZA A;  4EF1 A;  3S4U A;  1B7Z A;  3I6V A;  1SQY A;  4E0W A;  4YZZ A;  4F2O A;  3B6T A;  1JET A;  3FXU A;  1EU8 A;  3CFX A;  1MXZ A;  4YKK A;  3O97 A;  2GH9 A;  3G7W A;  2XXQ A;  5JTY B;  3W9V A;  5CBR A;  1MQH A;  2O84 X;  2O6A A;  4U22 A;  2Y7I A;  5I2K A;  1EZO A;  1B4H A;  2QPQ A;  4Z7E A;  4H8I A;  1GVC A;  2DQV A;  2GRV A;  2OLB A;  1XOC A;  2ZYK A;  3MPL A;  1FQE A;  1QUL A;  1LBC A;  1USY H;  3K6V A;  3TTR A;  2Q9T A;  4LA9 A;  5H8Q B;  4F22 A;  1TT1 A;  1AIV A;  1M5D A;  2V3T A;  5JEI A;  1B46 A;  3VVF A;  1LAH E;  3ZKK A;  2Y7R A;  3PUW E;  4OQO A;  4I1D A;  1D9V A;  2F36 A;  3A09 A;  4G8H A;  4ISU A;  4DXB A;  2UVJ A;  1P1U A;  4QFN A;  3U8Q A;  3U72 A;  3SKP A;  4KFQ A;  3TTN A;  2CZL A;  4KPT A;  5FHN A;  3MWB A;  4PFT A;  1B1H A;  1DSN A;  1DOT A;  2V93 A;  4P0I A;  5FHM A;  4ZE8 A;  2M8C A;  4U23 A;  3Q29 A;  4U1O A;  4EXL A;  2ZMB A;  1P1O A;  4RA1 A;  3VXC A;  3MZB A;  2D3I A;  4BDR A;  1ZLQ A;  4R6Y A;  4E0X A;  1SYI A;  3CG1 A;  1VSO A;  4RY1 A;  3VFJ A;  1B7U A;  3E9X A;  1SW1 A;  4EQ7 A;  5J1D A;  2OWT A;  2OWS A;  3TPA A;  3TCF A;  3E3K A;  3MQ9 A;  4U4X A;  5IKB A;  1P99 A;  4FEB A;  2I0C A;  3DP6 A;  4ZEF A;  1LFI A;  2O1M A;  4DCX A;  4HCY A;  4C1U A;  2VD3 A;  2DWJ A;  3FVN A;  3OO6 A;  4RJZ A;  3MP6 A;  4FJP A;  1LAG E;  3M3F A;  4GL8 A;  4X1D A;  1WOD A;  3THI A;  3U94 A;  4XXU A;  3FXQ A;  1JEU A;  3TCG A;  3O6I A;  3VVE A;  5A5X A;  1B5J A;  2AYS A;  1MH3 A;  1MPB A;  2DE4 A;  2DP8 A;  3OO7 A;  4R75 A;  1JW1 A;  2XXV A;  4IO4 A;  3RQT A;  4U1Z A;  3CSG A;  4YB6 A;  5ISU A;  3UIF A;  1A55 A;  3PPR A;  4UA8 A;  4AB5 A;  1UIU A;  4G4P A;  4ZE9 A;  3V83 A;  3EHU A;  3K2D A;  3IOW A;  2REG A;  4PP0 A;  3C31 A;  4C1T A;  3T96 B;  1B52 A;  4LQ2 A;  1B40 A;  4YMB A;  2FNC A;  1NNP A;  2H99 A;  3VV5 A;  2OJT A;  4RPN A;  3H03 A;  4IY5 A;  1S50 A;  4ZED A;  1TFA A;  3CFL A;  4NF6 B;  4HW8 A;  1VFD A;  4OYV A;  3TQW A;  2Z23 A;  3MZ9 A;  2HZK A;  4H6D A;  4NF8 B;  2F78 A;  2X7Q A;  1QUK A;  3KN8 A;  2UXA A;  1DTG A;  1SW2 A;  3O6H A;  3PUZ E;  3H06 B;  3TTK A;  1BP5 A;  3EQ1 A;  1JVX A;  2VHA A;  3LSW A;  2RC8 A;  3C36 A;  4G77 A;  5HPQ A;  1B58 A;  1OQG A;  2DWA A;  3CG3 A;  4RNS A;  4YKJ A;  1URS A;  4FE8 A;  4IY6 A;  4R9G A;  1FQF A;  5B7D A;  1Y3Q A;  1EH3 A;  3N5L A;  3LUY A;  5I2N B;  5JTY A;  3D4G A;  2XD2 A;  4KCD A;  5AA2 D;  1OLA A;  5CMK A;  2I3V A;  4TQU Q;  5DVJ A;  3RY3 A;  2QJE A;  4DXU A;  1LB8 A;  3TUS A;  2Y7P A;  4NF6 A;  1HSL A;  4X9T A;  3KSX A;  4QSE A;  4BDL A;  4BDM A;  3QYT A;  4JSO A;  3KSJ A;  1NNK A;  1B51 A;  3FD3 A;  4JWO A;  4MLV A;  3N6T A;  1XVY A;  1XHY A;  1P1Q A;  4F19 A;  4FOR A;  2NOO A;  3MPK A;  3K0V A;  4OEU A;  3N94 A;  5I2K B;  2DS9 A;  1PB8 A;  4XTC Q;  4EUO A;  3S9M C;  3VLV A;  1LGB C;  1R9Q A;  1MXU A;  5H8N A;  4KYE A;  3G3J A;  1N84 A;  5L9M A;  4MFI A;  5K2X A;  3KN7 A;  2ZYO A;  3MUQ A;  3QXM A;  4JDF A;  2OK2 A;  4TLL B;  3FVG A;  2XXU A;  4M4G A;  3PPO A;  3C32 A;  4ND9 A;  1QKB A;  2NWJ A;  4GL0 A;  4XKR A;  1FTM A;  5H8S A;  2XXW A;  3LSL A;  4R2F A;  3IR1 A;  2F34 A;  4C0R A;  2XX8 A;  1WDN A;  1DMB A;  3FJG A;  4IGR A;  3G3K A;  3OEN A;  4NF4 B;  1MPC A;  4POW A;  3S9N C;  2GHB A;  4O3B A;  3RGY A;  5ITO A;  2DE3 A;  4U21 A;  5BUU A;  3OEL A;  1YPN A;  1RYO A;  4OWD A;  1IQ7 A;  4RK2 A;  2R9J A;  1SVX B;  5K2Y A;  1SD3 A;  4GVO A;  1N3W A;  4G8N A;  5H8N B;  4QFK A;  2ONK E;  3OXN A;  1WVJ A;  4OFJ A;  3ZS6 A;  1VR5 A;  4R9F A;  1BTJ A;  4XIG Q;  4EQ9 A;  2DXR A;  3C4M A;  5ICQ A;  3PUY E;  3G3G A;  3IOT A;  3PMV A;  3VLU A;  2QMX A;  2XXI A;  1SDX A;  3UK4 A;  3N26 A;  3RTW B;  3QK6 A;  2KLF A;  4OHN A;  2E1S A;  1YTV A;  1JNF A;  1Z7N E;  1GV8 A;  3B7D A;  5ICT A;  4QF9 A;  4H5F A;  3EPE A;  3G3H A;  3TYH A;  4MF3 A;  4POX A;  3MJN A;  4NF4 A;  2I0B A;  4G2Z A;  4Z0I A;  2OZZ A;  3OSQ A;  3WAF A;  5I56 A;  3KFM A;  2XX7 A;  1IXI A;  2IEE A;  3RT8 A;  1BKA A;  4NWC A;  1YCJ A;  1Y4T A;  2DWH A;  3HO7 A;  5A5X B;  2UVI A;  3TKD A;  1FCK A;  4R2B A;  2PMS A;  3ZKL A;  3UA8 A;  1LLS A;  5I58 B;  1ZBM A;  3KN3 A;  2Q2C A;  1IIT A;  2F6G A;  1O7T A;  3HPI A;  3IO6 A;  1MM7 A;  1MY2 A;  3EHS A;  3QSL A;  3TEP A;  3T66 A;  4KHZ E;  1H44 A;  3FUZ A;  2AIX A;  2F97 A;  1ZIU A;  3QIM A;  3ILU B;  4F18 A;  3TMG A;  4ELQ A;  3PU5 A;  4F1V A;  2B3B A;  3D4C A;  1Y4C A;  4EDP A;  4OEV A;  2REJ A;  3C35 A;  5DVF A;  3IB0 A;  1I6A A;  1FTO A;  1NKX A;  2ANJ A;  2D21 A;  3FAT A;  3TAJ A;  5I56 B;  2O7U A;  1SI0 A;  2VGQ A;  3Q25 A;  1QUJ A;  1CB6 A;  1ZTY A;  1B3H A;  2X7P A;  3SEX A;  1FQC A;  2UYE A;  1KWH A;  3KEI A;  1BIY A;  4MH5 A;  4AQ4 A;  1B9J A;  1LCF A;  3QAX A;  1IXC A;  5H8H A;  1POY 1;  2DSF A;  2CMO A;  2HAU A;  5I57 A;  3H4Z A;  4LAT A;  4IGT A;  3TCH A;  2YPN A;  3HCQ A;  1BLF A;  1SW4 A;  2O1L A;  3PV0 E;  2BJJ X;  5AA4 B;  1AH5 A;  4QRZ A;  3MVX A;  4BDN A;  1N7W A;  4X48 A;  3VVD A;  5I2N A;  4ZEB A;  1MY3 A;  3AXF A;  3Q26 A;  1OVT A;  5FTH A;  4RPO A;  1NNF A;  1VFE A;  4ZDM A;  1US5 A;  1MXW A;  1H3D A;  2A5T B;  1MQG A;  4ZEI A;  1N7X A;  5CMM A;  3R7X A;  1UTB B;  1GTK A;  4DXC A;  1MY0 A;  4R72 A;  4ESW A;  4U2R A;  4GIZ A;  3CR9 A;  3MVW A;  3C34 A;  5I57 B;  2B65 A;  3OMB A;  1AOV A;  3T9U A;  3E4R A;  2HFB A;  4JSD A;  4RK9 A;  5F7V A;  4ONY A;  3OOA A;  4EF2 A;  2ONS A;  5EHS A;  1P1W A;  1FQA A;  4LP2 B;  4KYS A;  4I9D A;  3I5O A;  4O3A A;  3RT6 B;  1FQB A;  3FV1 A;  3OSR A;  2RCB A;  4WEP A;  2V25 A;  2RCA A;  4GD5 A;  3Q28 A;  4XKN A;  1F9B A;  4YAH X;  4F39 A;  2FA7 A;  3FVK A;  1MPD A;  4OFL A;  2A5T A;  2P0S A;  2ZYN A;  4HCW A;  1TXF A;  3USD A;  4F3P A;  1II5 A;  1UTB A;  1B3F A;  4GFR A;  4OVJ A;  1B7H A;  1H76 A;  2PX1 A;  3H3G A;  1B5I A;  5AA2 A;  5CM6 A;  2PT1 A;  2XD3 A;  3S2V A;  2Y7W A;  2Y84 A;  2IA4 A;  5JK4 A;  1B6H A;  1FTK A;  2R71 A;  2Z22 A;  4O3C A;  3H6V A;  2QMW A;  3K1M A;  5KDT A;  2YLN A;  3ODB A;  4OER A;  3KOS A;  3T22 A;  1A54 A;  3W15 C;  2HEU A;  5EYF A;  2F8D A;  1XC1 A;  2F7B A;  3BKI B;  3FJ7 A;  3KOT A;  3OEK A;  4LQ5 A;  2P1S A;  2XXP A;  1IXH A;  1PBP A;  2FYI A;  1MDQ A;  1IZ1 A;  4OTE A;  2HCA A;  2A5S A;  4PE5 B;  3O9P A;  4OZ9 A;  4RXL A;  1PBQ A;  2PVU A;  2H98 A;  3FIR A;  3CIJ A;  1OQH A;  4NWD A;  4ZEK A;  1A7L A;  2PYY A;  4LON B;  4PET A;  2THI A;  4AB6 A;  4P11 A;  3QUJ A;  3I3V A;  4F1Y A;  4EXK A;  5I58 A;  1QJM A;  2Z8D A;  4F3S A;  1QW0 A;  1SYH A;  3M3K A;  3P7I A;  4OEN A;  4F3B A;  1VE4 A;  1EZP A;  1I69 A;  2DVC A;  4MLQ A;  3ZSF A;  4QSD A;  3TOD A;  2HXW A;  5TPA B;  3KJT A;  1GR2 A;  1Y20 A;  1T0K A;  3SEV A;  4FAJ A;  2D5W A;  1B05 A;  3MBP A;  1MS7 A;  5ELV A;  5AE4 A;  1A40 A;  4U4S A;  3LBS A;  1PC3 A;  2ZNU A;  2X26 A;  4H65 A;  4I62 A;  1N04 A;  1RYX A;  2H25 A;  5ITP A;  1FTL A;  3CVG A;  2UYF A;  1A8F A; 
#chains in the Genus database with same CATH topology
 3K6W A;  1TWY A;  3K6U A;  4GBW A;  4KYD A;  2XXY A;  5H8H B;  4IR8 A;  1MQJ A;  5AA4 A;  3LC8 A;  1IXG A;  3HV1 A;  4BLA A;  4BDQ A;  5CRY A;  1P1N A;  3U92 A;  3R26 A;  1EZ9 A;  1XVX A;  3FV2 A;  1AL3 A;  3IO4 A;  1ZKB A;  3OO8 A;  4HE1 A;  4JVD A;  1NI9 A;  1MQI A;  1CE2 A;  3K00 A;  1XT8 A;  3MC2 A;  4GXS B;  2XXH A;  5F24 A;  4I40 A;  2VD2 A;  3MVZ A;  3SER A;  1USY E;  3A3C A;  4H46 A;  4PGP A;  1I6B A;  2P2A A;  1M5B A;  2DYX A;  2HZL A;  2XX9 A;  4H45 A;  5DT6 A;  1RDZ A;  1I6Q A;  2XXR A;  3FGS A;  2XXX A;  2ZYM A;  2F3D A;  4TLM B;  3IB2 A;  4FIM A;  3PPP A;  2H9B A;  3UGW A;  4UAC A;  1UQW A;  4P0G A;  4F1U A;  3TQL A;  1FPJ A;  1URD A;  3IK6 B;  3EF7 A;  1D9Q A;  1EYJ A;  4GOT A;  2R6G E;  3TDJ A;  3FZV A;  1ANF A;  4OVT A;  1JW4 A;  2OBG A;  3M3L A;  4N15 A;  1OIB A;  4EQB A;  1R9L A;  1LBB A;  3PUV E;  3KBR A;  1B4Z A;  3FJM A;  5B70 A;  4LVQ A;  1H45 A;  3DP8 A;  2RC9 A;  4IO5 A;  2PBW A;  3O28 A;  4NF5 B;  5H8F B;  5H8Q A;  2H5Y A;  3A3U A;  4N07 A;  2F6P A;  4ELR A;  4O8M A;  1JW5 A;  5IZ1 A;  4FEC A;  1NV5 A;  2NUV A;  2F35 A;  2V4C A;  1YAE A;  3U93 A;  5BWJ A;  2AL4 A;  3LSX A;  3MP1 A;  2F7A A;  2V3Q A;  4FBP A;  2L5V A;  4O7I A;  3W9W A;  1NH8 A;  3A29 A;  4P3L A;  2H4I A;  1H43 A;  4R75 A;  3JZJ A;  4GWX A;  4R74 A;  1LBX A;  4XKQ A;  4NF8 A;  5KZT A;  1NMU A;  4Q30 B;  2FBP A;  1D9Y A;  3RUM A;  1QUI A;  4R6H A;  1K9Y A;  4Q5T A;  1MY1 A;  3PMW A;  4YU0 A;  1B0L A;  3O29 A;  3H6T A;  4MHF A;  3UP9 A;  4ZZE A;  3IOR A;  4ZZA A;  4O94 A;  1SQY A;  3W9V A;  3G7W A;  2QPQ A;  5ET5 A;  1GVC A;  2ZYK A;  3TTR A;  1USY H;  2B4M A;  5H8Q B;  4F22 A;  1AIV A;  5JEI A;  2CZI A;  4I1D A;  1D9V A;  4G8H A;  4DXB A;  4QFN A;  3SKP A;  4HE0 A;  4KPT A;  4PFT A;  1DSN A;  3Q29 A;  4RA1 A;  4I3E A;  3U65 A;  2D3I A;  1ZLQ A;  1SYI A;  2JJK A;  1B7U A;  1SW1 A;  2OWS A;  3DP6 A;  4OAN A;  5I3S A;  4ZEF A;  2O1M A;  2VD3 A;  4FJP A;  1WOD A;  1FBD A;  3TCG A;  4JVC A;  2DE4 A;  3RQT A;  4U1Z A;  4YB6 A;  5ISU A;  3UIF A;  1A55 A;  3PPR A;  1UIU A;  1NV6 A;  2REG A;  4C1T A;  3VV5 A;  3H03 A;  3CFL A;  4H6D A;  4NF8 B;  1QUK A;  3KN8 A;  3EQ1 A;  1JVX A;  2VHA A;  3C36 A;  4G77 A;  1B58 A;  1OQG A;  3CG3 A;  1URS A;  4R9G A;  3N5L A;  4PBQ A;  2I3V A;  2QJE A;  4DXU A;  1LB8 A;  4NF6 A;  1HSL A;  4X9T A;  3QYT A;  4JWO A;  2QVU A;  4GWZ A;  1XHY A;  1P1Q A;  4F19 A;  4FOR A;  3MPK A;  4OEU A;  3N94 A;  1PB8 A;  5EQ7 A;  3S9M C;  1LGB C;  1R9Q A;  5H8N A;  3V5A A;  5K2X A;  4JDF A;  3FVG A;  2P3N A;  5H8S A;  4R2F A;  4C0R A;  1WDN A;  4P1E A;  3S9N C;  1MPC A;  3OEL A;  4RK2 A;  1IQ7 A;  4G8N A;  4QFK A;  2ONK E;  4OFJ A;  4R9F A;  3UK4 A;  3N26 A;  1YTV A;  4P8B A;  3G3H A;  4Z0I A;  3WAF A;  4PTK A;  3KFM A;  2IEE A;  1YCJ A;  3HO7 A;  2UVI A;  2PMS A;  1ZBM A;  3KN3 A;  4GWW A;  1O7T A;  3IO6 A;  3TEP A;  1H44 A;  3FUZ A;  2F97 A;  2ZZV A;  4F18 A;  2REJ A;  1I6A A;  2D21 A;  2O7U A;  4OA4 A;  3Q25 A;  1CB6 A;  1FQC A;  2DDK A;  3KEI A;  1IXC A;  5DW8 A;  5I57 A;  3TCH A;  2YPN A;  2O1L A;  1AH5 A;  2XWK A;  1K9Z A;  3Q26 A;  1OVT A;  4RPO A;  1US5 A;  4DI4 B;  1H3D A;  1MQG A;  1GTK A;  4U2R A;  3C34 A;  1AOV A;  3T9U A;  2ZZX A;  4JSD A;  5F7V A;  4ONY A;  2Q8M A;  1FQB A;  2GQ1 A;  2F3B A;  2RCB A;  4GD5 A;  1F9B A;  2A5T A;  1B3F A;  2XA5 A;  2PX1 A;  3S2V A;  2IA4 A;  4O3C A;  2QMW A;  5KDT A;  2YLN A;  3ODB A;  3KOS A;  3T22 A;  1XC1 A;  2F7B A;  3BKI B;  3FJ7 A;  1MDQ A;  4OTE A;  2A5S A;  4PAK A;  2H98 A;  3FIR A;  4NWD A;  4ZEK A;  4LON B;  2THI A;  1SYH A;  1VE4 A;  3ZSF A;  1GR2 A;  1Y20 A;  1T0K A;  1BK4 A;  4I62 A;  1RYX A;  3CVG A;  3RN8 A;  4PAF A;  4PDH A;  1MG1 A;  3HST A;  3WAE A;  3K02 A;  4PFU A;  5IGA A;  3ONM A;  2PCR A;  5EQA A;  5DTB A;  2GFE A;  3L6H A;  4QFL A;  4LZ8 A;  1Y1Z A;  5FTI A;  5L8D A;  3G3I A;  4GX6 A;  4JWY A;  4PE3 A;  4ELP A;  1NL5 A;  2I4C A;  3KG2 A;  4XF5 A;  3BBR A;  4N8Y A;  1XS5 A;  4N6P A;  1NH7 A;  3VLW A;  5EQ8 A;  3HN0 A;  2QL3 A;  3BFT A;  3SEY A;  1MM6 A;  2ALU A;  3DP4 A;  1DTZ A;  1ZU0 A;  1LFG A;  5IM2 A;  5KDT B;  1N3X A;  1D4N A;  5CMC A;  3LSF B;  3L6G A;  1KA0 A;  1LFH A;  2QS1 A;  2F7C A;  3IFC A;  2ZNT A;  3SDF A;  4GXA A;  2VP1 A;  3FXR A;  2XXT A;  1MXY A;  3QMF A;  1JQF A;  5FHO A;  4OVP A;  1INP A;  4XKP A;  4MMP A;  1PEB A;  1B2H A;  3UN6 A;  4XEQ A;  2CZK A;  2O68 A;  2AL5 A;  4JVI A;  2Z8F A;  4G8M A;  1R6Z A;  3VDF A;  1ZMG A;  4YB5 A;  2E0S A;  3R6U A;  5H8F A;  2LAO A;  3ECR A;  3FBP A;  1URG A;  2RF1 A;  3RNN A;  4G68 C;  1RDX A;  3RYD A;  4KR5 A;  1O63 A;  4NGU A;  2CEY A;  4KQP A;  5HBC A;  2QVR A;  4PBH A;  4XFE A;  1FW0 A;  4PQJ A;  4GF8 A;  1A8E A;  1Q9D A;  3RLF E;  3FXB A;  1MXV A;  2QRY A;  3IJX B;  1FTJ A;  2GHA A;  4ZEC A;  3GBB A;  3H7M A;  3K1P A;  4DCY A;  3RTF B;  3K4U A;  1L5T A;  4N6K A;  3RPL B;  4YMA A;  3HHG A;  1J1N A;  3S9E A;  2Q8J A;  5M2V A;  3B6W A;  2WBB A;  1NNT A;  5DYH A;  4YKI A;  5DEX A;  2QS2 A;  1LAX A;  2QS4 A;  1LCT A;  4H67 A;  2NXO A;  2O7I A;  4QFP A;  3GXA A;  4F29 A;  4F3G A;  1DPP A;  4L17 A;  4YKP A;  4X8R A;  3T9H B;  2Y7K A;  2XWI A;  2OCU A;  3O2A A;  2RIN A;  1B1X A;  1FQD A;  3TFL A;  2RKM A;  4GX4 A;  4WXJ A;  3CFZ A;  3IOU A;  4NF0 A;  4JWX A;  5I59 B;  2Y5K A;  2WKY A;  4NE4 A;  3MVY A;  5J16 A;  3S4U A;  1B7Z A;  3I6V A;  1JET A;  2GH9 A;  1MQH A;  2O6A A;  2Y7I A;  4H8I A;  2OLB A;  1XOC A;  1QUL A;  3K6V A;  2Q9T A;  4LA9 A;  3PUW E;  4NQ8 A;  3T0J A;  2F36 A;  1P1U A;  3U72 A;  2OWZ A;  2CZL A;  5FHN A;  1B1H A;  5FHM A;  4U23 A;  4EXL A;  4U1O A;  4LN5 A;  1P1O A;  3VXC A;  3MZB A;  4E0X A;  3CG1 A;  4RY1 A;  3E9X A;  5LTC A;  3MQ9 A;  5IKB A;  1P99 A;  1LFI A;  4HCY A;  4C1U A;  3OO6 A;  4XXU A;  3VVE A;  3O6I A;  5A5X A;  1MH3 A;  3OO7 A;  4IO4 A;  4ZE9 A;  4AB5 A;  4NX1 A;  4G4P A;  3K2D A;  3C31 A;  4YMB A;  4LQ2 A;  1B40 A;  1QGX A;  4RPN A;  2XWV A;  1S50 A;  4NF6 B;  4HW8 A;  1VFD A;  2Z23 A;  3MZ9 A;  2HZK A;  4MEV A;  3O6H A;  2UXA A;  1DTG A;  2XXK A;  1BP5 A;  1IMB A;  2DWA A;  4RNS A;  4IY6 A;  3BIH A;  4KCD A;  3LUZ A;  4X04 A;  5DVJ A;  3B50 A;  2Y7P A;  1G0I A;  3KSX A;  4BDL A;  4BDM A;  4JSO A;  3KSJ A;  1B51 A;  3FD3 A;  4MLV A;  3N6T A;  1NUZ A;  1FPG A;  3K0V A;  3D1R A;  2DS9 A;  2WEF A;  5L9M A;  2ZYO A;  2OK2 A;  2NWJ A;  4GL0 A;  3IR1 A;  3G3K A;  3RGY A;  5BUU A;  1SVX B;  5K2Y A;  4GWY A;  4XIG Q;  1BTJ A;  2DXR A;  3C4M A;  5ICQ A;  3G3G A;  3IOT A;  3VLU A;  2KLF A;  1Z7N E;  1GV8 A;  5EYG A;  5LDZ A;  3EPE A;  3TYH A;  2OZZ A;  2XX7 A;  1IXI A;  5A5X B;  1FCK A;  3ZKL A;  3UA8 A;  1IIT A;  3ILU B;  4ELQ A;  1Y4C A;  3C35 A;  5DVF A;  3MST A;  3IB0 A;  1FTO A;  3TAJ A;  1SI0 A;  2CEX A;  1B3H A;  2X7P A;  1IMC A;  1BIY A;  1FPE A;  1POY 1;  4IGT A;  1BLF A;  1SW4 A;  2BJJ X;  4QRZ A;  4BDN A;  1N7W A;  1VFE A;  1MXW A;  2A5T B;  1N7X A;  4R72 A;  4ESW A;  2WBD A;  2B65 A;  2PFZ A;  3E4R A;  4O7M A;  4RK9 A;  4EF2 A;  1P1W A;  1FQA A;  4O3A A;  3I5O A;  3OSR A;  4WEP A;  2RCA A;  2FIE A;  3EKI A;  1LEV A;  1MPD A;  4HCW A;  1TXF A;  3USD A;  1II5 A;  5CM6 A;  5T3J A;  1FTK A;  2Z22 A;  3H6V A;  3K1M A;  4MNC A;  4OER A;  1A54 A;  3KOT A;  2HXR A;  2P1S A;  4N91 A;  2FYI A;  4RXL A;  1A7L A;  4PET A;  4F1Y A;  3QUJ A;  3I3V A;  4NAP A;  3P7I A;  2DVC A;  4MLQ A;  1FPB A;  3E78 A;  1NV7 A;  1B05 A;  3MBP A;  5AE4 A;  1A40 A;  2X26 A;  1N04 A;  4NN3 A;  4WED A;  1PB9 A;  1FPI A;  5HM4 B;  3CHG A;  2ZXT A;  1NV4 A;  2I58 A;  3GZG A;  1Y3N A;  3C9H A;  5CMB A;  1OMP A;  2G29 A;  3TTL A;  2DWI A;  3MW0 A;  4Q0C A;  3PPN A;  5ICT A;  4PFW A;  2Y5L A;  4G68 B;  3O6G A;  1Y1M A;  3SEU A;  2ZNS A;  1FBH A;  3OEM A;  3CSB A;  5TP9 A;  3K01 A;  4GLI A;  1D3K A;  3PMX A;  4I8C A;  2DVZ A;  1MH4 A;  1DBZ A;  4OXV A;  4MBP A;  4K3F A;  1NV1 A;  4THI A;  1NFT A;  4P47 A;  1RDY A;  4YB7 A;  4F3S A;  4R6K A;  1B3G A;  1PB7 A;  1LB9 A;  2HAV A;  4LUB A;  1IEJ A;  4DIG A;  3M8U A;  4AS5 A;  3G3F A;  5EHM A;  4GX3 A;  4Q8R A;  4DI3 D;  4HS7 A;  3V89 B;  3SET A;  1ZJL A;  1O64 A;  2YJP A;  4QSC A;  1Q35 A;  2HQ0 A;  3EN3 A;  1RKM A;  1MY4 A;  1IIW A;  5LOM A;  1R1N A;  4F2Q A;  4LZ5 A;  3T9X B;  4GQO A;  1B0H A;  1LAF E;  3B6Q A;  2G93 A;  1FPL A;  4GWS A;  2CZH A;  1G0H A;  2I3W A;  3U1O A;  1ATG A;  3SES A;  3IAZ A;  5CBS A;  3KGC A;  4NMY A;  1MRP A;  1Y9U A;  2UVG A;  4G68 A;  3RPL A;  1OVB A;  3LR1 A;  1SBP A;  3K6X A;  2Q88 A;  4DLD A;  2Q89 A;  5TP9 B;  4FAT A;  5DEX B;  4JXI A;  4KD5 A;  4H0W A;  4EQ7 A;  2ESN A;  4GWO A;  3EHT A;  1JEV A;  5AA3 A;  3C33 A;  1MDP 1;  2O69 A;  4P56 A;  1LST A;  4QFO A;  2ONR A;  5TU0 A;  4MNI A;  4OET A;  1CNQ A;  3VE1 B;  1DPE A;  5I59 A;  2QSX A;  3GLB A;  2F5X A;  1EYI A;  2I6E A;  3FAS A;  1A99 A;  1N76 A;  3PPQ A;  1MXX A;  3FVO A;  3JV9 A;  5IAI A;  1Z7M E;  1UTH B;  3IOV A;  3BFU A;  3PD9 A;  4QHQ A;  1Y3P A;  1B5H A;  1UIV A;  1SW5 A;  4OFO A;  1PDA A;  3ILT B;  4GBV A;  5JTY B;  3T96 B;  2DXY A;  3F11 A;  1JVY A;  2DOJ A;  4EF1 A;  5CI5 A;  3KBZ A;  3B6T A;  3FXU A;  4PFR A;  1MXZ A;  4P1L A;  2O84 X;  1EZO A;  2GRV A;  3MPL A;  1LBC A;  2VPO A;  1TT1 A;  1M5D A;  3VVF A;  1LAH E;  4OQO A;  4PF6 A;  3U8Q A;  3MWB A;  4P0I A;  1LBY A;  4R6Y A;  1VSO A;  5J1D A;  2OWT A;  3TPA A;  3E3K A;  4U4X A;  2DWJ A;  4RJZ A;  3U94 A;  4GL8 A;  3M3F A;  4X1D A;  3THI A;  1JEU A;  1B5J A;  1MPB A;  2DP8 A;  2R8T A;  4PP0 A;  1B52 A;  2FNC A;  2H99 A;  4IY5 A;  1TFA A;  2PFY A;  3TQW A;  2X7Q A;  3PUZ E;  3TTK A;  1EZP A;  1FBG A;  4MIJ A;  4NHB A;  4PGN A;  5HPQ A;  1VDW A;  4FE8 A;  1EH3 A;  2OX3 A;  3LUY A;  5I2N B;  5JTY A;  2XD2 A;  5AA2 D;  1OLA A;  4TQU Q;  3TUS A;  2FIX A;  4PDD A;  4QSE A;  4HE2 A;  4AS4 A;  1XVY A;  4EUO A;  1MXU A;  3KN7 A;  4TLL B;  3MUQ A;  2XXU A;  4M4G A;  1QKB A;  1FTM A;  2XX8 A;  4PFB A;  4IGR A;  1DK4 A;  4POW A;  2GHB A;  4O3B A;  5A5L A;  4OWD A;  1RYO A;  1SD3 A;  4GVO A;  1N3W A;  1WVJ A;  3ZS6 A;  1VR5 A;  1IMF A;  3PUY E;  2QMX A;  2XXI A;  4ESX A;  1JNF A;  4QF9 A;  4H5F A;  4POX A;  4NF4 A;  3RT8 A;  1BKA A;  3TKD A;  5ET7 A;  5I58 B;  2Q2C A;  3GYY A;  3EHS A;  3T66 A;  4KHZ E;  4N6D A;  2AIX A;  3QIM A;  3ROJ A;  2B3B A;  4I3Y A;  3NOH A;  2ANJ A;  3FAT A;  5I56 B;  1ZTY A;  3SEX A;  1KWH A;  1B9J A;  3QAX A;  3H4Z A;  3HCQ A;  3PV0 E;  2WYP A;  2WYK A;  4X48 A;  3VVD A;  5I2N A;  3ISP A;  1MY3 A;  3KC0 A;  5FTH A;  1NNF A;  4UAB A;  4DXC A;  5CMM A;  1MY0 A;  5EYH A;  3CR9 A;  5IZ3 A;  1FBE A;  3OMB A;  2HFB A;  1XI6 A;  1DCU A;  3OOA A;  2ONS A;  4MNP A;  4KYS A;  4I9D A;  3RT6 B;  4XKN A;  3FV1 A;  3Q28 A;  2FA7 A;  2ZYN A;  1UTB A;  4GFR A;  4OVJ A;  1B7H A;  1H76 A;  5AA2 A;  1B5I A;  5FBP A;  2PT1 A;  2Y84 A;  5JK4 A;  1IMA A;  3W15 C;  2HEU A;  5EYF A;  2F8D A;  4LQ5 A;  3OEK A;  1IXH A;  1PBP A;  1LBV A;  2HCA A;  2P3V A;  4OZ9 A;  3MYU A;  1PBQ A;  2PVU A;  1FRP A;  2PYY A;  5I58 A;  4EXK A;  4GWU A;  4OVR A;  1QJM A;  2Z8D A;  3LV0 A;  4QSD A;  2HXW A;  5TPA B;  3SEV A;  4FAJ A;  2WX9 A;  2ZNU A;  1NV0 A;  2H25 A;  5ITP A;  3IB1 A;  2UYF A;  5EQ9 A;  4IO3 A;  5CC2 A;  1KA1 A;  4IO7 A;  1FBF A;  2BJI A;  4OMB A;  1S7Y A;  3DLN A;  1IME A;  4OES A;  4P9K A;  5L9O A;  4RYA A;  2I4B A;  3H6U A;  4ELO A;  3HHF A;  3IX1 A;  1B3L A;  4H1X A;  5ESY A;  4R73 A;  2QS3 A;  1M5F A;  1AMF A;  3V8X B;  3MAM A;  1FPK A;  4LZ7 A;  1N0T A;  1NUX A;  2DE2 A;  1OLC A;  3MP8 A;  4PC9 A;  3MZ1 A;  5AA2 B;  1QKA A;  4N8G A;  4N4U A;  4N13 A;  3DM0 A;  4DZ1 A;  1M5E A;  2I49 A;  5KCJ A;  5F1Q A;  1FJ9 A;  3S9L C;  1NV2 A;  2RC7 A;  4G61 A;  3SEW A;  1TFD A;  3TZA A;  5TPA A;  1NUW A;  4YZZ A;  2XHD A;  4MAG A;  4ECF A;  1S9T A;  3K1N A;  1LBZ A;  2NVU B;  1LBW A;  3IJO B;  3KJ7 A;  4IO6 A;  4NTL A;  4GRK A;  4IB2 A;  2Q2A A;  3VXB A;  1MQD A;  4H8J A;  4N81 A;  4OVS A;  3IL1 B;  2PT2 A;  4M1V A;  3TEL A;  5ET6 A;  5I84 A;  4F31 B;  4JB7 A;  4YIC A;  2B3F A;  3OO9 A;  2QFL A;  5DVI A;  2ABH A;  5L9S A;  4FED A;  3PGF A;  3BIG A;  4IO2 A;  3JYR A;  2UVH A;  3OD7 A;  1SI1 A;  1HSJ A;  4TOZ A;  2W7Y A;  4NF5 A;  3T93 B;  4PFI A;  1M5C A;  4PFY A;  3GBA A;  4PF8 A;  4KCC A;  3KZG A;  2VOZ A;  3N6U A;  3RPW A;  3DEL B;  4WKM A;  1HSE A;  4H5G A;  5KCJ B;  4MX6 A;  3Q27 A;  1QVS A;  3TTM A;  4HTG A;  1UTH A;  3E13 X;  1ELJ A;  5AA1 A;  4KI0 E;  3O66 A;  4NED A;  1Q1K A;  1SPI A;  2V84 A;  3UOR A;  2Z8E A;  3PUX E;  1YYZ A;  2KQZ A;  1IUD A;  4DE8 A;  3PTY A;  2V3U A;  2ZZW A;  3CRB A;  2O51 A;  3QUF A;  1US4 A;  1B3E A;  4JBZ A;  1B32 A;  4BDO A;  4ZS9 A;  3T9V A;  2QVV A;  1GGG A;  2I48 A;  3SZP A;  4DDD A;  3H6W A;  3HFU A;  3PD8 A;  4X1B A;  1POT A;  3CI8 A;  3IFA A;  4E0W A;  4F2O A;  1EU8 A;  3CFX A;  4YKK A;  5CBR A;  3O97 A;  2XXQ A;  4U22 A;  5I2K A;  1B4H A;  1NUY A;  4Z7E A;  4HXV A;  2DQV A;  1FQE A;  2V3T A;  1B46 A;  3ZKK A;  2Y7R A;  3B8B A;  3A09 A;  4ISU A;  2UVJ A;  4KFQ A;  3TTN A;  4ZE8 A;  2V93 A;  1DOT A;  4N17 A;  2M8C A;  2ZMB A;  4BDR A;  2FVZ A;  4PAI A;  3VFJ A;  3TCF A;  4FEB A;  2I0C A;  4DCX A;  3FVN A;  3MP6 A;  1LAG E;  4QBA A;  3FXQ A;  2AYS A;  3KC1 A;  1JW1 A;  2XXV A;  3CSG A;  4UA8 A;  1YZ0 A;  3V83 A;  3EHU A;  3IOW A;  2B4L A;  1NNP A;  2OJT A;  4ZED A;  4OYV A;  2F78 A;  4KXP A;  1SW2 A;  3H06 B;  3LSW A;  2RC8 A;  4YKJ A;  5B7D A;  4PCD A;  1FQF A;  1Y3Q A;  3D4G A;  2VT5 A;  5CMK A;  3RY3 A;  1FPF A;  1FBP A;  1NNK A;  2NOO A;  5I2K B;  4XTC Q;  2HHM A;  3VLV A;  3E79 A;  4KYE A;  3G3J A;  1N84 A;  4MFI A;  3QXM A;  2VPN A;  3PPO A;  3C32 A;  4ND9 A;  4XKR A;  5ET8 A;  1FBC A;  2XXW A;  3LSL A;  2F34 A;  1DMB A;  3FJG A;  1JP4 A;  3OEN A;  4NF4 B;  5ITO A;  2DE3 A;  4U21 A;  1YPN A;  2HPG A;  2R9J A;  4MCO A;  5H8N B;  3OXN A;  4EQ9 A;  5I5P A;  3PMV A;  1SDX A;  3RTW B;  3QK6 A;  4OHN A;  2E1S A;  1EYK A;  3B7D A;  4MF3 A;  2Q74 A;  3MJN A;  2I0B A;  4G2Z A;  4OVQ A;  3OSQ A;  5I56 A;  4NWC A;  1Y4T A;  2DWH A;  4R2B A;  1LLS A;  2F6G A;  3HPI A;  1MM7 A;  1MY2 A;  3QSL A;  1KZ8 A;  1ZIU A;  3TMG A;  3PU5 A;  4F1V A;  3D4C A;  4EDP A;  4OEV A;  1NKX A;  2VGQ A;  1QUJ A;  2UYE A;  4MH5 A;  4AQ4 A;  1LCF A;  5H8H A;  5IZ3 B;  2DSF A;  2CMO A;  2HAU A;  4LAT A;  3T1B A;  5AA4 B;  3MVX A;  4QXD A;  4ZEB A;  3AXF A;  1FPD A;  4ZDM A;  1NV3 A;  1YXI A;  4ZEI A;  1FTA A;  3R7X A;  1UTB B;  2FHY A;  4GIZ A;  3MVW A;  5I57 B;  1FSA A;  1AWB A;  5EHS A;  4LP2 B;  2V25 A;  4YAH X;  4F39 A;  3FVK A;  4OFL A;  5I7I A;  2P0S A;  1FJ6 A;  4F3P A;  1IMD A;  3H3G A;  2XD3 A;  2Y7W A;  1B6H A;  2R71 A;  4MJO A;  2MKZ A;  2XXP A;  2XWO A;  1IZ1 A;  4PE5 B;  3O9P A;  3CIJ A;  1OQH A;  4AB6 A;  4P11 A;  1QW0 A;  4NG7 A;  3M3K A;  4OEN A;  4F3B A;  1I69 A;  3TOD A;  3KJT A;  2D5W A;  5ELV A;  1MS7 A;  4U4S A;  3LBS A;  1PC3 A;  4H65 A;  5IZZ A;  2KR0 A;  1FTL A;  1A8F A; 
#chains in the Genus database with same CATH homology
 3RN8 A;  4WED A;  1PB9 A;  3K6W A;  4IO7 A;  5CC2 A;  1MG1 A;  1TWY A;  3K6U A;  5HM4 B;  3HST A;  3WAE A;  2ZXT A;  3K02 A;  4KYD A;  4OMB A;  1S7Y A;  4PFU A;  2XXY A;  2I58 A;  5H8H B;  3DLN A;  3GZG A;  3ONM A;  1Y3N A;  3C9H A;  1MQJ A;  5CMB A;  5DTB A;  2GFE A;  4OES A;  5AA4 A;  5L9O A;  3L6H A;  4RYA A;  3LC8 A;  1IXG A;  3HV1 A;  4QFL A;  2I4B A;  3H6U A;  1OMP A;  4LZ8 A;  4BLA A;  4ELO A;  3HHF A;  2G29 A;  3IX1 A;  1B3L A;  4BDQ A;  3TTL A;  1Y1Z A;  5CRY A;  2DWI A;  3MW0 A;  4H1X A;  1P1N A;  4Q0C A;  5FTI A;  3U92 A;  3PPN A;  4R73 A;  5L8D A;  2QS3 A;  3R26 A;  1M5F A;  3G3I A;  1AMF A;  4JWY A;  1EZ9 A;  1XVX A;  3FV2 A;  4PFW A;  1AL3 A;  3IO4 A;  1ZKB A;  3OO8 A;  3V8X B;  4ELP A;  1NL5 A;  3MAM A;  2I4C A;  4G68 B;  3O6G A;  1Y1M A;  3SEU A;  3KG2 A;  2ZNS A;  3BBR A;  1MQI A;  3OEM A;  1CE2 A;  3CSB A;  3K00 A;  1XT8 A;  5TP9 A;  1XS5 A;  3MC2 A;  4N6P A;  4LZ7 A;  1NH7 A;  1N0T A;  3K01 A;  4GLI A;  1D3K A;  2XXH A;  4GXS B;  3VLW A;  3PMX A;  2DE2 A;  4I8C A;  2DVZ A;  3HN0 A;  2QL3 A;  2VD2 A;  3MVZ A;  3SER A;  3BFT A;  1MH4 A;  1OLC A;  3MP8 A;  3MZ1 A;  3SEY A;  1MM6 A;  1USY E;  2ALU A;  3A3C A;  4OXV A;  4MBP A;  5AA2 B;  1I6B A;  2P2A A;  4K3F A;  3DP4 A;  1DTZ A;  1ZU0 A;  1QKA A;  1LFG A;  1M5B A;  2DYX A;  2HZL A;  4THI A;  1NFT A;  4N13 A;  2XX9 A;  3DM0 A;  1M5E A;  4DZ1 A;  5DT6 A;  3V5A A;  5KDT B;  1N3X A;  2I49 A;  1I6Q A;  4YB7 A;  2XXR A;  1D4N A;  1B3G A;  1PB7 A;  1LB9 A;  2HAV A;  4LUB A;  4R6K A;  5CMC A;  3LSF B;  5KCJ A;  3L6G A;  1IEJ A;  3FGS A;  5F1Q A;  1LFH A;  2QS1 A;  2F7C A;  2XXX A;  4DIG A;  2ZYM A;  3M8U A;  2ZNT A;  4TLM B;  3SDF A;  3IB2 A;  4FIM A;  3G3F A;  2VP1 A;  3PPP A;  3FXR A;  4GXA A;  5EHM A;  3S9L C;  3V89 B;  2H9B A;  4Q8R A;  3UGW A;  2RC7 A;  2XXT A;  1MXY A;  4HS7 A;  4UAC A;  1JQF A;  1UQW A;  1ZJL A;  4P0G A;  5FHO A;  3SET A;  1O64 A;  2YJP A;  3TQL A;  4F1U A;  1URD A;  3IK6 B;  1TFD A;  3EF7 A;  4QSC A;  3TZA A;  5TPA A;  4GOT A;  2R6G E;  1Q35 A;  3TDJ A;  4XKP A;  2HQ0 A;  3FZV A;  1ANF A;  3EN3 A;  1JW4 A;  1RKM A;  1PEB A;  2OBG A;  1MY4 A;  1IIW A;  1B2H A;  2XHD A;  1R1N A;  3M3L A;  4LZ5 A;  3UN6 A;  4F2Q A;  5LOM A;  2O68 A;  3T9X B;  4ECF A;  2AL5 A;  4GQO A;  1B0H A;  2Z8F A;  4G8M A;  1S9T A;  3K1N A;  1LAF E;  1R6Z A;  2NVU B;  1OIB A;  3VDF A;  1ZMG A;  3IJO B;  3KJ7 A;  4IO3 A;  4EQB A;  4YB5 A;  2E0S A;  1R9L A;  3B6Q A;  1LBB A;  3PUV E;  2LAO A;  2G93 A;  3ECR A;  3R6U A;  5H8F A;  3KBR A;  1B4Z A;  4IO6 A;  3FJM A;  1URG A;  2RF1 A;  5B70 A;  3RNN A;  4LVQ A;  1H45 A;  3DP8 A;  2RC9 A;  4IO5 A;  2I3W A;  4G68 C;  4NTL A;  2PBW A;  3U1O A;  4GRK A;  4IB2 A;  2Q2A A;  4KR5 A;  1O63 A;  1ATG A;  3O28 A;  3SES A;  3VXB A;  1MQD A;  3IAZ A;  4ESX A;  4H8J A;  4NF5 B;  5CBS A;  3KGC A;  4KQP A;  5HBC A;  3IL1 B;  2PT2 A;  4M1V A;  4NMY A;  1FW0 A;  3TEL A;  4PQJ A;  4F31 B;  1MRP A;  5I84 A;  4JB7 A;  1Y9U A;  4YIC A;  2UVG A;  4G68 A;  2B3F A;  4GF8 A;  5H8F B;  5H8Q A;  1OVB A;  3LR1 A;  1SBP A;  3K6X A;  2Q88 A;  3OO9 A;  1A8E A;  2H5Y A;  3A3U A;  4N07 A;  5DVI A;  2ABH A;  3RLF E;  2Q89 A;  5TP9 B;  4DLD A;  1MXV A;  4FAT A;  2QRY A;  5DEX B;  5L9S A;  3IJX B;  4FED A;  3PGF A;  1FTJ A;  2F6P A;  2GHA A;  4IO2 A;  4H0W A;  4JXI A;  3GBB A;  4KD5 A;  4ELR A;  4ZEC A;  1JW5 A;  3JYR A;  2UVH A;  3H7M A;  3K1P A;  1SI1 A;  2ESN A;  3OD7 A;  4FEC A;  4DCY A;  1HSJ A;  4GWO A;  4TOZ A;  2NUV A;  2W7Y A;  4NF5 A;  3T93 B;  3EHT A;  1M5C A;  2F35 A;  4PFY A;  1YAE A;  3RTF B;  3U93 A;  3GBA A;  1JEV A;  3K4U A;  1L5T A;  4KCC A;  3KZG A;  4YMA A;  2VOZ A;  5AA3 A;  3HHG A;  3SEW A;  3N6U A;  3RPW A;  5BWJ A;  1J1N A;  3C33 A;  2Q8J A;  5M2V A;  3B6W A;  3S9E A;  1MDP 1;  1NNT A;  3DEL B;  2O69 A;  4WKM A;  5DYH A;  2AL4 A;  4YKI A;  5DEX A;  1HSE A;  2QS2 A;  4H5G A;  1LST A;  3IB1 A;  4QFO A;  5KCJ B;  2ONR A;  5TU0 A;  3LSX A;  3MP1 A;  2F7A A;  1LAX A;  3Q27 A;  4OET A;  1QVS A;  3TTM A;  1UTH A;  2QS4 A;  2V3Q A;  1ELJ A;  1LCT A;  3E13 X;  3O66 A;  4HTG A;  1DPE A;  4KI0 E;  4H67 A;  4NED A;  5AA1 A;  3VE1 B;  1Q1K A;  2NXO A;  2O7I A;  4QFP A;  3W9W A;  1NH8 A;  3GXA A;  4F29 A;  5I59 A;  2QSX A;  4F3G A;  1DPP A;  2V84 A;  4L17 A;  2Z8E A;  3UOR A;  3GLB A;  3PUX E;  1IUD A;  2F5X A;  2I6E A;  4DE8 A;  3FAS A;  4YKP A;  3T9H B;  1A99 A;  2V3U A;  3CRB A;  1N76 A;  2H4I A;  2Y7K A;  2O51 A;  1H43 A;  3QUF A;  3JZJ A;  1MXX A;  1US4 A;  1B3E A;  2OCU A;  3FVO A;  3O2A A;  3PPQ A;  2RIN A;  4R74 A;  4XKQ A;  4NF8 A;  1B1X A;  4JBZ A;  1FQD A;  1NMU A;  2RKM A;  3JV9 A;  3TFL A;  5IAI A;  4WXJ A;  4Q30 B;  3CFZ A;  5KZT A;  1Z7M E;  1D9Y A;  1UTH B;  3IOV A;  1B32 A;  4BDO A;  3BFU A;  3IOU A;  3PD9 A;  4ZS9 A;  4QHQ A;  3T9V A;  3RUM A;  1Y3P A;  4JWX A;  1QUI A;  1B5H A;  5I59 B;  1GGG A;  1UIV A;  2I48 A;  1SW5 A;  4R6H A;  4DDD A;  3H6W A;  1MY1 A;  4OFO A;  1PDA A;  3PMW A;  3ILT B;  4Q5T A;  2WKY A;  4NE4 A;  4YU0 A;  1B0L A;  3MVY A;  2DXY A;  3H6T A;  3O29 A;  3F11 A;  3PD8 A;  3UP9 A;  1JVY A;  4ZZE A;  2DOJ A;  1POT A;  3CI8 A;  3IOR A;  4X1B A;  5CI5 A;  4ZZA A;  4EF1 A;  3S4U A;  1B7Z A;  3I6V A;  1SQY A;  4E0W A;  4YZZ A;  4F2O A;  3B6T A;  1JET A;  3FXU A;  1EU8 A;  3CFX A;  1MXZ A;  4YKK A;  3O97 A;  2GH9 A;  3G7W A;  2XXQ A;  5JTY B;  3W9V A;  5CBR A;  1MQH A;  2O84 X;  2O6A A;  4U22 A;  2Y7I A;  5I2K A;  1EZO A;  1B4H A;  2QPQ A;  4Z7E A;  4H8I A;  1GVC A;  2DQV A;  2GRV A;  2OLB A;  1XOC A;  2ZYK A;  3MPL A;  1FQE A;  1QUL A;  1LBC A;  1USY H;  3K6V A;  3TTR A;  2Q9T A;  4LA9 A;  5H8Q B;  4F22 A;  1TT1 A;  1AIV A;  1M5D A;  2V3T A;  5JEI A;  1B46 A;  3VVF A;  1LAH E;  3ZKK A;  2Y7R A;  3PUW E;  4OQO A;  4I1D A;  1D9V A;  2F36 A;  3A09 A;  4G8H A;  4ISU A;  4DXB A;  2UVJ A;  1P1U A;  4QFN A;  3U8Q A;  3U72 A;  3SKP A;  4KFQ A;  3TTN A;  2CZL A;  4KPT A;  5FHN A;  3MWB A;  4PFT A;  1B1H A;  1DSN A;  1DOT A;  2V93 A;  4P0I A;  5FHM A;  4ZE8 A;  2M8C A;  4U23 A;  3Q29 A;  4U1O A;  4EXL A;  2ZMB A;  1P1O A;  4RA1 A;  3VXC A;  3MZB A;  2D3I A;  4BDR A;  1ZLQ A;  4R6Y A;  4E0X A;  1SYI A;  3CG1 A;  1VSO A;  4RY1 A;  3VFJ A;  1B7U A;  3E9X A;  1SW1 A;  4EQ7 A;  5J1D A;  2OWT A;  2OWS A;  3TPA A;  3TCF A;  3E3K A;  3MQ9 A;  4U4X A;  5IKB A;  1P99 A;  4FEB A;  2I0C A;  3DP6 A;  4ZEF A;  1LFI A;  2O1M A;  4DCX A;  4HCY A;  4C1U A;  2VD3 A;  2DWJ A;  3FVN A;  3OO6 A;  4RJZ A;  3MP6 A;  4FJP A;  1LAG E;  3M3F A;  4GL8 A;  4X1D A;  1WOD A;  3THI A;  3U94 A;  4XXU A;  3FXQ A;  1JEU A;  3TCG A;  3O6I A;  3VVE A;  5A5X A;  1B5J A;  2AYS A;  1MH3 A;  1MPB A;  2DE4 A;  2DP8 A;  3OO7 A;  4R75 A;  1JW1 A;  2XXV A;  4IO4 A;  3RQT A;  4U1Z A;  3CSG A;  4YB6 A;  5ISU A;  3UIF A;  1A55 A;  3PPR A;  4UA8 A;  4AB5 A;  1UIU A;  4G4P A;  4ZE9 A;  3V83 A;  3EHU A;  3K2D A;  3IOW A;  2REG A;  4PP0 A;  3C31 A;  4C1T A;  3T96 B;  1B52 A;  4LQ2 A;  1B40 A;  4YMB A;  2FNC A;  1NNP A;  2H99 A;  3VV5 A;  2OJT A;  4RPN A;  3H03 A;  4IY5 A;  1S50 A;  4ZED A;  1TFA A;  3CFL A;  4NF6 B;  4HW8 A;  1VFD A;  4OYV A;  3TQW A;  2Z23 A;  3MZ9 A;  2HZK A;  4H6D A;  4NF8 B;  2F78 A;  2X7Q A;  1QUK A;  3KN8 A;  2UXA A;  1DTG A;  1SW2 A;  3O6H A;  3PUZ E;  3H06 B;  3TTK A;  1BP5 A;  3EQ1 A;  1JVX A;  2VHA A;  3LSW A;  2RC8 A;  3C36 A;  4G77 A;  5HPQ A;  1B58 A;  1OQG A;  2DWA A;  3CG3 A;  4RNS A;  4YKJ A;  1URS A;  4FE8 A;  4IY6 A;  4R9G A;  1FQF A;  5B7D A;  1Y3Q A;  1EH3 A;  3N5L A;  3LUY A;  5I2N B;  5JTY A;  3D4G A;  2XD2 A;  4KCD A;  5AA2 D;  1OLA A;  5CMK A;  2I3V A;  4TQU Q;  5DVJ A;  3RY3 A;  2QJE A;  4DXU A;  1LB8 A;  3TUS A;  2Y7P A;  4NF6 A;  1HSL A;  4X9T A;  3KSX A;  4QSE A;  4BDL A;  4BDM A;  3QYT A;  4JSO A;  3KSJ A;  1NNK A;  1B51 A;  3FD3 A;  4JWO A;  4MLV A;  3N6T A;  1XVY A;  1XHY A;  1P1Q A;  4F19 A;  4FOR A;  2NOO A;  3MPK A;  3K0V A;  4OEU A;  3N94 A;  5I2K B;  2DS9 A;  1PB8 A;  4XTC Q;  4EUO A;  3S9M C;  3VLV A;  1LGB C;  1R9Q A;  1MXU A;  5H8N A;  4KYE A;  3G3J A;  1N84 A;  5L9M A;  4MFI A;  5K2X A;  3KN7 A;  2ZYO A;  3MUQ A;  3QXM A;  4JDF A;  2OK2 A;  4TLL B;  3FVG A;  2XXU A;  4M4G A;  3PPO A;  3C32 A;  4ND9 A;  1QKB A;  2NWJ A;  4GL0 A;  4XKR A;  1FTM A;  5H8S A;  2XXW A;  3LSL A;  4R2F A;  3IR1 A;  2F34 A;  4C0R A;  2XX8 A;  1WDN A;  1DMB A;  3FJG A;  4IGR A;  3G3K A;  3OEN A;  4NF4 B;  1MPC A;  4POW A;  3S9N C;  2GHB A;  4O3B A;  3RGY A;  5ITO A;  2DE3 A;  4U21 A;  5BUU A;  3OEL A;  1YPN A;  1RYO A;  4OWD A;  1IQ7 A;  4RK2 A;  2R9J A;  1SVX B;  5K2Y A;  1SD3 A;  4GVO A;  1N3W A;  4G8N A;  5H8N B;  4QFK A;  2ONK E;  3OXN A;  1WVJ A;  4OFJ A;  3ZS6 A;  1VR5 A;  4R9F A;  1BTJ A;  4XIG Q;  4EQ9 A;  2DXR A;  3C4M A;  5ICQ A;  3PUY E;  3G3G A;  3IOT A;  3PMV A;  3VLU A;  2QMX A;  2XXI A;  1SDX A;  3UK4 A;  3N26 A;  3RTW B;  3QK6 A;  2KLF A;  4OHN A;  2E1S A;  1YTV A;  1JNF A;  1Z7N E;  1GV8 A;  3B7D A;  5ICT A;  4QF9 A;  4H5F A;  3EPE A;  3G3H A;  3TYH A;  4MF3 A;  4POX A;  3MJN A;  4NF4 A;  2I0B A;  4G2Z A;  4Z0I A;  2OZZ A;  3OSQ A;  3WAF A;  5I56 A;  3KFM A;  2XX7 A;  1IXI A;  2IEE A;  3RT8 A;  1BKA A;  4NWC A;  1YCJ A;  1Y4T A;  2DWH A;  3HO7 A;  5A5X B;  2UVI A;  3TKD A;  1FCK A;  4R2B A;  2PMS A;  3ZKL A;  3UA8 A;  1LLS A;  5I58 B;  1ZBM A;  3KN3 A;  2Q2C A;  1IIT A;  2F6G A;  1O7T A;  3HPI A;  3IO6 A;  1MM7 A;  1MY2 A;  3EHS A;  3QSL A;  3TEP A;  3T66 A;  4KHZ E;  1H44 A;  3FUZ A;  2AIX A;  2F97 A;  1ZIU A;  3QIM A;  3ILU B;  4F18 A;  3TMG A;  4ELQ A;  3PU5 A;  4F1V A;  2B3B A;  3D4C A;  1Y4C A;  4EDP A;  4OEV A;  2REJ A;  3C35 A;  5DVF A;  3IB0 A;  1I6A A;  1FTO A;  1NKX A;  2ANJ A;  2D21 A;  3FAT A;  3TAJ A;  5I56 B;  2O7U A;  1SI0 A;  2VGQ A;  3Q25 A;  1QUJ A;  1CB6 A;  1ZTY A;  1B3H A;  2X7P A;  3SEX A;  1FQC A;  2UYE A;  1KWH A;  3KEI A;  1BIY A;  4MH5 A;  4AQ4 A;  1B9J A;  1LCF A;  3QAX A;  1IXC A;  5H8H A;  1POY 1;  2DSF A;  2CMO A;  2HAU A;  5I57 A;  3H4Z A;  4LAT A;  4IGT A;  3TCH A;  2YPN A;  3HCQ A;  1BLF A;  1SW4 A;  2O1L A;  3PV0 E;  2BJJ X;  5AA4 B;  1AH5 A;  4QRZ A;  3MVX A;  4BDN A;  1N7W A;  4X48 A;  3VVD A;  5I2N A;  4ZEB A;  1MY3 A;  3AXF A;  3Q26 A;  1OVT A;  5FTH A;  4RPO A;  1NNF A;  1VFE A;  4ZDM A;  1US5 A;  1MXW A;  1H3D A;  2A5T B;  1MQG A;  4ZEI A;  1N7X A;  5CMM A;  3R7X A;  1UTB B;  1GTK A;  4DXC A;  1MY0 A;  4R72 A;  4ESW A;  4U2R A;  4GIZ A;  3CR9 A;  3MVW A;  3C34 A;  5I57 B;  2B65 A;  3OMB A;  1AOV A;  3T9U A;  3E4R A;  2HFB A;  4JSD A;  4RK9 A;  5F7V A;  4ONY A;  3OOA A;  4EF2 A;  2ONS A;  5EHS A;  1P1W A;  1FQA A;  4LP2 B;  4KYS A;  4I9D A;  3I5O A;  4O3A A;  3RT6 B;  1FQB A;  3FV1 A;  3OSR A;  2RCB A;  4WEP A;  2V25 A;  2RCA A;  4GD5 A;  3Q28 A;  4XKN A;  1F9B A;  4YAH X;  4F39 A;  2FA7 A;  3FVK A;  1MPD A;  4OFL A;  2A5T A;  2P0S A;  2ZYN A;  4HCW A;  1TXF A;  3USD A;  4F3P A;  1II5 A;  1UTB A;  1B3F A;  4GFR A;  4OVJ A;  1B7H A;  1H76 A;  2PX1 A;  3H3G A;  1B5I A;  5AA2 A;  5CM6 A;  2PT1 A;  2XD3 A;  3S2V A;  2Y7W A;  2Y84 A;  2IA4 A;  5JK4 A;  1B6H A;  1FTK A;  2R71 A;  2Z22 A;  4O3C A;  3H6V A;  2QMW A;  3K1M A;  5KDT A;  2YLN A;  3ODB A;  4OER A;  3KOS A;  3T22 A;  1A54 A;  3W15 C;  2HEU A;  5EYF A;  2F8D A;  1XC1 A;  2F7B A;  3BKI B;  3FJ7 A;  3KOT A;  3OEK A;  4LQ5 A;  2P1S A;  2XXP A;  1IXH A;  1PBP A;  2FYI A;  1MDQ A;  1IZ1 A;  4OTE A;  2HCA A;  2A5S A;  4PE5 B;  3O9P A;  4OZ9 A;  4RXL A;  1PBQ A;  2PVU A;  2H98 A;  3FIR A;  3CIJ A;  1OQH A;  4NWD A;  4ZEK A;  1A7L A;  2PYY A;  4LON B;  4PET A;  2THI A;  4AB6 A;  4P11 A;  3QUJ A;  3I3V A;  4F1Y A;  4EXK A;  5I58 A;  1QJM A;  2Z8D A;  4F3S A;  1QW0 A;  1SYH A;  3M3K A;  3P7I A;  4OEN A;  4F3B A;  1VE4 A;  1EZP A;  1I69 A;  2DVC A;  4MLQ A;  3ZSF A;  4QSD A;  3TOD A;  2HXW A;  5TPA B;  3KJT A;  1GR2 A;  1Y20 A;  1T0K A;  3SEV A;  4FAJ A;  2D5W A;  1B05 A;  3MBP A;  1MS7 A;  5ELV A;  5AE4 A;  1A40 A;  4U4S A;  3LBS A;  1PC3 A;  2ZNU A;  2X26 A;  4H65 A;  4I62 A;  1N04 A;  1RYX A;  2H25 A;  5ITP A;  1FTL A;  3CVG A;  2UYF A;  1A8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...