1PBPA

Fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGDSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphate transport
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title Fine tuning the specificity of the periplasmic phosphate transport receptor. Site-directed mutagenesis, ligand binding, and crystallographic studies.
pubmed rcsb
source organism Escherichia coli
total genus 112
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1994-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbpA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pbpA02
1P1WA 4PETA 4F18A 1P1OA 2OBGA 3BFUA 3U93A 4ZEDA 2P0SA 2HEUA 3K1MA 4XKRA 4X1BA 1US4A 4BLAA 5AA4B 4KYSA 3O97A 3MUQA 4EQBA 1JQFA 3MP1A 2H9BA 4OWDA 1XVXA 3KN3A 4YKJA 1M5EA 4R6KA 5I84A 2XXUA 5KDTB 3O66A 2ZNUA 3B6WA 4QF9A 4U22A 2XXIA 4YKIA 2YPNA 1I69A 1LAHE 1MPBA 4OERA 1B3FA 3G3GA 2UVJA 1GR2A 3GBBA 2NXOA 1R1NA 3C33A 1B6HA 4F39A 5L9OA 1MXWA 1SW5A 1H45A 1QKAA 1KWHA 1O7TA 3CFZA 3W9VA 5JK4A 3OEMA 2HCAA 5KCJB 4PP0A 4OEVA 2W7YA 5B7DA 2ONSA 3GBAA 3PPOA 3BBRA 3HHGA 2G29A 1JW4A 1Y3PA 4ZEFA 2FNCA 5AA2A 2OCUA 1LFHA 1OLAA 3KJ7A 2V93A 3SKPA 2QPQA 1B0LA 4RYAA 2E0SA 3E9XA 3CR9A 4L17A 3VXCA 1DTZA 2Q2AA 5L8DA 2WKYA 4OZ9A 2V3TA 3MC2A 5H8NA 1MY4A 5I2KA 4YKKA 4EF1A 1N7XA 1AL3A 1B9JA 4H5FA 2FA7A 1LBBA 2DXYA 3ILUB 1S7YA 1ANFA 3SEWA 1DOTA 2F8DA 4GXSB 1NKXA 3LBSA 3ZKKA 2I48A 2F78A 1S50A 3P7IA 2I6EA 3RT6B 2NOOA 3ILTB 4TLLB 3IOTA 3K1NA 3OO6A 1PBQA 4ZE8A 4IO7A 5F7VA 1LAFE 3R6UA 1LCFA 3KOSA 1ZMGA 1I6BA 2FYIA 3M3KA 4P0GA 4R75A 1QUIA 3PV0E 4YB5A 5AE4A 4ELQA 4F29A 1NNPA 1Z7NE 3CSGA 2Q9TA 5DVJA 1JVXA 1D4NA 4R72A 1MQIA 1HSEA 1LGBC 4THIA 1Q1KA 2F35A 1A40A 1OVBA 3H6UA 1UTHB 2DXRA 1XS5A 3UN6A 4G8NA 4G68B 2DWIA 1H43A 3TEPA 4OXVA 2ZNSA 1FQFA 5DEXB 1B46A 2XXPA 2ZMBA 1PEBA 2Y7RA 1MDQA 4JWYA 2ANJA 3UA8A 1VE4A 5ISUA 4P11A 3TTNA 4IGTA 3VLVA 2Q88A 1BIYA 1GTKA 4JWXA 3IR1A 4H67A 3MBPA 4F2QA 3KN7A 1BLFA 4ESXA 1YTVA 3Q27A 3CI8A 3LSWA 3MPLA 4KYDA 4LUBA 1B1XA 4FATA 3U92A 2V84A 3PD9A 4QFLA 2UVGA 2H25A 3K6UA 1R6ZA 3MWBA 3SEUA 4X1DA 1TFDA 2VD3A 3FVNA 4OTEA 2BJJX 1B3EA 5ICQA 2A5TA 2A5SA 2Q89A 5CBRA 1NNTA 5CBSA 2R9JA 1BP5A 3BKIB 4R73A 5CRYA 2XXHA 1GGGA 3UGWA 4NF6B 5FTIA 1USYH 3PPQA 2XXRA 4DCYA 3OSQA 4QHQA 1POTA 2B65A 4G2ZA 3O6GA 2VD2A 4KI0E 5IAIA 1JW1A 1M5FA 4FIMA 1B52A 4ESWA 4LP2B 1OQGA 2HXWA 1FQAA 3MP8A 3QYTA 3V83A 3T9HB 4EXKA 1RKMA 5BUUA 2DWHA 2Q2CA 3S9MC 1MPDA 2UYFA 2F5XA 3HV1A 1B5JA 5H8HB 4OMBA 3KSJA 2Z23A 3H6VA 3LSFB 4ISUA 5TPAA 2DE4A 1JNFA 3FV2A 1N84A 4N13A 3CFXA 2Z8EA 3DP6A 3T9XB 2Y7WA 1NNKA 3PMVA 4JWOA 1QJMA 1M5DA 1R9LA 1SW2A 5I58B 4YZZA 5FHNA 1AIVA 1TWYA 3C35A 3RQTA 3IB2A 3VV5A 3QXMA 5AA4A 3DP4A 4E0XA 4POXA 4QFOA 1MXXA 1XOCA 1MM7A 2V3UA 2GHAA 4H8JA 3RNNA 3EHUA 1PB8A 3DELB 2THIA 1N76A 3IO4A 5KDTA 1IXCA 1VSOA 4EF2A 4FAJA 5ICTA 3PUWE 1B2HA 3OXNA 4HTGA 3QUJA 2ONKE 3QAXA 4U2RA 3I5OA 3Q28A 3QIMA 1B0HA 1QKBA 2ZYNA 2P1SA 4HS7A 2V3QA 2PBWA 1D9YA 4I8CA 1PB9A 5KCJA 2H5YA 4F22A 4YB7A 3SETA 2R6GE 1XVYA 1TFAA 2O84X 4QFPA 3VLWA 1BKAA 1DTGA 1PC3A 2I4BA 5KZTA 5CM6A 1N0TA 3VFJA 1SQYA 5JTYB 3CIJA 2I0CA 1LFGA 1YAEA 3A09A 3LR1A 3ZKLA 2AL4A 1RYOA 1MH3A 3PU5A 1CB6A 1UTBB 3WAEA 4DLDA 1MQDA 1WDNA 4JDFA 3FD3A 5LOMA 2ZYOA 3KG2A 4MH5A 4Z0IA 4KD5A 4BDOA 5BWJA 3PPRA 4ECFA 1PDAA 2I0BA 2UVIA 4GQOA 3MZ9A 3HPIA 5EHMA 2ESNA 5HPQA 3G3KA 4GLIA 5AA2D 4NF8B 2Q8JA 1MY1A 4Z7EA 4GL0A 5AA3A 3K00A 4FEDA 5EYFA 2CZLA 2H4IA 4WEDA 3T22A 4IO6A 1B4HA 4H6DA 1JW5A 2F6GA 3OEKA 1SYIA 3PUXE 3OOAA 3JV9A 4KCCA 3EQ1A 4H1XA 4PE5B 3RY3A 3TAJA 1GVCA 2Y84A 2NUVA 1MY2A 3IL1B 3IOUA 3LSXA 4OETA 3TFLA 4JXIA 1II5A 3TCHA 2O7IA 2OZZA 3CVGA 4ZEKA 1B7ZA 3M3LA 3KSXA 3N5LA 2XXYA 1UTHA 1OLCA 4NE4A 1M5BA 4G68A 4Q30B 2VHAA 1MM6A 4AB6A 1FQCA 4I62A 5DEXA 1A54A 2QMWA 3E13X 1M5CA 4MLVA 4DXBA 3C32A 5B70A 4GRKA 1B5IA 3VLUA 2O51A 3Q25A 3IB1A 3R26A 2Z8FA 5I2NB 2UYEA 5I57B 5I59A 4M4GA 3EN3A 1QW0A 1QULA 4R74A 1WVJA 4EQ7A 1H76A 2RCAA 1UQWA 1A8EA 3LC8A 4YU0A 4TQUQ 1SW1A 3UIFA 1GV8A 4PFUA 1LCTA 3TTKA 4OYVA 4F1YA 3PPNA 4OESA 3ECRA 3V8XB 2QS4A 4DCXA 1ZU0A 3MVYA 3TYHA 4DIGA 3FGSA 2F6PA 4F3BA 4DZ1A 5K2XA 4F1UA 2ALUA 3W9WA 3FJ7A 4NF6A 1LLSA 1MH4A 1Y4TA 1TT1A 4KYEA 1LB9A 1ZLQA 4UA8A 4OFJA 3K02A 4KHZE 4OFOA 3UORA 4F19A 4MLQA 4C1TA 3FXRA 4IO2A 4F31B 3EPEA 2ZYMA 2H98A 3H4ZA 4JB7A 3IAZA 3K0VA 5CC2A 3OENA 2ZXTA 3K2DA 1SI1A 1DSNA 3O6IA 3C4MA 1VR5A 3VVEA 3HN0A 4RK9A 1B51A 4EDPA 1MDP1 4I9DA 3C31A 4ZS9A 1OQHA 3U94A 1B3HA 3CSBA 3FVGA 1FTLA 4H65A 5H8HA 1DPPA 2QS1A 2XX8A 2B3FA 4X9TA 4NF5B 1QUKA 2RCBA 4QFNA 4IO3A 3K01A 4ONYA 4O3BA 4BDRA 1SW4A 3N94A 4IO4A 4R6YA 1T0KA 3VVDA 5I58A 4G8HA 4AQ4A 4BDMA 2XXTA 2ONRA 2I3WA 3B6TA 3H3GA 3CG3A 2O69A 5TP9B 5IKBA 3MP6A 4TOZA 2Y7PA 2XX9A 3ODBA 3MVXA 3OMBA 3EHTA 5DYHA 3KEIA 1A7LA 2NWJA 1FTOA 4TLMB 2IEEA 2UVHA 3K6XA 3O29A 1FQBA 5I56B 2VGQA 4IY5A 1FCKA 3S2VA 3F11A 1IUDA 3TPAA 2D3IA 3VDFA 3WAFA 2PT1A 4EUOA 3S4UA 3U72A 2D5WA 2DSFA 3Q26A 3FIRA 4YMAA 1SBPA 2NVUB 2B3BA 1MY3A 3FASA 3FZVA 4U4XA 5H8FB 1OVTA 4Q5TA 1AH5A 1IIWA 1O64A 3W15C 3H6TA 4MBPA 4XKPA 4R2FA 2V25A 4OVJA 2PMSA 5HM4B 4RPOA 2E1SA 4YICA 1SDXA 2Y7IA 2DP8A 1P99A 5JTYA 3G7WA 1R9QA 3CFLA 4F3GA 1JETA 1LBCA 2O6AA 2O7UA 2Z8DA 2IA4A 1UTBA 1VFDA 3T9VA 4H8IA 4LQ2A 4WEPA 4E0WA 4GL8A 3QUFA 3IB0A 4F3SA 2PYYA 4ZDMA 2QS2A 1MQJA 3PMWA 1P1NA 4OEUA 1B05A 1QUJA 4NF8A 2CMOA 3Q29A 1IXIA 1PB7A 3VE1B 4KCDA 4Q0CA 4R2BA 4RNSA 4OQOA 2HZKA 5DT6A 1Y20A 2O1MA 3RN8A 3O6HA 2QRYA 3V5AA 2GH9A 3TMGA 5DTBA 2F97A 4I1DA 4G8MA 2DVZA 1EU8A 3OD7A 3S9LC 1ELJA 3ZSFA 4LATA 2G93A 1A99A 1Z7ME 4ELOA 2O1LA 1B32A 1IZ1A 2VOZA 4ZEIA 3U8QA 1NH7A 4NWDA 4ZEBA 2HAUA 5A5XB 3K6WA 4WKMA 4KQPA 4K3FA 3LUYA 1POY1 4PFTA 1SYHA 1USYE 4FJPA 1Y9UA 3C34A 1A55A 2QMXA 3PUYE 3KJTA 4IB2A 1Y3NA 3MVZA 2PX1A 1B3GA 3D4GA 4G68C 4YAHX 4KPTA 5HBCA 4DXCA 4F3PA 5L9MA 1B3LA 5J1DA 1LAGE 2DQVA 4NF4B 3MZ1A 1B1HA 2QL3A 5I2NA 2I49A 1MXVA 3FJMA 4ZZEA 3HHFA 5I57A 1NMUA 3EF7A 2XX7A 3GLBA 3FV1A 3S9EA 3OELA 3TELA 5JEIA 1J1NA 5H8SA 2D21A 3H7MA 1JEVA 4GFRA 2VP1A 1SI0A 3MPKA 1F9BA 3MVWA 4HCYA 3SDFA 3QK6A 3PGFA 3TCFA 4LZ5A 3SESA 3D4CA 5ITPA 1NNFA 3TUSA 4RA1A 3V89B 2DOJA 3AXFA 3KOTA 2RC9A 4GIZA 4XKNA 3CRBA 3M8UA 4GWOA 1VFEA 2XD3A 1FW0A 5H8QB 1H44A 2ABHA 2LAOA 3SEVA 5EHSA 3K4UA 3TODA 3OO9A 4C0RA 5CMBA 1EZPA 3KGCA 3FVOA 1I6AA 3JYRA 1FQEA 3RTFB 4PFYA 2Y7KA 4DXUA 4ZECA 2UXAA 4MFIA 5L9SA 2F34A 2OWTA 1ZIUA 3MAMA 3VVFA 5AA1A 1MQHA 4G77A 1A8FA 3N6UA 1UIUA 4H0WA 2RC8A 3IX1A 1ZKBA 1YCJA 5K2YA 2GFEA 2QJEA 4UACA 4FE8A 1ZBMA 2O68A 4FEBA 4JSDA 3G3FA 3UK4A 4YKPA 1Q35A 3MQ9A 5CMKA 4LZ8A 3RPWA 4N07A 4NF5A 1FTKA 3L6HA 2XHDA 3T66A 3JZJA 2YLNA 3KZGA 4H5GA 1HSLA 4R6HA 1Y1ZA 4YMBA 1IXGA 5ITOA 4IO5A 3G3IA 4BDQA 5TP9A 1FQDA 5FHMA 4NEDA 3OO8A 2ZNTA 5ELVA 1MXZA 4QSDA 3M3FA 3PUZE 3IOVA 1EH3A 3TTLA 2DYXA 1QVSA 2RF1A 4LVQA 5I56A 1RYXA 4OHNA 2XXQA 4XTCQ 5I59B 3KFMA 3R7XA 1P1UA 3FVKA 3MZBA 3FATA 4QSCA 1ATGA 4HW8A 3O9PA 1YPNA 4EXLA 3DP8A 1N7WA 4FORA 4LA9A 3H03A 2OJTA 3PUVE 1B58A 1NL5A 3K1PA 4Q8RA 3B7DA 4LZ7A 3OO7A 1CE2A 4PQJA 5H8FA 3FUZA 4QRZA 4FECA 4LQ5A 5F1QA 4RY1A 4ELPA 3USDA 3T96B 2DWJA 3SEXA 1MQGA 3TTRA 2RINA 2X7PA 1EZOA 2X7QA 2OLBA 1MS7A 1AMFA 1HSJA 1URSA 3OSRA 2DE2A 3CG1A 1JVYA 4U23A 4KFQA 3C9HA 2P2AA 2XXXA 3IK6B 3A3CA 2XD2A 3HO7A 4JSOA 3T9UA 1IEJA 3KN8A 5CMMA 4U21A 2F7AA 4PFWA 2RC7A 4XKQA 4GVOA 1BTJA 5AA2B 4RPNA 1N3WA 5FHOA 3U1OA 4DE8A 3T93B 3ONMA 4P0IA 3TQWA 4AB5A 3N6TA 2I3VA 1P1QA 3KBRA 4O3CA 3I6VA 1IXHA 5TU0A 3TQLA 4N6PA 4ND9A 4F2OA 1N3XA 5H8NB 1DMBA 2GHBA 5I2KB 5DVIA 4GF8A 2PT2A 2AYSA 3IJOB 4IY6A 3UP9A 1ZJLA 3L6GA 4IGRA 3TTMA 3GZGA 4EQ9A 3I3VA 1MY0A 1Y4CA 1US5A 1I6QA 1SD3A 5A5XA 2XXWA 1URGA 5FTHA 1EZ9A 2DVCA 1TXFA 2ZYKA 3BFTA 1MRPA 4NWCA 4POWA 4X48A 4NMYA 1PBPA 3O28A 4ZE9A 1ZTYA 3A3UA 4XXUA 2DS9A 1IITA 3VXBA 4XIGQ 1JEUA 1NH8A 3RUMA 2I4CA 4NF4A 5M2VA 1MG1A 2H99A 1MPCA 1NFTA 2GRVA 5CI5A 3TDJA 2M8CA 1LSTA 4BDLA 1AOVA 5DVFA 3K6VA 4OFLA 2F7CA 4M1VA 4JBZA 3E3KA 4C1UA 4YB6A 2AL5A 3THIA 3PPPA 2REJA 2XXVA 3HCQA 3FXUA 2AIXA 1H3DA 3SERA 4ELRA 4GOTA 1OMPA 4BDNA 4KR5A 3IOWA 2Z22A 1FTMA 3IORA 4RJZA 1DPEA 4U4SA 5H8QA 4ZZAA 3RLFE 2YJPA 1MXUA 1XT8A 3DM0A 5CMCA 3RT8A 3ZS6A 2F7BA 4MF3A 2OK2A 1XC1A 3RTWB 3FJGA 3IO6A 4U1OA 4RXLA 1B7UA 1N04A 4F1VA 3HSTA 3G3HA 2HFBA 4RK2A 4GD5A 3MW0A 4GXAA 2A5TB 2KLFA 1Y1MA 4R9GA 2F36A 2RKMA 4NTLA 3LSLA 1OIBA 2QS3A 4QSEA 1S9TA 2HAVA 1URDA 3IJXB 1LFIA 3O2AA 1MXYA 3H06B 1FTJA 3PMXA 3S9NC 2DE3A 2HZLA 4O3AA 3TZAA 1O63A 2OWSA 4DDDA 4OENA 3DLNA 2X26A 2PVUA 3QSLA 3PD8A 1B7HA 4HCWA 3TKDA 3G3JA 4R9FA 1LB8A 1IQ7A 4U1ZA 3TCGA 3EHSA 3N26A 1Y3QA 3H6WA 3FXQA 2I58A 1SVXB 2QSXA 1L5TA 1B4ZA 3RGYA 3MJNA 3C36A 1B40A 2HQ0A 2R71A 2DWAA 1UIVA 4QFKA 1XHYA 3SEYA 3E4RA 4G4PA 1B5HA 1D9VA 1LAXA 4WXJA 1D3KA 1WODA 4LONB 3B6QA 3GXAA 5TPAB 2REGA
chains in the Genus database with same CATH superfamily
1P1WA 4PETA 2FHYA 4F18A 1P1OA 2OBGA 3BFUA 3U93A 4ZEDA 2P0SA 2XWKA 3IFCA 2HEUA 3K1MA 4XKRA 4X1BA 1US4A 4UABA 4BLAA 5AA4B 4PDDA 4KYSA 3O97A 1FBEA 3MUQA 4EQBA 1JQFA 3MP1A 2ZZVA 2H9BA 4I3EA 4OWDA 1XVXA 3KN3A 4YKJA 1M5EA 4R6KA 5I84A 4NF0A 2XXUA 5KDTB 3O66A 4N4UA 2ZNUA 2B4LA 3B6WA 4QF9A 4U22A 1LBVA 2XXIA 4YKIA 1LBYA 2YPNA 1NV5A 2CZKA 4GX6A 1I69A 3BIHA 1LAHE 1MPBA 4OERA 1B3FA 3G3GA 2UVJA 1GR2A 3GBBA 4MIJA 2NXOA 3E79A 1FSAA 1R1NA 3C33A 1B6HA 4F39A 5L9OA 1MXWA 1QGXA 1SW5A 1H45A 1QKAA 1KWHA 1O7TA 3CFZA 5T3JA 3W9VA 5JK4A 4N91A 3OEMA 2HCAA 5KCJB 4PP0A 4OEVA 2W7YA 4X8RA 5B7DA 1FJ6A 4O7IA 1JP4A 4PBQA 2ONSA 3GBAA 3PPOA 3BBRA 3HHGA 2G29A 4GWUA 1JW4A 3A29A 1Y3PA 4ZEFA 2FNCA 5AA2A 2OCUA 1LFHA 1INPA 2WYPA 1OLAA 3KJ7A 2V93A 3SKPA 2QPQA 1B0LA 4RYAA 2E0SA 2F3DA 3E9XA 3CR9A 4L17A 3VXCA 1DTZA 2Q2AA 5L8DA 2WX9A 2WKYA 4OZ9A 2V3TA 3MC2A 5H8NA 1MY4A 5I2KA 4YKKA 4PDHA 4LN5A 4EF1A 1N7XA 1AL3A 1B9JA 4H5FA 2FA7A 1LBBA 2DXYA 3ILUB 1S7YA 1ANFA 3SEWA 2VPOA 4P1LA 5EQ8A 1DOTA 2F8DA 4GXSB 1NKXA 3LBSA 3ZKKA 2I48A 2F78A 1S50A 3P7IA 4MCOA 2I6EA 3RT6B 2NOOA 3ILTB 4TLLB 3IOTA 3K1NA 3OO6A 1PBQA 4ZE8A 4IO7A 5F7VA 1LAFE 4PGPA 3R6UA 1NV7A 3KBZA 1NV2A 1LCFA 3KOSA 4GX3A 1I6BA 1ZMGA 2FYIA 3M3KA 4PAFA 4P0GA 4R75A 1QUIA 4PBHA 3PV0E 4YB5A 5AE4A 4ELQA 4F29A 1NNPA 1Z7NE 3CSGA 2Q9TA 5DVJA 1JVXA 1D4NA 4R72A 4I3YA 1NV1A 1NUZA 1MQIA 1HSEA 1LGBC 4THIA 1Q1KA 2F35A 1A40A 1OVBA 3H6UA 1UTHB 2DXRA 1XS5A 3UN6A 4G8NA 4G68B 2DWIA 1H43A 3TEPA 4OXVA 2ZNSA 1FQFA 5DEXB 1B46A 4MNPA 2XXPA 2ZMBA 1PEBA 2Y7RA 1MDQA 4JWYA 2ANJA 3UA8A 1VE4A 5ISUA 4P11A 3TTNA 4IGTA 3VLVA 2Q88A 4PAKA 1BIYA 1GTKA 4JWXA 3IR1A 4XEQA 5LDZA 4MMPA 4H67A 3MBPA 4F2QA 2CEXA 1RDYA 3KN7A 1BLFA 4ESXA 4JVDA 3ROJA 1YTVA 3Q27A 3CI8A 3LSWA 3MPLA 4KYDA 4LUBA 1B1XA 4FATA 3U92A 2V84A 3PD9A 4MAGA 4QFLA 2UVGA 2H25A 3K6UA 1R6ZA 3MWBA 3SEUA 4X1DA 1TFDA 2VD3A 3FVNA 4OTEA 2BJJX 1B3EA 4N8GA 5ICQA 2A5TA 2A5SA 2Q89A 5CBRA 1NNTA 5CBSA 2R9JA 1BP5A 2CZIA 3BKIB 5IZZA 4R73A 5CRYA 2XXHA 1GGGA 3UGWA 4NF6B 5FTIA 1YXIA 4PE3A 2ZZWA 4MEVA 1USYH 3PPQA 2XXRA 4DCYA 3LUZA 3OSQA 4QHQA 1POTA 2B65A 4G2ZA 3O6GA 4GWWA 2VD2A 4KI0E 5IAIA 1FPEA 1JW1A 1M5FA 4FIMA 1B52A 4ESWA 4LP2B 5ET7A 1OQGA 2HXWA 1FQAA 3MP8A 3QYTA 3V83A 3T9HB 4EXKA 1RKMA 4QXDA 5BUUA 3PTYA 2DWHA 2Q2CA 3S9MC 4N17A 1MPDA 4MNCA 2UYFA 2F5XA 3QMFA 3HV1A 1B5JA 5H8HB 4OMBA 3KSJA 1NI9A 2Z23A 4PGNA 3H6VA 4NAPA 3LSFB 4ISUA 5TPAA 2DE4A 1JNFA 3FV2A 1N84A 4N13A 3CFXA 1NUYA 2Z8EA 3DP6A 3T9XB 2Y7WA 1NNKA 3FXBA 3PMVA 4P1EA 4JWOA 1QJMA 1M5DA 1R9LA 1SW2A 5I58B 4YZZA 5FHNA 1AIVA 1TWYA 3C35A 3RQTA 3IB2A 3VV5A 2QFLA 3QXMA 5AA4A 3DP4A 4I40A 4E0XA 4POXA 4QFOA 1MXXA 3HFUA 1XOCA 1CNQA 1MM7A 2V3UA 2GHAA 4H8JA 3RNNA 3EHUA 1PB8A 3DELB 2THIA 4N15A 1N76A 3IO4A 5KDTA 1IXCA 1VSOA 4EF2A 4FAJA 5ICTA 3PUWE 1B2HA 1EYJA 1FBDA 3OXNA 4HTGA 3QUJA 4DI3D 2ONKE 3QAXA 4U2RA 3I5OA 3Q28A 3QIMA 1B0HA 1QKBA 4OA4A 2ZYNA 1FBCA 2P1SA 4HS7A 2V3QA 2PBWA 2FIXA 1BK4A 1D9YA 4I8CA 1PB9A 5KCJA 2H5YA 4F22A 4YB7A 3SETA 2R6GE 1XVYA 1TFAA 2O84X 2P3NA 4HE2A 4QFPA 3VLWA 1BKAA 1DTGA 1PC3A 2I4BA 5KZTA 2DDKA 5CM6A 1N0TA 3VFJA 5I3SA 1SQYA 5JTYB 3CIJA 2I0CA 1LFGA 1YAEA 3A09A 4KXPA 3LR1A 3ZKLA 2AL4A 1RYOA 1MH3A 3PU5A 1CB6A 1UTBB 3WAEA 2PFZA 4DLDA 2FIEA 1KZ8A 4JVIA 1MQDA 1WDNA 4JDFA 3FD3A 5LOMA 2ZYOA 3KG2A 4MH5A 4Z0IA 1FBPA 4KD5A 4BDOA 5BWJA 1FPFA 3MYUA 3PPRA 4ECFA 1PDAA 2I0BA 2UVIA 4GQOA 3MZ9A 3HPIA 5EHMA 2ESNA 5HPQA 3G3KA 4GLIA 5AA2D 4NF8B 4P47A 3FBPA 2Q8JA 1MY1A 2WYKA 4Z7EA 4GL0A 5AA3A 3K00A 4FEDA 4PTKA 5EYFA 2CEYA 2CZLA 2H4IA 4WEDA 5ET8A 5A5LA 3T22A 4IO6A 1B4HA 4H6DA 1JW5A 2F6GA 3OEKA 1SYIA 3PUXE 3OOAA 1FPJA 3JV9A 4KCCA 3EQ1A 5EYGA 4H1XA 2KQZA 1G0IA 4OVQA 2JJKA 4PE5B 3RY3A 3TAJA 2HPGA 1GVCA 2Y84A 2NUVA 1LEVA 1MY2A 3IL1B 3IOUA 3LSXA 4OETA 3TFLA 3D1RA 4JXIA 1II5A 5EQ7A 3TCHA 2O7IA 2OZZA 3CVGA 4ZEKA 1B7ZA 3M3LA 3KSXA 3N5LA 2XXYA 4GX4A 1UTHA 1OLCA 4NE4A 1M5BA 4G68A 4Q30B 2VHAA 4XFEA 1MM6A 1LBZA 4AB6A 1FQCA 4GWZA 4I62A 5DEXA 1A54A 2QMWA 3E13X 1M5CA 4MLVA 1FPKA 4DXBA 4QBAA 3C32A 5B70A 4GRKA 1B5IA 3VLUA 2O51A 3Q25A 3IB1A 3R26A 2Z8FA 5I2NB 2UYEA 4AS5A 5I57B 5I59A 4M4GA 3EN3A 1QW0A 1QULA 4R74A 1WVJA 4EQ7A 1H76A 2RCAA 1UQWA 1A8EA 1FJ9A 3LC8A 4JVCA 4YU0A 4N81A 3NOHA 4TQUQ 1SW1A 4GWYA 1SPIA 3UIFA 1GV8A 1FBFA 4PFUA 1LCTA 4OVSA 3TTKA 4OYVA 4OVTA 4F1YA 4HXVA 3PPNA 4OESA 3ECRA 3V8XB 2QS4A 4DCXA 1ZU0A 3MVYA 4HE0A 3TYHA 4DIGA 3FGSA 2F6PA 4F3BA 4DZ1A 5K2XA 2L5VA 4F1UA 2ALUA 5ESYA 3W9WA 3FJ7A 1DBZA 1LBWA 4NF6A 1LLSA 1KA0A 1MH4A 1Y4TA 1TT1A 2XA5A 4KYEA 1LB9A 1ZLQA 4UA8A 4OFJA 3K02A 4KHZE 4OFOA 3UORA 4F19A 3T1BA 4MLQA 4C1TA 3FXRA 4IO2A 4PAIA 4F31B 3EPEA 2ZYMA 2H98A 3H4ZA 4JB7A 3IAZA 1LBXA 3K0VA 5CC2A 3OENA 2ZXTA 3K2DA 1SI1A 1DSNA 3O6IA 3C4MA 1VR5A 3VVEA 3HN0A 4NG7A 4MNIA 4RK9A 1B51A 4EDPA 1MDP1 4I9DA 3C31A 4ZS9A 1OQHA 3U94A 4AS4A 1B3HA 3CSBA 3FVGA 1FTLA 4H65A 3MSTA 5H8HA 1G0HA 5IZ3B 1DPPA 2QS1A 2XX8A 2B3FA 4X9TA 4NF5B 1QUKA 2RCBA 4QFNA 4ONYA 3K01A 4IO3A 4O3BA 4BDRA 1SW4A 4P3LA 3N94A 4IO4A 4R6YA 5F24A 2WBBA 1T0KA 3VVDA 5I58A 4G8HA 1IMDA 4AQ4A 4BDMA 2XXTA 2ONRA 2GQ1A 2I3WA 3T0JA 3B6TA 5EQAA 3H3GA 3CG3A 2O69A 5TP9B 5IKBA 2OWZA 3MP6A 4TOZA 2Y7PA 2XX9A 3ODBA 3MVXA 3OMBA 3EHTA 3LV0A 5DYHA 3KEIA 1A7LA 2NWJA 1FTOA 4TLMB 2IEEA 2UVHA 3K6XA 3O29A 1FQBA 5I56B 2VGQA 4IY5A 4PFIA 1FCKA 3S2VA 3F11A 5I5PA 3EKIA 2QVVA 1IUDA 3TPAA 2D3IA 3VDFA 3WAFA 2PT1A 4EUOA 1FPBA 3S4UA 3U72A 2D5WA 2DSFA 3Q26A 3FIRA 4YMAA 1SBPA 4GWXA 2NVUB 2B3BA 1MY3A 3FASA 3FZVA 4U4XA 5H8FB 1OVTA 4Q5TA 1AH5A 2KR0A 1IIWA 1O64A 3W15C 3H6TA 4MBPA 3E78A 4XKPA 4R2FA 2V25A 4OVJA 2PMSA 5HM4B 4RPOA 2E1SA 4YICA 1SDXA 2Y7IA 2DP8A 1P99A 2XXKA 5JTYA 1IMCA 3G7WA 1R9QA 3CFLA 4F3GA 1JETA 1LBCA 2O6AA 2O7UA 2Z8DA 1FRPA 2IA4A 1UTBA 1VFDA 3T9VA 4OANA 4H8IA 4LQ2A 4WEPA 4E0WA 4GL8A 3QUFA 3IB0A 4F3SA 2PYYA 1IMBA 4ZDMA 2QS2A 2Y5LA 1FPGA 5DW8A 1MQJA 3IFAA 3PMWA 1P1NA 1K9YA 4OEUA 1B05A 2BJIA 4O7MA 1QUJA 4NF8A 2CMOA 3Q29A 1IXIA 1PB7A 3VE1B 4MX6A 2ZZXA 2XWVA 4KCDA 4Q0CA 4R2BA 1NUXA 4RNSA 4OQOA 2HZKA 5DT6A 1Y20A 2O1MA 3RN8A 3O6HA 2QRYA 3V5AA 2GH9A 3TMGA 5DTBA 2F97A 4I1DA 4G8MA 1IMEA 2DVZA 1EU8A 3OD7A 3S9LC 1ELJA 5EYHA 3ZSFA 4LATA 4PFBA 1DK4A 2G93A 1A99A 1Z7ME 4ELOA 2O1LA 1NUWA 1B32A 1IZ1A 2VOZA 4ZEIA 3U8QA 1NH7A 4NWDA 4ZEBA 2HAUA 5A5XB 3K6WA 4WKMA 4KQPA 4NQ8A 4K3FA 3LUYA 1POY1 4PFTA 1SYHA 1USYE 4FJPA 1Y9UA 3C34A 1A55A 3KC1A 2QMXA 3PUYE 3KJTA 4IB2A 2XWOA 1Y3NA 3MVZA 2PX1A 1FBGA 1B3GA 3D4GA 4G68C 4YAHX 3B8BA 4KPTA 5HBCA 4DXCA 4F3PA 5L9MA 1B3LA 2Q8MA 5J1DA 1LAGE 4MHFA 2DQVA 1K9ZA 4NF4B 3MZ1A 1B1HA 2QL3A 1IMAA 1RDXA 5I2NA 2I49A 1MXVA 3FJMA 4GWSA 4ZZEA 3HHFA 4GBWA 5I57A 1NMUA 3EF7A 3BIGA 2XX7A 3GLBA 3FV1A 3S9EA 3OELA 3TELA 5JEIA 1J1NA 5H8SA 2D21A 3H7MA 1JEVA 4GFRA 2VP1A 1SI0A 3MPKA 1F9BA 3MVWA 4HCYA 3SDFA 3QK6A 3PGFA 3TCFA 4LZ5A 3SESA 2B4MA 3D4CA 5ITPA 4N6DA 1NNFA 3TUSA 4RA1A 2P3VA 3V89B 2DOJA 3AXFA 3KOTA 2RC9A 4GIZA 4XKNA 3CRBA 3M8UA 4GWOA 1VFEA 2XD3A 4HE1A 1FW0A 5H8QB 1H44A 4X04A 2ABHA 2LAOA 3SEVA 5EHSA 3K4UA 1D9QA 3TODA 1KA1A 3OO9A 4C0RA 5CMBA 1EZPA 3KGCA 3FVOA 1I6AA 3JYRA 1FQEA 3RTFB 4PFYA 2Y7KA 4DXUA 4ZECA 1IMFA 2UXAA 4MFIA 5L9SA 2F34A 2OWTA 1ZIUA 3MAMA 4PFRA 1RDZA 3VVFA 5AA1A 1MQHA 4G77A 5IM2A 1A8FA 3N6UA 1UIUA 4H0WA 5IZ1A 2RC8A 1FPDA 3IX1A 1ZKBA 1YCJA 5K2YA 2GFEA 2QJEA 4UACA 4FE8A 1ZBMA 2O68A 2PCRA 4GBVA 4FEBA 4JSDA 5J16A 1FPLA 3G3FA 4N8YA 5IZ3A 3UK4A 4YKPA 1Q35A 5EQ9A 3MQ9A 5CMKA 4LZ8A 3RPWA 4N07A 4NF5A 1FTKA 2QVRA 3L6HA 2XHDA 3T66A 3JZJA 4P9KA 1Q9DA 2YLNA 1NV0A 3ISPA 3RPLB 3KZGA 4H5GA 1HSLA 4R6HA 4N6KA 4XF5A 1Y1ZA 4YMBA 1IXGA 5ITOA 4IO5A 3G3IA 4BDQA 5TP9A 1FQDA 5FHMA 4NEDA 3OO8A 2ZNTA 5ELVA 1MXZA 4QSDA 3M3FA 3PUZE 4IR8A 3IOVA 1EH3A 3TTLA 2DYXA 1QVSA 2RF1A 4LVQA 5I56A 1RYXA 1NV6A 4OHNA 2XXQA 4XTCQ 5I59B 4H45A 3KFMA 3R7XA 1P1UA 3FVKA 3MZBA 3FATA 4QSCA 1ATGA 4HW8A 3O9PA 1YPNA 4EXLA 3DP8A 1N7WA 4FORA 4LA9A 3H03A 2OJTA 3PUVE 1B58A 1NL5A 3K1PA 4Q8RA 3B7DA 4LZ7A 3OO7A 1CE2A 4PQJA 5H8FA 3FUZA 4QRZA 4FECA 4LQ5A 5F1QA 4RY1A 4ELPA 3USDA 3T96B 2DWJA 3SEXA 1MQGA 3TTRA 2RINA 2X7PA 1EZOA 2X7QA 2V4CA 2OLBA 1MS7A 1AMFA 2MKZA 1HSJA 1URSA 3OSRA 2DE2A 3CG1A 1JVYA 2F3BA 4U23A 4KFQA 3C9HA 2P2AA 2XXXA 3IK6B 3A3CA 2XD2A 3HO7A 4JSOA 3T9UA 1IEJA 3KN8A 2FBPA 3KC0A 5CMMA 1FTAA 4U21A 1VDWA 3GYYA 4OVRA 2F7AA 4PFWA 2RC7A 4XKQA 4GVOA 1BTJA 5AA2B 4RPNA 2XWIA 2WEFA 1N3WA 2R8TA 5FHOA 3U1OA 4DE8A 3T93B 3ONMA 4P0IA 3TQWA 3SZPA 4AB5A 2QVUA 3N6TA 2I3VA 1YZ0A 1P1QA 3KBRA 4O3CA 1DCUA 3I6VA 3RYDA 1IXHA 5TU0A 3TQLA 1XI6A 4N6PA 5FBPA 4OVPA 4ND9A 4F2OA 1N3XA 5H8NB 1DMBA 2GHBA 5I2KB 1NV3A 5DVIA 4DI4B 4GF8A 2PT2A 2AYSA 3IJOB 4IY6A 3UP9A 1ZJLA 3L6GA 4IGRA 4NGUA 3TTMA 2WBDA 4FBPA 3GZGA 4EQ9A 3I3VA 1MY0A 1Y4CA 1US5A 1I6QA 2VPNA 1SD3A 5ET5A 1FPIA 5A5XA 2XXWA 1URGA 5FTHA 1EZ9A 1NV4A 2DVCA 1TXFA 2ZYKA 3BFTA 2HHMA 1MRPA 4NWCA 5I7IA 4POWA 4X48A 4NMYA 1PBPA 2OX3A 3O28A 4ZE9A 1ZTYA 3A3UA 4XXUA 2DS9A 1IITA 3VXBA 4PC9A 4XIGQ 1JEUA 4H46A 1NH8A 3RUMA 4NHBA 2I4CA 4NF4A 5M2VA 1MG1A 2H99A 1MPCA 1NFTA 2GRVA 5CI5A 3TDJA 2M8CA 1LSTA 4BDLA 1AOVA 1AWBA 5DVFA 3K6VA 4OFLA 3CHGA 4NN3A 2F7CA 4M1VA 4JBZA 4O94A 3E3KA 4C1UA 4YB6A 2AL5A 3THIA 3PPPA 2REJA 2XXVA 1FBHA 3HCQA 3FXUA 2AIXA 1H3DA 3SERA 4PF8A 4ELRA 4GOTA 1OMPA 4PF6A 2CZHA 4BDNA 4KR5A 5ET6A 3IOWA 2Z22A 1FTMA 3IORA 4RJZA 1DPEA 4U4SA 5H8QA 4ZZAA 3RLFE 2YJPA 1MXUA 1XT8A 3DM0A 5CMCA 3RT8A 3ZS6A 2F7BA 4MF3A 2OK2A 5LTCA 1XC1A 3RTWB 3FJGA 3IO6A 4U1OA 4RXLA 1B7UA 2Q74A 1N04A 4F1VA 1YYZA 3HSTA 3G3HA 2HFBA 4RK2A 4GD5A 3MW0A 3U65A 2PFYA 4GXAA 4G61A 2A5TB 2KLFA 1Y1MA 4R9GA 2F36A 2RKMA 5IGAA 4NTLA 3LSLA 1OIBA 2QS3A 4QSEA 1S9TA 2HAVA 1URDA 3IJXB 1LFIA 3O2AA 1MXYA 3H06B 1FTJA 3PMXA 3S9NC 2DE3A 2HZLA 4O3AA 3TZAA 1O63A 3B50A 2OWSA 4DDDA 4OENA 3DLNA 2X26A 2PVUA 3QSLA 3PD8A 1B7HA 2HXRA 4HCWA 3TKDA 3G3JA 2FVZA 4R9FA 1LB8A 1IQ7A 4U1ZA 3TCGA 3EHSA 3N26A 1Y3QA 4NX1A 3RPLA 1EYIA 3H6WA 3FXQA 2I58A 1SVXB 2QSXA 1L5TA 1B4ZA 3RGYA 3MJNA 3C36A 4PCDA 1B40A 4O8MA 2HQ0A 2R71A 4MJOA 2DWAA 4QFKA 1UIVA 2VT5A 2Y5KA 1XHYA 3SEYA 1EYKA 3E4RA 4G4PA 1B5HA 4P56A 1D9VA 1LAXA 4WXJA 1D3KA 1WODA 4LONB 3B6QA 3GXAA 5TPAB 2REGA 4P8BA
chains in the Genus database with same CATH topology
1P1WA 4PETA 4F18A 1P1OA 2OBGA 3BFUA 3U93A 4ZEDA 2P0SA 2HEUA 3K1MA 4XKRA 4X1BA 1US4A 4BLAA 5AA4B 4KYSA 3O97A 3MUQA 4EQBA 1JQFA 3MP1A 2H9BA 4OWDA 1XVXA 3KN3A 4YKJA 1M5EA 4R6KA 5I84A 2XXUA 5KDTB 3O66A 2ZNUA 3B6WA 4QF9A 4U22A 2XXIA 4YKIA 2YPNA 1I69A 1LAHE 1MPBA 4OERA 1B3FA 3G3GA 2UVJA 1GR2A 3GBBA 2NXOA 1R1NA 3C33A 1B6HA 4F39A 5L9OA 1MXWA 1SW5A 1H45A 1QKAA 1KWHA 1O7TA 3CFZA 3W9VA 5JK4A 3OEMA 2HCAA 5KCJB 4PP0A 4OEVA 2W7YA 5B7DA 2ONSA 3GBAA 3PPOA 3BBRA 3HHGA 2G29A 1JW4A 1Y3PA 4ZEFA 2FNCA 5AA2A 2OCUA 1LFHA 1OLAA 3KJ7A 2V93A 3SKPA 2QPQA 1B0LA 4RYAA 2E0SA 3E9XA 3CR9A 4L17A 3VXCA 1DTZA 2Q2AA 5L8DA 2WKYA 4OZ9A 2V3TA 3MC2A 5H8NA 1MY4A 5I2KA 4YKKA 4EF1A 1N7XA 1AL3A 1B9JA 4H5FA 2FA7A 1LBBA 2DXYA 3ILUB 1S7YA 1ANFA 3SEWA 1DOTA 2F8DA 4GXSB 1NKXA 3LBSA 3ZKKA 2I48A 2F78A 1S50A 3P7IA 2I6EA 3RT6B 2NOOA 3ILTB 4TLLB 3IOTA 3K1NA 3OO6A 1PBQA 4ZE8A 4IO7A 5F7VA 1LAFE 3R6UA 1LCFA 3KOSA 1ZMGA 1I6BA 2FYIA 3M3KA 4P0GA 4R75A 1QUIA 3PV0E 4YB5A 5AE4A 4ELQA 4F29A 1NNPA 1Z7NE 3CSGA 2Q9TA 5DVJA 1JVXA 1D4NA 4R72A 1MQIA 1HSEA 1LGBC 4THIA 1Q1KA 2F35A 1A40A 1OVBA 3H6UA 1UTHB 2DXRA 1XS5A 3UN6A 4G8NA 4G68B 2DWIA 1H43A 3TEPA 4OXVA 2ZNSA 1FQFA 5DEXB 1B46A 2XXPA 2ZMBA 1PEBA 2Y7RA 1MDQA 4JWYA 2ANJA 3UA8A 1VE4A 5ISUA 4P11A 3TTNA 4IGTA 3VLVA 2Q88A 1BIYA 1GTKA 4JWXA 3IR1A 4H67A 3MBPA 4F2QA 3KN7A 1BLFA 4ESXA 1YTVA 3Q27A 3CI8A 3LSWA 3MPLA 4KYDA 4LUBA 1B1XA 4FATA 3U92A 2V84A 3PD9A 4QFLA 2UVGA 2H25A 3K6UA 1R6ZA 3MWBA 3SEUA 4X1DA 1TFDA 2VD3A 3FVNA 4OTEA 2BJJX 1B3EA 5ICQA 2A5TA 2A5SA 2Q89A 5CBRA 1NNTA 5CBSA 2R9JA 1BP5A 3BKIB 4R73A 5CRYA 2XXHA 1GGGA 3UGWA 4NF6B 5FTIA 1USYH 3PPQA 2XXRA 4DCYA 3OSQA 4QHQA 1POTA 2B65A 4G2ZA 3O6GA 2VD2A 4KI0E 5IAIA 1JW1A 1M5FA 4FIMA 1B52A 4ESWA 4LP2B 1OQGA 2HXWA 1FQAA 3MP8A 3QYTA 3V83A 3T9HB 4EXKA 1RKMA 5BUUA 2DWHA 2Q2CA 3S9MC 1MPDA 2UYFA 2F5XA 3HV1A 1B5JA 5H8HB 4OMBA 3KSJA 2Z23A 3H6VA 3LSFB 4ISUA 5TPAA 2DE4A 1JNFA 3FV2A 1N84A 4N13A 3CFXA 2Z8EA 3DP6A 3T9XB 2Y7WA 1NNKA 3PMVA 4JWOA 1QJMA 1M5DA 1R9LA 1SW2A 5I58B 4YZZA 5FHNA 1AIVA 1TWYA 3C35A 3RQTA 3IB2A 3VV5A 3QXMA 5AA4A 3DP4A 4E0XA 4POXA 4QFOA 1MXXA 1XOCA 1MM7A 2V3UA 2GHAA 4H8JA 3RNNA 3EHUA 1PB8A 3DELB 2THIA 1N76A 3IO4A 5KDTA 1IXCA 1VSOA 4EF2A 4FAJA 5ICTA 3PUWE 1B2HA 3OXNA 4HTGA 3QUJA 2ONKE 3QAXA 4U2RA 3I5OA 3Q28A 3QIMA 1B0HA 1QKBA 2ZYNA 2P1SA 4HS7A 2V3QA 2PBWA 1D9YA 4I8CA 1PB9A 5KCJA 2H5YA 4F22A 4YB7A 3SETA 2R6GE 1XVYA 1TFAA 2O84X 4QFPA 3VLWA 1BKAA 1DTGA 1PC3A 2I4BA 5KZTA 5CM6A 1N0TA 3VFJA 1SQYA 5JTYB 3CIJA 2I0CA 1LFGA 1YAEA 3A09A 3LR1A 3ZKLA 2AL4A 1RYOA 1MH3A 3PU5A 1CB6A 1UTBB 3WAEA 4DLDA 1MQDA 1WDNA 4JDFA 3FD3A 5LOMA 2ZYOA 3KG2A 4MH5A 4Z0IA 4KD5A 4BDOA 5BWJA 3PPRA 4ECFA 1PDAA 2I0BA 2UVIA 4GQOA 3MZ9A 3HPIA 5EHMA 2ESNA 5HPQA 3G3KA 4GLIA 5AA2D 4NF8B 2Q8JA 1MY1A 4Z7EA 4GL0A 5AA3A 3K00A 4FEDA 5EYFA 2CZLA 2H4IA 4WEDA 3T22A 4IO6A 1B4HA 4H6DA 1JW5A 2F6GA 3OEKA 1SYIA 3PUXE 3OOAA 3JV9A 4KCCA 3EQ1A 4H1XA 4PE5B 3RY3A 3TAJA 1GVCA 2Y84A 2NUVA 1MY2A 3IL1B 3IOUA 3LSXA 4OETA 3TFLA 4JXIA 1II5A 3TCHA 2O7IA 2OZZA 3CVGA 4ZEKA 1B7ZA 3M3LA 3KSXA 3N5LA 2XXYA 1UTHA 1OLCA 4NE4A 1M5BA 4G68A 4Q30B 2VHAA 1MM6A 4AB6A 1FQCA 4I62A 5DEXA 1A54A 2QMWA 3E13X 1M5CA 4MLVA 4DXBA 3C32A 5B70A 4GRKA 1B5IA 3VLUA 2O51A 3Q25A 3IB1A 3R26A 2Z8FA 5I2NB 2UYEA 5I57B 5I59A 4M4GA 3EN3A 1QW0A 1QULA 4R74A 1WVJA 4EQ7A 1H76A 2RCAA 1UQWA 1A8EA 3LC8A 4YU0A 4TQUQ 1SW1A 3UIFA 1GV8A 4PFUA 1LCTA 3TTKA 4OYVA 4F1YA 3PPNA 4OESA 3ECRA 3V8XB 2QS4A 4DCXA 1ZU0A 3MVYA 3TYHA 4DIGA 3FGSA 2F6PA 4F3BA 4DZ1A 5K2XA 4F1UA 2ALUA 3W9WA 3FJ7A 4NF6A 1LLSA 1MH4A 1Y4TA 1TT1A 4KYEA 1LB9A 1ZLQA 4UA8A 4OFJA 3K02A 4KHZE 4OFOA 3UORA 4F19A 4MLQA 4C1TA 3FXRA 4IO2A 4F31B 3EPEA 2ZYMA 2H98A 3H4ZA 4JB7A 3IAZA 3K0VA 5CC2A 3OENA 2ZXTA 3K2DA 1SI1A 1DSNA 3O6IA 3C4MA 1VR5A 3VVEA 3HN0A 4RK9A 1B51A 4EDPA 1MDP1 4I9DA 3C31A 4ZS9A 1OQHA 3U94A 1B3HA 3CSBA 3FVGA 1FTLA 4H65A 5H8HA 1DPPA 2QS1A 2XX8A 2B3FA 4X9TA 4NF5B 1QUKA 2RCBA 4QFNA 4IO3A 3K01A 4ONYA 4O3BA 4BDRA 1SW4A 3N94A 4IO4A 4R6YA 1T0KA 3VVDA 5I58A 4G8HA 4AQ4A 4BDMA 2XXTA 2ONRA 2I3WA 3B6TA 3H3GA 3CG3A 2O69A 5TP9B 5IKBA 3MP6A 4TOZA 2Y7PA 2XX9A 3ODBA 3MVXA 3OMBA 3EHTA 5DYHA 3KEIA 1A7LA 2NWJA 1FTOA 4TLMB 2IEEA 2UVHA 3K6XA 3O29A 1FQBA 5I56B 2VGQA 4IY5A 1FCKA 3S2VA 3F11A 1IUDA 3TPAA 2D3IA 3VDFA 3WAFA 2PT1A 4EUOA 3S4UA 3U72A 2D5WA 2DSFA 3Q26A 3FIRA 4YMAA 1SBPA 2NVUB 2B3BA 1MY3A 3FASA 3FZVA 4U4XA 5H8FB 1OVTA 4Q5TA 1AH5A 1IIWA 1O64A 3W15C 3H6TA 4MBPA 4XKPA 4R2FA 2V25A 4OVJA 2PMSA 5HM4B 4RPOA 2E1SA 4YICA 1SDXA 2Y7IA 2DP8A 1P99A 5JTYA 3G7WA 1R9QA 3CFLA 4F3GA 1JETA 1LBCA 2O6AA 2O7UA 2Z8DA 2IA4A 1UTBA 1VFDA 3T9VA 4H8IA 4LQ2A 4WEPA 4E0WA 4GL8A 3QUFA 3IB0A 4F3SA 2PYYA 4ZDMA 2QS2A 1MQJA 3PMWA 1P1NA 4OEUA 1B05A 1QUJA 4NF8A 2CMOA 3Q29A 1IXIA 1PB7A 3VE1B 4KCDA 4Q0CA 4R2BA 4RNSA 4OQOA 2HZKA 5DT6A 1Y20A 2O1MA 3RN8A 3O6HA 2QRYA 3V5AA 2GH9A 3TMGA 5DTBA 2F97A 4I1DA 4G8MA 2DVZA 1EU8A 3OD7A 3S9LC 1ELJA 3ZSFA 4LATA 2G93A 1A99A 1Z7ME 4ELOA 2O1LA 1B32A 1IZ1A 2VOZA 4ZEIA 3U8QA 1NH7A 4NWDA 4ZEBA 2HAUA 5A5XB 3K6WA 4WKMA 4KQPA 4K3FA 3LUYA 1POY1 4PFTA 1SYHA 1USYE 4FJPA 1Y9UA 3C34A 1A55A 2QMXA 3PUYE 3KJTA 4IB2A 1Y3NA 3MVZA 2PX1A 1B3GA 3D4GA 4G68C 4YAHX 4KPTA 5HBCA 4DXCA 4F3PA 5L9MA 1B3LA 5J1DA 1LAGE 2DQVA 4NF4B 3MZ1A 1B1HA 2QL3A 5I2NA 2I49A 1MXVA 3FJMA 4ZZEA 3HHFA 5I57A 1NMUA 3EF7A 2XX7A 3GLBA 3FV1A 3S9EA 3OELA 3TELA 5JEIA 1J1NA 5H8SA 2D21A 3H7MA 1JEVA 4GFRA 2VP1A 1SI0A 3MPKA 1F9BA 3MVWA 4HCYA 3SDFA 3QK6A 3PGFA 3TCFA 4LZ5A 3SESA 3D4CA 5ITPA 1NNFA 3TUSA 4RA1A 3V89B 2DOJA 3AXFA 3KOTA 2RC9A 4GIZA 4XKNA 3CRBA 3M8UA 4GWOA 1VFEA 2XD3A 1FW0A 5H8QB 1H44A 2ABHA 2LAOA 3SEVA 5EHSA 3K4UA 3TODA 3OO9A 4C0RA 5CMBA 1EZPA 3KGCA 3FVOA 1I6AA 3JYRA 1FQEA 3RTFB 4PFYA 2Y7KA 4DXUA 4ZECA 2UXAA 4MFIA 5L9SA 2F34A 2OWTA 1ZIUA 3MAMA 3VVFA 5AA1A 1MQHA 4G77A 1A8FA 3N6UA 1UIUA 4H0WA 2RC8A 3IX1A 1ZKBA 1YCJA 5K2YA 2GFEA 2QJEA 4UACA 4FE8A 1ZBMA 2O68A 4FEBA 4JSDA 3G3FA 3UK4A 4YKPA 1Q35A 3MQ9A 5CMKA 4LZ8A 3RPWA 4N07A 4NF5A 1FTKA 3L6HA 2XHDA 3T66A 3JZJA 2YLNA 3KZGA 4H5GA 1HSLA 4R6HA 1Y1ZA 4YMBA 1IXGA 5ITOA 4IO5A 3G3IA 4BDQA 5TP9A 1FQDA 5FHMA 4NEDA 3OO8A 2ZNTA 5ELVA 1MXZA 4QSDA 3M3FA 3PUZE 3IOVA 1EH3A 3TTLA 2DYXA 1QVSA 2RF1A 4LVQA 5I56A 1RYXA 4OHNA 2XXQA 4XTCQ 5I59B 3KFMA 3R7XA 1P1UA 3FVKA 3MZBA 3FATA 4QSCA 1ATGA 4HW8A 3O9PA 1YPNA 4EXLA 3DP8A 1N7WA 4FORA 4LA9A 3H03A 2OJTA 3PUVE 1B58A 1NL5A 3K1PA 4Q8RA 3B7DA 4LZ7A 3OO7A 1CE2A 4PQJA 5H8FA 3FUZA 4QRZA 4FECA 4LQ5A 5F1QA 4RY1A 4ELPA 3USDA 3T96B 2DWJA 3SEXA 1MQGA 3TTRA 2RINA 2X7PA 1EZOA 2X7QA 2OLBA 1MS7A 1AMFA 1HSJA 1URSA 3OSRA 2DE2A 3CG1A 1JVYA 4U23A 4KFQA 3C9HA 2P2AA 2XXXA 3IK6B 3A3CA 2XD2A 3HO7A 4JSOA 3T9UA 1IEJA 3KN8A 5CMMA 4U21A 2F7AA 4PFWA 2RC7A 4XKQA 4GVOA 1BTJA 5AA2B 4RPNA 1N3WA 5FHOA 3U1OA 4DE8A 3T93B 3ONMA 4P0IA 3TQWA 4AB5A 3N6TA 2I3VA 1P1QA 3KBRA 4O3CA 3I6VA 1IXHA 5TU0A 3TQLA 4N6PA 4ND9A 4F2OA 1N3XA 5H8NB 1DMBA 2GHBA 5I2KB 5DVIA 4GF8A 2PT2A 2AYSA 3IJOB 4IY6A 3UP9A 1ZJLA 3L6GA 4IGRA 3TTMA 3GZGA 4EQ9A 3I3VA 1MY0A 1Y4CA 1US5A 1I6QA 1SD3A 5A5XA 2XXWA 1URGA 5FTHA 1EZ9A 2DVCA 1TXFA 2ZYKA 3BFTA 1MRPA 4NWCA 4POWA 4X48A 4NMYA 1PBPA 3O28A 4ZE9A 1ZTYA 3A3UA 4XXUA 2DS9A 1IITA 3VXBA 4XIGQ 1JEUA 1NH8A 3RUMA 2I4CA 4NF4A 5M2VA 1MG1A 2H99A 1MPCA 1NFTA 2GRVA 5CI5A 3TDJA 2M8CA 1LSTA 4BDLA 1AOVA 5DVFA 3K6VA 4OFLA 2F7CA 4M1VA 4JBZA 3E3KA 4C1UA 4YB6A 2AL5A 3THIA 3PPPA 2REJA 2XXVA 3HCQA 3FXUA 2AIXA 1H3DA 3SERA 4ELRA 4GOTA 1OMPA 4BDNA 4KR5A 3IOWA 2Z22A 1FTMA 3IORA 4RJZA 1DPEA 4U4SA 5H8QA 4ZZAA 3RLFE 2YJPA 1MXUA 1XT8A 3DM0A 5CMCA 3RT8A 3ZS6A 2F7BA 4MF3A 2OK2A 1XC1A 3RTWB 3FJGA 3IO6A 4U1OA 4RXLA 1B7UA 1N04A 4F1VA 3HSTA 3G3HA 2HFBA 4RK2A 4GD5A 3MW0A 4GXAA 2A5TB 2KLFA 1Y1MA 4R9GA 2F36A 2RKMA 4NTLA 3LSLA 1OIBA 2QS3A 4QSEA 1S9TA 2HAVA 1URDA 3IJXB 1LFIA 3O2AA 1MXYA 3H06B 1FTJA 3PMXA 3S9NC 2DE3A 2HZLA 4O3AA 3TZAA 1O63A 2OWSA 4DDDA 4OENA 3DLNA 2X26A 2PVUA 3QSLA 3PD8A 1B7HA 4HCWA 3TKDA 3G3JA 4R9FA 1LB8A 1IQ7A 4U1ZA 3TCGA 3EHSA 3N26A 1Y3QA 3H6WA 3FXQA 2I58A 1SVXB 2QSXA 1L5TA 1B4ZA 3RGYA 3MJNA 3C36A 1B40A 2HQ0A 2R71A 2DWAA 1UIVA 4QFKA 1XHYA 3SEYA 3E4RA 4G4PA 1B5HA 1D9VA 1LAXA 4WXJA 1D3KA 1WODA 4LONB 3B6QA 3GXAA 5TPAB 2REGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1W A;  4PET A;  4F18 A;  1P1O A;  2OBG A;  3BFU A;  3U93 A;  4ZED A;  2P0S A;  2HEU A;  3K1M A;  4XKR A;  4X1B A;  1US4 A;  4BLA A;  5AA4 B;  4KYS A;  3O97 A;  3MUQ A;  4EQB A;  1JQF A;  3MP1 A;  2H9B A;  4OWD A;  1XVX A;  3KN3 A;  4YKJ A;  1M5E A;  4R6K A;  5I84 A;  2XXU A;  5KDT B;  3O66 A;  2ZNU A;  3B6W A;  4QF9 A;  4U22 A;  2XXI A;  4YKI A;  2YPN A;  1I69 A;  1LAH E;  1MPB A;  4OER A;  1B3F A;  3G3G A;  2UVJ A;  1GR2 A;  3GBB A;  2NXO A;  1R1N A;  3C33 A;  1B6H A;  4F39 A;  5L9O A;  1MXW A;  1SW5 A;  1H45 A;  1QKA A;  1KWH A;  1O7T A;  3CFZ A;  3W9V A;  5JK4 A;  3OEM A;  2HCA A;  5KCJ B;  4PP0 A;  4OEV A;  2W7Y A;  5B7D A;  2ONS A;  3GBA A;  3PPO A;  3BBR A;  3HHG A;  2G29 A;  1JW4 A;  1Y3P A;  4ZEF A;  2FNC A;  5AA2 A;  2OCU A;  1LFH A;  1OLA A;  3KJ7 A;  2V93 A;  3SKP A;  2QPQ A;  1B0L A;  4RYA A;  2E0S A;  3E9X A;  3CR9 A;  4L17 A;  3VXC A;  1DTZ A;  2Q2A A;  5L8D A;  2WKY A;  4OZ9 A;  2V3T A;  3MC2 A;  5H8N A;  1MY4 A;  5I2K A;  4YKK A;  4EF1 A;  1N7X A;  1AL3 A;  1B9J A;  4H5F A;  2FA7 A;  1LBB A;  2DXY A;  3ILU B;  1S7Y A;  1ANF A;  3SEW A;  1DOT A;  2F8D A;  4GXS B;  1NKX A;  3LBS A;  3ZKK A;  2I48 A;  2F78 A;  1S50 A;  3P7I A;  2I6E A;  3RT6 B;  2NOO A;  3ILT B;  4TLL B;  3IOT A;  3K1N A;  3OO6 A;  1PBQ A;  4ZE8 A;  4IO7 A;  5F7V A;  1LAF E;  3R6U A;  1LCF A;  3KOS A;  1ZMG A;  1I6B A;  2FYI A;  3M3K A;  4P0G A;  4R75 A;  1QUI A;  3PV0 E;  4YB5 A;  5AE4 A;  4ELQ A;  4F29 A;  1NNP A;  1Z7N E;  3CSG A;  2Q9T A;  5DVJ A;  1JVX A;  1D4N A;  4R72 A;  1MQI A;  1HSE A;  1LGB C;  4THI A;  1Q1K A;  2F35 A;  1A40 A;  1OVB A;  3H6U A;  1UTH B;  2DXR A;  1XS5 A;  3UN6 A;  4G8N A;  4G68 B;  2DWI A;  1H43 A;  3TEP A;  4OXV A;  2ZNS A;  1FQF A;  5DEX B;  1B46 A;  2XXP A;  2ZMB A;  1PEB A;  2Y7R A;  1MDQ A;  4JWY A;  2ANJ A;  3UA8 A;  1VE4 A;  5ISU A;  4P11 A;  3TTN A;  4IGT A;  3VLV A;  2Q88 A;  1BIY A;  1GTK A;  4JWX A;  3IR1 A;  4H67 A;  3MBP A;  4F2Q A;  3KN7 A;  1BLF A;  4ESX A;  1YTV A;  3Q27 A;  3CI8 A;  3LSW A;  3MPL A;  4KYD A;  4LUB A;  1B1X A;  4FAT A;  3U92 A;  2V84 A;  3PD9 A;  4QFL A;  2UVG A;  2H25 A;  3K6U A;  1R6Z A;  3MWB A;  3SEU A;  4X1D A;  1TFD A;  2VD3 A;  3FVN A;  4OTE A;  2BJJ X;  1B3E A;  5ICQ A;  2A5T A;  2A5S A;  2Q89 A;  5CBR A;  1NNT A;  5CBS A;  2R9J A;  1BP5 A;  3BKI B;  4R73 A;  5CRY A;  2XXH A;  1GGG A;  3UGW A;  4NF6 B;  5FTI A;  1USY H;  3PPQ A;  2XXR A;  4DCY A;  3OSQ A;  4QHQ A;  1POT A;  2B65 A;  4G2Z A;  3O6G A;  2VD2 A;  4KI0 E;  5IAI A;  1JW1 A;  1M5F A;  4FIM A;  1B52 A;  4ESW A;  4LP2 B;  1OQG A;  2HXW A;  1FQA A;  3MP8 A;  3QYT A;  3V83 A;  3T9H B;  4EXK A;  1RKM A;  5BUU A;  2DWH A;  2Q2C A;  3S9M C;  1MPD A;  2UYF A;  2F5X A;  3HV1 A;  1B5J A;  5H8H B;  4OMB A;  3KSJ A;  2Z23 A;  3H6V A;  3LSF B;  4ISU A;  5TPA A;  2DE4 A;  1JNF A;  3FV2 A;  1N84 A;  4N13 A;  3CFX A;  2Z8E A;  3DP6 A;  3T9X B;  2Y7W A;  1NNK A;  3PMV A;  4JWO A;  1QJM A;  1M5D A;  1R9L A;  1SW2 A;  5I58 B;  4YZZ A;  5FHN A;  1AIV A;  1TWY A;  3C35 A;  3RQT A;  3IB2 A;  3VV5 A;  3QXM A;  5AA4 A;  3DP4 A;  4E0X A;  4POX A;  4QFO A;  1MXX A;  1XOC A;  1MM7 A;  2V3U A;  2GHA A;  4H8J A;  3RNN A;  3EHU A;  1PB8 A;  3DEL B;  2THI A;  1N76 A;  3IO4 A;  5KDT A;  1IXC A;  1VSO A;  4EF2 A;  4FAJ A;  5ICT A;  3PUW E;  1B2H A;  3OXN A;  4HTG A;  3QUJ A;  2ONK E;  3QAX A;  4U2R A;  3I5O A;  3Q28 A;  3QIM A;  1B0H A;  1QKB A;  2ZYN A;  2P1S A;  4HS7 A;  2V3Q A;  2PBW A;  1D9Y A;  4I8C A;  1PB9 A;  5KCJ A;  2H5Y A;  4F22 A;  4YB7 A;  3SET A;  2R6G E;  1XVY A;  1TFA A;  2O84 X;  4QFP A;  3VLW A;  1BKA A;  1DTG A;  1PC3 A;  2I4B A;  5KZT A;  5CM6 A;  1N0T A;  3VFJ A;  1SQY A;  5JTY B;  3CIJ A;  2I0C A;  1LFG A;  1YAE A;  3A09 A;  3LR1 A;  3ZKL A;  2AL4 A;  1RYO A;  1MH3 A;  3PU5 A;  1CB6 A;  1UTB B;  3WAE A;  4DLD A;  1MQD A;  1WDN A;  4JDF A;  3FD3 A;  5LOM A;  2ZYO A;  3KG2 A;  4MH5 A;  4Z0I A;  4KD5 A;  4BDO A;  5BWJ A;  3PPR A;  4ECF A;  1PDA A;  2I0B A;  2UVI A;  4GQO A;  3MZ9 A;  3HPI A;  5EHM A;  2ESN A;  5HPQ A;  3G3K A;  4GLI A;  5AA2 D;  4NF8 B;  2Q8J A;  1MY1 A;  4Z7E A;  4GL0 A;  5AA3 A;  3K00 A;  4FED A;  5EYF A;  2CZL A;  2H4I A;  4WED A;  3T22 A;  4IO6 A;  1B4H A;  4H6D A;  1JW5 A;  2F6G A;  3OEK A;  1SYI A;  3PUX E;  3OOA A;  3JV9 A;  4KCC A;  3EQ1 A;  4H1X A;  4PE5 B;  3RY3 A;  3TAJ A;  1GVC A;  2Y84 A;  2NUV A;  1MY2 A;  3IL1 B;  3IOU A;  3LSX A;  4OET A;  3TFL A;  4JXI A;  1II5 A;  3TCH A;  2O7I A;  2OZZ A;  3CVG A;  4ZEK A;  1B7Z A;  3M3L A;  3KSX A;  3N5L A;  2XXY A;  1UTH A;  1OLC A;  4NE4 A;  1M5B A;  4G68 A;  4Q30 B;  2VHA A;  1MM6 A;  4AB6 A;  1FQC A;  4I62 A;  5DEX A;  1A54 A;  2QMW A;  3E13 X;  1M5C A;  4MLV A;  4DXB A;  3C32 A;  5B70 A;  4GRK A;  1B5I A;  3VLU A;  2O51 A;  3Q25 A;  3IB1 A;  3R26 A;  2Z8F A;  5I2N B;  2UYE A;  5I57 B;  5I59 A;  4M4G A;  3EN3 A;  1QW0 A;  1QUL A;  4R74 A;  1WVJ A;  4EQ7 A;  1H76 A;  2RCA A;  1UQW A;  1A8E A;  3LC8 A;  4YU0 A;  4TQU Q;  1SW1 A;  3UIF A;  1GV8 A;  4PFU A;  1LCT A;  3TTK A;  4OYV A;  4F1Y A;  3PPN A;  4OES A;  3ECR A;  3V8X B;  2QS4 A;  4DCX A;  1ZU0 A;  3MVY A;  3TYH A;  4DIG A;  3FGS A;  2F6P A;  4F3B A;  4DZ1 A;  5K2X A;  4F1U A;  2ALU A;  3W9W A;  3FJ7 A;  4NF6 A;  1LLS A;  1MH4 A;  1Y4T A;  1TT1 A;  4KYE A;  1LB9 A;  1ZLQ A;  4UA8 A;  4OFJ A;  3K02 A;  4KHZ E;  4OFO A;  3UOR A;  4F19 A;  4MLQ A;  4C1T A;  3FXR A;  4IO2 A;  4F31 B;  3EPE A;  2ZYM A;  2H98 A;  3H4Z A;  4JB7 A;  3IAZ A;  3K0V A;  5CC2 A;  3OEN A;  2ZXT A;  3K2D A;  1SI1 A;  1DSN A;  3O6I A;  3C4M A;  1VR5 A;  3VVE A;  3HN0 A;  4RK9 A;  1B51 A;  4EDP A;  1MDP 1;  4I9D A;  3C31 A;  4ZS9 A;  1OQH A;  3U94 A;  1B3H A;  3CSB A;  3FVG A;  1FTL A;  4H65 A;  5H8H A;  1DPP A;  2QS1 A;  2XX8 A;  2B3F A;  4X9T A;  4NF5 B;  1QUK A;  2RCB A;  4QFN A;  4IO3 A;  3K01 A;  4ONY A;  4O3B A;  4BDR A;  1SW4 A;  3N94 A;  4IO4 A;  4R6Y A;  1T0K A;  3VVD A;  5I58 A;  4G8H A;  4AQ4 A;  4BDM A;  2XXT A;  2ONR A;  2I3W A;  3B6T A;  3H3G A;  3CG3 A;  2O69 A;  5TP9 B;  5IKB A;  3MP6 A;  4TOZ A;  2Y7P A;  2XX9 A;  3ODB A;  3MVX A;  3OMB A;  3EHT A;  5DYH A;  3KEI A;  1A7L A;  2NWJ A;  1FTO A;  4TLM B;  2IEE A;  2UVH A;  3K6X A;  3O29 A;  1FQB A;  5I56 B;  2VGQ A;  4IY5 A;  1FCK A;  3S2V A;  3F11 A;  1IUD A;  3TPA A;  2D3I A;  3VDF A;  3WAF A;  2PT1 A;  4EUO A;  3S4U A;  3U72 A;  2D5W A;  2DSF A;  3Q26 A;  3FIR A;  4YMA A;  1SBP A;  2NVU B;  2B3B A;  1MY3 A;  3FAS A;  3FZV A;  4U4X A;  5H8F B;  1OVT A;  4Q5T A;  1AH5 A;  1IIW A;  1O64 A;  3W15 C;  3H6T A;  4MBP A;  4XKP A;  4R2F A;  2V25 A;  4OVJ A;  2PMS A;  5HM4 B;  4RPO A;  2E1S A;  4YIC A;  1SDX A;  2Y7I A;  2DP8 A;  1P99 A;  5JTY A;  3G7W A;  1R9Q A;  3CFL A;  4F3G A;  1JET A;  1LBC A;  2O6A A;  2O7U A;  2Z8D A;  2IA4 A;  1UTB A;  1VFD A;  3T9V A;  4H8I A;  4LQ2 A;  4WEP A;  4E0W A;  4GL8 A;  3QUF A;  3IB0 A;  4F3S A;  2PYY A;  4ZDM A;  2QS2 A;  1MQJ A;  3PMW A;  1P1N A;  4OEU A;  1B05 A;  1QUJ A;  4NF8 A;  2CMO A;  3Q29 A;  1IXI A;  1PB7 A;  3VE1 B;  4KCD A;  4Q0C A;  4R2B A;  4RNS A;  4OQO A;  2HZK A;  5DT6 A;  1Y20 A;  2O1M A;  3RN8 A;  3O6H A;  2QRY A;  3V5A A;  2GH9 A;  3TMG A;  5DTB A;  2F97 A;  4I1D A;  4G8M A;  2DVZ A;  1EU8 A;  3OD7 A;  3S9L C;  1ELJ A;  3ZSF A;  4LAT A;  2G93 A;  1A99 A;  1Z7M E;  4ELO A;  2O1L A;  1B32 A;  1IZ1 A;  2VOZ A;  4ZEI A;  3U8Q A;  1NH7 A;  4NWD A;  4ZEB A;  2HAU A;  5A5X B;  3K6W A;  4WKM A;  4KQP A;  4K3F A;  3LUY A;  1POY 1;  4PFT A;  1SYH A;  1USY E;  4FJP A;  1Y9U A;  3C34 A;  1A55 A;  2QMX A;  3PUY E;  3KJT A;  4IB2 A;  1Y3N A;  3MVZ A;  2PX1 A;  1B3G A;  3D4G A;  4G68 C;  4YAH X;  4KPT A;  5HBC A;  4DXC A;  4F3P A;  5L9M A;  1B3L A;  5J1D A;  1LAG E;  2DQV A;  4NF4 B;  3MZ1 A;  1B1H A;  2QL3 A;  5I2N A;  2I49 A;  1MXV A;  3FJM A;  4ZZE A;  3HHF A;  5I57 A;  1NMU A;  3EF7 A;  2XX7 A;  3GLB A;  3FV1 A;  3S9E A;  3OEL A;  3TEL A;  5JEI A;  1J1N A;  5H8S A;  2D21 A;  3H7M A;  1JEV A;  4GFR A;  2VP1 A;  1SI0 A;  3MPK A;  1F9B A;  3MVW A;  4HCY A;  3SDF A;  3QK6 A;  3PGF A;  3TCF A;  4LZ5 A;  3SES A;  3D4C A;  5ITP A;  1NNF A;  3TUS A;  4RA1 A;  3V89 B;  2DOJ A;  3AXF A;  3KOT A;  2RC9 A;  4GIZ A;  4XKN A;  3CRB A;  3M8U A;  4GWO A;  1VFE A;  2XD3 A;  1FW0 A;  5H8Q B;  1H44 A;  2ABH A;  2LAO A;  3SEV A;  5EHS A;  3K4U A;  3TOD A;  3OO9 A;  4C0R A;  5CMB A;  1EZP A;  3KGC A;  3FVO A;  1I6A A;  3JYR A;  1FQE A;  3RTF B;  4PFY A;  2Y7K A;  4DXU A;  4ZEC A;  2UXA A;  4MFI A;  5L9S A;  2F34 A;  2OWT A;  1ZIU A;  3MAM A;  3VVF A;  5AA1 A;  1MQH A;  4G77 A;  1A8F A;  3N6U A;  1UIU A;  4H0W A;  2RC8 A;  3IX1 A;  1ZKB A;  1YCJ A;  5K2Y A;  2GFE A;  2QJE A;  4UAC A;  4FE8 A;  1ZBM A;  2O68 A;  4FEB A;  4JSD A;  3G3F A;  3UK4 A;  4YKP A;  1Q35 A;  3MQ9 A;  5CMK A;  4LZ8 A;  3RPW A;  4N07 A;  4NF5 A;  1FTK A;  3L6H A;  2XHD A;  3T66 A;  3JZJ A;  2YLN A;  3KZG A;  4H5G A;  1HSL A;  4R6H A;  1Y1Z A;  4YMB A;  1IXG A;  5ITO A;  4IO5 A;  3G3I A;  4BDQ A;  5TP9 A;  1FQD A;  5FHM A;  4NED A;  3OO8 A;  2ZNT A;  5ELV A;  1MXZ A;  4QSD A;  3M3F A;  3PUZ E;  3IOV A;  1EH3 A;  3TTL A;  2DYX A;  1QVS A;  2RF1 A;  4LVQ A;  5I56 A;  1RYX A;  4OHN A;  2XXQ A;  4XTC Q;  5I59 B;  3KFM A;  3R7X A;  1P1U A;  3FVK A;  3MZB A;  3FAT A;  4QSC A;  1ATG A;  4HW8 A;  3O9P A;  1YPN A;  4EXL A;  3DP8 A;  1N7W A;  4FOR A;  4LA9 A;  3H03 A;  2OJT A;  3PUV E;  1B58 A;  1NL5 A;  3K1P A;  4Q8R A;  3B7D A;  4LZ7 A;  3OO7 A;  1CE2 A;  4PQJ A;  5H8F A;  3FUZ A;  4QRZ A;  4FEC A;  4LQ5 A;  5F1Q A;  4RY1 A;  4ELP A;  3USD A;  3T96 B;  2DWJ A;  3SEX A;  1MQG A;  3TTR A;  2RIN A;  2X7P A;  1EZO A;  2X7Q A;  2OLB A;  1MS7 A;  1AMF A;  1HSJ A;  1URS A;  3OSR A;  2DE2 A;  3CG1 A;  1JVY A;  4U23 A;  4KFQ A;  3C9H A;  2P2A A;  2XXX A;  3IK6 B;  3A3C A;  2XD2 A;  3HO7 A;  4JSO A;  3T9U A;  1IEJ A;  3KN8 A;  5CMM A;  4U21 A;  2F7A A;  4PFW A;  2RC7 A;  4XKQ A;  4GVO A;  1BTJ A;  5AA2 B;  4RPN A;  1N3W A;  5FHO A;  3U1O A;  4DE8 A;  3T93 B;  3ONM A;  4P0I A;  3TQW A;  4AB5 A;  3N6T A;  2I3V A;  1P1Q A;  3KBR A;  4O3C A;  3I6V A;  1IXH A;  5TU0 A;  3TQL A;  4N6P A;  4ND9 A;  4F2O A;  1N3X A;  5H8N B;  1DMB A;  2GHB A;  5I2K B;  5DVI A;  4GF8 A;  2PT2 A;  2AYS A;  3IJO B;  4IY6 A;  3UP9 A;  1ZJL A;  3L6G A;  4IGR A;  3TTM A;  3GZG A;  4EQ9 A;  3I3V A;  1MY0 A;  1Y4C A;  1US5 A;  1I6Q A;  1SD3 A;  5A5X A;  2XXW A;  1URG A;  5FTH A;  1EZ9 A;  2DVC A;  1TXF A;  2ZYK A;  3BFT A;  1MRP A;  4NWC A;  4POW A;  4X48 A;  4NMY A;  1PBP A;  3O28 A;  4ZE9 A;  1ZTY A;  3A3U A;  4XXU A;  2DS9 A;  1IIT A;  3VXB A;  4XIG Q;  1JEU A;  1NH8 A;  3RUM A;  2I4C A;  4NF4 A;  5M2V A;  1MG1 A;  2H99 A;  1MPC A;  1NFT A;  2GRV A;  5CI5 A;  3TDJ A;  2M8C A;  1LST A;  4BDL A;  1AOV A;  5DVF A;  3K6V A;  4OFL A;  2F7C A;  4M1V A;  4JBZ A;  3E3K A;  4C1U A;  4YB6 A;  2AL5 A;  3THI A;  3PPP A;  2REJ A;  2XXV A;  3HCQ A;  3FXU A;  2AIX A;  1H3D A;  3SER A;  4ELR A;  4GOT A;  1OMP A;  4BDN A;  4KR5 A;  3IOW A;  2Z22 A;  1FTM A;  3IOR A;  4RJZ A;  1DPE A;  4U4S A;  5H8Q A;  4ZZA A;  3RLF E;  2YJP A;  1MXU A;  1XT8 A;  3DM0 A;  5CMC A;  3RT8 A;  3ZS6 A;  2F7B A;  4MF3 A;  2OK2 A;  1XC1 A;  3RTW B;  3FJG A;  3IO6 A;  4U1O A;  4RXL A;  1B7U A;  1N04 A;  4F1V A;  3HST A;  3G3H A;  2HFB A;  4RK2 A;  4GD5 A;  3MW0 A;  4GXA A;  2A5T B;  2KLF A;  1Y1M A;  4R9G A;  2F36 A;  2RKM A;  4NTL A;  3LSL A;  1OIB A;  2QS3 A;  4QSE A;  1S9T A;  2HAV A;  1URD A;  3IJX B;  1LFI A;  3O2A A;  1MXY A;  3H06 B;  1FTJ A;  3PMX A;  3S9N C;  2DE3 A;  2HZL A;  4O3A A;  3TZA A;  1O63 A;  2OWS A;  4DDD A;  4OEN A;  3DLN A;  2X26 A;  2PVU A;  3QSL A;  3PD8 A;  1B7H A;  4HCW A;  3TKD A;  3G3J A;  4R9F A;  1LB8 A;  1IQ7 A;  4U1Z A;  3TCG A;  3EHS A;  3N26 A;  1Y3Q A;  3H6W A;  3FXQ A;  2I58 A;  1SVX B;  2QSX A;  1L5T A;  1B4Z A;  3RGY A;  3MJN A;  3C36 A;  1B40 A;  2HQ0 A;  2R71 A;  2DWA A;  1UIV A;  4QFK A;  1XHY A;  3SEY A;  3E4R A;  4G4P A;  1B5H A;  1D9V A;  1LAX A;  4WXJ A;  1D3K A;  1WOD A;  4LON B;  3B6Q A;  3GXA A;  5TPA B;  2REG A; 
#chains in the Genus database with same CATH topology
 1P1W A;  4PET A;  2FHY A;  4F18 A;  1P1O A;  2OBG A;  3BFU A;  3U93 A;  4ZED A;  2P0S A;  2XWK A;  3IFC A;  2HEU A;  3K1M A;  4XKR A;  4X1B A;  1US4 A;  4UAB A;  4BLA A;  5AA4 B;  4PDD A;  4KYS A;  3O97 A;  1FBE A;  3MUQ A;  4EQB A;  1JQF A;  3MP1 A;  2ZZV A;  2H9B A;  4I3E A;  4OWD A;  1XVX A;  3KN3 A;  4YKJ A;  1M5E A;  4R6K A;  5I84 A;  4NF0 A;  2XXU A;  5KDT B;  3O66 A;  4N4U A;  2ZNU A;  2B4L A;  3B6W A;  4QF9 A;  4U22 A;  1LBV A;  2XXI A;  4YKI A;  1LBY A;  2YPN A;  1NV5 A;  2CZK A;  4GX6 A;  1I69 A;  3BIH A;  1LAH E;  1MPB A;  4OER A;  1B3F A;  3G3G A;  2UVJ A;  1GR2 A;  3GBB A;  4MIJ A;  2NXO A;  3E79 A;  1FSA A;  1R1N A;  3C33 A;  1B6H A;  4F39 A;  5L9O A;  1MXW A;  1QGX A;  1SW5 A;  1H45 A;  1QKA A;  1KWH A;  1O7T A;  3CFZ A;  5T3J A;  3W9V A;  5JK4 A;  4N91 A;  3OEM A;  2HCA A;  5KCJ B;  4PP0 A;  4OEV A;  2W7Y A;  4X8R A;  5B7D A;  1FJ6 A;  4O7I A;  1JP4 A;  4PBQ A;  2ONS A;  3GBA A;  3PPO A;  3BBR A;  3HHG A;  2G29 A;  4GWU A;  1JW4 A;  3A29 A;  1Y3P A;  4ZEF A;  2FNC A;  5AA2 A;  2OCU A;  1LFH A;  1INP A;  2WYP A;  1OLA A;  3KJ7 A;  2V93 A;  3SKP A;  2QPQ A;  1B0L A;  4RYA A;  2E0S A;  2F3D A;  3E9X A;  3CR9 A;  4L17 A;  3VXC A;  1DTZ A;  2Q2A A;  5L8D A;  2WX9 A;  2WKY A;  4OZ9 A;  2V3T A;  3MC2 A;  5H8N A;  1MY4 A;  5I2K A;  4YKK A;  4PDH A;  4LN5 A;  4EF1 A;  1N7X A;  1AL3 A;  1B9J A;  4H5F A;  2FA7 A;  1LBB A;  2DXY A;  3ILU B;  1S7Y A;  1ANF A;  3SEW A;  2VPO A;  4P1L A;  5EQ8 A;  1DOT A;  2F8D A;  4GXS B;  1NKX A;  3LBS A;  3ZKK A;  2I48 A;  2F78 A;  1S50 A;  3P7I A;  4MCO A;  2I6E A;  3RT6 B;  2NOO A;  3ILT B;  4TLL B;  3IOT A;  3K1N A;  3OO6 A;  1PBQ A;  4ZE8 A;  4IO7 A;  5F7V A;  1LAF E;  4PGP A;  3R6U A;  1NV7 A;  3KBZ A;  1NV2 A;  1LCF A;  3KOS A;  4GX3 A;  1I6B A;  1ZMG A;  2FYI A;  3M3K A;  4PAF A;  4P0G A;  4R75 A;  1QUI A;  4PBH A;  3PV0 E;  4YB5 A;  5AE4 A;  4ELQ A;  4F29 A;  1NNP A;  1Z7N E;  3CSG A;  2Q9T A;  5DVJ A;  1JVX A;  1D4N A;  4R72 A;  4I3Y A;  1NV1 A;  1NUZ A;  1MQI A;  1HSE A;  1LGB C;  4THI A;  1Q1K A;  2F35 A;  1A40 A;  1OVB A;  3H6U A;  1UTH B;  2DXR A;  1XS5 A;  3UN6 A;  4G8N A;  4G68 B;  2DWI A;  1H43 A;  3TEP A;  4OXV A;  2ZNS A;  1FQF A;  5DEX B;  1B46 A;  4MNP A;  2XXP A;  2ZMB A;  1PEB A;  2Y7R A;  1MDQ A;  4JWY A;  2ANJ A;  3UA8 A;  1VE4 A;  5ISU A;  4P11 A;  3TTN A;  4IGT A;  3VLV A;  2Q88 A;  4PAK A;  1BIY A;  1GTK A;  4JWX A;  3IR1 A;  4XEQ A;  5LDZ A;  4MMP A;  4H67 A;  3MBP A;  4F2Q A;  2CEX A;  1RDY A;  3KN7 A;  1BLF A;  4ESX A;  4JVD A;  3ROJ A;  1YTV A;  3Q27 A;  3CI8 A;  3LSW A;  3MPL A;  4KYD A;  4LUB A;  1B1X A;  4FAT A;  3U92 A;  2V84 A;  3PD9 A;  4MAG A;  4QFL A;  2UVG A;  2H25 A;  3K6U A;  1R6Z A;  3MWB A;  3SEU A;  4X1D A;  1TFD A;  2VD3 A;  3FVN A;  4OTE A;  2BJJ X;  1B3E A;  4N8G A;  5ICQ A;  2A5T A;  2A5S A;  2Q89 A;  5CBR A;  1NNT A;  5CBS A;  2R9J A;  1BP5 A;  2CZI A;  3BKI B;  5IZZ A;  4R73 A;  5CRY A;  2XXH A;  1GGG A;  3UGW A;  4NF6 B;  5FTI A;  1YXI A;  4PE3 A;  2ZZW A;  4MEV A;  1USY H;  3PPQ A;  2XXR A;  4DCY A;  3LUZ A;  3OSQ A;  4QHQ A;  1POT A;  2B65 A;  4G2Z A;  3O6G A;  4GWW A;  2VD2 A;  4KI0 E;  5IAI A;  1FPE A;  1JW1 A;  1M5F A;  4FIM A;  1B52 A;  4ESW A;  4LP2 B;  5ET7 A;  1OQG A;  2HXW A;  1FQA A;  3MP8 A;  3QYT A;  3V83 A;  3T9H B;  4EXK A;  1RKM A;  4QXD A;  5BUU A;  3PTY A;  2DWH A;  2Q2C A;  3S9M C;  4N17 A;  1MPD A;  4MNC A;  2UYF A;  2F5X A;  3QMF A;  3HV1 A;  1B5J A;  5H8H B;  4OMB A;  3KSJ A;  1NI9 A;  2Z23 A;  4PGN A;  3H6V A;  4NAP A;  3LSF B;  4ISU A;  5TPA A;  2DE4 A;  1JNF A;  3FV2 A;  1N84 A;  4N13 A;  3CFX A;  1NUY A;  2Z8E A;  3DP6 A;  3T9X B;  2Y7W A;  1NNK A;  3FXB A;  3PMV A;  4P1E A;  4JWO A;  1QJM A;  1M5D A;  1R9L A;  1SW2 A;  5I58 B;  4YZZ A;  5FHN A;  1AIV A;  1TWY A;  3C35 A;  3RQT A;  3IB2 A;  3VV5 A;  2QFL A;  3QXM A;  5AA4 A;  3DP4 A;  4I40 A;  4E0X A;  4POX A;  4QFO A;  1MXX A;  3HFU A;  1XOC A;  1CNQ A;  1MM7 A;  2V3U A;  2GHA A;  4H8J A;  3RNN A;  3EHU A;  1PB8 A;  3DEL B;  2THI A;  4N15 A;  1N76 A;  3IO4 A;  5KDT A;  1IXC A;  1VSO A;  4EF2 A;  4FAJ A;  5ICT A;  3PUW E;  1B2H A;  1EYJ A;  1FBD A;  3OXN A;  4HTG A;  3QUJ A;  4DI3 D;  2ONK E;  3QAX A;  4U2R A;  3I5O A;  3Q28 A;  3QIM A;  1B0H A;  1QKB A;  4OA4 A;  2ZYN A;  1FBC A;  2P1S A;  4HS7 A;  2V3Q A;  2PBW A;  2FIX A;  1BK4 A;  1D9Y A;  4I8C A;  1PB9 A;  5KCJ A;  2H5Y A;  4F22 A;  4YB7 A;  3SET A;  2R6G E;  1XVY A;  1TFA A;  2O84 X;  2P3N A;  4HE2 A;  4QFP A;  3VLW A;  1BKA A;  1DTG A;  1PC3 A;  2I4B A;  5KZT A;  2DDK A;  5CM6 A;  1N0T A;  3VFJ A;  5I3S A;  1SQY A;  5JTY B;  3CIJ A;  2I0C A;  1LFG A;  1YAE A;  3A09 A;  4KXP A;  3LR1 A;  3ZKL A;  2AL4 A;  1RYO A;  1MH3 A;  3PU5 A;  1CB6 A;  1UTB B;  3WAE A;  2PFZ A;  4DLD A;  2FIE A;  1KZ8 A;  4JVI A;  1MQD A;  1WDN A;  4JDF A;  3FD3 A;  5LOM A;  2ZYO A;  3KG2 A;  4MH5 A;  4Z0I A;  1FBP A;  4KD5 A;  4BDO A;  5BWJ A;  1FPF A;  3MYU A;  3PPR A;  4ECF A;  1PDA A;  2I0B A;  2UVI A;  4GQO A;  3MZ9 A;  3HPI A;  5EHM A;  2ESN A;  5HPQ A;  3G3K A;  4GLI A;  5AA2 D;  4NF8 B;  4P47 A;  3FBP A;  2Q8J A;  1MY1 A;  2WYK A;  4Z7E A;  4GL0 A;  5AA3 A;  3K00 A;  4FED A;  4PTK A;  5EYF A;  2CEY A;  2CZL A;  2H4I A;  4WED A;  5ET8 A;  5A5L A;  3T22 A;  4IO6 A;  1B4H A;  4H6D A;  1JW5 A;  2F6G A;  3OEK A;  1SYI A;  3PUX E;  3OOA A;  1FPJ A;  3JV9 A;  4KCC A;  3EQ1 A;  5EYG A;  4H1X A;  2KQZ A;  1G0I A;  4OVQ A;  2JJK A;  4PE5 B;  3RY3 A;  3TAJ A;  2HPG A;  1GVC A;  2Y84 A;  2NUV A;  1LEV A;  1MY2 A;  3IL1 B;  3IOU A;  3LSX A;  4OET A;  3TFL A;  3D1R A;  4JXI A;  1II5 A;  5EQ7 A;  3TCH A;  2O7I A;  2OZZ A;  3CVG A;  4ZEK A;  1B7Z A;  3M3L A;  3KSX A;  3N5L A;  2XXY A;  4GX4 A;  1UTH A;  1OLC A;  4NE4 A;  1M5B A;  4G68 A;  4Q30 B;  2VHA A;  4XFE A;  1MM6 A;  1LBZ A;  4AB6 A;  1FQC A;  4GWZ A;  4I62 A;  5DEX A;  1A54 A;  2QMW A;  3E13 X;  1M5C A;  4MLV A;  1FPK A;  4DXB A;  4QBA A;  3C32 A;  5B70 A;  4GRK A;  1B5I A;  3VLU A;  2O51 A;  3Q25 A;  3IB1 A;  3R26 A;  2Z8F A;  5I2N B;  2UYE A;  4AS5 A;  5I57 B;  5I59 A;  4M4G A;  3EN3 A;  1QW0 A;  1QUL A;  4R74 A;  1WVJ A;  4EQ7 A;  1H76 A;  2RCA A;  1UQW A;  1A8E A;  1FJ9 A;  3LC8 A;  4JVC A;  4YU0 A;  4N81 A;  3NOH A;  4TQU Q;  1SW1 A;  4GWY A;  1SPI A;  3UIF A;  1GV8 A;  1FBF A;  4PFU A;  1LCT A;  4OVS A;  3TTK A;  4OYV A;  4OVT A;  4F1Y A;  4HXV A;  3PPN A;  4OES A;  3ECR A;  3V8X B;  2QS4 A;  4DCX A;  1ZU0 A;  3MVY A;  4HE0 A;  3TYH A;  4DIG A;  3FGS A;  2F6P A;  4F3B A;  4DZ1 A;  5K2X A;  2L5V A;  4F1U A;  2ALU A;  5ESY A;  3W9W A;  3FJ7 A;  1DBZ A;  1LBW A;  4NF6 A;  1LLS A;  1KA0 A;  1MH4 A;  1Y4T A;  1TT1 A;  2XA5 A;  4KYE A;  1LB9 A;  1ZLQ A;  4UA8 A;  4OFJ A;  3K02 A;  4KHZ E;  4OFO A;  3UOR A;  4F19 A;  3T1B A;  4MLQ A;  4C1T A;  3FXR A;  4IO2 A;  4PAI A;  4F31 B;  3EPE A;  2ZYM A;  2H98 A;  3H4Z A;  4JB7 A;  3IAZ A;  1LBX A;  3K0V A;  5CC2 A;  3OEN A;  2ZXT A;  3K2D A;  1SI1 A;  1DSN A;  3O6I A;  3C4M A;  1VR5 A;  3VVE A;  3HN0 A;  4NG7 A;  4MNI A;  4RK9 A;  1B51 A;  4EDP A;  1MDP 1;  4I9D A;  3C31 A;  4ZS9 A;  1OQH A;  3U94 A;  4AS4 A;  1B3H A;  3CSB A;  3FVG A;  1FTL A;  4H65 A;  3MST A;  5H8H A;  1G0H A;  5IZ3 B;  1DPP A;  2QS1 A;  2XX8 A;  2B3F A;  4X9T A;  4NF5 B;  1QUK A;  2RCB A;  4QFN A;  4ONY A;  3K01 A;  4IO3 A;  4O3B A;  4BDR A;  1SW4 A;  4P3L A;  3N94 A;  4IO4 A;  4R6Y A;  5F24 A;  2WBB A;  1T0K A;  3VVD A;  5I58 A;  4G8H A;  1IMD A;  4AQ4 A;  4BDM A;  2XXT A;  2ONR A;  2GQ1 A;  2I3W A;  3T0J A;  3B6T A;  5EQA A;  3H3G A;  3CG3 A;  2O69 A;  5TP9 B;  5IKB A;  2OWZ A;  3MP6 A;  4TOZ A;  2Y7P A;  2XX9 A;  3ODB A;  3MVX A;  3OMB A;  3EHT A;  3LV0 A;  5DYH A;  3KEI A;  1A7L A;  2NWJ A;  1FTO A;  4TLM B;  2IEE A;  2UVH A;  3K6X A;  3O29 A;  1FQB A;  5I56 B;  2VGQ A;  4IY5 A;  4PFI A;  1FCK A;  3S2V A;  3F11 A;  5I5P A;  3EKI A;  2QVV A;  1IUD A;  3TPA A;  2D3I A;  3VDF A;  3WAF A;  2PT1 A;  4EUO A;  1FPB A;  3S4U A;  3U72 A;  2D5W A;  2DSF A;  3Q26 A;  3FIR A;  4YMA A;  1SBP A;  4GWX A;  2NVU B;  2B3B A;  1MY3 A;  3FAS A;  3FZV A;  4U4X A;  5H8F B;  1OVT A;  4Q5T A;  1AH5 A;  2KR0 A;  1IIW A;  1O64 A;  3W15 C;  3H6T A;  4MBP A;  3E78 A;  4XKP A;  4R2F A;  2V25 A;  4OVJ A;  2PMS A;  5HM4 B;  4RPO A;  2E1S A;  4YIC A;  1SDX A;  2Y7I A;  2DP8 A;  1P99 A;  2XXK A;  5JTY A;  1IMC A;  3G7W A;  1R9Q A;  3CFL A;  4F3G A;  1JET A;  1LBC A;  2O6A A;  2O7U A;  2Z8D A;  1FRP A;  2IA4 A;  1UTB A;  1VFD A;  3T9V A;  4OAN A;  4H8I A;  4LQ2 A;  4WEP A;  4E0W A;  4GL8 A;  3QUF A;  3IB0 A;  4F3S A;  2PYY A;  1IMB A;  4ZDM A;  2QS2 A;  2Y5L A;  1FPG A;  5DW8 A;  1MQJ A;  3IFA A;  3PMW A;  1P1N A;  1K9Y A;  4OEU A;  1B05 A;  2BJI A;  4O7M A;  1QUJ A;  4NF8 A;  2CMO A;  3Q29 A;  1IXI A;  1PB7 A;  3VE1 B;  4MX6 A;  2ZZX A;  2XWV A;  4KCD A;  4Q0C A;  4R2B A;  1NUX A;  4RNS A;  4OQO A;  2HZK A;  5DT6 A;  1Y20 A;  2O1M A;  3RN8 A;  3O6H A;  2QRY A;  3V5A A;  2GH9 A;  3TMG A;  5DTB A;  2F97 A;  4I1D A;  4G8M A;  1IME A;  2DVZ A;  1EU8 A;  3OD7 A;  3S9L C;  1ELJ A;  5EYH A;  3ZSF A;  4LAT A;  4PFB A;  1DK4 A;  2G93 A;  1A99 A;  1Z7M E;  4ELO A;  2O1L A;  1NUW A;  1B32 A;  1IZ1 A;  2VOZ A;  4ZEI A;  3U8Q A;  1NH7 A;  4NWD A;  4ZEB A;  2HAU A;  5A5X B;  3K6W A;  4WKM A;  4KQP A;  4NQ8 A;  4K3F A;  3LUY A;  1POY 1;  4PFT A;  1SYH A;  1USY E;  4FJP A;  1Y9U A;  3C34 A;  1A55 A;  3KC1 A;  2QMX A;  3PUY E;  3KJT A;  4IB2 A;  2XWO A;  1Y3N A;  3MVZ A;  2PX1 A;  1FBG A;  1B3G A;  3D4G A;  4G68 C;  4YAH X;  3B8B A;  4KPT A;  5HBC A;  4DXC A;  4F3P A;  5L9M A;  1B3L A;  2Q8M A;  5J1D A;  1LAG E;  4MHF A;  2DQV A;  1K9Z A;  4NF4 B;  3MZ1 A;  1B1H A;  2QL3 A;  1IMA A;  1RDX A;  5I2N A;  2I49 A;  1MXV A;  3FJM A;  4GWS A;  4ZZE A;  3HHF A;  4GBW A;  5I57 A;  1NMU A;  3EF7 A;  3BIG A;  2XX7 A;  3GLB A;  3FV1 A;  3S9E A;  3OEL A;  3TEL A;  5JEI A;  1J1N A;  5H8S A;  2D21 A;  3H7M A;  1JEV A;  4GFR A;  2VP1 A;  1SI0 A;  3MPK A;  1F9B A;  3MVW A;  4HCY A;  3SDF A;  3QK6 A;  3PGF A;  3TCF A;  4LZ5 A;  3SES A;  2B4M A;  3D4C A;  5ITP A;  4N6D A;  1NNF A;  3TUS A;  4RA1 A;  2P3V A;  3V89 B;  2DOJ A;  3AXF A;  3KOT A;  2RC9 A;  4GIZ A;  4XKN A;  3CRB A;  3M8U A;  4GWO A;  1VFE A;  2XD3 A;  4HE1 A;  1FW0 A;  5H8Q B;  1H44 A;  4X04 A;  2ABH A;  2LAO A;  3SEV A;  5EHS A;  3K4U A;  1D9Q A;  3TOD A;  1KA1 A;  3OO9 A;  4C0R A;  5CMB A;  1EZP A;  3KGC A;  3FVO A;  1I6A A;  3JYR A;  1FQE A;  3RTF B;  4PFY A;  2Y7K A;  4DXU A;  4ZEC A;  1IMF A;  2UXA A;  4MFI A;  5L9S A;  2F34 A;  2OWT A;  1ZIU A;  3MAM A;  4PFR A;  1RDZ A;  3VVF A;  5AA1 A;  1MQH A;  4G77 A;  5IM2 A;  1A8F A;  3N6U A;  1UIU A;  4H0W A;  5IZ1 A;  2RC8 A;  1FPD A;  3IX1 A;  1ZKB A;  1YCJ A;  5K2Y A;  2GFE A;  2QJE A;  4UAC A;  4FE8 A;  1ZBM A;  2O68 A;  2PCR A;  4GBV A;  4FEB A;  4JSD A;  5J16 A;  1FPL A;  3G3F A;  4N8Y A;  5IZ3 A;  3UK4 A;  4YKP A;  1Q35 A;  5EQ9 A;  3MQ9 A;  5CMK A;  4LZ8 A;  3RPW A;  4N07 A;  4NF5 A;  1FTK A;  2QVR A;  3L6H A;  2XHD A;  3T66 A;  3JZJ A;  4P9K A;  1Q9D A;  2YLN A;  1NV0 A;  3ISP A;  3RPL B;  3KZG A;  4H5G A;  1HSL A;  4R6H A;  4N6K A;  4XF5 A;  1Y1Z A;  4YMB A;  1IXG A;  5ITO A;  4IO5 A;  3G3I A;  4BDQ A;  5TP9 A;  1FQD A;  5FHM A;  4NED A;  3OO8 A;  2ZNT A;  5ELV A;  1MXZ A;  4QSD A;  3M3F A;  3PUZ E;  4IR8 A;  3IOV A;  1EH3 A;  3TTL A;  2DYX A;  1QVS A;  2RF1 A;  4LVQ A;  5I56 A;  1RYX A;  1NV6 A;  4OHN A;  2XXQ A;  4XTC Q;  5I59 B;  4H45 A;  3KFM A;  3R7X A;  1P1U A;  3FVK A;  3MZB A;  3FAT A;  4QSC A;  1ATG A;  4HW8 A;  3O9P A;  1YPN A;  4EXL A;  3DP8 A;  1N7W A;  4FOR A;  4LA9 A;  3H03 A;  2OJT A;  3PUV E;  1B58 A;  1NL5 A;  3K1P A;  4Q8R A;  3B7D A;  4LZ7 A;  3OO7 A;  1CE2 A;  4PQJ A;  5H8F A;  3FUZ A;  4QRZ A;  4FEC A;  4LQ5 A;  5F1Q A;  4RY1 A;  4ELP A;  3USD A;  3T96 B;  2DWJ A;  3SEX A;  1MQG A;  3TTR A;  2RIN A;  2X7P A;  1EZO A;  2X7Q A;  2V4C A;  2OLB A;  1MS7 A;  1AMF A;  2MKZ A;  1HSJ A;  1URS A;  3OSR A;  2DE2 A;  3CG1 A;  1JVY A;  2F3B A;  4U23 A;  4KFQ A;  3C9H A;  2P2A A;  2XXX A;  3IK6 B;  3A3C A;  2XD2 A;  3HO7 A;  4JSO A;  3T9U A;  1IEJ A;  3KN8 A;  2FBP A;  3KC0 A;  5CMM A;  1FTA A;  4U21 A;  1VDW A;  3GYY A;  4OVR A;  2F7A A;  4PFW A;  2RC7 A;  4XKQ A;  4GVO A;  1BTJ A;  5AA2 B;  4RPN A;  2XWI A;  2WEF A;  1N3W A;  2R8T A;  5FHO A;  3U1O A;  4DE8 A;  3T93 B;  3ONM A;  4P0I A;  3TQW A;  3SZP A;  4AB5 A;  2QVU A;  3N6T A;  2I3V A;  1YZ0 A;  1P1Q A;  3KBR A;  4O3C A;  1DCU A;  3I6V A;  3RYD A;  1IXH A;  5TU0 A;  3TQL A;  1XI6 A;  4N6P A;  5FBP A;  4OVP A;  4ND9 A;  4F2O A;  1N3X A;  5H8N B;  1DMB A;  2GHB A;  5I2K B;  1NV3 A;  5DVI A;  4DI4 B;  4GF8 A;  2PT2 A;  2AYS A;  3IJO B;  4IY6 A;  3UP9 A;  1ZJL A;  3L6G A;  4IGR A;  4NGU A;  3TTM A;  2WBD A;  4FBP A;  3GZG A;  4EQ9 A;  3I3V A;  1MY0 A;  1Y4C A;  1US5 A;  1I6Q A;  2VPN A;  1SD3 A;  5ET5 A;  1FPI A;  5A5X A;  2XXW A;  1URG A;  5FTH A;  1EZ9 A;  1NV4 A;  2DVC A;  1TXF A;  2ZYK A;  3BFT A;  2HHM A;  1MRP A;  4NWC A;  5I7I A;  4POW A;  4X48 A;  4NMY A;  1PBP A;  2OX3 A;  3O28 A;  4ZE9 A;  1ZTY A;  3A3U A;  4XXU A;  2DS9 A;  1IIT A;  3VXB A;  4PC9 A;  4XIG Q;  1JEU A;  4H46 A;  1NH8 A;  3RUM A;  4NHB A;  2I4C A;  4NF4 A;  5M2V A;  1MG1 A;  2H99 A;  1MPC A;  1NFT A;  2GRV A;  5CI5 A;  3TDJ A;  2M8C A;  1LST A;  4BDL A;  1AOV A;  1AWB A;  5DVF A;  3K6V A;  4OFL A;  3CHG A;  4NN3 A;  2F7C A;  4M1V A;  4JBZ A;  4O94 A;  3E3K A;  4C1U A;  4YB6 A;  2AL5 A;  3THI A;  3PPP A;  2REJ A;  2XXV A;  1FBH A;  3HCQ A;  3FXU A;  2AIX A;  1H3D A;  3SER A;  4PF8 A;  4ELR A;  4GOT A;  1OMP A;  4PF6 A;  2CZH A;  4BDN A;  4KR5 A;  5ET6 A;  3IOW A;  2Z22 A;  1FTM A;  3IOR A;  4RJZ A;  1DPE A;  4U4S A;  5H8Q A;  4ZZA A;  3RLF E;  2YJP A;  1MXU A;  1XT8 A;  3DM0 A;  5CMC A;  3RT8 A;  3ZS6 A;  2F7B A;  4MF3 A;  2OK2 A;  5LTC A;  1XC1 A;  3RTW B;  3FJG A;  3IO6 A;  4U1O A;  4RXL A;  1B7U A;  2Q74 A;  1N04 A;  4F1V A;  1YYZ A;  3HST A;  3G3H A;  2HFB A;  4RK2 A;  4GD5 A;  3MW0 A;  3U65 A;  2PFY A;  4GXA A;  4G61 A;  2A5T B;  2KLF A;  1Y1M A;  4R9G A;  2F36 A;  2RKM A;  5IGA A;  4NTL A;  3LSL A;  1OIB A;  2QS3 A;  4QSE A;  1S9T A;  2HAV A;  1URD A;  3IJX B;  1LFI A;  3O2A A;  1MXY A;  3H06 B;  1FTJ A;  3PMX A;  3S9N C;  2DE3 A;  2HZL A;  4O3A A;  3TZA A;  1O63 A;  3B50 A;  2OWS A;  4DDD A;  4OEN A;  3DLN A;  2X26 A;  2PVU A;  3QSL A;  3PD8 A;  1B7H A;  2HXR A;  4HCW A;  3TKD A;  3G3J A;  2FVZ A;  4R9F A;  1LB8 A;  1IQ7 A;  4U1Z A;  3TCG A;  3EHS A;  3N26 A;  1Y3Q A;  4NX1 A;  3RPL A;  1EYI A;  3H6W A;  3FXQ A;  2I58 A;  1SVX B;  2QSX A;  1L5T A;  1B4Z A;  3RGY A;  3MJN A;  3C36 A;  4PCD A;  1B40 A;  4O8M A;  2HQ0 A;  2R71 A;  4MJO A;  2DWA A;  4QFK A;  1UIV A;  2VT5 A;  2Y5K A;  1XHY A;  3SEY A;  1EYK A;  3E4R A;  4G4P A;  1B5H A;  4P56 A;  1D9V A;  1LAX A;  4WXJ A;  1D3K A;  1WOD A;  4LON B;  3B6Q A;  3GXA A;  5TPA B;  2REG A;  4P8B A; 
#chains in the Genus database with same CATH homology
 1P1W A;  4PET A;  4F18 A;  1P1O A;  2OBG A;  3BFU A;  3U93 A;  4ZED A;  2P0S A;  2HEU A;  3K1M A;  4XKR A;  4X1B A;  1US4 A;  4BLA A;  5AA4 B;  4KYS A;  3O97 A;  3MUQ A;  4EQB A;  1JQF A;  3MP1 A;  2H9B A;  4OWD A;  1XVX A;  3KN3 A;  4YKJ A;  1M5E A;  4R6K A;  5I84 A;  2XXU A;  5KDT B;  3O66 A;  2ZNU A;  3B6W A;  4QF9 A;  4U22 A;  2XXI A;  4YKI A;  2YPN A;  1I69 A;  1LAH E;  1MPB A;  4OER A;  1B3F A;  3G3G A;  2UVJ A;  1GR2 A;  3GBB A;  2NXO A;  1R1N A;  3C33 A;  1B6H A;  4F39 A;  5L9O A;  1MXW A;  1SW5 A;  1H45 A;  1QKA A;  1KWH A;  1O7T A;  3CFZ A;  3W9V A;  5JK4 A;  3OEM A;  2HCA A;  5KCJ B;  4PP0 A;  4OEV A;  2W7Y A;  5B7D A;  2ONS A;  3GBA A;  3PPO A;  3BBR A;  3HHG A;  2G29 A;  1JW4 A;  1Y3P A;  4ZEF A;  2FNC A;  5AA2 A;  2OCU A;  1LFH A;  1OLA A;  3KJ7 A;  2V93 A;  3SKP A;  2QPQ A;  1B0L A;  4RYA A;  2E0S A;  3E9X A;  3CR9 A;  4L17 A;  3VXC A;  1DTZ A;  2Q2A A;  5L8D A;  2WKY A;  4OZ9 A;  2V3T A;  3MC2 A;  5H8N A;  1MY4 A;  5I2K A;  4YKK A;  4EF1 A;  1N7X A;  1AL3 A;  1B9J A;  4H5F A;  2FA7 A;  1LBB A;  2DXY A;  3ILU B;  1S7Y A;  1ANF A;  3SEW A;  1DOT A;  2F8D A;  4GXS B;  1NKX A;  3LBS A;  3ZKK A;  2I48 A;  2F78 A;  1S50 A;  3P7I A;  2I6E A;  3RT6 B;  2NOO A;  3ILT B;  4TLL B;  3IOT A;  3K1N A;  3OO6 A;  1PBQ A;  4ZE8 A;  4IO7 A;  5F7V A;  1LAF E;  3R6U A;  1LCF A;  3KOS A;  1ZMG A;  1I6B A;  2FYI A;  3M3K A;  4P0G A;  4R75 A;  1QUI A;  3PV0 E;  4YB5 A;  5AE4 A;  4ELQ A;  4F29 A;  1NNP A;  1Z7N E;  3CSG A;  2Q9T A;  5DVJ A;  1JVX A;  1D4N A;  4R72 A;  1MQI A;  1HSE A;  1LGB C;  4THI A;  1Q1K A;  2F35 A;  1A40 A;  1OVB A;  3H6U A;  1UTH B;  2DXR A;  1XS5 A;  3UN6 A;  4G8N A;  4G68 B;  2DWI A;  1H43 A;  3TEP A;  4OXV A;  2ZNS A;  1FQF A;  5DEX B;  1B46 A;  2XXP A;  2ZMB A;  1PEB A;  2Y7R A;  1MDQ A;  4JWY A;  2ANJ A;  3UA8 A;  1VE4 A;  5ISU A;  4P11 A;  3TTN A;  4IGT A;  3VLV A;  2Q88 A;  1BIY A;  1GTK A;  4JWX A;  3IR1 A;  4H67 A;  3MBP A;  4F2Q A;  3KN7 A;  1BLF A;  4ESX A;  1YTV A;  3Q27 A;  3CI8 A;  3LSW A;  3MPL A;  4KYD A;  4LUB A;  1B1X A;  4FAT A;  3U92 A;  2V84 A;  3PD9 A;  4QFL A;  2UVG A;  2H25 A;  3K6U A;  1R6Z A;  3MWB A;  3SEU A;  4X1D A;  1TFD A;  2VD3 A;  3FVN A;  4OTE A;  2BJJ X;  1B3E A;  5ICQ A;  2A5T A;  2A5S A;  2Q89 A;  5CBR A;  1NNT A;  5CBS A;  2R9J A;  1BP5 A;  3BKI B;  4R73 A;  5CRY A;  2XXH A;  1GGG A;  3UGW A;  4NF6 B;  5FTI A;  1USY H;  3PPQ A;  2XXR A;  4DCY A;  3OSQ A;  4QHQ A;  1POT A;  2B65 A;  4G2Z A;  3O6G A;  2VD2 A;  4KI0 E;  5IAI A;  1JW1 A;  1M5F A;  4FIM A;  1B52 A;  4ESW A;  4LP2 B;  1OQG A;  2HXW A;  1FQA A;  3MP8 A;  3QYT A;  3V83 A;  3T9H B;  4EXK A;  1RKM A;  5BUU A;  2DWH A;  2Q2C A;  3S9M C;  1MPD A;  2UYF A;  2F5X A;  3HV1 A;  1B5J A;  5H8H B;  4OMB A;  3KSJ A;  2Z23 A;  3H6V A;  3LSF B;  4ISU A;  5TPA A;  2DE4 A;  1JNF A;  3FV2 A;  1N84 A;  4N13 A;  3CFX A;  2Z8E A;  3DP6 A;  3T9X B;  2Y7W A;  1NNK A;  3PMV A;  4JWO A;  1QJM A;  1M5D A;  1R9L A;  1SW2 A;  5I58 B;  4YZZ A;  5FHN A;  1AIV A;  1TWY A;  3C35 A;  3RQT A;  3IB2 A;  3VV5 A;  3QXM A;  5AA4 A;  3DP4 A;  4E0X A;  4POX A;  4QFO A;  1MXX A;  1XOC A;  1MM7 A;  2V3U A;  2GHA A;  4H8J A;  3RNN A;  3EHU A;  1PB8 A;  3DEL B;  2THI A;  1N76 A;  3IO4 A;  5KDT A;  1IXC A;  1VSO A;  4EF2 A;  4FAJ A;  5ICT A;  3PUW E;  1B2H A;  3OXN A;  4HTG A;  3QUJ A;  2ONK E;  3QAX A;  4U2R A;  3I5O A;  3Q28 A;  3QIM A;  1B0H A;  1QKB A;  2ZYN A;  2P1S A;  4HS7 A;  2V3Q A;  2PBW A;  1D9Y A;  4I8C A;  1PB9 A;  5KCJ A;  2H5Y A;  4F22 A;  4YB7 A;  3SET A;  2R6G E;  1XVY A;  1TFA A;  2O84 X;  4QFP A;  3VLW A;  1BKA A;  1DTG A;  1PC3 A;  2I4B A;  5KZT A;  5CM6 A;  1N0T A;  3VFJ A;  1SQY A;  5JTY B;  3CIJ A;  2I0C A;  1LFG A;  1YAE A;  3A09 A;  3LR1 A;  3ZKL A;  2AL4 A;  1RYO A;  1MH3 A;  3PU5 A;  1CB6 A;  1UTB B;  3WAE A;  4DLD A;  1MQD A;  1WDN A;  4JDF A;  3FD3 A;  5LOM A;  2ZYO A;  3KG2 A;  4MH5 A;  4Z0I A;  4KD5 A;  4BDO A;  5BWJ A;  3PPR A;  4ECF A;  1PDA A;  2I0B A;  2UVI A;  4GQO A;  3MZ9 A;  3HPI A;  5EHM A;  2ESN A;  5HPQ A;  3G3K A;  4GLI A;  5AA2 D;  4NF8 B;  2Q8J A;  1MY1 A;  4Z7E A;  4GL0 A;  5AA3 A;  3K00 A;  4FED A;  5EYF A;  2CZL A;  2H4I A;  4WED A;  3T22 A;  4IO6 A;  1B4H A;  4H6D A;  1JW5 A;  2F6G A;  3OEK A;  1SYI A;  3PUX E;  3OOA A;  3JV9 A;  4KCC A;  3EQ1 A;  4H1X A;  4PE5 B;  3RY3 A;  3TAJ A;  1GVC A;  2Y84 A;  2NUV A;  1MY2 A;  3IL1 B;  3IOU A;  3LSX A;  4OET A;  3TFL A;  4JXI A;  1II5 A;  3TCH A;  2O7I A;  2OZZ A;  3CVG A;  4ZEK A;  1B7Z A;  3M3L A;  3KSX A;  3N5L A;  2XXY A;  1UTH A;  1OLC A;  4NE4 A;  1M5B A;  4G68 A;  4Q30 B;  2VHA A;  1MM6 A;  4AB6 A;  1FQC A;  4I62 A;  5DEX A;  1A54 A;  2QMW A;  3E13 X;  1M5C A;  4MLV A;  4DXB A;  3C32 A;  5B70 A;  4GRK A;  1B5I A;  3VLU A;  2O51 A;  3Q25 A;  3IB1 A;  3R26 A;  2Z8F A;  5I2N B;  2UYE A;  5I57 B;  5I59 A;  4M4G A;  3EN3 A;  1QW0 A;  1QUL A;  4R74 A;  1WVJ A;  4EQ7 A;  1H76 A;  2RCA A;  1UQW A;  1A8E A;  3LC8 A;  4YU0 A;  4TQU Q;  1SW1 A;  3UIF A;  1GV8 A;  4PFU A;  1LCT A;  3TTK A;  4OYV A;  4F1Y A;  3PPN A;  4OES A;  3ECR A;  3V8X B;  2QS4 A;  4DCX A;  1ZU0 A;  3MVY A;  3TYH A;  4DIG A;  3FGS A;  2F6P A;  4F3B A;  4DZ1 A;  5K2X A;  4F1U A;  2ALU A;  3W9W A;  3FJ7 A;  4NF6 A;  1LLS A;  1MH4 A;  1Y4T A;  1TT1 A;  4KYE A;  1LB9 A;  1ZLQ A;  4UA8 A;  4OFJ A;  3K02 A;  4KHZ E;  4OFO A;  3UOR A;  4F19 A;  4MLQ A;  4C1T A;  3FXR A;  4IO2 A;  4F31 B;  3EPE A;  2ZYM A;  2H98 A;  3H4Z A;  4JB7 A;  3IAZ A;  3K0V A;  5CC2 A;  3OEN A;  2ZXT A;  3K2D A;  1SI1 A;  1DSN A;  3O6I A;  3C4M A;  1VR5 A;  3VVE A;  3HN0 A;  4RK9 A;  1B51 A;  4EDP A;  1MDP 1;  4I9D A;  3C31 A;  4ZS9 A;  1OQH A;  3U94 A;  1B3H A;  3CSB A;  3FVG A;  1FTL A;  4H65 A;  5H8H A;  1DPP A;  2QS1 A;  2XX8 A;  2B3F A;  4X9T A;  4NF5 B;  1QUK A;  2RCB A;  4QFN A;  4IO3 A;  3K01 A;  4ONY A;  4O3B A;  4BDR A;  1SW4 A;  3N94 A;  4IO4 A;  4R6Y A;  1T0K A;  3VVD A;  5I58 A;  4G8H A;  4AQ4 A;  4BDM A;  2XXT A;  2ONR A;  2I3W A;  3B6T A;  3H3G A;  3CG3 A;  2O69 A;  5TP9 B;  5IKB A;  3MP6 A;  4TOZ A;  2Y7P A;  2XX9 A;  3ODB A;  3MVX A;  3OMB A;  3EHT A;  5DYH A;  3KEI A;  1A7L A;  2NWJ A;  1FTO A;  4TLM B;  2IEE A;  2UVH A;  3K6X A;  3O29 A;  1FQB A;  5I56 B;  2VGQ A;  4IY5 A;  1FCK A;  3S2V A;  3F11 A;  1IUD A;  3TPA A;  2D3I A;  3VDF A;  3WAF A;  2PT1 A;  4EUO A;  3S4U A;  3U72 A;  2D5W A;  2DSF A;  3Q26 A;  3FIR A;  4YMA A;  1SBP A;  2NVU B;  2B3B A;  1MY3 A;  3FAS A;  3FZV A;  4U4X A;  5H8F B;  1OVT A;  4Q5T A;  1AH5 A;  1IIW A;  1O64 A;  3W15 C;  3H6T A;  4MBP A;  4XKP A;  4R2F A;  2V25 A;  4OVJ A;  2PMS A;  5HM4 B;  4RPO A;  2E1S A;  4YIC A;  1SDX A;  2Y7I A;  2DP8 A;  1P99 A;  5JTY A;  3G7W A;  1R9Q A;  3CFL A;  4F3G A;  1JET A;  1LBC A;  2O6A A;  2O7U A;  2Z8D A;  2IA4 A;  1UTB A;  1VFD A;  3T9V A;  4H8I A;  4LQ2 A;  4WEP A;  4E0W A;  4GL8 A;  3QUF A;  3IB0 A;  4F3S A;  2PYY A;  4ZDM A;  2QS2 A;  1MQJ A;  3PMW A;  1P1N A;  4OEU A;  1B05 A;  1QUJ A;  4NF8 A;  2CMO A;  3Q29 A;  1IXI A;  1PB7 A;  3VE1 B;  4KCD A;  4Q0C A;  4R2B A;  4RNS A;  4OQO A;  2HZK A;  5DT6 A;  1Y20 A;  2O1M A;  3RN8 A;  3O6H A;  2QRY A;  3V5A A;  2GH9 A;  3TMG A;  5DTB A;  2F97 A;  4I1D A;  4G8M A;  2DVZ A;  1EU8 A;  3OD7 A;  3S9L C;  1ELJ A;  3ZSF A;  4LAT A;  2G93 A;  1A99 A;  1Z7M E;  4ELO A;  2O1L A;  1B32 A;  1IZ1 A;  2VOZ A;  4ZEI A;  3U8Q A;  1NH7 A;  4NWD A;  4ZEB A;  2HAU A;  5A5X B;  3K6W A;  4WKM A;  4KQP A;  4K3F A;  3LUY A;  1POY 1;  4PFT A;  1SYH A;  1USY E;  4FJP A;  1Y9U A;  3C34 A;  1A55 A;  2QMX A;  3PUY E;  3KJT A;  4IB2 A;  1Y3N A;  3MVZ A;  2PX1 A;  1B3G A;  3D4G A;  4G68 C;  4YAH X;  4KPT A;  5HBC A;  4DXC A;  4F3P A;  5L9M A;  1B3L A;  5J1D A;  1LAG E;  2DQV A;  4NF4 B;  3MZ1 A;  1B1H A;  2QL3 A;  5I2N A;  2I49 A;  1MXV A;  3FJM A;  4ZZE A;  3HHF A;  5I57 A;  1NMU A;  3EF7 A;  2XX7 A;  3GLB A;  3FV1 A;  3S9E A;  3OEL A;  3TEL A;  5JEI A;  1J1N A;  5H8S A;  2D21 A;  3H7M A;  1JEV A;  4GFR A;  2VP1 A;  1SI0 A;  3MPK A;  1F9B A;  3MVW A;  4HCY A;  3SDF A;  3QK6 A;  3PGF A;  3TCF A;  4LZ5 A;  3SES A;  3D4C A;  5ITP A;  1NNF A;  3TUS A;  4RA1 A;  3V89 B;  2DOJ A;  3AXF A;  3KOT A;  2RC9 A;  4GIZ A;  4XKN A;  3CRB A;  3M8U A;  4GWO A;  1VFE A;  2XD3 A;  1FW0 A;  5H8Q B;  1H44 A;  2ABH A;  2LAO A;  3SEV A;  5EHS A;  3K4U A;  3TOD A;  3OO9 A;  4C0R A;  5CMB A;  1EZP A;  3KGC A;  3FVO A;  1I6A A;  3JYR A;  1FQE A;  3RTF B;  4PFY A;  2Y7K A;  4DXU A;  4ZEC A;  2UXA A;  4MFI A;  5L9S A;  2F34 A;  2OWT A;  1ZIU A;  3MAM A;  3VVF A;  5AA1 A;  1MQH A;  4G77 A;  1A8F A;  3N6U A;  1UIU A;  4H0W A;  2RC8 A;  3IX1 A;  1ZKB A;  1YCJ A;  5K2Y A;  2GFE A;  2QJE A;  4UAC A;  4FE8 A;  1ZBM A;  2O68 A;  4FEB A;  4JSD A;  3G3F A;  3UK4 A;  4YKP A;  1Q35 A;  3MQ9 A;  5CMK A;  4LZ8 A;  3RPW A;  4N07 A;  4NF5 A;  1FTK A;  3L6H A;  2XHD A;  3T66 A;  3JZJ A;  2YLN A;  3KZG A;  4H5G A;  1HSL A;  4R6H A;  1Y1Z A;  4YMB A;  1IXG A;  5ITO A;  4IO5 A;  3G3I A;  4BDQ A;  5TP9 A;  1FQD A;  5FHM A;  4NED A;  3OO8 A;  2ZNT A;  5ELV A;  1MXZ A;  4QSD A;  3M3F A;  3PUZ E;  3IOV A;  1EH3 A;  3TTL A;  2DYX A;  1QVS A;  2RF1 A;  4LVQ A;  5I56 A;  1RYX A;  4OHN A;  2XXQ A;  4XTC Q;  5I59 B;  3KFM A;  3R7X A;  1P1U A;  3FVK A;  3MZB A;  3FAT A;  4QSC A;  1ATG A;  4HW8 A;  3O9P A;  1YPN A;  4EXL A;  3DP8 A;  1N7W A;  4FOR A;  4LA9 A;  3H03 A;  2OJT A;  3PUV E;  1B58 A;  1NL5 A;  3K1P A;  4Q8R A;  3B7D A;  4LZ7 A;  3OO7 A;  1CE2 A;  4PQJ A;  5H8F A;  3FUZ A;  4QRZ A;  4FEC A;  4LQ5 A;  5F1Q A;  4RY1 A;  4ELP A;  3USD A;  3T96 B;  2DWJ A;  3SEX A;  1MQG A;  3TTR A;  2RIN A;  2X7P A;  1EZO A;  2X7Q A;  2OLB A;  1MS7 A;  1AMF A;  1HSJ A;  1URS A;  3OSR A;  2DE2 A;  3CG1 A;  1JVY A;  4U23 A;  4KFQ A;  3C9H A;  2P2A A;  2XXX A;  3IK6 B;  3A3C A;  2XD2 A;  3HO7 A;  4JSO A;  3T9U A;  1IEJ A;  3KN8 A;  5CMM A;  4U21 A;  2F7A A;  4PFW A;  2RC7 A;  4XKQ A;  4GVO A;  1BTJ A;  5AA2 B;  4RPN A;  1N3W A;  5FHO A;  3U1O A;  4DE8 A;  3T93 B;  3ONM A;  4P0I A;  3TQW A;  4AB5 A;  3N6T A;  2I3V A;  1P1Q A;  3KBR A;  4O3C A;  3I6V A;  1IXH A;  5TU0 A;  3TQL A;  4N6P A;  4ND9 A;  4F2O A;  1N3X A;  5H8N B;  1DMB A;  2GHB A;  5I2K B;  5DVI A;  4GF8 A;  2PT2 A;  2AYS A;  3IJO B;  4IY6 A;  3UP9 A;  1ZJL A;  3L6G A;  4IGR A;  3TTM A;  3GZG A;  4EQ9 A;  3I3V A;  1MY0 A;  1Y4C A;  1US5 A;  1I6Q A;  1SD3 A;  5A5X A;  2XXW A;  1URG A;  5FTH A;  1EZ9 A;  2DVC A;  1TXF A;  2ZYK A;  3BFT A;  1MRP A;  4NWC A;  4POW A;  4X48 A;  4NMY A;  1PBP A;  3O28 A;  4ZE9 A;  1ZTY A;  3A3U A;  4XXU A;  2DS9 A;  1IIT A;  3VXB A;  4XIG Q;  1JEU A;  1NH8 A;  3RUM A;  2I4C A;  4NF4 A;  5M2V A;  1MG1 A;  2H99 A;  1MPC A;  1NFT A;  2GRV A;  5CI5 A;  3TDJ A;  2M8C A;  1LST A;  4BDL A;  1AOV A;  5DVF A;  3K6V A;  4OFL A;  2F7C A;  4M1V A;  4JBZ A;  3E3K A;  4C1U A;  4YB6 A;  2AL5 A;  3THI A;  3PPP A;  2REJ A;  2XXV A;  3HCQ A;  3FXU A;  2AIX A;  1H3D A;  3SER A;  4ELR A;  4GOT A;  1OMP A;  4BDN A;  4KR5 A;  3IOW A;  2Z22 A;  1FTM A;  3IOR A;  4RJZ A;  1DPE A;  4U4S A;  5H8Q A;  4ZZA A;  3RLF E;  2YJP A;  1MXU A;  1XT8 A;  3DM0 A;  5CMC A;  3RT8 A;  3ZS6 A;  2F7B A;  4MF3 A;  2OK2 A;  1XC1 A;  3RTW B;  3FJG A;  3IO6 A;  4U1O A;  4RXL A;  1B7U A;  1N04 A;  4F1V A;  3HST A;  3G3H A;  2HFB A;  4RK2 A;  4GD5 A;  3MW0 A;  4GXA A;  2A5T B;  2KLF A;  1Y1M A;  4R9G A;  2F36 A;  2RKM A;  4NTL A;  3LSL A;  1OIB A;  2QS3 A;  4QSE A;  1S9T A;  2HAV A;  1URD A;  3IJX B;  1LFI A;  3O2A A;  1MXY A;  3H06 B;  1FTJ A;  3PMX A;  3S9N C;  2DE3 A;  2HZL A;  4O3A A;  3TZA A;  1O63 A;  2OWS A;  4DDD A;  4OEN A;  3DLN A;  2X26 A;  2PVU A;  3QSL A;  3PD8 A;  1B7H A;  4HCW A;  3TKD A;  3G3J A;  4R9F A;  1LB8 A;  1IQ7 A;  4U1Z A;  3TCG A;  3EHS A;  3N26 A;  1Y3Q A;  3H6W A;  3FXQ A;  2I58 A;  1SVX B;  2QSX A;  1L5T A;  1B4Z A;  3RGY A;  3MJN A;  3C36 A;  1B40 A;  2HQ0 A;  2R71 A;  2DWA A;  1UIV A;  4QFK A;  1XHY A;  3SEY A;  3E4R A;  4G4P A;  1B5H A;  1D9V A;  1LAX A;  4WXJ A;  1D3K A;  1WOD A;  4LON B;  3B6Q A;  3GXA A;  5TPA B;  2REG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...