5LTCA

Crystal structure of doubly spin labelled vcsiap r125
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
299
structure length
296
Chain Sequence
ATTLKMGMQASVGSVEYNSAKMLADTLEEMSQGEIKLALYPSAQLGDDRAMLQLTLGDLDITYAEFGRMGLWIPRAEAVMLPYVAKDFDHLRRMFESDFGQGVRDEMLQKFNWRALDTWYNGTAETTSNRPLNSIEDFKGLKLRVPNAKQNLNYAKLSGASPTPMSFSEVYALQTNAVDGQENPLPTIKTMKFYEVQKNLAMTHHIVNDQMVIISESTWQKLSDTDKDIIQKAVQKVGDAHTQTVKTQEAELVSFFKSEGINVTYPLEPFREAMQPLYKEFDSNIGQPIVSKLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PELDOR Spectroscopy Reveals Two Defined States of a Sialic Acid TRAP Transporter SBP in Solution.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Membrane protein
molecule keywords C4-dicarboxylate-binding periplasmic protein
total genus 120
structure length 296
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5ltcA00
4PF8A 5IM2A 4YICA 2HZLA 4N8YA 4PCDA 4PBQA 4N15A 4OA4A 2ZZXA 2CEYA 5IGAA 4PE3A 5I7IA 4MAGA 4OVRA 3GYYA 4PBHA 4MX6A 2HZKA 4MNPA 4XFEA 4O8MA 2HPGA 4PC9A 3B50A 4NF0A 4X8RA 4X04A 4PDDA 4NAPA 4NG7A 5IZZA 4MNCA 2WX9A 4P1EA 4UABA 4PGNA 4N6DA 4NN3A 4OVPA 4PFRA 4OVTA 2XWKA 4NGUA 2WYPA 4DI4B 5CM6A 4OVSA 4PAFA 4OANA 4MIJA 2XWOA 2ZZVA 2XWVA 4N8GA 4P56A 2WYKA 4NHBA 4PF6A 4PDHA 4P9KA 4XEQA 4NX1A 4PAIA 4PFBA 4XF5A 4N4UA 4PAKA 2V4CA 2ZZWA 2CEXA 4P8BA 4DI3D 4PETA 4P47A 2PFZA 4NQ8A 3U65A 4YZZA 4N17A 5LTCA 4O7MA 4P1LA 4MEVA 4N91A 2XA5A 4MNIA 4OVQA 2VPOA 4LN5A 2VPNA 2PFYA 4PGPA 4PFIA 4MCOA 4MHFA 2XXKA 4P3LA 3FXBA 5I5PA 2XWIA 4N6KA 4O94A 4MMPA
chains in the Genus database with same CATH superfamily
1FBCA 5ET7A 1OVBA 4JXIA 1NNPA 2X7PA 4Q8RA 1MS7A 2A5TA 3OMBA 5JEIA 4OVJA 1FPJA 1NH8A 1YAEA 4C1UA 3RPLB 2HEUA 3B6WA 2I3VA 4X48A 2Y7RA 3HHFA 4JWOA 1JW4A 3IORA 1I6QA 4PDDA 3A09A 3TKDA 2Y5LA 4G68C 4MJOA 4X9TA 2UVIA 3LV0A 3CFXA 5DVIA 4QRZA 2F3BA 5I3SA 5ICQA 3K0VA 5FHMA 4GXAA 1A54A 3CVGA 3G3KA 1D9QA 2PFZA 1SW5A 4G2ZA 5BUUA 4O7MA 1NNTA 3BIHA 5AE4A 3BBRA 2V84A 1FCKA 2DE4A 1DTZA 2GHBA 1JQFA 1LGBC 4JSDA 3SETA 3O29A 1YTVA 3KOTA 3PV0E 3E79A 4P3LA 4PF8A 1B0HA 4YKKA 3IO6A 3E3KA 2XXVA 3W9WA 2ONKE 3GBBA 3KGCA 1M5FA 1FQAA 2DYXA 5IGAA 1N0TA 4MLQA 4OHNA 5IKBA 3K1PA 1DK4A 1AWBA 2DP8A 2O51A 3TQWA 1G0IA 2ZNUA 3FD3A 1MQJA 4OXVA 4MNPA 1LAHE 3IL1B 5HBCA 3B6QA 3RPWA 3EKIA 1B4ZA 3EHSA 3O28A 4GFRA 1FJ6A 3DELB 4PGNA 3FVNA 4MF3A 2XWKA 4U2RA 4OVSA 1NV7A 4H46A 2ZYNA 5B7DA 1H45A 1B51A 2V4CA 4DI3D 4DXBA 1B3EA 3VE1B 1PDAA 2D5WA 2ZNSA 2V25A 5ESYA 5F7VA 4Q5TA 4EQ7A 1P99A 3U1OA 4PFUA 3MQ9A 3KEIA 3UORA 3CG3A 2V3QA 5H8FB 4MH5A 1FQFA 4N6KA 4O94A 4YMAA 4OENA 1TT1A 4MBPA 1H76A 1FQDA 4HCYA 4Z0IA 1CB6A 3EPEA 1YZ0A 3O2AA 3ILUB 4FJPA 4QSDA 3PGFA 3K6XA 4O3AA 2DWHA 5TP9B 1SPIA 3Q27A 5EYFA 4OVRA 4IO5A 4POWA 4PBHA 3RQTA 3OSQA 3KC0A 4NMYA 2ONRA 4O8MA 2Y84A 3H3GA 5L9SA 1DTGA 3T9HB 5H8NB 4I40A 1LBZA 1QULA 4C1TA 3Q28A 1JW1A 2A5SA 3MVZA 3C9HA 3O6HA 2I0CA 1P1OA 1ATGA 2MKZA 3CSBA 3PD9A 4HCWA 1MY1A 4I3YA 2H98A 3PPOA 4GXSB 3N6TA 1JNFA 3CR9A 4GWOA 4RA1A 2Z8DA 4P47A 3B8BA 3MAMA 1MXWA 3SDFA 4FEDA 1SW1A 1MY4A 1VDWA 2F5XA 3MVYA 2UVJA 1R9LA 2XXYA 5I2NA 3HSTA 1R1NA 3K6WA 2PT2A 4G68B 1LFHA 2KR0A 2H5YA 1DSNA 5IZ3B 1LEVA 2AL5A 2DXRA 4OWDA 5DEXB 2DVZA 1B46A 4PBQA 4ECFA 3N94A 5T3JA 3C31A 4NF5B 5I57B 4F1UA 4OERA 4NF6B 3QUJA 4PTKA 4LP2B 2FA7A 3TQLA 4KI0E 3LR1A 4FECA 2PBWA 5TPAA 5I2KA 3G3GA 4KQPA 4WXJA 3T9VA 4GQOA 1MY3A 2ZMBA 3MJNA 2Q88A 4OVTA 5AA2A 5CMBA 2WYPA 3PUXE 4PAFA 2XWVA 1Y3NA 3PMXA 3R6UA 3V89B 1QVSA 4PF6A 1NUZA 4DZ1A 5KCJB 1LAXA 4PAIA 3CSGA 2M8CA 2ESNA 5H8HB 1B7UA 2XXXA 1CE2A 3PUWE 4PFYA 4QFPA 1KA0A 4KCDA 1NUXA 1B5IA 1FJ9A 4R74A 3T93B 2FBPA 3SEWA 2G93A 3SERA 1ZLQA 1Q1KA 2QSXA 4PFIA 3T22A 2FHYA 2UVGA 4GF8A 1AOVA 2DQVA 1IXCA 2QS2A 2BJIA 4QXDA 3BKIB 5A5XA 2F7AA 1TFAA 3G3FA 3RT8A 5BWJA 3VDFA 3LSXA 2QFLA 3MVWA 4LATA 4KCCA 1M5EA 2PT1A 1MH4A 5EYGA 3QXMA 2W7YA 1B9JA 1ZBMA 1IMBA 4DCYA 1RYOA 4H65A 4XFEA 3OELA 2V93A 1FW0A 4MLVA 2HAUA 3VVEA 2F8DA 3SKPA 1FPDA 2X7QA 4HE0A 4OZ9A 4XKPA 4GWSA 3FV1A 3TMGA 1FPLA 3PPQA 4N6PA 4NG7A 3VVDA 1JEVA 4MNCA 3THIA 2Q8MA 3T66A 2Z8EA 4F3SA 4F2QA 4OQOA 3HV1A 1Y3PA 3RTWB 3FV2A 1FTOA 1MDP1 4X1DA 4RYAA 5A5LA 5AA2D 2F36A 1BKAA 3PMVA 1JVXA 1ZIUA 4PFBA 4AS5A 1PB7A 4R73A 2F6GA 1QUKA 4PFTA 4YB7A 4HE1A 2GHAA 3M3LA 1RYXA 4TLMB 3T1BA 1Y4CA 1MPDA 1TXFA 1EZPA 4ZEBA 2NWJA 3CI8A 1NKXA 4JDFA 1FPGA 4QFKA 1B32A 2Y7PA 1BIYA 2XX9A 3GXAA 3S4UA 4R2FA 2G29A 2QMXA 1B3LA 3PU5A 1WVJA 3SEUA 3K01A 5I84A 4LZ8A 4G8MA 3H6VA 4G61A 4KXPA 1IQ7A 4IY5A 4N81A 4KHZE 5IZ3A 4YU0A 1PC3A 2I4CA 1MXYA 1Y1MA 1B5HA 1DOTA 2Z8FA 4N07A 3MW0A 1QKAA 1N7XA 4R6HA 4GL0A 2OX3A 3USDA 1MQIA 4U4XA 3FVKA 1IXHA 4XKQA 4H8IA 4HS7A 3MZ9A 4PFRA 3TELA 5CBRA 4OMBA 4UACA 2WEFA 4EDPA 1FBFA 4LONB 4ZEDA 1FQCA 3A3UA 3OEKA 4F18A 4RPOA 2OCUA 2QMWA 5I2KB 4JVCA 1JVYA 2V3UA 1HSEA 4I62A 2BJJX 5I58A 5LDZA 2LAOA 4RK9A 1B05A 4DLDA 4XIGQ 4AB6A 2B3FA 4H6DA 4JVIA 5KCJA 1B3GA 4L17A 5ET5A 3CG1A 2KQZA 1JEUA 2Q8JA 5IAIA 1NUWA 1Y3QA 4QSEA 4NF4A 5EHMA 1FBGA 2CMOA 3TTMA 4KFQA 1LBWA 1Y4TA 3OO8A 2HAVA 3DP6A 3IJXB 2PX1A 1BLFA 1Y1ZA 1YPNA 4X1BA 2DVCA 4ZE9A 2RF1A 2ZXTA 1EYJA 2V3TA 5JK4A 1DCUA 1ELJA 4LA9A 2FIEA 3MSTA 3MBPA 3FBPA 1FPBA 4IR8A 3N5LA 1H43A 1OIBA 1D9YA 1LBYA 4I8CA 2B4MA 3CIJA 4NTLA 1LBCA 4EQBA 1VFDA 4YKIA 1TWYA 3UGWA 4YKJA 4O3CA 4ZEKA 5CRYA 3VLVA 2DWJA 1ANFA 4GLIA 1XVYA 4GVOA 1XS5A 5AA4B 3A3CA 5FHNA 4F3PA 1T0KA 1I6BA 2XXTA 4GD5A 5K2XA 1NFTA 1WDNA 3KG2A 4EUOA 3FASA 1B7ZA 2DE2A 3VXCA 4GWYA 4PETA 1O63A 1K9YA 3HN0A 4G77A 4BDQA 3MP6A 2CZHA 4N91A 1LAFE 2XA5A 4H67A 1N3WA 1EZ9A 2GFEA 5FHOA 1MQDA 4G8HA 4ZZEA 1SW4A 2NVUB 1II5A 2Q74A 3SESA 1RKMA 5CMMA 2KLFA 1QGXA 1RDYA 2UXAA 1UIUA 1EU8A 5I5PA 4P11A 3C32A 2H25A 4MMPA 2XXPA 2FYIA 3K1MA 3DLNA 1XHYA 4F31B 1O64A 3MVXA 2XX7A 1Q9DA 2HZLA 3H6WA 1MH3A 3VFJA 4KR5A 2ZYKA 2VGQA 4OA4A 2RCBA 4GBVA 4U1ZA 2B65A 3LSWA 3GZGA 3E9XA 2H99A 3TTLA 1A7LA 3RLFE 5H8SA 2H9BA 1S9TA 1URDA 2NOOA 3EQ1A 5JTYB 1IUDA 1N3XA 2HZKA 3GLBA 3V5AA 3N26A 2Q2CA 3ZKKA 1URSA 2F6PA 3MC2A 4X04A 4ZEIA 1SVXB 3Q29A 2E0SA 1S50A 2R71A 3G7WA 3VVFA 4OVPA 3MP8A 4G8NA 3IJOB 3MPLA 4OFLA 2PYYA 1KA1A 1CNQA 1OQHA 3TZAA 4KD5A 3B6TA 4E0WA 1UTHA 3IO4A 1PB9A 3N6UA 4ISUA 2FNCA 1NV0A 3H03A 3K2DA 2VD3A 4MEVA 2O7UA 1XC1A 3I5OA 1MY0A 5AA1A 1MXXA 2H4IA 1IEJA 1Z7NE 4YAHX 3ISPA 4GOTA 4EXLA 3TTKA 1FSAA 4O7IA 3C33A 3H6UA 4UA8A 1K9ZA 1FQEA 1GR2A 2O6AA 4OFJA 5ET8A 3FXBA 1UTBB 4ESXA 5I56B 1EZOA 3QYTA 2I49A 3IK6B 3IB2A 5TP9A 1B7HA 4YICA 3R26A 1B1HA 4N8YA 2RC9A 4LQ5A 3TCHA 2Z23A 2HXRA 3OOAA 5EQ8A 1I69A 3TTRA 4ZDMA 5CBSA 2HHMA 3ROJA 4FATA 2XXHA 3CRBA 4KYDA 2HPGA 2O84X 5DVJA 5H8QB 5KDTA 3T9XB 3BFTA 4OETA 2O7IA 4WEPA 3AXFA 3IOTA 4PFWA 2WX9A 3EF7A 2IA4A 4ELPA 5I59A 5EQ9A 3V8XB 2E1SA 1IZ1A 5CM6A 4IO4A 4EF1A 4OANA 3QSLA 1ZKBA 3FIRA 3S2VA 2ANJA 3RGYA 2I58A 1FTJA 3PUZE 1FTMA 2ZZWA 5IZ1A 3FATA 4F3GA 5FTIA 3U65A 1D9VA 5M2VA 1DPPA 3PUVE 3TYHA 1VE4A 5I2NB 1FPEA 1JW5A 2VPOA 2OWSA 2FIXA 4YKPA 4OYVA 2PFYA 1SYHA 4G4PA 4GRKA 1P1WA 5DTBA 2QRYA 1A40A 2GQ1A 1B6HA 1MM6A 2XD2A 1NV1A 1P1NA 2OJTA 1N76A 5FBPA 1NI9A 4AS4A 1URGA 1BK4A 5H8FA 2QS3A 2XXQA 2VT5A 2P1SA 5L9MA 2PVUA 1A8FA 3PPPA 4BDRA 2RKMA 1NV4A 3FZVA 4FBPA 1B5JA 4PC9A 1WODA 3BIGA 4JWYA 3IR1A 1QJMA 5ITPA 2DDKA 1Q35A 1F9BA 4UABA 4FIMA 4NN3A 4PQJA 4KYEA 1MQGA 1LFIA 1B40A 1QW0A 1XI6A 2XWOA 3MUQA 2I6EA 4GWXA 4GL8A 2F7CA 4P9KA 3JV9A 4JWXA 2F35A 4XF5A 4RPNA 1AL3A 4H5GA 1SYIA 1KWHA 4F39A 4YZZA 3RUMA 1M5CA 4U4SA 4OVQA 3FGSA 4BDOA 1MQHA 1IMAA 4MFIA 1JETA 3O9PA 4EF2A 3E4RA 1UTHB 3UIFA 3A29A 3ILTB 3LUZA 3WAEA 1LB8A 4HXVA 2PMSA 1GV8A 3TFLA 2WKYA 3U8QA 1H44A 2XXKA 2D3IA 2NXOA 4H45A 4U23A 1S7YA 1B3FA 3G3JA 2CZKA 1SD3A 3ZSFA 1YXIA 4HTGA 2Y7WA 1MPCA 2DE3A 4G68A 3IFAA 3OO6A 3U92A 4PCDA 4U1OA 3V83A 3SEVA 2OWZA 2CEYA 2QVVA 1QUIA 1NNKA 3K00A 3IB0A 1ZTYA 4DXCA 5I7IA 4FORA 1EH3A 3E78A 4ONYA 2Q2AA 5I56A 2NUVA 3O66A 4MX6A 1US4A 3S9MC 3TCGA 4EXKA 4NF5A 5I57A 4JVDA 1M5DA 4Z7EA 3B50A 2VHAA 4H1XA 3RPLA 1B0LA 3O97A 3TAJA 1AIVA 5IZZA 3CFLA 4P1EA 3PD8A 5J16A 3ZKLA 1SDXA 4BDMA 2ZZVA 3B7DA 4FEBA 2OBGA 4KYSA 4OEUA 1FRPA 4IO6A 4R9GA 3DM0A 3WAFA 4NE4A 5AA2B 3K1NA 1MXUA 1QUJA 2CEXA 1P1UA 3IOWA 4QHQA 1TFDA 2JJKA 1ZMGA 4IB2A 3Q26A 4QF9A 2ZYMA 1IXIA 4NQ8A 4OESA 3HPIA 4M4GA 5L8DA 3TEPA 1SI1A 3C34A 1NV6A 3OD7A 4H0WA 1FTKA 1INPA 4ZZAA 3G3HA 3ODBA 4PGPA 5B70A 2RC8A 2UYFA 3IB1A 4RY1A 4F29A 1IMCA 1Y20A 4NF8B 1D3KA 1MDQA 3LC8A 3CHGA 4ND9A 4ZE8A 4N13A 1BP5A 4F22A 3VLUA 1B58A 4HW8A 4NWCA 4I1DA 2XXUA 3M3KA 4QFLA 3OO9A 4F3BA 4N15A 3TUSA 1H3DA 4I9DA 3F11A 2P3NA 3EN3A 1LSTA 3HFUA 4YMBA 3QAXA 1OLAA 3PPNA 2P0SA 1Y9UA 2B4LA 2OK2A 1BTJA 4RJZA 3C4MA 2O69A 4P0IA 4X8RA 2Z22A 1VSOA 2O1MA 1SQYA 5DW8A 3FXQA 2D21A 2RINA 4M1VA 3FJGA 1MXVA 3O6GA 4R2BA 3KBRA 3FXUA 2F34A 2YJPA 4PAKA 4JBZA 2ALUA 1USYE 3RN8A 2VD2A 4U21A 1SI0A 1UQWA 1VR5A 3IOVA 1LBBA 4DCXA 2XX8A 5LTCA 3QUFA 4TQUQ 3RY3A 3SEXA 2XXIA 2CZIA 3FXRA 3S9EA 1A99A 2HFBA 1IMFA 2AYSA 4DE8A 1SW2A 3M8UA 3W15C 3IX1A 3EHUA 4THIA 5DEXA 4PE5B 1FPFA 4IY6A 5EHSA 2R6GE 5K2YA 2XWIA 4QFOA 3D4CA 4XKNA 4LZ5A 2ABHA 2QL3A 2GRVA 4R72A 5EQ7A 2CZLA 3LUYA 2ZZXA 1DPEA 3JYRA 5DT6A 2YLNA 2QPQA 1D4NA 4DXUA 1B4HA 4R6KA 1IMDA 2R9JA 3T9UA 4NF0A 1LAGE 1RDZA 3QK6A 3HCQA 2Y5KA 1FQBA 4NAPA 5AA4A 2XXWA 3K4UA 3R7XA 3UA8A 3KBZA 4XTCQ 1NUYA 4GX4A 4GIZA 1DBZA 2P3VA 1J1NA 4NGUA 5H8NA 3ZS6A 4I3EA 4EQ9A 1DMBA 2RCAA 3TODA 5H8HA 1OLCA 2WYKA 1YCJA 3UP9A 4ELOA 3S9NC 4XEQA 1LLSA 1B3HA 2Y7IA 4RK2A 5ICTA 4NX1A 4IGTA 5EYHA 4IGRA 5DVFA 3U93A 2AIXA 5KZTA 1NH7A 1GTKA 1EYKA 4O3BA 4P8BA 2Q89A 3D4GA 3BFUA 1A8EA 4P1LA 5FTHA 1A55A 1N04A 2QS4A 4LN5A 4PP0A 2F97A 1FBHA 3HO7A 4FAJA 3I6VA 2VPNA 2DXYA 5I58B 4H8JA 5CMCA 3RTFB 4TLLB 2QVUA 4XKRA 1OQGA 4MHFA 4JB7A 3W9VA 3IAZA 4LQ2A 1FPIA 3HHGA 2REGA 1R9QA 1FBPA 1R6ZA 3EHTA 4BLAA 1ZU0A 1L5TA 3TDJA 1LCFA 2I3WA 3FJMA 1USYH 4QSCA 4NF8A 4NEDA 3TTNA 4PE3A 4DIGA 4MAGA 3KSXA 4KPTA 2QJEA 2I0BA 1HSLA 1P1QA 3CFZA 3I3VA 3DP4A 2R8TA 1POTA 3OSRA 3GBAA 1XOCA 4WKMA 1FBEA 2XD3A 5L9OA 3KN3A 5AA3A 3QMFA 1NNFA 4DI4B 2DOJA 1SBPA 4JSOA 4N8GA 1QKBA 2I4BA 3K6VA 4PDHA 4BDLA 3U94A 2F7BA 2HXWA 4GWUA 1GVCA 4ELQA 1XVXA 1MG1A 5F24A 1PBPA 2X26A 4HE2A 2GH9A 3KFMA 2WBBA 3RNNA 3H06B 2OLBA 4N17A 4ELRA 3RYDA 3Q25A 5DYHA 1NV5A 3LBSA 3D1RA 2PCRA 2YPNA 1US5A 2F78A 2DS9A 3K02A 3UN6A 2XXRA 2A5TB 3DP8A 4E0XA 4GBWA 4Q30B 4MCOA 4NF6A 4XXUA 1EYIA 1N7WA 2OZZA 4IO7A 1XT8A 5CMKA 3MWBA 5IM2A 1FBDA 3IFCA 4H5FA 3TCFA 4YB5A 3M3FA 4QBAA 4R75A 3S9LC 3G3IA 3MZBA 4RXLA 3L6HA 4RNSA 4P0GA 3KC1A 5TPAB 3H7MA 3OO7A 2DSFA 2QS1A 1PEBA 5H8QA 2I48A 5A5XB 2XHDA 5HPQA 5KDTB 4GX3A 3GYYA 3RT6B 3KN7A 4U22A 4LZ7A 3TPAA 2HCAA 1O7TA 4YB6A 1I6AA 1YYZA 4QFNA 3IOUA 5JTYA 2P2AA 1B1XA 1MXZA 1OVTA 1LBVA 4N6DA 2FVZA 4C0RA 4LUBA 5EQAA 1KZ8A 3SEYA 2DWAA 4GWZA 1MM7A 3VV5A 4MIJA 2ONSA 1MRPA 1OMPA 3KOSA 4ZECA 2REJA 3NOHA 4N4UA 1B52A 4IO3A 5LOMA 2Y7KA 5ET6A 3OENA 1IIWA 1IITA 1B2HA 4ESWA 3ONMA 4NF4B 4Q0CA 5HM4B 3MP1A 5ISUA 3C36A 1AMFA 2QVRA 3JZJA 1NV3A 5CC2A 3PMWA 3UK4A 3C35A 1FTAA 1PB8A 3SZPA 4OFOA 4AB5A 2VP1A 3FJ7A 4K3FA 3H6TA 4IO2A 2DWIA 2OWTA 4LVQA 3VLWA 1ZJLA 1MPBA 1Z7ME 2VOZA 1LCTA 1MY2A 3KSJA 1GGGA 4FE8A 3KJTA 4POXA 1N84A 3T0JA 4ZS9A 1IXGA 1UTBA 2AL4A 2L5VA 2WBDA 4GX6A 1M5BA 4WEDA 3MZ1A 1IMEA 1RDXA 2B3BA 1NL5A 4F19A 4AQ4A 3ECRA 3PUYE 4F1VA 3P7IA 4GWWA 4DDDA 4OEVA 3KZGA 4BDNA 3E13X 5ITOA 2F3DA 1FPKA 2HQ0A 5ELVA 3VXBA 3MYUA 4R6YA 5F1QA 3K6UA 4ZEFA 4P56A 4NHBA 3OEMA 3T96B 3FVGA 5I59B 3MPKA 3H4ZA 1NV2A 3LSFB 1POY1 1NMUA 1G0HA 4OTEA 1LFGA 3QIMA 1AH5A 2RC7A 2ZNTA 3O6IA 1JP4A 3KJ7A 5TU0A 4F1YA 4F2OA 3LSLA 3PTYA 3U72A 1HSJA 4MNIA 2UYEA 2ZYOA 1VFEA 3PPRA 4TOZA 4NWDA 1LB9A 2Q9TA 1PBQA 3FUZA 2O68A 2THIA 1FTLA 3L6GA 2IEEA 2O1LA 2UVHA 5CI5A 1UIVA 3KN8A 5J1DA 4R9FA 3OXNA 3FVOA 1LBXA
chains in the Genus database with same CATH topology
2CZKA 1FBCA 5FBPA 1FPIA 2BJIA 4PF8A 1NI9A 5IM2A 1LEVA 5ET7A 4QXDA 1FBDA 3IFCA 1FBPA 4AS4A 1YXIA 3W9WA 1BK4A 5IZ3B 2DE3A 3IFAA 4YICA 4HCYA 4QBAA 1Q9DA 2HZLA 2QFLA 4N8YA 4F19A 1YZ0A 2DVZA 2VT5A 3T0JA 4PCDA 1FPJA 5EQ7A 4PBQA 1EYJA 2HXRA 3KC1A 4N15A 4OA4A 2OWZA 5T3JA 4GBVA 5JK4A 2L5VA 2CEYA 1DCUA 2P3NA 2QVVA 2ZZXA 2WBDA 4GX6A 5EQ8A 5IGAA 4G61A 4F1UA 4KXPA 5EYGA 2FIEA 4PE3A 5I7IA 4MAGA 3RPLB 1IMEA 4N81A 1RDXA 1DK4A 1SPIA 2HHMA 3MSTA 1AWBA 3E78A 3HFUA 1IMBA 3FBPA 4GX3A 4OVRA 5IZ3A 1FPBA 3GYYA 4PTKA 2QPQA 1G0IA 4IR8A 4PBHA 4MX6A 1NV4A 1LBYA 2HZKA 3KC0A 2B4LA 2B4MA 4FBPA 1IMDA 4MNPA 4XFEA 4O8MA 2HPGA 4PC9A 3BIGA 4JVDA 4F1VA 3B50A 4NF0A 1FPDA 2R8TA 1RDZA 1YYZA 4HE0A 4I40A 4X8RA 3RPLA 4GWSA 2Y5KA 1LBZA 3EKIA 4X04A 4PDDA 4NAPA 1FPLA 2OX3A 4GWWA 4NG7A 5A5LA 5IZZA 2DDKA 2Y5LA 4MNCA 3KBZA 1NUYA 2WX9A 2F3DA 1FPKA 4GX4A 4P1EA 2Q8MA 1FBEA 4UABA 1FJ6A 4PGNA 5J16A 4MJOA 4N6DA 1LBVA 1DBZA 2FVZA 2P3VA 4NN3A 4OVPA 4PFRA 4X9TA 3QMFA 5EQ9A 4OVTA 5EQAA 1KZ8A 2XWKA 4NGUA 2WYPA 5DW8A 4DI4B 4GWZA 5CM6A 4OVSA 3LV0A 2WEFA 4I3EA 4PAFA 1FBFA 3MYUA 4OANA 4MIJA 1XI6A 1KA1A 2XWOA 2ZZVA 2XWVA 2MKZA 4GWXA 4HCWA 4N8GA 4P56A 2WYKA 1NV7A 1FRPA 2F3BA 1CNQA 4H46A 4I3YA 4M1VA 4NHBA 1NUZA 4PDHA 4P9KA 4XEQA 4GWUA 4NX1A 2DE2A 1NV2A 4PAIA 3NOHA 5EYHA 4PFBA 4XF5A 4JVCA 5F24A 5I3SA 4N4UA 4PAKA 1G0HA 4HE2A 4AS5A 2V4CA 2ZZWA 1EYKA 2CEXA 4P8BA 4DI3D 5IZ1A 4GWYA 4PETA 1D9QA 2JJKA 4HE1A 4P47A 2WBBA 1JP4A 1K9YA 3B8BA 2PFZA 4NQ8A 3U65A 4YZZA 5ET6A 1NV0A 4N17A 3T1BA 5LTCA 3PTYA 4O7MA 4P1LA 5LDZA 4MEVA 2CZHA 3RYDA 4N91A 2XA5A 1KA0A 4MNIA 1FPEA 1NV6A 4OVQA 5ESYA 3BIHA 2VPOA 4LN5A 1NV5A 1INPA 1VDWA 2CZIA 2F5XA 1IMAA 3D1RA 1FBHA 1NUXA 1FPGA 2PCRA 2FIXA 1FJ9A 2VPNA 4JVIA 2QVRA 1NV3A 2Q9TA 3ROJA 5ET5A 2FBPA 2KQZA 1IMFA 1FTAA 2PFYA 4PGPA 3A29A 2DE4A 3ISPA 3LUZA 3SZPA 1NUWA 2Q74A 4GBWA 4HXVA 2QVUA 4PF6A 1FSAA 2V3QA 4O7IA 1IMCA 4PFIA 1QGXA 5J1DA 2FHYA 1RDYA 2GQ1A 1FBGA 1FPFA 2KR0A 4MCOA 4MHFA 1K9ZA 3CHGA 3W9VA 4F18A 2XXKA 3E79A 5ET8A 1EYIA 1NV1A 3FXBA 4H45A 4P3LA 2XWIA 4N6KA 5I5PA 4O94A 1LBWA 4MMPA 1LBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PF8 A;  5IM2 A;  4YIC A;  2HZL A;  4N8Y A;  4PCD A;  4PBQ A;  4N15 A;  4OA4 A;  2ZZX A;  2CEY A;  5IGA A;  4PE3 A;  5I7I A;  4MAG A;  4OVR A;  3GYY A;  4PBH A;  4MX6 A;  2HZK A;  4MNP A;  4XFE A;  4O8M A;  2HPG A;  4PC9 A;  3B50 A;  4NF0 A;  4X8R A;  4X04 A;  4PDD A;  4NAP A;  4NG7 A;  5IZZ A;  4MNC A;  2WX9 A;  4P1E A;  4UAB A;  4PGN A;  4N6D A;  4NN3 A;  4OVP A;  4PFR A;  4OVT A;  2XWK A;  4NGU A;  2WYP A;  4DI4 B;  5CM6 A;  4OVS A;  4PAF A;  4OAN A;  4MIJ A;  2XWO A;  2ZZV A;  2XWV A;  4N8G A;  4P56 A;  2WYK A;  4NHB A;  4PF6 A;  4PDH A;  4P9K A;  4XEQ A;  4NX1 A;  4PAI A;  4PFB A;  4XF5 A;  4N4U A;  4PAK A;  2V4C A;  2ZZW A;  2CEX A;  4P8B A;  4DI3 D;  4PET A;  4P47 A;  2PFZ A;  4NQ8 A;  3U65 A;  4YZZ A;  4N17 A;  5LTC A;  4O7M A;  4P1L A;  4MEV A;  4N91 A;  2XA5 A;  4MNI A;  4OVQ A;  2VPO A;  4LN5 A;  2VPN A;  2PFY A;  4PGP A;  4PFI A;  4MCO A;  4MHF A;  2XXK A;  4P3L A;  3FXB A;  5I5P A;  2XWI A;  4N6K A;  4O94 A;  4MMP A; 
#chains in the Genus database with same CATH topology
 1FBC A;  5ET7 A;  1OVB A;  4JXI A;  1NNP A;  2X7P A;  4Q8R A;  1MS7 A;  2A5T A;  3OMB A;  5JEI A;  4OVJ A;  1FPJ A;  1NH8 A;  1YAE A;  4C1U A;  3RPL B;  2HEU A;  3B6W A;  2I3V A;  4X48 A;  2Y7R A;  3HHF A;  4JWO A;  1JW4 A;  3IOR A;  1I6Q A;  4PDD A;  3A09 A;  3TKD A;  2Y5L A;  4G68 C;  4MJO A;  4X9T A;  2UVI A;  3LV0 A;  3CFX A;  5DVI A;  4QRZ A;  2F3B A;  5I3S A;  5ICQ A;  3K0V A;  5FHM A;  4GXA A;  1A54 A;  3CVG A;  3G3K A;  1D9Q A;  2PFZ A;  1SW5 A;  4G2Z A;  5BUU A;  4O7M A;  1NNT A;  3BIH A;  5AE4 A;  3BBR A;  2V84 A;  1FCK A;  2DE4 A;  1DTZ A;  2GHB A;  1JQF A;  1LGB C;  4JSD A;  3SET A;  3O29 A;  1YTV A;  3KOT A;  3PV0 E;  3E79 A;  4P3L A;  4PF8 A;  1B0H A;  4YKK A;  3IO6 A;  3E3K A;  2XXV A;  3W9W A;  2ONK E;  3GBB A;  3KGC A;  1M5F A;  1FQA A;  2DYX A;  5IGA A;  1N0T A;  4MLQ A;  4OHN A;  5IKB A;  3K1P A;  1DK4 A;  1AWB A;  2DP8 A;  2O51 A;  3TQW A;  1G0I A;  2ZNU A;  3FD3 A;  1MQJ A;  4OXV A;  4MNP A;  1LAH E;  3IL1 B;  5HBC A;  3B6Q A;  3RPW A;  3EKI A;  1B4Z A;  3EHS A;  3O28 A;  4GFR A;  1FJ6 A;  3DEL B;  4PGN A;  3FVN A;  4MF3 A;  2XWK A;  4U2R A;  4OVS A;  1NV7 A;  4H46 A;  2ZYN A;  5B7D A;  1H45 A;  1B51 A;  2V4C A;  4DI3 D;  4DXB A;  1B3E A;  3VE1 B;  1PDA A;  2D5W A;  2ZNS A;  2V25 A;  5ESY A;  5F7V A;  4Q5T A;  4EQ7 A;  1P99 A;  3U1O A;  4PFU A;  3MQ9 A;  3KEI A;  3UOR A;  3CG3 A;  2V3Q A;  5H8F B;  4MH5 A;  1FQF A;  4N6K A;  4O94 A;  4YMA A;  4OEN A;  1TT1 A;  4MBP A;  1H76 A;  1FQD A;  4HCY A;  4Z0I A;  1CB6 A;  3EPE A;  1YZ0 A;  3O2A A;  3ILU B;  4FJP A;  4QSD A;  3PGF A;  3K6X A;  4O3A A;  2DWH A;  5TP9 B;  1SPI A;  3Q27 A;  5EYF A;  4OVR A;  4IO5 A;  4POW A;  4PBH A;  3RQT A;  3OSQ A;  3KC0 A;  4NMY A;  2ONR A;  4O8M A;  2Y84 A;  3H3G A;  5L9S A;  1DTG A;  3T9H B;  5H8N B;  4I40 A;  1LBZ A;  1QUL A;  4C1T A;  3Q28 A;  1JW1 A;  2A5S A;  3MVZ A;  3C9H A;  3O6H A;  2I0C A;  1P1O A;  1ATG A;  2MKZ A;  3CSB A;  3PD9 A;  4HCW A;  1MY1 A;  4I3Y A;  2H98 A;  3PPO A;  4GXS B;  3N6T A;  1JNF A;  3CR9 A;  4GWO A;  4RA1 A;  2Z8D A;  4P47 A;  3B8B A;  3MAM A;  1MXW A;  3SDF A;  4FED A;  1SW1 A;  1MY4 A;  1VDW A;  2F5X A;  3MVY A;  2UVJ A;  1R9L A;  2XXY A;  5I2N A;  3HST A;  1R1N A;  3K6W A;  2PT2 A;  4G68 B;  1LFH A;  2KR0 A;  2H5Y A;  1DSN A;  5IZ3 B;  1LEV A;  2AL5 A;  2DXR A;  4OWD A;  5DEX B;  2DVZ A;  1B46 A;  4PBQ A;  4ECF A;  3N94 A;  5T3J A;  3C31 A;  4NF5 B;  5I57 B;  4F1U A;  4OER A;  4NF6 B;  3QUJ A;  4PTK A;  4LP2 B;  2FA7 A;  3TQL A;  4KI0 E;  3LR1 A;  4FEC A;  2PBW A;  5TPA A;  5I2K A;  3G3G A;  4KQP A;  4WXJ A;  3T9V A;  4GQO A;  1MY3 A;  2ZMB A;  3MJN A;  2Q88 A;  4OVT A;  5AA2 A;  5CMB A;  2WYP A;  3PUX E;  4PAF A;  2XWV A;  1Y3N A;  3PMX A;  3R6U A;  3V89 B;  1QVS A;  4PF6 A;  1NUZ A;  4DZ1 A;  5KCJ B;  1LAX A;  4PAI A;  3CSG A;  2M8C A;  2ESN A;  5H8H B;  1B7U A;  2XXX A;  1CE2 A;  3PUW E;  4PFY A;  4QFP A;  1KA0 A;  4KCD A;  1NUX A;  1B5I A;  1FJ9 A;  4R74 A;  3T93 B;  2FBP A;  3SEW A;  2G93 A;  3SER A;  1ZLQ A;  1Q1K A;  2QSX A;  4PFI A;  3T22 A;  2FHY A;  2UVG A;  4GF8 A;  1AOV A;  2DQV A;  1IXC A;  2QS2 A;  2BJI A;  4QXD A;  3BKI B;  5A5X A;  2F7A A;  1TFA A;  3G3F A;  3RT8 A;  5BWJ A;  3VDF A;  3LSX A;  2QFL A;  3MVW A;  4LAT A;  4KCC A;  1M5E A;  2PT1 A;  1MH4 A;  5EYG A;  3QXM A;  2W7Y A;  1B9J A;  1ZBM A;  1IMB A;  4DCY A;  1RYO A;  4H65 A;  4XFE A;  3OEL A;  2V93 A;  1FW0 A;  4MLV A;  2HAU A;  3VVE A;  2F8D A;  3SKP A;  1FPD A;  2X7Q A;  4HE0 A;  4OZ9 A;  4XKP A;  4GWS A;  3FV1 A;  3TMG A;  1FPL A;  3PPQ A;  4N6P A;  4NG7 A;  3VVD A;  1JEV A;  4MNC A;  3THI A;  2Q8M A;  3T66 A;  2Z8E A;  4F3S A;  4F2Q A;  4OQO A;  3HV1 A;  1Y3P A;  3RTW B;  3FV2 A;  1FTO A;  1MDP 1;  4X1D A;  4RYA A;  5A5L A;  5AA2 D;  2F36 A;  1BKA A;  3PMV A;  1JVX A;  1ZIU A;  4PFB A;  4AS5 A;  1PB7 A;  4R73 A;  2F6G A;  1QUK A;  4PFT A;  4YB7 A;  4HE1 A;  2GHA A;  3M3L A;  1RYX A;  4TLM B;  3T1B A;  1Y4C A;  1MPD A;  1TXF A;  1EZP A;  4ZEB A;  2NWJ A;  3CI8 A;  1NKX A;  4JDF A;  1FPG A;  4QFK A;  1B32 A;  2Y7P A;  1BIY A;  2XX9 A;  3GXA A;  3S4U A;  4R2F A;  2G29 A;  2QMX A;  1B3L A;  3PU5 A;  1WVJ A;  3SEU A;  3K01 A;  5I84 A;  4LZ8 A;  4G8M A;  3H6V A;  4G61 A;  4KXP A;  1IQ7 A;  4IY5 A;  4N81 A;  4KHZ E;  5IZ3 A;  4YU0 A;  1PC3 A;  2I4C A;  1MXY A;  1Y1M A;  1B5H A;  1DOT A;  2Z8F A;  4N07 A;  3MW0 A;  1QKA A;  1N7X A;  4R6H A;  4GL0 A;  2OX3 A;  3USD A;  1MQI A;  4U4X A;  3FVK A;  1IXH A;  4XKQ A;  4H8I A;  4HS7 A;  3MZ9 A;  4PFR A;  3TEL A;  5CBR A;  4OMB A;  4UAC A;  2WEF A;  4EDP A;  1FBF A;  4LON B;  4ZED A;  1FQC A;  3A3U A;  3OEK A;  4F18 A;  4RPO A;  2OCU A;  2QMW A;  5I2K B;  4JVC A;  1JVY A;  2V3U A;  1HSE A;  4I62 A;  2BJJ X;  5I58 A;  5LDZ A;  2LAO A;  4RK9 A;  1B05 A;  4DLD A;  4XIG Q;  4AB6 A;  2B3F A;  4H6D A;  4JVI A;  5KCJ A;  1B3G A;  4L17 A;  5ET5 A;  3CG1 A;  2KQZ A;  1JEU A;  2Q8J A;  5IAI A;  1NUW A;  1Y3Q A;  4QSE A;  4NF4 A;  5EHM A;  1FBG A;  2CMO A;  3TTM A;  4KFQ A;  1LBW A;  1Y4T A;  3OO8 A;  2HAV A;  3DP6 A;  3IJX B;  2PX1 A;  1BLF A;  1Y1Z A;  1YPN A;  4X1B A;  2DVC A;  4ZE9 A;  2RF1 A;  2ZXT A;  1EYJ A;  2V3T A;  5JK4 A;  1DCU A;  1ELJ A;  4LA9 A;  2FIE A;  3MST A;  3MBP A;  3FBP A;  1FPB A;  4IR8 A;  3N5L A;  1H43 A;  1OIB A;  1D9Y A;  1LBY A;  4I8C A;  2B4M A;  3CIJ A;  4NTL A;  1LBC A;  4EQB A;  1VFD A;  4YKI A;  1TWY A;  3UGW A;  4YKJ A;  4O3C A;  4ZEK A;  5CRY A;  3VLV A;  2DWJ A;  1ANF A;  4GLI A;  1XVY A;  4GVO A;  1XS5 A;  5AA4 B;  3A3C A;  5FHN A;  4F3P A;  1T0K A;  1I6B A;  2XXT A;  4GD5 A;  5K2X A;  1NFT A;  1WDN A;  3KG2 A;  4EUO A;  3FAS A;  1B7Z A;  2DE2 A;  3VXC A;  4GWY A;  4PET A;  1O63 A;  1K9Y A;  3HN0 A;  4G77 A;  4BDQ A;  3MP6 A;  2CZH A;  4N91 A;  1LAF E;  2XA5 A;  4H67 A;  1N3W A;  1EZ9 A;  2GFE A;  5FHO A;  1MQD A;  4G8H A;  4ZZE A;  1SW4 A;  2NVU B;  1II5 A;  2Q74 A;  3SES A;  1RKM A;  5CMM A;  2KLF A;  1QGX A;  1RDY A;  2UXA A;  1UIU A;  1EU8 A;  5I5P A;  4P11 A;  3C32 A;  2H25 A;  4MMP A;  2XXP A;  2FYI A;  3K1M A;  3DLN A;  1XHY A;  4F31 B;  1O64 A;  3MVX A;  2XX7 A;  1Q9D A;  2HZL A;  3H6W A;  1MH3 A;  3VFJ A;  4KR5 A;  2ZYK A;  2VGQ A;  4OA4 A;  2RCB A;  4GBV A;  4U1Z A;  2B65 A;  3LSW A;  3GZG A;  3E9X A;  2H99 A;  3TTL A;  1A7L A;  3RLF E;  5H8S A;  2H9B A;  1S9T A;  1URD A;  2NOO A;  3EQ1 A;  5JTY B;  1IUD A;  1N3X A;  2HZK A;  3GLB A;  3V5A A;  3N26 A;  2Q2C A;  3ZKK A;  1URS A;  2F6P A;  3MC2 A;  4X04 A;  4ZEI A;  1SVX B;  3Q29 A;  2E0S A;  1S50 A;  2R71 A;  3G7W A;  3VVF A;  4OVP A;  3MP8 A;  4G8N A;  3IJO B;  3MPL A;  4OFL A;  2PYY A;  1KA1 A;  1CNQ A;  1OQH A;  3TZA A;  4KD5 A;  3B6T A;  4E0W A;  1UTH A;  3IO4 A;  1PB9 A;  3N6U A;  4ISU A;  2FNC A;  1NV0 A;  3H03 A;  3K2D A;  2VD3 A;  4MEV A;  2O7U A;  1XC1 A;  3I5O A;  1MY0 A;  5AA1 A;  1MXX A;  2H4I A;  1IEJ A;  1Z7N E;  4YAH X;  3ISP A;  4GOT A;  4EXL A;  3TTK A;  1FSA A;  4O7I A;  3C33 A;  3H6U A;  4UA8 A;  1K9Z A;  1FQE A;  1GR2 A;  2O6A A;  4OFJ A;  5ET8 A;  3FXB A;  1UTB B;  4ESX A;  5I56 B;  1EZO A;  3QYT A;  2I49 A;  3IK6 B;  3IB2 A;  5TP9 A;  1B7H A;  4YIC A;  3R26 A;  1B1H A;  4N8Y A;  2RC9 A;  4LQ5 A;  3TCH A;  2Z23 A;  2HXR A;  3OOA A;  5EQ8 A;  1I69 A;  3TTR A;  4ZDM A;  5CBS A;  2HHM A;  3ROJ A;  4FAT A;  2XXH A;  3CRB A;  4KYD A;  2HPG A;  2O84 X;  5DVJ A;  5H8Q B;  5KDT A;  3T9X B;  3BFT A;  4OET A;  2O7I A;  4WEP A;  3AXF A;  3IOT A;  4PFW A;  2WX9 A;  3EF7 A;  2IA4 A;  4ELP A;  5I59 A;  5EQ9 A;  3V8X B;  2E1S A;  1IZ1 A;  5CM6 A;  4IO4 A;  4EF1 A;  4OAN A;  3QSL A;  1ZKB A;  3FIR A;  3S2V A;  2ANJ A;  3RGY A;  2I58 A;  1FTJ A;  3PUZ E;  1FTM A;  2ZZW A;  5IZ1 A;  3FAT A;  4F3G A;  5FTI A;  3U65 A;  1D9V A;  5M2V A;  1DPP A;  3PUV E;  3TYH A;  1VE4 A;  5I2N B;  1FPE A;  1JW5 A;  2VPO A;  2OWS A;  2FIX A;  4YKP A;  4OYV A;  2PFY A;  1SYH A;  4G4P A;  4GRK A;  1P1W A;  5DTB A;  2QRY A;  1A40 A;  2GQ1 A;  1B6H A;  1MM6 A;  2XD2 A;  1NV1 A;  1P1N A;  2OJT A;  1N76 A;  5FBP A;  1NI9 A;  4AS4 A;  1URG A;  1BK4 A;  5H8F A;  2QS3 A;  2XXQ A;  2VT5 A;  2P1S A;  5L9M A;  2PVU A;  1A8F A;  3PPP A;  4BDR A;  2RKM A;  1NV4 A;  3FZV A;  4FBP A;  1B5J A;  4PC9 A;  1WOD A;  3BIG A;  4JWY A;  3IR1 A;  1QJM A;  5ITP A;  2DDK A;  1Q35 A;  1F9B A;  4UAB A;  4FIM A;  4NN3 A;  4PQJ A;  4KYE A;  1MQG A;  1LFI A;  1B40 A;  1QW0 A;  1XI6 A;  2XWO A;  3MUQ A;  2I6E A;  4GWX A;  4GL8 A;  2F7C A;  4P9K A;  3JV9 A;  4JWX A;  2F35 A;  4XF5 A;  4RPN A;  1AL3 A;  4H5G A;  1SYI A;  1KWH A;  4F39 A;  4YZZ A;  3RUM A;  1M5C A;  4U4S A;  4OVQ A;  3FGS A;  4BDO A;  1MQH A;  1IMA A;  4MFI A;  1JET A;  3O9P A;  4EF2 A;  3E4R A;  1UTH B;  3UIF A;  3A29 A;  3ILT B;  3LUZ A;  3WAE A;  1LB8 A;  4HXV A;  2PMS A;  1GV8 A;  3TFL A;  2WKY A;  3U8Q A;  1H44 A;  2XXK A;  2D3I A;  2NXO A;  4H45 A;  4U23 A;  1S7Y A;  1B3F A;  3G3J A;  2CZK A;  1SD3 A;  3ZSF A;  1YXI A;  4HTG A;  2Y7W A;  1MPC A;  2DE3 A;  4G68 A;  3IFA A;  3OO6 A;  3U92 A;  4PCD A;  4U1O A;  3V83 A;  3SEV A;  2OWZ A;  2CEY A;  2QVV A;  1QUI A;  1NNK A;  3K00 A;  3IB0 A;  1ZTY A;  4DXC A;  5I7I A;  4FOR A;  1EH3 A;  3E78 A;  4ONY A;  2Q2A A;  5I56 A;  2NUV A;  3O66 A;  4MX6 A;  1US4 A;  3S9M C;  3TCG A;  4EXK A;  4NF5 A;  5I57 A;  4JVD A;  1M5D A;  4Z7E A;  3B50 A;  2VHA A;  4H1X A;  3RPL A;  1B0L A;  3O97 A;  3TAJ A;  1AIV A;  5IZZ A;  3CFL A;  4P1E A;  3PD8 A;  5J16 A;  3ZKL A;  1SDX A;  4BDM A;  2ZZV A;  3B7D A;  4FEB A;  2OBG A;  4KYS A;  4OEU A;  1FRP A;  4IO6 A;  4R9G A;  3DM0 A;  3WAF A;  4NE4 A;  5AA2 B;  3K1N A;  1MXU A;  1QUJ A;  2CEX A;  1P1U A;  3IOW A;  4QHQ A;  1TFD A;  2JJK A;  1ZMG A;  4IB2 A;  3Q26 A;  4QF9 A;  2ZYM A;  1IXI A;  4NQ8 A;  4OES A;  3HPI A;  4M4G A;  5L8D A;  3TEP A;  1SI1 A;  3C34 A;  1NV6 A;  3OD7 A;  4H0W A;  1FTK A;  1INP A;  4ZZA A;  3G3H A;  3ODB A;  4PGP A;  5B70 A;  2RC8 A;  2UYF A;  3IB1 A;  4RY1 A;  4F29 A;  1IMC A;  1Y20 A;  4NF8 B;  1D3K A;  1MDQ A;  3LC8 A;  3CHG A;  4ND9 A;  4ZE8 A;  4N13 A;  1BP5 A;  4F22 A;  3VLU A;  1B58 A;  4HW8 A;  4NWC A;  4I1D A;  2XXU A;  3M3K A;  4QFL A;  3OO9 A;  4F3B A;  4N15 A;  3TUS A;  1H3D A;  4I9D A;  3F11 A;  2P3N A;  3EN3 A;  1LST A;  3HFU A;  4YMB A;  3QAX A;  1OLA A;  3PPN A;  2P0S A;  1Y9U A;  2B4L A;  2OK2 A;  1BTJ A;  4RJZ A;  3C4M A;  2O69 A;  4P0I A;  4X8R A;  2Z22 A;  1VSO A;  2O1M A;  1SQY A;  5DW8 A;  3FXQ A;  2D21 A;  2RIN A;  4M1V A;  3FJG A;  1MXV A;  3O6G A;  4R2B A;  3KBR A;  3FXU A;  2F34 A;  2YJP A;  4PAK A;  4JBZ A;  2ALU A;  1USY E;  3RN8 A;  2VD2 A;  4U21 A;  1SI0 A;  1UQW A;  1VR5 A;  3IOV A;  1LBB A;  4DCX A;  2XX8 A;  5LTC A;  3QUF A;  4TQU Q;  3RY3 A;  3SEX A;  2XXI A;  2CZI A;  3FXR A;  3S9E A;  1A99 A;  2HFB A;  1IMF A;  2AYS A;  4DE8 A;  1SW2 A;  3M8U A;  3W15 C;  3IX1 A;  3EHU A;  4THI A;  5DEX A;  4PE5 B;  1FPF A;  4IY6 A;  5EHS A;  2R6G E;  5K2Y A;  2XWI A;  4QFO A;  3D4C A;  4XKN A;  4LZ5 A;  2ABH A;  2QL3 A;  2GRV A;  4R72 A;  5EQ7 A;  2CZL A;  3LUY A;  2ZZX A;  1DPE A;  3JYR A;  5DT6 A;  2YLN A;  2QPQ A;  1D4N A;  4DXU A;  1B4H A;  4R6K A;  1IMD A;  2R9J A;  3T9U A;  4NF0 A;  1LAG E;  1RDZ A;  3QK6 A;  3HCQ A;  2Y5K A;  1FQB A;  4NAP A;  5AA4 A;  2XXW A;  3K4U A;  3R7X A;  3UA8 A;  3KBZ A;  4XTC Q;  1NUY A;  4GX4 A;  4GIZ A;  1DBZ A;  2P3V A;  1J1N A;  4NGU A;  5H8N A;  3ZS6 A;  4I3E A;  4EQ9 A;  1DMB A;  2RCA A;  3TOD A;  5H8H A;  1OLC A;  2WYK A;  1YCJ A;  3UP9 A;  4ELO A;  3S9N C;  4XEQ A;  1LLS A;  1B3H A;  2Y7I A;  4RK2 A;  5ICT A;  4NX1 A;  4IGT A;  5EYH A;  4IGR A;  5DVF A;  3U93 A;  2AIX A;  5KZT A;  1NH7 A;  1GTK A;  1EYK A;  4O3B A;  4P8B A;  2Q89 A;  3D4G A;  3BFU A;  1A8E A;  4P1L A;  5FTH A;  1A55 A;  1N04 A;  2QS4 A;  4LN5 A;  4PP0 A;  2F97 A;  1FBH A;  3HO7 A;  4FAJ A;  3I6V A;  2VPN A;  2DXY A;  5I58 B;  4H8J A;  5CMC A;  3RTF B;  4TLL B;  2QVU A;  4XKR A;  1OQG A;  4MHF A;  4JB7 A;  3W9V A;  3IAZ A;  4LQ2 A;  1FPI A;  3HHG A;  2REG A;  1R9Q A;  1FBP A;  1R6Z A;  3EHT A;  4BLA A;  1ZU0 A;  1L5T A;  3TDJ A;  1LCF A;  2I3W A;  3FJM A;  1USY H;  4QSC A;  4NF8 A;  4NED A;  3TTN A;  4PE3 A;  4DIG A;  4MAG A;  3KSX A;  4KPT A;  2QJE A;  2I0B A;  1HSL A;  1P1Q A;  3CFZ A;  3I3V A;  3DP4 A;  2R8T A;  1POT A;  3OSR A;  3GBA A;  1XOC A;  4WKM A;  1FBE A;  2XD3 A;  5L9O A;  3KN3 A;  5AA3 A;  3QMF A;  1NNF A;  4DI4 B;  2DOJ A;  1SBP A;  4JSO A;  4N8G A;  1QKB A;  2I4B A;  3K6V A;  4PDH A;  4BDL A;  3U94 A;  2F7B A;  2HXW A;  4GWU A;  1GVC A;  4ELQ A;  1XVX A;  1MG1 A;  5F24 A;  1PBP A;  2X26 A;  4HE2 A;  2GH9 A;  3KFM A;  2WBB A;  3RNN A;  3H06 B;  2OLB A;  4N17 A;  4ELR A;  3RYD A;  3Q25 A;  5DYH A;  1NV5 A;  3LBS A;  3D1R A;  2PCR A;  2YPN A;  1US5 A;  2F78 A;  2DS9 A;  3K02 A;  3UN6 A;  2XXR A;  2A5T B;  3DP8 A;  4E0X A;  4GBW A;  4Q30 B;  4MCO A;  4NF6 A;  4XXU A;  1EYI A;  1N7W A;  2OZZ A;  4IO7 A;  1XT8 A;  5CMK A;  3MWB A;  5IM2 A;  1FBD A;  3IFC A;  4H5F A;  3TCF A;  4YB5 A;  3M3F A;  4QBA A;  4R75 A;  3S9L C;  3G3I A;  3MZB A;  4RXL A;  3L6H A;  4RNS A;  4P0G A;  3KC1 A;  5TPA B;  3H7M A;  3OO7 A;  2DSF A;  2QS1 A;  1PEB A;  5H8Q A;  2I48 A;  5A5X B;  2XHD A;  5HPQ A;  5KDT B;  4GX3 A;  3GYY A;  3RT6 B;  3KN7 A;  4U22 A;  4LZ7 A;  3TPA A;  2HCA A;  1O7T A;  4YB6 A;  1I6A A;  1YYZ A;  4QFN A;  3IOU A;  5JTY A;  2P2A A;  1B1X A;  1MXZ A;  1OVT A;  1LBV A;  4N6D A;  2FVZ A;  4C0R A;  4LUB A;  5EQA A;  1KZ8 A;  3SEY A;  2DWA A;  4GWZ A;  1MM7 A;  3VV5 A;  4MIJ A;  2ONS A;  1MRP A;  1OMP A;  3KOS A;  4ZEC A;  2REJ A;  3NOH A;  4N4U A;  1B52 A;  4IO3 A;  5LOM A;  2Y7K A;  5ET6 A;  3OEN A;  1IIW A;  1IIT A;  1B2H A;  4ESW A;  3ONM A;  4NF4 B;  4Q0C A;  5HM4 B;  3MP1 A;  5ISU A;  3C36 A;  1AMF A;  2QVR A;  3JZJ A;  1NV3 A;  5CC2 A;  3PMW A;  3UK4 A;  3C35 A;  1FTA A;  1PB8 A;  3SZP A;  4OFO A;  4AB5 A;  2VP1 A;  3FJ7 A;  4K3F A;  3H6T A;  4IO2 A;  2DWI A;  2OWT A;  4LVQ A;  3VLW A;  1ZJL A;  1MPB A;  1Z7M E;  2VOZ A;  1LCT A;  1MY2 A;  3KSJ A;  1GGG A;  4FE8 A;  3KJT A;  4POX A;  1N84 A;  3T0J A;  4ZS9 A;  1IXG A;  1UTB A;  2AL4 A;  2L5V A;  2WBD A;  4GX6 A;  1M5B A;  4WED A;  3MZ1 A;  1IME A;  1RDX A;  2B3B A;  1NL5 A;  4F19 A;  4AQ4 A;  3ECR A;  3PUY E;  4F1V A;  3P7I A;  4GWW A;  4DDD A;  4OEV A;  3KZG A;  4BDN A;  3E13 X;  5ITO A;  2F3D A;  1FPK A;  2HQ0 A;  5ELV A;  3VXB A;  3MYU A;  4R6Y A;  5F1Q A;  3K6U A;  4ZEF A;  4P56 A;  4NHB A;  3OEM A;  3T96 B;  3FVG A;  5I59 B;  3MPK A;  3H4Z A;  1NV2 A;  3LSF B;  1POY 1;  1NMU A;  1G0H A;  4OTE A;  1LFG A;  3QIM A;  1AH5 A;  2RC7 A;  2ZNT A;  3O6I A;  1JP4 A;  3KJ7 A;  5TU0 A;  4F1Y A;  4F2O A;  3LSL A;  3PTY A;  3U72 A;  1HSJ A;  4MNI A;  2UYE A;  2ZYO A;  1VFE A;  3PPR A;  4TOZ A;  4NWD A;  1LB9 A;  2Q9T A;  1PBQ A;  3FUZ A;  2O68 A;  2THI A;  1FTL A;  3L6G A;  2IEE A;  2O1L A;  2UVH A;  5CI5 A;  1UIV A;  3KN8 A;  5J1D A;  4R9F A;  3OXN A;  3FVO A;  1LBX A; 
#chains in the Genus database with same CATH homology
 2CZK A;  1FBC A;  5FBP A;  1FPI A;  2BJI A;  4PF8 A;  1NI9 A;  5IM2 A;  1LEV A;  5ET7 A;  4QXD A;  1FBD A;  3IFC A;  1FBP A;  4AS4 A;  1YXI A;  3W9W A;  1BK4 A;  5IZ3 B;  2DE3 A;  3IFA A;  4YIC A;  4HCY A;  4QBA A;  1Q9D A;  2HZL A;  2QFL A;  4N8Y A;  4F19 A;  1YZ0 A;  2DVZ A;  2VT5 A;  3T0J A;  4PCD A;  1FPJ A;  5EQ7 A;  4PBQ A;  1EYJ A;  2HXR A;  3KC1 A;  4N15 A;  4OA4 A;  2OWZ A;  5T3J A;  4GBV A;  5JK4 A;  2L5V A;  2CEY A;  1DCU A;  2P3N A;  2QVV A;  2ZZX A;  2WBD A;  4GX6 A;  5EQ8 A;  5IGA A;  4G61 A;  4F1U A;  4KXP A;  5EYG A;  2FIE A;  4PE3 A;  5I7I A;  4MAG A;  3RPL B;  1IME A;  4N81 A;  1RDX A;  1DK4 A;  1SPI A;  2HHM A;  3MST A;  1AWB A;  3E78 A;  3HFU A;  1IMB A;  3FBP A;  4GX3 A;  4OVR A;  5IZ3 A;  1FPB A;  3GYY A;  4PTK A;  2QPQ A;  1G0I A;  4IR8 A;  4PBH A;  4MX6 A;  1NV4 A;  1LBY A;  2HZK A;  3KC0 A;  2B4L A;  2B4M A;  4FBP A;  1IMD A;  4MNP A;  4XFE A;  4O8M A;  2HPG A;  4PC9 A;  3BIG A;  4JVD A;  4F1V A;  3B50 A;  4NF0 A;  1FPD A;  2R8T A;  1RDZ A;  1YYZ A;  4HE0 A;  4I40 A;  4X8R A;  3RPL A;  4GWS A;  2Y5K A;  1LBZ A;  3EKI A;  4X04 A;  4PDD A;  4NAP A;  1FPL A;  2OX3 A;  4GWW A;  4NG7 A;  5A5L A;  5IZZ A;  2DDK A;  2Y5L A;  4MNC A;  3KBZ A;  1NUY A;  2WX9 A;  2F3D A;  1FPK A;  4GX4 A;  4P1E A;  2Q8M A;  1FBE A;  4UAB A;  1FJ6 A;  4PGN A;  5J16 A;  4MJO A;  4N6D A;  1LBV A;  1DBZ A;  2FVZ A;  2P3V A;  4NN3 A;  4OVP A;  4PFR A;  4X9T A;  3QMF A;  5EQ9 A;  4OVT A;  5EQA A;  1KZ8 A;  2XWK A;  4NGU A;  2WYP A;  5DW8 A;  4DI4 B;  4GWZ A;  5CM6 A;  4OVS A;  3LV0 A;  2WEF A;  4I3E A;  4PAF A;  1FBF A;  3MYU A;  4OAN A;  4MIJ A;  1XI6 A;  1KA1 A;  2XWO A;  2ZZV A;  2XWV A;  2MKZ A;  4GWX A;  4HCW A;  4N8G A;  4P56 A;  2WYK A;  1NV7 A;  1FRP A;  2F3B A;  1CNQ A;  4H46 A;  4I3Y A;  4M1V A;  4NHB A;  1NUZ A;  4PDH A;  4P9K A;  4XEQ A;  4GWU A;  4NX1 A;  2DE2 A;  1NV2 A;  4PAI A;  3NOH A;  5EYH A;  4PFB A;  4XF5 A;  4JVC A;  5F24 A;  5I3S A;  4N4U A;  4PAK A;  1G0H A;  4HE2 A;  4AS5 A;  2V4C A;  2ZZW A;  1EYK A;  2CEX A;  4P8B A;  4DI3 D;  5IZ1 A;  4GWY A;  4PET A;  1D9Q A;  2JJK A;  4HE1 A;  4P47 A;  2WBB A;  1JP4 A;  1K9Y A;  3B8B A;  2PFZ A;  4NQ8 A;  3U65 A;  4YZZ A;  5ET6 A;  1NV0 A;  4N17 A;  3T1B A;  5LTC A;  3PTY A;  4O7M A;  4P1L A;  5LDZ A;  4MEV A;  2CZH A;  3RYD A;  4N91 A;  2XA5 A;  1KA0 A;  4MNI A;  1FPE A;  1NV6 A;  4OVQ A;  5ESY A;  3BIH A;  2VPO A;  4LN5 A;  1NV5 A;  1INP A;  1VDW A;  2CZI A;  2F5X A;  1IMA A;  3D1R A;  1FBH A;  1NUX A;  1FPG A;  2PCR A;  2FIX A;  1FJ9 A;  2VPN A;  4JVI A;  2QVR A;  1NV3 A;  2Q9T A;  3ROJ A;  5ET5 A;  2FBP A;  2KQZ A;  1IMF A;  1FTA A;  2PFY A;  4PGP A;  3A29 A;  2DE4 A;  3ISP A;  3LUZ A;  3SZP A;  1NUW A;  2Q74 A;  4GBW A;  4HXV A;  2QVU A;  4PF6 A;  1FSA A;  2V3Q A;  4O7I A;  1IMC A;  4PFI A;  1QGX A;  5J1D A;  2FHY A;  1RDY A;  2GQ1 A;  1FBG A;  1FPF A;  2KR0 A;  4MCO A;  4MHF A;  1K9Z A;  3CHG A;  3W9V A;  4F18 A;  2XXK A;  3E79 A;  5ET8 A;  1EYI A;  1NV1 A;  3FXB A;  4H45 A;  4P3L A;  2XWI A;  4N6K A;  5I5P A;  4O94 A;  1LBW A;  4MMP A;  1LBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...