5LTCA

Crystal structure of doubly spin labelled vcsiap r125
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
299
structure length
296
Chain Sequence
ATTLKMGMQASVGSVEYNSAKMLADTLEEMSQGEIKLALYPSAQLGDDRAMLQLTLGDLDITYAEFGRMGLWIPRAEAVMLPYVAKDFDHLRRMFESDFGQGVRDEMLQKFNWRALDTWYNGTAETTSNRPLNSIEDFKGLKLRVPNAKQNLNYAKLSGASPTPMSFSEVYALQTNAVDGQENPLPTIKTMKFYEVQKNLAMTHHIVNDQMVIISESTWQKLSDTDKDIIQKAVQKVGDAHTQTVKTQEAELVSFFKSEGINVTYPLEPFREAMQPLYKEFDSNIGQPIVSKLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords C4-dicarboxylate-binding periplasmic protein
publication title PELDOR Spectroscopy Reveals Two Defined States of a Sialic Acid TRAP Transporter SBP in Solution.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 120
structure length 296
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5ltcA00
4PF8A 4NF0A 2XWVA 3GYYA 4PBQA 5IGAA 4MIJA 4OVQA 4NAPA 4NQ8A 4MNIA 4N91A 4PFIA 2WYKA 2ZZXA 4P1EA 2PFYA 2ZZWA 4MAGA 2XWKA 4PDDA 2HZLA 5I7IA 4PGNA 4NHBA 4PFRA 4XF5A 4PAIA 4O94A 4PETA 2VPOA 2CEYA 4YICA 4NG7A 4PE3A 5I5PA 4PAKA 5IZZA 4N17A 4P47A 4MCOA 4X8RA 2WYPA 4PDHA 4N4UA 4DI3D 4P56A 4N8GA 4P9KA 4XEQA 4P1LA 4YZZA 4X04A 4MNPA 4PFBA 4MMPA 4OANA 2XWIA 5IM2A 4MX6A 4MHFA 4NX1A 4P8BA 4PGPA 2XA5A 4P3LA 4N8YA 2PFZA 2XXKA 3FXBA 4OVPA 2XWOA 4LN5A 4PAFA 5LTCA 4MNCA 3B50A 4O8MA 4DI4B 5CM6A 4N15A 4N6DA 4PF6A 2HZKA 4XFEA 4MEVA 4PBHA 2ZZVA 4OVRA 4OVTA 4PC9A 4PCDA 4NN3A 2WX9A 4UABA 2V4CA 3U65A 4OA4A 4OVSA 2HPGA 2CEXA 4O7MA 4NGUA 2VPNA 4N6KA
chains in the Genus database with same CATH superfamily
3VLUA 2DXRA 1JQFA 4IY5A 4F1UA 3H6UA 2I4BA 5IGAA 2QS2A 3K1MA 1MQHA 5I56B 1NH7A 4YB6A 3TUSA 2B4LA 4FIMA 3O6IA 2ZZXA 3IJXB 3B7DA 4PDDA 3TTKA 2REGA 2Q2CA 4AS4A 4JWXA 3QSLA 4HW8A 4F29A 3D1RA 4GVOA 2V3TA 2CMOA 5IZZA 4ISUA 3TPAA 5DEXA 3PUVE 3PUZE 1A8FA 1M5DA 1VR5A 4XTCQ 3OO9A 5CI5A 2DWAA 1LCFA 4G8NA 2H4IA 2GQ1A 1CE2A 4PFBA 4H45A 1B3HA 2DDKA 3PMVA 3LR1A 1FQBA 3W9WA 1ATGA 1NL5A 3QYTA 4EUOA 2QJEA 5ET6A 3S9EA 1QUKA 3OOAA 1FTAA 2XXPA 1H76A 1T0KA 4HXVA 4WKMA 3FBPA 4GX6A 3KSJA 4HE0A 3IB1A 3MPLA 2XD3A 1UTBB 2HZKA 4XFEA 3IFCA 4KFQA 1RDZA 3LC8A 4OA4A 2B3FA 2ANJA 3ZKLA 4O7MA 5I57A 4QFLA 3TQLA 4DE8A 2HHMA 4N6KA 1IXCA 4XKRA 1IMEA 2A5SA 1D9VA 1FTMA 4GWZA 1OLAA 3ILUB 1ZLQA 4TOZA 2PFYA 4PQJA 5CMBA 3HPIA 2UYEA 1DCUA 4X1BA 1JW1A 1PEBA 4PGNA 3MAMA 3K0VA 4QF9A 2OBGA 4NWDA 3VE1B 4YB7A 3FIRA 2FIEA 1D4NA 1B4HA 1LBZA 5M2VA 3AXFA 1LEVA 3LSFB 1LCTA 2Q74A 1SW4A 5CMKA 3PPPA 4I8CA 3TFLA 2UXAA 4LZ5A 3TCFA 4C1UA 1PB8A 4NF8B 1TFDA 4DIGA 2F34A 3FXRA 1UTHA 5DVIA 3C34A 4P3LA 2OX3A 3QXMA 3Q25A 1NNKA 3IB0A 3G3HA 2XWOA 3CRBA 3LSWA 5EHMA 4GWYA 2AYSA 3RY3A 1L5TA 5L9SA 2Q89A 2QL3A 4O8MA 2GHAA 4LP2B 4N15A 1BLFA 4N6DA 1OVBA 3T93B 2XXVA 4GFRA 1Y9UA 4UA8A 3HN0A 1FPDA 2RINA 2IEEA 3DP8A 1B40A 5TU0A 3WAEA 4R9FA 2P3VA 3EN3A 3C9HA 4ZS9A 1FPLA 1B2HA 4OVQA 2QMWA 4NAPA 2VD2A 4GOTA 5AA3A 5FTHA 1LBWA 5CMMA 2ZZWA 1IIWA 2JJKA 3O28A 1D9YA 1LBBA 3OSRA 1NNTA 2QFLA 1MQIA 2Q2AA 2QS1A 3CFLA 5F1QA 3ILTB 3ZS6A 3T1BA 5ET7A 2A5TA 3A3CA 4FEBA 1FQAA 1NV4A 1RDXA 1B3LA 2I4CA 3FXUA 4GF8A 3TMGA 2XXWA 2XX9A 4O3CA 2VHAA 2XXHA 3CG3A 1SPIA 4LQ5A 1EZOA 2Y7KA 5IM2A 1B5JA 3V8XB 2XXUA 4ELQA 5EQ9A 1IITA 2RC7A 1MXYA 2KLFA 4I1DA 1A40A 1MXWA 2F97A 1FBDA 4QSCA 2WBDA 3OEKA 1O7TA 3G3IA 5KCJA 5TP9A 1R1NA 3ONMA 1AOVA 3MW0A 3RT8A 2ONKE 4NN3A 2XXIA 3JZJA 1MPCA 3MP8A 4N6PA 3B8BA 3CIJA 2NWJA 2UVHA 4BDRA 3OXNA 1EZ9A 1RYOA 1YXIA 4H1XA 2F35A 4GD5A 2PT1A 3UK4A 4OFOA 4ZEKA 2WYKA 2O68A 1B32A 4HS7A 2VP1A 1NV5A 4NHBA 4O7IA 4NF6B 1BTJA 3PV0E 2FIXA 1MM7A 3IJOB 2FYIA 1PB7A 3SEYA 3KOTA 3R26A 1EYIA 3QUJA 3PTYA 3Q27A 5JTYA 3U94A 4YZZA 3FZVA 4LZ7A 1RYXA 1Y3PA 1HSEA 1MPDA 5TPAA 5I59A 4OANA 2Y7WA 4DZ1A 3R6UA 3T9UA 4Q8RA 3MZBA 3FVOA 1SW5A 1BKAA 1VFDA 1M5BA 3THIA 1JW5A 5CBRA 1FTJA 1IEJA 3IOUA 2FHYA 5I58A 3B50A 3TEPA 1FPIA 1S50A 4OEVA 1VDWA 4WEDA 5H8QB 3K1NA 2E1SA 1SQYA 4PBHA 3E9XA 4R2FA 2ZZVA 2O69A 4LQ2A 5HPQA 2H5YA 2HCAA 3HHFA 5HM4B 1MH4A 1IQ7A 1UIUA 2F8DA 3RTWB 3SERA 4G61A 1FRPA 1KWHA 3MJNA 2HAUA 4KYSA 1MY3A 2P3NA 3CSBA 3LUYA 4LONB 1FW0A 3QIMA 1TT1A 4OFLA 4YAHX 3C33A 3VXCA 2XWKA 2DQVA 2RCBA 4IB2A 3OSQA 4PE5B 4G68C 3K6VA 3IOTA 4HCWA 4YICA 1Z7ME 3MVYA 4N13A 4F3PA 4MCOA 3MSTA 4AB5A 2O1LA 4Z0IA 4PDHA 3NOHA 4YKKA 3H4ZA 5KDTB 2O51A 3GLBA 5IZ1A 4JVIA 3D4GA 4TQUQ 4R9GA 4U2RA 2PFZA 2AL4A 4LA9A 2DWIA 3R7XA 3FVGA 3IORA 3GXAA 1A54A 2HXRA 1LFGA 5FBPA 1IMCA 1WVJA 4FJPA 1GR2A 4JVDA 1OIBA 3O9PA 4QFNA 4XKPA 1B5IA 4GXSB 2D5WA 4GLIA 4F2QA 3IOVA 5DVJA 3OD7A 4DCXA 1FPGA 1B5HA 4ECFA 3K6WA 4KYEA 1SYIA 2X26A 3UGWA 2XWVA 3K02A 3D4CA 3T66A 1B0LA 4ZEIA 3E13X 3M3LA 3CI8A 2QRYA 1UTBA 3G3JA 5I7IA 2DXYA 4OYVA 1OQHA 4KHZE 4EQ9A 2I3WA 2D21A 4H8IA 3KSXA 3TAJA 1I6QA 4OTEA 3TTRA 4NF4B 3LSXA 4IY6A 1US5A 3PMWA 4IO4A 1R6ZA 4P11A 3T9HB 2ZNSA 1WODA 1HSLA 4MMPA 4BDNA 1JNFA 2UVGA 1MQJA 4I9DA 5BUUA 4ESXA 2I6EA 4JWYA 3H6VA 2PMSA 4KCCA 5IAIA 2F7CA 3S4UA 4G77A 2OWZA 3MYUA 3TCHA 3K01A 4H0WA 4ND9A 4OVJA 3CHGA 5LTCA 3KBZA 1FBFA 4G68A 3DM0A 2I3VA 5AA1A 2AIXA 2RC9A 3FD3A 2DP8A 5DW8A 3M3FA 3BKIB 4X48A 1N84A 1BIYA 1D9QA 1KZ8A 2L5VA 1O64A 1XI6A 1R9QA 3DLNA 2F6GA 1TWYA 3PPQA 3I5OA 4NTLA 1URDA 3O6GA 4ZEDA 4G8MA 5HBCA 4YKJA 2FBPA 5JK4A 3OO8A 1AMFA 3FASA 4PFIA 1FPJA 4P1EA 3Q26A 3CSGA 4RY1A 3K1PA 3M8UA 1DSNA 1FQCA 2V3UA 3VLWA 4QFOA 3RPLA 5B70A 1YYZA 3TDJA 5ICQA 4LZ8A 2O7UA 3K2DA 1MY1A 4IO7A 4PE3A 4YMBA 4N17A 1JEUA 1FPFA 4N4UA 3RT6B 1JETA 5H8FB 1MXUA 1CB6A 4XEQA 1EH3A 2Y5KA 2UVIA 4KD5A 1EYJA 1FQEA 2XWIA 1PDAA 3USDA 4H67A 2MKZA 4N8YA 3UIFA 3MZ1A 5JEIA 1FPBA 3PUXE 4KI0E 4IO3A 3UORA 3PU5A 5AA2B 5DEXB 2HXWA 4OFJA 4FATA 1I69A 5AE4A 1GVCA 1RDYA 4DI4B 1B1HA 1OLCA 4U22A 4QFPA 3CFZA 4OWDA 5EHSA 4MFIA 3K00A 5K2YA 1MM6A 3IAZA 1NUZA 1S9TA 3VVFA 1QW0A 2X7PA 1IMDA 2HPGA 3MWBA 1A99A 4QBAA 3ROJA 3WAFA 4MF3A 1UIVA 2G29A 1DTGA 4X9TA 4RK2A 3O2AA 1GGGA 1IMFA 4QFKA 3U93A 3UN6A 3S9MC 5CMCA 2UVJA 3PPRA 3FUZA 4MAGA 4ZDMA 4ZECA 4YKIA 1H43A 4RPOA 4OETA 2V3QA 2CZLA 3VVDA 1JVXA 4YKPA 5I57B 5CC2A 3KBRA 2PCRA 3SDFA 1P1NA 4PETA 4H8JA 2KR0A 4F22A 1N7WA 1MXVA 5I2KA 1VSOA 4MLVA 5ITPA 4R72A 1O63A 4P1LA 2XXRA 2P0SA 3SEXA 4RPNA 3I6VA 4I40A 4P0IA 4GBVA 2I49A 5H8HB 4NWCA 2F7AA 3FJ7A 4NX1A 1N3WA 3FXBA 3H06B 5I2NB 4ZE9A 1KA0A 4PAFA 3UA8A 3K6UA 1SD3A 5ITOA 1Y1ZA 2OK2A 2VOZA 4PF6A 2GFEA 5DTBA 1UTHB 4N07A 4OVSA 1USYE 1QULA 1S7YA 3HSTA 2I58A 1LAHE 3FXQA 4JXIA 3T96B 4JVCA 4MH5A 3RN8A 3GYYA 5EQ8A 2PT2A 1B7ZA 4DDDA 4GXAA 4MNIA 2O84X 4F31B 2WBBA 1B4ZA 1B3EA 2WKYA 5ICTA 3OO7A 2FVZA 2DWJA 2XXXA 4OERA 1IMBA 4ZEFA 3DELB 5H8QA 2ALUA 4MLQA 3CG1A 3PD9A 2Q8MA 1MRPA 3RNNA 4PFRA 3LSLA 4FE8A 5AA4B 4HTGA 5L9MA 1XS5A 4YU0A 1IXHA 5I5PA 4PAKA 1XOCA 3H6TA 5A5XB 2DE3A 1GV8A 2V84A 2DVZA 2M8CA 3O29A 3PUYE 1MPBA 3KN7A 1B9JA 3MBPA 5EYGA 4RJZA 4PFUA 2O6AA 3KN3A 4GWSA 2DVCA 2CZIA 5J1DA 1WDNA 1NV3A 2ZNTA 1N76A 4MX6A 5L9OA 1NUWA 4GWXA 1AL3A 4LUBA 4PTKA 4LVQA 4AS5A 2F3BA 4KCDA 1MQGA 1N04A 1SW2A 1NI9A 1K9ZA 2Z8DA 1MDP1 3EPEA 3QMFA 2O1MA 1QJMA 1YAEA 1D3KA 3EKIA 1F9BA 3W15C 5KDTA 4ELPA 3VXBA 3N5LA 4KPTA 4RXLA 3RLFE 5IZ3A 2RC8A 4TLMB 3V89B 4U1OA 1A8EA 5I84A 2CZKA 2ONSA 3E79A 1CNQA 4GX4A 4QXDA 1B7HA 5ISUA 4K3FA 2OCUA 4N91A 3OELA 4GL0A 1SI1A 4F39A 1B6HA 2DOJA 1NV1A 3RQTA 3GBAA 5T3JA 3IL1B 2BJJX 2XD2A 4RK9A 3TODA 1II5A 5L8DA 3RPWA 4NF5B 5ET5A 1Q35A 3C35A 4ELOA 5CRYA 2I48A 1MDQA 1DTZA 3M3KA 2X7QA 5I3SA 2Y7IA 4P47A 2WYPA 1QUIA 3IR1A 3ZKKA 2OLBA 3UP9A 3DP4A 1DBZA 2OWSA 4N8GA 2V93A 4X1DA 3SEWA 2DS9A 4PFWA 3SKPA 3MVZA 1Q1KA 3ZSFA 2QS3A 3SESA 4OENA 4E0XA 2NXOA 4JSDA 2AL5A 2XA5A 1SBPA 2QS4A 2R8TA 4R2BA 3N26A 2Q8JA 3ISPA 4KXPA 1FBEA 4M4GA 2ZYKA 1Q9DA 3SETA 3CFXA 4OEUA 1H3DA 1AH5A 2R6GE 4C0RA 5I56A 1FBHA 4U4XA 2QVVA 3MP6A 4EXKA 1LB8A 3KZGA 1YTVA 1PBQA 4O3AA 4GWUA 1RKMA 3TYHA 4LATA 1NUYA 5TPAB 5DT6A 4GWWA 4L17A 4EQBA 4JDFA 2Z22A 3ODBA 2NUVA 3G7WA 1DMBA 1FBGA 2YJPA 3KJ7A 4R6HA 4FBPA 4PBQA 1IXGA 3Q28A 4HE1A 4OXVA 1TXFA 4Z7EA 5I58B 1ZJLA 4GBWA 3GZGA 3TCGA 4U21A 2G93A 2F3DA 4H5GA 4OQOA 3KC1A 1A7LA 2Y84A 2OWTA 2F78A 2HZLA 1ANFA 4BLAA 4PAIA 3S9LC 5ELVA 5F7VA 4OHNA 1M5CA 3MVWA 1LAXA 3N94A 4NG7A 4DXUA 3RUMA 2Z23A 3O66A 2DYXA 2ZMBA 1FJ6A 1MXXA 3IB2A 3K4UA 1G0HA 4DXCA 4KQPA 1QGXA 1LFIA 4P0GA 4AQ4A 3DP6A 3FGSA 1SYHA 2H98A 5H8NB 1P1OA 1LSTA 4MHFA 4IO6A 1LBVA 4I3YA 1AIVA 4KYDA 3HV1A 4M1VA 4OVPA 2FNCA 4UACA 4POXA 1K9YA 4F1YA 3QAXA 4IO2A 1N7XA 3C36A 3CR9A 3BIHA 3PPOA 1EU8A 3FV1A 1ELJA 3T0JA 3EF7A 3KN8A 1M5FA 5H8FA 1IZ1A 4OVTA 1IXIA 1ZTYA 3KJTA 3ECRA 3B6WA 4Q30B 1ZBMA 1Y3NA 2XXQA 4R6KA 1XT8A 2B4MA 3B6TA 2W7YA 4R74A 1PC3A 1AWBA 1VE4A 3OENA 4NF0A 4HE2A 1LAFE 1FBCA 2WEFA 4R6YA 2CZHA 3TZAA 3S9NC 5AA2A 3HO7A 4NF8A 4ZEBA 2Q9TA 1NKXA 4XXUA 1G0IA 1FTKA 2B65A 3B6QA 1B3FA 1P1UA 3OMBA 4G4PA 4BDLA 5EYHA 2Y5LA 3C31A 4O94A 4I62A 1A55A 4U23A 3TKDA 2OJTA 3FATA 4NEDA 5ET8A 1EZPA 4ZZEA 1VFEA 1Y4CA 1POTA 5CBSA 3PMXA 3KOSA 2Q88A 4X04A 2BJIA 1B52A 3MPKA 3V5AA 3H7MA 4EF2A 1UQWA 4EF1A 2ZYMA 1Y4TA 1QVSA 2RCAA 4H5FA 1FQFA 1PB9A 5ESYA 5EYFA 1QKBA 4QSEA 5F24A 3BBRA 4G2ZA 3HFUA 2I0CA 3MZ9A 3G3GA 4FORA 2Y7PA 5IKBA 2R9JA 3C32A 3IO6A 2R71A 4EQ7A 1PBPA 2QVUA 1IUDA 4MBPA 1SVXB 2PVUA 1FCKA 1LFHA 1MY2A 1FQDA 1XVXA 1B46A 3KG2A 1NNFA 1YPNA 5H8HA 1NV6A 1OVTA 4NGUA 4PF8A 1LLSA 2NVUB 4R73A 4F19A 3SEUA 3OO6A 5I2NA 3LUZA 1LAGE 3JYRA 3RGYA 5FTIA 4G68B 3L6GA 1P99A 3A29A 5KZTA 3G3KA 1FSAA 3BFTA 1BP5A 3T9VA 4EXLA 1H44A 5EQ7A 4H6DA 1DK4A 4XF5A 3BIGA 2H9BA 3C4MA 4DCYA 4N81A 1ZKBA 5FHNA 4F3BA 4QRZA 2CEYA 3T9XB 2QPQA 3EHTA 3TQWA 2YPNA 4XIGQ 1HSJA 4F18A 3KC0A 3G3FA 4F3GA 2RF1A 2ZYOA 3RPLB 3U1OA 4OZ9A 2VD3A 2XX8A 5FHOA 3W9VA 5A5LA 3N6UA 1NMUA 2ZYNA 2O7IA 4Q0CA 2DE4A 3H6WA 4GL8A 5AA4A 2E0SA 3MVXA 3VDFA 4ZZAA 1P1QA 1DPPA 1ZIUA 2REJA 1B3GA 1Y1MA 5A5XA 3IX1A 5CM6A 3MQ9A 3RTFB 4F2OA 1LBYA 1URSA 1XHYA 2ESNA 3SZPA 3U65A 1YCJA 3H3GA 3SEVA 2XX7A 4NF6A 1OMPA 3E3KA 4U4SA 2VPNA 1Z7NE 2LAOA 2XXYA 3K6XA 2HFBA 3FVNA 1DPEA 4MIJA 4GX3A 4NQ8A 4NMYA 2VGQA 4H46A 3QK6A 1MY0A 4C1TA 1MH3A 4JSOA 1LBXA 1NV0A 4YB5A 2DWHA 2QMXA 3CVGA 3PGFA 1NUXA 4E0WA 4TLLB 5FHMA 1H45A 2P2AA 1NFTA 1I6AA 4OESA 5K2XA 3E4RA 3RYDA 4JBZA 4HCYA 3E78A 2PBWA 4P56A 4IO5A 3S2VA 2XXTA 2FA7A 4RA1A 4DLDA 2H99A 2ONRA 2H25A 3KGCA 1XC1A 4BDMA 5DYHA 2XXKA 4G8HA 2THIA 4EDPA 1N0TA 3FJMA 3QUFA 4JB7A 4NF5A 3VLVA 4AB6A 2RKMA 3Q29A 5I2KB 4MNCA 1US4A 1JEVA 2F6PA 1ZMGA 3EHSA 3HHGA 3FVKA 4RYAA 1MY4A 3N6TA 1XVYA 3V83A 1FTOA 3TTMA 3L6HA 5BWJA 4OVRA 1J1NA 5AA2D 2WX9A 3EQ1A 1ZU0A 3TTNA 1IMAA 2CEXA 1B05A 2A5TB 4DXBA 1POY1 2DE2A 2UYFA 2P1SA 1Y20A 2HAVA 3A09A 4IGTA 4GQOA 1LBCA 1LGBC 5LDZA 3KFMA 3OEMA 4GWOA 2YLNA 5DVFA 1B58A 1R9LA 1JP4A 2V25A 3F11A 4H65A 1JW4A 1SDXA 2F7BA 3IFAA 4I3EA 4FAJA 1QUJA 4IR8A 3GBBA 4QSDA 4WXJA 1I6BA 2VPOA 3VV5A 1OQGA 1B0HA 4MJOA 2PX1A 1FPEA 3I3VA 1LB9A 3VVEA 4X8RA 5KCJB 3PD8A 5TP9B 1INPA 2F36A 1FBPA 2HQ0A 4MNPA 3IO4A 1JVYA 4GIZA 3PPNA 1URGA 3LV0A 1YZ0A 2GRVA 1FTLA 2HEUA 2GH9A 2Z8FA 4LN5A 4R75A 4OMBA 2QVRA 2QSXA 3MC2A 4PP0A 5EQAA 2KQZA 4RNSA 1MXZA 1DOTA 4ELRA 2OZZA 4IGRA 1MQDA 3P7IA 4PFYA 2GHBA 4F1VA 3KEIA 3HCQA 4PC9A 4PCDA 3U92A 1NNPA 4POWA 1BK4A 5H8NA 3T22A 4NF4A 4XKQA 3FJGA 1GTKA 1Y3QA 2Z8EA 5JTYB 1B1XA 3MP1A 1MS7A 1NV2A 4F3SA 5I59B 3TELA 4YMAA 3O97A 1N3XA 4THIA 3O6HA 1B51A 4WEPA 1NH8A 3U72A 3VFJA 3TTLA 3BFUA 5IZ3B 4NE4A 4BDOA 4ESWA 4O3BA 4JWOA 4KR5A 2IA4A 2PYYA 3EHUA 3FV2A 1SI0A 4ONYA 2B3BA 5B7DA 4FECA 5J16A 5LOMA 2D3IA 4QHQA 4DI3D 1B7UA 3H03A 4P9KA 2DSFA 4FEDA 1NV7A 3A3UA 3IOWA 2Y7RA 4P8BA 4PGPA 1EYKA 4ZE8A 3U8QA 2XHDA 5H8SA 4Q5TA 3MUQA 3IK6B 1M5EA 4U1ZA 1P1WA 1FPKA 2ZNUA 1QKAA 2ABHA 4MEVA 2NOOA 1TFAA 4GRKA 3LBSA 1KA1A 4BDQA 1FJ9A 2F5XA 1USYH 4UABA 1MG1A 1SW1A 2V4CA 2I0BA 3PUWE 2ZXTA 4PFTA 4XKNA 2VT5A 3JV9A
chains in the Genus database with same CATH topology
4JVCA 4PF8A 4F19A 3GYYA 1FRPA 4G61A 4F1UA 5EQ8A 5IGAA 3LUZA 4MNIA 2P3NA 2B4LA 3A29A 2WBBA 2ZZXA 1FSAA 2FVZA 2XWKA 4PDDA 1IMBA 5EQ7A 2Q8MA 4AS4A 4PFRA 1DK4A 4XF5A 3BIGA 3D1RA 4N81A 4HCWA 2CEYA 4YICA 5I5PA 4PAKA 5IZZA 2QPQA 4MCOA 2DE3A 3MSTA 2DVZA 4PDHA 3NOHA 4F18A 5EYGA 3KC0A 2GQ1A 4GWSA 5IZ1A 4PFBA 2CZIA 5J1DA 4JVIA 3RPLB 4H45A 1NV3A 2DDKA 4MX6A 3W9VA 1NUWA 2PFZA 5A5LA 4GWXA 3W9WA 5ET6A 4PTKA 2HXRA 4AS5A 2DE4A 1FTAA 5FBPA 2F3BA 1IMCA 1NI9A 1K9ZA 4HXVA 3FBPA 4JVDA 3QMFA 4GX6A 4HE0A 5CM6A 2HZKA 4XFEA 1LBYA 3IFCA 3EKIA 1RDZA 3SZPA 3U65A 4OA4A 4O7MA 5IZ3A 1FPGA 2HHMA 2VPNA 4N6KA 2CZKA 1IMEA 2XWVA 3E79A 1CNQA 4GWZA 4GX4A 4MIJA 4QXDA 4GX3A 4NQ8A 4H46A 4N91A 2PFYA 1LBXA 1NV1A 1DCUA 1NV0A 5T3JA 5I7IA 4PGNA 1NUXA 5ET5A 2FIEA 3RYDA 1LBZA 5I3SA 1LEVA 4P47A 2Q74A 2WYPA 4HCYA 3E78A 1DBZA 4P56A 4N8GA 4MMPA 2XA5A 4P3LA 2OX3A 2XXKA 2R8TA 3ISPA 4KXPA 1FBEA 1Q9DA 2OWZA 3MYUA 2XWOA 3CHGA 5LTCA 4GWYA 3KBZA 4MNCA 1FBFA 1FBHA 4O8MA 2QVVA 4N15A 4N6DA 4GWUA 1NUYA 4OVRA 5DW8A 4GWWA 2WX9A 1FPDA 1IMAA 2CEXA 2L5VA 1D9QA 1KZ8A 1XI6A 2DE2A 1FBGA 2P3VA 4FBPA 4PBQA 1FPLA 4HE1A 4OVQA 4NAPA 2FBPA 5JK4A 5LDZA 4GBWA 4PFIA 1LBWA 1FPJA 1JP4A 2F3DA 4P1EA 3KC1A 2ZZWA 2JJKA 3RPLA 2HZLA 1YYZA 3IFAA 4I3EA 4IR8A 4PAIA 2QFLA 3T1BA 5ET7A 2VPOA 4NG7A 4PE3A 4MJOA 1NV4A 1FPFA 4N17A 1FPEA 1RDXA 4X8RA 1FJ6A 4N4UA 1INPA 1G0HA 4XEQA 1FBPA 2Y5KA 1QGXA 4MNPA 1SPIA 1EYJA 2XWIA 5IM2A 4MHFA 2MKZA 3LV0A 4N8YA 1LBVA 1YZ0A 5EQ9A 4I3YA 1FPBA 4M1VA 4OVPA 4LN5A 1K9YA 2QVRA 3BIHA 1FBDA 1RDYA 2WBDA 4DI4B 5EQAA 2KQZA 3T0JA 1NUZA 4F1VA 4OVTA 4PC9A 4PCDA 4NN3A 1IMDA 2HPGA 3B8BA 1BK4A 4QBAA 3ROJA 2B4MA 1AWBA 4NF0A 1YXIA 4HE2A 4X9TA 1FBCA 2WEFA 1IMFA 2CZHA 1NV2A 2WYKA 2Q9TA 4MAGA 1G0IA 1NV5A 2V3QA 4NHBA 4O7IA 2PCRA 2Y5LA 5EYHA 5IZ3B 4O94A 4PETA 2FIXA 2KR0A 5ET8A 5J16A 1EYIA 4DI3D 3PTYA 4P9KA 4P1LA 4YZZA 4X04A 2BJIA 1NV7A 4I40A 4OANA 4GBVA 4NX1A 4P8BA 4PGPA 1EYKA 3FXBA 5ESYA 1KA0A 5F24A 4PAFA 3HFUA 2FHYA 3B50A 1FPIA 1FPKA 4PF6A 1VDWA 2QVUA 4MEVA 4PBHA 1KA1A 2ZZVA 1FJ9A 2F5XA 4UABA 2V4CA 4OVSA 1NV6A 4NGUA 2VT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PF8 A;  4NF0 A;  2XWV A;  3GYY A;  4PBQ A;  5IGA A;  4MIJ A;  4OVQ A;  4NAP A;  4NQ8 A;  4MNI A;  4N91 A;  4PFI A;  2WYK A;  2ZZX A;  4P1E A;  2PFY A;  2ZZW A;  4MAG A;  2XWK A;  4PDD A;  2HZL A;  5I7I A;  4PGN A;  4NHB A;  4PFR A;  4XF5 A;  4PAI A;  4O94 A;  4PET A;  2VPO A;  2CEY A;  4YIC A;  4NG7 A;  4PE3 A;  5I5P A;  4PAK A;  5IZZ A;  4N17 A;  4P47 A;  4MCO A;  4X8R A;  2WYP A;  4PDH A;  4N4U A;  4DI3 D;  4P56 A;  4N8G A;  4P9K A;  4XEQ A;  4P1L A;  4YZZ A;  4X04 A;  4MNP A;  4PFB A;  4MMP A;  4OAN A;  2XWI A;  5IM2 A;  4MX6 A;  4MHF A;  4NX1 A;  4P8B A;  4PGP A;  2XA5 A;  4P3L A;  4N8Y A;  2PFZ A;  2XXK A;  3FXB A;  4OVP A;  2XWO A;  4LN5 A;  4PAF A;  5LTC A;  4MNC A;  3B50 A;  4O8M A;  4DI4 B;  5CM6 A;  4N15 A;  4N6D A;  4PF6 A;  2HZK A;  4XFE A;  4MEV A;  4PBH A;  2ZZV A;  4OVR A;  4OVT A;  4PC9 A;  4PCD A;  4NN3 A;  2WX9 A;  4UAB A;  2V4C A;  3U65 A;  4OA4 A;  4OVS A;  2HPG A;  2CEX A;  4O7M A;  4NGU A;  2VPN A;  4N6K A; 
#chains in the Genus database with same CATH topology
 3VLU A;  2DXR A;  1JQF A;  4IY5 A;  4F1U A;  3H6U A;  2I4B A;  5IGA A;  2QS2 A;  3K1M A;  1MQH A;  5I56 B;  1NH7 A;  4YB6 A;  3TUS A;  2B4L A;  4FIM A;  3O6I A;  2ZZX A;  3IJX B;  3B7D A;  4PDD A;  3TTK A;  2REG A;  2Q2C A;  4AS4 A;  4JWX A;  3QSL A;  4HW8 A;  4F29 A;  3D1R A;  4GVO A;  2V3T A;  2CMO A;  5IZZ A;  4ISU A;  3TPA A;  5DEX A;  3PUV E;  3PUZ E;  1A8F A;  1M5D A;  1VR5 A;  4XTC Q;  3OO9 A;  5CI5 A;  2DWA A;  1LCF A;  4G8N A;  2H4I A;  2GQ1 A;  1CE2 A;  4PFB A;  4H45 A;  1B3H A;  2DDK A;  3PMV A;  3LR1 A;  1FQB A;  3W9W A;  1ATG A;  1NL5 A;  3QYT A;  4EUO A;  2QJE A;  5ET6 A;  3S9E A;  1QUK A;  3OOA A;  1FTA A;  2XXP A;  1H76 A;  1T0K A;  4HXV A;  4WKM A;  3FBP A;  4GX6 A;  3KSJ A;  4HE0 A;  3IB1 A;  3MPL A;  2XD3 A;  1UTB B;  2HZK A;  4XFE A;  3IFC A;  4KFQ A;  1RDZ A;  3LC8 A;  4OA4 A;  2B3F A;  2ANJ A;  3ZKL A;  4O7M A;  5I57 A;  4QFL A;  3TQL A;  4DE8 A;  2HHM A;  4N6K A;  1IXC A;  4XKR A;  1IME A;  2A5S A;  1D9V A;  1FTM A;  4GWZ A;  1OLA A;  3ILU B;  1ZLQ A;  4TOZ A;  2PFY A;  4PQJ A;  5CMB A;  3HPI A;  2UYE A;  1DCU A;  4X1B A;  1JW1 A;  1PEB A;  4PGN A;  3MAM A;  3K0V A;  4QF9 A;  2OBG A;  4NWD A;  3VE1 B;  4YB7 A;  3FIR A;  2FIE A;  1D4N A;  1B4H A;  1LBZ A;  5M2V A;  3AXF A;  1LEV A;  3LSF B;  1LCT A;  2Q74 A;  1SW4 A;  5CMK A;  3PPP A;  4I8C A;  3TFL A;  2UXA A;  4LZ5 A;  3TCF A;  4C1U A;  1PB8 A;  4NF8 B;  1TFD A;  4DIG A;  2F34 A;  3FXR A;  1UTH A;  5DVI A;  3C34 A;  4P3L A;  2OX3 A;  3QXM A;  3Q25 A;  1NNK A;  3IB0 A;  3G3H A;  2XWO A;  3CRB A;  3LSW A;  5EHM A;  4GWY A;  2AYS A;  3RY3 A;  1L5T A;  5L9S A;  2Q89 A;  2QL3 A;  4O8M A;  2GHA A;  4LP2 B;  4N15 A;  1BLF A;  4N6D A;  1OVB A;  3T93 B;  2XXV A;  4GFR A;  1Y9U A;  4UA8 A;  3HN0 A;  1FPD A;  2RIN A;  2IEE A;  3DP8 A;  1B40 A;  5TU0 A;  3WAE A;  4R9F A;  2P3V A;  3EN3 A;  3C9H A;  4ZS9 A;  1FPL A;  1B2H A;  4OVQ A;  2QMW A;  4NAP A;  2VD2 A;  4GOT A;  5AA3 A;  5FTH A;  1LBW A;  5CMM A;  2ZZW A;  1IIW A;  2JJK A;  3O28 A;  1D9Y A;  1LBB A;  3OSR A;  1NNT A;  2QFL A;  1MQI A;  2Q2A A;  2QS1 A;  3CFL A;  5F1Q A;  3ILT B;  3ZS6 A;  3T1B A;  5ET7 A;  2A5T A;  3A3C A;  4FEB A;  1FQA A;  1NV4 A;  1RDX A;  1B3L A;  2I4C A;  3FXU A;  4GF8 A;  3TMG A;  2XXW A;  2XX9 A;  4O3C A;  2VHA A;  2XXH A;  3CG3 A;  1SPI A;  4LQ5 A;  1EZO A;  2Y7K A;  5IM2 A;  1B5J A;  3V8X B;  2XXU A;  4ELQ A;  5EQ9 A;  1IIT A;  2RC7 A;  1MXY A;  2KLF A;  4I1D A;  1A40 A;  1MXW A;  2F97 A;  1FBD A;  4QSC A;  2WBD A;  3OEK A;  1O7T A;  3G3I A;  5KCJ A;  5TP9 A;  1R1N A;  3ONM A;  1AOV A;  3MW0 A;  3RT8 A;  2ONK E;  4NN3 A;  2XXI A;  3JZJ A;  1MPC A;  3MP8 A;  4N6P A;  3B8B A;  3CIJ A;  2NWJ A;  2UVH A;  4BDR A;  3OXN A;  1EZ9 A;  1RYO A;  1YXI A;  4H1X A;  2F35 A;  4GD5 A;  2PT1 A;  3UK4 A;  4OFO A;  4ZEK A;  2WYK A;  2O68 A;  1B32 A;  4HS7 A;  2VP1 A;  1NV5 A;  4NHB A;  4O7I A;  4NF6 B;  1BTJ A;  3PV0 E;  2FIX A;  1MM7 A;  3IJO B;  2FYI A;  1PB7 A;  3SEY A;  3KOT A;  3R26 A;  1EYI A;  3QUJ A;  3PTY A;  3Q27 A;  5JTY A;  3U94 A;  4YZZ A;  3FZV A;  4LZ7 A;  1RYX A;  1Y3P A;  1HSE A;  1MPD A;  5TPA A;  5I59 A;  4OAN A;  2Y7W A;  4DZ1 A;  3R6U A;  3T9U A;  4Q8R A;  3MZB A;  3FVO A;  1SW5 A;  1BKA A;  1VFD A;  1M5B A;  3THI A;  1JW5 A;  5CBR A;  1FTJ A;  1IEJ A;  3IOU A;  2FHY A;  5I58 A;  3B50 A;  3TEP A;  1FPI A;  1S50 A;  4OEV A;  1VDW A;  4WED A;  5H8Q B;  3K1N A;  2E1S A;  1SQY A;  4PBH A;  3E9X A;  4R2F A;  2ZZV A;  2O69 A;  4LQ2 A;  5HPQ A;  2H5Y A;  2HCA A;  3HHF A;  5HM4 B;  1MH4 A;  1IQ7 A;  1UIU A;  2F8D A;  3RTW B;  3SER A;  4G61 A;  1FRP A;  1KWH A;  3MJN A;  2HAU A;  4KYS A;  1MY3 A;  2P3N A;  3CSB A;  3LUY A;  4LON B;  1FW0 A;  3QIM A;  1TT1 A;  4OFL A;  4YAH X;  3C33 A;  3VXC A;  2XWK A;  2DQV A;  2RCB A;  4IB2 A;  3OSQ A;  4PE5 B;  4G68 C;  3K6V A;  3IOT A;  4HCW A;  4YIC A;  1Z7M E;  3MVY A;  4N13 A;  4F3P A;  4MCO A;  3MST A;  4AB5 A;  2O1L A;  4Z0I A;  4PDH A;  3NOH A;  4YKK A;  3H4Z A;  5KDT B;  2O51 A;  3GLB A;  5IZ1 A;  4JVI A;  3D4G A;  4TQU Q;  4R9G A;  4U2R A;  2PFZ A;  2AL4 A;  4LA9 A;  2DWI A;  3R7X A;  3FVG A;  3IOR A;  3GXA A;  1A54 A;  2HXR A;  1LFG A;  5FBP A;  1IMC A;  1WVJ A;  4FJP A;  1GR2 A;  4JVD A;  1OIB A;  3O9P A;  4QFN A;  4XKP A;  1B5I A;  4GXS B;  2D5W A;  4GLI A;  4F2Q A;  3IOV A;  5DVJ A;  3OD7 A;  4DCX A;  1FPG A;  1B5H A;  4ECF A;  3K6W A;  4KYE A;  1SYI A;  2X26 A;  3UGW A;  2XWV A;  3K02 A;  3D4C A;  3T66 A;  1B0L A;  4ZEI A;  3E13 X;  3M3L A;  3CI8 A;  2QRY A;  1UTB A;  3G3J A;  5I7I A;  2DXY A;  4OYV A;  1OQH A;  4KHZ E;  4EQ9 A;  2I3W A;  2D21 A;  4H8I A;  3KSX A;  3TAJ A;  1I6Q A;  4OTE A;  3TTR A;  4NF4 B;  3LSX A;  4IY6 A;  1US5 A;  3PMW A;  4IO4 A;  1R6Z A;  4P11 A;  3T9H B;  2ZNS A;  1WOD A;  1HSL A;  4MMP A;  4BDN A;  1JNF A;  2UVG A;  1MQJ A;  4I9D A;  5BUU A;  4ESX A;  2I6E A;  4JWY A;  3H6V A;  2PMS A;  4KCC A;  5IAI A;  2F7C A;  3S4U A;  4G77 A;  2OWZ A;  3MYU A;  3TCH A;  3K01 A;  4H0W A;  4ND9 A;  4OVJ A;  3CHG A;  5LTC A;  3KBZ A;  1FBF A;  4G68 A;  3DM0 A;  2I3V A;  5AA1 A;  2AIX A;  2RC9 A;  3FD3 A;  2DP8 A;  5DW8 A;  3M3F A;  3BKI B;  4X48 A;  1N84 A;  1BIY A;  1D9Q A;  1KZ8 A;  2L5V A;  1O64 A;  1XI6 A;  1R9Q A;  3DLN A;  2F6G A;  1TWY A;  3PPQ A;  3I5O A;  4NTL A;  1URD A;  3O6G A;  4ZED A;  4G8M A;  5HBC A;  4YKJ A;  2FBP A;  5JK4 A;  3OO8 A;  1AMF A;  3FAS A;  4PFI A;  1FPJ A;  4P1E A;  3Q26 A;  3CSG A;  4RY1 A;  3K1P A;  3M8U A;  1DSN A;  1FQC A;  2V3U A;  3VLW A;  4QFO A;  3RPL A;  5B70 A;  1YYZ A;  3TDJ A;  5ICQ A;  4LZ8 A;  2O7U A;  3K2D A;  1MY1 A;  4IO7 A;  4PE3 A;  4YMB A;  4N17 A;  1JEU A;  1FPF A;  4N4U A;  3RT6 B;  1JET A;  5H8F B;  1MXU A;  1CB6 A;  4XEQ A;  1EH3 A;  2Y5K A;  2UVI A;  4KD5 A;  1EYJ A;  1FQE A;  2XWI A;  1PDA A;  3USD A;  4H67 A;  2MKZ A;  4N8Y A;  3UIF A;  3MZ1 A;  5JEI A;  1FPB A;  3PUX E;  4KI0 E;  4IO3 A;  3UOR A;  3PU5 A;  5AA2 B;  5DEX B;  2HXW A;  4OFJ A;  4FAT A;  1I69 A;  5AE4 A;  1GVC A;  1RDY A;  4DI4 B;  1B1H A;  1OLC A;  4U22 A;  4QFP A;  3CFZ A;  4OWD A;  5EHS A;  4MFI A;  3K00 A;  5K2Y A;  1MM6 A;  3IAZ A;  1NUZ A;  1S9T A;  3VVF A;  1QW0 A;  2X7P A;  1IMD A;  2HPG A;  3MWB A;  1A99 A;  4QBA A;  3ROJ A;  3WAF A;  4MF3 A;  1UIV A;  2G29 A;  1DTG A;  4X9T A;  4RK2 A;  3O2A A;  1GGG A;  1IMF A;  4QFK A;  3U93 A;  3UN6 A;  3S9M C;  5CMC A;  2UVJ A;  3PPR A;  3FUZ A;  4MAG A;  4ZDM A;  4ZEC A;  4YKI A;  1H43 A;  4RPO A;  4OET A;  2V3Q A;  2CZL A;  3VVD A;  1JVX A;  4YKP A;  5I57 B;  5CC2 A;  3KBR A;  2PCR A;  3SDF A;  1P1N A;  4PET A;  4H8J A;  2KR0 A;  4F22 A;  1N7W A;  1MXV A;  5I2K A;  1VSO A;  4MLV A;  5ITP A;  4R72 A;  1O63 A;  4P1L A;  2XXR A;  2P0S A;  3SEX A;  4RPN A;  3I6V A;  4I40 A;  4P0I A;  4GBV A;  2I49 A;  5H8H B;  4NWC A;  2F7A A;  3FJ7 A;  4NX1 A;  1N3W A;  3FXB A;  3H06 B;  5I2N B;  4ZE9 A;  1KA0 A;  4PAF A;  3UA8 A;  3K6U A;  1SD3 A;  5ITO A;  1Y1Z A;  2OK2 A;  2VOZ A;  4PF6 A;  2GFE A;  5DTB A;  1UTH B;  4N07 A;  4OVS A;  1USY E;  1QUL A;  1S7Y A;  3HST A;  2I58 A;  1LAH E;  3FXQ A;  4JXI A;  3T96 B;  4JVC A;  4MH5 A;  3RN8 A;  3GYY A;  5EQ8 A;  2PT2 A;  1B7Z A;  4DDD A;  4GXA A;  4MNI A;  2O84 X;  4F31 B;  2WBB A;  1B4Z A;  1B3E A;  2WKY A;  5ICT A;  3OO7 A;  2FVZ A;  2DWJ A;  2XXX A;  4OER A;  1IMB A;  4ZEF A;  3DEL B;  5H8Q A;  2ALU A;  4MLQ A;  3CG1 A;  3PD9 A;  2Q8M A;  1MRP A;  3RNN A;  4PFR A;  3LSL A;  4FE8 A;  5AA4 B;  4HTG A;  5L9M A;  1XS5 A;  4YU0 A;  1IXH A;  5I5P A;  4PAK A;  1XOC A;  3H6T A;  5A5X B;  2DE3 A;  1GV8 A;  2V84 A;  2DVZ A;  2M8C A;  3O29 A;  3PUY E;  1MPB A;  3KN7 A;  1B9J A;  3MBP A;  5EYG A;  4RJZ A;  4PFU A;  2O6A A;  3KN3 A;  4GWS A;  2DVC A;  2CZI A;  5J1D A;  1WDN A;  1NV3 A;  2ZNT A;  1N76 A;  4MX6 A;  5L9O A;  1NUW A;  4GWX A;  1AL3 A;  4LUB A;  4PTK A;  4LVQ A;  4AS5 A;  2F3B A;  4KCD A;  1MQG A;  1N04 A;  1SW2 A;  1NI9 A;  1K9Z A;  2Z8D A;  1MDP 1;  3EPE A;  3QMF A;  2O1M A;  1QJM A;  1YAE A;  1D3K A;  3EKI A;  1F9B A;  3W15 C;  5KDT A;  4ELP A;  3VXB A;  3N5L A;  4KPT A;  4RXL A;  3RLF E;  5IZ3 A;  2RC8 A;  4TLM B;  3V89 B;  4U1O A;  1A8E A;  5I84 A;  2CZK A;  2ONS A;  3E79 A;  1CNQ A;  4GX4 A;  4QXD A;  1B7H A;  5ISU A;  4K3F A;  2OCU A;  4N91 A;  3OEL A;  4GL0 A;  1SI1 A;  4F39 A;  1B6H A;  2DOJ A;  1NV1 A;  3RQT A;  3GBA A;  5T3J A;  3IL1 B;  2BJJ X;  2XD2 A;  4RK9 A;  3TOD A;  1II5 A;  5L8D A;  3RPW A;  4NF5 B;  5ET5 A;  1Q35 A;  3C35 A;  4ELO A;  5CRY A;  2I48 A;  1MDQ A;  1DTZ A;  3M3K A;  2X7Q A;  5I3S A;  2Y7I A;  4P47 A;  2WYP A;  1QUI A;  3IR1 A;  3ZKK A;  2OLB A;  3UP9 A;  3DP4 A;  1DBZ A;  2OWS A;  4N8G A;  2V93 A;  4X1D A;  3SEW A;  2DS9 A;  4PFW A;  3SKP A;  3MVZ A;  1Q1K A;  3ZSF A;  2QS3 A;  3SES A;  4OEN A;  4E0X A;  2NXO A;  4JSD A;  2AL5 A;  2XA5 A;  1SBP A;  2QS4 A;  2R8T A;  4R2B A;  3N26 A;  2Q8J A;  3ISP A;  4KXP A;  1FBE A;  4M4G A;  2ZYK A;  1Q9D A;  3SET A;  3CFX A;  4OEU A;  1H3D A;  1AH5 A;  2R6G E;  4C0R A;  5I56 A;  1FBH A;  4U4X A;  2QVV A;  3MP6 A;  4EXK A;  1LB8 A;  3KZG A;  1YTV A;  1PBQ A;  4O3A A;  4GWU A;  1RKM A;  3TYH A;  4LAT A;  1NUY A;  5TPA B;  5DT6 A;  4GWW A;  4L17 A;  4EQB A;  4JDF A;  2Z22 A;  3ODB A;  2NUV A;  3G7W A;  1DMB A;  1FBG A;  2YJP A;  3KJ7 A;  4R6H A;  4FBP A;  4PBQ A;  1IXG A;  3Q28 A;  4HE1 A;  4OXV A;  1TXF A;  4Z7E A;  5I58 B;  1ZJL A;  4GBW A;  3GZG A;  3TCG A;  4U21 A;  2G93 A;  2F3D A;  4H5G A;  4OQO A;  3KC1 A;  1A7L A;  2Y84 A;  2OWT A;  2F78 A;  2HZL A;  1ANF A;  4BLA A;  4PAI A;  3S9L C;  5ELV A;  5F7V A;  4OHN A;  1M5C A;  3MVW A;  1LAX A;  3N94 A;  4NG7 A;  4DXU A;  3RUM A;  2Z23 A;  3O66 A;  2DYX A;  2ZMB A;  1FJ6 A;  1MXX A;  3IB2 A;  3K4U A;  1G0H A;  4DXC A;  4KQP A;  1QGX A;  1LFI A;  4P0G A;  4AQ4 A;  3DP6 A;  3FGS A;  1SYH A;  2H98 A;  5H8N B;  1P1O A;  1LST A;  4MHF A;  4IO6 A;  1LBV A;  4I3Y A;  1AIV A;  4KYD A;  3HV1 A;  4M1V A;  4OVP A;  2FNC A;  4UAC A;  4POX A;  1K9Y A;  4F1Y A;  3QAX A;  4IO2 A;  1N7X A;  3C36 A;  3CR9 A;  3BIH A;  3PPO A;  1EU8 A;  3FV1 A;  1ELJ A;  3T0J A;  3EF7 A;  3KN8 A;  1M5F A;  5H8F A;  1IZ1 A;  4OVT A;  1IXI A;  1ZTY A;  3KJT A;  3ECR A;  3B6W A;  4Q30 B;  1ZBM A;  1Y3N A;  2XXQ A;  4R6K A;  1XT8 A;  2B4M A;  3B6T A;  2W7Y A;  4R74 A;  1PC3 A;  1AWB A;  1VE4 A;  3OEN A;  4NF0 A;  4HE2 A;  1LAF E;  1FBC A;  2WEF A;  4R6Y A;  2CZH A;  3TZA A;  3S9N C;  5AA2 A;  3HO7 A;  4NF8 A;  4ZEB A;  2Q9T A;  1NKX A;  4XXU A;  1G0I A;  1FTK A;  2B65 A;  3B6Q A;  1B3F A;  1P1U A;  3OMB A;  4G4P A;  4BDL A;  5EYH A;  2Y5L A;  3C31 A;  4O94 A;  4I62 A;  1A55 A;  4U23 A;  3TKD A;  2OJT A;  3FAT A;  4NED A;  5ET8 A;  1EZP A;  4ZZE A;  1VFE A;  1Y4C A;  1POT A;  5CBS A;  3PMX A;  3KOS A;  2Q88 A;  4X04 A;  2BJI A;  1B52 A;  3MPK A;  3V5A A;  3H7M A;  4EF2 A;  1UQW A;  4EF1 A;  2ZYM A;  1Y4T A;  1QVS A;  2RCA A;  4H5F A;  1FQF A;  1PB9 A;  5ESY A;  5EYF A;  1QKB A;  4QSE A;  5F24 A;  3BBR A;  4G2Z A;  3HFU A;  2I0C A;  3MZ9 A;  3G3G A;  4FOR A;  2Y7P A;  5IKB A;  2R9J A;  3C32 A;  3IO6 A;  2R71 A;  4EQ7 A;  1PBP A;  2QVU A;  1IUD A;  4MBP A;  1SVX B;  2PVU A;  1FCK A;  1LFH A;  1MY2 A;  1FQD A;  1XVX A;  1B46 A;  3KG2 A;  1NNF A;  1YPN A;  5H8H A;  1NV6 A;  1OVT A;  4NGU A;  4PF8 A;  1LLS A;  2NVU B;  4R73 A;  4F19 A;  3SEU A;  3OO6 A;  5I2N A;  3LUZ A;  1LAG E;  3JYR A;  3RGY A;  5FTI A;  4G68 B;  3L6G A;  1P99 A;  3A29 A;  5KZT A;  3G3K A;  1FSA A;  3BFT A;  1BP5 A;  3T9V A;  4EXL A;  1H44 A;  5EQ7 A;  4H6D A;  1DK4 A;  4XF5 A;  3BIG A;  2H9B A;  3C4M A;  4DCY A;  4N81 A;  1ZKB A;  5FHN A;  4F3B A;  4QRZ A;  2CEY A;  3T9X B;  2QPQ A;  3EHT A;  3TQW A;  2YPN A;  4XIG Q;  1HSJ A;  4F18 A;  3KC0 A;  3G3F A;  4F3G A;  2RF1 A;  2ZYO A;  3RPL B;  3U1O A;  4OZ9 A;  2VD3 A;  2XX8 A;  5FHO A;  3W9V A;  5A5L A;  3N6U A;  1NMU A;  2ZYN A;  2O7I A;  4Q0C A;  2DE4 A;  3H6W A;  4GL8 A;  5AA4 A;  2E0S A;  3MVX A;  3VDF A;  4ZZA A;  1P1Q A;  1DPP A;  1ZIU A;  2REJ A;  1B3G A;  1Y1M A;  5A5X A;  3IX1 A;  5CM6 A;  3MQ9 A;  3RTF B;  4F2O A;  1LBY A;  1URS A;  1XHY A;  2ESN A;  3SZP A;  3U65 A;  1YCJ A;  3H3G A;  3SEV A;  2XX7 A;  4NF6 A;  1OMP A;  3E3K A;  4U4S A;  2VPN A;  1Z7N E;  2LAO A;  2XXY A;  3K6X A;  2HFB A;  3FVN A;  1DPE A;  4MIJ A;  4GX3 A;  4NQ8 A;  4NMY A;  2VGQ A;  4H46 A;  3QK6 A;  1MY0 A;  4C1T A;  1MH3 A;  4JSO A;  1LBX A;  1NV0 A;  4YB5 A;  2DWH A;  2QMX A;  3CVG A;  3PGF A;  1NUX A;  4E0W A;  4TLL B;  5FHM A;  1H45 A;  2P2A A;  1NFT A;  1I6A A;  4OES A;  5K2X A;  3E4R A;  3RYD A;  4JBZ A;  4HCY A;  3E78 A;  2PBW A;  4P56 A;  4IO5 A;  3S2V A;  2XXT A;  2FA7 A;  4RA1 A;  4DLD A;  2H99 A;  2ONR A;  2H25 A;  3KGC A;  1XC1 A;  4BDM A;  5DYH A;  2XXK A;  4G8H A;  2THI A;  4EDP A;  1N0T A;  3FJM A;  3QUF A;  4JB7 A;  4NF5 A;  3VLV A;  4AB6 A;  2RKM A;  3Q29 A;  5I2K B;  4MNC A;  1US4 A;  1JEV A;  2F6P A;  1ZMG A;  3EHS A;  3HHG A;  3FVK A;  4RYA A;  1MY4 A;  3N6T A;  1XVY A;  3V83 A;  1FTO A;  3TTM A;  3L6H A;  5BWJ A;  4OVR A;  1J1N A;  5AA2 D;  2WX9 A;  3EQ1 A;  1ZU0 A;  3TTN A;  1IMA A;  2CEX A;  1B05 A;  2A5T B;  4DXB A;  1POY 1;  2DE2 A;  2UYF A;  2P1S A;  1Y20 A;  2HAV A;  3A09 A;  4IGT A;  4GQO A;  1LBC A;  1LGB C;  5LDZ A;  3KFM A;  3OEM A;  4GWO A;  2YLN A;  5DVF A;  1B58 A;  1R9L A;  1JP4 A;  2V25 A;  3F11 A;  4H65 A;  1JW4 A;  1SDX A;  2F7B A;  3IFA A;  4I3E A;  4FAJ A;  1QUJ A;  4IR8 A;  3GBB A;  4QSD A;  4WXJ A;  1I6B A;  2VPO A;  3VV5 A;  1OQG A;  1B0H A;  4MJO A;  2PX1 A;  1FPE A;  3I3V A;  1LB9 A;  3VVE A;  4X8R A;  5KCJ B;  3PD8 A;  5TP9 B;  1INP A;  2F36 A;  1FBP A;  2HQ0 A;  4MNP A;  3IO4 A;  1JVY A;  4GIZ A;  3PPN A;  1URG A;  3LV0 A;  1YZ0 A;  2GRV A;  1FTL A;  2HEU A;  2GH9 A;  2Z8F A;  4LN5 A;  4R75 A;  4OMB A;  2QVR A;  2QSX A;  3MC2 A;  4PP0 A;  5EQA A;  2KQZ A;  4RNS A;  1MXZ A;  1DOT A;  4ELR A;  2OZZ A;  4IGR A;  1MQD A;  3P7I A;  4PFY A;  2GHB A;  4F1V A;  3KEI A;  3HCQ A;  4PC9 A;  4PCD A;  3U92 A;  1NNP A;  4POW A;  1BK4 A;  5H8N A;  3T22 A;  4NF4 A;  4XKQ A;  3FJG A;  1GTK A;  1Y3Q A;  2Z8E A;  5JTY B;  1B1X A;  3MP1 A;  1MS7 A;  1NV2 A;  4F3S A;  5I59 B;  3TEL A;  4YMA A;  3O97 A;  1N3X A;  4THI A;  3O6H A;  1B51 A;  4WEP A;  1NH8 A;  3U72 A;  3VFJ A;  3TTL A;  3BFU A;  5IZ3 B;  4NE4 A;  4BDO A;  4ESW A;  4O3B A;  4JWO A;  4KR5 A;  2IA4 A;  2PYY A;  3EHU A;  3FV2 A;  1SI0 A;  4ONY A;  2B3B A;  5B7D A;  4FEC A;  5J16 A;  5LOM A;  2D3I A;  4QHQ A;  4DI3 D;  1B7U A;  3H03 A;  4P9K A;  2DSF A;  4FED A;  1NV7 A;  3A3U A;  3IOW A;  2Y7R A;  4P8B A;  4PGP A;  1EYK A;  4ZE8 A;  3U8Q A;  2XHD A;  5H8S A;  4Q5T A;  3MUQ A;  3IK6 B;  1M5E A;  4U1Z A;  1P1W A;  1FPK A;  2ZNU A;  1QKA A;  2ABH A;  4MEV A;  2NOO A;  1TFA A;  4GRK A;  3LBS A;  1KA1 A;  4BDQ A;  1FJ9 A;  2F5X A;  1USY H;  4UAB A;  1MG1 A;  1SW1 A;  2V4C A;  2I0B A;  3PUW E;  2ZXT A;  4PFT A;  4XKN A;  2VT5 A;  3JV9 A; 
#chains in the Genus database with same CATH homology
 4JVC A;  4PF8 A;  4F19 A;  3GYY A;  1FRP A;  4G61 A;  4F1U A;  5EQ8 A;  5IGA A;  3LUZ A;  4MNI A;  2P3N A;  2B4L A;  3A29 A;  2WBB A;  2ZZX A;  1FSA A;  2FVZ A;  2XWK A;  4PDD A;  1IMB A;  5EQ7 A;  2Q8M A;  4AS4 A;  4PFR A;  1DK4 A;  4XF5 A;  3BIG A;  3D1R A;  4N81 A;  4HCW A;  2CEY A;  4YIC A;  5I5P A;  4PAK A;  5IZZ A;  2QPQ A;  4MCO A;  2DE3 A;  3MST A;  2DVZ A;  4PDH A;  3NOH A;  4F18 A;  5EYG A;  3KC0 A;  2GQ1 A;  4GWS A;  5IZ1 A;  4PFB A;  2CZI A;  5J1D A;  4JVI A;  3RPL B;  4H45 A;  1NV3 A;  2DDK A;  4MX6 A;  3W9V A;  1NUW A;  2PFZ A;  5A5L A;  4GWX A;  3W9W A;  5ET6 A;  4PTK A;  2HXR A;  4AS5 A;  2DE4 A;  1FTA A;  5FBP A;  2F3B A;  1IMC A;  1NI9 A;  1K9Z A;  4HXV A;  3FBP A;  4JVD A;  3QMF A;  4GX6 A;  4HE0 A;  5CM6 A;  2HZK A;  4XFE A;  1LBY A;  3IFC A;  3EKI A;  1RDZ A;  3SZP A;  3U65 A;  4OA4 A;  4O7M A;  5IZ3 A;  1FPG A;  2HHM A;  2VPN A;  4N6K A;  2CZK A;  1IME A;  2XWV A;  3E79 A;  1CNQ A;  4GWZ A;  4GX4 A;  4MIJ A;  4QXD A;  4GX3 A;  4NQ8 A;  4H46 A;  4N91 A;  2PFY A;  1LBX A;  1NV1 A;  1DCU A;  1NV0 A;  5T3J A;  5I7I A;  4PGN A;  1NUX A;  5ET5 A;  2FIE A;  3RYD A;  1LBZ A;  5I3S A;  1LEV A;  4P47 A;  2Q74 A;  2WYP A;  4HCY A;  3E78 A;  1DBZ A;  4P56 A;  4N8G A;  4MMP A;  2XA5 A;  4P3L A;  2OX3 A;  2XXK A;  2R8T A;  3ISP A;  4KXP A;  1FBE A;  1Q9D A;  2OWZ A;  3MYU A;  2XWO A;  3CHG A;  5LTC A;  4GWY A;  3KBZ A;  4MNC A;  1FBF A;  1FBH A;  4O8M A;  2QVV A;  4N15 A;  4N6D A;  4GWU A;  1NUY A;  4OVR A;  5DW8 A;  4GWW A;  2WX9 A;  1FPD A;  1IMA A;  2CEX A;  2L5V A;  1D9Q A;  1KZ8 A;  1XI6 A;  2DE2 A;  1FBG A;  2P3V A;  4FBP A;  4PBQ A;  1FPL A;  4HE1 A;  4OVQ A;  4NAP A;  2FBP A;  5JK4 A;  5LDZ A;  4GBW A;  4PFI A;  1LBW A;  1FPJ A;  1JP4 A;  2F3D A;  4P1E A;  3KC1 A;  2ZZW A;  2JJK A;  3RPL A;  2HZL A;  1YYZ A;  3IFA A;  4I3E A;  4IR8 A;  4PAI A;  2QFL A;  3T1B A;  5ET7 A;  2VPO A;  4NG7 A;  4PE3 A;  4MJO A;  1NV4 A;  1FPF A;  4N17 A;  1FPE A;  1RDX A;  4X8R A;  1FJ6 A;  4N4U A;  1INP A;  1G0H A;  4XEQ A;  1FBP A;  2Y5K A;  1QGX A;  4MNP A;  1SPI A;  1EYJ A;  2XWI A;  5IM2 A;  4MHF A;  2MKZ A;  3LV0 A;  4N8Y A;  1LBV A;  1YZ0 A;  5EQ9 A;  4I3Y A;  1FPB A;  4M1V A;  4OVP A;  4LN5 A;  1K9Y A;  2QVR A;  3BIH A;  1FBD A;  1RDY A;  2WBD A;  4DI4 B;  5EQA A;  2KQZ A;  3T0J A;  1NUZ A;  4F1V A;  4OVT A;  4PC9 A;  4PCD A;  4NN3 A;  1IMD A;  2HPG A;  3B8B A;  1BK4 A;  4QBA A;  3ROJ A;  2B4M A;  1AWB A;  4NF0 A;  1YXI A;  4HE2 A;  4X9T A;  1FBC A;  2WEF A;  1IMF A;  2CZH A;  1NV2 A;  2WYK A;  2Q9T A;  4MAG A;  1G0I A;  1NV5 A;  2V3Q A;  4NHB A;  4O7I A;  2PCR A;  2Y5L A;  5EYH A;  5IZ3 B;  4O94 A;  4PET A;  2FIX A;  2KR0 A;  5ET8 A;  5J16 A;  1EYI A;  4DI3 D;  3PTY A;  4P9K A;  4P1L A;  4YZZ A;  4X04 A;  2BJI A;  1NV7 A;  4I40 A;  4OAN A;  4GBV A;  4NX1 A;  4P8B A;  4PGP A;  1EYK A;  3FXB A;  5ESY A;  1KA0 A;  5F24 A;  4PAF A;  3HFU A;  2FHY A;  3B50 A;  1FPI A;  1FPK A;  4PF6 A;  1VDW A;  2QVU A;  4MEV A;  4PBH A;  1KA1 A;  2ZZV A;  1FJ9 A;  2F5X A;  4UAB A;  2V4C A;  4OVS A;  1NV6 A;  4NGU A;  2VT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...