1TFAA

Ovotransferrin, n-terminal lobe, apo form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
KSVIRWCTVSSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAISLDGGQVFEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKGTEFTVNDLQGKTSCHTGLGRSAGWNIPIGTLIHRGAIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKTKCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQKDEYELLCLDGSRQPVDNYKTCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLFKDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (OVOTRANSFERRIN)
publication title Alternative structural state of transferrin. The crystallographic analysis of iron-loaded but domain-opened ovotransferrin N-lobe.
pubmed doi rcsb
molecule tags Transport protein
total genus 100
structure length 329
sequence length 329
ec nomenclature
pdb deposition date 1999-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tfaA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tfaA02
2IEEA 3RUMA 3BFUA 3QAXA 3PU5A 4LQ5A 3PUYE 4OXVA 2ZXTA 3M8UA 4AB6A 1QJMA 4HCWA 3E9XA 2DWIA 4KCDA 4GF8A 1YAEA 3LSWA 5AA4A 4H5GA 2Z23A 2VP1A 3IJOB 1N0TA 2DP8A 5CM6A 4GD5A 4BDQA 2WKYA 1ZIUA 3TZAA 4X1DA 3T66A 3R7XA 3VVFA 1XVYA 4AB5A 2F6GA 4H65A 1IXCA 3M3LA 3MZ9A 4DLDA 4IB2A 5FTIA 5B7DA 4O3CA 4TOZA 1LCFA 4EQBA 3LC8A 3IB0A 4EXLA 3MW0A 3H6WA 2UVGA 3QUFA 2O84X 5K2XA 4L17A 1XS5A 2F7CA 3KEIA 5TP9A 3HHFA 3DM0A 1QULA 4PE5B 3FJMA 5HM4B 2PX1A 3MVXA 3G7WA 4R73A 2O68A 3IOVA 2I48A 3E3KA 3C4MA 4RPOA 1MXVA 3K6XA 3TODA 1NFTA 3SDFA 4PETA 4E0WA 1MY1A 5KDTA 3PPRA 3SERA 2FNCA 3K1MA 5CRYA 3FXQA 3RT8A 1B3GA 3UGWA 4HS7A 3MVZA 1XC1A 2H25A 3PMWA 3FJ7A 5TP9B 3T9HB 4MF3A 4F3BA 3TPAA 4XIGQ 1IXGA 4F22A 3MBPA 4QFLA 4LZ7A 3LSFB 4Z7EA 3OENA 3TCHA 3FJGA 3FVOA 3LUYA 1QW0A 3GXAA 3EPEA 2CMOA 3DLNA 2DVCA 4RK2A 1H45A 4LQ2A 2HZLA 1SYIA 3TELA 3AXFA 4FORA 1HSEA 2RINA 3K01A 3OO8A 2DWAA 2G93A 4BDRA 4GOTA 4OETA 2V84A 4OTEA 4N6PA 1MY4A 4FIMA 1M5DA 1NNFA 3BFTA 3EF7A 2Y7RA 3TCFA 3LSXA 5EHSA 2XXPA 4KYEA 2UVHA 1JQFA 4MFIA 4OFLA 3S9EA 3PPQA 3SEYA 2ZNTA 1XOCA 1FTOA 3H3GA 2KLFA 2QSXA 2Y7KA 1MH4A 3OEKA 3FV1A 2A5TA 4I1DA 1USYH 1USYE 5L9OA 5DT6A 3O29A 5I2NA 1LFHA 2I3WA 2QS4A 4LP2B 5CBRA 3KG2A 1MRPA 1H76A 1QKBA 3T93B 5DVIA 5KZTA 4RJZA 4ZS9A 1QUJA 3U1OA 1Y20A 1POY1 4Q0CA 4AQ4A 5FHOA 2QPQA 3D4GA 2HCAA 2Q88A 4H5FA 5H8SA 4WXJA 4KD5A 3I6VA 2DE3A 1SVXB 4ZZEA 1ATGA 1A54A 5I2NB 2I4CA 4QF9A 5CMBA 1B0LA 1JW1A 3UORA 2E0SA 2XD2A 2REGA 4EQ9A 1GVCA 3OMBA 3K2DA 5ELVA 5KCJA 2UVJA 1Y3QA 3W9VA 2H9BA 2Y84A 3EHUA 3M3KA 4G68A 2OWTA 3JV9A 4GQOA 4U21A 4FEDA 5AA2A 4NTLA 3K1PA 2E1SA 4PFWA 4HTGA 1B32A 2Z22A 3I3VA 5DTBA 4IY5A 4OESA 3IOTA 1VE4A 4RA1A 4F1UA 5CC2A 4ZEIA 2DWJA 4R72A 3PUVE 3H4ZA 1Y1MA 4LATA 4R9FA 3C36A 1JW4A 4FE8A 3O2AA 3QK6A 3S9LC 3K6VA 5KCJB 4OHNA 4F2QA 3FVKA 3EHSA 3PGFA 2ZYKA 4BDMA 4X9TA 5AA2B 3TQLA 5M2VA 4F3SA 5LOMA 4F31B 1XHYA 4F2OA 3RT6B 3KZGA 1UIVA 1TT1A 1N76A 4U23A 3DELB 1MXXA 3MP1A 2RKMA 1GTKA 2XX7A 3Q27A 4IO2A 1LB9A 4XKQA 4ELRA 3ONMA 1DSNA 1Y3NA 1I6BA 1HSLA 2V93A 3TCGA 4U1ZA 4KFQA 4NWCA 1BTJA 3O6HA 3QUJA 2ZYMA 3G3FA 4H1XA 2HZKA 1VFEA 3CI8A 4RXLA 3FV2A 1FQFA 3MVWA 3MP8A 4MBPA 5J1DA 4E0XA 1N04A 1D4NA 1P1QA 3SKPA 4DXBA 2YLNA 3GZGA 4EF2A 3VXCA 2VD3A 4I8CA 3RPWA 4U2RA 3TTKA 3U92A 5HPQA 1NL5A 2FA7A 4FJPA 2OCUA 2XD3A 4G77A 1RKMA 5L8DA 1R9QA 4Z0IA 4FATA 1IUDA 2PT2A 1B0HA 3OEMA 3TKDA 3B6WA 4YKIA 2ABHA 3OSQA 3QIMA 1EH3A 3TTLA 4IO4A 2ZYNA 4GL0A 3V89B 1N7XA 4C1TA 3H6UA 3TTMA 1HSJA 3V5AA 1MQHA 2GFEA 5CI5A 1B3EA 3LR1A 1IITA 1MH3A 3TAJA 4KYSA 1SI1A 4LZ5A 4KQPA 3HPIA 3PPOA 1NNTA 2I4BA 4QHQA 4QFKA 4EDPA 2P0SA 1Y3PA 1LAGE 1MY3A 2F78A 4QRZA 4IO3A 3CFLA 5JEIA 3S9NC 1MG1A 4IO7A 4P0IA 2Q89A 5TPAA 1MPDA 3K6WA 4RNSA 3N26A 5IKBA 1MM6A 3MPKA 3THIA 1B3FA 3PD9A 2UVIA 4XTCQ 1ANFA 2R9JA 1MXZA 3PUZE 3OXNA 1SW2A 3K00A 3RN8A 4ZEDA 1H43A 5HBCA 2D21A 3FATA 3IO6A 1Y9UA 2X26A 2V25A 5DYHA 3CFXA 1LFIA 4FEBA 1T0KA 3SEVA 5TPAB 3GBBA 1FCKA 3TUSA 2VHAA 3K0VA 3HCQA 2REJA 3IJXB 1N3WA 4F19A 4F18A 1RYOA 3MVYA 1CB6A 3O66A 1MXWA 2O1LA 4MH5A 5H8NA 2XXUA 3PPPA 3S9MC 4H6DA 1SYHA 1B5JA 3H7MA 5I57B 4F29A 1OMPA 4K3FA 4F1YA 2O69A 2VOZA 1MPCA 4THIA 4DE8A 5ICTA 3SEXA 3O97A 4I62A 2QS2A 3TQWA 3KFMA 1I69A 5H8FA 1P1OA 1GR2A 1JNFA 3WAFA 1TXFA 4GVOA 3TFLA 1R6ZA 3PMXA 1VSOA 1N3XA 2AL5A 1LSTA 1PEBA 4NEDA 5H8NB 4YICA 2I49A 5EHMA 4Q8RA 3VVEA 3U8QA 1FTJA 5ISUA 4NF5A 3JYRA 3IB1A 3ZKLA 4PFTA 4QFOA 1SW5A 4X48A 3RLFE 3V83A 3VLUA 4ECFA 5BUUA 1B46A 5H8FB 4YMAA 4YKJA 3Q26A 3CRBA 1UTHA 4JXIA 5CMKA 3SEWA 4DIGA 3K1NA 1EZPA 4OFOA 1FQEA 3KGCA 3KN7A 4BLAA 3A3CA 2H99A 3EQ1A 1Y4TA 1B7HA 3H6TA 4ISUA 1UIUA 3LSLA 3ECRA 3S4UA 5I84A 1H44A 1YTVA 5DEXA 4NF5B 4R2BA 3C35A 4JWYA 1MXYA 3VDFA 1OLCA 4RYAA 2W7YA 1P1NA 5H8QB 3O6IA 3MJNA 2QS3A 1LLSA 1PB7A 1UTHB 3O9PA 3A3UA 3EHTA 4BDLA 3MUQA 2ONRA 3BKIB 2DE4A 3U72A 1FQCA 3MZ1A 3U94A 3FIRA 2DWHA 4DCXA 4QFNA 3DP4A 5CMCA 1GGGA 4G8NA 3D4CA 3PUWE 1PB9A 5DEXB 3T22A 2HFBA 1US5A 3UA8A 4ND9A 4KPTA 4OZ9A 4HW8A 3FXRA 1JEVA 1WVJA 4P11A 4JDFA 2PYYA 2XXTA 4M4GA 1Y1ZA 5K2YA 3OO6A 4O3BA 4PQJA 3O6GA 3A09A 1JVXA 1QVSA 2ZNUA 2XXHA 2B3FA 5DVFA 3MQ9A 1SW4A 4U22A 1FQDA 2VD2A 4NE4A 2H4IA 1BKAA 3HO7A 3VXBA 1AMFA 4R6KA 5A5XA 2G29A 2XXVA 1FTKA 2QL3A 5I58B 3ILUB 3G3JA 1DTZA 4H8JA 1OQHA 4UA8A 4OWDA 2NVUB 1P99A 4UACA 1I6AA 1PB8A 4YAHX 4YU0A 4IY6A 4ELQA 1F9BA 3N94A 2M8CA 3T9UA 1DPEA 5AA3A 1PDAA 4JBZA 3VFJA 1DOTA 4U4XA 3RY3A 2I6EA 1TFAA 5CMMA 3BBRA 3QSLA 3B7DA 2Y7PA 3G3KA 2QMWA 1KWHA 5F1QA 1O7TA 2Y7IA 3Q25A 1NH7A 2DXRA 3RTWB 4YZZA 1MXUA 5A5XB 1B3LA 3TTRA 1MS7A 3PV0E 1LFGA 1OQGA 3C32A 4N07A 5F7VA 5JTYB 3FZVA 3OO9A 1Z7ME 1WDNA 1SQYA 4G8MA 1M5CA 3IO4A 4F3GA 4R74A 1MQJA 2ZYOA 3OO7A 3IOWA 3KN8A 4F3PA 4XXUA 3Q29A 1ZKBA 1A7LA 3G3GA 4JB7A 4DXUA 2V3QA 2AYSA 4XKNA 3KSJA 1M5BA 5L9MA 5B70A 3KN3A 3CG1A 2Y7WA 1US4A 4LONB 1O64A 4R6YA 4EXKA 3PUXE 4WEPA 1S50A 1TFDA 3O28A 2NXOA 2RCAA 3HV1A 2XXWA 3IR1A 1B51A 1PBPA 4YKKA 4NMYA 3E4RA 4ONYA 4GFRA 1A8EA 1B3HA 3QYTA 3RTFB 1MQDA 2LAOA 3C34A 1B9JA 3P7IA 1B52A 1B4ZA 2H98A 4OEUA 3I5OA 1AH5A 2Q8JA 1EU8A 3H06B 1FQAA 3G3IA 4ZDMA 4IGTA 3C33A 3IAZA 1B6HA 1SW1A 1MPBA 3LBSA 1Q35A 4QSEA 3W9WA 3T9XB 2F97A 4IGRA 1WODA 3UN6A 2AIXA 1B7UA 4XKPA 4DCYA 4HCYA 2XXQA 1BLFA 1B2HA 4OENA 4ELPA 3KBRA 1D9YA 2F35A 3QXMA 4MLQA 4H8IA 2QMXA 1DTGA 2OLBA 2DQVA 1ZU0A 4ZEKA 2RF1A 4ZE9A 4GL8A 2A5SA 3C31A 1OVTA 3IL1B 2OBGA 4N13A 3SESA 1QUIA 3VE1B 3N5LA 5ICQA 5I59A 3TTNA 1FTLA 1S9TA 4TQUQ 2DS9A 5JK4A 1YPNA 3CSGA 2ONKE 3K02A 2O6AA 1B5IA 4R6HA 5DVJA 2RC9A 2HAUA 1LAFE 4TLMB 1LAHE 4NF8A 1NMUA 4KR5A 2ESNA 4IO6A 4BDNA 4YMBA 2Q2AA 2YJPA 3V8XB 3TDJA 3MC2A 3SETA 2V3UA 3KJ7A 3B6TA 1VFDA 5I56A 2FYIA 1Z7NE 3T9VA 3G3HA 4R75A 3GBAA 2ONSA 2GHBA 1A99A 5AA4B 4DDDA 4R2FA 2DE2A 5I57A 4ZE8A 3H6VA 2X7PA 3ZS6A 2F36A 4KYDA 2ANJA 4DXCA 5I59B 3ODBA 1AL3A 3SEUA 1UTBA 2ZMBA 1XVXA 4OMBA 3HN0A 2NWJA 3OSRA 3OD7A 1MDP1 4NF8B 5AA1A 1MQIA 2Q2CA 1LCTA 1XT8A 1OIBA 1D9VA 4QSDA 3PPNA 3S2VA 3RQTA 5I56B 5L9SA 4JWOA 4TLLB 1B4HA 2O7IA 3FD3A 3W15C 1UQWA 1IQ7A 4C1UA 4KI0E 2CZLA 3OOAA 1B40A 4U4SA 4GXSB 4Q5TA 1IIWA 1URGA 1ZMGA 1JW5A 5CBSA 1UTBB 3TYHA 3KOSA 4PP0A 4ZEFA 4YB7A 2NUVA 3C9HA 3K6UA 1POTA 2QJEA 4G2ZA 5FHMA 1IZ1A 4ELOA 3USDA 2UXAA 5KDTB 3TMGA 2UYFA 4I9DA 4FAJA 2BJJX 3M3FA 4OERA 5AE4A 3DP6A 1OVBA 3UIFA 3R26A 1RYXA 5H8QA 3FASA 1R1NA 3N6TA 2Q9TA 1TWYA 1IXIA 1B1HA 4LZ8A 1JEUA 2D3IA 3ILTB 1A8FA 1D3KA 4LVQA 1NNKA 3IX1A 1LB8A 2XHDA 4LUBA 1SDXA 4QSCA 4MLVA 2ALUA 1AIVA 2ZNSA 4POWA 1IEJA 1QKAA 2DYXA 3Q28A 1LBBA 4NF6A 5I2KA 2I3VA 4PFYA 1CE2A 4YB6A 3ZKKA 3UK4A 1M5EA 1SI0A 2O51A 3CG3A 3R6UA 1N7WA 1I6QA 3VVDA 1MY2A 5ITPA 4U1OA 1ZBMA 4F39A 3KOTA 2P2AA 2I0CA 2IA4A 4EQ7A 4GWOA 4X1BA 1AOVA 5TU0A 2F34A 2OWSA 4GLIA 2AL4A 3GLBA 4C0RA 4NF6B 5I2KB 4H0WA 3CR9A 4WEDA 4G68C 4Q30B 3KJTA 5AA2D 2F6PA 3KSXA 2OK2A 1ZTYA 1EZOA 1M5FA 3B6QA 1NH8A 4G4PA 4OQOA 2DSFA 1SD3A 3MZBA 4NF4A 4EF1A 2I0BA 4ESWA 2PBWA 3FXUA 5I58A 5EYFA 3N6UA 3VLVA 2A5TB 3U93A 1URDA 5H8HA 3JZJA 4OYVA 2DXYA 1SBPA 4GIZA 4QFPA 2QS1A 4YB5A 1ELJA 2XX8A 4EUOA 4OVJA 4FECA 2F7AA 2PVUA 3T96B 1URSA 3CIJA 4RK9A 1NNPA 3WAEA 4JSDA 2PMSA 2XXYA 2R71A 2HEUA 4O3AA 4NF4B 2YPNA 1Q1KA 2B65A 4F1VA 2XXRA 3IORA 3CFZA 5H8HB 4H67A 5JTYA 1B1XA 1N84A 1B5HA 1JETA 1LAXA 3L6GA 3H03A 3VLWA 1MY0A 4LA9A 4OFJA 2XX9A 2HXWA 5FHNA 2HAVA 1EZ9A 4ZEBA 2V3TA 4ESXA 1MM7A 1OLAA 3MWBA 3PD8A 4GXAA 2F8DA 1S7YA 3IK6B 1FTMA 1QUKA 4ZECA 3FVGA 5IAIA 3PMVA 2O1MA 3L6HA 1ZJLA 4G68B 1A55A 1FW0A 4KCCA 3FGSA 1L5TA 3FUZA 1BIYA 1NKXA 3TEPA 2THIA 1O63A 4RPNA 3MAMA 2RC8A 2OZZA 1LBCA 2O7UA 1JVYA 1DPPA 2VGQA 2DVZA 1PC3A 2P1SA 4BDOA 2Z8FA 2H5YA 1VR5A 3UP9A 4XKRA 2RC7A 1A40A 3IOUA 1ZLQA 2OJTA 2RCBA 2R6GE 2I58A 4DZ1A 3K4UA 3RNNA 4GRKA 4JSOA 2PT1A 1YCJA 2NOOA 3ZSFA 5BWJA 3F11A 1IXHA 4PFUA 2D5WA 2Z8DA 2DOJA 2F7BA 4POXA 1P1WA 3CVGA 1LGBC 3HSTA 3E13X 3FVNA 1FQBA 4YKPA 5FTHA 4M1VA 1R9LA 4OEVA 5ITOA 3IB2A 1Y4CA 2XXXA 1BP5A 4KHZE 1MDQA 4JWXA 2GHAA 2Z8EA 2GRVA 3OELA 2XXIA 1J1NA 2B3BA 2GH9A 4G8HA 1B7ZA 1B58A 2UYEA 4P0GA 3RGYA 1B05A 1H3DA 1MQGA 4RY1A 2QRYA 2F5XA 2X7QA 3HHGA 1PBQA 4ZZAA 3MPLA 3MP6A 3DP8A 1II5A 1P1UA 3EN3A 3VV5A 4NWDA 4R9GA 1DMBA 2HQ0A 3CSBA 1GV8A 4WKMA 4IO5A
chains in the Genus database with same CATH superfamily
2IEEA 3RUMA 3BFUA 3QAXA 3PU5A 4KXPA 1NUYA 4LQ5A 3PUYE 4OXVA 3U65A 2ZXTA 3M8UA 4AB6A 1QJMA 4HCWA 3E9XA 2DWIA 4KCDA 4GF8A 1YAEA 3LSWA 5AA4A 4H5GA 2Z23A 2VP1A 3IJOB 1N0TA 2DP8A 4JVIA 4P1EA 5CM6A 4GD5A 4BDQA 2WKYA 4P8BA 1ZIUA 3TZAA 4X1DA 3T66A 3R7XA 3VVFA 1XVYA 1KZ8A 4AB5A 2CZHA 2F6GA 4H65A 1IXCA 3M3LA 3MZ9A 4DLDA 4IB2A 5FTIA 5B7DA 4O3CA 4TOZA 1LCFA 4EQBA 3LC8A 3IB0A 4EXLA 3MW0A 3H6WA 2UVGA 3QUFA 2GQ1A 2O84X 5K2XA 4L17A 1XS5A 2F7CA 3KEIA 2L5VA 5TP9A 4PTKA 3HHFA 4NHBA 3DM0A 1QULA 4PE5B 3FJMA 4PE3A 5HM4B 2PX1A 3MVXA 3G7WA 4R73A 2O68A 3IOVA 2I48A 3E3KA 3D1RA 3C4MA 4RPOA 1MXVA 3K6XA 2KR0A 3TODA 1NFTA 3SDFA 4PETA 5LDZA 4E0WA 1K9YA 1MY1A 5EQAA 4NF0A 5KDTA 3GYYA 3PPRA 3SERA 2FNCA 3K1MA 5CRYA 3FXQA 3RT8A 1B3GA 3UGWA 4OVPA 5EQ7A 4HS7A 3RYDA 3MVZA 1XC1A 2H25A 3PMWA 3FJ7A 5TP9B 3T9HB 4MF3A 3EKIA 4F3BA 3TPAA 4XIGQ 1IXGA 1AWBA 4F22A 1YXIA 3MBPA 4QFLA 4LZ7A 4MNCA 3LSFB 4Z7EA 3OENA 1FRPA 3TCHA 3FJGA 3FVOA 3LUYA 1QW0A 3GXAA 3EPEA 5ET7A 2CMOA 3DLNA 2DVCA 1FPJA 4RK2A 1H45A 1FPKA 4LQ2A 1KA0A 2FVZA 4O7MA 2HZLA 1SYIA 3TELA 2R8TA 3AXFA 4FORA 1HSEA 3BIGA 4H46A 2RINA 3K01A 3OO8A 2DWAA 2G93A 3CHGA 4BDRA 4GOTA 4OETA 2V84A 4OTEA 4N6PA 1LBVA 1MY4A 4FIMA 1M5DA 1FPEA 1NNFA 3BFTA 3EF7A 2Y7RA 4GWXA 3TCFA 3LSXA 5EHSA 2XXPA 4KYEA 4N17A 2UVHA 1JQFA 4MFIA 4OFLA 3S9EA 3PPQA 3SEYA 2ZNTA 2XWKA 1XOCA 1FTOA 3H3GA 2KLFA 2QSXA 1FBPA 2Y7KA 1MH4A 3OEKA 3FV1A 2A5TA 4I1DA 1USYH 1USYE 5T3JA 5L9OA 5DT6A 3O29A 4HE1A 4PC9A 5I2NA 1LFHA 2I3WA 2QS4A 4P1LA 4LP2B 5CBRA 3KG2A 1MRPA 1DBZA 1H76A 1QKBA 3T93B 5DVIA 1NUWA 5KZTA 4RJZA 4ZS9A 1QUJA 3MSTA 3U1OA 4O7IA 1Y20A 1POY1 4Q0CA 4AQ4A 5FHOA 2QPQA 3D4GA 2HCAA 2Q88A 4GWWA 4H5FA 5H8SA 4WXJA 4KD5A 3I6VA 2DE3A 4XEQA 1SVXB 1FTAA 4ZZEA 3SZPA 1ATGA 1A54A 1NV3A 5I2NB 2I4CA 4QF9A 5CMBA 1B0LA 1JW1A 3UORA 2E0SA 2XD2A 2PFZA 2REGA 4P56A 1FPBA 4EQ9A 1GVCA 3B50A 3OMBA 3K2DA 5ELVA 5EQ9A 5KCJA 2UVJA 1Y3QA 3W9VA 2H9BA 4G68A 1FBFA 4NAPA 2Y84A 3EHUA 3M3KA 2OWTA 3JV9A 4PDDA 4GQOA 4U21A 4FEDA 5AA2A 2B4LA 4NTLA 3K1PA 2E1SA 4PFWA 4HTGA 1B32A 2Z22A 5F24A 3I3VA 3T0JA 5DTBA 4IY5A 4OESA 3IOTA 1VE4A 4RA1A 4N81A 1K9ZA 4F1UA 5CC2A 4ZEIA 2DWJA 2Q8MA 4R72A 3PUVE 3H4ZA 1Y1MA 4LATA 4R9FA 3C36A 1JW4A 4FE8A 4I40A 2QFLA 3O2AA 1VDWA 3QK6A 3S9LC 1XI6A 3K6VA 5KCJB 4OHNA 4F2QA 3FVKA 3EHSA 3PGFA 2ZYKA 3ROJA 4BDMA 4PFRA 4X9TA 5AA2B 3TQLA 5M2VA 4F3SA 4NG7A 5LOMA 4F31B 1XHYA 4F2OA 3T1BA 5IM2A 1LEVA 3RT6B 1FJ9A 3KZGA 1UIVA 1TT1A 1N76A 4U23A 3DELB 1MXXA 3MP1A 2RKMA 1GTKA 2XX7A 3Q27A 4IO2A 1LB9A 4XKQA 4ELRA 3ONMA 1DSNA 1Y3NA 1I6BA 1HSLA 4PCDA 2V93A 3TCGA 4U1ZA 5A5LA 4KFQA 4NWCA 1BTJA 3HFUA 3O6HA 3QUJA 2ZYMA 3G3FA 4H1XA 5EYGA 2CEXA 1VFEA 2HZKA 4O8MA 3CI8A 4RXLA 3FV2A 1FQFA 3MVWA 3MP8A 4MBPA 4H45A 5J1DA 4E0XA 1N04A 1D4NA 4PAFA 2FIEA 1P1QA 3SKPA 4DXBA 3E79A 2YLNA 3GZGA 4EF2A 3VXCA 2VD3A 4PFIA 4I8CA 3RPWA 4U2RA 3TTKA 3U92A 5HPQA 1NL5A 2FA7A 4FJPA 2OCUA 2XD3A 4G77A 1RKMA 2P3NA 5L8DA 1R9QA 4HXVA 4Z0IA 4P9KA 4FATA 1IUDA 2PT2A 4GWYA 1B0HA 3OEMA 3TKDA 3B6WA 4YKIA 2ABHA 3OSQA 3QIMA 2VPOA 1EH3A 3TTLA 4IO4A 2ZYNA 4GL0A 3V89B 1N7XA 4C1TA 2XWVA 3H6UA 3TTMA 3A29A 1HSJA 4N91A 3V5AA 4GBWA 1MQHA 2GFEA 5CI5A 1B3EA 3LR1A 1IITA 1MH3A 4OVSA 3TAJA 4PAKA 4KYSA 1SI1A 4LZ5A 4PFBA 4KQPA 3HPIA 3PPOA 1NNTA 2XWOA 2I4BA 4QFKA 4QHQA 4EDPA 1FBEA 2P0SA 1Y3PA 1LAGE 1MY3A 2F78A 4HE2A 4QRZA 1QGXA 4IO3A 3CFLA 5JEIA 3S9NC 1MG1A 4IO7A 4P0IA 2Q89A 5TPAA 1MPDA 3K6WA 4RNSA 3N26A 2PFYA 5IKBA 1MM6A 3FXBA 3MPKA 3THIA 2VT5A 1B3FA 3PD9A 4P3LA 2UVIA 4XTCQ 1ANFA 2WBDA 2R9JA 1MXZA 3PUZE 2QVRA 3OXNA 1IMDA 2F3BA 1SW2A 3K00A 3RN8A 4ZEDA 1H43A 5HBCA 2D21A 3FATA 3IO6A 4N8GA 1Y9UA 2X26A 2V25A 5DYHA 3CFXA 1LFIA 4FEBA 1T0KA 4MCOA 3SEVA 5TPAB 2WBBA 4NN3A 3GBBA 1FCKA 3TUSA 2VHAA 3K0VA 3HCQA 2REJA 3IJXB 3KBZA 1N3WA 4F19A 2QVVA 4F18A 1RYOA 3MVYA 1CB6A 3O66A 1MXWA 2O1LA 4MH5A 4NX1A 1CNQA 4GBVA 5H8NA 2XXUA 3PPPA 2ZZWA 3S9MC 4H6DA 1SYHA 4PGNA 1B5JA 1JP4A 3H7MA 5I57B 4F29A 1OMPA 4K3FA 4F1YA 2O69A 2VOZA 1MPCA 4THIA 4DE8A 5ICTA 3SEXA 3O97A 4I62A 2QS2A 2PCRA 1RDXA 3TQWA 3KFMA 1I69A 5H8FA 1P1OA 5LTCA 2P3VA 1GR2A 1JNFA 3WAFA 1TXFA 4GX3A 4GVOA 3TFLA 1R6ZA 3PMXA 4MEVA 1VSOA 1N3XA 2AL5A 1LSTA 1PEBA 2WYKA 4NEDA 5H8NB 4YICA 2CZIA 2OX3A 3LV0A 5J16A 2I49A 5EHMA 1RDZA 4Q8RA 3VVEA 3U8QA 1FTJA 2KQZA 2WX9A 5ISUA 4NF5A 3JYRA 4MNIA 3IB1A 3FBPA 3ZKLA 4PFTA 4QFOA 1SW5A 4X48A 3RLFE 3V83A 3VLUA 4ECFA 5BUUA 1B46A 5H8FB 4YMAA 3ISPA 4YKJA 3Q26A 3CRBA 4GX6A 1UTHA 4JXIA 2MKZA 5CMKA 3SEWA 4DIGA 3K1NA 5I3SA 1EZPA 4OFOA 1FQEA 3KGCA 3KN7A 4BLAA 3A3CA 2H99A 3EQ1A 1B7HA 1Y4TA 3H6TA 4ISUA 4GX4A 1UIUA 3LSLA 3ECRA 3S4UA 5I84A 1H44A 1YTVA 5DEXA 4NF5B 4DI4B 4R2BA 3C35A 4JWYA 1MXYA 3VDFA 1OLCA 4RYAA 4MIJA 2W7YA 5ET6A 1P1NA 5H8QB 3O6IA 3MJNA 2QS3A 1YZ0A 1LLSA 1PB7A 1UTHB 3O9PA 3A3UA 3EHTA 4BDLA 3MUQA 2ONRA 3BKIB 2DE4A 3U72A 1FQCA 4PDHA 3MZ1A 3U94A 3FIRA 3PTYA 2DWHA 4DCXA 4QFNA 3DP4A 5CMCA 1FSAA 1GGGA 4G8NA 3D4CA 3PUWE 1PB9A 4N15A 5DEXB 3T22A 2HFBA 1US5A 3UA8A 4ND9A 4KPTA 1LBZA 4OZ9A 4HW8A 3FXRA 1JEVA 1WVJA 4P11A 4JDFA 4MX6A 2PYYA 2XXTA 4M4GA 4N4UA 1Y1ZA 2B4MA 4PAIA 5K2YA 3OO6A 4O3BA 4PQJA 3O6GA 3A09A 1JVXA 1QVSA 2ZNUA 2XXHA 2B3FA 5DVFA 3MQ9A 1SW4A 4U22A 1G0HA 1FQDA 2VD2A 4NE4A 2H4IA 1BKAA 3HO7A 3VXBA 1AMFA 4R6KA 5A5XA 2G29A 2XXVA 1FTKA 1FBHA 2QL3A 5I58B 1EYIA 3ILUB 3G3JA 1DTZA 4H8JA 1OQHA 4UA8A 4DI3D 4OWDA 2NVUB 1P99A 1NUXA 4UACA 1I6AA 1PB8A 4YAHX 4YU0A 4IY6A 4ELQA 1F9BA 1IMBA 3N94A 2M8CA 3T9UA 3KC0A 1DPEA 1G0IA 5AA3A 1PDAA 3E78A 4JBZA 3VFJA 1DOTA 4U4XA 3RY3A 2I6EA 1TFAA 5CMMA 3BBRA 3QSLA 3B7DA 2Y7PA 3G3KA 4UABA 2QMWA 1KWHA 5F1QA 1O7TA 1LBXA 2Y7IA 3Q25A 1NH7A 2DXRA 3RTWB 4YZZA 1NV6A 1MXUA 5A5XB 1B3LA 3TTRA 3MYUA 1MS7A 3PV0E 1LFGA 1IMFA 1OQGA 4IR8A 3C32A 4N07A 5F7VA 5JTYB 3FZVA 3OO9A 4OVRA 1Z7ME 4NGUA 1WDNA 1SQYA 4G8MA 3RPLA 1M5CA 3IO4A 4F3GA 4R74A 1MQJA 2ZYOA 3OO7A 3IOWA 1FPFA 3KN8A 4F3PA 4XXUA 4OA4A 3Q29A 1ZKBA 4O94A 1A7LA 3G3GA 4JB7A 4N6DA 4DXUA 2V3QA 2AYSA 4XKNA 3KSJA 1M5BA 5L9MA 5B70A 3KN3A 1NI9A 3CG1A 2Y7WA 1US4A 4LONB 1O64A 4R6YA 4EXKA 3PUXE 4AS4A 4WEPA 1S50A 1TFDA 1EYKA 1NV1A 3O28A 2NXOA 2RCAA 3HV1A 1FBCA 2XXWA 3RPLB 3IR1A 1B51A 1PBPA 4YKKA 4NMYA 5ET5A 3E4RA 4LN5A 4ONYA 5I7IA 4GFRA 1A8EA 1B3HA 3QYTA 3IFCA 3RTFB 1MQDA 2LAOA 3C34A 1B9JA 1FBGA 3P7IA 4QBAA 1B52A 1B4ZA 2QVUA 2H98A 3NOHA 4OEUA 3IFAA 3I5OA 1AH5A 2Q8JA 1EU8A 1NUZA 3H06B 4GWUA 1FQAA 3G3IA 4MNPA 4ZDMA 4IGTA 3C33A 3IAZA 1B6HA 1SW1A 1MPBA 2XA5A 3LBSA 1Q35A 4QSEA 4GWZA 3W9WA 3T9XB 2F97A 4IGRA 1WODA 3UN6A 2AIXA 1B7UA 4XKPA 4DCYA 1FPIA 4HCYA 2XXQA 1BLFA 1B2HA 4OENA 4ELPA 4OANA 4PBHA 3KBRA 1D9YA 2F35A 2BJIA 3QXMA 4MLQA 2XWIA 4H8IA 2JJKA 2QMXA 1DTGA 2OLBA 2DQVA 1ZU0A 4ZEKA 2RF1A 4ZE9A 4P47A 4GL8A 2A5SA 3C31A 1OVTA 2ZZXA 2OBGA 3IL1B 4G61A 1NV2A 4N13A 3SESA 1QUIA 1IMCA 3VE1B 3N5LA 5ICQA 5I59A 3TTNA 1FTLA 5I5PA 1S9TA 4TQUQ 2DS9A 5JK4A 1YPNA 3CSGA 2ONKE 3K02A 2O6AA 1B5IA 4R6HA 1NV4A 5DVJA 2RC9A 5IZ3A 2HAUA 1LAFE 4TLMB 1LAHE 4NF8A 1NMUA 4KR5A 2ESNA 4IO6A 4BDNA 2Y5KA 2Q2AA 4YMBA 2YJPA 3V8XB 3MC2A 3TDJA 2V3UA 3KJ7A 3SETA 3B6TA 1VFDA 5I56A 2FYIA 1Z7NE 3T9VA 3G3HA 4R75A 3GBAA 2ONSA 2GHBA 1A99A 1FBDA 5AA4B 4DDDA 1FPLA 4R2FA 2DE2A 5I57A 4ZE8A 3H6VA 4MAGA 2X7PA 3ZS6A 2F36A 1Q9DA 4KYDA 2ANJA 4DXCA 5I59B 2CZKA 3ODBA 1AL3A 3SEUA 1UTBA 2ZMBA 1XVXA 4OMBA 3HN0A 2NWJA 4PGPA 1NV0A 3OSRA 5IZ3B 3OD7A 1INPA 1EYJA 1LBYA 1MDP1 4XFEA 4AS5A 4NF8B 5AA1A 1MQIA 1FPGA 2Q2CA 2WYPA 1LCTA 1XT8A 1OIBA 1D9VA 4QSDA 3PPNA 3S2VA 3RQTA 5I56B 5L9SA 4JWOA 4TLLB 4X04A 4FBPA 1B4HA 2O7IA 4QXDA 3FD3A 3W15C 1UQWA 1LBWA 1KA1A 1IQ7A 4C1UA 4KI0E 2CZLA 3OOAA 1B40A 4U4SA 4GXSB 4Q5TA 1IIWA 2WEFA 1URGA 1ZMGA 1JW5A 5CBSA 1UTBB 3TYHA 2CEYA 3KOSA 4PP0A 4ZEFA 4YB7A 2NUVA 3C9HA 3K6UA 1POTA 2QJEA 4G2ZA 1FJ6A 5FHMA 1IZ1A 4ELOA 3USDA 3KC1A 5EQ8A 2UXAA 5KDTB 4MMPA 3TMGA 2UYFA 4I9DA 4FAJA 2BJJX 4NQ8A 3M3FA 4OERA 5AE4A 3DP6A 1OVBA 3UIFA 3R26A 2Q74A 1RYXA 5H8QA 3FASA 1R1NA 3N6TA 2Q9TA 1TWYA 1IXIA 1B1HA 4LZ8A 1JEUA 2D3IA 3ILTB 2ZZVA 1A8FA 2Y5LA 4X8RA 1D3KA 4LVQA 1NNKA 3IX1A 1LB8A 2XHDA 4LUBA 3QMFA 1SDXA 4QSCA 4MLVA 2ALUA 1AIVA 4GWSA 2ZNSA 4POWA 1IEJA 1QKAA 2DYXA 3Q28A 1LBBA 4NF6A 5I2KA 2I3VA 4PFYA 1CE2A 4YB6A 3ZKKA 3UK4A 1M5EA 1SI0A 2O51A 5IZ1A 3CG3A 3R6UA 1N7WA 3BIHA 1I6QA 4MJOA 3VVDA 1MY2A 5ITPA 4U1OA 1ZBMA 4PF6A 4F39A 4JVDA 1DK4A 3KOTA 2P2AA 2HPGA 2I0CA 2IA4A 4EQ7A 4OVTA 4GWOA 4X1BA 1AOVA 5TU0A 5FBPA 2F34A 2OWSA 4GLIA 5EYHA 1RDYA 2AL4A 3GLBA 4C0RA 4NF6B 2HHMA 5I2KB 4H0WA 3CR9A 4WEDA 4G68C 4Q30B 3KJTA 5AA2D 2F6PA 3KSXA 2OK2A 1ZTYA 1EZOA 2F3DA 1M5FA 3B6QA 1IMAA 1NH8A 4G4PA 4OQOA 2DSFA 1SD3A 3MZBA 2DDKA 4NF4A 4EF1A 2I0BA 4ESWA 2PBWA 3FXUA 5I58A 5EYFA 3N6UA 3VLVA 2A5TB 3U93A 1URDA 1D9QA 5H8HA 3JZJA 4OYVA 3LUZA 2DXYA 1SBPA 4GIZA 4QFPA 2QS1A 4YB5A 1ELJA 2XX8A 4EUOA 4OVJA 4FECA 2F7AA 2PVUA 3T96B 5ESYA 1URSA 3CIJA 4RK9A 1NNPA 3WAEA 4JSDA 2PMSA 1DCUA 2XXYA 2R71A 2HEUA 4O3AA 4NF4B 2YPNA 1Q1KA 5IGAA 2B65A 4F1VA 2XXRA 1IMEA 3IORA 3CFZA 5H8HB 4H67A 5JTYA 4I3EA 1B1XA 1N84A 2OWZA 1B5HA 1JETA 1LAXA 3L6GA 3H03A 1NV5A 3VLWA 1MY0A 4JVCA 4LA9A 4OFJA 2XX9A 2HXWA 5FHNA 2HAVA 1EZ9A 4ZEBA 2V3TA 2V4CA 4ESXA 1MM7A 1OLAA 3MWBA 3PD8A 4GXAA 2F8DA 1S7YA 3IK6B 1FTMA 1QUKA 4ZECA 3FVGA 5IAIA 3PMVA 2O1MA 3L6HA 1ZJLA 4G68B 1A55A 1FW0A 4KCCA 3FGSA 2FBPA 1L5TA 3FUZA 1BIYA 1NKXA 3TEPA 2THIA 1O63A 4RPNA 3MAMA 2RC8A 2OZZA 1LBCA 2O7UA 1JVYA 1DPPA 2VGQA 2DVZA 1PC3A 2P1SA 4BDOA 2Z8FA 2H5YA 4PBQA 1VR5A 3UP9A 4XKRA 2RC7A 1A40A 3IOUA 1ZLQA 2OJTA 2RCBA 2R6GE 3B8BA 4OVQA 2I58A 4MHFA 4DZ1A 3K4UA 3RNNA 4GRKA 1FPDA 4JSOA 2PT1A 1YCJA 4I3YA 2NOOA 1BK4A 3ZSFA 1NV7A 5BWJA 3F11A 1IXHA 4PF8A 4PFUA 2D5WA 2Z8DA 2DOJA 2F7BA 4POXA 1YYZA 1P1WA 3CVGA 1LGBC 3HSTA 3E13X 3FVNA 1FQBA 4YKPA 5FTHA 4M1VA 1R9LA 4OEVA 5ITOA 3IB2A 5DW8A 1Y4CA 2XXXA 1BP5A 4KHZE 2VPNA 1MDQA 4JWXA 2GHAA 2Z8EA 2GRVA 3OELA 2XXIA 1J1NA 4HE0A 2B3BA 2GH9A 4G8HA 1B7ZA 1B58A 2FHYA 5ET8A 2UYEA 4P0GA 3RGYA 1B05A 1H3DA 2HXRA 2XXKA 1MQGA 4RY1A 2FIXA 2QRYA 4XF5A 2F5XA 2X7QA 3HHGA 1PBQA 5IZZA 4ZZAA 4N6KA 3MPLA 1SPIA 3MP6A 3DP8A 1II5A 1P1UA 3EN3A 3VV5A 4NWDA 4R9GA 1DMBA 2HQ0A 3CSBA 1GV8A 4N8YA 4WKMA 4IO5A
chains in the Genus database with same CATH topology
2IEEA 3RUMA 3BFUA 3QAXA 3PU5A 4LQ5A 3PUYE 4OXVA 2ZXTA 3M8UA 4AB6A 1QJMA 4HCWA 3E9XA 2DWIA 4KCDA 4GF8A 1YAEA 3LSWA 5AA4A 4H5GA 2Z23A 2VP1A 3IJOB 1N0TA 2DP8A 5CM6A 4GD5A 4BDQA 2WKYA 1ZIUA 3TZAA 4X1DA 3T66A 3R7XA 3VVFA 1XVYA 4AB5A 2F6GA 4H65A 1IXCA 3M3LA 3MZ9A 4DLDA 4IB2A 5FTIA 5B7DA 4O3CA 4TOZA 1LCFA 4EQBA 3LC8A 3IB0A 4EXLA 3MW0A 3H6WA 2UVGA 3QUFA 2O84X 5K2XA 4L17A 1XS5A 2F7CA 3KEIA 5TP9A 3HHFA 3DM0A 1QULA 4PE5B 3FJMA 5HM4B 2PX1A 3MVXA 3G7WA 4R73A 2O68A 3IOVA 2I48A 3E3KA 3C4MA 4RPOA 1MXVA 3K6XA 3TODA 1NFTA 3SDFA 4PETA 4E0WA 1MY1A 5KDTA 3PPRA 3SERA 2FNCA 3K1MA 5CRYA 3FXQA 3RT8A 1B3GA 3UGWA 4HS7A 3MVZA 1XC1A 2H25A 3PMWA 3FJ7A 5TP9B 3T9HB 4MF3A 4F3BA 3TPAA 4XIGQ 1IXGA 4F22A 3MBPA 4QFLA 4LZ7A 3LSFB 4Z7EA 3OENA 3TCHA 3FJGA 3FVOA 3LUYA 1QW0A 3GXAA 3EPEA 2CMOA 3DLNA 2DVCA 4RK2A 1H45A 4LQ2A 2HZLA 1SYIA 3TELA 3AXFA 4FORA 1HSEA 2RINA 3K01A 3OO8A 2DWAA 2G93A 4BDRA 4GOTA 4OETA 2V84A 4OTEA 4N6PA 1MY4A 4FIMA 1M5DA 1NNFA 3BFTA 3EF7A 2Y7RA 3TCFA 3LSXA 5EHSA 2XXPA 4KYEA 2UVHA 1JQFA 4MFIA 4OFLA 3S9EA 3PPQA 3SEYA 2ZNTA 1XOCA 1FTOA 3H3GA 2KLFA 2QSXA 2Y7KA 1MH4A 3OEKA 3FV1A 2A5TA 4I1DA 1USYH 1USYE 5L9OA 5DT6A 3O29A 5I2NA 1LFHA 2I3WA 2QS4A 4LP2B 5CBRA 3KG2A 1MRPA 1H76A 1QKBA 3T93B 5DVIA 5KZTA 4RJZA 4ZS9A 1QUJA 3U1OA 1Y20A 1POY1 4Q0CA 4AQ4A 5FHOA 2QPQA 3D4GA 2HCAA 2Q88A 4H5FA 5H8SA 4WXJA 4KD5A 3I6VA 2DE3A 1SVXB 4ZZEA 1ATGA 1A54A 5I2NB 2I4CA 4QF9A 5CMBA 1B0LA 1JW1A 3UORA 2E0SA 2XD2A 2REGA 4EQ9A 1GVCA 3OMBA 3K2DA 5ELVA 5KCJA 2UVJA 1Y3QA 3W9VA 2H9BA 2Y84A 3EHUA 3M3KA 4G68A 2OWTA 3JV9A 4GQOA 4U21A 4FEDA 5AA2A 4NTLA 3K1PA 2E1SA 4PFWA 4HTGA 1B32A 2Z22A 3I3VA 5DTBA 4IY5A 4OESA 3IOTA 1VE4A 4RA1A 4F1UA 5CC2A 4ZEIA 2DWJA 4R72A 3PUVE 3H4ZA 1Y1MA 4LATA 4R9FA 3C36A 1JW4A 4FE8A 3O2AA 3QK6A 3S9LC 3K6VA 5KCJB 4OHNA 4F2QA 3FVKA 3EHSA 3PGFA 2ZYKA 4BDMA 4X9TA 5AA2B 3TQLA 5M2VA 4F3SA 5LOMA 4F31B 1XHYA 4F2OA 3RT6B 3KZGA 1UIVA 1TT1A 1N76A 4U23A 3DELB 1MXXA 3MP1A 2RKMA 1GTKA 2XX7A 3Q27A 4IO2A 1LB9A 4XKQA 4ELRA 3ONMA 1DSNA 1Y3NA 1I6BA 1HSLA 2V93A 3TCGA 4U1ZA 4KFQA 4NWCA 1BTJA 3O6HA 3QUJA 2ZYMA 3G3FA 4H1XA 2HZKA 1VFEA 3CI8A 4RXLA 3FV2A 1FQFA 3MVWA 3MP8A 4MBPA 5J1DA 4E0XA 1N04A 1D4NA 1P1QA 3SKPA 4DXBA 2YLNA 3GZGA 4EF2A 3VXCA 2VD3A 4I8CA 3RPWA 4U2RA 3TTKA 3U92A 5HPQA 1NL5A 2FA7A 4FJPA 2OCUA 2XD3A 4G77A 1RKMA 5L8DA 1R9QA 4Z0IA 4FATA 1IUDA 2PT2A 1B0HA 3OEMA 3TKDA 3B6WA 4YKIA 2ABHA 3OSQA 3QIMA 1EH3A 3TTLA 4IO4A 2ZYNA 4GL0A 3V89B 1N7XA 4C1TA 3H6UA 3TTMA 1HSJA 3V5AA 1MQHA 2GFEA 5CI5A 1B3EA 3LR1A 1IITA 1MH3A 3TAJA 4KYSA 1SI1A 4LZ5A 4KQPA 3HPIA 3PPOA 1NNTA 2I4BA 4QHQA 4QFKA 4EDPA 2P0SA 1Y3PA 1LAGE 1MY3A 2F78A 4QRZA 4IO3A 3CFLA 5JEIA 3S9NC 1MG1A 4IO7A 4P0IA 2Q89A 5TPAA 1MPDA 3K6WA 4RNSA 3N26A 5IKBA 1MM6A 3MPKA 3THIA 1B3FA 3PD9A 2UVIA 4XTCQ 1ANFA 2R9JA 1MXZA 3PUZE 3OXNA 1SW2A 3K00A 3RN8A 4ZEDA 1H43A 5HBCA 2D21A 3FATA 3IO6A 1Y9UA 2X26A 2V25A 5DYHA 3CFXA 1LFIA 4FEBA 1T0KA 3SEVA 5TPAB 3GBBA 1FCKA 3TUSA 2VHAA 3K0VA 3HCQA 2REJA 3IJXB 1N3WA 4F19A 4F18A 1RYOA 3MVYA 1CB6A 3O66A 1MXWA 2O1LA 4MH5A 5H8NA 2XXUA 3PPPA 3S9MC 4H6DA 1SYHA 1B5JA 3H7MA 5I57B 4F29A 1OMPA 4K3FA 4F1YA 2O69A 2VOZA 1MPCA 4THIA 4DE8A 5ICTA 3SEXA 3O97A 4I62A 2QS2A 3TQWA 3KFMA 1I69A 5H8FA 1P1OA 1GR2A 1JNFA 3WAFA 1TXFA 4GVOA 3TFLA 1R6ZA 3PMXA 1VSOA 1N3XA 2AL5A 1LSTA 1PEBA 4NEDA 5H8NB 4YICA 2I49A 5EHMA 4Q8RA 3VVEA 3U8QA 1FTJA 5ISUA 4NF5A 3JYRA 3IB1A 3ZKLA 4PFTA 4QFOA 1SW5A 4X48A 3RLFE 3V83A 3VLUA 4ECFA 5BUUA 1B46A 5H8FB 4YMAA 4YKJA 3Q26A 3CRBA 1UTHA 4JXIA 5CMKA 3SEWA 4DIGA 3K1NA 1EZPA 4OFOA 1FQEA 3KGCA 3KN7A 4BLAA 3A3CA 2H99A 3EQ1A 1Y4TA 1B7HA 3H6TA 4ISUA 1UIUA 3LSLA 3ECRA 3S4UA 5I84A 1H44A 1YTVA 5DEXA 4NF5B 4R2BA 3C35A 4JWYA 1MXYA 3VDFA 1OLCA 4RYAA 2W7YA 1P1NA 5H8QB 3O6IA 3MJNA 2QS3A 1LLSA 1PB7A 1UTHB 3O9PA 3A3UA 3EHTA 4BDLA 3MUQA 2ONRA 3BKIB 2DE4A 3U72A 1FQCA 3MZ1A 3U94A 3FIRA 2DWHA 4DCXA 4QFNA 3DP4A 5CMCA 1GGGA 4G8NA 3D4CA 3PUWE 1PB9A 5DEXB 3T22A 2HFBA 1US5A 3UA8A 4ND9A 4KPTA 4OZ9A 4HW8A 3FXRA 1JEVA 1WVJA 4P11A 4JDFA 2PYYA 2XXTA 4M4GA 1Y1ZA 5K2YA 3OO6A 4O3BA 4PQJA 3O6GA 3A09A 1JVXA 1QVSA 2ZNUA 2XXHA 2B3FA 5DVFA 3MQ9A 1SW4A 4U22A 1FQDA 2VD2A 4NE4A 2H4IA 1BKAA 3HO7A 3VXBA 1AMFA 4R6KA 5A5XA 2G29A 2XXVA 1FTKA 2QL3A 5I58B 3ILUB 3G3JA 1DTZA 4H8JA 1OQHA 4UA8A 4OWDA 2NVUB 1P99A 4UACA 1I6AA 1PB8A 4YAHX 4YU0A 4IY6A 4ELQA 1F9BA 3N94A 2M8CA 3T9UA 1DPEA 5AA3A 1PDAA 4JBZA 3VFJA 1DOTA 4U4XA 3RY3A 2I6EA 1TFAA 5CMMA 3BBRA 3QSLA 3B7DA 2Y7PA 3G3KA 2QMWA 1KWHA 5F1QA 1O7TA 2Y7IA 3Q25A 1NH7A 2DXRA 3RTWB 4YZZA 1MXUA 5A5XB 1B3LA 3TTRA 1MS7A 3PV0E 1LFGA 1OQGA 3C32A 4N07A 5F7VA 5JTYB 3FZVA 3OO9A 1Z7ME 1WDNA 1SQYA 4G8MA 1M5CA 3IO4A 4F3GA 4R74A 1MQJA 2ZYOA 3OO7A 3IOWA 3KN8A 4F3PA 4XXUA 3Q29A 1ZKBA 1A7LA 3G3GA 4JB7A 4DXUA 2V3QA 2AYSA 4XKNA 3KSJA 1M5BA 5L9MA 5B70A 3KN3A 3CG1A 2Y7WA 1US4A 4LONB 1O64A 4R6YA 4EXKA 3PUXE 4WEPA 1S50A 1TFDA 3O28A 2NXOA 2RCAA 3HV1A 2XXWA 3IR1A 1B51A 1PBPA 4YKKA 4NMYA 3E4RA 4ONYA 4GFRA 1A8EA 1B3HA 3QYTA 3RTFB 1MQDA 2LAOA 3C34A 1B9JA 3P7IA 1B52A 1B4ZA 2H98A 4OEUA 3I5OA 1AH5A 2Q8JA 1EU8A 3H06B 1FQAA 3G3IA 4ZDMA 4IGTA 3C33A 3IAZA 1B6HA 1SW1A 1MPBA 3LBSA 1Q35A 4QSEA 3W9WA 3T9XB 2F97A 4IGRA 1WODA 3UN6A 2AIXA 1B7UA 4XKPA 4DCYA 4HCYA 2XXQA 1BLFA 1B2HA 4OENA 4ELPA 3KBRA 1D9YA 2F35A 3QXMA 4MLQA 4H8IA 2QMXA 1DTGA 2OLBA 2DQVA 1ZU0A 4ZEKA 2RF1A 4ZE9A 4GL8A 2A5SA 3C31A 1OVTA 3IL1B 2OBGA 4N13A 3SESA 1QUIA 3VE1B 3N5LA 5ICQA 5I59A 3TTNA 1FTLA 1S9TA 4TQUQ 2DS9A 5JK4A 1YPNA 3CSGA 2ONKE 3K02A 2O6AA 1B5IA 4R6HA 5DVJA 2RC9A 2HAUA 1LAFE 4TLMB 1LAHE 4NF8A 1NMUA 4KR5A 2ESNA 4IO6A 4BDNA 4YMBA 2Q2AA 2YJPA 3V8XB 3TDJA 3MC2A 3SETA 2V3UA 3KJ7A 3B6TA 1VFDA 5I56A 2FYIA 1Z7NE 3T9VA 3G3HA 4R75A 3GBAA 2ONSA 2GHBA 1A99A 5AA4B 4DDDA 4R2FA 2DE2A 5I57A 4ZE8A 3H6VA 2X7PA 3ZS6A 2F36A 4KYDA 2ANJA 4DXCA 5I59B 3ODBA 1AL3A 3SEUA 1UTBA 2ZMBA 1XVXA 4OMBA 3HN0A 2NWJA 3OSRA 3OD7A 1MDP1 4NF8B 5AA1A 1MQIA 2Q2CA 1LCTA 1XT8A 1OIBA 1D9VA 4QSDA 3PPNA 3S2VA 3RQTA 5I56B 5L9SA 4JWOA 4TLLB 1B4HA 2O7IA 3FD3A 3W15C 1UQWA 1IQ7A 4C1UA 4KI0E 2CZLA 3OOAA 1B40A 4U4SA 4GXSB 4Q5TA 1IIWA 1URGA 1ZMGA 1JW5A 5CBSA 1UTBB 3TYHA 3KOSA 4PP0A 4ZEFA 4YB7A 2NUVA 3C9HA 3K6UA 1POTA 2QJEA 4G2ZA 5FHMA 1IZ1A 4ELOA 3USDA 2UXAA 5KDTB 3TMGA 2UYFA 4I9DA 4FAJA 2BJJX 3M3FA 4OERA 5AE4A 3DP6A 1OVBA 3UIFA 3R26A 1RYXA 5H8QA 3FASA 1R1NA 3N6TA 2Q9TA 1TWYA 1IXIA 1B1HA 4LZ8A 1JEUA 2D3IA 3ILTB 1A8FA 1D3KA 4LVQA 1NNKA 3IX1A 1LB8A 2XHDA 4LUBA 1SDXA 4QSCA 4MLVA 2ALUA 1AIVA 2ZNSA 4POWA 1IEJA 1QKAA 2DYXA 3Q28A 1LBBA 4NF6A 5I2KA 2I3VA 4PFYA 1CE2A 4YB6A 3ZKKA 3UK4A 1M5EA 1SI0A 2O51A 3CG3A 3R6UA 1N7WA 1I6QA 3VVDA 1MY2A 5ITPA 4U1OA 1ZBMA 4F39A 3KOTA 2P2AA 2I0CA 2IA4A 4EQ7A 4GWOA 4X1BA 1AOVA 5TU0A 2F34A 2OWSA 4GLIA 2AL4A 3GLBA 4C0RA 4NF6B 5I2KB 4H0WA 3CR9A 4WEDA 4G68C 4Q30B 3KJTA 5AA2D 2F6PA 3KSXA 2OK2A 1ZTYA 1EZOA 1M5FA 3B6QA 1NH8A 4G4PA 4OQOA 2DSFA 1SD3A 3MZBA 4NF4A 4EF1A 2I0BA 4ESWA 2PBWA 3FXUA 5I58A 5EYFA 3N6UA 3VLVA 2A5TB 3U93A 1URDA 5H8HA 3JZJA 4OYVA 2DXYA 1SBPA 4GIZA 4QFPA 2QS1A 4YB5A 1ELJA 2XX8A 4EUOA 4OVJA 4FECA 2F7AA 2PVUA 3T96B 1URSA 3CIJA 4RK9A 1NNPA 3WAEA 4JSDA 2PMSA 2XXYA 2R71A 2HEUA 4O3AA 4NF4B 2YPNA 1Q1KA 2B65A 4F1VA 2XXRA 3IORA 3CFZA 5H8HB 4H67A 5JTYA 1B1XA 1N84A 1B5HA 1JETA 1LAXA 3L6GA 3H03A 3VLWA 1MY0A 4LA9A 4OFJA 2XX9A 2HXWA 5FHNA 2HAVA 1EZ9A 4ZEBA 2V3TA 4ESXA 1MM7A 1OLAA 3MWBA 3PD8A 4GXAA 2F8DA 1S7YA 3IK6B 1FTMA 1QUKA 4ZECA 3FVGA 5IAIA 3PMVA 2O1MA 3L6HA 1ZJLA 4G68B 1A55A 1FW0A 4KCCA 3FGSA 1L5TA 3FUZA 1BIYA 1NKXA 3TEPA 2THIA 1O63A 4RPNA 3MAMA 2RC8A 2OZZA 1LBCA 2O7UA 1JVYA 1DPPA 2VGQA 2DVZA 1PC3A 2P1SA 4BDOA 2Z8FA 2H5YA 1VR5A 3UP9A 4XKRA 2RC7A 1A40A 3IOUA 1ZLQA 2OJTA 2RCBA 2R6GE 2I58A 4DZ1A 3K4UA 3RNNA 4GRKA 4JSOA 2PT1A 1YCJA 2NOOA 3ZSFA 5BWJA 3F11A 1IXHA 4PFUA 2D5WA 2Z8DA 2DOJA 2F7BA 4POXA 1P1WA 3CVGA 1LGBC 3HSTA 3E13X 3FVNA 1FQBA 4YKPA 5FTHA 4M1VA 1R9LA 4OEVA 5ITOA 3IB2A 1Y4CA 2XXXA 1BP5A 4KHZE 1MDQA 4JWXA 2GHAA 2Z8EA 2GRVA 3OELA 2XXIA 1J1NA 2B3BA 2GH9A 4G8HA 1B7ZA 1B58A 2UYEA 4P0GA 3RGYA 1B05A 1H3DA 1MQGA 4RY1A 2QRYA 2F5XA 2X7QA 3HHGA 1PBQA 4ZZAA 3MPLA 3MP6A 3DP8A 1II5A 1P1UA 3EN3A 3VV5A 4NWDA 4R9GA 1DMBA 2HQ0A 3CSBA 1GV8A 4WKMA 4IO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IEE A;  3RUM A;  3BFU A;  3QAX A;  3PU5 A;  4LQ5 A;  3PUY E;  4OXV A;  2ZXT A;  3M8U A;  4AB6 A;  1QJM A;  4HCW A;  3E9X A;  2DWI A;  4KCD A;  4GF8 A;  1YAE A;  3LSW A;  5AA4 A;  4H5G A;  2Z23 A;  2VP1 A;  3IJO B;  1N0T A;  2DP8 A;  5CM6 A;  4GD5 A;  4BDQ A;  2WKY A;  1ZIU A;  3TZA A;  4X1D A;  3T66 A;  3R7X A;  3VVF A;  1XVY A;  4AB5 A;  2F6G A;  4H65 A;  1IXC A;  3M3L A;  3MZ9 A;  4DLD A;  4IB2 A;  5FTI A;  5B7D A;  4O3C A;  4TOZ A;  1LCF A;  4EQB A;  3LC8 A;  3IB0 A;  4EXL A;  3MW0 A;  3H6W A;  2UVG A;  3QUF A;  2O84 X;  5K2X A;  4L17 A;  1XS5 A;  2F7C A;  3KEI A;  5TP9 A;  3HHF A;  3DM0 A;  1QUL A;  4PE5 B;  3FJM A;  5HM4 B;  2PX1 A;  3MVX A;  3G7W A;  4R73 A;  2O68 A;  3IOV A;  2I48 A;  3E3K A;  3C4M A;  4RPO A;  1MXV A;  3K6X A;  3TOD A;  1NFT A;  3SDF A;  4PET A;  4E0W A;  1MY1 A;  5KDT A;  3PPR A;  3SER A;  2FNC A;  3K1M A;  5CRY A;  3FXQ A;  3RT8 A;  1B3G A;  3UGW A;  4HS7 A;  3MVZ A;  1XC1 A;  2H25 A;  3PMW A;  3FJ7 A;  5TP9 B;  3T9H B;  4MF3 A;  4F3B A;  3TPA A;  4XIG Q;  1IXG A;  4F22 A;  3MBP A;  4QFL A;  4LZ7 A;  3LSF B;  4Z7E A;  3OEN A;  3TCH A;  3FJG A;  3FVO A;  3LUY A;  1QW0 A;  3GXA A;  3EPE A;  2CMO A;  3DLN A;  2DVC A;  4RK2 A;  1H45 A;  4LQ2 A;  2HZL A;  1SYI A;  3TEL A;  3AXF A;  4FOR A;  1HSE A;  2RIN A;  3K01 A;  3OO8 A;  2DWA A;  2G93 A;  4BDR A;  4GOT A;  4OET A;  2V84 A;  4OTE A;  4N6P A;  1MY4 A;  4FIM A;  1M5D A;  1NNF A;  3BFT A;  3EF7 A;  2Y7R A;  3TCF A;  3LSX A;  5EHS A;  2XXP A;  4KYE A;  2UVH A;  1JQF A;  4MFI A;  4OFL A;  3S9E A;  3PPQ A;  3SEY A;  2ZNT A;  1XOC A;  1FTO A;  3H3G A;  2KLF A;  2QSX A;  2Y7K A;  1MH4 A;  3OEK A;  3FV1 A;  2A5T A;  4I1D A;  1USY H;  1USY E;  5L9O A;  5DT6 A;  3O29 A;  5I2N A;  1LFH A;  2I3W A;  2QS4 A;  4LP2 B;  5CBR A;  3KG2 A;  1MRP A;  1H76 A;  1QKB A;  3T93 B;  5DVI A;  5KZT A;  4RJZ A;  4ZS9 A;  1QUJ A;  3U1O A;  1Y20 A;  1POY 1;  4Q0C A;  4AQ4 A;  5FHO A;  2QPQ A;  3D4G A;  2HCA A;  2Q88 A;  4H5F A;  5H8S A;  4WXJ A;  4KD5 A;  3I6V A;  2DE3 A;  1SVX B;  4ZZE A;  1ATG A;  1A54 A;  5I2N B;  2I4C A;  4QF9 A;  5CMB A;  1B0L A;  1JW1 A;  3UOR A;  2E0S A;  2XD2 A;  2REG A;  4EQ9 A;  1GVC A;  3OMB A;  3K2D A;  5ELV A;  5KCJ A;  2UVJ A;  1Y3Q A;  3W9V A;  2H9B A;  2Y84 A;  3EHU A;  3M3K A;  4G68 A;  2OWT A;  3JV9 A;  4GQO A;  4U21 A;  4FED A;  5AA2 A;  4NTL A;  3K1P A;  2E1S A;  4PFW A;  4HTG A;  1B32 A;  2Z22 A;  3I3V A;  5DTB A;  4IY5 A;  4OES A;  3IOT A;  1VE4 A;  4RA1 A;  4F1U A;  5CC2 A;  4ZEI A;  2DWJ A;  4R72 A;  3PUV E;  3H4Z A;  1Y1M A;  4LAT A;  4R9F A;  3C36 A;  1JW4 A;  4FE8 A;  3O2A A;  3QK6 A;  3S9L C;  3K6V A;  5KCJ B;  4OHN A;  4F2Q A;  3FVK A;  3EHS A;  3PGF A;  2ZYK A;  4BDM A;  4X9T A;  5AA2 B;  3TQL A;  5M2V A;  4F3S A;  5LOM A;  4F31 B;  1XHY A;  4F2O A;  3RT6 B;  3KZG A;  1UIV A;  1TT1 A;  1N76 A;  4U23 A;  3DEL B;  1MXX A;  3MP1 A;  2RKM A;  1GTK A;  2XX7 A;  3Q27 A;  4IO2 A;  1LB9 A;  4XKQ A;  4ELR A;  3ONM A;  1DSN A;  1Y3N A;  1I6B A;  1HSL A;  2V93 A;  3TCG A;  4U1Z A;  4KFQ A;  4NWC A;  1BTJ A;  3O6H A;  3QUJ A;  2ZYM A;  3G3F A;  4H1X A;  2HZK A;  1VFE A;  3CI8 A;  4RXL A;  3FV2 A;  1FQF A;  3MVW A;  3MP8 A;  4MBP A;  5J1D A;  4E0X A;  1N04 A;  1D4N A;  1P1Q A;  3SKP A;  4DXB A;  2YLN A;  3GZG A;  4EF2 A;  3VXC A;  2VD3 A;  4I8C A;  3RPW A;  4U2R A;  3TTK A;  3U92 A;  5HPQ A;  1NL5 A;  2FA7 A;  4FJP A;  2OCU A;  2XD3 A;  4G77 A;  1RKM A;  5L8D A;  1R9Q A;  4Z0I A;  4FAT A;  1IUD A;  2PT2 A;  1B0H A;  3OEM A;  3TKD A;  3B6W A;  4YKI A;  2ABH A;  3OSQ A;  3QIM A;  1EH3 A;  3TTL A;  4IO4 A;  2ZYN A;  4GL0 A;  3V89 B;  1N7X A;  4C1T A;  3H6U A;  3TTM A;  1HSJ A;  3V5A A;  1MQH A;  2GFE A;  5CI5 A;  1B3E A;  3LR1 A;  1IIT A;  1MH3 A;  3TAJ A;  4KYS A;  1SI1 A;  4LZ5 A;  4KQP A;  3HPI A;  3PPO A;  1NNT A;  2I4B A;  4QHQ A;  4QFK A;  4EDP A;  2P0S A;  1Y3P A;  1LAG E;  1MY3 A;  2F78 A;  4QRZ A;  4IO3 A;  3CFL A;  5JEI A;  3S9N C;  1MG1 A;  4IO7 A;  4P0I A;  2Q89 A;  5TPA A;  1MPD A;  3K6W A;  4RNS A;  3N26 A;  5IKB A;  1MM6 A;  3MPK A;  3THI A;  1B3F A;  3PD9 A;  2UVI A;  4XTC Q;  1ANF A;  2R9J A;  1MXZ A;  3PUZ E;  3OXN A;  1SW2 A;  3K00 A;  3RN8 A;  4ZED A;  1H43 A;  5HBC A;  2D21 A;  3FAT A;  3IO6 A;  1Y9U A;  2X26 A;  2V25 A;  5DYH A;  3CFX A;  1LFI A;  4FEB A;  1T0K A;  3SEV A;  5TPA B;  3GBB A;  1FCK A;  3TUS A;  2VHA A;  3K0V A;  3HCQ A;  2REJ A;  3IJX B;  1N3W A;  4F19 A;  4F18 A;  1RYO A;  3MVY A;  1CB6 A;  3O66 A;  1MXW A;  2O1L A;  4MH5 A;  5H8N A;  2XXU A;  3PPP A;  3S9M C;  4H6D A;  1SYH A;  1B5J A;  3H7M A;  5I57 B;  4F29 A;  1OMP A;  4K3F A;  4F1Y A;  2O69 A;  2VOZ A;  1MPC A;  4THI A;  4DE8 A;  5ICT A;  3SEX A;  3O97 A;  4I62 A;  2QS2 A;  3TQW A;  3KFM A;  1I69 A;  5H8F A;  1P1O A;  1GR2 A;  1JNF A;  3WAF A;  1TXF A;  4GVO A;  3TFL A;  1R6Z A;  3PMX A;  1VSO A;  1N3X A;  2AL5 A;  1LST A;  1PEB A;  4NED A;  5H8N B;  4YIC A;  2I49 A;  5EHM A;  4Q8R A;  3VVE A;  3U8Q A;  1FTJ A;  5ISU A;  4NF5 A;  3JYR A;  3IB1 A;  3ZKL A;  4PFT A;  4QFO A;  1SW5 A;  4X48 A;  3RLF E;  3V83 A;  3VLU A;  4ECF A;  5BUU A;  1B46 A;  5H8F B;  4YMA A;  4YKJ A;  3Q26 A;  3CRB A;  1UTH A;  4JXI A;  5CMK A;  3SEW A;  4DIG A;  3K1N A;  1EZP A;  4OFO A;  1FQE A;  3KGC A;  3KN7 A;  4BLA A;  3A3C A;  2H99 A;  3EQ1 A;  1Y4T A;  1B7H A;  3H6T A;  4ISU A;  1UIU A;  3LSL A;  3ECR A;  3S4U A;  5I84 A;  1H44 A;  1YTV A;  5DEX A;  4NF5 B;  4R2B A;  3C35 A;  4JWY A;  1MXY A;  3VDF A;  1OLC A;  4RYA A;  2W7Y A;  1P1N A;  5H8Q B;  3O6I A;  3MJN A;  2QS3 A;  1LLS A;  1PB7 A;  1UTH B;  3O9P A;  3A3U A;  3EHT A;  4BDL A;  3MUQ A;  2ONR A;  3BKI B;  2DE4 A;  3U72 A;  1FQC A;  3MZ1 A;  3U94 A;  3FIR A;  2DWH A;  4DCX A;  4QFN A;  3DP4 A;  5CMC A;  1GGG A;  4G8N A;  3D4C A;  3PUW E;  1PB9 A;  5DEX B;  3T22 A;  2HFB A;  1US5 A;  3UA8 A;  4ND9 A;  4KPT A;  4OZ9 A;  4HW8 A;  3FXR A;  1JEV A;  1WVJ A;  4P11 A;  4JDF A;  2PYY A;  2XXT A;  4M4G A;  1Y1Z A;  5K2Y A;  3OO6 A;  4O3B A;  4PQJ A;  3O6G A;  3A09 A;  1JVX A;  1QVS A;  2ZNU A;  2XXH A;  2B3F A;  5DVF A;  3MQ9 A;  1SW4 A;  4U22 A;  1FQD A;  2VD2 A;  4NE4 A;  2H4I A;  1BKA A;  3HO7 A;  3VXB A;  1AMF A;  4R6K A;  5A5X A;  2G29 A;  2XXV A;  1FTK A;  2QL3 A;  5I58 B;  3ILU B;  3G3J A;  1DTZ A;  4H8J A;  1OQH A;  4UA8 A;  4OWD A;  2NVU B;  1P99 A;  4UAC A;  1I6A A;  1PB8 A;  4YAH X;  4YU0 A;  4IY6 A;  4ELQ A;  1F9B A;  3N94 A;  2M8C A;  3T9U A;  1DPE A;  5AA3 A;  1PDA A;  4JBZ A;  3VFJ A;  1DOT A;  4U4X A;  3RY3 A;  2I6E A;  1TFA A;  5CMM A;  3BBR A;  3QSL A;  3B7D A;  2Y7P A;  3G3K A;  2QMW A;  1KWH A;  5F1Q A;  1O7T A;  2Y7I A;  3Q25 A;  1NH7 A;  2DXR A;  3RTW B;  4YZZ A;  1MXU A;  5A5X B;  1B3L A;  3TTR A;  1MS7 A;  3PV0 E;  1LFG A;  1OQG A;  3C32 A;  4N07 A;  5F7V A;  5JTY B;  3FZV A;  3OO9 A;  1Z7M E;  1WDN A;  1SQY A;  4G8M A;  1M5C A;  3IO4 A;  4F3G A;  4R74 A;  1MQJ A;  2ZYO A;  3OO7 A;  3IOW A;  3KN8 A;  4F3P A;  4XXU A;  3Q29 A;  1ZKB A;  1A7L A;  3G3G A;  4JB7 A;  4DXU A;  2V3Q A;  2AYS A;  4XKN A;  3KSJ A;  1M5B A;  5L9M A;  5B70 A;  3KN3 A;  3CG1 A;  2Y7W A;  1US4 A;  4LON B;  1O64 A;  4R6Y A;  4EXK A;  3PUX E;  4WEP A;  1S50 A;  1TFD A;  3O28 A;  2NXO A;  2RCA A;  3HV1 A;  2XXW A;  3IR1 A;  1B51 A;  1PBP A;  4YKK A;  4NMY A;  3E4R A;  4ONY A;  4GFR A;  1A8E A;  1B3H A;  3QYT A;  3RTF B;  1MQD A;  2LAO A;  3C34 A;  1B9J A;  3P7I A;  1B52 A;  1B4Z A;  2H98 A;  4OEU A;  3I5O A;  1AH5 A;  2Q8J A;  1EU8 A;  3H06 B;  1FQA A;  3G3I A;  4ZDM A;  4IGT A;  3C33 A;  3IAZ A;  1B6H A;  1SW1 A;  1MPB A;  3LBS A;  1Q35 A;  4QSE A;  3W9W A;  3T9X B;  2F97 A;  4IGR A;  1WOD A;  3UN6 A;  2AIX A;  1B7U A;  4XKP A;  4DCY A;  4HCY A;  2XXQ A;  1BLF A;  1B2H A;  4OEN A;  4ELP A;  3KBR A;  1D9Y A;  2F35 A;  3QXM A;  4MLQ A;  4H8I A;  2QMX A;  1DTG A;  2OLB A;  2DQV A;  1ZU0 A;  4ZEK A;  2RF1 A;  4ZE9 A;  4GL8 A;  2A5S A;  3C31 A;  1OVT A;  3IL1 B;  2OBG A;  4N13 A;  3SES A;  1QUI A;  3VE1 B;  3N5L A;  5ICQ A;  5I59 A;  3TTN A;  1FTL A;  1S9T A;  4TQU Q;  2DS9 A;  5JK4 A;  1YPN A;  3CSG A;  2ONK E;  3K02 A;  2O6A A;  1B5I A;  4R6H A;  5DVJ A;  2RC9 A;  2HAU A;  1LAF E;  4TLM B;  1LAH E;  4NF8 A;  1NMU A;  4KR5 A;  2ESN A;  4IO6 A;  4BDN A;  4YMB A;  2Q2A A;  2YJP A;  3V8X B;  3TDJ A;  3MC2 A;  3SET A;  2V3U A;  3KJ7 A;  3B6T A;  1VFD A;  5I56 A;  2FYI A;  1Z7N E;  3T9V A;  3G3H A;  4R75 A;  3GBA A;  2ONS A;  2GHB A;  1A99 A;  5AA4 B;  4DDD A;  4R2F A;  2DE2 A;  5I57 A;  4ZE8 A;  3H6V A;  2X7P A;  3ZS6 A;  2F36 A;  4KYD A;  2ANJ A;  4DXC A;  5I59 B;  3ODB A;  1AL3 A;  3SEU A;  1UTB A;  2ZMB A;  1XVX A;  4OMB A;  3HN0 A;  2NWJ A;  3OSR A;  3OD7 A;  1MDP 1;  4NF8 B;  5AA1 A;  1MQI A;  2Q2C A;  1LCT A;  1XT8 A;  1OIB A;  1D9V A;  4QSD A;  3PPN A;  3S2V A;  3RQT A;  5I56 B;  5L9S A;  4JWO A;  4TLL B;  1B4H A;  2O7I A;  3FD3 A;  3W15 C;  1UQW A;  1IQ7 A;  4C1U A;  4KI0 E;  2CZL A;  3OOA A;  1B40 A;  4U4S A;  4GXS B;  4Q5T A;  1IIW A;  1URG A;  1ZMG A;  1JW5 A;  5CBS A;  1UTB B;  3TYH A;  3KOS A;  4PP0 A;  4ZEF A;  4YB7 A;  2NUV A;  3C9H A;  3K6U A;  1POT A;  2QJE A;  4G2Z A;  5FHM A;  1IZ1 A;  4ELO A;  3USD A;  2UXA A;  5KDT B;  3TMG A;  2UYF A;  4I9D A;  4FAJ A;  2BJJ X;  3M3F A;  4OER A;  5AE4 A;  3DP6 A;  1OVB A;  3UIF A;  3R26 A;  1RYX A;  5H8Q A;  3FAS A;  1R1N A;  3N6T A;  2Q9T A;  1TWY A;  1IXI A;  1B1H A;  4LZ8 A;  1JEU A;  2D3I A;  3ILT B;  1A8F A;  1D3K A;  4LVQ A;  1NNK A;  3IX1 A;  1LB8 A;  2XHD A;  4LUB A;  1SDX A;  4QSC A;  4MLV A;  2ALU A;  1AIV A;  2ZNS A;  4POW A;  1IEJ A;  1QKA A;  2DYX A;  3Q28 A;  1LBB A;  4NF6 A;  5I2K A;  2I3V A;  4PFY A;  1CE2 A;  4YB6 A;  3ZKK A;  3UK4 A;  1M5E A;  1SI0 A;  2O51 A;  3CG3 A;  3R6U A;  1N7W A;  1I6Q A;  3VVD A;  1MY2 A;  5ITP A;  4U1O A;  1ZBM A;  4F39 A;  3KOT A;  2P2A A;  2I0C A;  2IA4 A;  4EQ7 A;  4GWO A;  4X1B A;  1AOV A;  5TU0 A;  2F34 A;  2OWS A;  4GLI A;  2AL4 A;  3GLB A;  4C0R A;  4NF6 B;  5I2K B;  4H0W A;  3CR9 A;  4WED A;  4G68 C;  4Q30 B;  3KJT A;  5AA2 D;  2F6P A;  3KSX A;  2OK2 A;  1ZTY A;  1EZO A;  1M5F A;  3B6Q A;  1NH8 A;  4G4P A;  4OQO A;  2DSF A;  1SD3 A;  3MZB A;  4NF4 A;  4EF1 A;  2I0B A;  4ESW A;  2PBW A;  3FXU A;  5I58 A;  5EYF A;  3N6U A;  3VLV A;  2A5T B;  3U93 A;  1URD A;  5H8H A;  3JZJ A;  4OYV A;  2DXY A;  1SBP A;  4GIZ A;  4QFP A;  2QS1 A;  4YB5 A;  1ELJ A;  2XX8 A;  4EUO A;  4OVJ A;  4FEC A;  2F7A A;  2PVU A;  3T96 B;  1URS A;  3CIJ A;  4RK9 A;  1NNP A;  3WAE A;  4JSD A;  2PMS A;  2XXY A;  2R71 A;  2HEU A;  4O3A A;  4NF4 B;  2YPN A;  1Q1K A;  2B65 A;  4F1V A;  2XXR A;  3IOR A;  3CFZ A;  5H8H B;  4H67 A;  5JTY A;  1B1X A;  1N84 A;  1B5H A;  1JET A;  1LAX A;  3L6G A;  3H03 A;  3VLW A;  1MY0 A;  4LA9 A;  4OFJ A;  2XX9 A;  2HXW A;  5FHN A;  2HAV A;  1EZ9 A;  4ZEB A;  2V3T A;  4ESX A;  1MM7 A;  1OLA A;  3MWB A;  3PD8 A;  4GXA A;  2F8D A;  1S7Y A;  3IK6 B;  1FTM A;  1QUK A;  4ZEC A;  3FVG A;  5IAI A;  3PMV A;  2O1M A;  3L6H A;  1ZJL A;  4G68 B;  1A55 A;  1FW0 A;  4KCC A;  3FGS A;  1L5T A;  3FUZ A;  1BIY A;  1NKX A;  3TEP A;  2THI A;  1O63 A;  4RPN A;  3MAM A;  2RC8 A;  2OZZ A;  1LBC A;  2O7U A;  1JVY A;  1DPP A;  2VGQ A;  2DVZ A;  1PC3 A;  2P1S A;  4BDO A;  2Z8F A;  2H5Y A;  1VR5 A;  3UP9 A;  4XKR A;  2RC7 A;  1A40 A;  3IOU A;  1ZLQ A;  2OJT A;  2RCB A;  2R6G E;  2I58 A;  4DZ1 A;  3K4U A;  3RNN A;  4GRK A;  4JSO A;  2PT1 A;  1YCJ A;  2NOO A;  3ZSF A;  5BWJ A;  3F11 A;  1IXH A;  4PFU A;  2D5W A;  2Z8D A;  2DOJ A;  2F7B A;  4POX A;  1P1W A;  3CVG A;  1LGB C;  3HST A;  3E13 X;  3FVN A;  1FQB A;  4YKP A;  5FTH A;  4M1V A;  1R9L A;  4OEV A;  5ITO A;  3IB2 A;  1Y4C A;  2XXX A;  1BP5 A;  4KHZ E;  1MDQ A;  4JWX A;  2GHA A;  2Z8E A;  2GRV A;  3OEL A;  2XXI A;  1J1N A;  2B3B A;  2GH9 A;  4G8H A;  1B7Z A;  1B58 A;  2UYE A;  4P0G A;  3RGY A;  1B05 A;  1H3D A;  1MQG A;  4RY1 A;  2QRY A;  2F5X A;  2X7Q A;  3HHG A;  1PBQ A;  4ZZA A;  3MPL A;  3MP6 A;  3DP8 A;  1II5 A;  1P1U A;  3EN3 A;  3VV5 A;  4NWD A;  4R9G A;  1DMB A;  2HQ0 A;  3CSB A;  1GV8 A;  4WKM A;  4IO5 A; 
#chains in the Genus database with same CATH topology
 2IEE A;  3RUM A;  3BFU A;  3QAX A;  3PU5 A;  4KXP A;  1NUY A;  4LQ5 A;  3PUY E;  4OXV A;  3U65 A;  2ZXT A;  3M8U A;  4AB6 A;  1QJM A;  4HCW A;  3E9X A;  2DWI A;  4KCD A;  4GF8 A;  1YAE A;  3LSW A;  5AA4 A;  4H5G A;  2Z23 A;  2VP1 A;  3IJO B;  1N0T A;  2DP8 A;  4JVI A;  4P1E A;  5CM6 A;  4GD5 A;  4BDQ A;  2WKY A;  4P8B A;  1ZIU A;  3TZA A;  4X1D A;  3T66 A;  3R7X A;  3VVF A;  1XVY A;  1KZ8 A;  4AB5 A;  2CZH A;  2F6G A;  4H65 A;  1IXC A;  3M3L A;  3MZ9 A;  4DLD A;  4IB2 A;  5FTI A;  5B7D A;  4O3C A;  4TOZ A;  1LCF A;  4EQB A;  3LC8 A;  3IB0 A;  4EXL A;  3MW0 A;  3H6W A;  2UVG A;  3QUF A;  2GQ1 A;  2O84 X;  5K2X A;  4L17 A;  1XS5 A;  2F7C A;  3KEI A;  2L5V A;  5TP9 A;  4PTK A;  3HHF A;  4NHB A;  3DM0 A;  1QUL A;  4PE5 B;  3FJM A;  4PE3 A;  5HM4 B;  2PX1 A;  3MVX A;  3G7W A;  4R73 A;  2O68 A;  3IOV A;  2I48 A;  3E3K A;  3D1R A;  3C4M A;  4RPO A;  1MXV A;  3K6X A;  2KR0 A;  3TOD A;  1NFT A;  3SDF A;  4PET A;  5LDZ A;  4E0W A;  1K9Y A;  1MY1 A;  5EQA A;  4NF0 A;  5KDT A;  3GYY A;  3PPR A;  3SER A;  2FNC A;  3K1M A;  5CRY A;  3FXQ A;  3RT8 A;  1B3G A;  3UGW A;  4OVP A;  5EQ7 A;  4HS7 A;  3RYD A;  3MVZ A;  1XC1 A;  2H25 A;  3PMW A;  3FJ7 A;  5TP9 B;  3T9H B;  4MF3 A;  3EKI A;  4F3B A;  3TPA A;  4XIG Q;  1IXG A;  1AWB A;  4F22 A;  1YXI A;  3MBP A;  4QFL A;  4LZ7 A;  4MNC A;  3LSF B;  4Z7E A;  3OEN A;  1FRP A;  3TCH A;  3FJG A;  3FVO A;  3LUY A;  1QW0 A;  3GXA A;  3EPE A;  5ET7 A;  2CMO A;  3DLN A;  2DVC A;  1FPJ A;  4RK2 A;  1H45 A;  1FPK A;  4LQ2 A;  1KA0 A;  2FVZ A;  4O7M A;  2HZL A;  1SYI A;  3TEL A;  2R8T A;  3AXF A;  4FOR A;  1HSE A;  3BIG A;  4H46 A;  2RIN A;  3K01 A;  3OO8 A;  2DWA A;  2G93 A;  3CHG A;  4BDR A;  4GOT A;  4OET A;  2V84 A;  4OTE A;  4N6P A;  1LBV A;  1MY4 A;  4FIM A;  1M5D A;  1FPE A;  1NNF A;  3BFT A;  3EF7 A;  2Y7R A;  4GWX A;  3TCF A;  3LSX A;  5EHS A;  2XXP A;  4KYE A;  4N17 A;  2UVH A;  1JQF A;  4MFI A;  4OFL A;  3S9E A;  3PPQ A;  3SEY A;  2ZNT A;  2XWK A;  1XOC A;  1FTO A;  3H3G A;  2KLF A;  2QSX A;  1FBP A;  2Y7K A;  1MH4 A;  3OEK A;  3FV1 A;  2A5T A;  4I1D A;  1USY H;  1USY E;  5T3J A;  5L9O A;  5DT6 A;  3O29 A;  4HE1 A;  4PC9 A;  5I2N A;  1LFH A;  2I3W A;  2QS4 A;  4P1L A;  4LP2 B;  5CBR A;  3KG2 A;  1MRP A;  1DBZ A;  1H76 A;  1QKB A;  3T93 B;  5DVI A;  1NUW A;  5KZT A;  4RJZ A;  4ZS9 A;  1QUJ A;  3MST A;  3U1O A;  4O7I A;  1Y20 A;  1POY 1;  4Q0C A;  4AQ4 A;  5FHO A;  2QPQ A;  3D4G A;  2HCA A;  2Q88 A;  4GWW A;  4H5F A;  5H8S A;  4WXJ A;  4KD5 A;  3I6V A;  2DE3 A;  4XEQ A;  1SVX B;  1FTA A;  4ZZE A;  3SZP A;  1ATG A;  1A54 A;  1NV3 A;  5I2N B;  2I4C A;  4QF9 A;  5CMB A;  1B0L A;  1JW1 A;  3UOR A;  2E0S A;  2XD2 A;  2PFZ A;  2REG A;  4P56 A;  1FPB A;  4EQ9 A;  1GVC A;  3B50 A;  3OMB A;  3K2D A;  5ELV A;  5EQ9 A;  5KCJ A;  2UVJ A;  1Y3Q A;  3W9V A;  2H9B A;  4G68 A;  1FBF A;  4NAP A;  2Y84 A;  3EHU A;  3M3K A;  2OWT A;  3JV9 A;  4PDD A;  4GQO A;  4U21 A;  4FED A;  5AA2 A;  2B4L A;  4NTL A;  3K1P A;  2E1S A;  4PFW A;  4HTG A;  1B32 A;  2Z22 A;  5F24 A;  3I3V A;  3T0J A;  5DTB A;  4IY5 A;  4OES A;  3IOT A;  1VE4 A;  4RA1 A;  4N81 A;  1K9Z A;  4F1U A;  5CC2 A;  4ZEI A;  2DWJ A;  2Q8M A;  4R72 A;  3PUV E;  3H4Z A;  1Y1M A;  4LAT A;  4R9F A;  3C36 A;  1JW4 A;  4FE8 A;  4I40 A;  2QFL A;  3O2A A;  1VDW A;  3QK6 A;  3S9L C;  1XI6 A;  3K6V A;  5KCJ B;  4OHN A;  4F2Q A;  3FVK A;  3EHS A;  3PGF A;  2ZYK A;  3ROJ A;  4BDM A;  4PFR A;  4X9T A;  5AA2 B;  3TQL A;  5M2V A;  4F3S A;  4NG7 A;  5LOM A;  4F31 B;  1XHY A;  4F2O A;  3T1B A;  5IM2 A;  1LEV A;  3RT6 B;  1FJ9 A;  3KZG A;  1UIV A;  1TT1 A;  1N76 A;  4U23 A;  3DEL B;  1MXX A;  3MP1 A;  2RKM A;  1GTK A;  2XX7 A;  3Q27 A;  4IO2 A;  1LB9 A;  4XKQ A;  4ELR A;  3ONM A;  1DSN A;  1Y3N A;  1I6B A;  1HSL A;  4PCD A;  2V93 A;  3TCG A;  4U1Z A;  5A5L A;  4KFQ A;  4NWC A;  1BTJ A;  3HFU A;  3O6H A;  3QUJ A;  2ZYM A;  3G3F A;  4H1X A;  5EYG A;  2CEX A;  1VFE A;  2HZK A;  4O8M A;  3CI8 A;  4RXL A;  3FV2 A;  1FQF A;  3MVW A;  3MP8 A;  4MBP A;  4H45 A;  5J1D A;  4E0X A;  1N04 A;  1D4N A;  4PAF A;  2FIE A;  1P1Q A;  3SKP A;  4DXB A;  3E79 A;  2YLN A;  3GZG A;  4EF2 A;  3VXC A;  2VD3 A;  4PFI A;  4I8C A;  3RPW A;  4U2R A;  3TTK A;  3U92 A;  5HPQ A;  1NL5 A;  2FA7 A;  4FJP A;  2OCU A;  2XD3 A;  4G77 A;  1RKM A;  2P3N A;  5L8D A;  1R9Q A;  4HXV A;  4Z0I A;  4P9K A;  4FAT A;  1IUD A;  2PT2 A;  4GWY A;  1B0H A;  3OEM A;  3TKD A;  3B6W A;  4YKI A;  2ABH A;  3OSQ A;  3QIM A;  2VPO A;  1EH3 A;  3TTL A;  4IO4 A;  2ZYN A;  4GL0 A;  3V89 B;  1N7X A;  4C1T A;  2XWV A;  3H6U A;  3TTM A;  3A29 A;  1HSJ A;  4N91 A;  3V5A A;  4GBW A;  1MQH A;  2GFE A;  5CI5 A;  1B3E A;  3LR1 A;  1IIT A;  1MH3 A;  4OVS A;  3TAJ A;  4PAK A;  4KYS A;  1SI1 A;  4LZ5 A;  4PFB A;  4KQP A;  3HPI A;  3PPO A;  1NNT A;  2XWO A;  2I4B A;  4QFK A;  4QHQ A;  4EDP A;  1FBE A;  2P0S A;  1Y3P A;  1LAG E;  1MY3 A;  2F78 A;  4HE2 A;  4QRZ A;  1QGX A;  4IO3 A;  3CFL A;  5JEI A;  3S9N C;  1MG1 A;  4IO7 A;  4P0I A;  2Q89 A;  5TPA A;  1MPD A;  3K6W A;  4RNS A;  3N26 A;  2PFY A;  5IKB A;  1MM6 A;  3FXB A;  3MPK A;  3THI A;  2VT5 A;  1B3F A;  3PD9 A;  4P3L A;  2UVI A;  4XTC Q;  1ANF A;  2WBD A;  2R9J A;  1MXZ A;  3PUZ E;  2QVR A;  3OXN A;  1IMD A;  2F3B A;  1SW2 A;  3K00 A;  3RN8 A;  4ZED A;  1H43 A;  5HBC A;  2D21 A;  3FAT A;  3IO6 A;  4N8G A;  1Y9U A;  2X26 A;  2V25 A;  5DYH A;  3CFX A;  1LFI A;  4FEB A;  1T0K A;  4MCO A;  3SEV A;  5TPA B;  2WBB A;  4NN3 A;  3GBB A;  1FCK A;  3TUS A;  2VHA A;  3K0V A;  3HCQ A;  2REJ A;  3IJX B;  3KBZ A;  1N3W A;  4F19 A;  2QVV A;  4F18 A;  1RYO A;  3MVY A;  1CB6 A;  3O66 A;  1MXW A;  2O1L A;  4MH5 A;  4NX1 A;  1CNQ A;  4GBV A;  5H8N A;  2XXU A;  3PPP A;  2ZZW A;  3S9M C;  4H6D A;  1SYH A;  4PGN A;  1B5J A;  1JP4 A;  3H7M A;  5I57 B;  4F29 A;  1OMP A;  4K3F A;  4F1Y A;  2O69 A;  2VOZ A;  1MPC A;  4THI A;  4DE8 A;  5ICT A;  3SEX A;  3O97 A;  4I62 A;  2QS2 A;  2PCR A;  1RDX A;  3TQW A;  3KFM A;  1I69 A;  5H8F A;  1P1O A;  5LTC A;  2P3V A;  1GR2 A;  1JNF A;  3WAF A;  1TXF A;  4GX3 A;  4GVO A;  3TFL A;  1R6Z A;  3PMX A;  4MEV A;  1VSO A;  1N3X A;  2AL5 A;  1LST A;  1PEB A;  2WYK A;  4NED A;  5H8N B;  4YIC A;  2CZI A;  2OX3 A;  3LV0 A;  5J16 A;  2I49 A;  5EHM A;  1RDZ A;  4Q8R A;  3VVE A;  3U8Q A;  1FTJ A;  2KQZ A;  2WX9 A;  5ISU A;  4NF5 A;  3JYR A;  4MNI A;  3IB1 A;  3FBP A;  3ZKL A;  4PFT A;  4QFO A;  1SW5 A;  4X48 A;  3RLF E;  3V83 A;  3VLU A;  4ECF A;  5BUU A;  1B46 A;  5H8F B;  4YMA A;  3ISP A;  4YKJ A;  3Q26 A;  3CRB A;  4GX6 A;  1UTH A;  4JXI A;  2MKZ A;  5CMK A;  3SEW A;  4DIG A;  3K1N A;  5I3S A;  1EZP A;  4OFO A;  1FQE A;  3KGC A;  3KN7 A;  4BLA A;  3A3C A;  2H99 A;  3EQ1 A;  1B7H A;  1Y4T A;  3H6T A;  4ISU A;  4GX4 A;  1UIU A;  3LSL A;  3ECR A;  3S4U A;  5I84 A;  1H44 A;  1YTV A;  5DEX A;  4NF5 B;  4DI4 B;  4R2B A;  3C35 A;  4JWY A;  1MXY A;  3VDF A;  1OLC A;  4RYA A;  4MIJ A;  2W7Y A;  5ET6 A;  1P1N A;  5H8Q B;  3O6I A;  3MJN A;  2QS3 A;  1YZ0 A;  1LLS A;  1PB7 A;  1UTH B;  3O9P A;  3A3U A;  3EHT A;  4BDL A;  3MUQ A;  2ONR A;  3BKI B;  2DE4 A;  3U72 A;  1FQC A;  4PDH A;  3MZ1 A;  3U94 A;  3FIR A;  3PTY A;  2DWH A;  4DCX A;  4QFN A;  3DP4 A;  5CMC A;  1FSA A;  1GGG A;  4G8N A;  3D4C A;  3PUW E;  1PB9 A;  4N15 A;  5DEX B;  3T22 A;  2HFB A;  1US5 A;  3UA8 A;  4ND9 A;  4KPT A;  1LBZ A;  4OZ9 A;  4HW8 A;  3FXR A;  1JEV A;  1WVJ A;  4P11 A;  4JDF A;  4MX6 A;  2PYY A;  2XXT A;  4M4G A;  4N4U A;  1Y1Z A;  2B4M A;  4PAI A;  5K2Y A;  3OO6 A;  4O3B A;  4PQJ A;  3O6G A;  3A09 A;  1JVX A;  1QVS A;  2ZNU A;  2XXH A;  2B3F A;  5DVF A;  3MQ9 A;  1SW4 A;  4U22 A;  1G0H A;  1FQD A;  2VD2 A;  4NE4 A;  2H4I A;  1BKA A;  3HO7 A;  3VXB A;  1AMF A;  4R6K A;  5A5X A;  2G29 A;  2XXV A;  1FTK A;  1FBH A;  2QL3 A;  5I58 B;  1EYI A;  3ILU B;  3G3J A;  1DTZ A;  4H8J A;  1OQH A;  4UA8 A;  4DI3 D;  4OWD A;  2NVU B;  1P99 A;  1NUX A;  4UAC A;  1I6A A;  1PB8 A;  4YAH X;  4YU0 A;  4IY6 A;  4ELQ A;  1F9B A;  1IMB A;  3N94 A;  2M8C A;  3T9U A;  3KC0 A;  1DPE A;  1G0I A;  5AA3 A;  1PDA A;  3E78 A;  4JBZ A;  3VFJ A;  1DOT A;  4U4X A;  3RY3 A;  2I6E A;  1TFA A;  5CMM A;  3BBR A;  3QSL A;  3B7D A;  2Y7P A;  3G3K A;  4UAB A;  2QMW A;  1KWH A;  5F1Q A;  1O7T A;  1LBX A;  2Y7I A;  3Q25 A;  1NH7 A;  2DXR A;  3RTW B;  4YZZ A;  1NV6 A;  1MXU A;  5A5X B;  1B3L A;  3TTR A;  3MYU A;  1MS7 A;  3PV0 E;  1LFG A;  1IMF A;  1OQG A;  4IR8 A;  3C32 A;  4N07 A;  5F7V A;  5JTY B;  3FZV A;  3OO9 A;  4OVR A;  1Z7M E;  4NGU A;  1WDN A;  1SQY A;  4G8M A;  3RPL A;  1M5C A;  3IO4 A;  4F3G A;  4R74 A;  1MQJ A;  2ZYO A;  3OO7 A;  3IOW A;  1FPF A;  3KN8 A;  4F3P A;  4XXU A;  4OA4 A;  3Q29 A;  1ZKB A;  4O94 A;  1A7L A;  3G3G A;  4JB7 A;  4N6D A;  4DXU A;  2V3Q A;  2AYS A;  4XKN A;  3KSJ A;  1M5B A;  5L9M A;  5B70 A;  3KN3 A;  1NI9 A;  3CG1 A;  2Y7W A;  1US4 A;  4LON B;  1O64 A;  4R6Y A;  4EXK A;  3PUX E;  4AS4 A;  4WEP A;  1S50 A;  1TFD A;  1EYK A;  1NV1 A;  3O28 A;  2NXO A;  2RCA A;  3HV1 A;  1FBC A;  2XXW A;  3RPL B;  3IR1 A;  1B51 A;  1PBP A;  4YKK A;  4NMY A;  5ET5 A;  3E4R A;  4LN5 A;  4ONY A;  5I7I A;  4GFR A;  1A8E A;  1B3H A;  3QYT A;  3IFC A;  3RTF B;  1MQD A;  2LAO A;  3C34 A;  1B9J A;  1FBG A;  3P7I A;  4QBA A;  1B52 A;  1B4Z A;  2QVU A;  2H98 A;  3NOH A;  4OEU A;  3IFA A;  3I5O A;  1AH5 A;  2Q8J A;  1EU8 A;  1NUZ A;  3H06 B;  4GWU A;  1FQA A;  3G3I A;  4MNP A;  4ZDM A;  4IGT A;  3C33 A;  3IAZ A;  1B6H A;  1SW1 A;  1MPB A;  2XA5 A;  3LBS A;  1Q35 A;  4QSE A;  4GWZ A;  3W9W A;  3T9X B;  2F97 A;  4IGR A;  1WOD A;  3UN6 A;  2AIX A;  1B7U A;  4XKP A;  4DCY A;  1FPI A;  4HCY A;  2XXQ A;  1BLF A;  1B2H A;  4OEN A;  4ELP A;  4OAN A;  4PBH A;  3KBR A;  1D9Y A;  2F35 A;  2BJI A;  3QXM A;  4MLQ A;  2XWI A;  4H8I A;  2JJK A;  2QMX A;  1DTG A;  2OLB A;  2DQV A;  1ZU0 A;  4ZEK A;  2RF1 A;  4ZE9 A;  4P47 A;  4GL8 A;  2A5S A;  3C31 A;  1OVT A;  2ZZX A;  2OBG A;  3IL1 B;  4G61 A;  1NV2 A;  4N13 A;  3SES A;  1QUI A;  1IMC A;  3VE1 B;  3N5L A;  5ICQ A;  5I59 A;  3TTN A;  1FTL A;  5I5P A;  1S9T A;  4TQU Q;  2DS9 A;  5JK4 A;  1YPN A;  3CSG A;  2ONK E;  3K02 A;  2O6A A;  1B5I A;  4R6H A;  1NV4 A;  5DVJ A;  2RC9 A;  5IZ3 A;  2HAU A;  1LAF E;  4TLM B;  1LAH E;  4NF8 A;  1NMU A;  4KR5 A;  2ESN A;  4IO6 A;  4BDN A;  2Y5K A;  2Q2A A;  4YMB A;  2YJP A;  3V8X B;  3MC2 A;  3TDJ A;  2V3U A;  3KJ7 A;  3SET A;  3B6T A;  1VFD A;  5I56 A;  2FYI A;  1Z7N E;  3T9V A;  3G3H A;  4R75 A;  3GBA A;  2ONS A;  2GHB A;  1A99 A;  1FBD A;  5AA4 B;  4DDD A;  1FPL A;  4R2F A;  2DE2 A;  5I57 A;  4ZE8 A;  3H6V A;  4MAG A;  2X7P A;  3ZS6 A;  2F36 A;  1Q9D A;  4KYD A;  2ANJ A;  4DXC A;  5I59 B;  2CZK A;  3ODB A;  1AL3 A;  3SEU A;  1UTB A;  2ZMB A;  1XVX A;  4OMB A;  3HN0 A;  2NWJ A;  4PGP A;  1NV0 A;  3OSR A;  5IZ3 B;  3OD7 A;  1INP A;  1EYJ A;  1LBY A;  1MDP 1;  4XFE A;  4AS5 A;  4NF8 B;  5AA1 A;  1MQI A;  1FPG A;  2Q2C A;  2WYP A;  1LCT A;  1XT8 A;  1OIB A;  1D9V A;  4QSD A;  3PPN A;  3S2V A;  3RQT A;  5I56 B;  5L9S A;  4JWO A;  4TLL B;  4X04 A;  4FBP A;  1B4H A;  2O7I A;  4QXD A;  3FD3 A;  3W15 C;  1UQW A;  1LBW A;  1KA1 A;  1IQ7 A;  4C1U A;  4KI0 E;  2CZL A;  3OOA A;  1B40 A;  4U4S A;  4GXS B;  4Q5T A;  1IIW A;  2WEF A;  1URG A;  1ZMG A;  1JW5 A;  5CBS A;  1UTB B;  3TYH A;  2CEY A;  3KOS A;  4PP0 A;  4ZEF A;  4YB7 A;  2NUV A;  3C9H A;  3K6U A;  1POT A;  2QJE A;  4G2Z A;  1FJ6 A;  5FHM A;  1IZ1 A;  4ELO A;  3USD A;  3KC1 A;  5EQ8 A;  2UXA A;  5KDT B;  4MMP A;  3TMG A;  2UYF A;  4I9D A;  4FAJ A;  2BJJ X;  4NQ8 A;  3M3F A;  4OER A;  5AE4 A;  3DP6 A;  1OVB A;  3UIF A;  3R26 A;  2Q74 A;  1RYX A;  5H8Q A;  3FAS A;  1R1N A;  3N6T A;  2Q9T A;  1TWY A;  1IXI A;  1B1H A;  4LZ8 A;  1JEU A;  2D3I A;  3ILT B;  2ZZV A;  1A8F A;  2Y5L A;  4X8R A;  1D3K A;  4LVQ A;  1NNK A;  3IX1 A;  1LB8 A;  2XHD A;  4LUB A;  3QMF A;  1SDX A;  4QSC A;  4MLV A;  2ALU A;  1AIV A;  4GWS A;  2ZNS A;  4POW A;  1IEJ A;  1QKA A;  2DYX A;  3Q28 A;  1LBB A;  4NF6 A;  5I2K A;  2I3V A;  4PFY A;  1CE2 A;  4YB6 A;  3ZKK A;  3UK4 A;  1M5E A;  1SI0 A;  2O51 A;  5IZ1 A;  3CG3 A;  3R6U A;  1N7W A;  3BIH A;  1I6Q A;  4MJO A;  3VVD A;  1MY2 A;  5ITP A;  4U1O A;  1ZBM A;  4PF6 A;  4F39 A;  4JVD A;  1DK4 A;  3KOT A;  2P2A A;  2HPG A;  2I0C A;  2IA4 A;  4EQ7 A;  4OVT A;  4GWO A;  4X1B A;  1AOV A;  5TU0 A;  5FBP A;  2F34 A;  2OWS A;  4GLI A;  5EYH A;  1RDY A;  2AL4 A;  3GLB A;  4C0R A;  4NF6 B;  2HHM A;  5I2K B;  4H0W A;  3CR9 A;  4WED A;  4G68 C;  4Q30 B;  3KJT A;  5AA2 D;  2F6P A;  3KSX A;  2OK2 A;  1ZTY A;  1EZO A;  2F3D A;  1M5F A;  3B6Q A;  1IMA A;  1NH8 A;  4G4P A;  4OQO A;  2DSF A;  1SD3 A;  3MZB A;  2DDK A;  4NF4 A;  4EF1 A;  2I0B A;  4ESW A;  2PBW A;  3FXU A;  5I58 A;  5EYF A;  3N6U A;  3VLV A;  2A5T B;  3U93 A;  1URD A;  1D9Q A;  5H8H A;  3JZJ A;  4OYV A;  3LUZ A;  2DXY A;  1SBP A;  4GIZ A;  4QFP A;  2QS1 A;  4YB5 A;  1ELJ A;  2XX8 A;  4EUO A;  4OVJ A;  4FEC A;  2F7A A;  2PVU A;  3T96 B;  5ESY A;  1URS A;  3CIJ A;  4RK9 A;  1NNP A;  3WAE A;  4JSD A;  2PMS A;  1DCU A;  2XXY A;  2R71 A;  2HEU A;  4O3A A;  4NF4 B;  2YPN A;  1Q1K A;  5IGA A;  2B65 A;  4F1V A;  2XXR A;  1IME A;  3IOR A;  3CFZ A;  5H8H B;  4H67 A;  5JTY A;  4I3E A;  1B1X A;  1N84 A;  2OWZ A;  1B5H A;  1JET A;  1LAX A;  3L6G A;  3H03 A;  1NV5 A;  3VLW A;  1MY0 A;  4JVC A;  4LA9 A;  4OFJ A;  2XX9 A;  2HXW A;  5FHN A;  2HAV A;  1EZ9 A;  4ZEB A;  2V3T A;  2V4C A;  4ESX A;  1MM7 A;  1OLA A;  3MWB A;  3PD8 A;  4GXA A;  2F8D A;  1S7Y A;  3IK6 B;  1FTM A;  1QUK A;  4ZEC A;  3FVG A;  5IAI A;  3PMV A;  2O1M A;  3L6H A;  1ZJL A;  4G68 B;  1A55 A;  1FW0 A;  4KCC A;  3FGS A;  2FBP A;  1L5T A;  3FUZ A;  1BIY A;  1NKX A;  3TEP A;  2THI A;  1O63 A;  4RPN A;  3MAM A;  2RC8 A;  2OZZ A;  1LBC A;  2O7U A;  1JVY A;  1DPP A;  2VGQ A;  2DVZ A;  1PC3 A;  2P1S A;  4BDO A;  2Z8F A;  2H5Y A;  4PBQ A;  1VR5 A;  3UP9 A;  4XKR A;  2RC7 A;  1A40 A;  3IOU A;  1ZLQ A;  2OJT A;  2RCB A;  2R6G E;  3B8B A;  4OVQ A;  2I58 A;  4MHF A;  4DZ1 A;  3K4U A;  3RNN A;  4GRK A;  1FPD A;  4JSO A;  2PT1 A;  1YCJ A;  4I3Y A;  2NOO A;  1BK4 A;  3ZSF A;  1NV7 A;  5BWJ A;  3F11 A;  1IXH A;  4PF8 A;  4PFU A;  2D5W A;  2Z8D A;  2DOJ A;  2F7B A;  4POX A;  1YYZ A;  1P1W A;  3CVG A;  1LGB C;  3HST A;  3E13 X;  3FVN A;  1FQB A;  4YKP A;  5FTH A;  4M1V A;  1R9L A;  4OEV A;  5ITO A;  3IB2 A;  5DW8 A;  1Y4C A;  2XXX A;  1BP5 A;  4KHZ E;  2VPN A;  1MDQ A;  4JWX A;  2GHA A;  2Z8E A;  2GRV A;  3OEL A;  2XXI A;  1J1N A;  4HE0 A;  2B3B A;  2GH9 A;  4G8H A;  1B7Z A;  1B58 A;  2FHY A;  5ET8 A;  2UYE A;  4P0G A;  3RGY A;  1B05 A;  1H3D A;  2HXR A;  2XXK A;  1MQG A;  4RY1 A;  2FIX A;  2QRY A;  4XF5 A;  2F5X A;  2X7Q A;  3HHG A;  1PBQ A;  5IZZ A;  4ZZA A;  4N6K A;  3MPL A;  1SPI A;  3MP6 A;  3DP8 A;  1II5 A;  1P1U A;  3EN3 A;  3VV5 A;  4NWD A;  4R9G A;  1DMB A;  2HQ0 A;  3CSB A;  1GV8 A;  4N8Y A;  4WKM A;  4IO5 A; 
#chains in the Genus database with same CATH homology
 2IEE A;  3RUM A;  3BFU A;  3QAX A;  3PU5 A;  4LQ5 A;  3PUY E;  4OXV A;  2ZXT A;  3M8U A;  4AB6 A;  1QJM A;  4HCW A;  3E9X A;  2DWI A;  4KCD A;  4GF8 A;  1YAE A;  3LSW A;  5AA4 A;  4H5G A;  2Z23 A;  2VP1 A;  3IJO B;  1N0T A;  2DP8 A;  5CM6 A;  4GD5 A;  4BDQ A;  2WKY A;  1ZIU A;  3TZA A;  4X1D A;  3T66 A;  3R7X A;  3VVF A;  1XVY A;  4AB5 A;  2F6G A;  4H65 A;  1IXC A;  3M3L A;  3MZ9 A;  4DLD A;  4IB2 A;  5FTI A;  5B7D A;  4O3C A;  4TOZ A;  1LCF A;  4EQB A;  3LC8 A;  3IB0 A;  4EXL A;  3MW0 A;  3H6W A;  2UVG A;  3QUF A;  2O84 X;  5K2X A;  4L17 A;  1XS5 A;  2F7C A;  3KEI A;  5TP9 A;  3HHF A;  3DM0 A;  1QUL A;  4PE5 B;  3FJM A;  5HM4 B;  2PX1 A;  3MVX A;  3G7W A;  4R73 A;  2O68 A;  3IOV A;  2I48 A;  3E3K A;  3C4M A;  4RPO A;  1MXV A;  3K6X A;  3TOD A;  1NFT A;  3SDF A;  4PET A;  4E0W A;  1MY1 A;  5KDT A;  3PPR A;  3SER A;  2FNC A;  3K1M A;  5CRY A;  3FXQ A;  3RT8 A;  1B3G A;  3UGW A;  4HS7 A;  3MVZ A;  1XC1 A;  2H25 A;  3PMW A;  3FJ7 A;  5TP9 B;  3T9H B;  4MF3 A;  4F3B A;  3TPA A;  4XIG Q;  1IXG A;  4F22 A;  3MBP A;  4QFL A;  4LZ7 A;  3LSF B;  4Z7E A;  3OEN A;  3TCH A;  3FJG A;  3FVO A;  3LUY A;  1QW0 A;  3GXA A;  3EPE A;  2CMO A;  3DLN A;  2DVC A;  4RK2 A;  1H45 A;  4LQ2 A;  2HZL A;  1SYI A;  3TEL A;  3AXF A;  4FOR A;  1HSE A;  2RIN A;  3K01 A;  3OO8 A;  2DWA A;  2G93 A;  4BDR A;  4GOT A;  4OET A;  2V84 A;  4OTE A;  4N6P A;  1MY4 A;  4FIM A;  1M5D A;  1NNF A;  3BFT A;  3EF7 A;  2Y7R A;  3TCF A;  3LSX A;  5EHS A;  2XXP A;  4KYE A;  2UVH A;  1JQF A;  4MFI A;  4OFL A;  3S9E A;  3PPQ A;  3SEY A;  2ZNT A;  1XOC A;  1FTO A;  3H3G A;  2KLF A;  2QSX A;  2Y7K A;  1MH4 A;  3OEK A;  3FV1 A;  2A5T A;  4I1D A;  1USY H;  1USY E;  5L9O A;  5DT6 A;  3O29 A;  5I2N A;  1LFH A;  2I3W A;  2QS4 A;  4LP2 B;  5CBR A;  3KG2 A;  1MRP A;  1H76 A;  1QKB A;  3T93 B;  5DVI A;  5KZT A;  4RJZ A;  4ZS9 A;  1QUJ A;  3U1O A;  1Y20 A;  1POY 1;  4Q0C A;  4AQ4 A;  5FHO A;  2QPQ A;  3D4G A;  2HCA A;  2Q88 A;  4H5F A;  5H8S A;  4WXJ A;  4KD5 A;  3I6V A;  2DE3 A;  1SVX B;  4ZZE A;  1ATG A;  1A54 A;  5I2N B;  2I4C A;  4QF9 A;  5CMB A;  1B0L A;  1JW1 A;  3UOR A;  2E0S A;  2XD2 A;  2REG A;  4EQ9 A;  1GVC A;  3OMB A;  3K2D A;  5ELV A;  5KCJ A;  2UVJ A;  1Y3Q A;  3W9V A;  2H9B A;  2Y84 A;  3EHU A;  3M3K A;  4G68 A;  2OWT A;  3JV9 A;  4GQO A;  4U21 A;  4FED A;  5AA2 A;  4NTL A;  3K1P A;  2E1S A;  4PFW A;  4HTG A;  1B32 A;  2Z22 A;  3I3V A;  5DTB A;  4IY5 A;  4OES A;  3IOT A;  1VE4 A;  4RA1 A;  4F1U A;  5CC2 A;  4ZEI A;  2DWJ A;  4R72 A;  3PUV E;  3H4Z A;  1Y1M A;  4LAT A;  4R9F A;  3C36 A;  1JW4 A;  4FE8 A;  3O2A A;  3QK6 A;  3S9L C;  3K6V A;  5KCJ B;  4OHN A;  4F2Q A;  3FVK A;  3EHS A;  3PGF A;  2ZYK A;  4BDM A;  4X9T A;  5AA2 B;  3TQL A;  5M2V A;  4F3S A;  5LOM A;  4F31 B;  1XHY A;  4F2O A;  3RT6 B;  3KZG A;  1UIV A;  1TT1 A;  1N76 A;  4U23 A;  3DEL B;  1MXX A;  3MP1 A;  2RKM A;  1GTK A;  2XX7 A;  3Q27 A;  4IO2 A;  1LB9 A;  4XKQ A;  4ELR A;  3ONM A;  1DSN A;  1Y3N A;  1I6B A;  1HSL A;  2V93 A;  3TCG A;  4U1Z A;  4KFQ A;  4NWC A;  1BTJ A;  3O6H A;  3QUJ A;  2ZYM A;  3G3F A;  4H1X A;  2HZK A;  1VFE A;  3CI8 A;  4RXL A;  3FV2 A;  1FQF A;  3MVW A;  3MP8 A;  4MBP A;  5J1D A;  4E0X A;  1N04 A;  1D4N A;  1P1Q A;  3SKP A;  4DXB A;  2YLN A;  3GZG A;  4EF2 A;  3VXC A;  2VD3 A;  4I8C A;  3RPW A;  4U2R A;  3TTK A;  3U92 A;  5HPQ A;  1NL5 A;  2FA7 A;  4FJP A;  2OCU A;  2XD3 A;  4G77 A;  1RKM A;  5L8D A;  1R9Q A;  4Z0I A;  4FAT A;  1IUD A;  2PT2 A;  1B0H A;  3OEM A;  3TKD A;  3B6W A;  4YKI A;  2ABH A;  3OSQ A;  3QIM A;  1EH3 A;  3TTL A;  4IO4 A;  2ZYN A;  4GL0 A;  3V89 B;  1N7X A;  4C1T A;  3H6U A;  3TTM A;  1HSJ A;  3V5A A;  1MQH A;  2GFE A;  5CI5 A;  1B3E A;  3LR1 A;  1IIT A;  1MH3 A;  3TAJ A;  4KYS A;  1SI1 A;  4LZ5 A;  4KQP A;  3HPI A;  3PPO A;  1NNT A;  2I4B A;  4QHQ A;  4QFK A;  4EDP A;  2P0S A;  1Y3P A;  1LAG E;  1MY3 A;  2F78 A;  4QRZ A;  4IO3 A;  3CFL A;  5JEI A;  3S9N C;  1MG1 A;  4IO7 A;  4P0I A;  2Q89 A;  5TPA A;  1MPD A;  3K6W A;  4RNS A;  3N26 A;  5IKB A;  1MM6 A;  3MPK A;  3THI A;  1B3F A;  3PD9 A;  2UVI A;  4XTC Q;  1ANF A;  2R9J A;  1MXZ A;  3PUZ E;  3OXN A;  1SW2 A;  3K00 A;  3RN8 A;  4ZED A;  1H43 A;  5HBC A;  2D21 A;  3FAT A;  3IO6 A;  1Y9U A;  2X26 A;  2V25 A;  5DYH A;  3CFX A;  1LFI A;  4FEB A;  1T0K A;  3SEV A;  5TPA B;  3GBB A;  1FCK A;  3TUS A;  2VHA A;  3K0V A;  3HCQ A;  2REJ A;  3IJX B;  1N3W A;  4F19 A;  4F18 A;  1RYO A;  3MVY A;  1CB6 A;  3O66 A;  1MXW A;  2O1L A;  4MH5 A;  5H8N A;  2XXU A;  3PPP A;  3S9M C;  4H6D A;  1SYH A;  1B5J A;  3H7M A;  5I57 B;  4F29 A;  1OMP A;  4K3F A;  4F1Y A;  2O69 A;  2VOZ A;  1MPC A;  4THI A;  4DE8 A;  5ICT A;  3SEX A;  3O97 A;  4I62 A;  2QS2 A;  3TQW A;  3KFM A;  1I69 A;  5H8F A;  1P1O A;  1GR2 A;  1JNF A;  3WAF A;  1TXF A;  4GVO A;  3TFL A;  1R6Z A;  3PMX A;  1VSO A;  1N3X A;  2AL5 A;  1LST A;  1PEB A;  4NED A;  5H8N B;  4YIC A;  2I49 A;  5EHM A;  4Q8R A;  3VVE A;  3U8Q A;  1FTJ A;  5ISU A;  4NF5 A;  3JYR A;  3IB1 A;  3ZKL A;  4PFT A;  4QFO A;  1SW5 A;  4X48 A;  3RLF E;  3V83 A;  3VLU A;  4ECF A;  5BUU A;  1B46 A;  5H8F B;  4YMA A;  4YKJ A;  3Q26 A;  3CRB A;  1UTH A;  4JXI A;  5CMK A;  3SEW A;  4DIG A;  3K1N A;  1EZP A;  4OFO A;  1FQE A;  3KGC A;  3KN7 A;  4BLA A;  3A3C A;  2H99 A;  3EQ1 A;  1Y4T A;  1B7H A;  3H6T A;  4ISU A;  1UIU A;  3LSL A;  3ECR A;  3S4U A;  5I84 A;  1H44 A;  1YTV A;  5DEX A;  4NF5 B;  4R2B A;  3C35 A;  4JWY A;  1MXY A;  3VDF A;  1OLC A;  4RYA A;  2W7Y A;  1P1N A;  5H8Q B;  3O6I A;  3MJN A;  2QS3 A;  1LLS A;  1PB7 A;  1UTH B;  3O9P A;  3A3U A;  3EHT A;  4BDL A;  3MUQ A;  2ONR A;  3BKI B;  2DE4 A;  3U72 A;  1FQC A;  3MZ1 A;  3U94 A;  3FIR A;  2DWH A;  4DCX A;  4QFN A;  3DP4 A;  5CMC A;  1GGG A;  4G8N A;  3D4C A;  3PUW E;  1PB9 A;  5DEX B;  3T22 A;  2HFB A;  1US5 A;  3UA8 A;  4ND9 A;  4KPT A;  4OZ9 A;  4HW8 A;  3FXR A;  1JEV A;  1WVJ A;  4P11 A;  4JDF A;  2PYY A;  2XXT A;  4M4G A;  1Y1Z A;  5K2Y A;  3OO6 A;  4O3B A;  4PQJ A;  3O6G A;  3A09 A;  1JVX A;  1QVS A;  2ZNU A;  2XXH A;  2B3F A;  5DVF A;  3MQ9 A;  1SW4 A;  4U22 A;  1FQD A;  2VD2 A;  4NE4 A;  2H4I A;  1BKA A;  3HO7 A;  3VXB A;  1AMF A;  4R6K A;  5A5X A;  2G29 A;  2XXV A;  1FTK A;  2QL3 A;  5I58 B;  3ILU B;  3G3J A;  1DTZ A;  4H8J A;  1OQH A;  4UA8 A;  4OWD A;  2NVU B;  1P99 A;  4UAC A;  1I6A A;  1PB8 A;  4YAH X;  4YU0 A;  4IY6 A;  4ELQ A;  1F9B A;  3N94 A;  2M8C A;  3T9U A;  1DPE A;  5AA3 A;  1PDA A;  4JBZ A;  3VFJ A;  1DOT A;  4U4X A;  3RY3 A;  2I6E A;  1TFA A;  5CMM A;  3BBR A;  3QSL A;  3B7D A;  2Y7P A;  3G3K A;  2QMW A;  1KWH A;  5F1Q A;  1O7T A;  2Y7I A;  3Q25 A;  1NH7 A;  2DXR A;  3RTW B;  4YZZ A;  1MXU A;  5A5X B;  1B3L A;  3TTR A;  1MS7 A;  3PV0 E;  1LFG A;  1OQG A;  3C32 A;  4N07 A;  5F7V A;  5JTY B;  3FZV A;  3OO9 A;  1Z7M E;  1WDN A;  1SQY A;  4G8M A;  1M5C A;  3IO4 A;  4F3G A;  4R74 A;  1MQJ A;  2ZYO A;  3OO7 A;  3IOW A;  3KN8 A;  4F3P A;  4XXU A;  3Q29 A;  1ZKB A;  1A7L A;  3G3G A;  4JB7 A;  4DXU A;  2V3Q A;  2AYS A;  4XKN A;  3KSJ A;  1M5B A;  5L9M A;  5B70 A;  3KN3 A;  3CG1 A;  2Y7W A;  1US4 A;  4LON B;  1O64 A;  4R6Y A;  4EXK A;  3PUX E;  4WEP A;  1S50 A;  1TFD A;  3O28 A;  2NXO A;  2RCA A;  3HV1 A;  2XXW A;  3IR1 A;  1B51 A;  1PBP A;  4YKK A;  4NMY A;  3E4R A;  4ONY A;  4GFR A;  1A8E A;  1B3H A;  3QYT A;  3RTF B;  1MQD A;  2LAO A;  3C34 A;  1B9J A;  3P7I A;  1B52 A;  1B4Z A;  2H98 A;  4OEU A;  3I5O A;  1AH5 A;  2Q8J A;  1EU8 A;  3H06 B;  1FQA A;  3G3I A;  4ZDM A;  4IGT A;  3C33 A;  3IAZ A;  1B6H A;  1SW1 A;  1MPB A;  3LBS A;  1Q35 A;  4QSE A;  3W9W A;  3T9X B;  2F97 A;  4IGR A;  1WOD A;  3UN6 A;  2AIX A;  1B7U A;  4XKP A;  4DCY A;  4HCY A;  2XXQ A;  1BLF A;  1B2H A;  4OEN A;  4ELP A;  3KBR A;  1D9Y A;  2F35 A;  3QXM A;  4MLQ A;  4H8I A;  2QMX A;  1DTG A;  2OLB A;  2DQV A;  1ZU0 A;  4ZEK A;  2RF1 A;  4ZE9 A;  4GL8 A;  2A5S A;  3C31 A;  1OVT A;  3IL1 B;  2OBG A;  4N13 A;  3SES A;  1QUI A;  3VE1 B;  3N5L A;  5ICQ A;  5I59 A;  3TTN A;  1FTL A;  1S9T A;  4TQU Q;  2DS9 A;  5JK4 A;  1YPN A;  3CSG A;  2ONK E;  3K02 A;  2O6A A;  1B5I A;  4R6H A;  5DVJ A;  2RC9 A;  2HAU A;  1LAF E;  4TLM B;  1LAH E;  4NF8 A;  1NMU A;  4KR5 A;  2ESN A;  4IO6 A;  4BDN A;  4YMB A;  2Q2A A;  2YJP A;  3V8X B;  3TDJ A;  3MC2 A;  3SET A;  2V3U A;  3KJ7 A;  3B6T A;  1VFD A;  5I56 A;  2FYI A;  1Z7N E;  3T9V A;  3G3H A;  4R75 A;  3GBA A;  2ONS A;  2GHB A;  1A99 A;  5AA4 B;  4DDD A;  4R2F A;  2DE2 A;  5I57 A;  4ZE8 A;  3H6V A;  2X7P A;  3ZS6 A;  2F36 A;  4KYD A;  2ANJ A;  4DXC A;  5I59 B;  3ODB A;  1AL3 A;  3SEU A;  1UTB A;  2ZMB A;  1XVX A;  4OMB A;  3HN0 A;  2NWJ A;  3OSR A;  3OD7 A;  1MDP 1;  4NF8 B;  5AA1 A;  1MQI A;  2Q2C A;  1LCT A;  1XT8 A;  1OIB A;  1D9V A;  4QSD A;  3PPN A;  3S2V A;  3RQT A;  5I56 B;  5L9S A;  4JWO A;  4TLL B;  1B4H A;  2O7I A;  3FD3 A;  3W15 C;  1UQW A;  1IQ7 A;  4C1U A;  4KI0 E;  2CZL A;  3OOA A;  1B40 A;  4U4S A;  4GXS B;  4Q5T A;  1IIW A;  1URG A;  1ZMG A;  1JW5 A;  5CBS A;  1UTB B;  3TYH A;  3KOS A;  4PP0 A;  4ZEF A;  4YB7 A;  2NUV A;  3C9H A;  3K6U A;  1POT A;  2QJE A;  4G2Z A;  5FHM A;  1IZ1 A;  4ELO A;  3USD A;  2UXA A;  5KDT B;  3TMG A;  2UYF A;  4I9D A;  4FAJ A;  2BJJ X;  3M3F A;  4OER A;  5AE4 A;  3DP6 A;  1OVB A;  3UIF A;  3R26 A;  1RYX A;  5H8Q A;  3FAS A;  1R1N A;  3N6T A;  2Q9T A;  1TWY A;  1IXI A;  1B1H A;  4LZ8 A;  1JEU A;  2D3I A;  3ILT B;  1A8F A;  1D3K A;  4LVQ A;  1NNK A;  3IX1 A;  1LB8 A;  2XHD A;  4LUB A;  1SDX A;  4QSC A;  4MLV A;  2ALU A;  1AIV A;  2ZNS A;  4POW A;  1IEJ A;  1QKA A;  2DYX A;  3Q28 A;  1LBB A;  4NF6 A;  5I2K A;  2I3V A;  4PFY A;  1CE2 A;  4YB6 A;  3ZKK A;  3UK4 A;  1M5E A;  1SI0 A;  2O51 A;  3CG3 A;  3R6U A;  1N7W A;  1I6Q A;  3VVD A;  1MY2 A;  5ITP A;  4U1O A;  1ZBM A;  4F39 A;  3KOT A;  2P2A A;  2I0C A;  2IA4 A;  4EQ7 A;  4GWO A;  4X1B A;  1AOV A;  5TU0 A;  2F34 A;  2OWS A;  4GLI A;  2AL4 A;  3GLB A;  4C0R A;  4NF6 B;  5I2K B;  4H0W A;  3CR9 A;  4WED A;  4G68 C;  4Q30 B;  3KJT A;  5AA2 D;  2F6P A;  3KSX A;  2OK2 A;  1ZTY A;  1EZO A;  1M5F A;  3B6Q A;  1NH8 A;  4G4P A;  4OQO A;  2DSF A;  1SD3 A;  3MZB A;  4NF4 A;  4EF1 A;  2I0B A;  4ESW A;  2PBW A;  3FXU A;  5I58 A;  5EYF A;  3N6U A;  3VLV A;  2A5T B;  3U93 A;  1URD A;  5H8H A;  3JZJ A;  4OYV A;  2DXY A;  1SBP A;  4GIZ A;  4QFP A;  2QS1 A;  4YB5 A;  1ELJ A;  2XX8 A;  4EUO A;  4OVJ A;  4FEC A;  2F7A A;  2PVU A;  3T96 B;  1URS A;  3CIJ A;  4RK9 A;  1NNP A;  3WAE A;  4JSD A;  2PMS A;  2XXY A;  2R71 A;  2HEU A;  4O3A A;  4NF4 B;  2YPN A;  1Q1K A;  2B65 A;  4F1V A;  2XXR A;  3IOR A;  3CFZ A;  5H8H B;  4H67 A;  5JTY A;  1B1X A;  1N84 A;  1B5H A;  1JET A;  1LAX A;  3L6G A;  3H03 A;  3VLW A;  1MY0 A;  4LA9 A;  4OFJ A;  2XX9 A;  2HXW A;  5FHN A;  2HAV A;  1EZ9 A;  4ZEB A;  2V3T A;  4ESX A;  1MM7 A;  1OLA A;  3MWB A;  3PD8 A;  4GXA A;  2F8D A;  1S7Y A;  3IK6 B;  1FTM A;  1QUK A;  4ZEC A;  3FVG A;  5IAI A;  3PMV A;  2O1M A;  3L6H A;  1ZJL A;  4G68 B;  1A55 A;  1FW0 A;  4KCC A;  3FGS A;  1L5T A;  3FUZ A;  1BIY A;  1NKX A;  3TEP A;  2THI A;  1O63 A;  4RPN A;  3MAM A;  2RC8 A;  2OZZ A;  1LBC A;  2O7U A;  1JVY A;  1DPP A;  2VGQ A;  2DVZ A;  1PC3 A;  2P1S A;  4BDO A;  2Z8F A;  2H5Y A;  1VR5 A;  3UP9 A;  4XKR A;  2RC7 A;  1A40 A;  3IOU A;  1ZLQ A;  2OJT A;  2RCB A;  2R6G E;  2I58 A;  4DZ1 A;  3K4U A;  3RNN A;  4GRK A;  4JSO A;  2PT1 A;  1YCJ A;  2NOO A;  3ZSF A;  5BWJ A;  3F11 A;  1IXH A;  4PFU A;  2D5W A;  2Z8D A;  2DOJ A;  2F7B A;  4POX A;  1P1W A;  3CVG A;  1LGB C;  3HST A;  3E13 X;  3FVN A;  1FQB A;  4YKP A;  5FTH A;  4M1V A;  1R9L A;  4OEV A;  5ITO A;  3IB2 A;  1Y4C A;  2XXX A;  1BP5 A;  4KHZ E;  1MDQ A;  4JWX A;  2GHA A;  2Z8E A;  2GRV A;  3OEL A;  2XXI A;  1J1N A;  2B3B A;  2GH9 A;  4G8H A;  1B7Z A;  1B58 A;  2UYE A;  4P0G A;  3RGY A;  1B05 A;  1H3D A;  1MQG A;  4RY1 A;  2QRY A;  2F5X A;  2X7Q A;  3HHG A;  1PBQ A;  4ZZA A;  3MPL A;  3MP6 A;  3DP8 A;  1II5 A;  1P1U A;  3EN3 A;  3VV5 A;  4NWD A;  4R9G A;  1DMB A;  2HQ0 A;  3CSB A;  1GV8 A;  4WKM A;  4IO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...