4OXVA

Crystal structure of mltf from pseudomonas aeruginosa complexed with valine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
428
structure length
424
Chain Sequence
APTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine
rcsb
source organism Pseudomonas aeruginosa padk2_cf510
molecule tags Lyase
molecule keywords Membrane-bound lytic murein transglycosylase F
total genus 158
structure length 424
sequence length 428
ec nomenclature ec 4.2.2.-:
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oxvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oxvA02
4YB6A 5HPQA 1DPEA 3MQ9A 2PMSA 3KJ7A 4FECA 2PX1A 3OO6A 1N3WA 3EN3A 2ANJA 1DMBA 3SEVA 2F7CA 4EQBA 5AE4A 2AYSA 4ONYA 4E0XA 3OO9A 1VSOA 2GHBA 4OVJA 3QAXA 4YKJA 2YLNA 4R6YA 3S9EA 4DXUA 3I3VA 1SI0A 3FXRA 4EF1A 2Y7KA 1FQBA 1MPCA 1GR2A 1SW1A 2GFEA 2UVJA 3LR1A 3L6HA 4NE4A 1MXXA 3QXMA 4POXA 3SEYA 1MXVA 3C36A 3SEXA 3H4ZA 4X1BA 2F6GA 3DP4A 1OQHA 1ELJA 3O6GA 1GVCA 2F8DA 3VVEA 1N84A 4I8CA 4ZEKA 5CBSA 4GL0A 4OERA 3OEMA 2UVIA 4RK2A 2O7UA 1URGA 2Y7WA 1N3XA 2HZKA 4H67A 5DYHA 3FGSA 4XKQA 5TP9B 4ZEFA 3VVFA 5LOMA 4YB7A 1Z7ME 4YB5A 3FIRA 2DXRA 4NF8A 4RA1A 4RYAA 2HXWA 3D4CA 4OETA 4PFYA 3N5LA 5H8HA 1I69A 2F34A 5JK4A 1WDNA 1NH8A 3R6UA 2P1SA 4XKPA 3PV0E 4L17A 3RN8A 2ZNUA 3T9UA 5FTIA 1P1QA 2Z8DA 2O51A 3MP6A 4OFJA 4YZZA 3UORA 2Q88A 2V3QA 4GL8A 5J1DA 3ODBA 1LSTA 3A09A 4RY1A 5IKBA 1H44A 2R6GE 1GGGA 4YICA 3H06B 3JZJA 4ZZEA 3T93B 1LCFA 5AA3A 3MC2A 1I6AA 4DCXA 3IOWA 2OJTA 1MY0A 4GIZA 2QS4A 2XD3A 4EQ9A 4F3SA 1B3EA 3T9XB 3C35A 5IAIA 4AQ4A 1BLFA 1D9YA 2XD2A 1PB9A 5DVIA 4H65A 4ELQA 4F31B 4OXVA 4BDNA 4XKRA 1YPNA 3SEUA 4G4PA 3TPAA 3UK4A 4QFOA 2DWHA 4G2ZA 1NKXA 4R75A 3QSLA 5H8NA 4ELPA 3MWBA 3RT8A 4OEUA 1MQJA 1S9TA 4OZ9A 4BDMA 1SDXA 2XHDA 2I3WA 3HPIA 1AMFA 1LBCA 3IJOB 3QIMA 5KDTA 1VE4A 3RGYA 2NUVA 1QUIA 4JWXA 1MXWA 4O3CA 2ONRA 2R71A 3M3LA 2THIA 5M2VA 4LONB 1SBPA 2A5TA 3QUFA 3ILUB 4AB5A 1JW1A 1TXFA 2PVUA 4FAJA 5AA4A 5KCJA 3UGWA 5I58B 1B52A 1UIVA 2UVHA 2UYFA 3KN3A 3KSJA 3PPPA 3SETA 3KOSA 4ZEBA 3UN6A 4WEPA 3KJTA 3QK6A 3N6TA 3DLNA 1URSA 2D3IA 3BBRA 4JSDA 5ITPA 3TAJA 2F35A 3I5OA 1IIWA 2IEEA 3HN0A 3U94A 1FQFA 4MBPA 3USDA 1XT8A 3CRBA 3MVZA 2Q89A 1JNFA 3OSQA 4HW8A 5A5XB 2F97A 2F7AA 2XXUA 1B3GA 1ATGA 3FD3A 2XXYA 5AA2B 4R9FA 3E3KA 3FASA 3PMXA 1GV8A 2AL4A 2FNCA 4NWDA 4OFLA 1H76A 2QJEA 4KI0E 4DDDA 1FQEA 3LSXA 2P0SA 3PPRA 4K3FA 5CRYA 3ECRA 3VDFA 3H6WA 4IO2A 4KR5A 5DEXA 3TMGA 3UA8A 4E0WA 5I57A 1M5DA 1FTKA 3TZAA 1NNKA 5BWJA 1B5IA 2DE3A 3ZSFA 4U4SA 1B7HA 3FATA 3G3FA 3LUYA 4HCWA 4ZE8A 1URDA 1XOCA 4IO7A 1US4A 2Q2CA 3IR1A 1M5FA 3S9MC 1FTLA 1LB8A 4FATA 5AA2A 4Q30B 3OO7A 3O29A 2Z23A 4HCYA 1LFGA 4LZ7A 4NEDA 3WAFA 4H5GA 1Y20A 1EZPA 3EHTA 4GRKA 4POWA 1P1UA 1UTHA 1UQWA 3Q28A 3IB1A 4R9GA 1QKAA 3D4GA 3UIFA 5TPAA 2V3TA 3VE1B 3Q27A 3O6HA 2G93A 3DP8A 3RQTA 4OMBA 4DXBA 1WODA 1Y3QA 4IY5A 5B70A 1PB8A 2O1MA 4G8HA 3K6UA 4F1VA 2XXWA 3KBRA 1MG1A 4LVQA 2Y7PA 1LAXA 2RCAA 2RINA 2W7YA 1MXUA 4GLIA 4N07A 2E1SA 1LFHA 3TFLA 5FHNA 1B2HA 1EU8A 2Y84A 3MVXA 3VXBA 3MUQA 1B51A 1XS5A 4G77A 1Y1ZA 3SKPA 1Q35A 3BFTA 1O63A 3OD7A 3R7XA 1USYH 4KCCA 5CMMA 5CMBA 1YAEA 4OHNA 3TTRA 2F6PA 1H45A 5L9MA 3I6VA 3U92A 1FTJA 4KPTA 4F3PA 3FV1A 2AL5A 2G29A 5CMKA 2DVZA 1LGBC 4JXIA 4KHZE 1MPBA 3JYRA 4FEBA 3CVGA 3H03A 4NF6A 1OVBA 5I84A 2REGA 2RCBA 1A99A 3KZGA 3O6IA 2Z8FA 4LQ2A 3PPOA 5KZTA 4LUBA 2X7QA 1R9LA 4LP2B 4RK9A 2IA4A 3FUZA 3IORA 1JVYA 3LBSA 4I1DA 5EYFA 5TPAB 3SDFA 2QMWA 1SYIA 1BP5A 1WVJA 2I58A 4ELRA 3S9LC 3KN8A 2I0BA 3RT6B 3A3UA 2CMOA 5ISUA 3B6QA 1JQFA 4TQUQ 3G7WA 3C34A 4IGRA 1DPPA 4FEDA 1IXCA 2OZZA 1LCTA 4PETA 1XVXA 4IB2A 4RPOA 3LSLA 5ICQA 3IOUA 2B65A 2FA7A 1HSLA 3F11A 3TDJA 4JBZA 3KN7A 3CG1A 4UA8A 1JEVA 3MVYA 4C0RA 5B7DA 1SYHA 5I2KA 4H6DA 2X26A 3N94A 3S4UA 1SW2A 4EQ7A 3O66A 2H5YA 2V93A 4QFKA 5CBRA 1YTVA 2V3UA 4F2QA 4F3GA 4F22A 3CFZA 1UIUA 1ZMGA 1Y1MA 4KYDA 4UACA 1FCKA 5JTYB 3IK6B 3U8QA 3E9XA 4R74A 4FJPA 4H8IA 4F2OA 3CSBA 2F5XA 3E13X 5F1QA 1L5TA 1US5A 2RKMA 2AIXA 3EF7A 3QYTA 4RXLA 4ELOA 3FXQA 1A8FA 3O9PA 3KSXA 1DOTA 1I6BA 2QSXA 3IB0A 4ZZAA 3EHUA 4FIMA 3EQ1A 3PUZE 1DTGA 1EH3A 2VHAA 2XXHA 3HSTA 4GOTA 4GXSB 4IO3A 3VXCA 3W15C 2VD2A 3K4UA 3Q25A 5TU0A 2GHAA 5TP9A 2NWJA 3RLFE 2O68A 3HCQA 5BUUA 1HSJA 3MPLA 1D3KA 3O97A 5HBCA 1QKBA 4R6KA 2QS3A 3FXUA 3KEIA 1IXHA 4YKKA 3VV5A 1PB7A 3OOAA 4Q5TA 3MP8A 4QFNA 1I6QA 3KGCA 3TCGA 4ZEDA 5I56B 3W9VA 1M5BA 1GTKA 4QFPA 4JSOA 3VLWA 3FVOA 4PP0A 1O7TA 2XXPA 3CIJA 1DTZA 4JWOA 1AL3A 3RPWA 1ZLQA 3TCFA 4G68C 4QSDA 3MAMA 3IJXB 1PDAA 4U23A 4F3BA 4PQJA 1ZKBA 2LAOA 4KFQA 3MBPA 4NMYA 5K2XA 5L9SA 1MDP1 4P0GA 4ZE9A 1F9BA 1MRPA 5I59B 2RC8A 3GZGA 3H7MA 3K0VA 4U21A 1H3DA 4BDRA 1DSNA 1LLSA 4BDQA 4ESWA 2YJPA 3H6UA 5H8QA 2REJA 1AIVA 3TTMA 1PC3A 1MDQA 2E0SA 5H8FA 4U1OA 2A5SA 1Y9UA 4OESA 1MY1A 1LAHE 1BTJA 2I49A 2ZNSA 2D5WA 2DWAA 3FJ7A 3K1MA 3H6VA 1A7LA 2NXOA 4X48A 3KOTA 3RUMA 4EXLA 4R72A 4WEDA 1JEUA 3MZ1A 5L9OA 3B6WA 1SW4A 2ZYNA 4O3BA 1PBPA 1R9QA 1B3LA 3LSFB 1CE2A 1UTBB 4NF4B 1O64A 1OQGA 3K02A 1IXIA 1TT1A 4M4GA 5DT6A 3ZS6A 4Q0CA 3MPKA 1B46A 2ALUA 1QW0A 2ONSA 1IUDA 1QVSA 3EHSA 3KFMA 2UYEA 3PMVA 1A55A 4LZ5A 4M1VA 4BLAA 4F18A 3AXFA 3FVGA 1A8EA 2I0CA 1NFTA 1S50A 2DWJA 4MLVA 2A5TB 5H8SA 5KCJB 5FHMA 2H98A 3TTKA 3U93A 3K6VA 2OCUA 3T66A 1NH7A 4YAHX 1MXYA 2HQ0A 3TCHA 1LFIA 2Q8JA 1FTMA 2VD3A 1N04A 3K01A 1UTHB 4WXJA 1II5A 3CFXA 2XX9A 4IY6A 1D4NA 3VFJA 3OO8A 2RF1A 4GFRA 4FE8A 4GD5A 4KYSA 2WKYA 4DLDA 1RYXA 1B9JA 1IEJA 4BDLA 3CSGA 4KYEA 4PFWA 5ITOA 3K2DA 3FVKA 2I4BA 3IL1B 3PUWE 2O7IA 1MQGA 1OLCA 4PFTA 5H8HB 5ELVA 1NNPA 2XXIA 1ZIUA 3OENA 1B7UA 5DEXB 3S2VA 3C31A 3TTNA 5AA4B 2V84A 2I48A 3P7IA 4ND9A 2Z22A 4QSCA 4C1UA 5I58A 4N13A 2ZYOA 3CG3A 3K1PA 2DXYA 2RC9A 2Y7IA 2HFBA 3B7DA 4U4XA 4QHQA 4ZS9A 1B3FA 1EZOA 1CB6A 3T22A 3RNNA 2H4IA 4XXUA 1OIBA 3TQWA 3IX1A 3O2AA 4ECFA 4IGTA 3T9HB 4OENA 5DVJA 4YMAA 3LC8A 1JVXA 3CR9A 1ANFA 1POY1 4OWDA 3IAZA 2DP8A 3U72A 4OEVA 3ILTB 1MPDA 3FZVA 3MJNA 2PYYA 2XX8A 4QRZA 2HCAA 2OBGA 5EHSA 3PGFA 3FVNA 5CC2A 1MXZA 1TFAA 1A40A 2CZLA 1N76A 3MW0A 3VLUA 1ZTYA 3DELB 3IO4A 2H25A 4IO4A 4OTEA 4X1DA 1HSEA 1MH4A 1YCJA 4F39A 1T0KA 1LAFE 3K00A 4GF8A 3BKIB 3N26A 1ZJLA 2D21A 1B7ZA 1A54A 1BKAA 1BIYA 1MH3A 2HAVA 2ZXTA 3DM0A 2GH9A 2I3VA 2B3FA 3LSWA 3UP9A 1B58A 1IXGA 2VP1A 4XKNA 5KDTB 2NOOA 5CI5A 1UTBA 2DE4A 1QUKA 2DOJA 5CM6A 4RNSA 4YMBA 4PFUA 3K1NA 1XHYA 2Q2AA 1Y4TA 3M3FA 3TEPA 1VFEA 3CFLA 4QF9A 4WKMA 4ESXA 3O28A 4KD5A 3HHFA 4YU0A 4DXCA 4GWOA 1LAGE 3WAEA 3HHGA 1MM7A 1B05A 4MH5A 5AA2D 1NNFA 2H99A 2ONKE 4KCDA 4JDFA 4MFIA 1TFDA 1RKMA 5H8QB 4NF5A 3ZKLA 3N6UA 2Z8EA 5ICTA 5H8FB 3GBBA 1S7YA 1VR5A 1USYE 3G3GA 4EUOA 1B1XA 1FQCA 3HO7A 5FHOA 3IB2A 4I62A 4F1YA 4OFOA 3ZKKA 1P1OA 4KQPA 2QPQA 4H5FA 3TTLA 1SI1A 1ZU0A 3SEWA 1JETA 1FQAA 1XC1A 5HM4B 3H3GA 2ABHA 2QRYA 3VVDA 4NF4A 1MY2A 4Z0IA 1R6ZA 4P0IA 3DP6A 5I2NB 4N6PA 2PT2A 4EXKA 3K6XA 2H9BA 1OLAA 3FJMA 4NF6B 4Z7EA 5I57B 1QJMA 1B0LA 1MY4A 2OWSA 4NTLA 2XXQA 3S9NC 2QS1A 1KWHA 3TELA 4F1UA 1FTOA 3V8XB 5I56A 4BDOA 1B4ZA 1N7WA 2M8CA 5I2KB 1NMUA 2O6AA 3Q26A 4JB7A 2ESNA 4RPNA 5DTBA 3A3CA 2GRVA 3T96B 3PMWA 3PU5A 2V25A 1SQYA 1B0HA 3M8UA 3BFUA 3MZBA 4R6HA 4H0WA 3THIA 3MZ9A 3ONMA 5EHMA 4DZ1A 3MVWA 4R2BA 1Q1KA 4EDPA 4NF5B 2HEUA 1TWYA 2I4CA 4EF2A 1Y4CA 2Q9TA 2ZNTA 3C4MA 4FORA 4MF3A 4TLLB 5DVFA 5F7VA 3PD8A 2KLFA 4Q8RA 3GBAA 3V83A 3PPQA 3Q29A 4ZECA 3R26A 4O3AA 3K6WA 1SW5A 3IO6A 2YPNA 3SESA 1B6HA 1ZBMA 2UXAA 5H8NB 1B1HA 2OLBA 3OSRA 3W9WA 4MLQA 3IOTA 5I2NA 4IO5A 3OELA 3G3KA 3VLVA 1MQHA 4NWCA 4U22A 2PBWA 5JEIA 2NVUB 2F36A 3C32A 3PUVE 3RTWB 1H43A 1PEBA 2UVGA 1B32A 3EPEA 1LB9A 2I6EA 2F7BA 3FV2A 1P1NA 3QUJA 4I9DA 3C9HA 3OXNA 4TOZA 3U1OA 5CMCA 1IITA 1OMPA 1VFDA 3PD9A 4YKIA 1MY3A 4RJZA 2P2AA 4R73A 1M5CA 2PT1A 4LA9A 1XVYA 2XX7A 2HZLA 4JWYA 2RC7A 1AOVA 2XXRA 4U1ZA 3SERA 3KG2A 3FJGA 3TUSA 1N7XA 4G68A 1J1NA 1Z7NE 3E4RA 3MP1A 1IQ7A 2QMXA 4NF8B 4LZ8A 4GVOA 4H1XA 2DWIA 1P1WA 2VGQA 3G3IA 2OK2A 1MQDA 1SD3A 3L6GA 4THIA 2XXVA 4XTCQ 5FTHA 3M3KA 2XXXA 2OWTA 3TQLA 3V5AA 4F19A 5A5XA 2ZYKA 3JV9A 2HAUA 2Y7RA 1B5HA 1MM6A 2F78A 3OMBA 3PUYE 4G8MA 2ZYMA 2ZMBA 4GXAA 3T9VA 1OVTA 4GQOA 1EZ9A 4OYVA 3PPNA 4QSEA 4G8NA 1NL5A 2B3BA 3RY3A 1B3HA 1B40A 4YKPA 1Y3NA 1SVXB 3HV1A 3PUXE 2O1LA 2VOZA 4HTGA 3GLBA 4AB6A 4DCYA 3OEKA 3B6TA 4XIGQ 2DE2A 3G3JA 4ZEIA 1B4HA 2BJJX 4P11A 2R9JA 4DE8A 2XXTA 1MQIA 1D9VA 3G3HA 4TLMB 5L8DA 3V89B 1M5EA 4HS7A 1FW0A 4ISUA 1MS7A 2QS2A 4X9TA 1FQDA 1P99A 2O84X 2X7PA 5I59A 1RYOA 3TKDA 3IOVA 3RTFB 1QULA 2QL3A 2O69A 2DVCA 1Y3PA 3TYHA 5JTYA 3C33A 4IO6A 4F29A 4R2FA 1B5JA 1LBBA 4G68B 4LATA 3H6TA 2DSFA 4U2RA 2DYXA 2FYIA 5K2YA 1NNTA 3GXAA 5AA1A 1AH5A 1N0TA 1QUJA 3TODA 1JW5A 4QFLA 1IZ1A 2DQVA 4DIGA 3CI8A 1PBQA 1R1NA 2DS9A 4LQ5A 1POTA 4ZDMA 4C1TA 1JW4A 4PE5B 4H8JA 4OQOA
chains in the Genus database with same CATH superfamily
2PMSA 2PX1A 3OO6A 3EN3A 3SEVA 4ONYA 3OO9A 4YKJA 3S9EA 3I3VA 4EF1A 2UVJA 3QXMA 1MXVA 3DP4A 1OQHA 1ELJA 3O6GA 4I8CA 2HHMA 2UVIA 1N3XA 2HZKA 4H67A 4O7MA 5DYHA 5TP9B 3VVFA 5LOMA 1Z7ME 4YB5A 3FIRA 4PFYA 3N5LA 5H8HA 2F34A 5JK4A 3R6UA 2P1SA 2ZNUA 2VT5A 2Q88A 4PF8A 4RY1A 3H06B 3JZJA 4DCXA 1MY0A 2OWZA 4F3SA 2FIXA 1DK4A 3T9XB 4AQ4A 1PB9A 4ELQA 4XKRA 3UK4A 1NKXA 3QSLA 5H8NA 3LUZA 1MQJA 4OZ9A 4BDMA 1SDXA 3QIMA 3IJOB 2ZZXA 1QUIA 4OVSA 2WEFA 4OA4A 1SBPA 1LBXA 3ILUB 1JW1A 2PVUA 1B52A 3SETA 5T3JA 3DLNA 5ITPA 2XXKA 3MVZA 2Q89A 4HW8A 2CEYA 2F97A 2XXUA 3FD3A 3E3KA 4OFLA 3LSXA 4K3FA 3PPRA 1NNKA 4QXDA 2F3DA 3LUYA 4ZE8A 1XOCA 3B8BA 3IR1A 3S9MC 1FTLA 4FATA 4Q30B 4HCYA 2WYPA 1LFGA 3QMFA 1Y20A 4MCOA 3EHTA 4POWA 1UTHA 2V3TA 3IFCA 3Q27A 2G93A 4OMBA 4MMPA 1WODA 1PB8A 3K6UA 2Y7PA 1NV7A 3TFLA 3VXBA 3MUQA 2BJIA 1XS5A 3OD7A 4PCDA 1YAEA 1FBFA 4MNPA 5L9MA 3I6VA 2G29A 3FBPA 1LGBC 4FEBA 4OVTA 4LUBA 4I1DA 1FJ6A 1WVJA 4ELRA 2I58A 3B6QA 4FEDA 1LCTA 3LSLA 3IOUA 4NF0A 4NGUA 2H5YA 3CFZA 4PGPA 3U8QA 4FJPA 3EF7A 4PAFA 3O9PA 3KSXA 1INPA 4ZZAA 3EHUA 3EQ1A 4GX6A 2VD2A 3Q25A 4N8GA 3HCQA 3O97A 1IXHA 1PB7A 4ZEDA 4QFNA 1I6QA 3W9VA 1M5BA 2JJKA 1DTZA 4JWOA 1AL3A 3RPWA 3TCFA 3IJXB 4F3BA 2LAOA 4NMYA 5K2XA 4P0GA 1MRPA 3H6UA 3TTMA 4N15A 1MDQA 2E0SA 5EQ8A 3TDJA 5B7DA 2DWAA 3H6VA 2NXOA 1JEUA 3MZ1A 5L9OA 4GWUA 4O3BA 1R9QA 1CE2A 1LBWA 3K02A 5DT6A 4Q0CA 2ONSA 1QW0A 1IUDA 2KR0A 4FBPA 4F18A 4GWZA 1S50A 4MLVA 5KCJB 3TTKA 3T66A 1MXYA 1LFIA 2VD3A 3CFXA 1EYKA 4GFRA 4GD5A 4KYEA 4PFTA 1FRPA 1ZIUA 1DBZA 5AA4B 2V84A 4XF5A 3P7IA 4C1UA 4GWXA 3K1PA 4P1LA 2HFBA 4ZS9A 4QHQA 1B3FA 1CB6A 2H4IA 1OIBA 3RYDA 4ECFA 5DVJA 4YMAA 3CR9A 1POY1 3ILTB 3CHGA 1JP4A 4QRZA 2HCAA 1MXZA 1A40A 4GWWA 1ZTYA 4X1DA 2B4MA 1HSEA 1MH4A 1YCJA 3BIHA 1LAFE 1ZJLA 3DM0A 1A54A 5I5PA 2HAVA 3LSWA 2I3VA 5CI5A 3K1NA 3M3FA 1VFEA 4WKMA 3O28A 3HHFA 4N8YA 1LAGE 3HHGA 4KCDA 4MFIA 2FVZA 4HE1A 3ZKLA 4MJOA 4I62A 1SI1A 3SEWA 4Z0IA 1MY2A 4GBVA 1NV3A 1G0HA 4NF6B 1QJMA 3S9NC 3TELA 3V8XB 1N7WA 2O6AA 3Q26A 3E78A 4RPNA 2GRVA 2ZZVA 3THIA 4DZ1A 3MSTA 1Y4CA 4FORA 2ZNTA 3C4MA 4MF3A 3PD8A 3GBAA 1NV6A 3V83A 2WBDA 1SW5A 2OLBA 3W9WA 3IOTA 4IO5A 3VLVA 4NAPA 4AS5A 3RTWB 3EPEA 2FBPA 2F7BA 4JVDA 1VFDA 1OMPA 4RJZA 1NV5A 2MKZA 4LA9A 1AOVA 2HZLA 2RC7A 3KG2A 4OVJA 1Z7NE 4GVOA 4XTCQ 3G3IA 2XXXA 4F19A 3JV9A 2HAUA 2Y7RA 4G8MA 1MM6A 2QVUA 4GQOA 2B3BA 4YKPA 5ET7A 2O1LA 4HTGA 2BJJX 4P11A 2XXTA 1D9VA 3ISPA 4HS7A 1MS7A 2QS2A 5I59A 1RYOA 3C33A 4P56A 4R2FA 4G68B 1NNTA 5AA1A 1IZ1A 2DQVA 4C1TA 2DS9A 4YB6A 3MQ9A 1N3WA 2AYSA 4E0XA 4G61A 3QAXA 1SI0A 2Y7KA 1MPCA 4NE4A 1GR2A 5F24A 2GFEA 4P9KA 4POXA 3SEYA 3H4ZA 4X1BA 2F6GA 5ET8A 2F8DA 1N84A 4OERA 3OEMA 2O7UA 4XKQA 4ZEFA 1IMCA 4NF8A 2HXWA 5LTCA 3T0JA 3RN8A 3PV0E 4L17A 5IKBA 4PTKA 5IM2A 1LCFA 4EQ9A 2PCRA 1Q9DA 5IAIA 4QBAA 2XD2A 4MNCA 4OXVA 5IZ3A 3TPAA 4G2ZA 3MWBA 1S9TA 1AMFA 2NUVA 2ONRA 5M2VA 5KCJA 4FAJA 5I58B 3KSJA 2UVHA 2UYFA 4ZEBA 4GWSA 4WEPA 3N6TA 1URSA 4JSDA 3TAJA 3I5OA 1IIWA 2DDKA 2IEEA 3U94A 1XT8A 1JNFA 4R9FA 2AL4A 2FNCA 4NWDA 2QJEA 4OVQA 1FQEA 2P0SA 3VDFA 1M5DA 1FTKA 4MEVA 1B7HA 3G3FA 5I3SA 4IO7A 2Q2CA 3U65A 3RPLA 4LZ7A 3O29A 3WAFA 4GRKA 1P1UA 3IB1A 1QKAA 3UIFA 5IZZA 3NOHA 4F1VA 5AA2A 1LAXA 2RCAA 1MXUA 1LFHA 2Y84A 1NV4A 1O63A 3R7XA 5CMBA 5CMMA 2F6PA 4KPTA 2DVZA 4JXIA 1MPBA 4NF6A 2RCBA 1A99A 2Z8FA 3PPOA 4N6DA 1AWBA 3LBSA 5EYFA 1SYIA 3RT6B 5ISUA 1JQFA 3SZPA 1IXCA 2OZZA 4PETA 4I3YA 3CG1A 3MVYA 4C0RA 4H6DA 4MNIA 3N94A 1YTVA 1ZMGA 1Y1MA 4UACA 1FCKA 3E9XA 4R74A 4H8IA 4F2OA 3E13X 2AIXA 3QYTA 1DOTA 3IB0A 2QSXA 1DTGA 2XXHA 4GOTA 5TU0A 3RLFE 5BUUA 1D3KA 5HBCA 3FXUA 4Q5TA 4JSOA 4G68C 4PQJA 4KFQA 3MBPA 1MDP1 1F9BA 5I59B 2RC8A 3H7MA 4U21A 4BDRA 1DSNA 2YJPA 1AIVA 1FPGA 2A5SA 1Y9UA 4OESA 1MY1A 3FJ7A 2ZNSA 4X48A 4R72A 4WEDA 1EYJA 5EYHA 1SW4A 1B3LA 1O64A 1OQGA 4M4GA 2OX3A 2ALUA 3RPLB 3PMVA 5AA3A 4LZ5A 3AXFA 1A8EA 3ROJA 2DWJA 2A5TB 4HXVA 4WXJA 1II5A 2XX9A 3EKIA 2RF1A 4DLDA 5IZ1A 4N81A 1NV0A 3CSGA 4PFWA 3FVKA 2I4BA 3IL1B 4I40A 2O7IA 5ELVA 2XXIA 5DEXB 2I48A 4ND9A 2Z22A 4N13A 2ZYOA 2Y7IA 4N17A 3B7DA 5FBPA 4IGTA 1DCUA 1ANFA 3IAZA 3U72A 4OEVA 2OBGA 3PGFA 3FVNA 2CZLA 3IO4A 4IO4A 2H25A 3KBZA 1T0KA 3BKIB 4H45A 2ZXTA 3IFAA 1UTBA 2DE4A 5CM6A 4OVRA 4YMBA 1XHYA 3TEPA 4QF9A 1KZ8A 4YU0A 2XA5A 1FBDA 1MM7A 1B05A 5AA2D 2H99A 4PDHA 5A5LA 3N6UA 2Z8EA 1S7YA 3HO7A 2CEXA 1P1OA 2QPQA 1JETA 4HE0A 2QRYA 3DP6A 2PT2A 3K6XA 4Z7EA 3FJMA 4NTLA 3BIGA 2QS1A 1KWHA 4F1UA 5I2KB 5J16A 2XWIA 3VLWA 2V25A 1FPKA 3MZBA 3MZ9A 3HFUA 2HEUA 4EF2A 2Q9TA 4TLLB 4Q8RA 2KLFA 2KQZA 4P3LA 4ZECA 3IO6A 2UXAA 5I2NA 1FBEA 3OELA 1MQHA 4NWCA 2NVUB 1IMFA 1PEBA 1LB9A 2I6EA 4I9DA 3C9HA 3OXNA 5CMCA 4YKIA 3PD9A 1MY3A 4R73A 4AS4A 1XVYA 2XX7A 4O8MA 2XXRA 3TUSA 3FJGA 4G68A 3E4RA 3MP1A 1IQ7A 4BLAA 4LZ8A 4GBWA 2VGQA 1YXIA 1MQDA 1SD3A 4THIA 3TQLA 5FTHA 2OWTA 1B5HA 2F78A 4PFRA 2ZYMA 2ZMBA 3T9VA 4GX3A 4O7IA 1Y3NA 3HV1A 3B6TA 4XIGQ 5ET5A 3G3JA 2R9JA 3G3HA 4TLMB 3V89B 1FW0A 4X9TA 1FSAA 1QULA 1VDWA 2DVCA 1Y3PA 4LATA 3H6TA 2DSFA 2DYXA 1AH5A 4LQ5A 1POTA 4PE5B 2QVVA 4PC9A 1LBZA 1DPEA 4OVPA 2F7CA 1VSOA 2GHBA 1NV2A 2YLNA 4R6YA 4DXUA 1FQBA 1SW1A 2HPGA 3L6HA 1MXXA 5EQ7A 3SEXA 5CBSA 1URGA 4JVIA 4PBQA 3FGSA 4YB7A 4RA1A 4RYAA 1IMDA 4OETA 1WDNA 4XKPA 3T9UA 5FTIA 1P1QA 4OFJA 4YZZA 3UORA 2V3QA 5J1DA 3ODBA 3A09A 4YICA 3T93B 3MC2A 1I6AA 3IOWA 1FBHA 2XD3A 1B3EA 1D9YA 4BDNA 3SEUA 4G4PA 4PBHA 2XHDA 1LBCA 1VE4A 3RGYA 4JWXA 1MXWA 2THIA 2A5TA 3QUFA 3UGWA 1IMAA 1UIVA 3KN3A 3KOSA 3UN6A 3BBRA 2F35A 1FQFA 4MBPA 2F7AA 1IMEA 1ATGA 5AA2B 1H76A 4KI0E 5CRYA 3ECRA 4IO2A 4KR5A 5DEXA 3TMGA 3UA8A 4E0WA 3KC0A 3TZAA 5BWJA 1B5IA 2DE3A 3ZSFA 1M5FA 3OO7A 1EZPA 1FBCA 4H5GA 4NX1A 4R9GA 3O6HA 4IY5A 4G8HA 2O1MA 3KBRA 4LVQA 1YYZA 2HXRA 2RINA 2W7YA 2E1SA 3MVXA 1FPJA 5DW8A 4G77A 3SKPA 1KA1A 1USYH 4KCCA 3FV1A 2AL5A 1FJ9A 3CVGA 3H03A 1OVBA 2REGA 4X8RA 4LP2B 4RK9A 2IA4A 3IORA 3SESA 5TPAB 3SDFA 2QMWA 3S9LC 1BP5A 3KN8A 3A3UA 2CMOA 4TQUQ 3G7WA 3C34A 4IGRA 1DPPA 1XVXA 2FA7A 1HSLA 3KN7A 4UA8A 1JEVA 1SYHA 5I2KA 2X26A 3S4UA 1SW2A 4EQ7A 3O66A 2V93A 2V3UA 4F3GA 5JTYB 2F5XA 5EQAA 1US5A 2RKMA 4ELOA 3FXQA 1I6BA 1RDXA 1EYIA 3PUZE 1EH3A 3HSTA 4IO3A 3VXCA 2O68A 1HSJA 2WBBA 1QKBA 2PFYA 4NN3A 4YKKA 3OOAA 1FTAA 4QFPA 1GTKA 3FVOA 1O7TA 3CIJA 1ZLQA 3MAMA 4U23A 4ZE9A 1BK4A 4ESWA 5H8QA 2REJA 1K9YA 5H8FA 4U1OA 2I49A 4EXLA 3K1MA 1A7LA 5EYGA 3B6WA 2F3BA 1D9QA 2WX9A 3KFMA 4M1VA 2I0CA 4KXPA 3U93A 2OCUA 1NH7A 2HQ0A 3TCHA 2P3VA 2Q8JA 1FTMA 1N04A 1D4NA 4PDDA 2WKYA 1RYXA 1IEJA 4BDLA 3K2DA 3PUWE 5H8HB 1OLCA 1NNPA 1B7UA 3TTNA 4O94A 5I58A 2RC9A 4MHFA 3T22A 3O2AA 3T9HB 4OENA 1JVXA 2DP8A 1MPDA 3FZVA 3MJNA 2PYYA 2XX8A 4PE3A 1TFAA 1N76A 1FPIA 3DELB 4OTEA 3K00A 4GF8A 3N26A 1FBGA 1BKAA 1FPEA 3UP9A 1Y4TA 4ESXA 4KD5A 4XFEA 4DXCA 4HE2A 3WAEA 1NNFA 2ONKE 1TFDA 5H8QB 5H8FB 3GBBA 1USYE 3MYUA 1FQCA 2XWVA 1RDYA 3IB2A 4OFOA 3ZKKA 4H5FA 1NUWA 5I7IA 3E79A 4IR8A 3H3GA 2ABHA 1XI6A 1R6ZA 4P0IA 5I2NB 4N6PA 4EXKA 2H9BA 1OLAA 4P1EA 2OWSA 2XXQA 2GQ1A 5I56A 4BDOA 1B4ZA 4JB7A 2ESNA 3T96B 3PMWA 3PU5A 1SQYA 1B0HA 3M8UA 4H0WA 3ONMA 5EHMA 4R2BA 1Q1KA 4EDPA 4NF5B 1TWYA 5F7VA 5DVFA 3PPQA 3Q29A 3R26A 3K6WA 2YPNA 3OSRA 4MLQA 3G3KA 5JEIA 3C32A 3PUVE 3FV2A 1B32A 4TOZA 2PT1A 3SERA 4NF8B 2QMXA 2Y5LA 1P1WA 3L6GA 4XEQA 5A5XA 3OMBA 4MIJA 4GXAA 1OVTA 1EZ9A 3PPNA 4QSEA 4G8NA 3RY3A 1B40A 3PUXE 5ESYA 4DE8A 1MQIA 1M5EA 4ISUA 1P99A 2X7PA 3TKDA 2QL3A 2O69A 5JTYA 4IO6A 1LBBA 5K2YA 1YZ0A 2Q74A 5IGAA 4QFLA 4DIGA 4ZDMA 1CNQA 5HPQA 4FECA 3KJ7A 2ANJA 1DMBA 4EQBA 1RDZA 5AE4A 4I3EA 3FXRA 3LR1A 1NUXA 1FPFA 3C36A 4GX4A 1GVCA 3VVEA 4ZEKA 2XWKA 4GL0A 4RK2A 2Y7WA 2PFZA 2DXRA 3D4CA 3T1BA 1I69A 1NH8A 2Z8DA 2O51A 3MP6A 4GL8A 1LSTA 1H44A 2R6GE 1GGGA 4ZZEA 4MX6A 2OJTA 2FIEA 4GIZA 2QS4A 2V4CA 1FPLA 3C35A 5ICQA 1BLFA 5DVIA 4F31B 4H65A 1YPNA 4QFOA 2DWHA 4R75A 4ELPA 3RT8A 4OEUA 5KDTA 2I3WA 3HPIA 4NHBA 4O3CA 3M3LA 2R71A 4LONB 4AB5A 5AA4A 1TXFA 3PPPA 2FHYA 3KJTA 3QK6A 2D3IA 3B50A 3HN0A 3USDA 3CRBA 3OSQA 5A5XB 1B3GA 2XXYA 1GV8A 3FASA 3PMXA 4DDDA 4PGNA 3PTYA 3H6WA 5I57A 4U4SA 3FATA 4HCWA 1URDA 1US4A 1LB8A 2B4LA 2Z23A 4NEDA 4P8BA 4H46A 1UQWA 3Q28A 4PFBA 3D4GA 3LV0A 5TPAA 3VE1B 4X04A 3RQTA 3DP8A 4DXBA 1Y3QA 5B70A 2XXWA 1MG1A 4N07A 4GLIA 1LBYA 5FHNA 1B2HA 1EU8A 1B51A 1KA0A 1Y1ZA 5IZ3B 1Q35A 3BFTA 2XWOA 4N4UA 4OHNA 3TTRA 1H45A 4F3PA 3U92A 1FTJA 5ET6A 5CMKA 4KHZE 2Q8MA 3JYRA 5I84A 1NI9A 3KZGA 3O6IA 5EQ9A 4LQ2A 2X7QA 1R9LA 3FUZA 1JVYA 2I0BA 4IB2A 4RPOA 1G0IA 1FBPA 2B65A 3F11A 4JBZA 2P3NA 1FPDA 3D1RA 2QFLA 4QFKA 5CBRA 4F2QA 4F22A 3FXBA 1UIUA 4KYDA 3IK6B 5KZTA 3CSBA 5F1QA 1L5TA 4RXLA 1A8FA 4FIMA 1NUYA 2VHAA 4GXSB 3W15C 3K4UA 2GHAA 5TP9A 2NWJA 3MPLA 4R6KA 2QS3A 3KEIA 3VV5A 5I56B 3MP8A 3KGCA 3TCGA 1SPIA 4LN5A 4PP0A 2XXPA 4QSDA 1PDAA 1LBVA 1ZKBA 5L9SA 4N91A 3GZGA 3K0VA 1H3DA 1LLSA 2CZHA 4BDQA 1PC3A 1K9ZA 1LAHE 1BTJA 2D5WA 3RUMA 3KOTA 4PFIA 1NV1A 2ZYNA 1PBPA 3LSFB 1UTBB 4NF4B 2QVRA 1IXIA 1TT1A 3ZS6A 4OANA 3MPKA 1B46A 3EHSA 1QVSA 2UYEA 1A55A 3FVGA 3GYYA 1NFTA 5H8SA 5FHMA 2H98A 3K6VA 4YAHX 2L5VA 4DI3D 3K01A 1UTHB 4IY6A 4JVCA 3VFJA 3OO8A 4KYSA 4FE8A 1B9JA 5ITOA 1FPBA 4PF6A 1MQGA 3OENA 3S2VA 3C31A 4QSCA 1QGXA 3CG3A 2DXYA 1EZOA 4U4XA 3RNNA 4XXUA 3TQWA 3IX1A 3LC8A 2CZIA 4OWDA 3A29A 5EHSA 5CC2A 3MW0A 3VLUA 4F39A 1B7ZA 2D21A 4NG7A 5HM4B 1BIYA 1MH3A 2GH9A 5KDTB 2B3FA 4PAIA 1B58A 1IXGA 2VP1A 4XKNA 2NOOA 1QUKA 2DOJA 2ZZWA 4RNSA 4PFUA 2Q2AA 3CFLA 4GWOA 4MH5A 4JDFA 1RKMA 4NF5A 5ICTA 1VR5A 3G3GA 4EUOA 1B1XA 3KC1A 5FHOA 4F1YA 4GWYA 4KQPA 1ZU0A 1FQAA 1XC1A 4MAGA 3VVDA 4NF4A 5I57B 1B0LA 1MY4A 1FTOA 2M8CA 2R8TA 1NMUA 5DTBA 3A3CA 1LEVA 3BFUA 4R6HA 3MVWA 2I4CA 4N6KA 1IMBA 4O3AA 1B6HA 1ZBMA 5H8NB 1B1HA 5LDZA 4P47A 4U22A 2PBWA 2F36A 1H43A 2UVGA 3QUJA 1P1NA 1IITA 2P2AA 1M5CA 4UABA 4JWYA 4U1ZA 1N7XA 1J1NA 3U1OA 4H1XA 4PAKA 2DWIA 2OK2A 3TTLA 3V5AA 2XXVA 3M3KA 2ZYKA 3PUYE 4OYVA 1NL5A 1B3HA 1SVXB 4NQ8A 2VOZA 4AB6A 2VPOA 3GLBA 4DCYA 3OEKA 2DE2A 4ZEIA 1B4HA 5L8DA 1FQDA 2O84X 2VPNA 3IOVA 3RTFB 3TYHA 4F29A 1B5JA 4DI4B 4U2RA 2FYIA 3GXAA 1N0TA 2Y5KA 1QUJA 3TODA 1JW5A 1NUZA 3CI8A 1PBQA 1R1NA 2WYKA 2CZKA 1JW4A 4H8JA 4OQOA
chains in the Genus database with same CATH topology
4YB6A 5HPQA 1DPEA 3MQ9A 2PMSA 3KJ7A 4FECA 2PX1A 3OO6A 1N3WA 3EN3A 2ANJA 1DMBA 3SEVA 2F7CA 4EQBA 5AE4A 2AYSA 4ONYA 4E0XA 3OO9A 1VSOA 2GHBA 4OVJA 3QAXA 4YKJA 2YLNA 4R6YA 3S9EA 4DXUA 3I3VA 1SI0A 3FXRA 4EF1A 2Y7KA 1FQBA 1MPCA 1GR2A 1SW1A 2GFEA 2UVJA 3LR1A 3L6HA 4NE4A 1MXXA 3QXMA 4POXA 3SEYA 1MXVA 3C36A 3SEXA 3H4ZA 4X1BA 2F6GA 3DP4A 1OQHA 1ELJA 3O6GA 1GVCA 2F8DA 3VVEA 1N84A 4I8CA 4ZEKA 5CBSA 4GL0A 4OERA 3OEMA 2UVIA 4RK2A 2O7UA 1URGA 2Y7WA 1N3XA 2HZKA 4H67A 5DYHA 3FGSA 4XKQA 5TP9B 4ZEFA 3VVFA 5LOMA 4YB7A 1Z7ME 4YB5A 3FIRA 2DXRA 4NF8A 4RA1A 4RYAA 2HXWA 3D4CA 4OETA 4PFYA 3N5LA 5H8HA 1I69A 2F34A 5JK4A 1WDNA 1NH8A 3R6UA 2P1SA 4XKPA 3PV0E 4L17A 3RN8A 2ZNUA 3T9UA 5FTIA 1P1QA 2Z8DA 2O51A 3MP6A 4OFJA 4YZZA 3UORA 2Q88A 2V3QA 4GL8A 5J1DA 3ODBA 1LSTA 3A09A 4RY1A 5IKBA 1H44A 2R6GE 1GGGA 4YICA 3H06B 3JZJA 4ZZEA 3T93B 1LCFA 5AA3A 3MC2A 1I6AA 4DCXA 3IOWA 2OJTA 1MY0A 4GIZA 2QS4A 2XD3A 4EQ9A 4F3SA 1B3EA 3T9XB 3C35A 5IAIA 4AQ4A 1BLFA 1D9YA 2XD2A 1PB9A 5DVIA 4H65A 4ELQA 4F31B 4OXVA 4BDNA 4XKRA 1YPNA 3SEUA 4G4PA 3TPAA 3UK4A 4QFOA 2DWHA 4G2ZA 1NKXA 4R75A 3QSLA 5H8NA 4ELPA 3MWBA 3RT8A 4OEUA 1MQJA 1S9TA 4OZ9A 4BDMA 1SDXA 2XHDA 2I3WA 3HPIA 1AMFA 1LBCA 3IJOB 3QIMA 5KDTA 1VE4A 3RGYA 2NUVA 1QUIA 4JWXA 1MXWA 4O3CA 2ONRA 2R71A 3M3LA 2THIA 5M2VA 4LONB 1SBPA 2A5TA 3QUFA 3ILUB 4AB5A 1JW1A 1TXFA 2PVUA 4FAJA 5AA4A 5KCJA 3UGWA 5I58B 1B52A 1UIVA 2UVHA 2UYFA 3KN3A 3KSJA 3PPPA 3SETA 3KOSA 4ZEBA 3UN6A 4WEPA 3KJTA 3QK6A 3N6TA 3DLNA 1URSA 2D3IA 3BBRA 4JSDA 5ITPA 3TAJA 2F35A 3I5OA 1IIWA 2IEEA 3HN0A 3U94A 1FQFA 4MBPA 3USDA 1XT8A 3CRBA 3MVZA 2Q89A 1JNFA 3OSQA 4HW8A 5A5XB 2F97A 2F7AA 2XXUA 1B3GA 1ATGA 3FD3A 2XXYA 5AA2B 4R9FA 3E3KA 3FASA 3PMXA 1GV8A 2AL4A 2FNCA 4NWDA 4OFLA 1H76A 2QJEA 4KI0E 4DDDA 1FQEA 3LSXA 2P0SA 3PPRA 4K3FA 5CRYA 3ECRA 3VDFA 3H6WA 4IO2A 4KR5A 5DEXA 3TMGA 3UA8A 4E0WA 5I57A 1M5DA 1FTKA 3TZAA 1NNKA 5BWJA 1B5IA 2DE3A 3ZSFA 4U4SA 1B7HA 3FATA 3G3FA 3LUYA 4HCWA 4ZE8A 1URDA 1XOCA 4IO7A 1US4A 2Q2CA 3IR1A 1M5FA 3S9MC 1FTLA 1LB8A 4FATA 5AA2A 4Q30B 3OO7A 3O29A 2Z23A 4HCYA 1LFGA 4LZ7A 4NEDA 3WAFA 4H5GA 1Y20A 1EZPA 3EHTA 4GRKA 4POWA 1P1UA 1UTHA 1UQWA 3Q28A 3IB1A 4R9GA 1QKAA 3D4GA 3UIFA 5TPAA 2V3TA 3VE1B 3Q27A 3O6HA 2G93A 3DP8A 3RQTA 4OMBA 4DXBA 1WODA 1Y3QA 4IY5A 5B70A 1PB8A 2O1MA 4G8HA 3K6UA 4F1VA 2XXWA 3KBRA 1MG1A 4LVQA 2Y7PA 1LAXA 2RCAA 2RINA 2W7YA 1MXUA 4GLIA 4N07A 2E1SA 1LFHA 3TFLA 5FHNA 1B2HA 1EU8A 2Y84A 3MVXA 3VXBA 3MUQA 1B51A 1XS5A 4G77A 1Y1ZA 3SKPA 1Q35A 3BFTA 1O63A 3OD7A 3R7XA 1USYH 4KCCA 5CMMA 5CMBA 1YAEA 4OHNA 3TTRA 2F6PA 1H45A 5L9MA 3I6VA 3U92A 1FTJA 4KPTA 4F3PA 3FV1A 2AL5A 2G29A 5CMKA 2DVZA 1LGBC 4JXIA 4KHZE 1MPBA 3JYRA 4FEBA 3CVGA 3H03A 4NF6A 1OVBA 5I84A 2REGA 2RCBA 1A99A 3KZGA 3O6IA 2Z8FA 4LQ2A 3PPOA 5KZTA 4LUBA 2X7QA 1R9LA 4LP2B 4RK9A 2IA4A 3FUZA 3IORA 1JVYA 3LBSA 4I1DA 5EYFA 5TPAB 3SDFA 2QMWA 1SYIA 1BP5A 1WVJA 2I58A 4ELRA 3S9LC 3KN8A 2I0BA 3RT6B 3A3UA 2CMOA 5ISUA 3B6QA 1JQFA 4TQUQ 3G7WA 3C34A 4IGRA 1DPPA 4FEDA 1IXCA 2OZZA 1LCTA 4PETA 1XVXA 4IB2A 4RPOA 3LSLA 5ICQA 3IOUA 2B65A 2FA7A 1HSLA 3F11A 3TDJA 4JBZA 3KN7A 3CG1A 4UA8A 1JEVA 3MVYA 4C0RA 5B7DA 1SYHA 5I2KA 4H6DA 2X26A 3N94A 3S4UA 1SW2A 4EQ7A 3O66A 2H5YA 2V93A 4QFKA 5CBRA 1YTVA 2V3UA 4F2QA 4F3GA 4F22A 3CFZA 1UIUA 1ZMGA 1Y1MA 4KYDA 4UACA 1FCKA 5JTYB 3IK6B 3U8QA 3E9XA 4R74A 4FJPA 4H8IA 4F2OA 3CSBA 2F5XA 3E13X 5F1QA 1L5TA 1US5A 2RKMA 2AIXA 3EF7A 3QYTA 4RXLA 4ELOA 3FXQA 1A8FA 3O9PA 3KSXA 1DOTA 1I6BA 2QSXA 3IB0A 4ZZAA 3EHUA 4FIMA 3EQ1A 3PUZE 1DTGA 1EH3A 2VHAA 2XXHA 3HSTA 4GOTA 4GXSB 4IO3A 3VXCA 3W15C 2VD2A 3K4UA 3Q25A 5TU0A 2GHAA 5TP9A 2NWJA 3RLFE 2O68A 3HCQA 5BUUA 1HSJA 3MPLA 1D3KA 3O97A 5HBCA 1QKBA 4R6KA 2QS3A 3FXUA 3KEIA 1IXHA 4YKKA 3VV5A 1PB7A 3OOAA 4Q5TA 3MP8A 4QFNA 1I6QA 3KGCA 3TCGA 4ZEDA 5I56B 3W9VA 1M5BA 1GTKA 4QFPA 4JSOA 3VLWA 3FVOA 4PP0A 1O7TA 2XXPA 3CIJA 1DTZA 4JWOA 1AL3A 3RPWA 1ZLQA 3TCFA 4G68C 4QSDA 3MAMA 3IJXB 1PDAA 4U23A 4F3BA 4PQJA 1ZKBA 2LAOA 4KFQA 3MBPA 4NMYA 5K2XA 5L9SA 1MDP1 4P0GA 4ZE9A 1F9BA 1MRPA 5I59B 2RC8A 3GZGA 3H7MA 3K0VA 4U21A 1H3DA 4BDRA 1DSNA 1LLSA 4BDQA 4ESWA 2YJPA 3H6UA 5H8QA 2REJA 1AIVA 3TTMA 1PC3A 1MDQA 2E0SA 5H8FA 4U1OA 2A5SA 1Y9UA 4OESA 1MY1A 1LAHE 1BTJA 2I49A 2ZNSA 2D5WA 2DWAA 3FJ7A 3K1MA 3H6VA 1A7LA 2NXOA 4X48A 3KOTA 3RUMA 4EXLA 4R72A 4WEDA 1JEUA 3MZ1A 5L9OA 3B6WA 1SW4A 2ZYNA 4O3BA 1PBPA 1R9QA 1B3LA 3LSFB 1CE2A 1UTBB 4NF4B 1O64A 1OQGA 3K02A 1IXIA 1TT1A 4M4GA 5DT6A 3ZS6A 4Q0CA 3MPKA 1B46A 2ALUA 1QW0A 2ONSA 1IUDA 1QVSA 3EHSA 3KFMA 2UYEA 3PMVA 1A55A 4LZ5A 4M1VA 4BLAA 4F18A 3AXFA 3FVGA 1A8EA 2I0CA 1NFTA 1S50A 2DWJA 4MLVA 2A5TB 5H8SA 5KCJB 5FHMA 2H98A 3TTKA 3U93A 3K6VA 2OCUA 3T66A 1NH7A 4YAHX 1MXYA 2HQ0A 3TCHA 1LFIA 2Q8JA 1FTMA 2VD3A 1N04A 3K01A 1UTHB 4WXJA 1II5A 3CFXA 2XX9A 4IY6A 1D4NA 3VFJA 3OO8A 2RF1A 4GFRA 4FE8A 4GD5A 4KYSA 2WKYA 4DLDA 1RYXA 1B9JA 1IEJA 4BDLA 3CSGA 4KYEA 4PFWA 5ITOA 3K2DA 3FVKA 2I4BA 3IL1B 3PUWE 2O7IA 1MQGA 1OLCA 4PFTA 5H8HB 5ELVA 1NNPA 2XXIA 1ZIUA 3OENA 1B7UA 5DEXB 3S2VA 3C31A 3TTNA 5AA4B 2V84A 2I48A 3P7IA 4ND9A 2Z22A 4QSCA 4C1UA 5I58A 4N13A 2ZYOA 3CG3A 3K1PA 2DXYA 2RC9A 2Y7IA 2HFBA 3B7DA 4U4XA 4QHQA 4ZS9A 1B3FA 1EZOA 1CB6A 3T22A 3RNNA 2H4IA 4XXUA 1OIBA 3TQWA 3IX1A 3O2AA 4ECFA 4IGTA 3T9HB 4OENA 5DVJA 4YMAA 3LC8A 1JVXA 3CR9A 1ANFA 1POY1 4OWDA 3IAZA 2DP8A 3U72A 4OEVA 3ILTB 1MPDA 3FZVA 3MJNA 2PYYA 2XX8A 4QRZA 2HCAA 2OBGA 5EHSA 3PGFA 3FVNA 5CC2A 1MXZA 1TFAA 1A40A 2CZLA 1N76A 3MW0A 3VLUA 1ZTYA 3DELB 3IO4A 2H25A 4IO4A 4OTEA 4X1DA 1HSEA 1MH4A 1YCJA 4F39A 1T0KA 1LAFE 3K00A 4GF8A 3BKIB 3N26A 1ZJLA 2D21A 1B7ZA 1A54A 1BKAA 1BIYA 1MH3A 2HAVA 2ZXTA 3DM0A 2GH9A 2I3VA 2B3FA 3LSWA 3UP9A 1B58A 1IXGA 2VP1A 4XKNA 5KDTB 2NOOA 5CI5A 1UTBA 2DE4A 1QUKA 2DOJA 5CM6A 4RNSA 4YMBA 4PFUA 3K1NA 1XHYA 2Q2AA 1Y4TA 3M3FA 3TEPA 1VFEA 3CFLA 4QF9A 4WKMA 4ESXA 3O28A 4KD5A 3HHFA 4YU0A 4DXCA 4GWOA 1LAGE 3WAEA 3HHGA 1MM7A 1B05A 4MH5A 5AA2D 1NNFA 2H99A 2ONKE 4KCDA 4JDFA 4MFIA 1TFDA 1RKMA 5H8QB 4NF5A 3ZKLA 3N6UA 2Z8EA 5ICTA 5H8FB 3GBBA 1S7YA 1VR5A 1USYE 3G3GA 4EUOA 1B1XA 1FQCA 3HO7A 5FHOA 3IB2A 4I62A 4F1YA 4OFOA 3ZKKA 1P1OA 4KQPA 2QPQA 4H5FA 3TTLA 1SI1A 1ZU0A 3SEWA 1JETA 1FQAA 1XC1A 5HM4B 3H3GA 2ABHA 2QRYA 3VVDA 4NF4A 1MY2A 4Z0IA 1R6ZA 4P0IA 3DP6A 5I2NB 4N6PA 2PT2A 4EXKA 3K6XA 2H9BA 1OLAA 3FJMA 4NF6B 4Z7EA 5I57B 1QJMA 1B0LA 1MY4A 2OWSA 4NTLA 2XXQA 3S9NC 2QS1A 1KWHA 3TELA 4F1UA 1FTOA 3V8XB 5I56A 4BDOA 1B4ZA 1N7WA 2M8CA 5I2KB 1NMUA 2O6AA 3Q26A 4JB7A 2ESNA 4RPNA 5DTBA 3A3CA 2GRVA 3T96B 3PMWA 3PU5A 2V25A 1SQYA 1B0HA 3M8UA 3BFUA 3MZBA 4R6HA 4H0WA 3THIA 3MZ9A 3ONMA 5EHMA 4DZ1A 3MVWA 4R2BA 1Q1KA 4EDPA 4NF5B 2HEUA 1TWYA 2I4CA 4EF2A 1Y4CA 2Q9TA 2ZNTA 3C4MA 4FORA 4MF3A 4TLLB 5DVFA 5F7VA 3PD8A 2KLFA 4Q8RA 3GBAA 3V83A 3PPQA 3Q29A 4ZECA 3R26A 4O3AA 3K6WA 1SW5A 3IO6A 2YPNA 3SESA 1B6HA 1ZBMA 2UXAA 5H8NB 1B1HA 2OLBA 3OSRA 3W9WA 4MLQA 3IOTA 5I2NA 4IO5A 3OELA 3G3KA 3VLVA 1MQHA 4NWCA 4U22A 2PBWA 5JEIA 2NVUB 2F36A 3C32A 3PUVE 3RTWB 1H43A 1PEBA 2UVGA 1B32A 3EPEA 1LB9A 2I6EA 2F7BA 3FV2A 1P1NA 3QUJA 4I9DA 3C9HA 3OXNA 4TOZA 3U1OA 5CMCA 1IITA 1OMPA 1VFDA 3PD9A 4YKIA 1MY3A 4RJZA 2P2AA 4R73A 1M5CA 2PT1A 4LA9A 1XVYA 2XX7A 2HZLA 4JWYA 2RC7A 1AOVA 2XXRA 4U1ZA 3SERA 3KG2A 3FJGA 3TUSA 1N7XA 4G68A 1J1NA 1Z7NE 3E4RA 3MP1A 1IQ7A 2QMXA 4NF8B 4LZ8A 4GVOA 4H1XA 2DWIA 1P1WA 2VGQA 3G3IA 2OK2A 1MQDA 1SD3A 3L6GA 4THIA 2XXVA 4XTCQ 5FTHA 3M3KA 2XXXA 2OWTA 3TQLA 3V5AA 4F19A 5A5XA 2ZYKA 3JV9A 2HAUA 2Y7RA 1B5HA 1MM6A 2F78A 3OMBA 3PUYE 4G8MA 2ZYMA 2ZMBA 4GXAA 3T9VA 1OVTA 4GQOA 1EZ9A 4OYVA 3PPNA 4QSEA 4G8NA 1NL5A 2B3BA 3RY3A 1B3HA 1B40A 4YKPA 1Y3NA 1SVXB 3HV1A 3PUXE 2O1LA 2VOZA 4HTGA 3GLBA 4AB6A 4DCYA 3OEKA 3B6TA 4XIGQ 2DE2A 3G3JA 4ZEIA 1B4HA 2BJJX 4P11A 2R9JA 4DE8A 2XXTA 1MQIA 1D9VA 3G3HA 4TLMB 5L8DA 3V89B 1M5EA 4HS7A 1FW0A 4ISUA 1MS7A 2QS2A 4X9TA 1FQDA 1P99A 2O84X 2X7PA 5I59A 1RYOA 3TKDA 3IOVA 3RTFB 1QULA 2QL3A 2O69A 2DVCA 1Y3PA 3TYHA 5JTYA 3C33A 4IO6A 4F29A 4R2FA 1B5JA 1LBBA 4G68B 4LATA 3H6TA 2DSFA 4U2RA 2DYXA 2FYIA 5K2YA 1NNTA 3GXAA 5AA1A 1AH5A 1N0TA 1QUJA 3TODA 1JW5A 4QFLA 1IZ1A 2DQVA 4DIGA 3CI8A 1PBQA 1R1NA 2DS9A 4LQ5A 1POTA 4ZDMA 4C1TA 1JW4A 4PE5B 4H8JA 4OQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YB6 A;  5HPQ A;  1DPE A;  3MQ9 A;  2PMS A;  3KJ7 A;  4FEC A;  2PX1 A;  3OO6 A;  1N3W A;  3EN3 A;  2ANJ A;  1DMB A;  3SEV A;  2F7C A;  4EQB A;  5AE4 A;  2AYS A;  4ONY A;  4E0X A;  3OO9 A;  1VSO A;  2GHB A;  4OVJ A;  3QAX A;  4YKJ A;  2YLN A;  4R6Y A;  3S9E A;  4DXU A;  3I3V A;  1SI0 A;  3FXR A;  4EF1 A;  2Y7K A;  1FQB A;  1MPC A;  1GR2 A;  1SW1 A;  2GFE A;  2UVJ A;  3LR1 A;  3L6H A;  4NE4 A;  1MXX A;  3QXM A;  4POX A;  3SEY A;  1MXV A;  3C36 A;  3SEX A;  3H4Z A;  4X1B A;  2F6G A;  3DP4 A;  1OQH A;  1ELJ A;  3O6G A;  1GVC A;  2F8D A;  3VVE A;  1N84 A;  4I8C A;  4ZEK A;  5CBS A;  4GL0 A;  4OER A;  3OEM A;  2UVI A;  4RK2 A;  2O7U A;  1URG A;  2Y7W A;  1N3X A;  2HZK A;  4H67 A;  5DYH A;  3FGS A;  4XKQ A;  5TP9 B;  4ZEF A;  3VVF A;  5LOM A;  4YB7 A;  1Z7M E;  4YB5 A;  3FIR A;  2DXR A;  4NF8 A;  4RA1 A;  4RYA A;  2HXW A;  3D4C A;  4OET A;  4PFY A;  3N5L A;  5H8H A;  1I69 A;  2F34 A;  5JK4 A;  1WDN A;  1NH8 A;  3R6U A;  2P1S A;  4XKP A;  3PV0 E;  4L17 A;  3RN8 A;  2ZNU A;  3T9U A;  5FTI A;  1P1Q A;  2Z8D A;  2O51 A;  3MP6 A;  4OFJ A;  4YZZ A;  3UOR A;  2Q88 A;  2V3Q A;  4GL8 A;  5J1D A;  3ODB A;  1LST A;  3A09 A;  4RY1 A;  5IKB A;  1H44 A;  2R6G E;  1GGG A;  4YIC A;  3H06 B;  3JZJ A;  4ZZE A;  3T93 B;  1LCF A;  5AA3 A;  3MC2 A;  1I6A A;  4DCX A;  3IOW A;  2OJT A;  1MY0 A;  4GIZ A;  2QS4 A;  2XD3 A;  4EQ9 A;  4F3S A;  1B3E A;  3T9X B;  3C35 A;  5IAI A;  4AQ4 A;  1BLF A;  1D9Y A;  2XD2 A;  1PB9 A;  5DVI A;  4H65 A;  4ELQ A;  4F31 B;  4OXV A;  4BDN A;  4XKR A;  1YPN A;  3SEU A;  4G4P A;  3TPA A;  3UK4 A;  4QFO A;  2DWH A;  4G2Z A;  1NKX A;  4R75 A;  3QSL A;  5H8N A;  4ELP A;  3MWB A;  3RT8 A;  4OEU A;  1MQJ A;  1S9T A;  4OZ9 A;  4BDM A;  1SDX A;  2XHD A;  2I3W A;  3HPI A;  1AMF A;  1LBC A;  3IJO B;  3QIM A;  5KDT A;  1VE4 A;  3RGY A;  2NUV A;  1QUI A;  4JWX A;  1MXW A;  4O3C A;  2ONR A;  2R71 A;  3M3L A;  2THI A;  5M2V A;  4LON B;  1SBP A;  2A5T A;  3QUF A;  3ILU B;  4AB5 A;  1JW1 A;  1TXF A;  2PVU A;  4FAJ A;  5AA4 A;  5KCJ A;  3UGW A;  5I58 B;  1B52 A;  1UIV A;  2UVH A;  2UYF A;  3KN3 A;  3KSJ A;  3PPP A;  3SET A;  3KOS A;  4ZEB A;  3UN6 A;  4WEP A;  3KJT A;  3QK6 A;  3N6T A;  3DLN A;  1URS A;  2D3I A;  3BBR A;  4JSD A;  5ITP A;  3TAJ A;  2F35 A;  3I5O A;  1IIW A;  2IEE A;  3HN0 A;  3U94 A;  1FQF A;  4MBP A;  3USD A;  1XT8 A;  3CRB A;  3MVZ A;  2Q89 A;  1JNF A;  3OSQ A;  4HW8 A;  5A5X B;  2F97 A;  2F7A A;  2XXU A;  1B3G A;  1ATG A;  3FD3 A;  2XXY A;  5AA2 B;  4R9F A;  3E3K A;  3FAS A;  3PMX A;  1GV8 A;  2AL4 A;  2FNC A;  4NWD A;  4OFL A;  1H76 A;  2QJE A;  4KI0 E;  4DDD A;  1FQE A;  3LSX A;  2P0S A;  3PPR A;  4K3F A;  5CRY A;  3ECR A;  3VDF A;  3H6W A;  4IO2 A;  4KR5 A;  5DEX A;  3TMG A;  3UA8 A;  4E0W A;  5I57 A;  1M5D A;  1FTK A;  3TZA A;  1NNK A;  5BWJ A;  1B5I A;  2DE3 A;  3ZSF A;  4U4S A;  1B7H A;  3FAT A;  3G3F A;  3LUY A;  4HCW A;  4ZE8 A;  1URD A;  1XOC A;  4IO7 A;  1US4 A;  2Q2C A;  3IR1 A;  1M5F A;  3S9M C;  1FTL A;  1LB8 A;  4FAT A;  5AA2 A;  4Q30 B;  3OO7 A;  3O29 A;  2Z23 A;  4HCY A;  1LFG A;  4LZ7 A;  4NED A;  3WAF A;  4H5G A;  1Y20 A;  1EZP A;  3EHT A;  4GRK A;  4POW A;  1P1U A;  1UTH A;  1UQW A;  3Q28 A;  3IB1 A;  4R9G A;  1QKA A;  3D4G A;  3UIF A;  5TPA A;  2V3T A;  3VE1 B;  3Q27 A;  3O6H A;  2G93 A;  3DP8 A;  3RQT A;  4OMB A;  4DXB A;  1WOD A;  1Y3Q A;  4IY5 A;  5B70 A;  1PB8 A;  2O1M A;  4G8H A;  3K6U A;  4F1V A;  2XXW A;  3KBR A;  1MG1 A;  4LVQ A;  2Y7P A;  1LAX A;  2RCA A;  2RIN A;  2W7Y A;  1MXU A;  4GLI A;  4N07 A;  2E1S A;  1LFH A;  3TFL A;  5FHN A;  1B2H A;  1EU8 A;  2Y84 A;  3MVX A;  3VXB A;  3MUQ A;  1B51 A;  1XS5 A;  4G77 A;  1Y1Z A;  3SKP A;  1Q35 A;  3BFT A;  1O63 A;  3OD7 A;  3R7X A;  1USY H;  4KCC A;  5CMM A;  5CMB A;  1YAE A;  4OHN A;  3TTR A;  2F6P A;  1H45 A;  5L9M A;  3I6V A;  3U92 A;  1FTJ A;  4KPT A;  4F3P A;  3FV1 A;  2AL5 A;  2G29 A;  5CMK A;  2DVZ A;  1LGB C;  4JXI A;  4KHZ E;  1MPB A;  3JYR A;  4FEB A;  3CVG A;  3H03 A;  4NF6 A;  1OVB A;  5I84 A;  2REG A;  2RCB A;  1A99 A;  3KZG A;  3O6I A;  2Z8F A;  4LQ2 A;  3PPO A;  5KZT A;  4LUB A;  2X7Q A;  1R9L A;  4LP2 B;  4RK9 A;  2IA4 A;  3FUZ A;  3IOR A;  1JVY A;  3LBS A;  4I1D A;  5EYF A;  5TPA B;  3SDF A;  2QMW A;  1SYI A;  1BP5 A;  1WVJ A;  2I58 A;  4ELR A;  3S9L C;  3KN8 A;  2I0B A;  3RT6 B;  3A3U A;  2CMO A;  5ISU A;  3B6Q A;  1JQF A;  4TQU Q;  3G7W A;  3C34 A;  4IGR A;  1DPP A;  4FED A;  1IXC A;  2OZZ A;  1LCT A;  4PET A;  1XVX A;  4IB2 A;  4RPO A;  3LSL A;  5ICQ A;  3IOU A;  2B65 A;  2FA7 A;  1HSL A;  3F11 A;  3TDJ A;  4JBZ A;  3KN7 A;  3CG1 A;  4UA8 A;  1JEV A;  3MVY A;  4C0R A;  5B7D A;  1SYH A;  5I2K A;  4H6D A;  2X26 A;  3N94 A;  3S4U A;  1SW2 A;  4EQ7 A;  3O66 A;  2H5Y A;  2V93 A;  4QFK A;  5CBR A;  1YTV A;  2V3U A;  4F2Q A;  4F3G A;  4F22 A;  3CFZ A;  1UIU A;  1ZMG A;  1Y1M A;  4KYD A;  4UAC A;  1FCK A;  5JTY B;  3IK6 B;  3U8Q A;  3E9X A;  4R74 A;  4FJP A;  4H8I A;  4F2O A;  3CSB A;  2F5X A;  3E13 X;  5F1Q A;  1L5T A;  1US5 A;  2RKM A;  2AIX A;  3EF7 A;  3QYT A;  4RXL A;  4ELO A;  3FXQ A;  1A8F A;  3O9P A;  3KSX A;  1DOT A;  1I6B A;  2QSX A;  3IB0 A;  4ZZA A;  3EHU A;  4FIM A;  3EQ1 A;  3PUZ E;  1DTG A;  1EH3 A;  2VHA A;  2XXH A;  3HST A;  4GOT A;  4GXS B;  4IO3 A;  3VXC A;  3W15 C;  2VD2 A;  3K4U A;  3Q25 A;  5TU0 A;  2GHA A;  5TP9 A;  2NWJ A;  3RLF E;  2O68 A;  3HCQ A;  5BUU A;  1HSJ A;  3MPL A;  1D3K A;  3O97 A;  5HBC A;  1QKB A;  4R6K A;  2QS3 A;  3FXU A;  3KEI A;  1IXH A;  4YKK A;  3VV5 A;  1PB7 A;  3OOA A;  4Q5T A;  3MP8 A;  4QFN A;  1I6Q A;  3KGC A;  3TCG A;  4ZED A;  5I56 B;  3W9V A;  1M5B A;  1GTK A;  4QFP A;  4JSO A;  3VLW A;  3FVO A;  4PP0 A;  1O7T A;  2XXP A;  3CIJ A;  1DTZ A;  4JWO A;  1AL3 A;  3RPW A;  1ZLQ A;  3TCF A;  4G68 C;  4QSD A;  3MAM A;  3IJX B;  1PDA A;  4U23 A;  4F3B A;  4PQJ A;  1ZKB A;  2LAO A;  4KFQ A;  3MBP A;  4NMY A;  5K2X A;  5L9S A;  1MDP 1;  4P0G A;  4ZE9 A;  1F9B A;  1MRP A;  5I59 B;  2RC8 A;  3GZG A;  3H7M A;  3K0V A;  4U21 A;  1H3D A;  4BDR A;  1DSN A;  1LLS A;  4BDQ A;  4ESW A;  2YJP A;  3H6U A;  5H8Q A;  2REJ A;  1AIV A;  3TTM A;  1PC3 A;  1MDQ A;  2E0S A;  5H8F A;  4U1O A;  2A5S A;  1Y9U A;  4OES A;  1MY1 A;  1LAH E;  1BTJ A;  2I49 A;  2ZNS A;  2D5W A;  2DWA A;  3FJ7 A;  3K1M A;  3H6V A;  1A7L A;  2NXO A;  4X48 A;  3KOT A;  3RUM A;  4EXL A;  4R72 A;  4WED A;  1JEU A;  3MZ1 A;  5L9O A;  3B6W A;  1SW4 A;  2ZYN A;  4O3B A;  1PBP A;  1R9Q A;  1B3L A;  3LSF B;  1CE2 A;  1UTB B;  4NF4 B;  1O64 A;  1OQG A;  3K02 A;  1IXI A;  1TT1 A;  4M4G A;  5DT6 A;  3ZS6 A;  4Q0C A;  3MPK A;  1B46 A;  2ALU A;  1QW0 A;  2ONS A;  1IUD A;  1QVS A;  3EHS A;  3KFM A;  2UYE A;  3PMV A;  1A55 A;  4LZ5 A;  4M1V A;  4BLA A;  4F18 A;  3AXF A;  3FVG A;  1A8E A;  2I0C A;  1NFT A;  1S50 A;  2DWJ A;  4MLV A;  2A5T B;  5H8S A;  5KCJ B;  5FHM A;  2H98 A;  3TTK A;  3U93 A;  3K6V A;  2OCU A;  3T66 A;  1NH7 A;  4YAH X;  1MXY A;  2HQ0 A;  3TCH A;  1LFI A;  2Q8J A;  1FTM A;  2VD3 A;  1N04 A;  3K01 A;  1UTH B;  4WXJ A;  1II5 A;  3CFX A;  2XX9 A;  4IY6 A;  1D4N A;  3VFJ A;  3OO8 A;  2RF1 A;  4GFR A;  4FE8 A;  4GD5 A;  4KYS A;  2WKY A;  4DLD A;  1RYX A;  1B9J A;  1IEJ A;  4BDL A;  3CSG A;  4KYE A;  4PFW A;  5ITO A;  3K2D A;  3FVK A;  2I4B A;  3IL1 B;  3PUW E;  2O7I A;  1MQG A;  1OLC A;  4PFT A;  5H8H B;  5ELV A;  1NNP A;  2XXI A;  1ZIU A;  3OEN A;  1B7U A;  5DEX B;  3S2V A;  3C31 A;  3TTN A;  5AA4 B;  2V84 A;  2I48 A;  3P7I A;  4ND9 A;  2Z22 A;  4QSC A;  4C1U A;  5I58 A;  4N13 A;  2ZYO A;  3CG3 A;  3K1P A;  2DXY A;  2RC9 A;  2Y7I A;  2HFB A;  3B7D A;  4U4X A;  4QHQ A;  4ZS9 A;  1B3F A;  1EZO A;  1CB6 A;  3T22 A;  3RNN A;  2H4I A;  4XXU A;  1OIB A;  3TQW A;  3IX1 A;  3O2A A;  4ECF A;  4IGT A;  3T9H B;  4OEN A;  5DVJ A;  4YMA A;  3LC8 A;  1JVX A;  3CR9 A;  1ANF A;  1POY 1;  4OWD A;  3IAZ A;  2DP8 A;  3U72 A;  4OEV A;  3ILT B;  1MPD A;  3FZV A;  3MJN A;  2PYY A;  2XX8 A;  4QRZ A;  2HCA A;  2OBG A;  5EHS A;  3PGF A;  3FVN A;  5CC2 A;  1MXZ A;  1TFA A;  1A40 A;  2CZL A;  1N76 A;  3MW0 A;  3VLU A;  1ZTY A;  3DEL B;  3IO4 A;  2H25 A;  4IO4 A;  4OTE A;  4X1D A;  1HSE A;  1MH4 A;  1YCJ A;  4F39 A;  1T0K A;  1LAF E;  3K00 A;  4GF8 A;  3BKI B;  3N26 A;  1ZJL A;  2D21 A;  1B7Z A;  1A54 A;  1BKA A;  1BIY A;  1MH3 A;  2HAV A;  2ZXT A;  3DM0 A;  2GH9 A;  2I3V A;  2B3F A;  3LSW A;  3UP9 A;  1B58 A;  1IXG A;  2VP1 A;  4XKN A;  5KDT B;  2NOO A;  5CI5 A;  1UTB A;  2DE4 A;  1QUK A;  2DOJ A;  5CM6 A;  4RNS A;  4YMB A;  4PFU A;  3K1N A;  1XHY A;  2Q2A A;  1Y4T A;  3M3F A;  3TEP A;  1VFE A;  3CFL A;  4QF9 A;  4WKM A;  4ESX A;  3O28 A;  4KD5 A;  3HHF A;  4YU0 A;  4DXC A;  4GWO A;  1LAG E;  3WAE A;  3HHG A;  1MM7 A;  1B05 A;  4MH5 A;  5AA2 D;  1NNF A;  2H99 A;  2ONK E;  4KCD A;  4JDF A;  4MFI A;  1TFD A;  1RKM A;  5H8Q B;  4NF5 A;  3ZKL A;  3N6U A;  2Z8E A;  5ICT A;  5H8F B;  3GBB A;  1S7Y A;  1VR5 A;  1USY E;  3G3G A;  4EUO A;  1B1X A;  1FQC A;  3HO7 A;  5FHO A;  3IB2 A;  4I62 A;  4F1Y A;  4OFO A;  3ZKK A;  1P1O A;  4KQP A;  2QPQ A;  4H5F A;  3TTL A;  1SI1 A;  1ZU0 A;  3SEW A;  1JET A;  1FQA A;  1XC1 A;  5HM4 B;  3H3G A;  2ABH A;  2QRY A;  3VVD A;  4NF4 A;  1MY2 A;  4Z0I A;  1R6Z A;  4P0I A;  3DP6 A;  5I2N B;  4N6P A;  2PT2 A;  4EXK A;  3K6X A;  2H9B A;  1OLA A;  3FJM A;  4NF6 B;  4Z7E A;  5I57 B;  1QJM A;  1B0L A;  1MY4 A;  2OWS A;  4NTL A;  2XXQ A;  3S9N C;  2QS1 A;  1KWH A;  3TEL A;  4F1U A;  1FTO A;  3V8X B;  5I56 A;  4BDO A;  1B4Z A;  1N7W A;  2M8C A;  5I2K B;  1NMU A;  2O6A A;  3Q26 A;  4JB7 A;  2ESN A;  4RPN A;  5DTB A;  3A3C A;  2GRV A;  3T96 B;  3PMW A;  3PU5 A;  2V25 A;  1SQY A;  1B0H A;  3M8U A;  3BFU A;  3MZB A;  4R6H A;  4H0W A;  3THI A;  3MZ9 A;  3ONM A;  5EHM A;  4DZ1 A;  3MVW A;  4R2B A;  1Q1K A;  4EDP A;  4NF5 B;  2HEU A;  1TWY A;  2I4C A;  4EF2 A;  1Y4C A;  2Q9T A;  2ZNT A;  3C4M A;  4FOR A;  4MF3 A;  4TLL B;  5DVF A;  5F7V A;  3PD8 A;  2KLF A;  4Q8R A;  3GBA A;  3V83 A;  3PPQ A;  3Q29 A;  4ZEC A;  3R26 A;  4O3A A;  3K6W A;  1SW5 A;  3IO6 A;  2YPN A;  3SES A;  1B6H A;  1ZBM A;  2UXA A;  5H8N B;  1B1H A;  2OLB A;  3OSR A;  3W9W A;  4MLQ A;  3IOT A;  5I2N A;  4IO5 A;  3OEL A;  3G3K A;  3VLV A;  1MQH A;  4NWC A;  4U22 A;  2PBW A;  5JEI A;  2NVU B;  2F36 A;  3C32 A;  3PUV E;  3RTW B;  1H43 A;  1PEB A;  2UVG A;  1B32 A;  3EPE A;  1LB9 A;  2I6E A;  2F7B A;  3FV2 A;  1P1N A;  3QUJ A;  4I9D A;  3C9H A;  3OXN A;  4TOZ A;  3U1O A;  5CMC A;  1IIT A;  1OMP A;  1VFD A;  3PD9 A;  4YKI A;  1MY3 A;  4RJZ A;  2P2A A;  4R73 A;  1M5C A;  2PT1 A;  4LA9 A;  1XVY A;  2XX7 A;  2HZL A;  4JWY A;  2RC7 A;  1AOV A;  2XXR A;  4U1Z A;  3SER A;  3KG2 A;  3FJG A;  3TUS A;  1N7X A;  4G68 A;  1J1N A;  1Z7N E;  3E4R A;  3MP1 A;  1IQ7 A;  2QMX A;  4NF8 B;  4LZ8 A;  4GVO A;  4H1X A;  2DWI A;  1P1W A;  2VGQ A;  3G3I A;  2OK2 A;  1MQD A;  1SD3 A;  3L6G A;  4THI A;  2XXV A;  4XTC Q;  5FTH A;  3M3K A;  2XXX A;  2OWT A;  3TQL A;  3V5A A;  4F19 A;  5A5X A;  2ZYK A;  3JV9 A;  2HAU A;  2Y7R A;  1B5H A;  1MM6 A;  2F78 A;  3OMB A;  3PUY E;  4G8M A;  2ZYM A;  2ZMB A;  4GXA A;  3T9V A;  1OVT A;  4GQO A;  1EZ9 A;  4OYV A;  3PPN A;  4QSE A;  4G8N A;  1NL5 A;  2B3B A;  3RY3 A;  1B3H A;  1B40 A;  4YKP A;  1Y3N A;  1SVX B;  3HV1 A;  3PUX E;  2O1L A;  2VOZ A;  4HTG A;  3GLB A;  4AB6 A;  4DCY A;  3OEK A;  3B6T A;  4XIG Q;  2DE2 A;  3G3J A;  4ZEI A;  1B4H A;  2BJJ X;  4P11 A;  2R9J A;  4DE8 A;  2XXT A;  1MQI A;  1D9V A;  3G3H A;  4TLM B;  5L8D A;  3V89 B;  1M5E A;  4HS7 A;  1FW0 A;  4ISU A;  1MS7 A;  2QS2 A;  4X9T A;  1FQD A;  1P99 A;  2O84 X;  2X7P A;  5I59 A;  1RYO A;  3TKD A;  3IOV A;  3RTF B;  1QUL A;  2QL3 A;  2O69 A;  2DVC A;  1Y3P A;  3TYH A;  5JTY A;  3C33 A;  4IO6 A;  4F29 A;  4R2F A;  1B5J A;  1LBB A;  4G68 B;  4LAT A;  3H6T A;  2DSF A;  4U2R A;  2DYX A;  2FYI A;  5K2Y A;  1NNT A;  3GXA A;  5AA1 A;  1AH5 A;  1N0T A;  1QUJ A;  3TOD A;  1JW5 A;  4QFL A;  1IZ1 A;  2DQV A;  4DIG A;  3CI8 A;  1PBQ A;  1R1N A;  2DS9 A;  4LQ5 A;  1POT A;  4ZDM A;  4C1T A;  1JW4 A;  4PE5 B;  4H8J A;  4OQO A; 
#chains in the Genus database with same CATH topology
 2PMS A;  2PX1 A;  3OO6 A;  3EN3 A;  3SEV A;  4ONY A;  3OO9 A;  4YKJ A;  3S9E A;  3I3V A;  4EF1 A;  2UVJ A;  3QXM A;  1MXV A;  3DP4 A;  1OQH A;  1ELJ A;  3O6G A;  4I8C A;  2HHM A;  2UVI A;  1N3X A;  2HZK A;  4H67 A;  4O7M A;  5DYH A;  5TP9 B;  3VVF A;  5LOM A;  1Z7M E;  4YB5 A;  3FIR A;  4PFY A;  3N5L A;  5H8H A;  2F34 A;  5JK4 A;  3R6U A;  2P1S A;  2ZNU A;  2VT5 A;  2Q88 A;  4PF8 A;  4RY1 A;  3H06 B;  3JZJ A;  4DCX A;  1MY0 A;  2OWZ A;  4F3S A;  2FIX A;  1DK4 A;  3T9X B;  4AQ4 A;  1PB9 A;  4ELQ A;  4XKR A;  3UK4 A;  1NKX A;  3QSL A;  5H8N A;  3LUZ A;  1MQJ A;  4OZ9 A;  4BDM A;  1SDX A;  3QIM A;  3IJO B;  2ZZX A;  1QUI A;  4OVS A;  2WEF A;  4OA4 A;  1SBP A;  1LBX A;  3ILU B;  1JW1 A;  2PVU A;  1B52 A;  3SET A;  5T3J A;  3DLN A;  5ITP A;  2XXK A;  3MVZ A;  2Q89 A;  4HW8 A;  2CEY A;  2F97 A;  2XXU A;  3FD3 A;  3E3K A;  4OFL A;  3LSX A;  4K3F A;  3PPR A;  1NNK A;  4QXD A;  2F3D A;  3LUY A;  4ZE8 A;  1XOC A;  3B8B A;  3IR1 A;  3S9M C;  1FTL A;  4FAT A;  4Q30 B;  4HCY A;  2WYP A;  1LFG A;  3QMF A;  1Y20 A;  4MCO A;  3EHT A;  4POW A;  1UTH A;  2V3T A;  3IFC A;  3Q27 A;  2G93 A;  4OMB A;  4MMP A;  1WOD A;  1PB8 A;  3K6U A;  2Y7P A;  1NV7 A;  3TFL A;  3VXB A;  3MUQ A;  2BJI A;  1XS5 A;  3OD7 A;  4PCD A;  1YAE A;  1FBF A;  4MNP A;  5L9M A;  3I6V A;  2G29 A;  3FBP A;  1LGB C;  4FEB A;  4OVT A;  4LUB A;  4I1D A;  1FJ6 A;  1WVJ A;  4ELR A;  2I58 A;  3B6Q A;  4FED A;  1LCT A;  3LSL A;  3IOU A;  4NF0 A;  4NGU A;  2H5Y A;  3CFZ A;  4PGP A;  3U8Q A;  4FJP A;  3EF7 A;  4PAF A;  3O9P A;  3KSX A;  1INP A;  4ZZA A;  3EHU A;  3EQ1 A;  4GX6 A;  2VD2 A;  3Q25 A;  4N8G A;  3HCQ A;  3O97 A;  1IXH A;  1PB7 A;  4ZED A;  4QFN A;  1I6Q A;  3W9V A;  1M5B A;  2JJK A;  1DTZ A;  4JWO A;  1AL3 A;  3RPW A;  3TCF A;  3IJX B;  4F3B A;  2LAO A;  4NMY A;  5K2X A;  4P0G A;  1MRP A;  3H6U A;  3TTM A;  4N15 A;  1MDQ A;  2E0S A;  5EQ8 A;  3TDJ A;  5B7D A;  2DWA A;  3H6V A;  2NXO A;  1JEU A;  3MZ1 A;  5L9O A;  4GWU A;  4O3B A;  1R9Q A;  1CE2 A;  1LBW A;  3K02 A;  5DT6 A;  4Q0C A;  2ONS A;  1QW0 A;  1IUD A;  2KR0 A;  4FBP A;  4F18 A;  4GWZ A;  1S50 A;  4MLV A;  5KCJ B;  3TTK A;  3T66 A;  1MXY A;  1LFI A;  2VD3 A;  3CFX A;  1EYK A;  4GFR A;  4GD5 A;  4KYE A;  4PFT A;  1FRP A;  1ZIU A;  1DBZ A;  5AA4 B;  2V84 A;  4XF5 A;  3P7I A;  4C1U A;  4GWX A;  3K1P A;  4P1L A;  2HFB A;  4ZS9 A;  4QHQ A;  1B3F A;  1CB6 A;  2H4I A;  1OIB A;  3RYD A;  4ECF A;  5DVJ A;  4YMA A;  3CR9 A;  1POY 1;  3ILT B;  3CHG A;  1JP4 A;  4QRZ A;  2HCA A;  1MXZ A;  1A40 A;  4GWW A;  1ZTY A;  4X1D A;  2B4M A;  1HSE A;  1MH4 A;  1YCJ A;  3BIH A;  1LAF E;  1ZJL A;  3DM0 A;  1A54 A;  5I5P A;  2HAV A;  3LSW A;  2I3V A;  5CI5 A;  3K1N A;  3M3F A;  1VFE A;  4WKM A;  3O28 A;  3HHF A;  4N8Y A;  1LAG E;  3HHG A;  4KCD A;  4MFI A;  2FVZ A;  4HE1 A;  3ZKL A;  4MJO A;  4I62 A;  1SI1 A;  3SEW A;  4Z0I A;  1MY2 A;  4GBV A;  1NV3 A;  1G0H A;  4NF6 B;  1QJM A;  3S9N C;  3TEL A;  3V8X B;  1N7W A;  2O6A A;  3Q26 A;  3E78 A;  4RPN A;  2GRV A;  2ZZV A;  3THI A;  4DZ1 A;  3MST A;  1Y4C A;  4FOR A;  2ZNT A;  3C4M A;  4MF3 A;  3PD8 A;  3GBA A;  1NV6 A;  3V83 A;  2WBD A;  1SW5 A;  2OLB A;  3W9W A;  3IOT A;  4IO5 A;  3VLV A;  4NAP A;  4AS5 A;  3RTW B;  3EPE A;  2FBP A;  2F7B A;  4JVD A;  1VFD A;  1OMP A;  4RJZ A;  1NV5 A;  2MKZ A;  4LA9 A;  1AOV A;  2HZL A;  2RC7 A;  3KG2 A;  4OVJ A;  1Z7N E;  4GVO A;  4XTC Q;  3G3I A;  2XXX A;  4F19 A;  3JV9 A;  2HAU A;  2Y7R A;  4G8M A;  1MM6 A;  2QVU A;  4GQO A;  2B3B A;  4YKP A;  5ET7 A;  2O1L A;  4HTG A;  2BJJ X;  4P11 A;  2XXT A;  1D9V A;  3ISP A;  4HS7 A;  1MS7 A;  2QS2 A;  5I59 A;  1RYO A;  3C33 A;  4P56 A;  4R2F A;  4G68 B;  1NNT A;  5AA1 A;  1IZ1 A;  2DQV A;  4C1T A;  2DS9 A;  4YB6 A;  3MQ9 A;  1N3W A;  2AYS A;  4E0X A;  4G61 A;  3QAX A;  1SI0 A;  2Y7K A;  1MPC A;  4NE4 A;  1GR2 A;  5F24 A;  2GFE A;  4P9K A;  4POX A;  3SEY A;  3H4Z A;  4X1B A;  2F6G A;  5ET8 A;  2F8D A;  1N84 A;  4OER A;  3OEM A;  2O7U A;  4XKQ A;  4ZEF A;  1IMC A;  4NF8 A;  2HXW A;  5LTC A;  3T0J A;  3RN8 A;  3PV0 E;  4L17 A;  5IKB A;  4PTK A;  5IM2 A;  1LCF A;  4EQ9 A;  2PCR A;  1Q9D A;  5IAI A;  4QBA A;  2XD2 A;  4MNC A;  4OXV A;  5IZ3 A;  3TPA A;  4G2Z A;  3MWB A;  1S9T A;  1AMF A;  2NUV A;  2ONR A;  5M2V A;  5KCJ A;  4FAJ A;  5I58 B;  3KSJ A;  2UVH A;  2UYF A;  4ZEB A;  4GWS A;  4WEP A;  3N6T A;  1URS A;  4JSD A;  3TAJ A;  3I5O A;  1IIW A;  2DDK A;  2IEE A;  3U94 A;  1XT8 A;  1JNF A;  4R9F A;  2AL4 A;  2FNC A;  4NWD A;  2QJE A;  4OVQ A;  1FQE A;  2P0S A;  3VDF A;  1M5D A;  1FTK A;  4MEV A;  1B7H A;  3G3F A;  5I3S A;  4IO7 A;  2Q2C A;  3U65 A;  3RPL A;  4LZ7 A;  3O29 A;  3WAF A;  4GRK A;  1P1U A;  3IB1 A;  1QKA A;  3UIF A;  5IZZ A;  3NOH A;  4F1V A;  5AA2 A;  1LAX A;  2RCA A;  1MXU A;  1LFH A;  2Y84 A;  1NV4 A;  1O63 A;  3R7X A;  5CMB A;  5CMM A;  2F6P A;  4KPT A;  2DVZ A;  4JXI A;  1MPB A;  4NF6 A;  2RCB A;  1A99 A;  2Z8F A;  3PPO A;  4N6D A;  1AWB A;  3LBS A;  5EYF A;  1SYI A;  3RT6 B;  5ISU A;  1JQF A;  3SZP A;  1IXC A;  2OZZ A;  4PET A;  4I3Y A;  3CG1 A;  3MVY A;  4C0R A;  4H6D A;  4MNI A;  3N94 A;  1YTV A;  1ZMG A;  1Y1M A;  4UAC A;  1FCK A;  3E9X A;  4R74 A;  4H8I A;  4F2O A;  3E13 X;  2AIX A;  3QYT A;  1DOT A;  3IB0 A;  2QSX A;  1DTG A;  2XXH A;  4GOT A;  5TU0 A;  3RLF E;  5BUU A;  1D3K A;  5HBC A;  3FXU A;  4Q5T A;  4JSO A;  4G68 C;  4PQJ A;  4KFQ A;  3MBP A;  1MDP 1;  1F9B A;  5I59 B;  2RC8 A;  3H7M A;  4U21 A;  4BDR A;  1DSN A;  2YJP A;  1AIV A;  1FPG A;  2A5S A;  1Y9U A;  4OES A;  1MY1 A;  3FJ7 A;  2ZNS A;  4X48 A;  4R72 A;  4WED A;  1EYJ A;  5EYH A;  1SW4 A;  1B3L A;  1O64 A;  1OQG A;  4M4G A;  2OX3 A;  2ALU A;  3RPL B;  3PMV A;  5AA3 A;  4LZ5 A;  3AXF A;  1A8E A;  3ROJ A;  2DWJ A;  2A5T B;  4HXV A;  4WXJ A;  1II5 A;  2XX9 A;  3EKI A;  2RF1 A;  4DLD A;  5IZ1 A;  4N81 A;  1NV0 A;  3CSG A;  4PFW A;  3FVK A;  2I4B A;  3IL1 B;  4I40 A;  2O7I A;  5ELV A;  2XXI A;  5DEX B;  2I48 A;  4ND9 A;  2Z22 A;  4N13 A;  2ZYO A;  2Y7I A;  4N17 A;  3B7D A;  5FBP A;  4IGT A;  1DCU A;  1ANF A;  3IAZ A;  3U72 A;  4OEV A;  2OBG A;  3PGF A;  3FVN A;  2CZL A;  3IO4 A;  4IO4 A;  2H25 A;  3KBZ A;  1T0K A;  3BKI B;  4H45 A;  2ZXT A;  3IFA A;  1UTB A;  2DE4 A;  5CM6 A;  4OVR A;  4YMB A;  1XHY A;  3TEP A;  4QF9 A;  1KZ8 A;  4YU0 A;  2XA5 A;  1FBD A;  1MM7 A;  1B05 A;  5AA2 D;  2H99 A;  4PDH A;  5A5L A;  3N6U A;  2Z8E A;  1S7Y A;  3HO7 A;  2CEX A;  1P1O A;  2QPQ A;  1JET A;  4HE0 A;  2QRY A;  3DP6 A;  2PT2 A;  3K6X A;  4Z7E A;  3FJM A;  4NTL A;  3BIG A;  2QS1 A;  1KWH A;  4F1U A;  5I2K B;  5J16 A;  2XWI A;  3VLW A;  2V25 A;  1FPK A;  3MZB A;  3MZ9 A;  3HFU A;  2HEU A;  4EF2 A;  2Q9T A;  4TLL B;  4Q8R A;  2KLF A;  2KQZ A;  4P3L A;  4ZEC A;  3IO6 A;  2UXA A;  5I2N A;  1FBE A;  3OEL A;  1MQH A;  4NWC A;  2NVU B;  1IMF A;  1PEB A;  1LB9 A;  2I6E A;  4I9D A;  3C9H A;  3OXN A;  5CMC A;  4YKI A;  3PD9 A;  1MY3 A;  4R73 A;  4AS4 A;  1XVY A;  2XX7 A;  4O8M A;  2XXR A;  3TUS A;  3FJG A;  4G68 A;  3E4R A;  3MP1 A;  1IQ7 A;  4BLA A;  4LZ8 A;  4GBW A;  2VGQ A;  1YXI A;  1MQD A;  1SD3 A;  4THI A;  3TQL A;  5FTH A;  2OWT A;  1B5H A;  2F78 A;  4PFR A;  2ZYM A;  2ZMB A;  3T9V A;  4GX3 A;  4O7I A;  1Y3N A;  3HV1 A;  3B6T A;  4XIG Q;  5ET5 A;  3G3J A;  2R9J A;  3G3H A;  4TLM B;  3V89 B;  1FW0 A;  4X9T A;  1FSA A;  1QUL A;  1VDW A;  2DVC A;  1Y3P A;  4LAT A;  3H6T A;  2DSF A;  2DYX A;  1AH5 A;  4LQ5 A;  1POT A;  4PE5 B;  2QVV A;  4PC9 A;  1LBZ A;  1DPE A;  4OVP A;  2F7C A;  1VSO A;  2GHB A;  1NV2 A;  2YLN A;  4R6Y A;  4DXU A;  1FQB A;  1SW1 A;  2HPG A;  3L6H A;  1MXX A;  5EQ7 A;  3SEX A;  5CBS A;  1URG A;  4JVI A;  4PBQ A;  3FGS A;  4YB7 A;  4RA1 A;  4RYA A;  1IMD A;  4OET A;  1WDN A;  4XKP A;  3T9U A;  5FTI A;  1P1Q A;  4OFJ A;  4YZZ A;  3UOR A;  2V3Q A;  5J1D A;  3ODB A;  3A09 A;  4YIC A;  3T93 B;  3MC2 A;  1I6A A;  3IOW A;  1FBH A;  2XD3 A;  1B3E A;  1D9Y A;  4BDN A;  3SEU A;  4G4P A;  4PBH A;  2XHD A;  1LBC A;  1VE4 A;  3RGY A;  4JWX A;  1MXW A;  2THI A;  2A5T A;  3QUF A;  3UGW A;  1IMA A;  1UIV A;  3KN3 A;  3KOS A;  3UN6 A;  3BBR A;  2F35 A;  1FQF A;  4MBP A;  2F7A A;  1IME A;  1ATG A;  5AA2 B;  1H76 A;  4KI0 E;  5CRY A;  3ECR A;  4IO2 A;  4KR5 A;  5DEX A;  3TMG A;  3UA8 A;  4E0W A;  3KC0 A;  3TZA A;  5BWJ A;  1B5I A;  2DE3 A;  3ZSF A;  1M5F A;  3OO7 A;  1EZP A;  1FBC A;  4H5G A;  4NX1 A;  4R9G A;  3O6H A;  4IY5 A;  4G8H A;  2O1M A;  3KBR A;  4LVQ A;  1YYZ A;  2HXR A;  2RIN A;  2W7Y A;  2E1S A;  3MVX A;  1FPJ A;  5DW8 A;  4G77 A;  3SKP A;  1KA1 A;  1USY H;  4KCC A;  3FV1 A;  2AL5 A;  1FJ9 A;  3CVG A;  3H03 A;  1OVB A;  2REG A;  4X8R A;  4LP2 B;  4RK9 A;  2IA4 A;  3IOR A;  3SES A;  5TPA B;  3SDF A;  2QMW A;  3S9L C;  1BP5 A;  3KN8 A;  3A3U A;  2CMO A;  4TQU Q;  3G7W A;  3C34 A;  4IGR A;  1DPP A;  1XVX A;  2FA7 A;  1HSL A;  3KN7 A;  4UA8 A;  1JEV A;  1SYH A;  5I2K A;  2X26 A;  3S4U A;  1SW2 A;  4EQ7 A;  3O66 A;  2V93 A;  2V3U A;  4F3G A;  5JTY B;  2F5X A;  5EQA A;  1US5 A;  2RKM A;  4ELO A;  3FXQ A;  1I6B A;  1RDX A;  1EYI A;  3PUZ E;  1EH3 A;  3HST A;  4IO3 A;  3VXC A;  2O68 A;  1HSJ A;  2WBB A;  1QKB A;  2PFY A;  4NN3 A;  4YKK A;  3OOA A;  1FTA A;  4QFP A;  1GTK A;  3FVO A;  1O7T A;  3CIJ A;  1ZLQ A;  3MAM A;  4U23 A;  4ZE9 A;  1BK4 A;  4ESW A;  5H8Q A;  2REJ A;  1K9Y A;  5H8F A;  4U1O A;  2I49 A;  4EXL A;  3K1M A;  1A7L A;  5EYG A;  3B6W A;  2F3B A;  1D9Q A;  2WX9 A;  3KFM A;  4M1V A;  2I0C A;  4KXP A;  3U93 A;  2OCU A;  1NH7 A;  2HQ0 A;  3TCH A;  2P3V A;  2Q8J A;  1FTM A;  1N04 A;  1D4N A;  4PDD A;  2WKY A;  1RYX A;  1IEJ A;  4BDL A;  3K2D A;  3PUW E;  5H8H B;  1OLC A;  1NNP A;  1B7U A;  3TTN A;  4O94 A;  5I58 A;  2RC9 A;  4MHF A;  3T22 A;  3O2A A;  3T9H B;  4OEN A;  1JVX A;  2DP8 A;  1MPD A;  3FZV A;  3MJN A;  2PYY A;  2XX8 A;  4PE3 A;  1TFA A;  1N76 A;  1FPI A;  3DEL B;  4OTE A;  3K00 A;  4GF8 A;  3N26 A;  1FBG A;  1BKA A;  1FPE A;  3UP9 A;  1Y4T A;  4ESX A;  4KD5 A;  4XFE A;  4DXC A;  4HE2 A;  3WAE A;  1NNF A;  2ONK E;  1TFD A;  5H8Q B;  5H8F B;  3GBB A;  1USY E;  3MYU A;  1FQC A;  2XWV A;  1RDY A;  3IB2 A;  4OFO A;  3ZKK A;  4H5F A;  1NUW A;  5I7I A;  3E79 A;  4IR8 A;  3H3G A;  2ABH A;  1XI6 A;  1R6Z A;  4P0I A;  5I2N B;  4N6P A;  4EXK A;  2H9B A;  1OLA A;  4P1E A;  2OWS A;  2XXQ A;  2GQ1 A;  5I56 A;  4BDO A;  1B4Z A;  4JB7 A;  2ESN A;  3T96 B;  3PMW A;  3PU5 A;  1SQY A;  1B0H A;  3M8U A;  4H0W A;  3ONM A;  5EHM A;  4R2B A;  1Q1K A;  4EDP A;  4NF5 B;  1TWY A;  5F7V A;  5DVF A;  3PPQ A;  3Q29 A;  3R26 A;  3K6W A;  2YPN A;  3OSR A;  4MLQ A;  3G3K A;  5JEI A;  3C32 A;  3PUV E;  3FV2 A;  1B32 A;  4TOZ A;  2PT1 A;  3SER A;  4NF8 B;  2QMX A;  2Y5L A;  1P1W A;  3L6G A;  4XEQ A;  5A5X A;  3OMB A;  4MIJ A;  4GXA A;  1OVT A;  1EZ9 A;  3PPN A;  4QSE A;  4G8N A;  3RY3 A;  1B40 A;  3PUX E;  5ESY A;  4DE8 A;  1MQI A;  1M5E A;  4ISU A;  1P99 A;  2X7P A;  3TKD A;  2QL3 A;  2O69 A;  5JTY A;  4IO6 A;  1LBB A;  5K2Y A;  1YZ0 A;  2Q74 A;  5IGA A;  4QFL A;  4DIG A;  4ZDM A;  1CNQ A;  5HPQ A;  4FEC A;  3KJ7 A;  2ANJ A;  1DMB A;  4EQB A;  1RDZ A;  5AE4 A;  4I3E A;  3FXR A;  3LR1 A;  1NUX A;  1FPF A;  3C36 A;  4GX4 A;  1GVC A;  3VVE A;  4ZEK A;  2XWK A;  4GL0 A;  4RK2 A;  2Y7W A;  2PFZ A;  2DXR A;  3D4C A;  3T1B A;  1I69 A;  1NH8 A;  2Z8D A;  2O51 A;  3MP6 A;  4GL8 A;  1LST A;  1H44 A;  2R6G E;  1GGG A;  4ZZE A;  4MX6 A;  2OJT A;  2FIE A;  4GIZ A;  2QS4 A;  2V4C A;  1FPL A;  3C35 A;  5ICQ A;  1BLF A;  5DVI A;  4F31 B;  4H65 A;  1YPN A;  4QFO A;  2DWH A;  4R75 A;  4ELP A;  3RT8 A;  4OEU A;  5KDT A;  2I3W A;  3HPI A;  4NHB A;  4O3C A;  3M3L A;  2R71 A;  4LON B;  4AB5 A;  5AA4 A;  1TXF A;  3PPP A;  2FHY A;  3KJT A;  3QK6 A;  2D3I A;  3B50 A;  3HN0 A;  3USD A;  3CRB A;  3OSQ A;  5A5X B;  1B3G A;  2XXY A;  1GV8 A;  3FAS A;  3PMX A;  4DDD A;  4PGN A;  3PTY A;  3H6W A;  5I57 A;  4U4S A;  3FAT A;  4HCW A;  1URD A;  1US4 A;  1LB8 A;  2B4L A;  2Z23 A;  4NED A;  4P8B A;  4H46 A;  1UQW A;  3Q28 A;  4PFB A;  3D4G A;  3LV0 A;  5TPA A;  3VE1 B;  4X04 A;  3RQT A;  3DP8 A;  4DXB A;  1Y3Q A;  5B70 A;  2XXW A;  1MG1 A;  4N07 A;  4GLI A;  1LBY A;  5FHN A;  1B2H A;  1EU8 A;  1B51 A;  1KA0 A;  1Y1Z A;  5IZ3 B;  1Q35 A;  3BFT A;  2XWO A;  4N4U A;  4OHN A;  3TTR A;  1H45 A;  4F3P A;  3U92 A;  1FTJ A;  5ET6 A;  5CMK A;  4KHZ E;  2Q8M A;  3JYR A;  5I84 A;  1NI9 A;  3KZG A;  3O6I A;  5EQ9 A;  4LQ2 A;  2X7Q A;  1R9L A;  3FUZ A;  1JVY A;  2I0B A;  4IB2 A;  4RPO A;  1G0I A;  1FBP A;  2B65 A;  3F11 A;  4JBZ A;  2P3N A;  1FPD A;  3D1R A;  2QFL A;  4QFK A;  5CBR A;  4F2Q A;  4F22 A;  3FXB A;  1UIU A;  4KYD A;  3IK6 B;  5KZT A;  3CSB A;  5F1Q A;  1L5T A;  4RXL A;  1A8F A;  4FIM A;  1NUY A;  2VHA A;  4GXS B;  3W15 C;  3K4U A;  2GHA A;  5TP9 A;  2NWJ A;  3MPL A;  4R6K A;  2QS3 A;  3KEI A;  3VV5 A;  5I56 B;  3MP8 A;  3KGC A;  3TCG A;  1SPI A;  4LN5 A;  4PP0 A;  2XXP A;  4QSD A;  1PDA A;  1LBV A;  1ZKB A;  5L9S A;  4N91 A;  3GZG A;  3K0V A;  1H3D A;  1LLS A;  2CZH A;  4BDQ A;  1PC3 A;  1K9Z A;  1LAH E;  1BTJ A;  2D5W A;  3RUM A;  3KOT A;  4PFI A;  1NV1 A;  2ZYN A;  1PBP A;  3LSF B;  1UTB B;  4NF4 B;  2QVR A;  1IXI A;  1TT1 A;  3ZS6 A;  4OAN A;  3MPK A;  1B46 A;  3EHS A;  1QVS A;  2UYE A;  1A55 A;  3FVG A;  3GYY A;  1NFT A;  5H8S A;  5FHM A;  2H98 A;  3K6V A;  4YAH X;  2L5V A;  4DI3 D;  3K01 A;  1UTH B;  4IY6 A;  4JVC A;  3VFJ A;  3OO8 A;  4KYS A;  4FE8 A;  1B9J A;  5ITO A;  1FPB A;  4PF6 A;  1MQG A;  3OEN A;  3S2V A;  3C31 A;  4QSC A;  1QGX A;  3CG3 A;  2DXY A;  1EZO A;  4U4X A;  3RNN A;  4XXU A;  3TQW A;  3IX1 A;  3LC8 A;  2CZI A;  4OWD A;  3A29 A;  5EHS A;  5CC2 A;  3MW0 A;  3VLU A;  4F39 A;  1B7Z A;  2D21 A;  4NG7 A;  5HM4 B;  1BIY A;  1MH3 A;  2GH9 A;  5KDT B;  2B3F A;  4PAI A;  1B58 A;  1IXG A;  2VP1 A;  4XKN A;  2NOO A;  1QUK A;  2DOJ A;  2ZZW A;  4RNS A;  4PFU A;  2Q2A A;  3CFL A;  4GWO A;  4MH5 A;  4JDF A;  1RKM A;  4NF5 A;  5ICT A;  1VR5 A;  3G3G A;  4EUO A;  1B1X A;  3KC1 A;  5FHO A;  4F1Y A;  4GWY A;  4KQP A;  1ZU0 A;  1FQA A;  1XC1 A;  4MAG A;  3VVD A;  4NF4 A;  5I57 B;  1B0L A;  1MY4 A;  1FTO A;  2M8C A;  2R8T A;  1NMU A;  5DTB A;  3A3C A;  1LEV A;  3BFU A;  4R6H A;  3MVW A;  2I4C A;  4N6K A;  1IMB A;  4O3A A;  1B6H A;  1ZBM A;  5H8N B;  1B1H A;  5LDZ A;  4P47 A;  4U22 A;  2PBW A;  2F36 A;  1H43 A;  2UVG A;  3QUJ A;  1P1N A;  1IIT A;  2P2A A;  1M5C A;  4UAB A;  4JWY A;  4U1Z A;  1N7X A;  1J1N A;  3U1O A;  4H1X A;  4PAK A;  2DWI A;  2OK2 A;  3TTL A;  3V5A A;  2XXV A;  3M3K A;  2ZYK A;  3PUY E;  4OYV A;  1NL5 A;  1B3H A;  1SVX B;  4NQ8 A;  2VOZ A;  4AB6 A;  2VPO A;  3GLB A;  4DCY A;  3OEK A;  2DE2 A;  4ZEI A;  1B4H A;  5L8D A;  1FQD A;  2O84 X;  2VPN A;  3IOV A;  3RTF B;  3TYH A;  4F29 A;  1B5J A;  4DI4 B;  4U2R A;  2FYI A;  3GXA A;  1N0T A;  2Y5K A;  1QUJ A;  3TOD A;  1JW5 A;  1NUZ A;  3CI8 A;  1PBQ A;  1R1N A;  2WYK A;  2CZK A;  1JW4 A;  4H8J A;  4OQO A; 
#chains in the Genus database with same CATH homology
 4YB6 A;  5HPQ A;  1DPE A;  3MQ9 A;  2PMS A;  3KJ7 A;  4FEC A;  2PX1 A;  3OO6 A;  1N3W A;  3EN3 A;  2ANJ A;  1DMB A;  3SEV A;  2F7C A;  4EQB A;  5AE4 A;  2AYS A;  4ONY A;  4E0X A;  3OO9 A;  1VSO A;  2GHB A;  4OVJ A;  3QAX A;  4YKJ A;  2YLN A;  4R6Y A;  3S9E A;  4DXU A;  3I3V A;  1SI0 A;  3FXR A;  4EF1 A;  2Y7K A;  1FQB A;  1MPC A;  1GR2 A;  1SW1 A;  2GFE A;  2UVJ A;  3LR1 A;  3L6H A;  4NE4 A;  1MXX A;  3QXM A;  4POX A;  3SEY A;  1MXV A;  3C36 A;  3SEX A;  3H4Z A;  4X1B A;  2F6G A;  3DP4 A;  1OQH A;  1ELJ A;  3O6G A;  1GVC A;  2F8D A;  3VVE A;  1N84 A;  4I8C A;  4ZEK A;  5CBS A;  4GL0 A;  4OER A;  3OEM A;  2UVI A;  4RK2 A;  2O7U A;  1URG A;  2Y7W A;  1N3X A;  2HZK A;  4H67 A;  5DYH A;  3FGS A;  4XKQ A;  5TP9 B;  4ZEF A;  3VVF A;  5LOM A;  4YB7 A;  1Z7M E;  4YB5 A;  3FIR A;  2DXR A;  4NF8 A;  4RA1 A;  4RYA A;  2HXW A;  3D4C A;  4OET A;  4PFY A;  3N5L A;  5H8H A;  1I69 A;  2F34 A;  5JK4 A;  1WDN A;  1NH8 A;  3R6U A;  2P1S A;  4XKP A;  3PV0 E;  4L17 A;  3RN8 A;  2ZNU A;  3T9U A;  5FTI A;  1P1Q A;  2Z8D A;  2O51 A;  3MP6 A;  4OFJ A;  4YZZ A;  3UOR A;  2Q88 A;  2V3Q A;  4GL8 A;  5J1D A;  3ODB A;  1LST A;  3A09 A;  4RY1 A;  5IKB A;  1H44 A;  2R6G E;  1GGG A;  4YIC A;  3H06 B;  3JZJ A;  4ZZE A;  3T93 B;  1LCF A;  5AA3 A;  3MC2 A;  1I6A A;  4DCX A;  3IOW A;  2OJT A;  1MY0 A;  4GIZ A;  2QS4 A;  2XD3 A;  4EQ9 A;  4F3S A;  1B3E A;  3T9X B;  3C35 A;  5IAI A;  4AQ4 A;  1BLF A;  1D9Y A;  2XD2 A;  1PB9 A;  5DVI A;  4H65 A;  4ELQ A;  4F31 B;  4OXV A;  4BDN A;  4XKR A;  1YPN A;  3SEU A;  4G4P A;  3TPA A;  3UK4 A;  4QFO A;  2DWH A;  4G2Z A;  1NKX A;  4R75 A;  3QSL A;  5H8N A;  4ELP A;  3MWB A;  3RT8 A;  4OEU A;  1MQJ A;  1S9T A;  4OZ9 A;  4BDM A;  1SDX A;  2XHD A;  2I3W A;  3HPI A;  1AMF A;  1LBC A;  3IJO B;  3QIM A;  5KDT A;  1VE4 A;  3RGY A;  2NUV A;  1QUI A;  4JWX A;  1MXW A;  4O3C A;  2ONR A;  2R71 A;  3M3L A;  2THI A;  5M2V A;  4LON B;  1SBP A;  2A5T A;  3QUF A;  3ILU B;  4AB5 A;  1JW1 A;  1TXF A;  2PVU A;  4FAJ A;  5AA4 A;  5KCJ A;  3UGW A;  5I58 B;  1B52 A;  1UIV A;  2UVH A;  2UYF A;  3KN3 A;  3KSJ A;  3PPP A;  3SET A;  3KOS A;  4ZEB A;  3UN6 A;  4WEP A;  3KJT A;  3QK6 A;  3N6T A;  3DLN A;  1URS A;  2D3I A;  3BBR A;  4JSD A;  5ITP A;  3TAJ A;  2F35 A;  3I5O A;  1IIW A;  2IEE A;  3HN0 A;  3U94 A;  1FQF A;  4MBP A;  3USD A;  1XT8 A;  3CRB A;  3MVZ A;  2Q89 A;  1JNF A;  3OSQ A;  4HW8 A;  5A5X B;  2F97 A;  2F7A A;  2XXU A;  1B3G A;  1ATG A;  3FD3 A;  2XXY A;  5AA2 B;  4R9F A;  3E3K A;  3FAS A;  3PMX A;  1GV8 A;  2AL4 A;  2FNC A;  4NWD A;  4OFL A;  1H76 A;  2QJE A;  4KI0 E;  4DDD A;  1FQE A;  3LSX A;  2P0S A;  3PPR A;  4K3F A;  5CRY A;  3ECR A;  3VDF A;  3H6W A;  4IO2 A;  4KR5 A;  5DEX A;  3TMG A;  3UA8 A;  4E0W A;  5I57 A;  1M5D A;  1FTK A;  3TZA A;  1NNK A;  5BWJ A;  1B5I A;  2DE3 A;  3ZSF A;  4U4S A;  1B7H A;  3FAT A;  3G3F A;  3LUY A;  4HCW A;  4ZE8 A;  1URD A;  1XOC A;  4IO7 A;  1US4 A;  2Q2C A;  3IR1 A;  1M5F A;  3S9M C;  1FTL A;  1LB8 A;  4FAT A;  5AA2 A;  4Q30 B;  3OO7 A;  3O29 A;  2Z23 A;  4HCY A;  1LFG A;  4LZ7 A;  4NED A;  3WAF A;  4H5G A;  1Y20 A;  1EZP A;  3EHT A;  4GRK A;  4POW A;  1P1U A;  1UTH A;  1UQW A;  3Q28 A;  3IB1 A;  4R9G A;  1QKA A;  3D4G A;  3UIF A;  5TPA A;  2V3T A;  3VE1 B;  3Q27 A;  3O6H A;  2G93 A;  3DP8 A;  3RQT A;  4OMB A;  4DXB A;  1WOD A;  1Y3Q A;  4IY5 A;  5B70 A;  1PB8 A;  2O1M A;  4G8H A;  3K6U A;  4F1V A;  2XXW A;  3KBR A;  1MG1 A;  4LVQ A;  2Y7P A;  1LAX A;  2RCA A;  2RIN A;  2W7Y A;  1MXU A;  4GLI A;  4N07 A;  2E1S A;  1LFH A;  3TFL A;  5FHN A;  1B2H A;  1EU8 A;  2Y84 A;  3MVX A;  3VXB A;  3MUQ A;  1B51 A;  1XS5 A;  4G77 A;  1Y1Z A;  3SKP A;  1Q35 A;  3BFT A;  1O63 A;  3OD7 A;  3R7X A;  1USY H;  4KCC A;  5CMM A;  5CMB A;  1YAE A;  4OHN A;  3TTR A;  2F6P A;  1H45 A;  5L9M A;  3I6V A;  3U92 A;  1FTJ A;  4KPT A;  4F3P A;  3FV1 A;  2AL5 A;  2G29 A;  5CMK A;  2DVZ A;  1LGB C;  4JXI A;  4KHZ E;  1MPB A;  3JYR A;  4FEB A;  3CVG A;  3H03 A;  4NF6 A;  1OVB A;  5I84 A;  2REG A;  2RCB A;  1A99 A;  3KZG A;  3O6I A;  2Z8F A;  4LQ2 A;  3PPO A;  5KZT A;  4LUB A;  2X7Q A;  1R9L A;  4LP2 B;  4RK9 A;  2IA4 A;  3FUZ A;  3IOR A;  1JVY A;  3LBS A;  4I1D A;  5EYF A;  5TPA B;  3SDF A;  2QMW A;  1SYI A;  1BP5 A;  1WVJ A;  2I58 A;  4ELR A;  3S9L C;  3KN8 A;  2I0B A;  3RT6 B;  3A3U A;  2CMO A;  5ISU A;  3B6Q A;  1JQF A;  4TQU Q;  3G7W A;  3C34 A;  4IGR A;  1DPP A;  4FED A;  1IXC A;  2OZZ A;  1LCT A;  4PET A;  1XVX A;  4IB2 A;  4RPO A;  3LSL A;  5ICQ A;  3IOU A;  2B65 A;  2FA7 A;  1HSL A;  3F11 A;  3TDJ A;  4JBZ A;  3KN7 A;  3CG1 A;  4UA8 A;  1JEV A;  3MVY A;  4C0R A;  5B7D A;  1SYH A;  5I2K A;  4H6D A;  2X26 A;  3N94 A;  3S4U A;  1SW2 A;  4EQ7 A;  3O66 A;  2H5Y A;  2V93 A;  4QFK A;  5CBR A;  1YTV A;  2V3U A;  4F2Q A;  4F3G A;  4F22 A;  3CFZ A;  1UIU A;  1ZMG A;  1Y1M A;  4KYD A;  4UAC A;  1FCK A;  5JTY B;  3IK6 B;  3U8Q A;  3E9X A;  4R74 A;  4FJP A;  4H8I A;  4F2O A;  3CSB A;  2F5X A;  3E13 X;  5F1Q A;  1L5T A;  1US5 A;  2RKM A;  2AIX A;  3EF7 A;  3QYT A;  4RXL A;  4ELO A;  3FXQ A;  1A8F A;  3O9P A;  3KSX A;  1DOT A;  1I6B A;  2QSX A;  3IB0 A;  4ZZA A;  3EHU A;  4FIM A;  3EQ1 A;  3PUZ E;  1DTG A;  1EH3 A;  2VHA A;  2XXH A;  3HST A;  4GOT A;  4GXS B;  4IO3 A;  3VXC A;  3W15 C;  2VD2 A;  3K4U A;  3Q25 A;  5TU0 A;  2GHA A;  5TP9 A;  2NWJ A;  3RLF E;  2O68 A;  3HCQ A;  5BUU A;  1HSJ A;  3MPL A;  1D3K A;  3O97 A;  5HBC A;  1QKB A;  4R6K A;  2QS3 A;  3FXU A;  3KEI A;  1IXH A;  4YKK A;  3VV5 A;  1PB7 A;  3OOA A;  4Q5T A;  3MP8 A;  4QFN A;  1I6Q A;  3KGC A;  3TCG A;  4ZED A;  5I56 B;  3W9V A;  1M5B A;  1GTK A;  4QFP A;  4JSO A;  3VLW A;  3FVO A;  4PP0 A;  1O7T A;  2XXP A;  3CIJ A;  1DTZ A;  4JWO A;  1AL3 A;  3RPW A;  1ZLQ A;  3TCF A;  4G68 C;  4QSD A;  3MAM A;  3IJX B;  1PDA A;  4U23 A;  4F3B A;  4PQJ A;  1ZKB A;  2LAO A;  4KFQ A;  3MBP A;  4NMY A;  5K2X A;  5L9S A;  1MDP 1;  4P0G A;  4ZE9 A;  1F9B A;  1MRP A;  5I59 B;  2RC8 A;  3GZG A;  3H7M A;  3K0V A;  4U21 A;  1H3D A;  4BDR A;  1DSN A;  1LLS A;  4BDQ A;  4ESW A;  2YJP A;  3H6U A;  5H8Q A;  2REJ A;  1AIV A;  3TTM A;  1PC3 A;  1MDQ A;  2E0S A;  5H8F A;  4U1O A;  2A5S A;  1Y9U A;  4OES A;  1MY1 A;  1LAH E;  1BTJ A;  2I49 A;  2ZNS A;  2D5W A;  2DWA A;  3FJ7 A;  3K1M A;  3H6V A;  1A7L A;  2NXO A;  4X48 A;  3KOT A;  3RUM A;  4EXL A;  4R72 A;  4WED A;  1JEU A;  3MZ1 A;  5L9O A;  3B6W A;  1SW4 A;  2ZYN A;  4O3B A;  1PBP A;  1R9Q A;  1B3L A;  3LSF B;  1CE2 A;  1UTB B;  4NF4 B;  1O64 A;  1OQG A;  3K02 A;  1IXI A;  1TT1 A;  4M4G A;  5DT6 A;  3ZS6 A;  4Q0C A;  3MPK A;  1B46 A;  2ALU A;  1QW0 A;  2ONS A;  1IUD A;  1QVS A;  3EHS A;  3KFM A;  2UYE A;  3PMV A;  1A55 A;  4LZ5 A;  4M1V A;  4BLA A;  4F18 A;  3AXF A;  3FVG A;  1A8E A;  2I0C A;  1NFT A;  1S50 A;  2DWJ A;  4MLV A;  2A5T B;  5H8S A;  5KCJ B;  5FHM A;  2H98 A;  3TTK A;  3U93 A;  3K6V A;  2OCU A;  3T66 A;  1NH7 A;  4YAH X;  1MXY A;  2HQ0 A;  3TCH A;  1LFI A;  2Q8J A;  1FTM A;  2VD3 A;  1N04 A;  3K01 A;  1UTH B;  4WXJ A;  1II5 A;  3CFX A;  2XX9 A;  4IY6 A;  1D4N A;  3VFJ A;  3OO8 A;  2RF1 A;  4GFR A;  4FE8 A;  4GD5 A;  4KYS A;  2WKY A;  4DLD A;  1RYX A;  1B9J A;  1IEJ A;  4BDL A;  3CSG A;  4KYE A;  4PFW A;  5ITO A;  3K2D A;  3FVK A;  2I4B A;  3IL1 B;  3PUW E;  2O7I A;  1MQG A;  1OLC A;  4PFT A;  5H8H B;  5ELV A;  1NNP A;  2XXI A;  1ZIU A;  3OEN A;  1B7U A;  5DEX B;  3S2V A;  3C31 A;  3TTN A;  5AA4 B;  2V84 A;  2I48 A;  3P7I A;  4ND9 A;  2Z22 A;  4QSC A;  4C1U A;  5I58 A;  4N13 A;  2ZYO A;  3CG3 A;  3K1P A;  2DXY A;  2RC9 A;  2Y7I A;  2HFB A;  3B7D A;  4U4X A;  4QHQ A;  4ZS9 A;  1B3F A;  1EZO A;  1CB6 A;  3T22 A;  3RNN A;  2H4I A;  4XXU A;  1OIB A;  3TQW A;  3IX1 A;  3O2A A;  4ECF A;  4IGT A;  3T9H B;  4OEN A;  5DVJ A;  4YMA A;  3LC8 A;  1JVX A;  3CR9 A;  1ANF A;  1POY 1;  4OWD A;  3IAZ A;  2DP8 A;  3U72 A;  4OEV A;  3ILT B;  1MPD A;  3FZV A;  3MJN A;  2PYY A;  2XX8 A;  4QRZ A;  2HCA A;  2OBG A;  5EHS A;  3PGF A;  3FVN A;  5CC2 A;  1MXZ A;  1TFA A;  1A40 A;  2CZL A;  1N76 A;  3MW0 A;  3VLU A;  1ZTY A;  3DEL B;  3IO4 A;  2H25 A;  4IO4 A;  4OTE A;  4X1D A;  1HSE A;  1MH4 A;  1YCJ A;  4F39 A;  1T0K A;  1LAF E;  3K00 A;  4GF8 A;  3BKI B;  3N26 A;  1ZJL A;  2D21 A;  1B7Z A;  1A54 A;  1BKA A;  1BIY A;  1MH3 A;  2HAV A;  2ZXT A;  3DM0 A;  2GH9 A;  2I3V A;  2B3F A;  3LSW A;  3UP9 A;  1B58 A;  1IXG A;  2VP1 A;  4XKN A;  5KDT B;  2NOO A;  5CI5 A;  1UTB A;  2DE4 A;  1QUK A;  2DOJ A;  5CM6 A;  4RNS A;  4YMB A;  4PFU A;  3K1N A;  1XHY A;  2Q2A A;  1Y4T A;  3M3F A;  3TEP A;  1VFE A;  3CFL A;  4QF9 A;  4WKM A;  4ESX A;  3O28 A;  4KD5 A;  3HHF A;  4YU0 A;  4DXC A;  4GWO A;  1LAG E;  3WAE A;  3HHG A;  1MM7 A;  1B05 A;  4MH5 A;  5AA2 D;  1NNF A;  2H99 A;  2ONK E;  4KCD A;  4JDF A;  4MFI A;  1TFD A;  1RKM A;  5H8Q B;  4NF5 A;  3ZKL A;  3N6U A;  2Z8E A;  5ICT A;  5H8F B;  3GBB A;  1S7Y A;  1VR5 A;  1USY E;  3G3G A;  4EUO A;  1B1X A;  1FQC A;  3HO7 A;  5FHO A;  3IB2 A;  4I62 A;  4F1Y A;  4OFO A;  3ZKK A;  1P1O A;  4KQP A;  2QPQ A;  4H5F A;  3TTL A;  1SI1 A;  1ZU0 A;  3SEW A;  1JET A;  1FQA A;  1XC1 A;  5HM4 B;  3H3G A;  2ABH A;  2QRY A;  3VVD A;  4NF4 A;  1MY2 A;  4Z0I A;  1R6Z A;  4P0I A;  3DP6 A;  5I2N B;  4N6P A;  2PT2 A;  4EXK A;  3K6X A;  2H9B A;  1OLA A;  3FJM A;  4NF6 B;  4Z7E A;  5I57 B;  1QJM A;  1B0L A;  1MY4 A;  2OWS A;  4NTL A;  2XXQ A;  3S9N C;  2QS1 A;  1KWH A;  3TEL A;  4F1U A;  1FTO A;  3V8X B;  5I56 A;  4BDO A;  1B4Z A;  1N7W A;  2M8C A;  5I2K B;  1NMU A;  2O6A A;  3Q26 A;  4JB7 A;  2ESN A;  4RPN A;  5DTB A;  3A3C A;  2GRV A;  3T96 B;  3PMW A;  3PU5 A;  2V25 A;  1SQY A;  1B0H A;  3M8U A;  3BFU A;  3MZB A;  4R6H A;  4H0W A;  3THI A;  3MZ9 A;  3ONM A;  5EHM A;  4DZ1 A;  3MVW A;  4R2B A;  1Q1K A;  4EDP A;  4NF5 B;  2HEU A;  1TWY A;  2I4C A;  4EF2 A;  1Y4C A;  2Q9T A;  2ZNT A;  3C4M A;  4FOR A;  4MF3 A;  4TLL B;  5DVF A;  5F7V A;  3PD8 A;  2KLF A;  4Q8R A;  3GBA A;  3V83 A;  3PPQ A;  3Q29 A;  4ZEC A;  3R26 A;  4O3A A;  3K6W A;  1SW5 A;  3IO6 A;  2YPN A;  3SES A;  1B6H A;  1ZBM A;  2UXA A;  5H8N B;  1B1H A;  2OLB A;  3OSR A;  3W9W A;  4MLQ A;  3IOT A;  5I2N A;  4IO5 A;  3OEL A;  3G3K A;  3VLV A;  1MQH A;  4NWC A;  4U22 A;  2PBW A;  5JEI A;  2NVU B;  2F36 A;  3C32 A;  3PUV E;  3RTW B;  1H43 A;  1PEB A;  2UVG A;  1B32 A;  3EPE A;  1LB9 A;  2I6E A;  2F7B A;  3FV2 A;  1P1N A;  3QUJ A;  4I9D A;  3C9H A;  3OXN A;  4TOZ A;  3U1O A;  5CMC A;  1IIT A;  1OMP A;  1VFD A;  3PD9 A;  4YKI A;  1MY3 A;  4RJZ A;  2P2A A;  4R73 A;  1M5C A;  2PT1 A;  4LA9 A;  1XVY A;  2XX7 A;  2HZL A;  4JWY A;  2RC7 A;  1AOV A;  2XXR A;  4U1Z A;  3SER A;  3KG2 A;  3FJG A;  3TUS A;  1N7X A;  4G68 A;  1J1N A;  1Z7N E;  3E4R A;  3MP1 A;  1IQ7 A;  2QMX A;  4NF8 B;  4LZ8 A;  4GVO A;  4H1X A;  2DWI A;  1P1W A;  2VGQ A;  3G3I A;  2OK2 A;  1MQD A;  1SD3 A;  3L6G A;  4THI A;  2XXV A;  4XTC Q;  5FTH A;  3M3K A;  2XXX A;  2OWT A;  3TQL A;  3V5A A;  4F19 A;  5A5X A;  2ZYK A;  3JV9 A;  2HAU A;  2Y7R A;  1B5H A;  1MM6 A;  2F78 A;  3OMB A;  3PUY E;  4G8M A;  2ZYM A;  2ZMB A;  4GXA A;  3T9V A;  1OVT A;  4GQO A;  1EZ9 A;  4OYV A;  3PPN A;  4QSE A;  4G8N A;  1NL5 A;  2B3B A;  3RY3 A;  1B3H A;  1B40 A;  4YKP A;  1Y3N A;  1SVX B;  3HV1 A;  3PUX E;  2O1L A;  2VOZ A;  4HTG A;  3GLB A;  4AB6 A;  4DCY A;  3OEK A;  3B6T A;  4XIG Q;  2DE2 A;  3G3J A;  4ZEI A;  1B4H A;  2BJJ X;  4P11 A;  2R9J A;  4DE8 A;  2XXT A;  1MQI A;  1D9V A;  3G3H A;  4TLM B;  5L8D A;  3V89 B;  1M5E A;  4HS7 A;  1FW0 A;  4ISU A;  1MS7 A;  2QS2 A;  4X9T A;  1FQD A;  1P99 A;  2O84 X;  2X7P A;  5I59 A;  1RYO A;  3TKD A;  3IOV A;  3RTF B;  1QUL A;  2QL3 A;  2O69 A;  2DVC A;  1Y3P A;  3TYH A;  5JTY A;  3C33 A;  4IO6 A;  4F29 A;  4R2F A;  1B5J A;  1LBB A;  4G68 B;  4LAT A;  3H6T A;  2DSF A;  4U2R A;  2DYX A;  2FYI A;  5K2Y A;  1NNT A;  3GXA A;  5AA1 A;  1AH5 A;  1N0T A;  1QUJ A;  3TOD A;  1JW5 A;  4QFL A;  1IZ1 A;  2DQV A;  4DIG A;  3CI8 A;  1PBQ A;  1R1N A;  2DS9 A;  4LQ5 A;  1POT A;  4ZDM A;  4C1T A;  1JW4 A;  4PE5 B;  4H8J A;  4OQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...