4OXVA

Crystal structure of mltf from pseudomonas aeruginosa complexed with valine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
428
structure length
424
Chain Sequence
APTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase F
publication title Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine
rcsb
source organism Pseudomonas aeruginosa padk2_cf510
molecule tags Lyase
total genus 158
structure length 424
sequence length 428
ec nomenclature ec 4.2.2.-:
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oxvA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4oxvA02
1P1OA 2XXYA 4EDPA 3ODBA 1IXCA 4ISUA 3T93B 1B3GA 4NF4A 4WEPA 3SEXA 3ILTB 1ZBMA 5I56A 4U1OA 5ELVA 1L5TA 4ZEKA 1SVXB 2ESNA 3HHFA 2HZLA 1B0LA 4TLMB 1Q35A 1VE4A 1POTA 2DE2A 4WKMA 1M5FA 3O6HA 1IUDA 4MBPA 3MVXA 5H8QB 1LFIA 1ATGA 3OEMA 3MBPA 2ANJA 3PD8A 3WAFA 1A99A 3MJNA 4ELRA 4LONB 1LAGE 4DCYA 3HO7A 1JEVA 4JB7A 4PFUA 3IL1B 3L6HA 5L9SA 3DELB 2O51A 2HFBA 1YTVA 5B7DA 3K1NA 4OXVA 1QUJA 1JETA 4JWOA 1CB6A 4Z0IA 3OEKA 2VD2A 4OWDA 1BLFA 3VDFA 1LCFA 2ONSA 5I57B 5L9OA 1B1XA 1LB8A 4IO2A 3PPOA 3FXUA 3HV1A 1LB9A 3SKPA 1B40A 3BBRA 3MUQA 2GRVA 1MY0A 3K2DA 5FHOA 3RTWB 4AB5A 3H6WA 2IEEA 5CBRA 3QAXA 3B6TA 2M8CA 3JV9A 4RPNA 1OVBA 3KBRA 1SW1A 3KEIA 3Q25A 1B7HA 4BDLA 1SD3A 4Z7EA 3C4MA 3N6TA 3BFTA 3A3CA 5B70A 1OQGA 2QMXA 2ZNSA 3A09A 2QS3A 1JEUA 3MQ9A 3C9HA 1GR2A 3PUVE 1XVYA 4NF5A 1VR5A 3H3GA 1MY2A 1LAXA 4LZ5A 1BKAA 4I62A 1NKXA 2DWAA 3H7MA 5JEIA 4LZ8A 5BUUA 3FV2A 3PU5A 4X48A 1WVJA 4R74A 2O7UA 3IOTA 4KYSA 4F1VA 1ZTYA 2G29A 3PPRA 4ZECA 4KYDA 3S2VA 1Y3NA 1LFHA 2I3VA 5DVFA 2I4BA 1IQ7A 2XXTA 1XS5A 3PUYE 3V83A 2PT2A 3KSXA 4JDFA 2O1LA 3M3LA 5AA2B 2O6AA 1KWHA 3E3KA 4F18A 5CRYA 5I59B 1H43A 4R6HA 5JK4A 4NE4A 3DP8A 1GTKA 2HCAA 3IAZA 4O3BA 4KCDA 3QSLA 4N13A 1UTBA 3S9NC 1D9YA 2ALUA 1O64A 5M2VA 4DLDA 2Q2CA 2QRYA 3OENA 1TXFA 5J1DA 1LAHE 2PX1A 1TT1A 2PVUA 3K1MA 3BKIB 3OO6A 4XXUA 3UP9A 3PD9A 2RF1A 5I84A 1NNKA 1LLSA 2PT1A 2X7QA 1MXUA 1N7XA 1Y3QA 1QJMA 4H6DA 1MQGA 3U93A 3HN0A 1MXWA 3M3FA 3V5AA 3MAMA 4KD5A 4OEVA 1XVXA 1CE2A 5TPAB 2THIA 3LSLA 4PP0A 2UYEA 4NWDA 3QYTA 3G3HA 3KGCA 3O28A 3PMVA 2ONRA 4NF8A 1N0TA 2DYXA 2OBGA 3BFUA 1MDQA 3SESA 4KCCA 2Q8JA 2OWTA 4RY1A 3H6VA 4YMAA 3TELA 4U22A 1A7LA 2KLFA 2XXRA 4G2ZA 1FQDA 1PB7A 3CSBA 2OWSA 3IK6B 3B6QA 4G8HA 2NOOA 5A5XA 3Q29A 5DT6A 3HPIA 4YMBA 3KN8A 2O1MA 1IITA 4U4SA 3SEUA 4G68A 4ESXA 3K6UA 4ELQA 3QUJA 1EH3A 2ZMBA 4EUOA 4F1YA 4NF4B 3T22A 2CZLA 1B2HA 3PPNA 1S9TA 2XHDA 4PFTA 1H76A 1LCTA 2XX7A 2ZXTA 4I9DA 4FJPA 5I56B 2E0SA 2HEUA 3SETA 3VLWA 5I2NA 3V8XB 4DXCA 3OELA 1QW0A 4EQ9A 3H03A 4P0IA 2V25A 3OO9A 3IOVA 2Y7KA 2Q89A 3UK4A 5KDTA 3G7WA 3MP6A 4RK9A 1SI0A 3EN3A 4XKQA 3KN7A 4YKJA 3DM0A 1MPDA 4OFLA 3RY3A 3U1OA 1VSOA 3IX1A 1B46A 3ECRA 3IJXB 3OD7A 2OLBA 1PBQA 4EF2A 2P1SA 1PEBA 4IB2A 1OQHA 3LSFB 4YB7A 1SW2A 4RJZA 2UVHA 3PUXE 1MRPA 1QUIA 2RINA 1LBCA 4FEDA 3TPAA 5CMBA 4EQBA 3OXNA 4KPTA 5F1QA 2GH9A 3PGFA 3SEVA 2AIXA 1I6BA 2FA7A 4BDRA 1AMFA 3OSQA 2Q88A 4I8CA 1P1UA 1OIBA 2F7BA 4XKPA 2UVJA 1MXZA 1MXVA 2ZYKA 2AL5A 3TYHA 4F22A 3K00A 1S7YA 5EHSA 4HS7A 2PMSA 3TCFA 4IO6A 4FE8A 1MH4A 1A8FA 2RCAA 3O66A 4X1BA 3T66A 3VFJA 2QPQA 3IR1A 5HBCA 5FTHA 3IB0A 3FVGA 3VXCA 2F7AA 2XXXA 4YICA 4XTCQ 1SI1A 1XHYA 2YPNA 4NF5B 3LUYA 3TTMA 3HHGA 4QSEA 3U92A 2HZKA 3A3UA 2HXWA 5CMCA 1IXHA 1LFGA 1DOTA 2H4IA 4I1DA 1M5EA 4RK2A 4Q30B 1DPEA 1D3KA 1OLAA 4GIZA 3RQTA 2V3QA 4ONYA 3MVYA 4OZ9A 1WDNA 2HQ0A 2UVGA 5F7VA 2OJTA 3RGYA 1N76A 2DS9A 3KJ7A 2F35A 4LZ7A 4KYEA 4F31B 1ANFA 4RYAA 4RXLA 3U72A 3D4GA 1PC3A 1A8EA 3CG1A 3IO6A 1B7ZA 4BLAA 2ZYMA 1S50A 4GRKA 4F3SA 1R1NA 5FTIA 2GHAA 2Q9TA 2I4CA 3MPKA 1ZU0A 4DDDA 2RKMA 3EQ1A 1JNFA 4POXA 5I2KA 4E0XA 4HTGA 3KOTA 4BDQA 4LQ2A 3ONMA 5ITPA 1Q1KA 1B1HA 2OCUA 1B52A 4H8IA 1NNFA 1UTBB 4JWXA 1TWYA 2DE3A 4ECFA 1JW1A 5FHMA 1PB8A 3G3KA 1MY4A 4HCYA 3O6GA 2XXPA 1UIUA 2Y7RA 3RLFE 5AA3A 4GLIA 3C34A 3K6WA 4F2QA 2DVZA 3OSRA 1SDXA 2R71A 5I58A 4X1DA 2O7IA 4U2RA 3UIFA 3S9MC 1MG1A 1FCKA 2AYSA 5EYFA 3FIRA 4KQPA 3T9HB 3RT6B 3OOAA 1IZ1A 5L9MA 2UYFA 3W15C 1B4HA 1AL3A 3R26A 4ZZEA 3D4CA 1RYOA 4NMYA 1A55A 4IGTA 3MPLA 3KOSA 3LC8A 5JTYA 1BP5A 4GXSB 3B7DA 4OHNA 4ND9A 4NF8B 4ESWA 5K2YA 3FJMA 1US5A 3E9XA 1NH7A 2BJJX 2RC7A 4TOZA 4QSCA 4EQ7A 3C31A 1DPPA 2VHAA 3LBSA 3DP6A 2F5XA 4HCWA 3G3JA 2Q2AA 1B6HA 2A5TA 1OLCA 4L17A 1H45A 4OETA 1XOCA 3JYRA 4DE8A 5A5XB 3MC2A 2FYIA 1LAFE 3CIJA 2WKYA 4NEDA 5AA2D 4IO5A 4KHZE 4G68B 3MWBA 3SERA 1MQHA 4M1VA 4TLLB 4U1ZA 3UN6A 3VXBA 1QKBA 1ZLQA 3VVEA 1Y1ZA 3S9LC 4OVJA 3FXRA 2ZYNA 4FEBA 4YB5A 5I2NB 4IY5A 4OTEA 1FQEA 1M5BA 1PDAA 3TEPA 1JW4A 4ZZAA 3I3VA 4GL8A 1MQDA 3EHSA 4QRZA 3GXAA 3N6UA 3IOUA 1GV8A 2NWJA 1AH5A 3K02A 3S4UA 5KDTB 1Y20A 1VFEA 3TKDA 5ICQA 3TUSA 2QL3A 1FTKA 3H06B 5AE4A 2XXHA 3N26A 3TCGA 3C35A 4YU0A 1B7UA 5CC2A 3MZBA 2DP8A 3ILUB 1OVTA 1MS7A 4FAJA 3IJOB 1IXGA 2F6GA 4MH5A 5TU0A 5BWJA 1JQFA 1MY1A 4FATA 1JW5A 5AA4A 3I6VA 1NNPA 3KZGA 3C33A 4ELOA 4NF6A 3UA8A 1QULA 1RKMA 2HAVA 1FQBA 2GHBA 2XX8A 1Y4TA 1ZJLA 3MP8A 4GF8A 3FVKA 1POY1 4G68C 2AL4A 1Y9UA 4QFNA 3IO4A 3RTFB 2W7YA 1B0HA 4RPOA 3THIA 4XKNA 4H5FA 4LA9A 3G3GA 4MLVA 1D9VA 1ZKBA 4BDOA 3FJ7A 3V89B 3GBAA 2RC9A 4EXKA 1DSNA 1DTZA 1UQWA 4IO3A 1US4A 3Q28A 1N84A 3K01A 1DMBA 1LBBA 2CMOA 4R2BA 4ZE9A 3H4ZA 3U8QA 1SYHA 3FVNA 4C1UA 5TP9A 1O63A 4TQUQ 1N3XA 1USYE 3C32A 4YKIA 2X26A 3E13X 1PB9A 3GBBA 3TTNA 2REGA 3T9XB 5H8HA 3MVZA 4EF1A 2DE4A 2DQVA 4IO7A 4NWCA 4H67A 4AB6A 4DXBA 4YKKA 5H8NA 4H1XA 1TFAA 1HSLA 2RC8A 3O9PA 1XT8A 2X7PA 1RYXA 3CRBA 3R6UA 4PQJA 3DP4A 2QJEA 2VP1A 5DYHA 3PUWE 3GLBA 4RA1A 5I2KB 2DXYA 4H0WA 2DVCA 4QF9A 3Q26A 4P0GA 1Y1MA 2F6PA 4WXJA 2UXAA 4MF3A 2FNCA 3GZGA 1Z7ME 1I6QA 2V3UA 2HAUA 4R2FA 3CSGA 2XD2A 2DWHA 1UIVA 4DZ1A 3TDJA 4OESA 5DTBA 2DWIA 3IB1A 3OMBA 1I6AA 1FW0A 4MFIA 4DIGA 4QFOA 5CMKA 1SW4A 5KCJA 2R9JA 2IA4A 3MZ9A 1URDA 4PETA 3K6VA 4UA8A 1D4NA 1MQIA 3OO8A 4U23A 4F3BA 1SYIA 2A5SA 1NFTA 1A40A 4Q0CA 2PYYA 2YLNA 2Z8EA 3USDA 4LATA 4K3FA 4R75A 1FTMA 5JTYB 4AQ4A 4OMBA 2NUVA 5AA1A 4P11A 1H44A 2Y7IA 3OO7A 5KZTA 4JXIA 1MPBA 1M5CA 3TTRA 1Y4CA 4XKRA 3FJGA 3CFZA 5HPQA 3LSXA 2XXIA 2A5TB 1NL5A 4QFLA 3PMWA 3QK6A 1B3EA 1T0KA 3VV5A 4MLQA 2I3WA 4FECA 2V3TA 4Q5TA 3VLUA 3CR9A 5H8FA 5DVIA 3TCHA 2XD3A 2XX9A 1B5JA 4GXAA 3T9VA 3E4RA 3TODA 1N3WA 2QS4A 2I0BA 2Y7WA 2NVUB 3EHTA 1MDP1 3TQWA 2I58A 3FUZA 1DTGA 1P1WA 1YPNA 5CM6A 1MPCA 3MZ1A 2B3FA 4ELPA 2Y7PA 1P1NA 2ZYOA 4UACA 3PMXA 4THIA 4ZEDA 1VFDA 4M4GA 3ZKKA 1BTJA 4R6KA 2D21A 3PV0E 4IY6A 2VD3A 2PBWA 3G3FA 5CBSA 3DLNA 4LVQA 4FORA 2LAOA 3T9UA 1UTHA 2H5YA 4GWOA 2H25A 2ONKE 1MQJA 4O3CA 4F39A 1Z7NE 4OFJA 3H6UA 4PFWA 3CG3A 4C1TA 4PE5B 3PPPA 4R6YA 4BDNA 3ZSFA 4ZS9A 5L8DA 3O6IA 4IGRA 4R73A 3KSJA 3VVFA 2D5WA 3EHUA 2H99A 4YKPA 4R9FA 5AA4B 1MY3A 4QFPA 4YAHX 5DEXA 1Y3PA 3UGWA 2QSXA 2NXOA 2VOZA 4G77A 1BIYA 4NF6B 3K1PA 2I49A 1FQFA 4JBZA 3CFLA 1QUKA 1B32A 3JZJA 3KFMA 1B4ZA 4QSDA 4R9GA 1TFDA 5H8SA 3SDFA 3S9EA 4JSOA 2O84X 1II5A 1WODA 2I0CA 1IIWA 2XXUA 4F3GA 1URSA 4RNSA 4DXUA 5IKBA 1OMPA 4LQ5A 2ZNUA 1EZ9A 4H5GA 2Z8FA 2F97A 1AOVA 3TFLA 1NH8A 2OZZA 3SEWA 4ZEBA 2DWJA 2DXRA 2RCBA 1MH3A 3PUZE 1M5DA 3TTKA 3RNNA 4X9TA 2ABHA 2V93A 2F36A 3R7XA 1SW5A 4IO4A 5H8QA 3VVDA 1HSEA 4OEUA 4ZDMA 1FQCA 2Y84A 2O68A 2XXWA 5TP9B 1MXYA 4N6PA 2QS1A 3SEYA 2XXQA 1MM6A 4F19A 3HCQA 4EXLA 4H8JA 1JVXA 3RPWA 5H8HB 1B5IA 3TQLA 3KN3A 2Z23A 3N94A 4JSDA 3WAEA 2F78A 5H8NB 1FTOA 4YB6A 2H9BA 1N7WA 3IB2A 5ICTA 1QKAA 5I57A 1LSTA 3T96B 1B58A 4F2OA 3VLVA 4ZEIA 3QXMA 4GL0A 4U21A 1SQYA 4R72A 1GVCA 1IXIA 5HM4B 1B3LA 3RUMA 3QUFA 3CVGA 3FATA 4KR5A 4OFOA 1QVSA 2F7CA 3LR1A 1B3HA 3K4UA 2YJPA 3UORA 3B6WA 3TZAA 1NNTA 4OQOA 2ZNTA 3ZS6A 4QFKA 3M3KA 1XC1A 3O29A 3O2AA 2P2AA 4QHQA 3FZVA 3EPEA 3IORA 4N07A 4FIMA 3N5LA 2P0SA 5FHNA 4E0WA 1FQAA 4LP2B 1F9BA 1B51A 1B05A 5KCJB 3RN8A 3M8UA 1USYH 3MP1A 4GQOA 4G8NA 4U4XA 1ELJA 2Z22A 4OENA 4XIGQ 2I6EA 3C36A 1J1NA 4GD5A 2F34A 1P1QA 4BDMA 3KG2A 4F29A 2UVIA 5DVJA 3K6XA 2QS2A 3AXFA 5EHMA 3CFXA 5ITOA 1GGGA 3PPQA 2R6GE 1B3FA 2G93A 2DOJA 1B5HA 4Q8RA 1SBPA 5LOMA 3FASA 4G4PA 4DCXA 3I5OA 4F3PA 5CI5A 1ZMGA 5AA2A 3HSTA 3QIMA 4WEDA 3MVWA 3TAJA 2F8DA 4POWA 4KFQA 5I59A 2D3IA 1A54A 4JWYA 3W9VA 4ZE8A 1EU8A 4YZZA 1MM7A 1R6ZA 1EZPA 3KJTA 5H8FB 3Q27A 3O97A 4OERA 4OYVA 2XXVA 1P99A 1HSJA 2B65A 4G8MA 4HW8A 3EF7A 4NTLA 3W9WA 3FV1A 4LUBA 3H6TA 3F11A 3RT8A 3U94A 1URGA 4F1UA 1PBPA 2VGQA 4GVOA 2REJA 4C0RA 1B9JA 2B3BA 4PFYA 1YCJA 2OK2A 3FGSA 5ISUA 3CI8A 4GFRA 2H98A 3VE1B 1IEJA 1YAEA 1EZOA 2O69A 2I48A 1H3DA 1FTJA 3TTLA 3LSWA 1UTHB 2QMWA 4H65A 5TPAA 1ZIUA 3IOWA 1R9QA 2E1SA 1I69A 1O7TA 1JVYA 1N04A 3ZKLA 2Z8DA 3MW0A 5I58B 4ZEFA 3P7IA 3TMGA 4GOTA 3FD3A 2V84A 3G3IA 5CMMA 5IAIA 4O3AA 1LGBC 3K0VA 1NMUA 5DEXB 1R9LA 3FXQA 2GFEA 3L6GA 4KI0E 1AIVA 5K2XA 1FTLA 2DSFA 3FVOA 1MXXA
chains in the Genus database with same CATH superfamily
1P1OA 2XXYA 4EDPA 1FPLA 4NN3A 3ODBA 1LBZA 1FPDA 1IXCA 4ISUA 3T93B 1B3GA 4NF4A 4WEPA 3SEXA 4P56A 3ILTB 1ZBMA 5I56A 2P3VA 4U1OA 5ELVA 1L5TA 4ZEKA 1SVXB 2ESNA 3HHFA 2BJIA 2HZLA 1B0LA 4TLMB 1Q35A 1VE4A 1POTA 2DE2A 4WKMA 1M5FA 3O6HA 1IUDA 4MBPA 3MVXA 5H8QB 1LFIA 1D9QA 3BIGA 1ATGA 3OEMA 3MBPA 2ANJA 3PD8A 3WAFA 1A99A 3MJNA 4ELRA 4LONB 1LAGE 4DCYA 3HO7A 1JEVA 2F3BA 4JB7A 4PFUA 3IL1B 3L6HA 5L9SA 3DELB 2O51A 2HFBA 4H45A 4N15A 1YTVA 1VDWA 5B7DA 3K1NA 4OXVA 1QUJA 1JETA 2R8TA 1FJ9A 4JWOA 1CB6A 4Z0IA 3OEKA 2VD2A 4GX3A 4OWDA 1BLFA 3VDFA 1LCFA 2ONSA 5I57B 1NV4A 5L9OA 1FSAA 4N8YA 3RPLB 1B1XA 1LB8A 4IO2A 3PPOA 3FXUA 4JVDA 3HV1A 4I40A 1LB9A 3SKPA 1B40A 3KBZA 3BBRA 3MUQA 2WYKA 4PDHA 2GRVA 1MY0A 3K2DA 4MHFA 5FHOA 3RTWB 4AB5A 3H6WA 2IEEA 5CBRA 1DCUA 3QAXA 3B6TA 2M8CA 3JV9A 4RPNA 1OVBA 3KBRA 1SW1A 3KEIA 3Q25A 5EQ7A 1B7HA 4BDLA 1SD3A 4Z7EA 3C4MA 3N6TA 3BFTA 3A3CA 5B70A 1OQGA 2QMXA 2ZNSA 3A09A 2QS3A 1JEUA 3MQ9A 3C9HA 1GR2A 3PUVE 1XVYA 4NF5A 4MAGA 1VR5A 3H3GA 1NV3A 1MY2A 1LAXA 4LZ5A 1BKAA 4I62A 1NKXA 2DWAA 3H7MA 5JEIA 4LZ8A 1FBHA 5BUUA 3FV2A 3PU5A 4X48A 1WVJA 4R74A 2O7UA 3IOTA 4KYSA 4GBWA 4F1VA 1ZTYA 2G29A 2XXKA 3PPRA 4XEQA 4ZECA 1YZ0A 4KYDA 4P3LA 3S2VA 1EYKA 1Y3NA 1LBXA 1LFHA 2I3VA 5DVFA 2I4BA 1IQ7A 2XXTA 1XS5A 3PUYE 3V83A 2PT2A 3KSXA 4JDFA 2O1LA 3B8BA 3M3LA 5AA2B 1FPIA 1KA0A 2O6AA 1KWHA 3E3KA 4F18A 2WBBA 5CRYA 5I59B 1H43A 4R6HA 5JK4A 1SPIA 4NE4A 3DP8A 5EQ9A 1GTKA 2HCAA 3IAZA 4O3BA 4KCDA 3QSLA 5ET5A 4N13A 1UTBA 3S9NC 1D9YA 4I3EA 2ALUA 4PGNA 1O64A 5M2VA 4DLDA 2Q2CA 2QRYA 3OENA 1TXFA 5J1DA 1LAHE 2PX1A 1TT1A 2PVUA 3K1MA 3BKIB 3OO6A 4XXUA 4PC9A 3UP9A 3PD9A 2RF1A 5I84A 1NNKA 1LLSA 2PT1A 2V4CA 2X7QA 1MXUA 2XWIA 1N7XA 1Y3QA 1QJMA 4H6DA 1MQGA 3U93A 5A5LA 3HN0A 4DI3D 1MXWA 3M3FA 3V5AA 3MAMA 4PF8A 4KD5A 4OEVA 4HE1A 1XVXA 2WYPA 3QMFA 1CE2A 5TPAB 4AS5A 2THIA 3LSLA 1IMFA 4PP0A 2UYEA 4NWDA 3QYTA 4MX6A 1NV0A 3G3HA 3KGCA 3O28A 2QFLA 3PMVA 2ONRA 4P1EA 4NF8A 1N0TA 2DYXA 2OBGA 3BFUA 1MDQA 3SESA 4KCCA 2Q8JA 2OWTA 4RY1A 3H6VA 2CEXA 4YMAA 3TELA 4U22A 1A7LA 2KLFA 2XXRA 4G2ZA 1FQDA 1PB7A 3CSBA 2OWSA 4GX6A 3IK6B 1G0HA 3B6QA 1KA1A 4G8HA 2NOOA 5A5XA 3Q29A 5DT6A 3HPIA 4YMBA 3KN8A 5IZ3B 1YXIA 2O1MA 1IITA 4U4SA 3SEUA 4G68A 4ESXA 3K6UA 3KC1A 3QUJA 4ELQA 1EH3A 2ZMBA 4EUOA 4F1YA 4NF4B 2HHMA 3T22A 2CZLA 1B2HA 3PPNA 1S9TA 4PTKA 2XHDA 4PFTA 4I9DA 1H76A 1LCTA 1LBVA 2XX7A 2ZXTA 4FJPA 5I56B 2E0SA 2HEUA 3SETA 1NI9A 3VLWA 5I2NA 3V8XB 4DXCA 3OELA 1YYZA 1QW0A 2CZIA 4EQ9A 3H03A 4P0IA 2V25A 3OO9A 3IOVA 2QVVA 2Y7KA 4PCDA 2Q89A 3UK4A 5KDTA 3G7WA 3MP6A 4RK9A 1SI0A 4PE3A 1FTAA 3EN3A 4XKQA 3KN7A 4YKJA 3DM0A 1MPDA 4OFLA 3RY3A 3U1OA 1VSOA 2KQZA 1NUYA 3IX1A 1B46A 3ECRA 5IM2A 3IJXB 1RDYA 3OD7A 2OLBA 4UABA 2ZZXA 1PBQA 4EF2A 2P1SA 1PEBA 1DBZA 4IB2A 1OQHA 3LSFB 4HE2A 4YB7A 1SW2A 4RJZA 2UVHA 3PUXE 1MRPA 1QUIA 5ESYA 2RINA 3B50A 1LBCA 4FEDA 3TPAA 5CMBA 4EQBA 3OXNA 4KPTA 5F1QA 2GH9A 3PGFA 3SEVA 2AIXA 4NF0A 1I6BA 2FA7A 4BDRA 1AMFA 3OSQA 2Q88A 4I8CA 1P1UA 1OIBA 2F7BA 4XKPA 2UVJA 1MXZA 2PCRA 1MXVA 2ZYKA 2AL5A 4NHBA 2OWZA 3TYHA 4F22A 3K00A 1S7YA 5EHSA 4HS7A 2PMSA 3TCFA 4IO6A 4FE8A 1MH4A 1A8FA 2RCAA 3O66A 2F3DA 4X1BA 3T66A 3VFJA 2QPQA 5FBPA 3IR1A 5HBCA 5FTHA 3IB0A 3FVGA 5ET6A 3VXCA 2F7AA 2XXXA 5ET8A 4YICA 4XTCQ 5T3JA 1SI1A 1XHYA 2YPNA 5F24A 4NF5B 3LUYA 3TTMA 1FPFA 3HHGA 4QSEA 3U92A 2HZKA 3A3UA 3ROJA 3E79A 2HXWA 5CMCA 4PGPA 1IXHA 1LFGA 1DOTA 2H4IA 4I1DA 1M5EA 4RK2A 4Q30B 3ISPA 1DPEA 4NX1A 1D3KA 1OLAA 4GIZA 3RQTA 2V3QA 4ONYA 3MVYA 4OZ9A 4AS4A 1WDNA 2HQ0A 2WEFA 5LDZA 2UVGA 5F7VA 5ET7A 2OJTA 3RGYA 1N76A 2DS9A 3KJ7A 2F35A 4LZ7A 4KYEA 4F31B 1ANFA 1K9ZA 4RYAA 4RXLA 3U72A 3D4GA 1PC3A 4GX4A 1A8EA 1IMBA 3CG1A 3IO6A 1B7ZA 4BLAA 2ZYMA 4PDDA 1S50A 4GRKA 4DI4B 4F3SA 4PFIA 1R1NA 5FTIA 2GHAA 2Q9TA 2I4CA 3MPKA 1ZU0A 4DDDA 2RKMA 3EQ1A 4XFEA 4MMPA 1JNFA 4POXA 5I2KA 1XI6A 4MCOA 4E0XA 4HTGA 3KOTA 4P8BA 4MNPA 4BDQA 4PAFA 4LQ2A 3ONMA 5ITPA 1Q1KA 3U65A 1B1HA 2OCUA 1B52A 4H8IA 2CZKA 1NNFA 1UTBB 4JWXA 1TWYA 2DE3A 4ECFA 1JW1A 5FHMA 1PB8A 4QBAA 3G3KA 1MY4A 3T0JA 4HCYA 3O6GA 2XXPA 1UIUA 2Y7RA 3RLFE 5AA3A 4GLIA 5DW8A 3C34A 3K6WA 4MNIA 4F2QA 2DVZA 3OSRA 1SDXA 2R71A 5I58A 4X1DA 2O7IA 2L5VA 4U2RA 3UIFA 3S9MC 1MG1A 1FCKA 2AYSA 5EYFA 1FPGA 3FIRA 4KQPA 1FBPA 3T9HB 3RT6B 3OOAA 2FHYA 1FPKA 1IZ1A 5L9MA 2UYFA 4N6KA 3W15C 1B4HA 1AL3A 3R26A 4ZZEA 3D4CA 1RYOA 4NMYA 1A55A 4IGTA 3MPLA 3KOSA 3LC8A 5JTYA 1BP5A 4GXSB 3B7DA 4OHNA 4ND9A 4NF8B 4ESWA 5K2YA 3FJMA 1US5A 3E9XA 1NH7A 2BJJX 4NGUA 2RC7A 4GWUA 4TOZA 4QSCA 4EQ7A 3IFAA 3C31A 1DPPA 2VHAA 3LBSA 4OVTA 3DP6A 1FPEA 2F5XA 2HPGA 4HCWA 2GQ1A 3G3JA 2Q2AA 1B6HA 2A5TA 1OLCA 4L17A 1H45A 4OETA 1XOCA 3JYRA 4DE8A 5A5XB 3MC2A 2FYIA 1LAFE 3CIJA 2WKYA 4NEDA 5AA2D 4IO5A 3A29A 4KHZE 4G68B 3MWBA 3SERA 1MQHA 4M1VA 2OX3A 4TLLB 4O8MA 4U1ZA 3UN6A 3VXBA 1QKBA 1ZLQA 3VVEA 1Y1ZA 3S9LC 4OVJA 3FXRA 2ZYNA 4FEBA 1NUXA 4YB5A 5I2NB 4IY5A 4JVIA 4OTEA 1FQEA 1M5BA 1PDAA 3TEPA 1JW4A 4ZZAA 3I3VA 4GL8A 1MQDA 3EHSA 4QRZA 5J16A 3GXAA 3N6UA 3IOUA 1GV8A 2NWJA 1IMAA 1AH5A 3K02A 3S4UA 5KDTB 1Y20A 1VFEA 3TKDA 5ICQA 3TUSA 2QL3A 1FTKA 3H06B 5AE4A 2XXHA 3N26A 3TCGA 3C35A 4YU0A 3RPLA 1B7UA 3LUZA 5CC2A 3MZBA 2DP8A 3ILUB 1OVTA 4X8RA 1MS7A 4FAJA 3IJOB 1IXGA 2F6GA 4MH5A 5TU0A 3E78A 4O7MA 5BWJA 3SZPA 1JQFA 4MNCA 1MY1A 4FATA 1JW5A 5AA4A 3I6VA 2WBDA 2KR0A 1NNPA 3KZGA 3C33A 4ELOA 2DDKA 1LEVA 4NF6A 3UA8A 1QULA 1RKMA 2MKZA 3HFUA 2HAVA 1FQBA 4MEVA 2GHBA 2XX8A 1Y4TA 1ZJLA 3MP8A 4GF8A 3FVKA 1POY1 4G68C 2AL4A 1Y9UA 4QFNA 3IO4A 2QVRA 3RTFB 2W7YA 1B0HA 4RPOA 3THIA 4XKNA 4N81A 4H5FA 4LA9A 3G3GA 2Y5KA 4MLVA 2XWVA 1D9VA 1ZKBA 4BDOA 3FJ7A 3V89B 3GBAA 2RC9A 4OA4A 2FIEA 4EXKA 1DSNA 1DTZA 1UQWA 4IO3A 1US4A 3Q28A 1N84A 5IGAA 2FVZA 3K01A 1DMBA 1LBBA 2CMOA 4OVPA 5IZ1A 4R2BA 4ZE9A 3H4ZA 3U8QA 1SYHA 3FVNA 4C1UA 1NV7A 5TP9A 1QGXA 1O63A 4TQUQ 1N3XA 1USYE 3C32A 4YKIA 1RDXA 2X26A 4HXVA 3KC0A 3E13X 1PB9A 3GBBA 4GWYA 3TTNA 2REGA 3T9XB 5H8HA 3MVZA 4EF1A 2DE4A 2DQVA 4IO7A 4NWCA 4H67A 4AB6A 4DXBA 4YKKA 2CZHA 5H8NA 4N6DA 4H1XA 1TFAA 1HSLA 2JJKA 4PAKA 2RC8A 3O9PA 1XT8A 2X7PA 1RYXA 3CRBA 3R6UA 4PQJA 3DP4A 2QJEA 2VP1A 1DK4A 5DYHA 3PUWE 3GLBA 4RA1A 5I2KB 2DXYA 4H0WA 2DVCA 4QF9A 3Q26A 4P0GA 1NV6A 1Y1MA 2F6PA 4WXJA 2UXAA 3RYDA 4MF3A 2FNCA 3GZGA 1Z7ME 2ZZWA 3T1BA 1I6QA 2V3UA 2HAUA 4R2FA 3CSGA 2XD2A 2P3NA 2DWHA 1NUWA 1FRPA 1UIVA 4DZ1A 4GWXA 1JP4A 3TDJA 4OESA 5DTBA 2DWIA 3IB1A 3OMBA 1I6AA 1FW0A 4MFIA 4DIGA 4QFOA 5CMKA 1SW4A 5KCJA 2R9JA 2IA4A 3MZ9A 1URDA 4PETA 4PFBA 3K6VA 4UA8A 1D4NA 1MQIA 3OO8A 4MIJA 4U23A 4F3BA 1SYIA 2A5SA 1NFTA 1A40A 4Q0CA 2PYYA 2YLNA 2Z8EA 3USDA 4LATA 4K3FA 4R75A 1FTMA 5JTYB 4AQ4A 4OMBA 2NUVA 5AA1A 2HXRA 4N4UA 4X04A 4P11A 1H44A 2Y7IA 1FPBA 3OO7A 4QXDA 3PTYA 5KZTA 4JXIA 1MPBA 1AWBA 1M5CA 3TTRA 1Y4CA 4XKRA 3FJGA 3MSTA 3CFZA 5HPQA 3LSXA 2XXIA 1FBFA 4HE0A 4NG7A 2A5TB 1NL5A 4QFLA 3PMWA 3QK6A 1B3EA 1T0KA 3VV5A 4MLQA 2ZZVA 2I3WA 4FECA 2V3TA 4Q5TA 3VLUA 3CR9A 5H8FA 1CNQA 2FBPA 5DVIA 3TCHA 2XD3A 2XX9A 1B5JA 4GXAA 3T9VA 3E4RA 3TODA 1N3WA 2QS4A 2I0BA 2Y7WA 2NVUB 3EHTA 1MDP1 3TQWA 2I58A 3EKIA 3FUZA 1DTGA 1P1WA 1YPNA 4P47A 5CM6A 1IMDA 1MPCA 3MZ1A 4PF6A 2B3FA 4ELPA 4PBQA 2Y7PA 1P1NA 3D1RA 2ZYOA 4O94A 4UACA 3PMXA 4THIA 4ZEDA 1VFDA 4M4GA 3ZKKA 1BTJA 4R6KA 2D21A 3PV0E 4IY6A 4N8GA 2VD3A 2PBWA 4MJOA 3G3FA 5CBSA 2B4LA 3DLNA 2XA5A 5EQAA 4LVQA 4FORA 2LAOA 3T9UA 1UTHA 2H5YA 1RDZA 4GWOA 2H25A 4H46A 2ONKE 1MQJA 4O3CA 4F39A 1Z7NE 5IZZA 4OFJA 3H6UA 4PFWA 3CG3A 4C1TA 4PE5B 3PPPA 4R6YA 4BDNA 3ZSFA 3NOHA 4ZS9A 5L8DA 3O6IA 4IGRA 4R73A 3KSJA 3VVFA 2D5WA 2VT5A 4O7IA 3EHUA 2H99A 4YKPA 2Q74A 4R9FA 5AA4B 1MY3A 4QFPA 4YAHX 5DEXA 1Y3PA 3UGWA 4PFRA 2QSXA 2NXOA 4JVCA 2VOZA 4G77A 1BIYA 4NF6B 2Q8MA 3K1PA 2I49A 1FQFA 4JBZA 3CFLA 1QUKA 1B32A 4P1LA 3JZJA 3KFMA 1B4ZA 4QSDA 4R9GA 1TFDA 5H8SA 3SDFA 3S9EA 4JSOA 2O84X 1II5A 1WODA 2I0CA 1IIWA 2XXUA 4F3GA 1FJ6A 1URSA 4RNSA 4DXUA 5IKBA 1OMPA 4LQ5A 2XWOA 2ZNUA 2QVUA 1EZ9A 4H5GA 2Z8FA 2F97A 1AOVA 3TFLA 1NH8A 2OZZA 3SEWA 4ZEBA 4KXPA 2DWJA 2DXRA 5LTCA 2RCBA 1KZ8A 1MH3A 1IMCA 1INPA 3PUZE 1M5DA 3TTKA 2XWKA 2Y5LA 3RNNA 4X9TA 2ABHA 2V93A 2F36A 3R7XA 1SW5A 4IO4A 5H8QA 3VVDA 1HSEA 4OEUA 5EQ8A 4ZDMA 1FQCA 2Y84A 2O68A 2XXWA 5TP9B 1MXYA 4N6PA 4PAIA 2QS1A 3SEYA 1EYIA 2XXQA 4FBPA 1MM6A 4F19A 3HCQA 3LV0A 4EXLA 4GWSA 4H8JA 1JVXA 4I3YA 3RPWA 5H8HB 1B5IA 3TQLA 4NQ8A 3KN3A 2Z23A 3N94A 4JSDA 3WAEA 2F78A 5H8NB 1FTOA 4YB6A 2H9BA 1N7WA 3IB2A 5ICTA 1QKAA 5I57A 1LSTA 1NUZA 3T96B 1B58A 4F2OA 3VLVA 4ZEIA 3QXMA 4GL0A 4U21A 1SQYA 4OVRA 4R72A 1GVCA 1IXIA 1FBCA 1NV5A 5HM4B 1B3LA 3RUMA 1NV2A 3QUFA 3CVGA 3FATA 4KR5A 4OFOA 1QVSA 2F7CA 3LR1A 1B3HA 3K4UA 2YJPA 3UORA 3B6WA 3TZAA 1NNTA 5EYGA 4OQOA 2ZNTA 3ZS6A 4QFKA 3M3KA 1XC1A 3O29A 3O2AA 2P2AA 4QHQA 3FZVA 3EPEA 3IORA 4N07A 4FIMA 3N5LA 2P0SA 2WX9A 4PBHA 4XF5A 5FHNA 4E0WA 1FQAA 2PFYA 4LP2B 1FBGA 1F9BA 1LBYA 1B51A 1B05A 3GYYA 5KCJB 4N91A 3RN8A 3M8UA 1USYH 3MP1A 4GQOA 4G8NA 4U4XA 1ELJA 2VPNA 2Z22A 4OENA 4XIGQ 2I6EA 3C36A 1J1NA 4GD5A 1Q9DA 2F34A 1P1QA 4BDMA 3KG2A 4F29A 2CEYA 2UVIA 5DVJA 3K6XA 2QS2A 3AXFA 3IFCA 5EHMA 3CFXA 5ITOA 1GGGA 3BIHA 3PPQA 2R6GE 1B3FA 2G93A 2B4MA 2DOJA 1B5HA 4Q8RA 4GWWA 1SBPA 5LOMA 3FASA 4G4PA 5IZ3A 4DCXA 3I5OA 4F3PA 5CI5A 1ZMGA 5I5PA 5AA2A 3HSTA 3QIMA 3CHGA 4WEDA 3MVWA 3TAJA 2F8DA 4LN5A 4GBVA 4POWA 4KFQA 4OVQA 5I59A 2D3IA 1A54A 4JWYA 3W9VA 4ZE8A 1EU8A 4YZZA 1MM7A 1R6ZA 1EZPA 3KJTA 5H8FB 3Q27A 3O97A 4N17A 4OERA 4OYVA 2XXVA 1P99A 1HSJA 2B65A 4G8MA 2FIXA 4HW8A 3EF7A 4NTLA 3W9WA 3FV1A 4LUBA 4OVSA 3H6TA 1G0IA 3FBPA 3F11A 3RT8A 3MYUA 3U94A 1FPJA 1EYJA 1URGA 4F1UA 5I3SA 1PBPA 1FBEA 2VGQA 4GVOA 1NV1A 2REJA 4OANA 4C0RA 1B9JA 2B3BA 4PFYA 1YCJA 2OK2A 3FGSA 5ISUA 5I7IA 3CI8A 4GFRA 2H98A 3VE1B 1IEJA 1YAEA 1EZOA 2O69A 2I48A 4IR8A 1H3DA 4NAPA 1FTJA 3TTLA 3LSWA 1UTHB 2QMWA 4H65A 5TPAA 1ZIUA 3IOWA 1R9QA 2E1SA 1I69A 1O7TA 1JVYA 1IMEA 1N04A 3ZKLA 2Z8DA 3MW0A 5I58B 4ZEFA 3P7IA 4GWZA 3TMGA 4GOTA 3FD3A 2V84A 3G3IA 5CMMA 5IAIA 4O3AA 4G61A 1LGBC 1LBWA 2PFZA 4P9KA 3K0VA 1NMUA 3FXBA 5DEXB 1R9LA 3FXQA 1BK4A 1FBDA 2GFEA 3L6GA 2VPOA 1K9YA 4KI0E 1AIVA 5K2XA 5EYHA 1FTLA 2DSFA 3FVOA 1MXXA
chains in the Genus database with same CATH topology
1P1OA 2XXYA 4EDPA 3ODBA 1IXCA 4ISUA 3T93B 1B3GA 4NF4A 4WEPA 3SEXA 3ILTB 1ZBMA 5I56A 4U1OA 5ELVA 1L5TA 4ZEKA 1SVXB 2ESNA 3HHFA 2HZLA 1B0LA 4TLMB 1Q35A 1VE4A 1POTA 2DE2A 4WKMA 1M5FA 3O6HA 1IUDA 4MBPA 3MVXA 5H8QB 1LFIA 1ATGA 3OEMA 3MBPA 2ANJA 3PD8A 3WAFA 1A99A 3MJNA 4ELRA 4LONB 1LAGE 4DCYA 3HO7A 1JEVA 4JB7A 4PFUA 3IL1B 3L6HA 5L9SA 3DELB 2O51A 2HFBA 1YTVA 5B7DA 3K1NA 4OXVA 1QUJA 1JETA 4JWOA 1CB6A 4Z0IA 3OEKA 2VD2A 4OWDA 1BLFA 3VDFA 1LCFA 2ONSA 5I57B 5L9OA 1B1XA 1LB8A 4IO2A 3PPOA 3FXUA 3HV1A 1LB9A 3SKPA 1B40A 3BBRA 3MUQA 2GRVA 1MY0A 3K2DA 5FHOA 3RTWB 4AB5A 3H6WA 2IEEA 5CBRA 3QAXA 3B6TA 2M8CA 3JV9A 4RPNA 1OVBA 3KBRA 1SW1A 3KEIA 3Q25A 1B7HA 4BDLA 1SD3A 4Z7EA 3C4MA 3N6TA 3BFTA 3A3CA 5B70A 1OQGA 2QMXA 2ZNSA 3A09A 2QS3A 1JEUA 3MQ9A 3C9HA 1GR2A 3PUVE 1XVYA 4NF5A 1VR5A 3H3GA 1MY2A 1LAXA 4LZ5A 1BKAA 4I62A 1NKXA 2DWAA 3H7MA 5JEIA 4LZ8A 5BUUA 3FV2A 3PU5A 4X48A 1WVJA 4R74A 2O7UA 3IOTA 4KYSA 4F1VA 1ZTYA 2G29A 3PPRA 4ZECA 4KYDA 3S2VA 1Y3NA 1LFHA 2I3VA 5DVFA 2I4BA 1IQ7A 2XXTA 1XS5A 3PUYE 3V83A 2PT2A 3KSXA 4JDFA 2O1LA 3M3LA 5AA2B 2O6AA 1KWHA 3E3KA 4F18A 5CRYA 5I59B 1H43A 4R6HA 5JK4A 4NE4A 3DP8A 1GTKA 2HCAA 3IAZA 4O3BA 4KCDA 3QSLA 4N13A 1UTBA 3S9NC 1D9YA 2ALUA 1O64A 5M2VA 4DLDA 2Q2CA 2QRYA 3OENA 1TXFA 5J1DA 1LAHE 2PX1A 1TT1A 2PVUA 3K1MA 3BKIB 3OO6A 4XXUA 3UP9A 3PD9A 2RF1A 5I84A 1NNKA 1LLSA 2PT1A 2X7QA 1MXUA 1N7XA 1Y3QA 1QJMA 4H6DA 1MQGA 3U93A 3HN0A 1MXWA 3M3FA 3V5AA 3MAMA 4KD5A 4OEVA 1XVXA 1CE2A 5TPAB 2THIA 3LSLA 4PP0A 2UYEA 4NWDA 3QYTA 3G3HA 3KGCA 3O28A 3PMVA 2ONRA 4NF8A 1N0TA 2DYXA 2OBGA 3BFUA 1MDQA 3SESA 4KCCA 2Q8JA 2OWTA 4RY1A 3H6VA 4YMAA 3TELA 4U22A 1A7LA 2KLFA 2XXRA 4G2ZA 1FQDA 1PB7A 3CSBA 2OWSA 3IK6B 3B6QA 4G8HA 2NOOA 5A5XA 3Q29A 5DT6A 3HPIA 4YMBA 3KN8A 2O1MA 1IITA 4U4SA 3SEUA 4G68A 4ESXA 3K6UA 4ELQA 3QUJA 1EH3A 2ZMBA 4EUOA 4F1YA 4NF4B 3T22A 2CZLA 1B2HA 3PPNA 1S9TA 2XHDA 4PFTA 1H76A 1LCTA 2XX7A 2ZXTA 4I9DA 4FJPA 5I56B 2E0SA 2HEUA 3SETA 3VLWA 5I2NA 3V8XB 4DXCA 3OELA 1QW0A 4EQ9A 3H03A 4P0IA 2V25A 3OO9A 3IOVA 2Y7KA 2Q89A 3UK4A 5KDTA 3G7WA 3MP6A 4RK9A 1SI0A 3EN3A 4XKQA 3KN7A 4YKJA 3DM0A 1MPDA 4OFLA 3RY3A 3U1OA 1VSOA 3IX1A 1B46A 3ECRA 3IJXB 3OD7A 2OLBA 1PBQA 4EF2A 2P1SA 1PEBA 4IB2A 1OQHA 3LSFB 4YB7A 1SW2A 4RJZA 2UVHA 3PUXE 1MRPA 1QUIA 2RINA 1LBCA 4FEDA 3TPAA 5CMBA 4EQBA 3OXNA 4KPTA 5F1QA 2GH9A 3PGFA 3SEVA 2AIXA 1I6BA 2FA7A 4BDRA 1AMFA 3OSQA 2Q88A 4I8CA 1P1UA 1OIBA 2F7BA 4XKPA 2UVJA 1MXZA 1MXVA 2ZYKA 2AL5A 3TYHA 4F22A 3K00A 1S7YA 5EHSA 4HS7A 2PMSA 3TCFA 4IO6A 4FE8A 1MH4A 1A8FA 2RCAA 3O66A 4X1BA 3T66A 3VFJA 2QPQA 3IR1A 5HBCA 5FTHA 3IB0A 3FVGA 3VXCA 2F7AA 2XXXA 4YICA 4XTCQ 1SI1A 1XHYA 2YPNA 4NF5B 3LUYA 3TTMA 3HHGA 4QSEA 3U92A 2HZKA 3A3UA 2HXWA 5CMCA 1IXHA 1LFGA 1DOTA 2H4IA 4I1DA 1M5EA 4RK2A 4Q30B 1DPEA 1D3KA 1OLAA 4GIZA 3RQTA 2V3QA 4ONYA 3MVYA 4OZ9A 1WDNA 2HQ0A 2UVGA 5F7VA 2OJTA 3RGYA 1N76A 2DS9A 3KJ7A 2F35A 4LZ7A 4KYEA 4F31B 1ANFA 4RYAA 4RXLA 3U72A 3D4GA 1PC3A 1A8EA 3CG1A 3IO6A 1B7ZA 4BLAA 2ZYMA 1S50A 4GRKA 4F3SA 1R1NA 5FTIA 2GHAA 2Q9TA 2I4CA 3MPKA 1ZU0A 4DDDA 2RKMA 3EQ1A 1JNFA 4POXA 5I2KA 4E0XA 4HTGA 3KOTA 4BDQA 4LQ2A 3ONMA 5ITPA 1Q1KA 1B1HA 2OCUA 1B52A 4H8IA 1NNFA 1UTBB 4JWXA 1TWYA 2DE3A 4ECFA 1JW1A 5FHMA 1PB8A 3G3KA 1MY4A 4HCYA 3O6GA 2XXPA 1UIUA 2Y7RA 3RLFE 5AA3A 4GLIA 3C34A 3K6WA 4F2QA 2DVZA 3OSRA 1SDXA 2R71A 5I58A 4X1DA 2O7IA 4U2RA 3UIFA 3S9MC 1MG1A 1FCKA 2AYSA 5EYFA 3FIRA 4KQPA 3T9HB 3RT6B 3OOAA 1IZ1A 5L9MA 2UYFA 3W15C 1B4HA 1AL3A 3R26A 4ZZEA 3D4CA 1RYOA 4NMYA 1A55A 4IGTA 3MPLA 3KOSA 3LC8A 5JTYA 1BP5A 4GXSB 3B7DA 4OHNA 4ND9A 4NF8B 4ESWA 5K2YA 3FJMA 1US5A 3E9XA 1NH7A 2BJJX 2RC7A 4TOZA 4QSCA 4EQ7A 3C31A 1DPPA 2VHAA 3LBSA 3DP6A 2F5XA 4HCWA 3G3JA 2Q2AA 1B6HA 2A5TA 1OLCA 4L17A 1H45A 4OETA 1XOCA 3JYRA 4DE8A 5A5XB 3MC2A 2FYIA 1LAFE 3CIJA 2WKYA 4NEDA 5AA2D 4IO5A 4KHZE 4G68B 3MWBA 3SERA 1MQHA 4M1VA 4TLLB 4U1ZA 3UN6A 3VXBA 1QKBA 1ZLQA 3VVEA 1Y1ZA 3S9LC 4OVJA 3FXRA 2ZYNA 4FEBA 4YB5A 5I2NB 4IY5A 4OTEA 1FQEA 1M5BA 1PDAA 3TEPA 1JW4A 4ZZAA 3I3VA 4GL8A 1MQDA 3EHSA 4QRZA 3GXAA 3N6UA 3IOUA 1GV8A 2NWJA 1AH5A 3K02A 3S4UA 5KDTB 1Y20A 1VFEA 3TKDA 5ICQA 3TUSA 2QL3A 1FTKA 3H06B 5AE4A 2XXHA 3N26A 3TCGA 3C35A 4YU0A 1B7UA 5CC2A 3MZBA 2DP8A 3ILUB 1OVTA 1MS7A 4FAJA 3IJOB 1IXGA 2F6GA 4MH5A 5TU0A 5BWJA 1JQFA 1MY1A 4FATA 1JW5A 5AA4A 3I6VA 1NNPA 3KZGA 3C33A 4ELOA 4NF6A 3UA8A 1QULA 1RKMA 2HAVA 1FQBA 2GHBA 2XX8A 1Y4TA 1ZJLA 3MP8A 4GF8A 3FVKA 1POY1 4G68C 2AL4A 1Y9UA 4QFNA 3IO4A 3RTFB 2W7YA 1B0HA 4RPOA 3THIA 4XKNA 4H5FA 4LA9A 3G3GA 4MLVA 1D9VA 1ZKBA 4BDOA 3FJ7A 3V89B 3GBAA 2RC9A 4EXKA 1DSNA 1DTZA 1UQWA 4IO3A 1US4A 3Q28A 1N84A 3K01A 1DMBA 1LBBA 2CMOA 4R2BA 4ZE9A 3H4ZA 3U8QA 1SYHA 3FVNA 4C1UA 5TP9A 1O63A 4TQUQ 1N3XA 1USYE 3C32A 4YKIA 2X26A 3E13X 1PB9A 3GBBA 3TTNA 2REGA 3T9XB 5H8HA 3MVZA 4EF1A 2DE4A 2DQVA 4IO7A 4NWCA 4H67A 4AB6A 4DXBA 4YKKA 5H8NA 4H1XA 1TFAA 1HSLA 2RC8A 3O9PA 1XT8A 2X7PA 1RYXA 3CRBA 3R6UA 4PQJA 3DP4A 2QJEA 2VP1A 5DYHA 3PUWE 3GLBA 4RA1A 5I2KB 2DXYA 4H0WA 2DVCA 4QF9A 3Q26A 4P0GA 1Y1MA 2F6PA 4WXJA 2UXAA 4MF3A 2FNCA 3GZGA 1Z7ME 1I6QA 2V3UA 2HAUA 4R2FA 3CSGA 2XD2A 2DWHA 1UIVA 4DZ1A 3TDJA 4OESA 5DTBA 2DWIA 3IB1A 3OMBA 1I6AA 1FW0A 4MFIA 4DIGA 4QFOA 5CMKA 1SW4A 5KCJA 2R9JA 2IA4A 3MZ9A 1URDA 4PETA 3K6VA 4UA8A 1D4NA 1MQIA 3OO8A 4U23A 4F3BA 1SYIA 2A5SA 1NFTA 1A40A 4Q0CA 2PYYA 2YLNA 2Z8EA 3USDA 4LATA 4K3FA 4R75A 1FTMA 5JTYB 4AQ4A 4OMBA 2NUVA 5AA1A 4P11A 1H44A 2Y7IA 3OO7A 5KZTA 4JXIA 1MPBA 1M5CA 3TTRA 1Y4CA 4XKRA 3FJGA 3CFZA 5HPQA 3LSXA 2XXIA 2A5TB 1NL5A 4QFLA 3PMWA 3QK6A 1B3EA 1T0KA 3VV5A 4MLQA 2I3WA 4FECA 2V3TA 4Q5TA 3VLUA 3CR9A 5H8FA 5DVIA 3TCHA 2XD3A 2XX9A 1B5JA 4GXAA 3T9VA 3E4RA 3TODA 1N3WA 2QS4A 2I0BA 2Y7WA 2NVUB 3EHTA 1MDP1 3TQWA 2I58A 3FUZA 1DTGA 1P1WA 1YPNA 5CM6A 1MPCA 3MZ1A 2B3FA 4ELPA 2Y7PA 1P1NA 2ZYOA 4UACA 3PMXA 4THIA 4ZEDA 1VFDA 4M4GA 3ZKKA 1BTJA 4R6KA 2D21A 3PV0E 4IY6A 2VD3A 2PBWA 3G3FA 5CBSA 3DLNA 4LVQA 4FORA 2LAOA 3T9UA 1UTHA 2H5YA 4GWOA 2H25A 2ONKE 1MQJA 4O3CA 4F39A 1Z7NE 4OFJA 3H6UA 4PFWA 3CG3A 4C1TA 4PE5B 3PPPA 4R6YA 4BDNA 3ZSFA 4ZS9A 5L8DA 3O6IA 4IGRA 4R73A 3KSJA 3VVFA 2D5WA 3EHUA 2H99A 4YKPA 4R9FA 5AA4B 1MY3A 4QFPA 4YAHX 5DEXA 1Y3PA 3UGWA 2QSXA 2NXOA 2VOZA 4G77A 1BIYA 4NF6B 3K1PA 2I49A 1FQFA 4JBZA 3CFLA 1QUKA 1B32A 3JZJA 3KFMA 1B4ZA 4QSDA 4R9GA 1TFDA 5H8SA 3SDFA 3S9EA 4JSOA 2O84X 1II5A 1WODA 2I0CA 1IIWA 2XXUA 4F3GA 1URSA 4RNSA 4DXUA 5IKBA 1OMPA 4LQ5A 2ZNUA 1EZ9A 4H5GA 2Z8FA 2F97A 1AOVA 3TFLA 1NH8A 2OZZA 3SEWA 4ZEBA 2DWJA 2DXRA 2RCBA 1MH3A 3PUZE 1M5DA 3TTKA 3RNNA 4X9TA 2ABHA 2V93A 2F36A 3R7XA 1SW5A 4IO4A 5H8QA 3VVDA 1HSEA 4OEUA 4ZDMA 1FQCA 2Y84A 2O68A 2XXWA 5TP9B 1MXYA 4N6PA 2QS1A 3SEYA 2XXQA 1MM6A 4F19A 3HCQA 4EXLA 4H8JA 1JVXA 3RPWA 5H8HB 1B5IA 3TQLA 3KN3A 2Z23A 3N94A 4JSDA 3WAEA 2F78A 5H8NB 1FTOA 4YB6A 2H9BA 1N7WA 3IB2A 5ICTA 1QKAA 5I57A 1LSTA 3T96B 1B58A 4F2OA 3VLVA 4ZEIA 3QXMA 4GL0A 4U21A 1SQYA 4R72A 1GVCA 1IXIA 5HM4B 1B3LA 3RUMA 3QUFA 3CVGA 3FATA 4KR5A 4OFOA 1QVSA 2F7CA 3LR1A 1B3HA 3K4UA 2YJPA 3UORA 3B6WA 3TZAA 1NNTA 4OQOA 2ZNTA 3ZS6A 4QFKA 3M3KA 1XC1A 3O29A 3O2AA 2P2AA 4QHQA 3FZVA 3EPEA 3IORA 4N07A 4FIMA 3N5LA 2P0SA 5FHNA 4E0WA 1FQAA 4LP2B 1F9BA 1B51A 1B05A 5KCJB 3RN8A 3M8UA 1USYH 3MP1A 4GQOA 4G8NA 4U4XA 1ELJA 2Z22A 4OENA 4XIGQ 2I6EA 3C36A 1J1NA 4GD5A 2F34A 1P1QA 4BDMA 3KG2A 4F29A 2UVIA 5DVJA 3K6XA 2QS2A 3AXFA 5EHMA 3CFXA 5ITOA 1GGGA 3PPQA 2R6GE 1B3FA 2G93A 2DOJA 1B5HA 4Q8RA 1SBPA 5LOMA 3FASA 4G4PA 4DCXA 3I5OA 4F3PA 5CI5A 1ZMGA 5AA2A 3HSTA 3QIMA 4WEDA 3MVWA 3TAJA 2F8DA 4POWA 4KFQA 5I59A 2D3IA 1A54A 4JWYA 3W9VA 4ZE8A 1EU8A 4YZZA 1MM7A 1R6ZA 1EZPA 3KJTA 5H8FB 3Q27A 3O97A 4OERA 4OYVA 2XXVA 1P99A 1HSJA 2B65A 4G8MA 4HW8A 3EF7A 4NTLA 3W9WA 3FV1A 4LUBA 3H6TA 3F11A 3RT8A 3U94A 1URGA 4F1UA 1PBPA 2VGQA 4GVOA 2REJA 4C0RA 1B9JA 2B3BA 4PFYA 1YCJA 2OK2A 3FGSA 5ISUA 3CI8A 4GFRA 2H98A 3VE1B 1IEJA 1YAEA 1EZOA 2O69A 2I48A 1H3DA 1FTJA 3TTLA 3LSWA 1UTHB 2QMWA 4H65A 5TPAA 1ZIUA 3IOWA 1R9QA 2E1SA 1I69A 1O7TA 1JVYA 1N04A 3ZKLA 2Z8DA 3MW0A 5I58B 4ZEFA 3P7IA 3TMGA 4GOTA 3FD3A 2V84A 3G3IA 5CMMA 5IAIA 4O3AA 1LGBC 3K0VA 1NMUA 5DEXB 1R9LA 3FXQA 2GFEA 3L6GA 4KI0E 1AIVA 5K2XA 1FTLA 2DSFA 3FVOA 1MXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1O A;  2XXY A;  4EDP A;  3ODB A;  1IXC A;  4ISU A;  3T93 B;  1B3G A;  4NF4 A;  4WEP A;  3SEX A;  3ILT B;  1ZBM A;  5I56 A;  4U1O A;  5ELV A;  1L5T A;  4ZEK A;  1SVX B;  2ESN A;  3HHF A;  2HZL A;  1B0L A;  4TLM B;  1Q35 A;  1VE4 A;  1POT A;  2DE2 A;  4WKM A;  1M5F A;  3O6H A;  1IUD A;  4MBP A;  3MVX A;  5H8Q B;  1LFI A;  1ATG A;  3OEM A;  3MBP A;  2ANJ A;  3PD8 A;  3WAF A;  1A99 A;  3MJN A;  4ELR A;  4LON B;  1LAG E;  4DCY A;  3HO7 A;  1JEV A;  4JB7 A;  4PFU A;  3IL1 B;  3L6H A;  5L9S A;  3DEL B;  2O51 A;  2HFB A;  1YTV A;  5B7D A;  3K1N A;  4OXV A;  1QUJ A;  1JET A;  4JWO A;  1CB6 A;  4Z0I A;  3OEK A;  2VD2 A;  4OWD A;  1BLF A;  3VDF A;  1LCF A;  2ONS A;  5I57 B;  5L9O A;  1B1X A;  1LB8 A;  4IO2 A;  3PPO A;  3FXU A;  3HV1 A;  1LB9 A;  3SKP A;  1B40 A;  3BBR A;  3MUQ A;  2GRV A;  1MY0 A;  3K2D A;  5FHO A;  3RTW B;  4AB5 A;  3H6W A;  2IEE A;  5CBR A;  3QAX A;  3B6T A;  2M8C A;  3JV9 A;  4RPN A;  1OVB A;  3KBR A;  1SW1 A;  3KEI A;  3Q25 A;  1B7H A;  4BDL A;  1SD3 A;  4Z7E A;  3C4M A;  3N6T A;  3BFT A;  3A3C A;  5B70 A;  1OQG A;  2QMX A;  2ZNS A;  3A09 A;  2QS3 A;  1JEU A;  3MQ9 A;  3C9H A;  1GR2 A;  3PUV E;  1XVY A;  4NF5 A;  1VR5 A;  3H3G A;  1MY2 A;  1LAX A;  4LZ5 A;  1BKA A;  4I62 A;  1NKX A;  2DWA A;  3H7M A;  5JEI A;  4LZ8 A;  5BUU A;  3FV2 A;  3PU5 A;  4X48 A;  1WVJ A;  4R74 A;  2O7U A;  3IOT A;  4KYS A;  4F1V A;  1ZTY A;  2G29 A;  3PPR A;  4ZEC A;  4KYD A;  3S2V A;  1Y3N A;  1LFH A;  2I3V A;  5DVF A;  2I4B A;  1IQ7 A;  2XXT A;  1XS5 A;  3PUY E;  3V83 A;  2PT2 A;  3KSX A;  4JDF A;  2O1L A;  3M3L A;  5AA2 B;  2O6A A;  1KWH A;  3E3K A;  4F18 A;  5CRY A;  5I59 B;  1H43 A;  4R6H A;  5JK4 A;  4NE4 A;  3DP8 A;  1GTK A;  2HCA A;  3IAZ A;  4O3B A;  4KCD A;  3QSL A;  4N13 A;  1UTB A;  3S9N C;  1D9Y A;  2ALU A;  1O64 A;  5M2V A;  4DLD A;  2Q2C A;  2QRY A;  3OEN A;  1TXF A;  5J1D A;  1LAH E;  2PX1 A;  1TT1 A;  2PVU A;  3K1M A;  3BKI B;  3OO6 A;  4XXU A;  3UP9 A;  3PD9 A;  2RF1 A;  5I84 A;  1NNK A;  1LLS A;  2PT1 A;  2X7Q A;  1MXU A;  1N7X A;  1Y3Q A;  1QJM A;  4H6D A;  1MQG A;  3U93 A;  3HN0 A;  1MXW A;  3M3F A;  3V5A A;  3MAM A;  4KD5 A;  4OEV A;  1XVX A;  1CE2 A;  5TPA B;  2THI A;  3LSL A;  4PP0 A;  2UYE A;  4NWD A;  3QYT A;  3G3H A;  3KGC A;  3O28 A;  3PMV A;  2ONR A;  4NF8 A;  1N0T A;  2DYX A;  2OBG A;  3BFU A;  1MDQ A;  3SES A;  4KCC A;  2Q8J A;  2OWT A;  4RY1 A;  3H6V A;  4YMA A;  3TEL A;  4U22 A;  1A7L A;  2KLF A;  2XXR A;  4G2Z A;  1FQD A;  1PB7 A;  3CSB A;  2OWS A;  3IK6 B;  3B6Q A;  4G8H A;  2NOO A;  5A5X A;  3Q29 A;  5DT6 A;  3HPI A;  4YMB A;  3KN8 A;  2O1M A;  1IIT A;  4U4S A;  3SEU A;  4G68 A;  4ESX A;  3K6U A;  4ELQ A;  3QUJ A;  1EH3 A;  2ZMB A;  4EUO A;  4F1Y A;  4NF4 B;  3T22 A;  2CZL A;  1B2H A;  3PPN A;  1S9T A;  2XHD A;  4PFT A;  1H76 A;  1LCT A;  2XX7 A;  2ZXT A;  4I9D A;  4FJP A;  5I56 B;  2E0S A;  2HEU A;  3SET A;  3VLW A;  5I2N A;  3V8X B;  4DXC A;  3OEL A;  1QW0 A;  4EQ9 A;  3H03 A;  4P0I A;  2V25 A;  3OO9 A;  3IOV A;  2Y7K A;  2Q89 A;  3UK4 A;  5KDT A;  3G7W A;  3MP6 A;  4RK9 A;  1SI0 A;  3EN3 A;  4XKQ A;  3KN7 A;  4YKJ A;  3DM0 A;  1MPD A;  4OFL A;  3RY3 A;  3U1O A;  1VSO A;  3IX1 A;  1B46 A;  3ECR A;  3IJX B;  3OD7 A;  2OLB A;  1PBQ A;  4EF2 A;  2P1S A;  1PEB A;  4IB2 A;  1OQH A;  3LSF B;  4YB7 A;  1SW2 A;  4RJZ A;  2UVH A;  3PUX E;  1MRP A;  1QUI A;  2RIN A;  1LBC A;  4FED A;  3TPA A;  5CMB A;  4EQB A;  3OXN A;  4KPT A;  5F1Q A;  2GH9 A;  3PGF A;  3SEV A;  2AIX A;  1I6B A;  2FA7 A;  4BDR A;  1AMF A;  3OSQ A;  2Q88 A;  4I8C A;  1P1U A;  1OIB A;  2F7B A;  4XKP A;  2UVJ A;  1MXZ A;  1MXV A;  2ZYK A;  2AL5 A;  3TYH A;  4F22 A;  3K00 A;  1S7Y A;  5EHS A;  4HS7 A;  2PMS A;  3TCF A;  4IO6 A;  4FE8 A;  1MH4 A;  1A8F A;  2RCA A;  3O66 A;  4X1B A;  3T66 A;  3VFJ A;  2QPQ A;  3IR1 A;  5HBC A;  5FTH A;  3IB0 A;  3FVG A;  3VXC A;  2F7A A;  2XXX A;  4YIC A;  4XTC Q;  1SI1 A;  1XHY A;  2YPN A;  4NF5 B;  3LUY A;  3TTM A;  3HHG A;  4QSE A;  3U92 A;  2HZK A;  3A3U A;  2HXW A;  5CMC A;  1IXH A;  1LFG A;  1DOT A;  2H4I A;  4I1D A;  1M5E A;  4RK2 A;  4Q30 B;  1DPE A;  1D3K A;  1OLA A;  4GIZ A;  3RQT A;  2V3Q A;  4ONY A;  3MVY A;  4OZ9 A;  1WDN A;  2HQ0 A;  2UVG A;  5F7V A;  2OJT A;  3RGY A;  1N76 A;  2DS9 A;  3KJ7 A;  2F35 A;  4LZ7 A;  4KYE A;  4F31 B;  1ANF A;  4RYA A;  4RXL A;  3U72 A;  3D4G A;  1PC3 A;  1A8E A;  3CG1 A;  3IO6 A;  1B7Z A;  4BLA A;  2ZYM A;  1S50 A;  4GRK A;  4F3S A;  1R1N A;  5FTI A;  2GHA A;  2Q9T A;  2I4C A;  3MPK A;  1ZU0 A;  4DDD A;  2RKM A;  3EQ1 A;  1JNF A;  4POX A;  5I2K A;  4E0X A;  4HTG A;  3KOT A;  4BDQ A;  4LQ2 A;  3ONM A;  5ITP A;  1Q1K A;  1B1H A;  2OCU A;  1B52 A;  4H8I A;  1NNF A;  1UTB B;  4JWX A;  1TWY A;  2DE3 A;  4ECF A;  1JW1 A;  5FHM A;  1PB8 A;  3G3K A;  1MY4 A;  4HCY A;  3O6G A;  2XXP A;  1UIU A;  2Y7R A;  3RLF E;  5AA3 A;  4GLI A;  3C34 A;  3K6W A;  4F2Q A;  2DVZ A;  3OSR A;  1SDX A;  2R71 A;  5I58 A;  4X1D A;  2O7I A;  4U2R A;  3UIF A;  3S9M C;  1MG1 A;  1FCK A;  2AYS A;  5EYF A;  3FIR A;  4KQP A;  3T9H B;  3RT6 B;  3OOA A;  1IZ1 A;  5L9M A;  2UYF A;  3W15 C;  1B4H A;  1AL3 A;  3R26 A;  4ZZE A;  3D4C A;  1RYO A;  4NMY A;  1A55 A;  4IGT A;  3MPL A;  3KOS A;  3LC8 A;  5JTY A;  1BP5 A;  4GXS B;  3B7D A;  4OHN A;  4ND9 A;  4NF8 B;  4ESW A;  5K2Y A;  3FJM A;  1US5 A;  3E9X A;  1NH7 A;  2BJJ X;  2RC7 A;  4TOZ A;  4QSC A;  4EQ7 A;  3C31 A;  1DPP A;  2VHA A;  3LBS A;  3DP6 A;  2F5X A;  4HCW A;  3G3J A;  2Q2A A;  1B6H A;  2A5T A;  1OLC A;  4L17 A;  1H45 A;  4OET A;  1XOC A;  3JYR A;  4DE8 A;  5A5X B;  3MC2 A;  2FYI A;  1LAF E;  3CIJ A;  2WKY A;  4NED A;  5AA2 D;  4IO5 A;  4KHZ E;  4G68 B;  3MWB A;  3SER A;  1MQH A;  4M1V A;  4TLL B;  4U1Z A;  3UN6 A;  3VXB A;  1QKB A;  1ZLQ A;  3VVE A;  1Y1Z A;  3S9L C;  4OVJ A;  3FXR A;  2ZYN A;  4FEB A;  4YB5 A;  5I2N B;  4IY5 A;  4OTE A;  1FQE A;  1M5B A;  1PDA A;  3TEP A;  1JW4 A;  4ZZA A;  3I3V A;  4GL8 A;  1MQD A;  3EHS A;  4QRZ A;  3GXA A;  3N6U A;  3IOU A;  1GV8 A;  2NWJ A;  1AH5 A;  3K02 A;  3S4U A;  5KDT B;  1Y20 A;  1VFE A;  3TKD A;  5ICQ A;  3TUS A;  2QL3 A;  1FTK A;  3H06 B;  5AE4 A;  2XXH A;  3N26 A;  3TCG A;  3C35 A;  4YU0 A;  1B7U A;  5CC2 A;  3MZB A;  2DP8 A;  3ILU B;  1OVT A;  1MS7 A;  4FAJ A;  3IJO B;  1IXG A;  2F6G A;  4MH5 A;  5TU0 A;  5BWJ A;  1JQF A;  1MY1 A;  4FAT A;  1JW5 A;  5AA4 A;  3I6V A;  1NNP A;  3KZG A;  3C33 A;  4ELO A;  4NF6 A;  3UA8 A;  1QUL A;  1RKM A;  2HAV A;  1FQB A;  2GHB A;  2XX8 A;  1Y4T A;  1ZJL A;  3MP8 A;  4GF8 A;  3FVK A;  1POY 1;  4G68 C;  2AL4 A;  1Y9U A;  4QFN A;  3IO4 A;  3RTF B;  2W7Y A;  1B0H A;  4RPO A;  3THI A;  4XKN A;  4H5F A;  4LA9 A;  3G3G A;  4MLV A;  1D9V A;  1ZKB A;  4BDO A;  3FJ7 A;  3V89 B;  3GBA A;  2RC9 A;  4EXK A;  1DSN A;  1DTZ A;  1UQW A;  4IO3 A;  1US4 A;  3Q28 A;  1N84 A;  3K01 A;  1DMB A;  1LBB A;  2CMO A;  4R2B A;  4ZE9 A;  3H4Z A;  3U8Q A;  1SYH A;  3FVN A;  4C1U A;  5TP9 A;  1O63 A;  4TQU Q;  1N3X A;  1USY E;  3C32 A;  4YKI A;  2X26 A;  3E13 X;  1PB9 A;  3GBB A;  3TTN A;  2REG A;  3T9X B;  5H8H A;  3MVZ A;  4EF1 A;  2DE4 A;  2DQV A;  4IO7 A;  4NWC A;  4H67 A;  4AB6 A;  4DXB A;  4YKK A;  5H8N A;  4H1X A;  1TFA A;  1HSL A;  2RC8 A;  3O9P A;  1XT8 A;  2X7P A;  1RYX A;  3CRB A;  3R6U A;  4PQJ A;  3DP4 A;  2QJE A;  2VP1 A;  5DYH A;  3PUW E;  3GLB A;  4RA1 A;  5I2K B;  2DXY A;  4H0W A;  2DVC A;  4QF9 A;  3Q26 A;  4P0G A;  1Y1M A;  2F6P A;  4WXJ A;  2UXA A;  4MF3 A;  2FNC A;  3GZG A;  1Z7M E;  1I6Q A;  2V3U A;  2HAU A;  4R2F A;  3CSG A;  2XD2 A;  2DWH A;  1UIV A;  4DZ1 A;  3TDJ A;  4OES A;  5DTB A;  2DWI A;  3IB1 A;  3OMB A;  1I6A A;  1FW0 A;  4MFI A;  4DIG A;  4QFO A;  5CMK A;  1SW4 A;  5KCJ A;  2R9J A;  2IA4 A;  3MZ9 A;  1URD A;  4PET A;  3K6V A;  4UA8 A;  1D4N A;  1MQI A;  3OO8 A;  4U23 A;  4F3B A;  1SYI A;  2A5S A;  1NFT A;  1A40 A;  4Q0C A;  2PYY A;  2YLN A;  2Z8E A;  3USD A;  4LAT A;  4K3F A;  4R75 A;  1FTM A;  5JTY B;  4AQ4 A;  4OMB A;  2NUV A;  5AA1 A;  4P11 A;  1H44 A;  2Y7I A;  3OO7 A;  5KZT A;  4JXI A;  1MPB A;  1M5C A;  3TTR A;  1Y4C A;  4XKR A;  3FJG A;  3CFZ A;  5HPQ A;  3LSX A;  2XXI A;  2A5T B;  1NL5 A;  4QFL A;  3PMW A;  3QK6 A;  1B3E A;  1T0K A;  3VV5 A;  4MLQ A;  2I3W A;  4FEC A;  2V3T A;  4Q5T A;  3VLU A;  3CR9 A;  5H8F A;  5DVI A;  3TCH A;  2XD3 A;  2XX9 A;  1B5J A;  4GXA A;  3T9V A;  3E4R A;  3TOD A;  1N3W A;  2QS4 A;  2I0B A;  2Y7W A;  2NVU B;  3EHT A;  1MDP 1;  3TQW A;  2I58 A;  3FUZ A;  1DTG A;  1P1W A;  1YPN A;  5CM6 A;  1MPC A;  3MZ1 A;  2B3F A;  4ELP A;  2Y7P A;  1P1N A;  2ZYO A;  4UAC A;  3PMX A;  4THI A;  4ZED A;  1VFD A;  4M4G A;  3ZKK A;  1BTJ A;  4R6K A;  2D21 A;  3PV0 E;  4IY6 A;  2VD3 A;  2PBW A;  3G3F A;  5CBS A;  3DLN A;  4LVQ A;  4FOR A;  2LAO A;  3T9U A;  1UTH A;  2H5Y A;  4GWO A;  2H25 A;  2ONK E;  1MQJ A;  4O3C A;  4F39 A;  1Z7N E;  4OFJ A;  3H6U A;  4PFW A;  3CG3 A;  4C1T A;  4PE5 B;  3PPP A;  4R6Y A;  4BDN A;  3ZSF A;  4ZS9 A;  5L8D A;  3O6I A;  4IGR A;  4R73 A;  3KSJ A;  3VVF A;  2D5W A;  3EHU A;  2H99 A;  4YKP A;  4R9F A;  5AA4 B;  1MY3 A;  4QFP A;  4YAH X;  5DEX A;  1Y3P A;  3UGW A;  2QSX A;  2NXO A;  2VOZ A;  4G77 A;  1BIY A;  4NF6 B;  3K1P A;  2I49 A;  1FQF A;  4JBZ A;  3CFL A;  1QUK A;  1B32 A;  3JZJ A;  3KFM A;  1B4Z A;  4QSD A;  4R9G A;  1TFD A;  5H8S A;  3SDF A;  3S9E A;  4JSO A;  2O84 X;  1II5 A;  1WOD A;  2I0C A;  1IIW A;  2XXU A;  4F3G A;  1URS A;  4RNS A;  4DXU A;  5IKB A;  1OMP A;  4LQ5 A;  2ZNU A;  1EZ9 A;  4H5G A;  2Z8F A;  2F97 A;  1AOV A;  3TFL A;  1NH8 A;  2OZZ A;  3SEW A;  4ZEB A;  2DWJ A;  2DXR A;  2RCB A;  1MH3 A;  3PUZ E;  1M5D A;  3TTK A;  3RNN A;  4X9T A;  2ABH A;  2V93 A;  2F36 A;  3R7X A;  1SW5 A;  4IO4 A;  5H8Q A;  3VVD A;  1HSE A;  4OEU A;  4ZDM A;  1FQC A;  2Y84 A;  2O68 A;  2XXW A;  5TP9 B;  1MXY A;  4N6P A;  2QS1 A;  3SEY A;  2XXQ A;  1MM6 A;  4F19 A;  3HCQ A;  4EXL A;  4H8J A;  1JVX A;  3RPW A;  5H8H B;  1B5I A;  3TQL A;  3KN3 A;  2Z23 A;  3N94 A;  4JSD A;  3WAE A;  2F78 A;  5H8N B;  1FTO A;  4YB6 A;  2H9B A;  1N7W A;  3IB2 A;  5ICT A;  1QKA A;  5I57 A;  1LST A;  3T96 B;  1B58 A;  4F2O A;  3VLV A;  4ZEI A;  3QXM A;  4GL0 A;  4U21 A;  1SQY A;  4R72 A;  1GVC A;  1IXI A;  5HM4 B;  1B3L A;  3RUM A;  3QUF A;  3CVG A;  3FAT A;  4KR5 A;  4OFO A;  1QVS A;  2F7C A;  3LR1 A;  1B3H A;  3K4U A;  2YJP A;  3UOR A;  3B6W A;  3TZA A;  1NNT A;  4OQO A;  2ZNT A;  3ZS6 A;  4QFK A;  3M3K A;  1XC1 A;  3O29 A;  3O2A A;  2P2A A;  4QHQ A;  3FZV A;  3EPE A;  3IOR A;  4N07 A;  4FIM A;  3N5L A;  2P0S A;  5FHN A;  4E0W A;  1FQA A;  4LP2 B;  1F9B A;  1B51 A;  1B05 A;  5KCJ B;  3RN8 A;  3M8U A;  1USY H;  3MP1 A;  4GQO A;  4G8N A;  4U4X A;  1ELJ A;  2Z22 A;  4OEN A;  4XIG Q;  2I6E A;  3C36 A;  1J1N A;  4GD5 A;  2F34 A;  1P1Q A;  4BDM A;  3KG2 A;  4F29 A;  2UVI A;  5DVJ A;  3K6X A;  2QS2 A;  3AXF A;  5EHM A;  3CFX A;  5ITO A;  1GGG A;  3PPQ A;  2R6G E;  1B3F A;  2G93 A;  2DOJ A;  1B5H A;  4Q8R A;  1SBP A;  5LOM A;  3FAS A;  4G4P A;  4DCX A;  3I5O A;  4F3P A;  5CI5 A;  1ZMG A;  5AA2 A;  3HST A;  3QIM A;  4WED A;  3MVW A;  3TAJ A;  2F8D A;  4POW A;  4KFQ A;  5I59 A;  2D3I A;  1A54 A;  4JWY A;  3W9V A;  4ZE8 A;  1EU8 A;  4YZZ A;  1MM7 A;  1R6Z A;  1EZP A;  3KJT A;  5H8F B;  3Q27 A;  3O97 A;  4OER A;  4OYV A;  2XXV A;  1P99 A;  1HSJ A;  2B65 A;  4G8M A;  4HW8 A;  3EF7 A;  4NTL A;  3W9W A;  3FV1 A;  4LUB A;  3H6T A;  3F11 A;  3RT8 A;  3U94 A;  1URG A;  4F1U A;  1PBP A;  2VGQ A;  4GVO A;  2REJ A;  4C0R A;  1B9J A;  2B3B A;  4PFY A;  1YCJ A;  2OK2 A;  3FGS A;  5ISU A;  3CI8 A;  4GFR A;  2H98 A;  3VE1 B;  1IEJ A;  1YAE A;  1EZO A;  2O69 A;  2I48 A;  1H3D A;  1FTJ A;  3TTL A;  3LSW A;  1UTH B;  2QMW A;  4H65 A;  5TPA A;  1ZIU A;  3IOW A;  1R9Q A;  2E1S A;  1I69 A;  1O7T A;  1JVY A;  1N04 A;  3ZKL A;  2Z8D A;  3MW0 A;  5I58 B;  4ZEF A;  3P7I A;  3TMG A;  4GOT A;  3FD3 A;  2V84 A;  3G3I A;  5CMM A;  5IAI A;  4O3A A;  1LGB C;  3K0V A;  1NMU A;  5DEX B;  1R9L A;  3FXQ A;  2GFE A;  3L6G A;  4KI0 E;  1AIV A;  5K2X A;  1FTL A;  2DSF A;  3FVO A;  1MXX A; 
#chains in the Genus database with same CATH topology
 1P1O A;  2XXY A;  4EDP A;  1FPL A;  4NN3 A;  3ODB A;  1LBZ A;  1FPD A;  1IXC A;  4ISU A;  3T93 B;  1B3G A;  4NF4 A;  4WEP A;  3SEX A;  4P56 A;  3ILT B;  1ZBM A;  5I56 A;  2P3V A;  4U1O A;  5ELV A;  1L5T A;  4ZEK A;  1SVX B;  2ESN A;  3HHF A;  2BJI A;  2HZL A;  1B0L A;  4TLM B;  1Q35 A;  1VE4 A;  1POT A;  2DE2 A;  4WKM A;  1M5F A;  3O6H A;  1IUD A;  4MBP A;  3MVX A;  5H8Q B;  1LFI A;  1D9Q A;  3BIG A;  1ATG A;  3OEM A;  3MBP A;  2ANJ A;  3PD8 A;  3WAF A;  1A99 A;  3MJN A;  4ELR A;  4LON B;  1LAG E;  4DCY A;  3HO7 A;  1JEV A;  2F3B A;  4JB7 A;  4PFU A;  3IL1 B;  3L6H A;  5L9S A;  3DEL B;  2O51 A;  2HFB A;  4H45 A;  4N15 A;  1YTV A;  1VDW A;  5B7D A;  3K1N A;  4OXV A;  1QUJ A;  1JET A;  2R8T A;  1FJ9 A;  4JWO A;  1CB6 A;  4Z0I A;  3OEK A;  2VD2 A;  4GX3 A;  4OWD A;  1BLF A;  3VDF A;  1LCF A;  2ONS A;  5I57 B;  1NV4 A;  5L9O A;  1FSA A;  4N8Y A;  3RPL B;  1B1X A;  1LB8 A;  4IO2 A;  3PPO A;  3FXU A;  4JVD A;  3HV1 A;  4I40 A;  1LB9 A;  3SKP A;  1B40 A;  3KBZ A;  3BBR A;  3MUQ A;  2WYK A;  4PDH A;  2GRV A;  1MY0 A;  3K2D A;  4MHF A;  5FHO A;  3RTW B;  4AB5 A;  3H6W A;  2IEE A;  5CBR A;  1DCU A;  3QAX A;  3B6T A;  2M8C A;  3JV9 A;  4RPN A;  1OVB A;  3KBR A;  1SW1 A;  3KEI A;  3Q25 A;  5EQ7 A;  1B7H A;  4BDL A;  1SD3 A;  4Z7E A;  3C4M A;  3N6T A;  3BFT A;  3A3C A;  5B70 A;  1OQG A;  2QMX A;  2ZNS A;  3A09 A;  2QS3 A;  1JEU A;  3MQ9 A;  3C9H A;  1GR2 A;  3PUV E;  1XVY A;  4NF5 A;  4MAG A;  1VR5 A;  3H3G A;  1NV3 A;  1MY2 A;  1LAX A;  4LZ5 A;  1BKA A;  4I62 A;  1NKX A;  2DWA A;  3H7M A;  5JEI A;  4LZ8 A;  1FBH A;  5BUU A;  3FV2 A;  3PU5 A;  4X48 A;  1WVJ A;  4R74 A;  2O7U A;  3IOT A;  4KYS A;  4GBW A;  4F1V A;  1ZTY A;  2G29 A;  2XXK A;  3PPR A;  4XEQ A;  4ZEC A;  1YZ0 A;  4KYD A;  4P3L A;  3S2V A;  1EYK A;  1Y3N A;  1LBX A;  1LFH A;  2I3V A;  5DVF A;  2I4B A;  1IQ7 A;  2XXT A;  1XS5 A;  3PUY E;  3V83 A;  2PT2 A;  3KSX A;  4JDF A;  2O1L A;  3B8B A;  3M3L A;  5AA2 B;  1FPI A;  1KA0 A;  2O6A A;  1KWH A;  3E3K A;  4F18 A;  2WBB A;  5CRY A;  5I59 B;  1H43 A;  4R6H A;  5JK4 A;  1SPI A;  4NE4 A;  3DP8 A;  5EQ9 A;  1GTK A;  2HCA A;  3IAZ A;  4O3B A;  4KCD A;  3QSL A;  5ET5 A;  4N13 A;  1UTB A;  3S9N C;  1D9Y A;  4I3E A;  2ALU A;  4PGN A;  1O64 A;  5M2V A;  4DLD A;  2Q2C A;  2QRY A;  3OEN A;  1TXF A;  5J1D A;  1LAH E;  2PX1 A;  1TT1 A;  2PVU A;  3K1M A;  3BKI B;  3OO6 A;  4XXU A;  4PC9 A;  3UP9 A;  3PD9 A;  2RF1 A;  5I84 A;  1NNK A;  1LLS A;  2PT1 A;  2V4C A;  2X7Q A;  1MXU A;  2XWI A;  1N7X A;  1Y3Q A;  1QJM A;  4H6D A;  1MQG A;  3U93 A;  5A5L A;  3HN0 A;  4DI3 D;  1MXW A;  3M3F A;  3V5A A;  3MAM A;  4PF8 A;  4KD5 A;  4OEV A;  4HE1 A;  1XVX A;  2WYP A;  3QMF A;  1CE2 A;  5TPA B;  4AS5 A;  2THI A;  3LSL A;  1IMF A;  4PP0 A;  2UYE A;  4NWD A;  3QYT A;  4MX6 A;  1NV0 A;  3G3H A;  3KGC A;  3O28 A;  2QFL A;  3PMV A;  2ONR A;  4P1E A;  4NF8 A;  1N0T A;  2DYX A;  2OBG A;  3BFU A;  1MDQ A;  3SES A;  4KCC A;  2Q8J A;  2OWT A;  4RY1 A;  3H6V A;  2CEX A;  4YMA A;  3TEL A;  4U22 A;  1A7L A;  2KLF A;  2XXR A;  4G2Z A;  1FQD A;  1PB7 A;  3CSB A;  2OWS A;  4GX6 A;  3IK6 B;  1G0H A;  3B6Q A;  1KA1 A;  4G8H A;  2NOO A;  5A5X A;  3Q29 A;  5DT6 A;  3HPI A;  4YMB A;  3KN8 A;  5IZ3 B;  1YXI A;  2O1M A;  1IIT A;  4U4S A;  3SEU A;  4G68 A;  4ESX A;  3K6U A;  3KC1 A;  3QUJ A;  4ELQ A;  1EH3 A;  2ZMB A;  4EUO A;  4F1Y A;  4NF4 B;  2HHM A;  3T22 A;  2CZL A;  1B2H A;  3PPN A;  1S9T A;  4PTK A;  2XHD A;  4PFT A;  4I9D A;  1H76 A;  1LCT A;  1LBV A;  2XX7 A;  2ZXT A;  4FJP A;  5I56 B;  2E0S A;  2HEU A;  3SET A;  1NI9 A;  3VLW A;  5I2N A;  3V8X B;  4DXC A;  3OEL A;  1YYZ A;  1QW0 A;  2CZI A;  4EQ9 A;  3H03 A;  4P0I A;  2V25 A;  3OO9 A;  3IOV A;  2QVV A;  2Y7K A;  4PCD A;  2Q89 A;  3UK4 A;  5KDT A;  3G7W A;  3MP6 A;  4RK9 A;  1SI0 A;  4PE3 A;  1FTA A;  3EN3 A;  4XKQ A;  3KN7 A;  4YKJ A;  3DM0 A;  1MPD A;  4OFL A;  3RY3 A;  3U1O A;  1VSO A;  2KQZ A;  1NUY A;  3IX1 A;  1B46 A;  3ECR A;  5IM2 A;  3IJX B;  1RDY A;  3OD7 A;  2OLB A;  4UAB A;  2ZZX A;  1PBQ A;  4EF2 A;  2P1S A;  1PEB A;  1DBZ A;  4IB2 A;  1OQH A;  3LSF B;  4HE2 A;  4YB7 A;  1SW2 A;  4RJZ A;  2UVH A;  3PUX E;  1MRP A;  1QUI A;  5ESY A;  2RIN A;  3B50 A;  1LBC A;  4FED A;  3TPA A;  5CMB A;  4EQB A;  3OXN A;  4KPT A;  5F1Q A;  2GH9 A;  3PGF A;  3SEV A;  2AIX A;  4NF0 A;  1I6B A;  2FA7 A;  4BDR A;  1AMF A;  3OSQ A;  2Q88 A;  4I8C A;  1P1U A;  1OIB A;  2F7B A;  4XKP A;  2UVJ A;  1MXZ A;  2PCR A;  1MXV A;  2ZYK A;  2AL5 A;  4NHB A;  2OWZ A;  3TYH A;  4F22 A;  3K00 A;  1S7Y A;  5EHS A;  4HS7 A;  2PMS A;  3TCF A;  4IO6 A;  4FE8 A;  1MH4 A;  1A8F A;  2RCA A;  3O66 A;  2F3D A;  4X1B A;  3T66 A;  3VFJ A;  2QPQ A;  5FBP A;  3IR1 A;  5HBC A;  5FTH A;  3IB0 A;  3FVG A;  5ET6 A;  3VXC A;  2F7A A;  2XXX A;  5ET8 A;  4YIC A;  4XTC Q;  5T3J A;  1SI1 A;  1XHY A;  2YPN A;  5F24 A;  4NF5 B;  3LUY A;  3TTM A;  1FPF A;  3HHG A;  4QSE A;  3U92 A;  2HZK A;  3A3U A;  3ROJ A;  3E79 A;  2HXW A;  5CMC A;  4PGP A;  1IXH A;  1LFG A;  1DOT A;  2H4I A;  4I1D A;  1M5E A;  4RK2 A;  4Q30 B;  3ISP A;  1DPE A;  4NX1 A;  1D3K A;  1OLA A;  4GIZ A;  3RQT A;  2V3Q A;  4ONY A;  3MVY A;  4OZ9 A;  4AS4 A;  1WDN A;  2HQ0 A;  2WEF A;  5LDZ A;  2UVG A;  5F7V A;  5ET7 A;  2OJT A;  3RGY A;  1N76 A;  2DS9 A;  3KJ7 A;  2F35 A;  4LZ7 A;  4KYE A;  4F31 B;  1ANF A;  1K9Z A;  4RYA A;  4RXL A;  3U72 A;  3D4G A;  1PC3 A;  4GX4 A;  1A8E A;  1IMB A;  3CG1 A;  3IO6 A;  1B7Z A;  4BLA A;  2ZYM A;  4PDD A;  1S50 A;  4GRK A;  4DI4 B;  4F3S A;  4PFI A;  1R1N A;  5FTI A;  2GHA A;  2Q9T A;  2I4C A;  3MPK A;  1ZU0 A;  4DDD A;  2RKM A;  3EQ1 A;  4XFE A;  4MMP A;  1JNF A;  4POX A;  5I2K A;  1XI6 A;  4MCO A;  4E0X A;  4HTG A;  3KOT A;  4P8B A;  4MNP A;  4BDQ A;  4PAF A;  4LQ2 A;  3ONM A;  5ITP A;  1Q1K A;  3U65 A;  1B1H A;  2OCU A;  1B52 A;  4H8I A;  2CZK A;  1NNF A;  1UTB B;  4JWX A;  1TWY A;  2DE3 A;  4ECF A;  1JW1 A;  5FHM A;  1PB8 A;  4QBA A;  3G3K A;  1MY4 A;  3T0J A;  4HCY A;  3O6G A;  2XXP A;  1UIU A;  2Y7R A;  3RLF E;  5AA3 A;  4GLI A;  5DW8 A;  3C34 A;  3K6W A;  4MNI A;  4F2Q A;  2DVZ A;  3OSR A;  1SDX A;  2R71 A;  5I58 A;  4X1D A;  2O7I A;  2L5V A;  4U2R A;  3UIF A;  3S9M C;  1MG1 A;  1FCK A;  2AYS A;  5EYF A;  1FPG A;  3FIR A;  4KQP A;  1FBP A;  3T9H B;  3RT6 B;  3OOA A;  2FHY A;  1FPK A;  1IZ1 A;  5L9M A;  2UYF A;  4N6K A;  3W15 C;  1B4H A;  1AL3 A;  3R26 A;  4ZZE A;  3D4C A;  1RYO A;  4NMY A;  1A55 A;  4IGT A;  3MPL A;  3KOS A;  3LC8 A;  5JTY A;  1BP5 A;  4GXS B;  3B7D A;  4OHN A;  4ND9 A;  4NF8 B;  4ESW A;  5K2Y A;  3FJM A;  1US5 A;  3E9X A;  1NH7 A;  2BJJ X;  4NGU A;  2RC7 A;  4GWU A;  4TOZ A;  4QSC A;  4EQ7 A;  3IFA A;  3C31 A;  1DPP A;  2VHA A;  3LBS A;  4OVT A;  3DP6 A;  1FPE A;  2F5X A;  2HPG A;  4HCW A;  2GQ1 A;  3G3J A;  2Q2A A;  1B6H A;  2A5T A;  1OLC A;  4L17 A;  1H45 A;  4OET A;  1XOC A;  3JYR A;  4DE8 A;  5A5X B;  3MC2 A;  2FYI A;  1LAF E;  3CIJ A;  2WKY A;  4NED A;  5AA2 D;  4IO5 A;  3A29 A;  4KHZ E;  4G68 B;  3MWB A;  3SER A;  1MQH A;  4M1V A;  2OX3 A;  4TLL B;  4O8M A;  4U1Z A;  3UN6 A;  3VXB A;  1QKB A;  1ZLQ A;  3VVE A;  1Y1Z A;  3S9L C;  4OVJ A;  3FXR A;  2ZYN A;  4FEB A;  1NUX A;  4YB5 A;  5I2N B;  4IY5 A;  4JVI A;  4OTE A;  1FQE A;  1M5B A;  1PDA A;  3TEP A;  1JW4 A;  4ZZA A;  3I3V A;  4GL8 A;  1MQD A;  3EHS A;  4QRZ A;  5J16 A;  3GXA A;  3N6U A;  3IOU A;  1GV8 A;  2NWJ A;  1IMA A;  1AH5 A;  3K02 A;  3S4U A;  5KDT B;  1Y20 A;  1VFE A;  3TKD A;  5ICQ A;  3TUS A;  2QL3 A;  1FTK A;  3H06 B;  5AE4 A;  2XXH A;  3N26 A;  3TCG A;  3C35 A;  4YU0 A;  3RPL A;  1B7U A;  3LUZ A;  5CC2 A;  3MZB A;  2DP8 A;  3ILU B;  1OVT A;  4X8R A;  1MS7 A;  4FAJ A;  3IJO B;  1IXG A;  2F6G A;  4MH5 A;  5TU0 A;  3E78 A;  4O7M A;  5BWJ A;  3SZP A;  1JQF A;  4MNC A;  1MY1 A;  4FAT A;  1JW5 A;  5AA4 A;  3I6V A;  2WBD A;  2KR0 A;  1NNP A;  3KZG A;  3C33 A;  4ELO A;  2DDK A;  1LEV A;  4NF6 A;  3UA8 A;  1QUL A;  1RKM A;  2MKZ A;  3HFU A;  2HAV A;  1FQB A;  4MEV A;  2GHB A;  2XX8 A;  1Y4T A;  1ZJL A;  3MP8 A;  4GF8 A;  3FVK A;  1POY 1;  4G68 C;  2AL4 A;  1Y9U A;  4QFN A;  3IO4 A;  2QVR A;  3RTF B;  2W7Y A;  1B0H A;  4RPO A;  3THI A;  4XKN A;  4N81 A;  4H5F A;  4LA9 A;  3G3G A;  2Y5K A;  4MLV A;  2XWV A;  1D9V A;  1ZKB A;  4BDO A;  3FJ7 A;  3V89 B;  3GBA A;  2RC9 A;  4OA4 A;  2FIE A;  4EXK A;  1DSN A;  1DTZ A;  1UQW A;  4IO3 A;  1US4 A;  3Q28 A;  1N84 A;  5IGA A;  2FVZ A;  3K01 A;  1DMB A;  1LBB A;  2CMO A;  4OVP A;  5IZ1 A;  4R2B A;  4ZE9 A;  3H4Z A;  3U8Q A;  1SYH A;  3FVN A;  4C1U A;  1NV7 A;  5TP9 A;  1QGX A;  1O63 A;  4TQU Q;  1N3X A;  1USY E;  3C32 A;  4YKI A;  1RDX A;  2X26 A;  4HXV A;  3KC0 A;  3E13 X;  1PB9 A;  3GBB A;  4GWY A;  3TTN A;  2REG A;  3T9X B;  5H8H A;  3MVZ A;  4EF1 A;  2DE4 A;  2DQV A;  4IO7 A;  4NWC A;  4H67 A;  4AB6 A;  4DXB A;  4YKK A;  2CZH A;  5H8N A;  4N6D A;  4H1X A;  1TFA A;  1HSL A;  2JJK A;  4PAK A;  2RC8 A;  3O9P A;  1XT8 A;  2X7P A;  1RYX A;  3CRB A;  3R6U A;  4PQJ A;  3DP4 A;  2QJE A;  2VP1 A;  1DK4 A;  5DYH A;  3PUW E;  3GLB A;  4RA1 A;  5I2K B;  2DXY A;  4H0W A;  2DVC A;  4QF9 A;  3Q26 A;  4P0G A;  1NV6 A;  1Y1M A;  2F6P A;  4WXJ A;  2UXA A;  3RYD A;  4MF3 A;  2FNC A;  3GZG A;  1Z7M E;  2ZZW A;  3T1B A;  1I6Q A;  2V3U A;  2HAU A;  4R2F A;  3CSG A;  2XD2 A;  2P3N A;  2DWH A;  1NUW A;  1FRP A;  1UIV A;  4DZ1 A;  4GWX A;  1JP4 A;  3TDJ A;  4OES A;  5DTB A;  2DWI A;  3IB1 A;  3OMB A;  1I6A A;  1FW0 A;  4MFI A;  4DIG A;  4QFO A;  5CMK A;  1SW4 A;  5KCJ A;  2R9J A;  2IA4 A;  3MZ9 A;  1URD A;  4PET A;  4PFB A;  3K6V A;  4UA8 A;  1D4N A;  1MQI A;  3OO8 A;  4MIJ A;  4U23 A;  4F3B A;  1SYI A;  2A5S A;  1NFT A;  1A40 A;  4Q0C A;  2PYY A;  2YLN A;  2Z8E A;  3USD A;  4LAT A;  4K3F A;  4R75 A;  1FTM A;  5JTY B;  4AQ4 A;  4OMB A;  2NUV A;  5AA1 A;  2HXR A;  4N4U A;  4X04 A;  4P11 A;  1H44 A;  2Y7I A;  1FPB A;  3OO7 A;  4QXD A;  3PTY A;  5KZT A;  4JXI A;  1MPB A;  1AWB A;  1M5C A;  3TTR A;  1Y4C A;  4XKR A;  3FJG A;  3MST A;  3CFZ A;  5HPQ A;  3LSX A;  2XXI A;  1FBF A;  4HE0 A;  4NG7 A;  2A5T B;  1NL5 A;  4QFL A;  3PMW A;  3QK6 A;  1B3E A;  1T0K A;  3VV5 A;  4MLQ A;  2ZZV A;  2I3W A;  4FEC A;  2V3T A;  4Q5T A;  3VLU A;  3CR9 A;  5H8F A;  1CNQ A;  2FBP A;  5DVI A;  3TCH A;  2XD3 A;  2XX9 A;  1B5J A;  4GXA A;  3T9V A;  3E4R A;  3TOD A;  1N3W A;  2QS4 A;  2I0B A;  2Y7W A;  2NVU B;  3EHT A;  1MDP 1;  3TQW A;  2I58 A;  3EKI A;  3FUZ A;  1DTG A;  1P1W A;  1YPN A;  4P47 A;  5CM6 A;  1IMD A;  1MPC A;  3MZ1 A;  4PF6 A;  2B3F A;  4ELP A;  4PBQ A;  2Y7P A;  1P1N A;  3D1R A;  2ZYO A;  4O94 A;  4UAC A;  3PMX A;  4THI A;  4ZED A;  1VFD A;  4M4G A;  3ZKK A;  1BTJ A;  4R6K A;  2D21 A;  3PV0 E;  4IY6 A;  4N8G A;  2VD3 A;  2PBW A;  4MJO A;  3G3F A;  5CBS A;  2B4L A;  3DLN A;  2XA5 A;  5EQA A;  4LVQ A;  4FOR A;  2LAO A;  3T9U A;  1UTH A;  2H5Y A;  1RDZ A;  4GWO A;  2H25 A;  4H46 A;  2ONK E;  1MQJ A;  4O3C A;  4F39 A;  1Z7N E;  5IZZ A;  4OFJ A;  3H6U A;  4PFW A;  3CG3 A;  4C1T A;  4PE5 B;  3PPP A;  4R6Y A;  4BDN A;  3ZSF A;  3NOH A;  4ZS9 A;  5L8D A;  3O6I A;  4IGR A;  4R73 A;  3KSJ A;  3VVF A;  2D5W A;  2VT5 A;  4O7I A;  3EHU A;  2H99 A;  4YKP A;  2Q74 A;  4R9F A;  5AA4 B;  1MY3 A;  4QFP A;  4YAH X;  5DEX A;  1Y3P A;  3UGW A;  4PFR A;  2QSX A;  2NXO A;  4JVC A;  2VOZ A;  4G77 A;  1BIY A;  4NF6 B;  2Q8M A;  3K1P A;  2I49 A;  1FQF A;  4JBZ A;  3CFL A;  1QUK A;  1B32 A;  4P1L A;  3JZJ A;  3KFM A;  1B4Z A;  4QSD A;  4R9G A;  1TFD A;  5H8S A;  3SDF A;  3S9E A;  4JSO A;  2O84 X;  1II5 A;  1WOD A;  2I0C A;  1IIW A;  2XXU A;  4F3G A;  1FJ6 A;  1URS A;  4RNS A;  4DXU A;  5IKB A;  1OMP A;  4LQ5 A;  2XWO A;  2ZNU A;  2QVU A;  1EZ9 A;  4H5G A;  2Z8F A;  2F97 A;  1AOV A;  3TFL A;  1NH8 A;  2OZZ A;  3SEW A;  4ZEB A;  4KXP A;  2DWJ A;  2DXR A;  5LTC A;  2RCB A;  1KZ8 A;  1MH3 A;  1IMC A;  1INP A;  3PUZ E;  1M5D A;  3TTK A;  2XWK A;  2Y5L A;  3RNN A;  4X9T A;  2ABH A;  2V93 A;  2F36 A;  3R7X A;  1SW5 A;  4IO4 A;  5H8Q A;  3VVD A;  1HSE A;  4OEU A;  5EQ8 A;  4ZDM A;  1FQC A;  2Y84 A;  2O68 A;  2XXW A;  5TP9 B;  1MXY A;  4N6P A;  4PAI A;  2QS1 A;  3SEY A;  1EYI A;  2XXQ A;  4FBP A;  1MM6 A;  4F19 A;  3HCQ A;  3LV0 A;  4EXL A;  4GWS A;  4H8J A;  1JVX A;  4I3Y A;  3RPW A;  5H8H B;  1B5I A;  3TQL A;  4NQ8 A;  3KN3 A;  2Z23 A;  3N94 A;  4JSD A;  3WAE A;  2F78 A;  5H8N B;  1FTO A;  4YB6 A;  2H9B A;  1N7W A;  3IB2 A;  5ICT A;  1QKA A;  5I57 A;  1LST A;  1NUZ A;  3T96 B;  1B58 A;  4F2O A;  3VLV A;  4ZEI A;  3QXM A;  4GL0 A;  4U21 A;  1SQY A;  4OVR A;  4R72 A;  1GVC A;  1IXI A;  1FBC A;  1NV5 A;  5HM4 B;  1B3L A;  3RUM A;  1NV2 A;  3QUF A;  3CVG A;  3FAT A;  4KR5 A;  4OFO A;  1QVS A;  2F7C A;  3LR1 A;  1B3H A;  3K4U A;  2YJP A;  3UOR A;  3B6W A;  3TZA A;  1NNT A;  5EYG A;  4OQO A;  2ZNT A;  3ZS6 A;  4QFK A;  3M3K A;  1XC1 A;  3O29 A;  3O2A A;  2P2A A;  4QHQ A;  3FZV A;  3EPE A;  3IOR A;  4N07 A;  4FIM A;  3N5L A;  2P0S A;  2WX9 A;  4PBH A;  4XF5 A;  5FHN A;  4E0W A;  1FQA A;  2PFY A;  4LP2 B;  1FBG A;  1F9B A;  1LBY A;  1B51 A;  1B05 A;  3GYY A;  5KCJ B;  4N91 A;  3RN8 A;  3M8U A;  1USY H;  3MP1 A;  4GQO A;  4G8N A;  4U4X A;  1ELJ A;  2VPN A;  2Z22 A;  4OEN A;  4XIG Q;  2I6E A;  3C36 A;  1J1N A;  4GD5 A;  1Q9D A;  2F34 A;  1P1Q A;  4BDM A;  3KG2 A;  4F29 A;  2CEY A;  2UVI A;  5DVJ A;  3K6X A;  2QS2 A;  3AXF A;  3IFC A;  5EHM A;  3CFX A;  5ITO A;  1GGG A;  3BIH A;  3PPQ A;  2R6G E;  1B3F A;  2G93 A;  2B4M A;  2DOJ A;  1B5H A;  4Q8R A;  4GWW A;  1SBP A;  5LOM A;  3FAS A;  4G4P A;  5IZ3 A;  4DCX A;  3I5O A;  4F3P A;  5CI5 A;  1ZMG A;  5I5P A;  5AA2 A;  3HST A;  3QIM A;  3CHG A;  4WED A;  3MVW A;  3TAJ A;  2F8D A;  4LN5 A;  4GBV A;  4POW A;  4KFQ A;  4OVQ A;  5I59 A;  2D3I A;  1A54 A;  4JWY A;  3W9V A;  4ZE8 A;  1EU8 A;  4YZZ A;  1MM7 A;  1R6Z A;  1EZP A;  3KJT A;  5H8F B;  3Q27 A;  3O97 A;  4N17 A;  4OER A;  4OYV A;  2XXV A;  1P99 A;  1HSJ A;  2B65 A;  4G8M A;  2FIX A;  4HW8 A;  3EF7 A;  4NTL A;  3W9W A;  3FV1 A;  4LUB A;  4OVS A;  3H6T A;  1G0I A;  3FBP A;  3F11 A;  3RT8 A;  3MYU A;  3U94 A;  1FPJ A;  1EYJ A;  1URG A;  4F1U A;  5I3S A;  1PBP A;  1FBE A;  2VGQ A;  4GVO A;  1NV1 A;  2REJ A;  4OAN A;  4C0R A;  1B9J A;  2B3B A;  4PFY A;  1YCJ A;  2OK2 A;  3FGS A;  5ISU A;  5I7I A;  3CI8 A;  4GFR A;  2H98 A;  3VE1 B;  1IEJ A;  1YAE A;  1EZO A;  2O69 A;  2I48 A;  4IR8 A;  1H3D A;  4NAP A;  1FTJ A;  3TTL A;  3LSW A;  1UTH B;  2QMW A;  4H65 A;  5TPA A;  1ZIU A;  3IOW A;  1R9Q A;  2E1S A;  1I69 A;  1O7T A;  1JVY A;  1IME A;  1N04 A;  3ZKL A;  2Z8D A;  3MW0 A;  5I58 B;  4ZEF A;  3P7I A;  4GWZ A;  3TMG A;  4GOT A;  3FD3 A;  2V84 A;  3G3I A;  5CMM A;  5IAI A;  4O3A A;  4G61 A;  1LGB C;  1LBW A;  2PFZ A;  4P9K A;  3K0V A;  1NMU A;  3FXB A;  5DEX B;  1R9L A;  3FXQ A;  1BK4 A;  1FBD A;  2GFE A;  3L6G A;  2VPO A;  1K9Y A;  4KI0 E;  1AIV A;  5K2X A;  5EYH A;  1FTL A;  2DSF A;  3FVO A;  1MXX A; 
#chains in the Genus database with same CATH homology
 1P1O A;  2XXY A;  4EDP A;  3ODB A;  1IXC A;  4ISU A;  3T93 B;  1B3G A;  4NF4 A;  4WEP A;  3SEX A;  3ILT B;  1ZBM A;  5I56 A;  4U1O A;  5ELV A;  1L5T A;  4ZEK A;  1SVX B;  2ESN A;  3HHF A;  2HZL A;  1B0L A;  4TLM B;  1Q35 A;  1VE4 A;  1POT A;  2DE2 A;  4WKM A;  1M5F A;  3O6H A;  1IUD A;  4MBP A;  3MVX A;  5H8Q B;  1LFI A;  1ATG A;  3OEM A;  3MBP A;  2ANJ A;  3PD8 A;  3WAF A;  1A99 A;  3MJN A;  4ELR A;  4LON B;  1LAG E;  4DCY A;  3HO7 A;  1JEV A;  4JB7 A;  4PFU A;  3IL1 B;  3L6H A;  5L9S A;  3DEL B;  2O51 A;  2HFB A;  1YTV A;  5B7D A;  3K1N A;  4OXV A;  1QUJ A;  1JET A;  4JWO A;  1CB6 A;  4Z0I A;  3OEK A;  2VD2 A;  4OWD A;  1BLF A;  3VDF A;  1LCF A;  2ONS A;  5I57 B;  5L9O A;  1B1X A;  1LB8 A;  4IO2 A;  3PPO A;  3FXU A;  3HV1 A;  1LB9 A;  3SKP A;  1B40 A;  3BBR A;  3MUQ A;  2GRV A;  1MY0 A;  3K2D A;  5FHO A;  3RTW B;  4AB5 A;  3H6W A;  2IEE A;  5CBR A;  3QAX A;  3B6T A;  2M8C A;  3JV9 A;  4RPN A;  1OVB A;  3KBR A;  1SW1 A;  3KEI A;  3Q25 A;  1B7H A;  4BDL A;  1SD3 A;  4Z7E A;  3C4M A;  3N6T A;  3BFT A;  3A3C A;  5B70 A;  1OQG A;  2QMX A;  2ZNS A;  3A09 A;  2QS3 A;  1JEU A;  3MQ9 A;  3C9H A;  1GR2 A;  3PUV E;  1XVY A;  4NF5 A;  1VR5 A;  3H3G A;  1MY2 A;  1LAX A;  4LZ5 A;  1BKA A;  4I62 A;  1NKX A;  2DWA A;  3H7M A;  5JEI A;  4LZ8 A;  5BUU A;  3FV2 A;  3PU5 A;  4X48 A;  1WVJ A;  4R74 A;  2O7U A;  3IOT A;  4KYS A;  4F1V A;  1ZTY A;  2G29 A;  3PPR A;  4ZEC A;  4KYD A;  3S2V A;  1Y3N A;  1LFH A;  2I3V A;  5DVF A;  2I4B A;  1IQ7 A;  2XXT A;  1XS5 A;  3PUY E;  3V83 A;  2PT2 A;  3KSX A;  4JDF A;  2O1L A;  3M3L A;  5AA2 B;  2O6A A;  1KWH A;  3E3K A;  4F18 A;  5CRY A;  5I59 B;  1H43 A;  4R6H A;  5JK4 A;  4NE4 A;  3DP8 A;  1GTK A;  2HCA A;  3IAZ A;  4O3B A;  4KCD A;  3QSL A;  4N13 A;  1UTB A;  3S9N C;  1D9Y A;  2ALU A;  1O64 A;  5M2V A;  4DLD A;  2Q2C A;  2QRY A;  3OEN A;  1TXF A;  5J1D A;  1LAH E;  2PX1 A;  1TT1 A;  2PVU A;  3K1M A;  3BKI B;  3OO6 A;  4XXU A;  3UP9 A;  3PD9 A;  2RF1 A;  5I84 A;  1NNK A;  1LLS A;  2PT1 A;  2X7Q A;  1MXU A;  1N7X A;  1Y3Q A;  1QJM A;  4H6D A;  1MQG A;  3U93 A;  3HN0 A;  1MXW A;  3M3F A;  3V5A A;  3MAM A;  4KD5 A;  4OEV A;  1XVX A;  1CE2 A;  5TPA B;  2THI A;  3LSL A;  4PP0 A;  2UYE A;  4NWD A;  3QYT A;  3G3H A;  3KGC A;  3O28 A;  3PMV A;  2ONR A;  4NF8 A;  1N0T A;  2DYX A;  2OBG A;  3BFU A;  1MDQ A;  3SES A;  4KCC A;  2Q8J A;  2OWT A;  4RY1 A;  3H6V A;  4YMA A;  3TEL A;  4U22 A;  1A7L A;  2KLF A;  2XXR A;  4G2Z A;  1FQD A;  1PB7 A;  3CSB A;  2OWS A;  3IK6 B;  3B6Q A;  4G8H A;  2NOO A;  5A5X A;  3Q29 A;  5DT6 A;  3HPI A;  4YMB A;  3KN8 A;  2O1M A;  1IIT A;  4U4S A;  3SEU A;  4G68 A;  4ESX A;  3K6U A;  4ELQ A;  3QUJ A;  1EH3 A;  2ZMB A;  4EUO A;  4F1Y A;  4NF4 B;  3T22 A;  2CZL A;  1B2H A;  3PPN A;  1S9T A;  2XHD A;  4PFT A;  1H76 A;  1LCT A;  2XX7 A;  2ZXT A;  4I9D A;  4FJP A;  5I56 B;  2E0S A;  2HEU A;  3SET A;  3VLW A;  5I2N A;  3V8X B;  4DXC A;  3OEL A;  1QW0 A;  4EQ9 A;  3H03 A;  4P0I A;  2V25 A;  3OO9 A;  3IOV A;  2Y7K A;  2Q89 A;  3UK4 A;  5KDT A;  3G7W A;  3MP6 A;  4RK9 A;  1SI0 A;  3EN3 A;  4XKQ A;  3KN7 A;  4YKJ A;  3DM0 A;  1MPD A;  4OFL A;  3RY3 A;  3U1O A;  1VSO A;  3IX1 A;  1B46 A;  3ECR A;  3IJX B;  3OD7 A;  2OLB A;  1PBQ A;  4EF2 A;  2P1S A;  1PEB A;  4IB2 A;  1OQH A;  3LSF B;  4YB7 A;  1SW2 A;  4RJZ A;  2UVH A;  3PUX E;  1MRP A;  1QUI A;  2RIN A;  1LBC A;  4FED A;  3TPA A;  5CMB A;  4EQB A;  3OXN A;  4KPT A;  5F1Q A;  2GH9 A;  3PGF A;  3SEV A;  2AIX A;  1I6B A;  2FA7 A;  4BDR A;  1AMF A;  3OSQ A;  2Q88 A;  4I8C A;  1P1U A;  1OIB A;  2F7B A;  4XKP A;  2UVJ A;  1MXZ A;  1MXV A;  2ZYK A;  2AL5 A;  3TYH A;  4F22 A;  3K00 A;  1S7Y A;  5EHS A;  4HS7 A;  2PMS A;  3TCF A;  4IO6 A;  4FE8 A;  1MH4 A;  1A8F A;  2RCA A;  3O66 A;  4X1B A;  3T66 A;  3VFJ A;  2QPQ A;  3IR1 A;  5HBC A;  5FTH A;  3IB0 A;  3FVG A;  3VXC A;  2F7A A;  2XXX A;  4YIC A;  4XTC Q;  1SI1 A;  1XHY A;  2YPN A;  4NF5 B;  3LUY A;  3TTM A;  3HHG A;  4QSE A;  3U92 A;  2HZK A;  3A3U A;  2HXW A;  5CMC A;  1IXH A;  1LFG A;  1DOT A;  2H4I A;  4I1D A;  1M5E A;  4RK2 A;  4Q30 B;  1DPE A;  1D3K A;  1OLA A;  4GIZ A;  3RQT A;  2V3Q A;  4ONY A;  3MVY A;  4OZ9 A;  1WDN A;  2HQ0 A;  2UVG A;  5F7V A;  2OJT A;  3RGY A;  1N76 A;  2DS9 A;  3KJ7 A;  2F35 A;  4LZ7 A;  4KYE A;  4F31 B;  1ANF A;  4RYA A;  4RXL A;  3U72 A;  3D4G A;  1PC3 A;  1A8E A;  3CG1 A;  3IO6 A;  1B7Z A;  4BLA A;  2ZYM A;  1S50 A;  4GRK A;  4F3S A;  1R1N A;  5FTI A;  2GHA A;  2Q9T A;  2I4C A;  3MPK A;  1ZU0 A;  4DDD A;  2RKM A;  3EQ1 A;  1JNF A;  4POX A;  5I2K A;  4E0X A;  4HTG A;  3KOT A;  4BDQ A;  4LQ2 A;  3ONM A;  5ITP A;  1Q1K A;  1B1H A;  2OCU A;  1B52 A;  4H8I A;  1NNF A;  1UTB B;  4JWX A;  1TWY A;  2DE3 A;  4ECF A;  1JW1 A;  5FHM A;  1PB8 A;  3G3K A;  1MY4 A;  4HCY A;  3O6G A;  2XXP A;  1UIU A;  2Y7R A;  3RLF E;  5AA3 A;  4GLI A;  3C34 A;  3K6W A;  4F2Q A;  2DVZ A;  3OSR A;  1SDX A;  2R71 A;  5I58 A;  4X1D A;  2O7I A;  4U2R A;  3UIF A;  3S9M C;  1MG1 A;  1FCK A;  2AYS A;  5EYF A;  3FIR A;  4KQP A;  3T9H B;  3RT6 B;  3OOA A;  1IZ1 A;  5L9M A;  2UYF A;  3W15 C;  1B4H A;  1AL3 A;  3R26 A;  4ZZE A;  3D4C A;  1RYO A;  4NMY A;  1A55 A;  4IGT A;  3MPL A;  3KOS A;  3LC8 A;  5JTY A;  1BP5 A;  4GXS B;  3B7D A;  4OHN A;  4ND9 A;  4NF8 B;  4ESW A;  5K2Y A;  3FJM A;  1US5 A;  3E9X A;  1NH7 A;  2BJJ X;  2RC7 A;  4TOZ A;  4QSC A;  4EQ7 A;  3C31 A;  1DPP A;  2VHA A;  3LBS A;  3DP6 A;  2F5X A;  4HCW A;  3G3J A;  2Q2A A;  1B6H A;  2A5T A;  1OLC A;  4L17 A;  1H45 A;  4OET A;  1XOC A;  3JYR A;  4DE8 A;  5A5X B;  3MC2 A;  2FYI A;  1LAF E;  3CIJ A;  2WKY A;  4NED A;  5AA2 D;  4IO5 A;  4KHZ E;  4G68 B;  3MWB A;  3SER A;  1MQH A;  4M1V A;  4TLL B;  4U1Z A;  3UN6 A;  3VXB A;  1QKB A;  1ZLQ A;  3VVE A;  1Y1Z A;  3S9L C;  4OVJ A;  3FXR A;  2ZYN A;  4FEB A;  4YB5 A;  5I2N B;  4IY5 A;  4OTE A;  1FQE A;  1M5B A;  1PDA A;  3TEP A;  1JW4 A;  4ZZA A;  3I3V A;  4GL8 A;  1MQD A;  3EHS A;  4QRZ A;  3GXA A;  3N6U A;  3IOU A;  1GV8 A;  2NWJ A;  1AH5 A;  3K02 A;  3S4U A;  5KDT B;  1Y20 A;  1VFE A;  3TKD A;  5ICQ A;  3TUS A;  2QL3 A;  1FTK A;  3H06 B;  5AE4 A;  2XXH A;  3N26 A;  3TCG A;  3C35 A;  4YU0 A;  1B7U A;  5CC2 A;  3MZB A;  2DP8 A;  3ILU B;  1OVT A;  1MS7 A;  4FAJ A;  3IJO B;  1IXG A;  2F6G A;  4MH5 A;  5TU0 A;  5BWJ A;  1JQF A;  1MY1 A;  4FAT A;  1JW5 A;  5AA4 A;  3I6V A;  1NNP A;  3KZG A;  3C33 A;  4ELO A;  4NF6 A;  3UA8 A;  1QUL A;  1RKM A;  2HAV A;  1FQB A;  2GHB A;  2XX8 A;  1Y4T A;  1ZJL A;  3MP8 A;  4GF8 A;  3FVK A;  1POY 1;  4G68 C;  2AL4 A;  1Y9U A;  4QFN A;  3IO4 A;  3RTF B;  2W7Y A;  1B0H A;  4RPO A;  3THI A;  4XKN A;  4H5F A;  4LA9 A;  3G3G A;  4MLV A;  1D9V A;  1ZKB A;  4BDO A;  3FJ7 A;  3V89 B;  3GBA A;  2RC9 A;  4EXK A;  1DSN A;  1DTZ A;  1UQW A;  4IO3 A;  1US4 A;  3Q28 A;  1N84 A;  3K01 A;  1DMB A;  1LBB A;  2CMO A;  4R2B A;  4ZE9 A;  3H4Z A;  3U8Q A;  1SYH A;  3FVN A;  4C1U A;  5TP9 A;  1O63 A;  4TQU Q;  1N3X A;  1USY E;  3C32 A;  4YKI A;  2X26 A;  3E13 X;  1PB9 A;  3GBB A;  3TTN A;  2REG A;  3T9X B;  5H8H A;  3MVZ A;  4EF1 A;  2DE4 A;  2DQV A;  4IO7 A;  4NWC A;  4H67 A;  4AB6 A;  4DXB A;  4YKK A;  5H8N A;  4H1X A;  1TFA A;  1HSL A;  2RC8 A;  3O9P A;  1XT8 A;  2X7P A;  1RYX A;  3CRB A;  3R6U A;  4PQJ A;  3DP4 A;  2QJE A;  2VP1 A;  5DYH A;  3PUW E;  3GLB A;  4RA1 A;  5I2K B;  2DXY A;  4H0W A;  2DVC A;  4QF9 A;  3Q26 A;  4P0G A;  1Y1M A;  2F6P A;  4WXJ A;  2UXA A;  4MF3 A;  2FNC A;  3GZG A;  1Z7M E;  1I6Q A;  2V3U A;  2HAU A;  4R2F A;  3CSG A;  2XD2 A;  2DWH A;  1UIV A;  4DZ1 A;  3TDJ A;  4OES A;  5DTB A;  2DWI A;  3IB1 A;  3OMB A;  1I6A A;  1FW0 A;  4MFI A;  4DIG A;  4QFO A;  5CMK A;  1SW4 A;  5KCJ A;  2R9J A;  2IA4 A;  3MZ9 A;  1URD A;  4PET A;  3K6V A;  4UA8 A;  1D4N A;  1MQI A;  3OO8 A;  4U23 A;  4F3B A;  1SYI A;  2A5S A;  1NFT A;  1A40 A;  4Q0C A;  2PYY A;  2YLN A;  2Z8E A;  3USD A;  4LAT A;  4K3F A;  4R75 A;  1FTM A;  5JTY B;  4AQ4 A;  4OMB A;  2NUV A;  5AA1 A;  4P11 A;  1H44 A;  2Y7I A;  3OO7 A;  5KZT A;  4JXI A;  1MPB A;  1M5C A;  3TTR A;  1Y4C A;  4XKR A;  3FJG A;  3CFZ A;  5HPQ A;  3LSX A;  2XXI A;  2A5T B;  1NL5 A;  4QFL A;  3PMW A;  3QK6 A;  1B3E A;  1T0K A;  3VV5 A;  4MLQ A;  2I3W A;  4FEC A;  2V3T A;  4Q5T A;  3VLU A;  3CR9 A;  5H8F A;  5DVI A;  3TCH A;  2XD3 A;  2XX9 A;  1B5J A;  4GXA A;  3T9V A;  3E4R A;  3TOD A;  1N3W A;  2QS4 A;  2I0B A;  2Y7W A;  2NVU B;  3EHT A;  1MDP 1;  3TQW A;  2I58 A;  3FUZ A;  1DTG A;  1P1W A;  1YPN A;  5CM6 A;  1MPC A;  3MZ1 A;  2B3F A;  4ELP A;  2Y7P A;  1P1N A;  2ZYO A;  4UAC A;  3PMX A;  4THI A;  4ZED A;  1VFD A;  4M4G A;  3ZKK A;  1BTJ A;  4R6K A;  2D21 A;  3PV0 E;  4IY6 A;  2VD3 A;  2PBW A;  3G3F A;  5CBS A;  3DLN A;  4LVQ A;  4FOR A;  2LAO A;  3T9U A;  1UTH A;  2H5Y A;  4GWO A;  2H25 A;  2ONK E;  1MQJ A;  4O3C A;  4F39 A;  1Z7N E;  4OFJ A;  3H6U A;  4PFW A;  3CG3 A;  4C1T A;  4PE5 B;  3PPP A;  4R6Y A;  4BDN A;  3ZSF A;  4ZS9 A;  5L8D A;  3O6I A;  4IGR A;  4R73 A;  3KSJ A;  3VVF A;  2D5W A;  3EHU A;  2H99 A;  4YKP A;  4R9F A;  5AA4 B;  1MY3 A;  4QFP A;  4YAH X;  5DEX A;  1Y3P A;  3UGW A;  2QSX A;  2NXO A;  2VOZ A;  4G77 A;  1BIY A;  4NF6 B;  3K1P A;  2I49 A;  1FQF A;  4JBZ A;  3CFL A;  1QUK A;  1B32 A;  3JZJ A;  3KFM A;  1B4Z A;  4QSD A;  4R9G A;  1TFD A;  5H8S A;  3SDF A;  3S9E A;  4JSO A;  2O84 X;  1II5 A;  1WOD A;  2I0C A;  1IIW A;  2XXU A;  4F3G A;  1URS A;  4RNS A;  4DXU A;  5IKB A;  1OMP A;  4LQ5 A;  2ZNU A;  1EZ9 A;  4H5G A;  2Z8F A;  2F97 A;  1AOV A;  3TFL A;  1NH8 A;  2OZZ A;  3SEW A;  4ZEB A;  2DWJ A;  2DXR A;  2RCB A;  1MH3 A;  3PUZ E;  1M5D A;  3TTK A;  3RNN A;  4X9T A;  2ABH A;  2V93 A;  2F36 A;  3R7X A;  1SW5 A;  4IO4 A;  5H8Q A;  3VVD A;  1HSE A;  4OEU A;  4ZDM A;  1FQC A;  2Y84 A;  2O68 A;  2XXW A;  5TP9 B;  1MXY A;  4N6P A;  2QS1 A;  3SEY A;  2XXQ A;  1MM6 A;  4F19 A;  3HCQ A;  4EXL A;  4H8J A;  1JVX A;  3RPW A;  5H8H B;  1B5I A;  3TQL A;  3KN3 A;  2Z23 A;  3N94 A;  4JSD A;  3WAE A;  2F78 A;  5H8N B;  1FTO A;  4YB6 A;  2H9B A;  1N7W A;  3IB2 A;  5ICT A;  1QKA A;  5I57 A;  1LST A;  3T96 B;  1B58 A;  4F2O A;  3VLV A;  4ZEI A;  3QXM A;  4GL0 A;  4U21 A;  1SQY A;  4R72 A;  1GVC A;  1IXI A;  5HM4 B;  1B3L A;  3RUM A;  3QUF A;  3CVG A;  3FAT A;  4KR5 A;  4OFO A;  1QVS A;  2F7C A;  3LR1 A;  1B3H A;  3K4U A;  2YJP A;  3UOR A;  3B6W A;  3TZA A;  1NNT A;  4OQO A;  2ZNT A;  3ZS6 A;  4QFK A;  3M3K A;  1XC1 A;  3O29 A;  3O2A A;  2P2A A;  4QHQ A;  3FZV A;  3EPE A;  3IOR A;  4N07 A;  4FIM A;  3N5L A;  2P0S A;  5FHN A;  4E0W A;  1FQA A;  4LP2 B;  1F9B A;  1B51 A;  1B05 A;  5KCJ B;  3RN8 A;  3M8U A;  1USY H;  3MP1 A;  4GQO A;  4G8N A;  4U4X A;  1ELJ A;  2Z22 A;  4OEN A;  4XIG Q;  2I6E A;  3C36 A;  1J1N A;  4GD5 A;  2F34 A;  1P1Q A;  4BDM A;  3KG2 A;  4F29 A;  2UVI A;  5DVJ A;  3K6X A;  2QS2 A;  3AXF A;  5EHM A;  3CFX A;  5ITO A;  1GGG A;  3PPQ A;  2R6G E;  1B3F A;  2G93 A;  2DOJ A;  1B5H A;  4Q8R A;  1SBP A;  5LOM A;  3FAS A;  4G4P A;  4DCX A;  3I5O A;  4F3P A;  5CI5 A;  1ZMG A;  5AA2 A;  3HST A;  3QIM A;  4WED A;  3MVW A;  3TAJ A;  2F8D A;  4POW A;  4KFQ A;  5I59 A;  2D3I A;  1A54 A;  4JWY A;  3W9V A;  4ZE8 A;  1EU8 A;  4YZZ A;  1MM7 A;  1R6Z A;  1EZP A;  3KJT A;  5H8F B;  3Q27 A;  3O97 A;  4OER A;  4OYV A;  2XXV A;  1P99 A;  1HSJ A;  2B65 A;  4G8M A;  4HW8 A;  3EF7 A;  4NTL A;  3W9W A;  3FV1 A;  4LUB A;  3H6T A;  3F11 A;  3RT8 A;  3U94 A;  1URG A;  4F1U A;  1PBP A;  2VGQ A;  4GVO A;  2REJ A;  4C0R A;  1B9J A;  2B3B A;  4PFY A;  1YCJ A;  2OK2 A;  3FGS A;  5ISU A;  3CI8 A;  4GFR A;  2H98 A;  3VE1 B;  1IEJ A;  1YAE A;  1EZO A;  2O69 A;  2I48 A;  1H3D A;  1FTJ A;  3TTL A;  3LSW A;  1UTH B;  2QMW A;  4H65 A;  5TPA A;  1ZIU A;  3IOW A;  1R9Q A;  2E1S A;  1I69 A;  1O7T A;  1JVY A;  1N04 A;  3ZKL A;  2Z8D A;  3MW0 A;  5I58 B;  4ZEF A;  3P7I A;  3TMG A;  4GOT A;  3FD3 A;  2V84 A;  3G3I A;  5CMM A;  5IAI A;  4O3A A;  1LGB C;  3K0V A;  1NMU A;  5DEX B;  1R9L A;  3FXQ A;  2GFE A;  3L6G A;  4KI0 E;  1AIV A;  5K2X A;  1FTL A;  2DSF A;  3FVO A;  1MXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...