1B7ZA

Structure of oxalate substituted diferric mare lactoferrin from colostrum
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (LACTOFERRIN)
publication title Structure of oxalate-substituted diferric mare lactoferrin at 2.7 A resolution.
pubmed doi rcsb
molecule tags Metal transport
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA03
1YPNA 3SEXA 3FV1A 1SI1A 1URGA 1POTA 4OETA 2PX1A 4EQBA 3S9EA 1MY1A 5CI5A 1SI0A 5DVIA 1H76A 4GWOA 2DYXA 3VLWA 2X7PA 3R26A 3KSJA 2XXWA 4YB7A 4I1DA 4C1TA 2Y7WA 4GLIA 1HSLA 1TWYA 1EZOA 4ZZAA 4FATA 2Q2AA 3IORA 5CC2A 4BLAA 1MY4A 2DOJA 2WKYA 4KYSA 3LUYA 2VOZA 1GTKA 3EHUA 4U22A 5ICQA 2QMWA 1TT1A 5DVJA 3TQLA 2XXPA 3G3JA 4IO5A 3VVFA 1Y1ZA 2THIA 3U1OA 2QS2A 2E1SA 1FTKA 2QRYA 1SW2A 1IEJA 4TOZA 5AA2D 1N84A 4QFNA 3WAEA 1NNTA 1J1NA 3K1PA 1P1WA 2ZYNA 3FV2A 3KN7A 3TELA 1LGBC 3IL1B 5J1DA 5CRYA 4ECFA 3GLBA 3ILTB 3EN3A 4GXAA 1FQCA 1MY2A 4NF8B 3K1MA 3MVXA 3RNNA 3PPQA 3M8UA 3PPOA 3HV1A 4QRZA 3T9XB 4KPTA 4OFJA 5DYHA 4FIMA 4YMBA 5A5XA 3CIJA 1UIUA 4BDRA 3PU5A 1MQJA 1DMBA 1DOTA 3UP9A 5JK4A 2UYFA 2O7UA 1JEVA 4JSDA 4LATA 2ZNTA 4JWXA 4IO6A 5I57A 5L9OA 1IZ1A 2V3QA 3IO4A 4G8MA 2DE2A 1Y9UA 1I6AA 5JEIA 1M5DA 3D4GA 3WAFA 1JNFA 1AMFA 2QS3A 2DVCA 2Z8FA 2P0SA 1B0HA 4KYEA 4DCYA 4OENA 4YZZA 4I9DA 1DTGA 1KWHA 4QSDA 1ZBMA 3T93B 3ZS6A 3TFLA 3O28A 3PV0E 1LCTA 4POWA 4YKJA 4FEDA 4XKRA 4PFWA 5AA4A 4FJPA 5CBRA 5TPAB 1B58A 5EHMA 2F97A 2Y84A 3IOTA 4U4XA 3V8XB 2R9JA 1M5FA 3IAZA 4YKPA 3DM0A 2ESNA 2P1SA 3UIFA 1NH8A 4U2RA 4U4SA 2ABHA 3DP6A 4AB5A 4R6KA 4G2ZA 1PEBA 1PB9A 4IB2A 2O84X 4JBZA 1Y1MA 4BDLA 3PUZE 2DWIA 4GL0A 3RTWB 2YLNA 5TU0A 2R71A 3F11A 3U92A 4Z7EA 3C34A 3CSBA 1ZKBA 4LZ5A 3TUSA 3W15C 3VDFA 4L17A 3TKDA 4F1YA 1B1XA 2AYSA 2DP8A 4E0XA 4M1VA 4FORA 1A54A 5ISUA 1YAEA 1N0TA 2FNCA 3RY3A 3M3LA 3S9MC 1Z7NE 4YMAA 3MP6A 5A5XB 2V25A 1Q35A 2O68A 5K2YA 3KN3A 2PT1A 2CZLA 4F29A 3O6IA 1B5IA 4KR5A 3T9UA 3FVOA 5I57B 3B6QA 3N6UA 3LC8A 3ODBA 2VP1A 3OO8A 4PE5B 1RYXA 3U8QA 2GRVA 4F3BA 1MDP1 3MZ1A 3DP4A 4MBPA 2REJA 2RC7A 4O3BA 2I48A 3H06B 3B6WA 1B7HA 3O29A 1LB8A 1R1NA 4I62A 1QW0A 3VLUA 2M8CA 1QULA 4ONYA 4HS7A 3OSQA 4NF5B 2RCAA 4OHNA 2OLBA 5AA4B 4H8JA 5CBSA 2DSFA 4OTEA 4EDPA 3IJXB 1US5A 3KOSA 3Q27A 1UIVA 3R6UA 2E0SA 3S9LC 2HAVA 3OSRA 3LSWA 4NWCA 1AOVA 2UVIA 1CE2A 4IGTA 4ZS9A 2O7IA 1ZMGA 1R6ZA 2UVJA 4R9GA 4IY6A 4HCYA 3FVNA 4IO7A 4YB6A 1B6HA 1UTHA 3O2AA 1YTVA 4MFIA 3I6VA 3C4MA 1A8FA 1WDNA 3TEPA 4NF4B 3TZAA 1LBCA 1JW5A 4JWYA 4KCDA 4H5FA 1B3HA 4OVJA 1MY0A 3H03A 3FGSA 2PVUA 3TODA 1B5HA 1P1UA 1ATGA 2D21A 2H4IA 2ZYMA 1YCJA 2XXIA 2QPQA 4R74A 3MAMA 2FYIA 4F22A 2GHBA 5B7DA 3FXRA 3DELB 1I6QA 3H6TA 1WVJA 2OCUA 1QUKA 3TCHA 3VFJA 5L9MA 3O97A 4DLDA 4R75A 3UA8A 3K2DA 4EXKA 1ZU0A 4F1VA 3LSLA 3FVGA 1EH3A 4H8IA 3P7IA 4QFPA 1I69A 5I58A 3VV5A 3RTFB 3KN8A 3K6WA 4KI0E 2O1LA 4Q0CA 5H8QB 1IIWA 5HPQA 3W9WA 4NMYA 1US4A 2I4BA 3FZVA 3OEMA 3OO9A 2X7QA 5CM6A 1N3XA 3O9PA 2V84A 3MW0A 1FCKA 3E9XA 3G3IA 3UORA 1B46A 4MLQA 4THIA 2Q9TA 5FHNA 2R6GE 1A99A 2QS1A 4R2FA 1B5JA 2ANJA 2AL5A 2UXAA 4ZEKA 3T9HB 1NH7A 3VXCA 3OENA 1MPBA 2DXRA 2YJPA 2KLFA 2I3VA 1OVTA 1XS5A 2I6EA 2HZKA 1UTBA 1B4ZA 3RGYA 4XIGQ 3B6TA 1TFAA 4XKQA 4GD5A 1XT8A 4OQOA 1PB8A 4ELPA 1LAFE 4F2QA 1D9YA 5TPAA 4F19A 3MPKA 1SW1A 1UTHB 2ALUA 1NMUA 1TFDA 3BFTA 1PDAA 3SEUA 1MM7A 4RJZA 4H6DA 2VD2A 5FTHA 3OO6A 2XHDA 4G77A 2F5XA 1MQIA 3CFLA 1N7WA 4PP0A 3PUWE 2X26A 2Q2CA 3KEIA 3IOUA 4XKPA 1CB6A 1B3GA 3U94A 5L9SA 2H25A 3RUMA 1D4NA 3QYTA 5M2VA 2V93A 1NL5A 2DS9A 3SESA 2Z22A 3H6VA 4R6YA 4ND9A 3N26A 1OVBA 3PPRA 1MQGA 1SQYA 2XXQA 3OOAA 3KJ7A 3M3FA 1XC1A 4NEDA 3MPLA 2DQVA 2A5SA 3EHSA 5ELVA 3HN0A 2QMXA 5I58B 4MF3A 3AXFA 4EF1A 4GL8A 1VFEA 1ZIUA 4AQ4A 1H44A 1N3WA 3PGFA 3GBBA 2H98A 2ZYKA 4QFLA 2NXOA 3CFXA 1B05A 2HXWA 1OLAA 1DSNA 1NNFA 2XD3A 4DXBA 3MC2A 1O63A 4R2BA 4LA9A 1B51A 1Q1KA 4POXA 5EHSA 5KDTA 3VVDA 5CMMA 1NNPA 2D3IA 3ZKLA 4ZDMA 2F6PA 3VVEA 4XTCQ 1HSEA 1RYOA 1UTBB 1TXFA 5BUUA 3TTMA 2GH9A 3GBAA 3U93A 5IKBA 1IQ7A 2HEUA 4NF5A 3PMXA 3CFZA 3JYRA 4FAJA 3S2VA 2HCAA 4MLVA 1BKAA 2LAOA 1D3KA 4JB7A 1MXZA 4Q30B 1LAHE 5FHOA 4WXJA 4ZE9A 2UVHA 3QAXA 4G8HA 3ZKKA 3HHFA 1MH3A 4G68A 3S9NC 1QUIA 3RT8A 1SYIA 1JETA 2P2AA 3TDJA 2XX7A 3SERA 5CMBA 4ZEBA 4NF6B 2W7YA 1MPDA 3KFMA 5CMCA 4ZZEA 4DZ1A 3OO7A 1A40A 1I6BA 4YKIA 3C36A 4BDQA 5AA3A 3MVYA 4GOTA 4PETA 4GFRA 2XXVA 3G3GA 3IX1A 3H7MA 4C0RA 4NF4A 2PMSA 3VXBA 3FJGA 3Q28A 1IXHA 1MRPA 3SKPA 4WEPA 1QKAA 3A3CA 3H3GA 3C33A 3MJNA 1JW1A 2VHAA 4LQ5A 2ONRA 3OD7A 5H8SA 4HW8A 2NOOA 3FASA 3IJOB 3K4UA 4F2OA 1LBBA 3OXNA 2BJJX 3V83A 1MH4A 4EQ7A 1Y3NA 4N6PA 2XXXA 5JTYB 1B1HA 1FTLA 3G3KA 2IEEA 3G7WA 1WODA 4NWDA 5I84A 2PYYA 1D9VA 2QL3A 5DEXA 3N94A 4YAHX 1T0KA 5KDTB 5H8QA 4GIZA 1N76A 3BBRA 3CRBA 2XXYA 4LZ7A 4YU0A 1USYE 4WKMA 4JDFA 4KHZE 3S4UA 2RC8A 3SDFA 1NKXA 2F7AA 2F35A 3FD3A 3EHTA 4G68C 3N6TA 4RA1A 3IOWA 2DXYA 3TAJA 1RKMA 3KZGA 1URSA 4TLMB 4ZE8A 5ICTA 2REGA 4EXLA 1FQEA 1URDA 4U23A 3H4ZA 4KD5A 1S7YA 1DTZA 3Q26A 4QF9A 4G68B 3RQTA 1FQBA 1S50A 1MXUA 4F39A 4Q8RA 5H8HA 4RNSA 1B52A 1B2HA 4KFQA 3V5AA 2D5WA 5L8DA 2DE3A 5AA1A 1ZLQA 2VGQA 1LCFA 3QXMA 1MQDA 2OWTA 2AIXA 3ECRA 3QUFA 2Q88A 3O6HA 3MWBA 1POY1 5CMKA 4P11A 4GF8A 2I49A 3FVKA 3ILUB 1OQGA 4Z0IA 3ZSFA 3IB1A 2I3WA 2ZXTA 3CG1A 4R73A 4R9FA 1VR5A 3K6VA 2HZLA 1SDXA 1FTMA 5ITOA 1LFIA 1MM6A 5I59A 5F7VA 1ELJA 4RYAA 2V3TA 3FJ7A 3PPNA 2Q89A 4Q5TA 4ISUA 3RPWA 1XVXA 2PBWA 4KCCA 4DIGA 1ANFA 1FW0A 1PBQA 2F8DA 2NWJA 4ZEFA 4OZ9A 2O69A 1P1OA 5DEXB 3C31A 3M3KA 3PUVE 3E3KA 4H1XA 1N7XA 3K02A 4XXUA 3TTNA 2OZZA 3IB0A 1B7ZA 4JXIA 5DT6A 2Y7KA 3EQ1A 4PQJA 3THIA 2OJTA 4OERA 5TP9B 3K0VA 1USYH 3SETA 3BKIB 1O7TA 1B40A 4LONB 3CG3A 1A8EA 2QS4A 1Y3QA 1B4HA 3RLFE 1UQWA 2B3FA 2O6AA 4F3GA 4P0GA 4UA8A 4OFLA 4LUBA 4ZEIA 2NUVA 1EZPA 3W9VA 2QSXA 1PB7A 2O51A 2DVZA 3OMBA 1B9JA 2ONSA 1Y4CA 2I4CA 3R7XA 4R72A 1QKBA 2OK2A 5F1QA 1JQFA 1Z7ME 3IO6A 1OQHA 3PUXE 5H8HB 3O66A 4ZEDA 3U72A 3TPAA 2XXRA 2I58A 4DXUA 4U1OA 3QUJA 1B3LA 2HAUA 1XVYA 2RKMA 4F1UA 5B70A 2QJEA 5H8FB 3TCFA 5I2KB 1R9QA 1P1QA 4O3AA 5DVFA 5KCJB 1OMPA 4GVOA 4H65A 3USDA 2I0CA 1LSTA 4ZECA 5IAIA 2G93A 3RT6B 1LAXA 4AB6A 2OBGA 5H8NA 3G3HA 1XOCA 3CVGA 4NF6A 2UVGA 1FTOA 4BDOA 3MP8A 3LSFB 1LFGA 1M5EA 3ONMA 1H3DA 2G29A 1PBPA 4DXCA 4QSEA 1H43A 4LZ8A 1DPPA 2IA4A 2A5TB 3FUZA 5FTIA 5I2NB 2ONKE 4LVQA 4QFOA 2RINA 3LBSA 3MBPA 4PFUA 5I59B 2DWAA 5I56B 3KJTA 1QJMA 3C32A 4TQUQ 1JVXA 1OIBA 1A55A 2F36A 3K01A 3IOVA 4N13A 2AL4A 1BLFA 3MVZA 1MS7A 4GRKA 4BDMA 5FHMA 4QHQA 4RY1A 1AH5A 4M4GA 4OFOA 2Y7IA 2Z23A 4IO2A 4TLLB 3MZBA 2XD2A 1GV8A 3GZGA 2VD3A 1VSOA 3PUYE 2NVUB 1ZTYA 3DP8A 1MY3A 5KZTA 1QVSA 3E4RA 1XHYA 3FXQA 5JTYA 5DTBA 2PT2A 1EZ9A 1MXYA 1SW4A 3SEVA 4E0WA 4GQOA 2H9BA 1VE4A 1AIVA 3UGWA 3K1NA 1BIYA 1MPCA 4NE4A 4EF2A 4EQ9A 2XX8A 4GXSB 2OWSA 2Y7PA 3T9VA 1L5TA 1LB9A 2ZNUA 3C35A 1DPEA 4RPNA 1VFDA 4HTGA 3B7DA 1NFTA 1IXCA 1LAGE 3TTRA 2F34A 3D4CA 3N5LA 4H5GA 3PMVA 2H5YA 1Y20A 3KGCA 4HCWA 2YPNA 3JV9A 1IXGA 1H45A 3MZ9A 3MQ9A 5AA2A 2Y7RA 3IK6B 5H8NB 3OELA 3K00A 3K6UA 1JVYA 1O64A 4I8CA 4OMBA 4YICA 5LOMA 3IR1A 4IO3A 4ELQA 2ZMBA 1MQHA 3TMGA 1B3EA 1P99A 1IXIA 5EYFA 3T96B 4DE8A 4PFYA 1II5A 1F9BA 4IO4A 4G8NA 4OWDA 2F7CA 3L6HA 3G3FA 4H67A 4O3CA 2H99A 4MH5A 3QIMA 2V3UA 4FEBA 2F6GA 4YKKA 3TCGA 4DDDA 2XXUA 3I5OA 3SEYA 1Y3PA 3BFUA 3FXUA 4PFTA 2DWJA 1BP5A 5ITPA 1B3FA 5HBCA 4ELOA 1SYHA 1MG1A 4EUOA 3QSLA 3T66A 3A09A 3VE1B 4WEDA 2Z8EA 1LLSA 4F18A 3E13X 3HCQA 4ESWA 1SD3A 1JW4A 3C9HA 3HSTA 4BDNA 3FJMA 1M5CA 3O6GA 3V89B 4N07A 3LSXA 1GR2A 2O1MA 1SVXB 4UACA 3KBRA 3HO7A 1MXXA 1IUDA 1IITA 3KG2A 2XX9A 3TQWA 3GXAA 3T22A 1FQAA 2RF1A 4OESA 5AE4A 2B3BA 4OEUA 2ZYOA 3LR1A 4OEVA 4RXLA 4YB5A 1A7LA 5TP9A 4R6HA 4F3PA 1SBPA 2ZNSA 4C1UA 4XKNA 3UK4A 1MXWA 1HSJA 3DLNA 4G4PA 2I0BA 2DE4A 3EPEA 3TTLA 3Q25A 3CR9A 5BWJA 1B32A 3VLVA 4LP2B 1FQFA 3CI8A 1R9LA 2F7BA 4RK2A 4X1DA 3RN8A 5AA2B 5K2XA 2RCBA 4IY5A 1JEUA 4F3SA 3KOTA 4NTLA 1MXVA 2HFBA 1PC3A 2F78A 3OEKA 5H8FA 5I2KA 3HHGA 1QUJA 1SW5A 3K6XA 5KCJA 1AL3A 1FTJA 2B65A 2Z8DA 1NNKA 4X9TA 4F31B 2XXHA 2Q8JA 1M5BA 3FATA 2FA7A 3MP1A 4OYVA 3UN6A 3PD8A 2CMOA 3A3UA 1S9TA 3QK6A 5HM4B 4H0WA 1BTJA 4X48A 2DWHA 2A5TA 5I2NA 2XXTA 3MVWA 1GGGA 1LFHA 4U1ZA 4KYDA 5I56A 1MDQA 3MUQA 2GFEA 4JSOA 3TYHA 1GVCA 1EU8A 4U21A 3HPIA 2UYEA 4JWOA 1N04A 1FQDA 3H6UA 4ESXA 1P1NA 3PD9A 2RC9A 3Q29A 4NF8A 3EF7A 3FIRA 3PMWA 3SEWA 4K3FA 4FECA 1B0LA 3JZJA 3H6WA 4ELRA 4KQPA 4LQ2A 4OXVA 3IB2A 1OLCA 3TTKA 4RK9A 1ZJLA 4P0IA 1Y4TA 4X1BA 1B7UA 3I3VA 2GHAA 3L6GA 4RPOA 4DCXA 4QFKA 3CSGA 3KSXA 3PPPA 4FE8A 4QSCA 2HQ0A 4IGRA
chains in the Genus database with same CATH superfamily
1YPNA 3SEXA 3FV1A 1SI1A 1URGA 1POTA 4OETA 4NF0A 2PX1A 4EQBA 3S9EA 1MY1A 5CI5A 1SI0A 5DVIA 1H76A 4GWOA 2DYXA 3VLWA 2X7PA 3R26A 3KSJA 2XXWA 4YB7A 4I1DA 4C1TA 2Y7WA 4GLIA 1HSLA 1TWYA 1EZOA 4ZZAA 4FATA 3MSTA 2Q2AA 3IORA 5CC2A 4BLAA 2WBDA 1MY4A 2ZZVA 2DOJA 2XWVA 2WKYA 4KYSA 3LUYA 2VOZA 4N81A 1GTKA 3EHUA 4U22A 5ICQA 1FPKA 2QMWA 1TT1A 1FPFA 5DVJA 3TQLA 2XXPA 3G3JA 4IO5A 4N8GA 4PF6A 3VVFA 1Y1ZA 2THIA 2PFYA 3U1OA 2QS2A 2E1SA 1FTKA 2QRYA 1IMFA 1SW2A 1LBWA 1IEJA 2VPNA 4TOZA 5AA2D 1N84A 4QFNA 3WAEA 1NNTA 1J1NA 3K1PA 1P1WA 2ZYNA 3FV2A 3KN7A 3TELA 2F3BA 1LGBC 3IL1B 5J1DA 5CRYA 1FRPA 4ECFA 3GLBA 3ILTB 2FVZA 3EN3A 4GXAA 1FQCA 1MY2A 4MEVA 4NF8B 3K1MA 3MVXA 3RNNA 3PPQA 3M8UA 2XWIA 3PPOA 3HV1A 2JJKA 4QRZA 3T9XB 4KPTA 4OFJA 5DYHA 4FIMA 4YMBA 5I3SA 1NV6A 5A5XA 3CIJA 4GWWA 1FPEA 1UIUA 4BDRA 3PU5A 4O7MA 4H45A 1MQJA 1DMBA 1DOTA 3UP9A 5JK4A 2UYFA 2O7UA 1JEVA 4JSDA 4LATA 2ZNTA 4JWXA 4IO6A 5I57A 5L9OA 1BK4A 1IZ1A 2V3QA 1FPIA 3IO4A 4G8MA 5IZ3B 2DE2A 1Y9UA 1I6AA 5JEIA 1M5DA 4JVIA 3D4GA 3WAFA 1JNFA 2L5VA 1AMFA 2QS3A 2DVCA 2Z8FA 2P0SA 1B0HA 4KYEA 4DCYA 2MKZA 4OENA 4YZZA 4I9DA 1DTGA 1KWHA 4PGNA 4QSDA 1ZBMA 2OWZA 3T93B 3MYUA 4OVSA 5ET8A 5ET7A 3ZS6A 3TFLA 3O28A 3PV0E 1LCTA 4POWA 4YKJA 4FEDA 4XKRA 4PFWA 5AA4A 4FJPA 5CBRA 5TPAB 1B58A 5EHMA 4PCDA 2F97A 2Y84A 3IOTA 4U4XA 3V8XB 2R9JA 1M5FA 3IAZA 4YKPA 3DM0A 2ESNA 2P1SA 3UIFA 1NH8A 1EYJA 4U2RA 4U4SA 2ABHA 3DP6A 4AB5A 4R6KA 4G2ZA 1PEBA 1PB9A 4IB2A 2O84X 4JBZA 1Y1MA 4BDLA 3PUZE 2DWIA 4GL0A 3RTWB 2YLNA 5TU0A 2R71A 3F11A 4MAGA 3U92A 4Z7EA 1INPA 4OVTA 2WYKA 3C34A 4XFEA 3CSBA 1ZKBA 4LZ5A 3TUSA 4GWSA 3W15C 3VDFA 4L17A 3IFCA 4OVRA 3TKDA 4GBVA 4F1YA 1B1XA 2AYSA 2DP8A 4E0XA 4M1VA 4FORA 1A54A 5ISUA 2ZZWA 1YAEA 1N0TA 2FNCA 3RY3A 3M3LA 3S9MC 1CNQA 1Z7NE 4YMAA 3MP6A 5A5XB 5DW8A 2V25A 1Q35A 2O68A 5K2YA 2B4MA 3KN3A 1LBZA 2PT1A 2CZLA 4PAIA 4F29A 3O6IA 1B5IA 4KR5A 3T9UA 3FVOA 5I57B 3B6QA 3N6UA 3LC8A 3ODBA 2VP1A 3OO8A 4PE5B 1RYXA 3U8QA 2GRVA 4F3BA 1MDP1 1FPDA 3MZ1A 3DP4A 4MBPA 2REJA 4P1LA 2RC7A 4O3BA 2I48A 3H06B 1LEVA 3B6WA 3ROJA 1B7HA 3O29A 1LB8A 1R1NA 4I62A 1QW0A 3VLUA 2M8CA 4MNCA 1QULA 4ONYA 4HS7A 3OSQA 4NF5B 1SPIA 2RCAA 4OHNA 2OLBA 5AA4B 1LBYA 4H8JA 5CBSA 1QGXA 2DSFA 4OTEA 4EDPA 3A29A 3KC1A 3IJXB 1US5A 3KOSA 3Q27A 4H46A 1UIVA 3R6UA 2E0SA 3S9LC 2HAVA 3OSRA 3LSWA 4NWCA 1AOVA 1DK4A 2UVIA 1CE2A 4IGTA 4ZS9A 3HFUA 2R8TA 2O7IA 1ZMGA 1R6ZA 1YYZA 2UVJA 4R9GA 4IY6A 4GBWA 2FIEA 4HCYA 3FVNA 3GYYA 4IO7A 4YB6A 4XF5A 1Q9DA 4X04A 1B6HA 1UTHA 4GWZA 3O2AA 1YTVA 4MFIA 3I6VA 3C4MA 2WBBA 1A8FA 1WDNA 3TEPA 4NF4B 3TZAA 4LN5A 1LBCA 1JW5A 4JWYA 4KCDA 4H5FA 1B3HA 4OVJA 1MY0A 3H03A 3FGSA 2PVUA 1JP4A 2Q74A 3TODA 1B5HA 1P1UA 1ATGA 2D21A 4MIJA 2H4IA 2ZYMA 4MNIA 1YCJA 2XXIA 2QPQA 4R74A 3MAMA 2FYIA 4F22A 2GHBA 5B7DA 3FXRA 3DELB 1I6QA 3H6TA 4FBPA 1WVJA 2OCUA 4I3EA 1QUKA 3TCHA 3VFJA 5L9MA 2XWKA 3O97A 4DLDA 4R75A 3UA8A 3K2DA 4EXKA 1ZU0A 4F1VA 4PFIA 2CEXA 3LSLA 1KA1A 3FVGA 1EH3A 4H8IA 2BJIA 3P7IA 4QFPA 1I69A 5I58A 3VV5A 3RTFB 3KN8A 3K6WA 4KI0E 2O1LA 4Q0CA 3T0JA 5H8QB 1IIWA 5HPQA 3W9WA 4NMYA 1US4A 2I4BA 3FZVA 3OEMA 3OO9A 2X7QA 5CM6A 1N3XA 3O9PA 2V84A 3MW0A 1FCKA 3E9XA 3G3IA 3UORA 1B46A 4MLQA 4THIA 2P3NA 2Q9TA 4NQ8A 5FHNA 2R6GE 1A99A 2QS1A 4R2FA 1B5JA 2ANJA 2AL5A 3T1BA 2UXAA 4ZEKA 3T9HB 1NH7A 3VXCA 5EQAA 3OENA 1MPBA 2DXRA 2YJPA 2KLFA 2I3VA 1OVTA 1XS5A 2I6EA 2HZKA 1NV0A 1UTBA 1B4ZA 3RGYA 4XIGQ 3B6TA 4N4UA 1TFAA 4XKQA 4GD5A 3LUZA 1DBZA 1XT8A 4P9KA 4OQOA 4JVCA 1PB8A 4ELPA 1LAFE 4F2QA 1D9YA 2Y5KA 5TPAA 3MPKA 4F19A 4MJOA 1SW1A 1UTHB 3FBPA 2ALUA 1NMUA 3D1RA 1TFDA 3BFTA 1PDAA 4NHBA 3SEUA 1MM7A 3B50A 4RJZA 4H6DA 1DCUA 2VD2A 5EQ9A 5FTHA 3OO6A 2XHDA 4G77A 2F5XA 4MMPA 1MQIA 3CFLA 1N7WA 4PP0A 3PUWE 2X26A 2Q2CA 3KEIA 4P47A 3IOUA 2CEYA 4G61A 1CB6A 4XKPA 1B3GA 3U94A 5L9SA 2H25A 3RUMA 1D4NA 3QYTA 5M2VA 2V93A 1NL5A 2DS9A 1K9YA 2VT5A 3SESA 2Z22A 3H6VA 4R6YA 4ND9A 3N26A 1OVBA 3PPRA 1MQGA 1SQYA 2XXQA 3OOAA 3KJ7A 1NV7A 3M3FA 1XC1A 4NEDA 3MPLA 2DQVA 1FBFA 2A5SA 3EHSA 5ELVA 3HN0A 1NV3A 2QMXA 5I58B 4MF3A 5FBPA 3AXFA 4EF1A 4GL8A 1VFEA 1ZIUA 4AQ4A 2WEFA 1H44A 1N3WA 3PGFA 3GBBA 2H98A 2WYPA 2ZYKA 4NX1A 4QFLA 4PBHA 2NXOA 3CFXA 2V4CA 1B05A 2HXWA 1OLAA 4AS5A 1G0IA 1DSNA 1NNFA 2QFLA 2XD3A 4DXBA 3MC2A 1O63A 4R2BA 4LA9A 1B51A 1Q1KA 4POXA 4PFRA 5EHSA 5KDTA 4JVDA 3VVDA 5CMMA 4N17A 1NNPA 2D3IA 1FBCA 2XXKA 4GX6A 3ZKLA 4ZDMA 2F6PA 3VVEA 4OANA 4XTCQ 1NV4A 1HSEA 1RYOA 1UTBB 3CHGA 4PAFA 1TXFA 5BUUA 3TTMA 1NV1A 2GH9A 3GBAA 3U93A 5IKBA 1IQ7A 2HEUA 4GX4A 4NF5A 3PMXA 3CFZA 3JYRA 1IMDA 4FAJA 3S2VA 2HCAA 4MLVA 1BKAA 2LAOA 5EYGA 1D3KA 4JB7A 1MXZA 4Q30B 1LAHE 5FHOA 4NG7A 4KXPA 2B4LA 5ESYA 4WXJA 4ZE9A 2UVHA 3QAXA 4G8HA 3ZKKA 3HHFA 1MH3A 4G68A 3S9NC 1QUIA 1LBVA 3RT8A 1SYIA 1JETA 2P2AA 3TDJA 3RPLB 2XX7A 3SERA 5CMBA 4ZEBA 1NUWA 4NF6B 2W7YA 1MPDA 3KFMA 5CMCA 4ZZEA 4DZ1A 3OO7A 1A40A 1I6BA 4YKIA 3C36A 4BDQA 5AA3A 3MVYA 4PDHA 4PDDA 4GOTA 4PETA 4GFRA 2XXVA 3G3GA 4QBAA 3IX1A 3H7MA 4C0RA 4NF4A 2PMSA 3VXBA 3FJGA 3Q28A 1IXHA 2OX3A 1MRPA 5IGAA 5IZ1A 3SKPA 2HHMA 4WEPA 1QKAA 3A3CA 3H3GA 3C33A 3MJNA 1JW1A 2VHAA 4LQ5A 2ONRA 3OD7A 5H8SA 4X8RA 4HW8A 4GWUA 2PFZA 2NOOA 3FASA 3IJOB 4OVQA 3K4UA 4F2OA 1LBBA 3OXNA 2QVRA 4HE2A 2BJJX 3V83A 2KR0A 1MH4A 4EQ7A 1Y3NA 4N6PA 2XXXA 5JTYB 1B1HA 1FTLA 3G3KA 2IEEA 3G7WA 1WODA 3NOHA 2WX9A 4NWDA 5I84A 2PYYA 1D9VA 2QL3A 5DEXA 3N94A 4YAHX 1T0KA 5KDTB 4PC9A 5H8QA 4GIZA 1N76A 1NUYA 1FBDA 3BBRA 3CRBA 2XXYA 1NV2A 4LZ7A 4YU0A 1USYE 4WKMA 4JDFA 4XEQA 4KHZE 3S4UA 2RC8A 4PTKA 3SDFA 1NKXA 2F7AA 2F35A 3FD3A 2F3DA 3EHTA 2CZKA 4G68C 3N6TA 1IMAA 4RA1A 4O8MA 3IOWA 1FTAA 2DXYA 1RKMA 3TAJA 3KZGA 1URSA 4TLMB 4ZE8A 5ICTA 2REGA 1EYIA 4EXLA 1FQEA 1URDA 4U23A 3H4ZA 4KD5A 1S7YA 1DTZA 2CZHA 3Q26A 4QF9A 4G68B 3RQTA 1FQBA 1S50A 1MXUA 4F39A 4Q8RA 5H8HA 4RNSA 3RYDA 5J16A 4MNPA 1B52A 4MX6A 1B2HA 4KFQA 4HE1A 3U65A 3V5AA 2D5WA 5L8DA 2DE3A 5AA1A 1ZLQA 2VGQA 1LCFA 3QXMA 1MQDA 2OWTA 2AIXA 3ECRA 3QUFA 2Q88A 3O6HA 3MWBA 4P3LA 1POY1 5CMKA 4P11A 4GF8A 2I49A 3FVKA 3ILUB 1OQGA 1IMEA 4Z0IA 3ZSFA 3IB1A 3LV0A 4NN3A 2I3WA 2ZXTA 3CG1A 4R73A 4R9FA 1VR5A 3K6VA 2HZLA 4IR8A 1SDXA 1FTMA 2DDKA 5ITOA 1LFIA 1MM6A 4N8YA 5I59A 5F7VA 1ELJA 4RYAA 2V3TA 3FJ7A 3PPNA 2Q89A 4P8BA 3PTYA 4Q5TA 4ISUA 1NUXA 3EKIA 1XVXA 3RPWA 2PBWA 4KCCA 4DIGA 1FSAA 1ANFA 1FW0A 1PBQA 2F8DA 2NWJA 4ZEFA 4OZ9A 2O69A 1P1OA 5DEXB 3C31A 4GWYA 3M3KA 3PUVE 3E3KA 4H1XA 1N7XA 5EQ7A 3K02A 2QVUA 4XXUA 3TTNA 2HPGA 2OZZA 3IB0A 1B7ZA 4JXIA 5DT6A 2Y7KA 3EQ1A 4PQJA 1FBHA 3THIA 2OJTA 4OERA 5TP9B 3K0VA 1USYH 3SETA 5LDZA 3BKIB 1O7TA 1B40A 4LONB 3CG3A 1A8EA 2QS4A 1Y3QA 3FXBA 1B4HA 3RLFE 1UQWA 2B3FA 2O6AA 4F3GA 4P0GA 4UA8A 4OFLA 4LUBA 4N6DA 4ZEIA 2NUVA 3B8BA 1EZPA 3W9VA 2QSXA 1PB7A 2O51A 2DVZA 3ISPA 3OMBA 1B9JA 2ONSA 4OA4A 1Y4CA 2I4CA 3R7XA 4R72A 4I3YA 1QKBA 2OK2A 4P1EA 1IMBA 5F1QA 1JQFA 1Z7ME 3IO6A 1OQHA 3PUXE 1NI9A 2VPOA 5H8HB 3O66A 4ZEDA 1NV5A 3U72A 3TPAA 4MCOA 1FPLA 2XXRA 2I58A 4DXUA 1D9QA 4U1OA 3QUJA 1B3LA 2HAUA 1XVYA 2RKMA 4F1UA 5B70A 2QJEA 5H8FB 3TCFA 5I2KB 1R9QA 4GX3A 1P1QA 4O3AA 5DVFA 5KCJB 1OMPA 4GVOA 4H65A 2I0CA 3USDA 1LSTA 4ZECA 5IAIA 2G93A 3RT6B 1LAXA 4AB6A 2OBGA 5H8NA 3RPLA 4PBQA 1FBPA 3G3HA 5I5PA 1XOCA 3CVGA 4NF6A 2UVGA 1FTOA 4BDOA 3MP8A 4OVPA 3LSFB 1LFGA 1M5EA 3ONMA 1H3DA 2G29A 1PBPA 4DXCA 4QSEA 1H43A 4LZ8A 1DPPA 2IA4A 2A5TB 3FUZA 5FTIA 5I2NB 3BIGA 2ONKE 4LVQA 4QFOA 2RINA 1VDWA 3LBSA 4P56A 3MBPA 3KBZA 4PFUA 5I59B 2DWAA 5I56B 3KJTA 1QJMA 3C32A 4TQUQ 1JVXA 1OIBA 1A55A 2F36A 2Y5LA 1EYKA 3K01A 3IOVA 4N13A 1FPGA 2AL4A 5A5LA 1K9ZA 1BLFA 3MVZA 2CZIA 1MS7A 4AS4A 4GRKA 4BDMA 5FHMA 4QHQA 4RY1A 1AH5A 4M4GA 4OFOA 2Y7IA 2Z23A 4IO2A 4TLLB 3MZBA 2XD2A 1GV8A 1RDYA 3GZGA 3KC0A 2VD3A 1VSOA 3PUYE 2NVUB 1ZTYA 3DP8A 5EQ8A 1MY3A 5KZTA 1QVSA 1IMCA 3E4RA 1XHYA 4N6KA 3FXQA 5JTYA 5DTBA 2PT2A 3SZPA 1EZ9A 1MXYA 4PF8A 3IFAA 1SW4A 3SEVA 4E0WA 4GQOA 2H9BA 1VE4A 1AIVA 3UGWA 3K1NA 2KQZA 2FBPA 4PGPA 1BIYA 1MPCA 4NE4A 4EF2A 4EQ9A 2XX8A 4GXSB 2OWSA 2Y7PA 3T9VA 4DI4B 1L5TA 1LB9A 2ZNUA 3C35A 1DPEA 4N91A 4RPNA 1VFDA 4HTGA 3B7DA 1FPJA 1NFTA 1IXCA 1LAGE 4HE0A 4N15A 3TTRA 2F34A 3D4CA 3N5LA 4H5GA 3PMVA 2H5YA 1Y20A 3KGCA 4HCWA 3E78A 2YPNA 3JV9A 1IXGA 1FJ9A 1H45A 3MZ9A 3MQ9A 2ZZXA 5AA2A 2Y7RA 3IK6B 5H8NB 1FBGA 3OELA 3K00A 3K6UA 1JVYA 1O64A 4I8CA 4OMBA 4YICA 5LOMA 3IR1A 4IO3A 4ELQA 2ZMBA 1MQHA 3TMGA 1B3EA 1P99A 1IXIA 5EYFA 3T96B 4DE8A 4PFYA 1II5A 4PAKA 1F9BA 1FPBA 4IO4A 4G8NA 4OWDA 2F7CA 3L6HA 3G3FA 4H67A 4O3CA 2H99A 4MH5A 3QIMA 2V3UA 4FEBA 2F6GA 4YKKA 3TCGA 4DDDA 2XXUA 3I5OA 3SEYA 4NGUA 2FHYA 1Y3PA 3BFUA 3FXUA 4PFTA 2DWJA 1BP5A 5LTCA 5ITPA 1G0HA 2GQ1A 1B3FA 5HBCA 4ELOA 1SYHA 1MG1A 1AWBA 4EUOA 3QSLA 3T66A 3QMFA 5IM2A 3A09A 3VE1B 4WEDA 2Z8EA 1LLSA 4F18A 3E13X 3HCQA 4ESWA 1SD3A 1YZ0A 1JW4A 5ET6A 3C9HA 3HSTA 4BDNA 3FJMA 1M5CA 3O6GA 3V89B 4N07A 3LSXA 1GR2A 2O1MA 1SVXB 5T3JA 4UACA 3KBRA 3HO7A 1MXXA 1IUDA 1IITA 3KG2A 2XX9A 3GXAA 3TQWA 3T22A 1FQAA 2RF1A 4OESA 5AE4A 2B3BA 4OEUA 2ZYOA 3LR1A 4OEVA 4RXLA 1YXIA 5ET5A 4YB5A 1A7LA 5TP9A 4R6HA 4F3PA 1SBPA 2ZNSA 4NAPA 4C1UA 4XKNA 3UK4A 1MXWA 1HSJA 5EYHA 1KZ8A 3DLNA 4G4PA 2I0BA 1LBXA 1NUZA 2DE4A 3EPEA 3TTLA 3Q25A 3CR9A 5BWJA 1B32A 3VLVA 4QXDA 4LP2B 1FQFA 3CI8A 1R9LA 2F7BA 4RK2A 4X1DA 3RN8A 3BIHA 5AA2B 5K2XA 4O7IA 4UABA 2RCBA 4IY5A 2FIXA 2Q8MA 2XA5A 1JEUA 4F3SA 3KOTA 4NTLA 2P3VA 1MXVA 2HFBA 1PC3A 2F78A 3OEKA 5H8FA 5I2KA 3HHGA 1QUJA 1SW5A 3K6XA 5KCJA 1AL3A 1FTJA 4GWXA 2B65A 2Z8DA 1NNKA 4X9TA 4F31B 2XXHA 2Q8JA 1M5BA 3FATA 2FA7A 3MP1A 1FJ6A 4OYVA 3UN6A 1RDXA 2QVVA 3PD8A 2CMOA 1KA0A 1XI6A 3A3UA 1S9TA 3QK6A 5F24A 5HM4B 3E79A 4H0WA 1BTJA 4X48A 4O94A 2DWHA 2A5TA 5I2NA 2XXTA 3MVWA 1GGGA 1LFHA 4U1ZA 4KYDA 1FBEA 5I56A 1MDQA 3MUQA 2GFEA 4MHFA 4JSOA 3TYHA 1GVCA 1EU8A 4U21A 3HPIA 4DI3D 2UYEA 4PE3A 4JWOA 1N04A 1FQDA 3H6UA 4ESXA 1P1NA 5IZZA 3PD9A 2RC9A 3Q29A 4NF8A 3EF7A 3FIRA 3PMWA 3SEWA 4K3FA 4FECA 1B0LA 3JZJA 3H6WA 4ELRA 4KQPA 4LQ2A 4OXVA 2XWOA 4I40A 5I7IA 3IB2A 4HXVA 1OLCA 3TTKA 4RK9A 1ZJLA 4P0IA 1Y4TA 4X1BA 1B7UA 4PFBA 3I3VA 2GHAA 3L6GA 4RPOA 4DCXA 1RDZA 2HXRA 4QFKA 2PCRA 3CSGA 3KSXA 3PPPA 5IZ3A 4FE8A 4QSCA 2HQ0A 4IGRA
chains in the Genus database with same CATH topology
1YPNA 3SEXA 3FV1A 1SI1A 1URGA 1POTA 4OETA 2PX1A 4EQBA 3S9EA 1MY1A 5CI5A 1SI0A 5DVIA 1H76A 4GWOA 2DYXA 3VLWA 2X7PA 3R26A 3KSJA 2XXWA 4YB7A 4I1DA 4C1TA 2Y7WA 4GLIA 1HSLA 1TWYA 1EZOA 4ZZAA 4FATA 2Q2AA 3IORA 5CC2A 4BLAA 1MY4A 2DOJA 2WKYA 4KYSA 3LUYA 2VOZA 1GTKA 3EHUA 4U22A 5ICQA 2QMWA 1TT1A 5DVJA 3TQLA 2XXPA 3G3JA 4IO5A 3VVFA 1Y1ZA 2THIA 3U1OA 2QS2A 2E1SA 1FTKA 2QRYA 1SW2A 1IEJA 4TOZA 5AA2D 1N84A 4QFNA 3WAEA 1NNTA 1J1NA 3K1PA 1P1WA 2ZYNA 3FV2A 3KN7A 3TELA 1LGBC 3IL1B 5J1DA 5CRYA 4ECFA 3GLBA 3ILTB 3EN3A 4GXAA 1FQCA 1MY2A 4NF8B 3K1MA 3MVXA 3RNNA 3PPQA 3M8UA 3PPOA 3HV1A 4QRZA 3T9XB 4KPTA 4OFJA 5DYHA 4FIMA 4YMBA 5A5XA 3CIJA 1UIUA 4BDRA 3PU5A 1MQJA 1DMBA 1DOTA 3UP9A 5JK4A 2UYFA 2O7UA 1JEVA 4JSDA 4LATA 2ZNTA 4JWXA 4IO6A 5I57A 5L9OA 1IZ1A 2V3QA 3IO4A 4G8MA 2DE2A 1Y9UA 1I6AA 5JEIA 1M5DA 3D4GA 3WAFA 1JNFA 1AMFA 2QS3A 2DVCA 2Z8FA 2P0SA 1B0HA 4KYEA 4DCYA 4OENA 4YZZA 4I9DA 1DTGA 1KWHA 4QSDA 1ZBMA 3T93B 3ZS6A 3TFLA 3O28A 3PV0E 1LCTA 4POWA 4YKJA 4FEDA 4XKRA 4PFWA 5AA4A 4FJPA 5CBRA 5TPAB 1B58A 5EHMA 2F97A 2Y84A 3IOTA 4U4XA 3V8XB 2R9JA 1M5FA 3IAZA 4YKPA 3DM0A 2ESNA 2P1SA 3UIFA 1NH8A 4U2RA 4U4SA 2ABHA 3DP6A 4AB5A 4R6KA 4G2ZA 1PEBA 1PB9A 4IB2A 2O84X 4JBZA 1Y1MA 4BDLA 3PUZE 2DWIA 4GL0A 3RTWB 2YLNA 5TU0A 2R71A 3F11A 3U92A 4Z7EA 3C34A 3CSBA 1ZKBA 4LZ5A 3TUSA 3W15C 3VDFA 4L17A 3TKDA 4F1YA 1B1XA 2AYSA 2DP8A 4E0XA 4M1VA 4FORA 1A54A 5ISUA 1YAEA 1N0TA 2FNCA 3RY3A 3M3LA 3S9MC 1Z7NE 4YMAA 3MP6A 5A5XB 2V25A 1Q35A 2O68A 5K2YA 3KN3A 2PT1A 2CZLA 4F29A 3O6IA 1B5IA 4KR5A 3T9UA 3FVOA 5I57B 3B6QA 3N6UA 3LC8A 3ODBA 2VP1A 3OO8A 4PE5B 1RYXA 3U8QA 2GRVA 4F3BA 1MDP1 3MZ1A 3DP4A 4MBPA 2REJA 2RC7A 4O3BA 2I48A 3H06B 3B6WA 1B7HA 3O29A 1LB8A 1R1NA 4I62A 1QW0A 3VLUA 2M8CA 1QULA 4ONYA 4HS7A 3OSQA 4NF5B 2RCAA 4OHNA 2OLBA 5AA4B 4H8JA 5CBSA 2DSFA 4OTEA 4EDPA 3IJXB 1US5A 3KOSA 3Q27A 1UIVA 3R6UA 2E0SA 3S9LC 2HAVA 3OSRA 3LSWA 4NWCA 1AOVA 2UVIA 1CE2A 4IGTA 4ZS9A 2O7IA 1ZMGA 1R6ZA 2UVJA 4R9GA 4IY6A 4HCYA 3FVNA 4IO7A 4YB6A 1B6HA 1UTHA 3O2AA 1YTVA 4MFIA 3I6VA 3C4MA 1A8FA 1WDNA 3TEPA 4NF4B 3TZAA 1LBCA 1JW5A 4JWYA 4KCDA 4H5FA 1B3HA 4OVJA 1MY0A 3H03A 3FGSA 2PVUA 3TODA 1B5HA 1P1UA 1ATGA 2D21A 2H4IA 2ZYMA 1YCJA 2XXIA 2QPQA 4R74A 3MAMA 2FYIA 4F22A 2GHBA 5B7DA 3FXRA 3DELB 1I6QA 3H6TA 1WVJA 2OCUA 1QUKA 3TCHA 3VFJA 5L9MA 3O97A 4DLDA 4R75A 3UA8A 3K2DA 4EXKA 1ZU0A 4F1VA 3LSLA 3FVGA 1EH3A 4H8IA 3P7IA 4QFPA 1I69A 5I58A 3VV5A 3RTFB 3KN8A 3K6WA 4KI0E 2O1LA 4Q0CA 5H8QB 1IIWA 5HPQA 3W9WA 4NMYA 1US4A 2I4BA 3FZVA 3OEMA 3OO9A 2X7QA 5CM6A 1N3XA 3O9PA 2V84A 3MW0A 1FCKA 3E9XA 3G3IA 3UORA 1B46A 4MLQA 4THIA 2Q9TA 5FHNA 2R6GE 1A99A 2QS1A 4R2FA 1B5JA 2ANJA 2AL5A 2UXAA 4ZEKA 3T9HB 1NH7A 3VXCA 3OENA 1MPBA 2DXRA 2YJPA 2KLFA 2I3VA 1OVTA 1XS5A 2I6EA 2HZKA 1UTBA 1B4ZA 3RGYA 4XIGQ 3B6TA 1TFAA 4XKQA 4GD5A 1XT8A 4OQOA 1PB8A 4ELPA 1LAFE 4F2QA 1D9YA 5TPAA 4F19A 3MPKA 1SW1A 1UTHB 2ALUA 1NMUA 1TFDA 3BFTA 1PDAA 3SEUA 1MM7A 4RJZA 4H6DA 2VD2A 5FTHA 3OO6A 2XHDA 4G77A 2F5XA 1MQIA 3CFLA 1N7WA 4PP0A 3PUWE 2X26A 2Q2CA 3KEIA 3IOUA 4XKPA 1CB6A 1B3GA 3U94A 5L9SA 2H25A 3RUMA 1D4NA 3QYTA 5M2VA 2V93A 1NL5A 2DS9A 3SESA 2Z22A 3H6VA 4R6YA 4ND9A 3N26A 1OVBA 3PPRA 1MQGA 1SQYA 2XXQA 3OOAA 3KJ7A 3M3FA 1XC1A 4NEDA 3MPLA 2DQVA 2A5SA 3EHSA 5ELVA 3HN0A 2QMXA 5I58B 4MF3A 3AXFA 4EF1A 4GL8A 1VFEA 1ZIUA 4AQ4A 1H44A 1N3WA 3PGFA 3GBBA 2H98A 2ZYKA 4QFLA 2NXOA 3CFXA 1B05A 2HXWA 1OLAA 1DSNA 1NNFA 2XD3A 4DXBA 3MC2A 1O63A 4R2BA 4LA9A 1B51A 1Q1KA 4POXA 5EHSA 5KDTA 3VVDA 5CMMA 1NNPA 2D3IA 3ZKLA 4ZDMA 2F6PA 3VVEA 4XTCQ 1HSEA 1RYOA 1UTBB 1TXFA 5BUUA 3TTMA 2GH9A 3GBAA 3U93A 5IKBA 1IQ7A 2HEUA 4NF5A 3PMXA 3CFZA 3JYRA 4FAJA 3S2VA 2HCAA 4MLVA 1BKAA 2LAOA 1D3KA 4JB7A 1MXZA 4Q30B 1LAHE 5FHOA 4WXJA 4ZE9A 2UVHA 3QAXA 4G8HA 3ZKKA 3HHFA 1MH3A 4G68A 3S9NC 1QUIA 3RT8A 1SYIA 1JETA 2P2AA 3TDJA 2XX7A 3SERA 5CMBA 4ZEBA 4NF6B 2W7YA 1MPDA 3KFMA 5CMCA 4ZZEA 4DZ1A 3OO7A 1A40A 1I6BA 4YKIA 3C36A 4BDQA 5AA3A 3MVYA 4GOTA 4PETA 4GFRA 2XXVA 3G3GA 3IX1A 3H7MA 4C0RA 4NF4A 2PMSA 3VXBA 3FJGA 3Q28A 1IXHA 1MRPA 3SKPA 4WEPA 1QKAA 3A3CA 3H3GA 3C33A 3MJNA 1JW1A 2VHAA 4LQ5A 2ONRA 3OD7A 5H8SA 4HW8A 2NOOA 3FASA 3IJOB 3K4UA 4F2OA 1LBBA 3OXNA 2BJJX 3V83A 1MH4A 4EQ7A 1Y3NA 4N6PA 2XXXA 5JTYB 1B1HA 1FTLA 3G3KA 2IEEA 3G7WA 1WODA 4NWDA 5I84A 2PYYA 1D9VA 2QL3A 5DEXA 3N94A 4YAHX 1T0KA 5KDTB 5H8QA 4GIZA 1N76A 3BBRA 3CRBA 2XXYA 4LZ7A 4YU0A 1USYE 4WKMA 4JDFA 4KHZE 3S4UA 2RC8A 3SDFA 1NKXA 2F7AA 2F35A 3FD3A 3EHTA 4G68C 3N6TA 4RA1A 3IOWA 2DXYA 3TAJA 1RKMA 3KZGA 1URSA 4TLMB 4ZE8A 5ICTA 2REGA 4EXLA 1FQEA 1URDA 4U23A 3H4ZA 4KD5A 1S7YA 1DTZA 3Q26A 4QF9A 4G68B 3RQTA 1FQBA 1S50A 1MXUA 4F39A 4Q8RA 5H8HA 4RNSA 1B52A 1B2HA 4KFQA 3V5AA 2D5WA 5L8DA 2DE3A 5AA1A 1ZLQA 2VGQA 1LCFA 3QXMA 1MQDA 2OWTA 2AIXA 3ECRA 3QUFA 2Q88A 3O6HA 3MWBA 1POY1 5CMKA 4P11A 4GF8A 2I49A 3FVKA 3ILUB 1OQGA 4Z0IA 3ZSFA 3IB1A 2I3WA 2ZXTA 3CG1A 4R73A 4R9FA 1VR5A 3K6VA 2HZLA 1SDXA 1FTMA 5ITOA 1LFIA 1MM6A 5I59A 5F7VA 1ELJA 4RYAA 2V3TA 3FJ7A 3PPNA 2Q89A 4Q5TA 4ISUA 3RPWA 1XVXA 2PBWA 4KCCA 4DIGA 1ANFA 1FW0A 1PBQA 2F8DA 2NWJA 4ZEFA 4OZ9A 2O69A 1P1OA 5DEXB 3C31A 3M3KA 3PUVE 3E3KA 4H1XA 1N7XA 3K02A 4XXUA 3TTNA 2OZZA 3IB0A 1B7ZA 4JXIA 5DT6A 2Y7KA 3EQ1A 4PQJA 3THIA 2OJTA 4OERA 5TP9B 3K0VA 1USYH 3SETA 3BKIB 1O7TA 1B40A 4LONB 3CG3A 1A8EA 2QS4A 1Y3QA 1B4HA 3RLFE 1UQWA 2B3FA 2O6AA 4F3GA 4P0GA 4UA8A 4OFLA 4LUBA 4ZEIA 2NUVA 1EZPA 3W9VA 2QSXA 1PB7A 2O51A 2DVZA 3OMBA 1B9JA 2ONSA 1Y4CA 2I4CA 3R7XA 4R72A 1QKBA 2OK2A 5F1QA 1JQFA 1Z7ME 3IO6A 1OQHA 3PUXE 5H8HB 3O66A 4ZEDA 3U72A 3TPAA 2XXRA 2I58A 4DXUA 4U1OA 3QUJA 1B3LA 2HAUA 1XVYA 2RKMA 4F1UA 5B70A 2QJEA 5H8FB 3TCFA 5I2KB 1R9QA 1P1QA 4O3AA 5DVFA 5KCJB 1OMPA 4GVOA 4H65A 3USDA 2I0CA 1LSTA 4ZECA 5IAIA 2G93A 3RT6B 1LAXA 4AB6A 2OBGA 5H8NA 3G3HA 1XOCA 3CVGA 4NF6A 2UVGA 1FTOA 4BDOA 3MP8A 3LSFB 1LFGA 1M5EA 3ONMA 1H3DA 2G29A 1PBPA 4DXCA 4QSEA 1H43A 4LZ8A 1DPPA 2IA4A 2A5TB 3FUZA 5FTIA 5I2NB 2ONKE 4LVQA 4QFOA 2RINA 3LBSA 3MBPA 4PFUA 5I59B 2DWAA 5I56B 3KJTA 1QJMA 3C32A 4TQUQ 1JVXA 1OIBA 1A55A 2F36A 3K01A 3IOVA 4N13A 2AL4A 1BLFA 3MVZA 1MS7A 4GRKA 4BDMA 5FHMA 4QHQA 4RY1A 1AH5A 4M4GA 4OFOA 2Y7IA 2Z23A 4IO2A 4TLLB 3MZBA 2XD2A 1GV8A 3GZGA 2VD3A 1VSOA 3PUYE 2NVUB 1ZTYA 3DP8A 1MY3A 5KZTA 1QVSA 3E4RA 1XHYA 3FXQA 5JTYA 5DTBA 2PT2A 1EZ9A 1MXYA 1SW4A 3SEVA 4E0WA 4GQOA 2H9BA 1VE4A 1AIVA 3UGWA 3K1NA 1BIYA 1MPCA 4NE4A 4EF2A 4EQ9A 2XX8A 4GXSB 2OWSA 2Y7PA 3T9VA 1L5TA 1LB9A 2ZNUA 3C35A 1DPEA 4RPNA 1VFDA 4HTGA 3B7DA 1NFTA 1IXCA 1LAGE 3TTRA 2F34A 3D4CA 3N5LA 4H5GA 3PMVA 2H5YA 1Y20A 3KGCA 4HCWA 2YPNA 3JV9A 1IXGA 1H45A 3MZ9A 3MQ9A 5AA2A 2Y7RA 3IK6B 5H8NB 3OELA 3K00A 3K6UA 1JVYA 1O64A 4I8CA 4OMBA 4YICA 5LOMA 3IR1A 4IO3A 4ELQA 2ZMBA 1MQHA 3TMGA 1B3EA 1P99A 1IXIA 5EYFA 3T96B 4DE8A 4PFYA 1II5A 1F9BA 4IO4A 4G8NA 4OWDA 2F7CA 3L6HA 3G3FA 4H67A 4O3CA 2H99A 4MH5A 3QIMA 2V3UA 4FEBA 2F6GA 4YKKA 3TCGA 4DDDA 2XXUA 3I5OA 3SEYA 1Y3PA 3BFUA 3FXUA 4PFTA 2DWJA 1BP5A 5ITPA 1B3FA 5HBCA 4ELOA 1SYHA 1MG1A 4EUOA 3QSLA 3T66A 3A09A 3VE1B 4WEDA 2Z8EA 1LLSA 4F18A 3E13X 3HCQA 4ESWA 1SD3A 1JW4A 3C9HA 3HSTA 4BDNA 3FJMA 1M5CA 3O6GA 3V89B 4N07A 3LSXA 1GR2A 2O1MA 1SVXB 4UACA 3KBRA 3HO7A 1MXXA 1IUDA 1IITA 3KG2A 2XX9A 3TQWA 3GXAA 3T22A 1FQAA 2RF1A 4OESA 5AE4A 2B3BA 4OEUA 2ZYOA 3LR1A 4OEVA 4RXLA 4YB5A 1A7LA 5TP9A 4R6HA 4F3PA 1SBPA 2ZNSA 4C1UA 4XKNA 3UK4A 1MXWA 1HSJA 3DLNA 4G4PA 2I0BA 2DE4A 3EPEA 3TTLA 3Q25A 3CR9A 5BWJA 1B32A 3VLVA 4LP2B 1FQFA 3CI8A 1R9LA 2F7BA 4RK2A 4X1DA 3RN8A 5AA2B 5K2XA 2RCBA 4IY5A 1JEUA 4F3SA 3KOTA 4NTLA 1MXVA 2HFBA 1PC3A 2F78A 3OEKA 5H8FA 5I2KA 3HHGA 1QUJA 1SW5A 3K6XA 5KCJA 1AL3A 1FTJA 2B65A 2Z8DA 1NNKA 4X9TA 4F31B 2XXHA 2Q8JA 1M5BA 3FATA 2FA7A 3MP1A 4OYVA 3UN6A 3PD8A 2CMOA 3A3UA 1S9TA 3QK6A 5HM4B 4H0WA 1BTJA 4X48A 2DWHA 2A5TA 5I2NA 2XXTA 3MVWA 1GGGA 1LFHA 4U1ZA 4KYDA 5I56A 1MDQA 3MUQA 2GFEA 4JSOA 3TYHA 1GVCA 1EU8A 4U21A 3HPIA 2UYEA 4JWOA 1N04A 1FQDA 3H6UA 4ESXA 1P1NA 3PD9A 2RC9A 3Q29A 4NF8A 3EF7A 3FIRA 3PMWA 3SEWA 4K3FA 4FECA 1B0LA 3JZJA 3H6WA 4ELRA 4KQPA 4LQ2A 4OXVA 3IB2A 1OLCA 3TTKA 4RK9A 1ZJLA 4P0IA 1Y4TA 4X1BA 1B7UA 3I3VA 2GHAA 3L6GA 4RPOA 4DCXA 4QFKA 3CSGA 3KSXA 3PPPA 4FE8A 4QSCA 2HQ0A 4IGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YPN A;  3SEX A;  3FV1 A;  1SI1 A;  1URG A;  1POT A;  4OET A;  2PX1 A;  4EQB A;  3S9E A;  1MY1 A;  5CI5 A;  1SI0 A;  5DVI A;  1H76 A;  4GWO A;  2DYX A;  3VLW A;  2X7P A;  3R26 A;  3KSJ A;  2XXW A;  4YB7 A;  4I1D A;  4C1T A;  2Y7W A;  4GLI A;  1HSL A;  1TWY A;  1EZO A;  4ZZA A;  4FAT A;  2Q2A A;  3IOR A;  5CC2 A;  4BLA A;  1MY4 A;  2DOJ A;  2WKY A;  4KYS A;  3LUY A;  2VOZ A;  1GTK A;  3EHU A;  4U22 A;  5ICQ A;  2QMW A;  1TT1 A;  5DVJ A;  3TQL A;  2XXP A;  3G3J A;  4IO5 A;  3VVF A;  1Y1Z A;  2THI A;  3U1O A;  2QS2 A;  2E1S A;  1FTK A;  2QRY A;  1SW2 A;  1IEJ A;  4TOZ A;  5AA2 D;  1N84 A;  4QFN A;  3WAE A;  1NNT A;  1J1N A;  3K1P A;  1P1W A;  2ZYN A;  3FV2 A;  3KN7 A;  3TEL A;  1LGB C;  3IL1 B;  5J1D A;  5CRY A;  4ECF A;  3GLB A;  3ILT B;  3EN3 A;  4GXA A;  1FQC A;  1MY2 A;  4NF8 B;  3K1M A;  3MVX A;  3RNN A;  3PPQ A;  3M8U A;  3PPO A;  3HV1 A;  4QRZ A;  3T9X B;  4KPT A;  4OFJ A;  5DYH A;  4FIM A;  4YMB A;  5A5X A;  3CIJ A;  1UIU A;  4BDR A;  3PU5 A;  1MQJ A;  1DMB A;  1DOT A;  3UP9 A;  5JK4 A;  2UYF A;  2O7U A;  1JEV A;  4JSD A;  4LAT A;  2ZNT A;  4JWX A;  4IO6 A;  5I57 A;  5L9O A;  1IZ1 A;  2V3Q A;  3IO4 A;  4G8M A;  2DE2 A;  1Y9U A;  1I6A A;  5JEI A;  1M5D A;  3D4G A;  3WAF A;  1JNF A;  1AMF A;  2QS3 A;  2DVC A;  2Z8F A;  2P0S A;  1B0H A;  4KYE A;  4DCY A;  4OEN A;  4YZZ A;  4I9D A;  1DTG A;  1KWH A;  4QSD A;  1ZBM A;  3T93 B;  3ZS6 A;  3TFL A;  3O28 A;  3PV0 E;  1LCT A;  4POW A;  4YKJ A;  4FED A;  4XKR A;  4PFW A;  5AA4 A;  4FJP A;  5CBR A;  5TPA B;  1B58 A;  5EHM A;  2F97 A;  2Y84 A;  3IOT A;  4U4X A;  3V8X B;  2R9J A;  1M5F A;  3IAZ A;  4YKP A;  3DM0 A;  2ESN A;  2P1S A;  3UIF A;  1NH8 A;  4U2R A;  4U4S A;  2ABH A;  3DP6 A;  4AB5 A;  4R6K A;  4G2Z A;  1PEB A;  1PB9 A;  4IB2 A;  2O84 X;  4JBZ A;  1Y1M A;  4BDL A;  3PUZ E;  2DWI A;  4GL0 A;  3RTW B;  2YLN A;  5TU0 A;  2R71 A;  3F11 A;  3U92 A;  4Z7E A;  3C34 A;  3CSB A;  1ZKB A;  4LZ5 A;  3TUS A;  3W15 C;  3VDF A;  4L17 A;  3TKD A;  4F1Y A;  1B1X A;  2AYS A;  2DP8 A;  4E0X A;  4M1V A;  4FOR A;  1A54 A;  5ISU A;  1YAE A;  1N0T A;  2FNC A;  3RY3 A;  3M3L A;  3S9M C;  1Z7N E;  4YMA A;  3MP6 A;  5A5X B;  2V25 A;  1Q35 A;  2O68 A;  5K2Y A;  3KN3 A;  2PT1 A;  2CZL A;  4F29 A;  3O6I A;  1B5I A;  4KR5 A;  3T9U A;  3FVO A;  5I57 B;  3B6Q A;  3N6U A;  3LC8 A;  3ODB A;  2VP1 A;  3OO8 A;  4PE5 B;  1RYX A;  3U8Q A;  2GRV A;  4F3B A;  1MDP 1;  3MZ1 A;  3DP4 A;  4MBP A;  2REJ A;  2RC7 A;  4O3B A;  2I48 A;  3H06 B;  3B6W A;  1B7H A;  3O29 A;  1LB8 A;  1R1N A;  4I62 A;  1QW0 A;  3VLU A;  2M8C A;  1QUL A;  4ONY A;  4HS7 A;  3OSQ A;  4NF5 B;  2RCA A;  4OHN A;  2OLB A;  5AA4 B;  4H8J A;  5CBS A;  2DSF A;  4OTE A;  4EDP A;  3IJX B;  1US5 A;  3KOS A;  3Q27 A;  1UIV A;  3R6U A;  2E0S A;  3S9L C;  2HAV A;  3OSR A;  3LSW A;  4NWC A;  1AOV A;  2UVI A;  1CE2 A;  4IGT A;  4ZS9 A;  2O7I A;  1ZMG A;  1R6Z A;  2UVJ A;  4R9G A;  4IY6 A;  4HCY A;  3FVN A;  4IO7 A;  4YB6 A;  1B6H A;  1UTH A;  3O2A A;  1YTV A;  4MFI A;  3I6V A;  3C4M A;  1A8F A;  1WDN A;  3TEP A;  4NF4 B;  3TZA A;  1LBC A;  1JW5 A;  4JWY A;  4KCD A;  4H5F A;  1B3H A;  4OVJ A;  1MY0 A;  3H03 A;  3FGS A;  2PVU A;  3TOD A;  1B5H A;  1P1U A;  1ATG A;  2D21 A;  2H4I A;  2ZYM A;  1YCJ A;  2XXI A;  2QPQ A;  4R74 A;  3MAM A;  2FYI A;  4F22 A;  2GHB A;  5B7D A;  3FXR A;  3DEL B;  1I6Q A;  3H6T A;  1WVJ A;  2OCU A;  1QUK A;  3TCH A;  3VFJ A;  5L9M A;  3O97 A;  4DLD A;  4R75 A;  3UA8 A;  3K2D A;  4EXK A;  1ZU0 A;  4F1V A;  3LSL A;  3FVG A;  1EH3 A;  4H8I A;  3P7I A;  4QFP A;  1I69 A;  5I58 A;  3VV5 A;  3RTF B;  3KN8 A;  3K6W A;  4KI0 E;  2O1L A;  4Q0C A;  5H8Q B;  1IIW A;  5HPQ A;  3W9W A;  4NMY A;  1US4 A;  2I4B A;  3FZV A;  3OEM A;  3OO9 A;  2X7Q A;  5CM6 A;  1N3X A;  3O9P A;  2V84 A;  3MW0 A;  1FCK A;  3E9X A;  3G3I A;  3UOR A;  1B46 A;  4MLQ A;  4THI A;  2Q9T A;  5FHN A;  2R6G E;  1A99 A;  2QS1 A;  4R2F A;  1B5J A;  2ANJ A;  2AL5 A;  2UXA A;  4ZEK A;  3T9H B;  1NH7 A;  3VXC A;  3OEN A;  1MPB A;  2DXR A;  2YJP A;  2KLF A;  2I3V A;  1OVT A;  1XS5 A;  2I6E A;  2HZK A;  1UTB A;  1B4Z A;  3RGY A;  4XIG Q;  3B6T A;  1TFA A;  4XKQ A;  4GD5 A;  1XT8 A;  4OQO A;  1PB8 A;  4ELP A;  1LAF E;  4F2Q A;  1D9Y A;  5TPA A;  4F19 A;  3MPK A;  1SW1 A;  1UTH B;  2ALU A;  1NMU A;  1TFD A;  3BFT A;  1PDA A;  3SEU A;  1MM7 A;  4RJZ A;  4H6D A;  2VD2 A;  5FTH A;  3OO6 A;  2XHD A;  4G77 A;  2F5X A;  1MQI A;  3CFL A;  1N7W A;  4PP0 A;  3PUW E;  2X26 A;  2Q2C A;  3KEI A;  3IOU A;  4XKP A;  1CB6 A;  1B3G A;  3U94 A;  5L9S A;  2H25 A;  3RUM A;  1D4N A;  3QYT A;  5M2V A;  2V93 A;  1NL5 A;  2DS9 A;  3SES A;  2Z22 A;  3H6V A;  4R6Y A;  4ND9 A;  3N26 A;  1OVB A;  3PPR A;  1MQG A;  1SQY A;  2XXQ A;  3OOA A;  3KJ7 A;  3M3F A;  1XC1 A;  4NED A;  3MPL A;  2DQV A;  2A5S A;  3EHS A;  5ELV A;  3HN0 A;  2QMX A;  5I58 B;  4MF3 A;  3AXF A;  4EF1 A;  4GL8 A;  1VFE A;  1ZIU A;  4AQ4 A;  1H44 A;  1N3W A;  3PGF A;  3GBB A;  2H98 A;  2ZYK A;  4QFL A;  2NXO A;  3CFX A;  1B05 A;  2HXW A;  1OLA A;  1DSN A;  1NNF A;  2XD3 A;  4DXB A;  3MC2 A;  1O63 A;  4R2B A;  4LA9 A;  1B51 A;  1Q1K A;  4POX A;  5EHS A;  5KDT A;  3VVD A;  5CMM A;  1NNP A;  2D3I A;  3ZKL A;  4ZDM A;  2F6P A;  3VVE A;  4XTC Q;  1HSE A;  1RYO A;  1UTB B;  1TXF A;  5BUU A;  3TTM A;  2GH9 A;  3GBA A;  3U93 A;  5IKB A;  1IQ7 A;  2HEU A;  4NF5 A;  3PMX A;  3CFZ A;  3JYR A;  4FAJ A;  3S2V A;  2HCA A;  4MLV A;  1BKA A;  2LAO A;  1D3K A;  4JB7 A;  1MXZ A;  4Q30 B;  1LAH E;  5FHO A;  4WXJ A;  4ZE9 A;  2UVH A;  3QAX A;  4G8H A;  3ZKK A;  3HHF A;  1MH3 A;  4G68 A;  3S9N C;  1QUI A;  3RT8 A;  1SYI A;  1JET A;  2P2A A;  3TDJ A;  2XX7 A;  3SER A;  5CMB A;  4ZEB A;  4NF6 B;  2W7Y A;  1MPD A;  3KFM A;  5CMC A;  4ZZE A;  4DZ1 A;  3OO7 A;  1A40 A;  1I6B A;  4YKI A;  3C36 A;  4BDQ A;  5AA3 A;  3MVY A;  4GOT A;  4PET A;  4GFR A;  2XXV A;  3G3G A;  3IX1 A;  3H7M A;  4C0R A;  4NF4 A;  2PMS A;  3VXB A;  3FJG A;  3Q28 A;  1IXH A;  1MRP A;  3SKP A;  4WEP A;  1QKA A;  3A3C A;  3H3G A;  3C33 A;  3MJN A;  1JW1 A;  2VHA A;  4LQ5 A;  2ONR A;  3OD7 A;  5H8S A;  4HW8 A;  2NOO A;  3FAS A;  3IJO B;  3K4U A;  4F2O A;  1LBB A;  3OXN A;  2BJJ X;  3V83 A;  1MH4 A;  4EQ7 A;  1Y3N A;  4N6P A;  2XXX A;  5JTY B;  1B1H A;  1FTL A;  3G3K A;  2IEE A;  3G7W A;  1WOD A;  4NWD A;  5I84 A;  2PYY A;  1D9V A;  2QL3 A;  5DEX A;  3N94 A;  4YAH X;  1T0K A;  5KDT B;  5H8Q A;  4GIZ A;  1N76 A;  3BBR A;  3CRB A;  2XXY A;  4LZ7 A;  4YU0 A;  1USY E;  4WKM A;  4JDF A;  4KHZ E;  3S4U A;  2RC8 A;  3SDF A;  1NKX A;  2F7A A;  2F35 A;  3FD3 A;  3EHT A;  4G68 C;  3N6T A;  4RA1 A;  3IOW A;  2DXY A;  3TAJ A;  1RKM A;  3KZG A;  1URS A;  4TLM B;  4ZE8 A;  5ICT A;  2REG A;  4EXL A;  1FQE A;  1URD A;  4U23 A;  3H4Z A;  4KD5 A;  1S7Y A;  1DTZ A;  3Q26 A;  4QF9 A;  4G68 B;  3RQT A;  1FQB A;  1S50 A;  1MXU A;  4F39 A;  4Q8R A;  5H8H A;  4RNS A;  1B52 A;  1B2H A;  4KFQ A;  3V5A A;  2D5W A;  5L8D A;  2DE3 A;  5AA1 A;  1ZLQ A;  2VGQ A;  1LCF A;  3QXM A;  1MQD A;  2OWT A;  2AIX A;  3ECR A;  3QUF A;  2Q88 A;  3O6H A;  3MWB A;  1POY 1;  5CMK A;  4P11 A;  4GF8 A;  2I49 A;  3FVK A;  3ILU B;  1OQG A;  4Z0I A;  3ZSF A;  3IB1 A;  2I3W A;  2ZXT A;  3CG1 A;  4R73 A;  4R9F A;  1VR5 A;  3K6V A;  2HZL A;  1SDX A;  1FTM A;  5ITO A;  1LFI A;  1MM6 A;  5I59 A;  5F7V A;  1ELJ A;  4RYA A;  2V3T A;  3FJ7 A;  3PPN A;  2Q89 A;  4Q5T A;  4ISU A;  3RPW A;  1XVX A;  2PBW A;  4KCC A;  4DIG A;  1ANF A;  1FW0 A;  1PBQ A;  2F8D A;  2NWJ A;  4ZEF A;  4OZ9 A;  2O69 A;  1P1O A;  5DEX B;  3C31 A;  3M3K A;  3PUV E;  3E3K A;  4H1X A;  1N7X A;  3K02 A;  4XXU A;  3TTN A;  2OZZ A;  3IB0 A;  1B7Z A;  4JXI A;  5DT6 A;  2Y7K A;  3EQ1 A;  4PQJ A;  3THI A;  2OJT A;  4OER A;  5TP9 B;  3K0V A;  1USY H;  3SET A;  3BKI B;  1O7T A;  1B40 A;  4LON B;  3CG3 A;  1A8E A;  2QS4 A;  1Y3Q A;  1B4H A;  3RLF E;  1UQW A;  2B3F A;  2O6A A;  4F3G A;  4P0G A;  4UA8 A;  4OFL A;  4LUB A;  4ZEI A;  2NUV A;  1EZP A;  3W9V A;  2QSX A;  1PB7 A;  2O51 A;  2DVZ A;  3OMB A;  1B9J A;  2ONS A;  1Y4C A;  2I4C A;  3R7X A;  4R72 A;  1QKB A;  2OK2 A;  5F1Q A;  1JQF A;  1Z7M E;  3IO6 A;  1OQH A;  3PUX E;  5H8H B;  3O66 A;  4ZED A;  3U72 A;  3TPA A;  2XXR A;  2I58 A;  4DXU A;  4U1O A;  3QUJ A;  1B3L A;  2HAU A;  1XVY A;  2RKM A;  4F1U A;  5B70 A;  2QJE A;  5H8F B;  3TCF A;  5I2K B;  1R9Q A;  1P1Q A;  4O3A A;  5DVF A;  5KCJ B;  1OMP A;  4GVO A;  4H65 A;  3USD A;  2I0C A;  1LST A;  4ZEC A;  5IAI A;  2G93 A;  3RT6 B;  1LAX A;  4AB6 A;  2OBG A;  5H8N A;  3G3H A;  1XOC A;  3CVG A;  4NF6 A;  2UVG A;  1FTO A;  4BDO A;  3MP8 A;  3LSF B;  1LFG A;  1M5E A;  3ONM A;  1H3D A;  2G29 A;  1PBP A;  4DXC A;  4QSE A;  1H43 A;  4LZ8 A;  1DPP A;  2IA4 A;  2A5T B;  3FUZ A;  5FTI A;  5I2N B;  2ONK E;  4LVQ A;  4QFO A;  2RIN A;  3LBS A;  3MBP A;  4PFU A;  5I59 B;  2DWA A;  5I56 B;  3KJT A;  1QJM A;  3C32 A;  4TQU Q;  1JVX A;  1OIB A;  1A55 A;  2F36 A;  3K01 A;  3IOV A;  4N13 A;  2AL4 A;  1BLF A;  3MVZ A;  1MS7 A;  4GRK A;  4BDM A;  5FHM A;  4QHQ A;  4RY1 A;  1AH5 A;  4M4G A;  4OFO A;  2Y7I A;  2Z23 A;  4IO2 A;  4TLL B;  3MZB A;  2XD2 A;  1GV8 A;  3GZG A;  2VD3 A;  1VSO A;  3PUY E;  2NVU B;  1ZTY A;  3DP8 A;  1MY3 A;  5KZT A;  1QVS A;  3E4R A;  1XHY A;  3FXQ A;  5JTY A;  5DTB A;  2PT2 A;  1EZ9 A;  1MXY A;  1SW4 A;  3SEV A;  4E0W A;  4GQO A;  2H9B A;  1VE4 A;  1AIV A;  3UGW A;  3K1N A;  1BIY A;  1MPC A;  4NE4 A;  4EF2 A;  4EQ9 A;  2XX8 A;  4GXS B;  2OWS A;  2Y7P A;  3T9V A;  1L5T A;  1LB9 A;  2ZNU A;  3C35 A;  1DPE A;  4RPN A;  1VFD A;  4HTG A;  3B7D A;  1NFT A;  1IXC A;  1LAG E;  3TTR A;  2F34 A;  3D4C A;  3N5L A;  4H5G A;  3PMV A;  2H5Y A;  1Y20 A;  3KGC A;  4HCW A;  2YPN A;  3JV9 A;  1IXG A;  1H45 A;  3MZ9 A;  3MQ9 A;  5AA2 A;  2Y7R A;  3IK6 B;  5H8N B;  3OEL A;  3K00 A;  3K6U A;  1JVY A;  1O64 A;  4I8C A;  4OMB A;  4YIC A;  5LOM A;  3IR1 A;  4IO3 A;  4ELQ A;  2ZMB A;  1MQH A;  3TMG A;  1B3E A;  1P99 A;  1IXI A;  5EYF A;  3T96 B;  4DE8 A;  4PFY A;  1II5 A;  1F9B A;  4IO4 A;  4G8N A;  4OWD A;  2F7C A;  3L6H A;  3G3F A;  4H67 A;  4O3C A;  2H99 A;  4MH5 A;  3QIM A;  2V3U A;  4FEB A;  2F6G A;  4YKK A;  3TCG A;  4DDD A;  2XXU A;  3I5O A;  3SEY A;  1Y3P A;  3BFU A;  3FXU A;  4PFT A;  2DWJ A;  1BP5 A;  5ITP A;  1B3F A;  5HBC A;  4ELO A;  1SYH A;  1MG1 A;  4EUO A;  3QSL A;  3T66 A;  3A09 A;  3VE1 B;  4WED A;  2Z8E A;  1LLS A;  4F18 A;  3E13 X;  3HCQ A;  4ESW A;  1SD3 A;  1JW4 A;  3C9H A;  3HST A;  4BDN A;  3FJM A;  1M5C A;  3O6G A;  3V89 B;  4N07 A;  3LSX A;  1GR2 A;  2O1M A;  1SVX B;  4UAC A;  3KBR A;  3HO7 A;  1MXX A;  1IUD A;  1IIT A;  3KG2 A;  2XX9 A;  3TQW A;  3GXA A;  3T22 A;  1FQA A;  2RF1 A;  4OES A;  5AE4 A;  2B3B A;  4OEU A;  2ZYO A;  3LR1 A;  4OEV A;  4RXL A;  4YB5 A;  1A7L A;  5TP9 A;  4R6H A;  4F3P A;  1SBP A;  2ZNS A;  4C1U A;  4XKN A;  3UK4 A;  1MXW A;  1HSJ A;  3DLN A;  4G4P A;  2I0B A;  2DE4 A;  3EPE A;  3TTL A;  3Q25 A;  3CR9 A;  5BWJ A;  1B32 A;  3VLV A;  4LP2 B;  1FQF A;  3CI8 A;  1R9L A;  2F7B A;  4RK2 A;  4X1D A;  3RN8 A;  5AA2 B;  5K2X A;  2RCB A;  4IY5 A;  1JEU A;  4F3S A;  3KOT A;  4NTL A;  1MXV A;  2HFB A;  1PC3 A;  2F78 A;  3OEK A;  5H8F A;  5I2K A;  3HHG A;  1QUJ A;  1SW5 A;  3K6X A;  5KCJ A;  1AL3 A;  1FTJ A;  2B65 A;  2Z8D A;  1NNK A;  4X9T A;  4F31 B;  2XXH A;  2Q8J A;  1M5B A;  3FAT A;  2FA7 A;  3MP1 A;  4OYV A;  3UN6 A;  3PD8 A;  2CMO A;  3A3U A;  1S9T A;  3QK6 A;  5HM4 B;  4H0W A;  1BTJ A;  4X48 A;  2DWH A;  2A5T A;  5I2N A;  2XXT A;  3MVW A;  1GGG A;  1LFH A;  4U1Z A;  4KYD A;  5I56 A;  1MDQ A;  3MUQ A;  2GFE A;  4JSO A;  3TYH A;  1GVC A;  1EU8 A;  4U21 A;  3HPI A;  2UYE A;  4JWO A;  1N04 A;  1FQD A;  3H6U A;  4ESX A;  1P1N A;  3PD9 A;  2RC9 A;  3Q29 A;  4NF8 A;  3EF7 A;  3FIR A;  3PMW A;  3SEW A;  4K3F A;  4FEC A;  1B0L A;  3JZJ A;  3H6W A;  4ELR A;  4KQP A;  4LQ2 A;  4OXV A;  3IB2 A;  1OLC A;  3TTK A;  4RK9 A;  1ZJL A;  4P0I A;  1Y4T A;  4X1B A;  1B7U A;  3I3V A;  2GHA A;  3L6G A;  4RPO A;  4DCX A;  4QFK A;  3CSG A;  3KSX A;  3PPP A;  4FE8 A;  4QSC A;  2HQ0 A;  4IGR A; 
#chains in the Genus database with same CATH topology
 1YPN A;  3SEX A;  3FV1 A;  1SI1 A;  1URG A;  1POT A;  4OET A;  4NF0 A;  2PX1 A;  4EQB A;  3S9E A;  1MY1 A;  5CI5 A;  1SI0 A;  5DVI A;  1H76 A;  4GWO A;  2DYX A;  3VLW A;  2X7P A;  3R26 A;  3KSJ A;  2XXW A;  4YB7 A;  4I1D A;  4C1T A;  2Y7W A;  4GLI A;  1HSL A;  1TWY A;  1EZO A;  4ZZA A;  4FAT A;  3MST A;  2Q2A A;  3IOR A;  5CC2 A;  4BLA A;  2WBD A;  1MY4 A;  2ZZV A;  2DOJ A;  2XWV A;  2WKY A;  4KYS A;  3LUY A;  2VOZ A;  4N81 A;  1GTK A;  3EHU A;  4U22 A;  5ICQ A;  1FPK A;  2QMW A;  1TT1 A;  1FPF A;  5DVJ A;  3TQL A;  2XXP A;  3G3J A;  4IO5 A;  4N8G A;  4PF6 A;  3VVF A;  1Y1Z A;  2THI A;  2PFY A;  3U1O A;  2QS2 A;  2E1S A;  1FTK A;  2QRY A;  1IMF A;  1SW2 A;  1LBW A;  1IEJ A;  2VPN A;  4TOZ A;  5AA2 D;  1N84 A;  4QFN A;  3WAE A;  1NNT A;  1J1N A;  3K1P A;  1P1W A;  2ZYN A;  3FV2 A;  3KN7 A;  3TEL A;  2F3B A;  1LGB C;  3IL1 B;  5J1D A;  5CRY A;  1FRP A;  4ECF A;  3GLB A;  3ILT B;  2FVZ A;  3EN3 A;  4GXA A;  1FQC A;  1MY2 A;  4MEV A;  4NF8 B;  3K1M A;  3MVX A;  3RNN A;  3PPQ A;  3M8U A;  2XWI A;  3PPO A;  3HV1 A;  2JJK A;  4QRZ A;  3T9X B;  4KPT A;  4OFJ A;  5DYH A;  4FIM A;  4YMB A;  5I3S A;  1NV6 A;  5A5X A;  3CIJ A;  4GWW A;  1FPE A;  1UIU A;  4BDR A;  3PU5 A;  4O7M A;  4H45 A;  1MQJ A;  1DMB A;  1DOT A;  3UP9 A;  5JK4 A;  2UYF A;  2O7U A;  1JEV A;  4JSD A;  4LAT A;  2ZNT A;  4JWX A;  4IO6 A;  5I57 A;  5L9O A;  1BK4 A;  1IZ1 A;  2V3Q A;  1FPI A;  3IO4 A;  4G8M A;  5IZ3 B;  2DE2 A;  1Y9U A;  1I6A A;  5JEI A;  1M5D A;  4JVI A;  3D4G A;  3WAF A;  1JNF A;  2L5V A;  1AMF A;  2QS3 A;  2DVC A;  2Z8F A;  2P0S A;  1B0H A;  4KYE A;  4DCY A;  2MKZ A;  4OEN A;  4YZZ A;  4I9D A;  1DTG A;  1KWH A;  4PGN A;  4QSD A;  1ZBM A;  2OWZ A;  3T93 B;  3MYU A;  4OVS A;  5ET8 A;  5ET7 A;  3ZS6 A;  3TFL A;  3O28 A;  3PV0 E;  1LCT A;  4POW A;  4YKJ A;  4FED A;  4XKR A;  4PFW A;  5AA4 A;  4FJP A;  5CBR A;  5TPA B;  1B58 A;  5EHM A;  4PCD A;  2F97 A;  2Y84 A;  3IOT A;  4U4X A;  3V8X B;  2R9J A;  1M5F A;  3IAZ A;  4YKP A;  3DM0 A;  2ESN A;  2P1S A;  3UIF A;  1NH8 A;  1EYJ A;  4U2R A;  4U4S A;  2ABH A;  3DP6 A;  4AB5 A;  4R6K A;  4G2Z A;  1PEB A;  1PB9 A;  4IB2 A;  2O84 X;  4JBZ A;  1Y1M A;  4BDL A;  3PUZ E;  2DWI A;  4GL0 A;  3RTW B;  2YLN A;  5TU0 A;  2R71 A;  3F11 A;  4MAG A;  3U92 A;  4Z7E A;  1INP A;  4OVT A;  2WYK A;  3C34 A;  4XFE A;  3CSB A;  1ZKB A;  4LZ5 A;  3TUS A;  4GWS A;  3W15 C;  3VDF A;  4L17 A;  3IFC A;  4OVR A;  3TKD A;  4GBV A;  4F1Y A;  1B1X A;  2AYS A;  2DP8 A;  4E0X A;  4M1V A;  4FOR A;  1A54 A;  5ISU A;  2ZZW A;  1YAE A;  1N0T A;  2FNC A;  3RY3 A;  3M3L A;  3S9M C;  1CNQ A;  1Z7N E;  4YMA A;  3MP6 A;  5A5X B;  5DW8 A;  2V25 A;  1Q35 A;  2O68 A;  5K2Y A;  2B4M A;  3KN3 A;  1LBZ A;  2PT1 A;  2CZL A;  4PAI A;  4F29 A;  3O6I A;  1B5I A;  4KR5 A;  3T9U A;  3FVO A;  5I57 B;  3B6Q A;  3N6U A;  3LC8 A;  3ODB A;  2VP1 A;  3OO8 A;  4PE5 B;  1RYX A;  3U8Q A;  2GRV A;  4F3B A;  1MDP 1;  1FPD A;  3MZ1 A;  3DP4 A;  4MBP A;  2REJ A;  4P1L A;  2RC7 A;  4O3B A;  2I48 A;  3H06 B;  1LEV A;  3B6W A;  3ROJ A;  1B7H A;  3O29 A;  1LB8 A;  1R1N A;  4I62 A;  1QW0 A;  3VLU A;  2M8C A;  4MNC A;  1QUL A;  4ONY A;  4HS7 A;  3OSQ A;  4NF5 B;  1SPI A;  2RCA A;  4OHN A;  2OLB A;  5AA4 B;  1LBY A;  4H8J A;  5CBS A;  1QGX A;  2DSF A;  4OTE A;  4EDP A;  3A29 A;  3KC1 A;  3IJX B;  1US5 A;  3KOS A;  3Q27 A;  4H46 A;  1UIV A;  3R6U A;  2E0S A;  3S9L C;  2HAV A;  3OSR A;  3LSW A;  4NWC A;  1AOV A;  1DK4 A;  2UVI A;  1CE2 A;  4IGT A;  4ZS9 A;  3HFU A;  2R8T A;  2O7I A;  1ZMG A;  1R6Z A;  1YYZ A;  2UVJ A;  4R9G A;  4IY6 A;  4GBW A;  2FIE A;  4HCY A;  3FVN A;  3GYY A;  4IO7 A;  4YB6 A;  4XF5 A;  1Q9D A;  4X04 A;  1B6H A;  1UTH A;  4GWZ A;  3O2A A;  1YTV A;  4MFI A;  3I6V A;  3C4M A;  2WBB A;  1A8F A;  1WDN A;  3TEP A;  4NF4 B;  3TZA A;  4LN5 A;  1LBC A;  1JW5 A;  4JWY A;  4KCD A;  4H5F A;  1B3H A;  4OVJ A;  1MY0 A;  3H03 A;  3FGS A;  2PVU A;  1JP4 A;  2Q74 A;  3TOD A;  1B5H A;  1P1U A;  1ATG A;  2D21 A;  4MIJ A;  2H4I A;  2ZYM A;  4MNI A;  1YCJ A;  2XXI A;  2QPQ A;  4R74 A;  3MAM A;  2FYI A;  4F22 A;  2GHB A;  5B7D A;  3FXR A;  3DEL B;  1I6Q A;  3H6T A;  4FBP A;  1WVJ A;  2OCU A;  4I3E A;  1QUK A;  3TCH A;  3VFJ A;  5L9M A;  2XWK A;  3O97 A;  4DLD A;  4R75 A;  3UA8 A;  3K2D A;  4EXK A;  1ZU0 A;  4F1V A;  4PFI A;  2CEX A;  3LSL A;  1KA1 A;  3FVG A;  1EH3 A;  4H8I A;  2BJI A;  3P7I A;  4QFP A;  1I69 A;  5I58 A;  3VV5 A;  3RTF B;  3KN8 A;  3K6W A;  4KI0 E;  2O1L A;  4Q0C A;  3T0J A;  5H8Q B;  1IIW A;  5HPQ A;  3W9W A;  4NMY A;  1US4 A;  2I4B A;  3FZV A;  3OEM A;  3OO9 A;  2X7Q A;  5CM6 A;  1N3X A;  3O9P A;  2V84 A;  3MW0 A;  1FCK A;  3E9X A;  3G3I A;  3UOR A;  1B46 A;  4MLQ A;  4THI A;  2P3N A;  2Q9T A;  4NQ8 A;  5FHN A;  2R6G E;  1A99 A;  2QS1 A;  4R2F A;  1B5J A;  2ANJ A;  2AL5 A;  3T1B A;  2UXA A;  4ZEK A;  3T9H B;  1NH7 A;  3VXC A;  5EQA A;  3OEN A;  1MPB A;  2DXR A;  2YJP A;  2KLF A;  2I3V A;  1OVT A;  1XS5 A;  2I6E A;  2HZK A;  1NV0 A;  1UTB A;  1B4Z A;  3RGY A;  4XIG Q;  3B6T A;  4N4U A;  1TFA A;  4XKQ A;  4GD5 A;  3LUZ A;  1DBZ A;  1XT8 A;  4P9K A;  4OQO A;  4JVC A;  1PB8 A;  4ELP A;  1LAF E;  4F2Q A;  1D9Y A;  2Y5K A;  5TPA A;  3MPK A;  4F19 A;  4MJO A;  1SW1 A;  1UTH B;  3FBP A;  2ALU A;  1NMU A;  3D1R A;  1TFD A;  3BFT A;  1PDA A;  4NHB A;  3SEU A;  1MM7 A;  3B50 A;  4RJZ A;  4H6D A;  1DCU A;  2VD2 A;  5EQ9 A;  5FTH A;  3OO6 A;  2XHD A;  4G77 A;  2F5X A;  4MMP A;  1MQI A;  3CFL A;  1N7W A;  4PP0 A;  3PUW E;  2X26 A;  2Q2C A;  3KEI A;  4P47 A;  3IOU A;  2CEY A;  4G61 A;  1CB6 A;  4XKP A;  1B3G A;  3U94 A;  5L9S A;  2H25 A;  3RUM A;  1D4N A;  3QYT A;  5M2V A;  2V93 A;  1NL5 A;  2DS9 A;  1K9Y A;  2VT5 A;  3SES A;  2Z22 A;  3H6V A;  4R6Y A;  4ND9 A;  3N26 A;  1OVB A;  3PPR A;  1MQG A;  1SQY A;  2XXQ A;  3OOA A;  3KJ7 A;  1NV7 A;  3M3F A;  1XC1 A;  4NED A;  3MPL A;  2DQV A;  1FBF A;  2A5S A;  3EHS A;  5ELV A;  3HN0 A;  1NV3 A;  2QMX A;  5I58 B;  4MF3 A;  5FBP A;  3AXF A;  4EF1 A;  4GL8 A;  1VFE A;  1ZIU A;  4AQ4 A;  2WEF A;  1H44 A;  1N3W A;  3PGF A;  3GBB A;  2H98 A;  2WYP A;  2ZYK A;  4NX1 A;  4QFL A;  4PBH A;  2NXO A;  3CFX A;  2V4C A;  1B05 A;  2HXW A;  1OLA A;  4AS5 A;  1G0I A;  1DSN A;  1NNF A;  2QFL A;  2XD3 A;  4DXB A;  3MC2 A;  1O63 A;  4R2B A;  4LA9 A;  1B51 A;  1Q1K A;  4POX A;  4PFR A;  5EHS A;  5KDT A;  4JVD A;  3VVD A;  5CMM A;  4N17 A;  1NNP A;  2D3I A;  1FBC A;  2XXK A;  4GX6 A;  3ZKL A;  4ZDM A;  2F6P A;  3VVE A;  4OAN A;  4XTC Q;  1NV4 A;  1HSE A;  1RYO A;  1UTB B;  3CHG A;  4PAF A;  1TXF A;  5BUU A;  3TTM A;  1NV1 A;  2GH9 A;  3GBA A;  3U93 A;  5IKB A;  1IQ7 A;  2HEU A;  4GX4 A;  4NF5 A;  3PMX A;  3CFZ A;  3JYR A;  1IMD A;  4FAJ A;  3S2V A;  2HCA A;  4MLV A;  1BKA A;  2LAO A;  5EYG A;  1D3K A;  4JB7 A;  1MXZ A;  4Q30 B;  1LAH E;  5FHO A;  4NG7 A;  4KXP A;  2B4L A;  5ESY A;  4WXJ A;  4ZE9 A;  2UVH A;  3QAX A;  4G8H A;  3ZKK A;  3HHF A;  1MH3 A;  4G68 A;  3S9N C;  1QUI A;  1LBV A;  3RT8 A;  1SYI A;  1JET A;  2P2A A;  3TDJ A;  3RPL B;  2XX7 A;  3SER A;  5CMB A;  4ZEB A;  1NUW A;  4NF6 B;  2W7Y A;  1MPD A;  3KFM A;  5CMC A;  4ZZE A;  4DZ1 A;  3OO7 A;  1A40 A;  1I6B A;  4YKI A;  3C36 A;  4BDQ A;  5AA3 A;  3MVY A;  4PDH A;  4PDD A;  4GOT A;  4PET A;  4GFR A;  2XXV A;  3G3G A;  4QBA A;  3IX1 A;  3H7M A;  4C0R A;  4NF4 A;  2PMS A;  3VXB A;  3FJG A;  3Q28 A;  1IXH A;  2OX3 A;  1MRP A;  5IGA A;  5IZ1 A;  3SKP A;  2HHM A;  4WEP A;  1QKA A;  3A3C A;  3H3G A;  3C33 A;  3MJN A;  1JW1 A;  2VHA A;  4LQ5 A;  2ONR A;  3OD7 A;  5H8S A;  4X8R A;  4HW8 A;  4GWU A;  2PFZ A;  2NOO A;  3FAS A;  3IJO B;  4OVQ A;  3K4U A;  4F2O A;  1LBB A;  3OXN A;  2QVR A;  4HE2 A;  2BJJ X;  3V83 A;  2KR0 A;  1MH4 A;  4EQ7 A;  1Y3N A;  4N6P A;  2XXX A;  5JTY B;  1B1H A;  1FTL A;  3G3K A;  2IEE A;  3G7W A;  1WOD A;  3NOH A;  2WX9 A;  4NWD A;  5I84 A;  2PYY A;  1D9V A;  2QL3 A;  5DEX A;  3N94 A;  4YAH X;  1T0K A;  5KDT B;  4PC9 A;  5H8Q A;  4GIZ A;  1N76 A;  1NUY A;  1FBD A;  3BBR A;  3CRB A;  2XXY A;  1NV2 A;  4LZ7 A;  4YU0 A;  1USY E;  4WKM A;  4JDF A;  4XEQ A;  4KHZ E;  3S4U A;  2RC8 A;  4PTK A;  3SDF A;  1NKX A;  2F7A A;  2F35 A;  3FD3 A;  2F3D A;  3EHT A;  2CZK A;  4G68 C;  3N6T A;  1IMA A;  4RA1 A;  4O8M A;  3IOW A;  1FTA A;  2DXY A;  1RKM A;  3TAJ A;  3KZG A;  1URS A;  4TLM B;  4ZE8 A;  5ICT A;  2REG A;  1EYI A;  4EXL A;  1FQE A;  1URD A;  4U23 A;  3H4Z A;  4KD5 A;  1S7Y A;  1DTZ A;  2CZH A;  3Q26 A;  4QF9 A;  4G68 B;  3RQT A;  1FQB A;  1S50 A;  1MXU A;  4F39 A;  4Q8R A;  5H8H A;  4RNS A;  3RYD A;  5J16 A;  4MNP A;  1B52 A;  4MX6 A;  1B2H A;  4KFQ A;  4HE1 A;  3U65 A;  3V5A A;  2D5W A;  5L8D A;  2DE3 A;  5AA1 A;  1ZLQ A;  2VGQ A;  1LCF A;  3QXM A;  1MQD A;  2OWT A;  2AIX A;  3ECR A;  3QUF A;  2Q88 A;  3O6H A;  3MWB A;  4P3L A;  1POY 1;  5CMK A;  4P11 A;  4GF8 A;  2I49 A;  3FVK A;  3ILU B;  1OQG A;  1IME A;  4Z0I A;  3ZSF A;  3IB1 A;  3LV0 A;  4NN3 A;  2I3W A;  2ZXT A;  3CG1 A;  4R73 A;  4R9F A;  1VR5 A;  3K6V A;  2HZL A;  4IR8 A;  1SDX A;  1FTM A;  2DDK A;  5ITO A;  1LFI A;  1MM6 A;  4N8Y A;  5I59 A;  5F7V A;  1ELJ A;  4RYA A;  2V3T A;  3FJ7 A;  3PPN A;  2Q89 A;  4P8B A;  3PTY A;  4Q5T A;  4ISU A;  1NUX A;  3EKI A;  1XVX A;  3RPW A;  2PBW A;  4KCC A;  4DIG A;  1FSA A;  1ANF A;  1FW0 A;  1PBQ A;  2F8D A;  2NWJ A;  4ZEF A;  4OZ9 A;  2O69 A;  1P1O A;  5DEX B;  3C31 A;  4GWY A;  3M3K A;  3PUV E;  3E3K A;  4H1X A;  1N7X A;  5EQ7 A;  3K02 A;  2QVU A;  4XXU A;  3TTN A;  2HPG A;  2OZZ A;  3IB0 A;  1B7Z A;  4JXI A;  5DT6 A;  2Y7K A;  3EQ1 A;  4PQJ A;  1FBH A;  3THI A;  2OJT A;  4OER A;  5TP9 B;  3K0V A;  1USY H;  3SET A;  5LDZ A;  3BKI B;  1O7T A;  1B40 A;  4LON B;  3CG3 A;  1A8E A;  2QS4 A;  1Y3Q A;  3FXB A;  1B4H A;  3RLF E;  1UQW A;  2B3F A;  2O6A A;  4F3G A;  4P0G A;  4UA8 A;  4OFL A;  4LUB A;  4N6D A;  4ZEI A;  2NUV A;  3B8B A;  1EZP A;  3W9V A;  2QSX A;  1PB7 A;  2O51 A;  2DVZ A;  3ISP A;  3OMB A;  1B9J A;  2ONS A;  4OA4 A;  1Y4C A;  2I4C A;  3R7X A;  4R72 A;  4I3Y A;  1QKB A;  2OK2 A;  4P1E A;  1IMB A;  5F1Q A;  1JQF A;  1Z7M E;  3IO6 A;  1OQH A;  3PUX E;  1NI9 A;  2VPO A;  5H8H B;  3O66 A;  4ZED A;  1NV5 A;  3U72 A;  3TPA A;  4MCO A;  1FPL A;  2XXR A;  2I58 A;  4DXU A;  1D9Q A;  4U1O A;  3QUJ A;  1B3L A;  2HAU A;  1XVY A;  2RKM A;  4F1U A;  5B70 A;  2QJE A;  5H8F B;  3TCF A;  5I2K B;  1R9Q A;  4GX3 A;  1P1Q A;  4O3A A;  5DVF A;  5KCJ B;  1OMP A;  4GVO A;  4H65 A;  2I0C A;  3USD A;  1LST A;  4ZEC A;  5IAI A;  2G93 A;  3RT6 B;  1LAX A;  4AB6 A;  2OBG A;  5H8N A;  3RPL A;  4PBQ A;  1FBP A;  3G3H A;  5I5P A;  1XOC A;  3CVG A;  4NF6 A;  2UVG A;  1FTO A;  4BDO A;  3MP8 A;  4OVP A;  3LSF B;  1LFG A;  1M5E A;  3ONM A;  1H3D A;  2G29 A;  1PBP A;  4DXC A;  4QSE A;  1H43 A;  4LZ8 A;  1DPP A;  2IA4 A;  2A5T B;  3FUZ A;  5FTI A;  5I2N B;  3BIG A;  2ONK E;  4LVQ A;  4QFO A;  2RIN A;  1VDW A;  3LBS A;  4P56 A;  3MBP A;  3KBZ A;  4PFU A;  5I59 B;  2DWA A;  5I56 B;  3KJT A;  1QJM A;  3C32 A;  4TQU Q;  1JVX A;  1OIB A;  1A55 A;  2F36 A;  2Y5L A;  1EYK A;  3K01 A;  3IOV A;  4N13 A;  1FPG A;  2AL4 A;  5A5L A;  1K9Z A;  1BLF A;  3MVZ A;  2CZI A;  1MS7 A;  4AS4 A;  4GRK A;  4BDM A;  5FHM A;  4QHQ A;  4RY1 A;  1AH5 A;  4M4G A;  4OFO A;  2Y7I A;  2Z23 A;  4IO2 A;  4TLL B;  3MZB A;  2XD2 A;  1GV8 A;  1RDY A;  3GZG A;  3KC0 A;  2VD3 A;  1VSO A;  3PUY E;  2NVU B;  1ZTY A;  3DP8 A;  5EQ8 A;  1MY3 A;  5KZT A;  1QVS A;  1IMC A;  3E4R A;  1XHY A;  4N6K A;  3FXQ A;  5JTY A;  5DTB A;  2PT2 A;  3SZP A;  1EZ9 A;  1MXY A;  4PF8 A;  3IFA A;  1SW4 A;  3SEV A;  4E0W A;  4GQO A;  2H9B A;  1VE4 A;  1AIV A;  3UGW A;  3K1N A;  2KQZ A;  2FBP A;  4PGP A;  1BIY A;  1MPC A;  4NE4 A;  4EF2 A;  4EQ9 A;  2XX8 A;  4GXS B;  2OWS A;  2Y7P A;  3T9V A;  4DI4 B;  1L5T A;  1LB9 A;  2ZNU A;  3C35 A;  1DPE A;  4N91 A;  4RPN A;  1VFD A;  4HTG A;  3B7D A;  1FPJ A;  1NFT A;  1IXC A;  1LAG E;  4HE0 A;  4N15 A;  3TTR A;  2F34 A;  3D4C A;  3N5L A;  4H5G A;  3PMV A;  2H5Y A;  1Y20 A;  3KGC A;  4HCW A;  3E78 A;  2YPN A;  3JV9 A;  1IXG A;  1FJ9 A;  1H45 A;  3MZ9 A;  3MQ9 A;  2ZZX A;  5AA2 A;  2Y7R A;  3IK6 B;  5H8N B;  1FBG A;  3OEL A;  3K00 A;  3K6U A;  1JVY A;  1O64 A;  4I8C A;  4OMB A;  4YIC A;  5LOM A;  3IR1 A;  4IO3 A;  4ELQ A;  2ZMB A;  1MQH A;  3TMG A;  1B3E A;  1P99 A;  1IXI A;  5EYF A;  3T96 B;  4DE8 A;  4PFY A;  1II5 A;  4PAK A;  1F9B A;  1FPB A;  4IO4 A;  4G8N A;  4OWD A;  2F7C A;  3L6H A;  3G3F A;  4H67 A;  4O3C A;  2H99 A;  4MH5 A;  3QIM A;  2V3U A;  4FEB A;  2F6G A;  4YKK A;  3TCG A;  4DDD A;  2XXU A;  3I5O A;  3SEY A;  4NGU A;  2FHY A;  1Y3P A;  3BFU A;  3FXU A;  4PFT A;  2DWJ A;  1BP5 A;  5LTC A;  5ITP A;  1G0H A;  2GQ1 A;  1B3F A;  5HBC A;  4ELO A;  1SYH A;  1MG1 A;  1AWB A;  4EUO A;  3QSL A;  3T66 A;  3QMF A;  5IM2 A;  3A09 A;  3VE1 B;  4WED A;  2Z8E A;  1LLS A;  4F18 A;  3E13 X;  3HCQ A;  4ESW A;  1SD3 A;  1YZ0 A;  1JW4 A;  5ET6 A;  3C9H A;  3HST A;  4BDN A;  3FJM A;  1M5C A;  3O6G A;  3V89 B;  4N07 A;  3LSX A;  1GR2 A;  2O1M A;  1SVX B;  5T3J A;  4UAC A;  3KBR A;  3HO7 A;  1MXX A;  1IUD A;  1IIT A;  3KG2 A;  2XX9 A;  3GXA A;  3TQW A;  3T22 A;  1FQA A;  2RF1 A;  4OES A;  5AE4 A;  2B3B A;  4OEU A;  2ZYO A;  3LR1 A;  4OEV A;  4RXL A;  1YXI A;  5ET5 A;  4YB5 A;  1A7L A;  5TP9 A;  4R6H A;  4F3P A;  1SBP A;  2ZNS A;  4NAP A;  4C1U A;  4XKN A;  3UK4 A;  1MXW A;  1HSJ A;  5EYH A;  1KZ8 A;  3DLN A;  4G4P A;  2I0B A;  1LBX A;  1NUZ A;  2DE4 A;  3EPE A;  3TTL A;  3Q25 A;  3CR9 A;  5BWJ A;  1B32 A;  3VLV A;  4QXD A;  4LP2 B;  1FQF A;  3CI8 A;  1R9L A;  2F7B A;  4RK2 A;  4X1D A;  3RN8 A;  3BIH A;  5AA2 B;  5K2X A;  4O7I A;  4UAB A;  2RCB A;  4IY5 A;  2FIX A;  2Q8M A;  2XA5 A;  1JEU A;  4F3S A;  3KOT A;  4NTL A;  2P3V A;  1MXV A;  2HFB A;  1PC3 A;  2F78 A;  3OEK A;  5H8F A;  5I2K A;  3HHG A;  1QUJ A;  1SW5 A;  3K6X A;  5KCJ A;  1AL3 A;  1FTJ A;  4GWX A;  2B65 A;  2Z8D A;  1NNK A;  4X9T A;  4F31 B;  2XXH A;  2Q8J A;  1M5B A;  3FAT A;  2FA7 A;  3MP1 A;  1FJ6 A;  4OYV A;  3UN6 A;  1RDX A;  2QVV A;  3PD8 A;  2CMO A;  1KA0 A;  1XI6 A;  3A3U A;  1S9T A;  3QK6 A;  5F24 A;  5HM4 B;  3E79 A;  4H0W A;  1BTJ A;  4X48 A;  4O94 A;  2DWH A;  2A5T A;  5I2N A;  2XXT A;  3MVW A;  1GGG A;  1LFH A;  4U1Z A;  4KYD A;  1FBE A;  5I56 A;  1MDQ A;  3MUQ A;  2GFE A;  4MHF A;  4JSO A;  3TYH A;  1GVC A;  1EU8 A;  4U21 A;  3HPI A;  4DI3 D;  2UYE A;  4PE3 A;  4JWO A;  1N04 A;  1FQD A;  3H6U A;  4ESX A;  1P1N A;  5IZZ A;  3PD9 A;  2RC9 A;  3Q29 A;  4NF8 A;  3EF7 A;  3FIR A;  3PMW A;  3SEW A;  4K3F A;  4FEC A;  1B0L A;  3JZJ A;  3H6W A;  4ELR A;  4KQP A;  4LQ2 A;  4OXV A;  2XWO A;  4I40 A;  5I7I A;  3IB2 A;  4HXV A;  1OLC A;  3TTK A;  4RK9 A;  1ZJL A;  4P0I A;  1Y4T A;  4X1B A;  1B7U A;  4PFB A;  3I3V A;  2GHA A;  3L6G A;  4RPO A;  4DCX A;  1RDZ A;  2HXR A;  4QFK A;  2PCR A;  3CSG A;  3KSX A;  3PPP A;  5IZ3 A;  4FE8 A;  4QSC A;  2HQ0 A;  4IGR A; 
#chains in the Genus database with same CATH homology
 1YPN A;  3SEX A;  3FV1 A;  1SI1 A;  1URG A;  1POT A;  4OET A;  2PX1 A;  4EQB A;  3S9E A;  1MY1 A;  5CI5 A;  1SI0 A;  5DVI A;  1H76 A;  4GWO A;  2DYX A;  3VLW A;  2X7P A;  3R26 A;  3KSJ A;  2XXW A;  4YB7 A;  4I1D A;  4C1T A;  2Y7W A;  4GLI A;  1HSL A;  1TWY A;  1EZO A;  4ZZA A;  4FAT A;  2Q2A A;  3IOR A;  5CC2 A;  4BLA A;  1MY4 A;  2DOJ A;  2WKY A;  4KYS A;  3LUY A;  2VOZ A;  1GTK A;  3EHU A;  4U22 A;  5ICQ A;  2QMW A;  1TT1 A;  5DVJ A;  3TQL A;  2XXP A;  3G3J A;  4IO5 A;  3VVF A;  1Y1Z A;  2THI A;  3U1O A;  2QS2 A;  2E1S A;  1FTK A;  2QRY A;  1SW2 A;  1IEJ A;  4TOZ A;  5AA2 D;  1N84 A;  4QFN A;  3WAE A;  1NNT A;  1J1N A;  3K1P A;  1P1W A;  2ZYN A;  3FV2 A;  3KN7 A;  3TEL A;  1LGB C;  3IL1 B;  5J1D A;  5CRY A;  4ECF A;  3GLB A;  3ILT B;  3EN3 A;  4GXA A;  1FQC A;  1MY2 A;  4NF8 B;  3K1M A;  3MVX A;  3RNN A;  3PPQ A;  3M8U A;  3PPO A;  3HV1 A;  4QRZ A;  3T9X B;  4KPT A;  4OFJ A;  5DYH A;  4FIM A;  4YMB A;  5A5X A;  3CIJ A;  1UIU A;  4BDR A;  3PU5 A;  1MQJ A;  1DMB A;  1DOT A;  3UP9 A;  5JK4 A;  2UYF A;  2O7U A;  1JEV A;  4JSD A;  4LAT A;  2ZNT A;  4JWX A;  4IO6 A;  5I57 A;  5L9O A;  1IZ1 A;  2V3Q A;  3IO4 A;  4G8M A;  2DE2 A;  1Y9U A;  1I6A A;  5JEI A;  1M5D A;  3D4G A;  3WAF A;  1JNF A;  1AMF A;  2QS3 A;  2DVC A;  2Z8F A;  2P0S A;  1B0H A;  4KYE A;  4DCY A;  4OEN A;  4YZZ A;  4I9D A;  1DTG A;  1KWH A;  4QSD A;  1ZBM A;  3T93 B;  3ZS6 A;  3TFL A;  3O28 A;  3PV0 E;  1LCT A;  4POW A;  4YKJ A;  4FED A;  4XKR A;  4PFW A;  5AA4 A;  4FJP A;  5CBR A;  5TPA B;  1B58 A;  5EHM A;  2F97 A;  2Y84 A;  3IOT A;  4U4X A;  3V8X B;  2R9J A;  1M5F A;  3IAZ A;  4YKP A;  3DM0 A;  2ESN A;  2P1S A;  3UIF A;  1NH8 A;  4U2R A;  4U4S A;  2ABH A;  3DP6 A;  4AB5 A;  4R6K A;  4G2Z A;  1PEB A;  1PB9 A;  4IB2 A;  2O84 X;  4JBZ A;  1Y1M A;  4BDL A;  3PUZ E;  2DWI A;  4GL0 A;  3RTW B;  2YLN A;  5TU0 A;  2R71 A;  3F11 A;  3U92 A;  4Z7E A;  3C34 A;  3CSB A;  1ZKB A;  4LZ5 A;  3TUS A;  3W15 C;  3VDF A;  4L17 A;  3TKD A;  4F1Y A;  1B1X A;  2AYS A;  2DP8 A;  4E0X A;  4M1V A;  4FOR A;  1A54 A;  5ISU A;  1YAE A;  1N0T A;  2FNC A;  3RY3 A;  3M3L A;  3S9M C;  1Z7N E;  4YMA A;  3MP6 A;  5A5X B;  2V25 A;  1Q35 A;  2O68 A;  5K2Y A;  3KN3 A;  2PT1 A;  2CZL A;  4F29 A;  3O6I A;  1B5I A;  4KR5 A;  3T9U A;  3FVO A;  5I57 B;  3B6Q A;  3N6U A;  3LC8 A;  3ODB A;  2VP1 A;  3OO8 A;  4PE5 B;  1RYX A;  3U8Q A;  2GRV A;  4F3B A;  1MDP 1;  3MZ1 A;  3DP4 A;  4MBP A;  2REJ A;  2RC7 A;  4O3B A;  2I48 A;  3H06 B;  3B6W A;  1B7H A;  3O29 A;  1LB8 A;  1R1N A;  4I62 A;  1QW0 A;  3VLU A;  2M8C A;  1QUL A;  4ONY A;  4HS7 A;  3OSQ A;  4NF5 B;  2RCA A;  4OHN A;  2OLB A;  5AA4 B;  4H8J A;  5CBS A;  2DSF A;  4OTE A;  4EDP A;  3IJX B;  1US5 A;  3KOS A;  3Q27 A;  1UIV A;  3R6U A;  2E0S A;  3S9L C;  2HAV A;  3OSR A;  3LSW A;  4NWC A;  1AOV A;  2UVI A;  1CE2 A;  4IGT A;  4ZS9 A;  2O7I A;  1ZMG A;  1R6Z A;  2UVJ A;  4R9G A;  4IY6 A;  4HCY A;  3FVN A;  4IO7 A;  4YB6 A;  1B6H A;  1UTH A;  3O2A A;  1YTV A;  4MFI A;  3I6V A;  3C4M A;  1A8F A;  1WDN A;  3TEP A;  4NF4 B;  3TZA A;  1LBC A;  1JW5 A;  4JWY A;  4KCD A;  4H5F A;  1B3H A;  4OVJ A;  1MY0 A;  3H03 A;  3FGS A;  2PVU A;  3TOD A;  1B5H A;  1P1U A;  1ATG A;  2D21 A;  2H4I A;  2ZYM A;  1YCJ A;  2XXI A;  2QPQ A;  4R74 A;  3MAM A;  2FYI A;  4F22 A;  2GHB A;  5B7D A;  3FXR A;  3DEL B;  1I6Q A;  3H6T A;  1WVJ A;  2OCU A;  1QUK A;  3TCH A;  3VFJ A;  5L9M A;  3O97 A;  4DLD A;  4R75 A;  3UA8 A;  3K2D A;  4EXK A;  1ZU0 A;  4F1V A;  3LSL A;  3FVG A;  1EH3 A;  4H8I A;  3P7I A;  4QFP A;  1I69 A;  5I58 A;  3VV5 A;  3RTF B;  3KN8 A;  3K6W A;  4KI0 E;  2O1L A;  4Q0C A;  5H8Q B;  1IIW A;  5HPQ A;  3W9W A;  4NMY A;  1US4 A;  2I4B A;  3FZV A;  3OEM A;  3OO9 A;  2X7Q A;  5CM6 A;  1N3X A;  3O9P A;  2V84 A;  3MW0 A;  1FCK A;  3E9X A;  3G3I A;  3UOR A;  1B46 A;  4MLQ A;  4THI A;  2Q9T A;  5FHN A;  2R6G E;  1A99 A;  2QS1 A;  4R2F A;  1B5J A;  2ANJ A;  2AL5 A;  2UXA A;  4ZEK A;  3T9H B;  1NH7 A;  3VXC A;  3OEN A;  1MPB A;  2DXR A;  2YJP A;  2KLF A;  2I3V A;  1OVT A;  1XS5 A;  2I6E A;  2HZK A;  1UTB A;  1B4Z A;  3RGY A;  4XIG Q;  3B6T A;  1TFA A;  4XKQ A;  4GD5 A;  1XT8 A;  4OQO A;  1PB8 A;  4ELP A;  1LAF E;  4F2Q A;  1D9Y A;  5TPA A;  4F19 A;  3MPK A;  1SW1 A;  1UTH B;  2ALU A;  1NMU A;  1TFD A;  3BFT A;  1PDA A;  3SEU A;  1MM7 A;  4RJZ A;  4H6D A;  2VD2 A;  5FTH A;  3OO6 A;  2XHD A;  4G77 A;  2F5X A;  1MQI A;  3CFL A;  1N7W A;  4PP0 A;  3PUW E;  2X26 A;  2Q2C A;  3KEI A;  3IOU A;  4XKP A;  1CB6 A;  1B3G A;  3U94 A;  5L9S A;  2H25 A;  3RUM A;  1D4N A;  3QYT A;  5M2V A;  2V93 A;  1NL5 A;  2DS9 A;  3SES A;  2Z22 A;  3H6V A;  4R6Y A;  4ND9 A;  3N26 A;  1OVB A;  3PPR A;  1MQG A;  1SQY A;  2XXQ A;  3OOA A;  3KJ7 A;  3M3F A;  1XC1 A;  4NED A;  3MPL A;  2DQV A;  2A5S A;  3EHS A;  5ELV A;  3HN0 A;  2QMX A;  5I58 B;  4MF3 A;  3AXF A;  4EF1 A;  4GL8 A;  1VFE A;  1ZIU A;  4AQ4 A;  1H44 A;  1N3W A;  3PGF A;  3GBB A;  2H98 A;  2ZYK A;  4QFL A;  2NXO A;  3CFX A;  1B05 A;  2HXW A;  1OLA A;  1DSN A;  1NNF A;  2XD3 A;  4DXB A;  3MC2 A;  1O63 A;  4R2B A;  4LA9 A;  1B51 A;  1Q1K A;  4POX A;  5EHS A;  5KDT A;  3VVD A;  5CMM A;  1NNP A;  2D3I A;  3ZKL A;  4ZDM A;  2F6P A;  3VVE A;  4XTC Q;  1HSE A;  1RYO A;  1UTB B;  1TXF A;  5BUU A;  3TTM A;  2GH9 A;  3GBA A;  3U93 A;  5IKB A;  1IQ7 A;  2HEU A;  4NF5 A;  3PMX A;  3CFZ A;  3JYR A;  4FAJ A;  3S2V A;  2HCA A;  4MLV A;  1BKA A;  2LAO A;  1D3K A;  4JB7 A;  1MXZ A;  4Q30 B;  1LAH E;  5FHO A;  4WXJ A;  4ZE9 A;  2UVH A;  3QAX A;  4G8H A;  3ZKK A;  3HHF A;  1MH3 A;  4G68 A;  3S9N C;  1QUI A;  3RT8 A;  1SYI A;  1JET A;  2P2A A;  3TDJ A;  2XX7 A;  3SER A;  5CMB A;  4ZEB A;  4NF6 B;  2W7Y A;  1MPD A;  3KFM A;  5CMC A;  4ZZE A;  4DZ1 A;  3OO7 A;  1A40 A;  1I6B A;  4YKI A;  3C36 A;  4BDQ A;  5AA3 A;  3MVY A;  4GOT A;  4PET A;  4GFR A;  2XXV A;  3G3G A;  3IX1 A;  3H7M A;  4C0R A;  4NF4 A;  2PMS A;  3VXB A;  3FJG A;  3Q28 A;  1IXH A;  1MRP A;  3SKP A;  4WEP A;  1QKA A;  3A3C A;  3H3G A;  3C33 A;  3MJN A;  1JW1 A;  2VHA A;  4LQ5 A;  2ONR A;  3OD7 A;  5H8S A;  4HW8 A;  2NOO A;  3FAS A;  3IJO B;  3K4U A;  4F2O A;  1LBB A;  3OXN A;  2BJJ X;  3V83 A;  1MH4 A;  4EQ7 A;  1Y3N A;  4N6P A;  2XXX A;  5JTY B;  1B1H A;  1FTL A;  3G3K A;  2IEE A;  3G7W A;  1WOD A;  4NWD A;  5I84 A;  2PYY A;  1D9V A;  2QL3 A;  5DEX A;  3N94 A;  4YAH X;  1T0K A;  5KDT B;  5H8Q A;  4GIZ A;  1N76 A;  3BBR A;  3CRB A;  2XXY A;  4LZ7 A;  4YU0 A;  1USY E;  4WKM A;  4JDF A;  4KHZ E;  3S4U A;  2RC8 A;  3SDF A;  1NKX A;  2F7A A;  2F35 A;  3FD3 A;  3EHT A;  4G68 C;  3N6T A;  4RA1 A;  3IOW A;  2DXY A;  3TAJ A;  1RKM A;  3KZG A;  1URS A;  4TLM B;  4ZE8 A;  5ICT A;  2REG A;  4EXL A;  1FQE A;  1URD A;  4U23 A;  3H4Z A;  4KD5 A;  1S7Y A;  1DTZ A;  3Q26 A;  4QF9 A;  4G68 B;  3RQT A;  1FQB A;  1S50 A;  1MXU A;  4F39 A;  4Q8R A;  5H8H A;  4RNS A;  1B52 A;  1B2H A;  4KFQ A;  3V5A A;  2D5W A;  5L8D A;  2DE3 A;  5AA1 A;  1ZLQ A;  2VGQ A;  1LCF A;  3QXM A;  1MQD A;  2OWT A;  2AIX A;  3ECR A;  3QUF A;  2Q88 A;  3O6H A;  3MWB A;  1POY 1;  5CMK A;  4P11 A;  4GF8 A;  2I49 A;  3FVK A;  3ILU B;  1OQG A;  4Z0I A;  3ZSF A;  3IB1 A;  2I3W A;  2ZXT A;  3CG1 A;  4R73 A;  4R9F A;  1VR5 A;  3K6V A;  2HZL A;  1SDX A;  1FTM A;  5ITO A;  1LFI A;  1MM6 A;  5I59 A;  5F7V A;  1ELJ A;  4RYA A;  2V3T A;  3FJ7 A;  3PPN A;  2Q89 A;  4Q5T A;  4ISU A;  3RPW A;  1XVX A;  2PBW A;  4KCC A;  4DIG A;  1ANF A;  1FW0 A;  1PBQ A;  2F8D A;  2NWJ A;  4ZEF A;  4OZ9 A;  2O69 A;  1P1O A;  5DEX B;  3C31 A;  3M3K A;  3PUV E;  3E3K A;  4H1X A;  1N7X A;  3K02 A;  4XXU A;  3TTN A;  2OZZ A;  3IB0 A;  1B7Z A;  4JXI A;  5DT6 A;  2Y7K A;  3EQ1 A;  4PQJ A;  3THI A;  2OJT A;  4OER A;  5TP9 B;  3K0V A;  1USY H;  3SET A;  3BKI B;  1O7T A;  1B40 A;  4LON B;  3CG3 A;  1A8E A;  2QS4 A;  1Y3Q A;  1B4H A;  3RLF E;  1UQW A;  2B3F A;  2O6A A;  4F3G A;  4P0G A;  4UA8 A;  4OFL A;  4LUB A;  4ZEI A;  2NUV A;  1EZP A;  3W9V A;  2QSX A;  1PB7 A;  2O51 A;  2DVZ A;  3OMB A;  1B9J A;  2ONS A;  1Y4C A;  2I4C A;  3R7X A;  4R72 A;  1QKB A;  2OK2 A;  5F1Q A;  1JQF A;  1Z7M E;  3IO6 A;  1OQH A;  3PUX E;  5H8H B;  3O66 A;  4ZED A;  3U72 A;  3TPA A;  2XXR A;  2I58 A;  4DXU A;  4U1O A;  3QUJ A;  1B3L A;  2HAU A;  1XVY A;  2RKM A;  4F1U A;  5B70 A;  2QJE A;  5H8F B;  3TCF A;  5I2K B;  1R9Q A;  1P1Q A;  4O3A A;  5DVF A;  5KCJ B;  1OMP A;  4GVO A;  4H65 A;  3USD A;  2I0C A;  1LST A;  4ZEC A;  5IAI A;  2G93 A;  3RT6 B;  1LAX A;  4AB6 A;  2OBG A;  5H8N A;  3G3H A;  1XOC A;  3CVG A;  4NF6 A;  2UVG A;  1FTO A;  4BDO A;  3MP8 A;  3LSF B;  1LFG A;  1M5E A;  3ONM A;  1H3D A;  2G29 A;  1PBP A;  4DXC A;  4QSE A;  1H43 A;  4LZ8 A;  1DPP A;  2IA4 A;  2A5T B;  3FUZ A;  5FTI A;  5I2N B;  2ONK E;  4LVQ A;  4QFO A;  2RIN A;  3LBS A;  3MBP A;  4PFU A;  5I59 B;  2DWA A;  5I56 B;  3KJT A;  1QJM A;  3C32 A;  4TQU Q;  1JVX A;  1OIB A;  1A55 A;  2F36 A;  3K01 A;  3IOV A;  4N13 A;  2AL4 A;  1BLF A;  3MVZ A;  1MS7 A;  4GRK A;  4BDM A;  5FHM A;  4QHQ A;  4RY1 A;  1AH5 A;  4M4G A;  4OFO A;  2Y7I A;  2Z23 A;  4IO2 A;  4TLL B;  3MZB A;  2XD2 A;  1GV8 A;  3GZG A;  2VD3 A;  1VSO A;  3PUY E;  2NVU B;  1ZTY A;  3DP8 A;  1MY3 A;  5KZT A;  1QVS A;  3E4R A;  1XHY A;  3FXQ A;  5JTY A;  5DTB A;  2PT2 A;  1EZ9 A;  1MXY A;  1SW4 A;  3SEV A;  4E0W A;  4GQO A;  2H9B A;  1VE4 A;  1AIV A;  3UGW A;  3K1N A;  1BIY A;  1MPC A;  4NE4 A;  4EF2 A;  4EQ9 A;  2XX8 A;  4GXS B;  2OWS A;  2Y7P A;  3T9V A;  1L5T A;  1LB9 A;  2ZNU A;  3C35 A;  1DPE A;  4RPN A;  1VFD A;  4HTG A;  3B7D A;  1NFT A;  1IXC A;  1LAG E;  3TTR A;  2F34 A;  3D4C A;  3N5L A;  4H5G A;  3PMV A;  2H5Y A;  1Y20 A;  3KGC A;  4HCW A;  2YPN A;  3JV9 A;  1IXG A;  1H45 A;  3MZ9 A;  3MQ9 A;  5AA2 A;  2Y7R A;  3IK6 B;  5H8N B;  3OEL A;  3K00 A;  3K6U A;  1JVY A;  1O64 A;  4I8C A;  4OMB A;  4YIC A;  5LOM A;  3IR1 A;  4IO3 A;  4ELQ A;  2ZMB A;  1MQH A;  3TMG A;  1B3E A;  1P99 A;  1IXI A;  5EYF A;  3T96 B;  4DE8 A;  4PFY A;  1II5 A;  1F9B A;  4IO4 A;  4G8N A;  4OWD A;  2F7C A;  3L6H A;  3G3F A;  4H67 A;  4O3C A;  2H99 A;  4MH5 A;  3QIM A;  2V3U A;  4FEB A;  2F6G A;  4YKK A;  3TCG A;  4DDD A;  2XXU A;  3I5O A;  3SEY A;  1Y3P A;  3BFU A;  3FXU A;  4PFT A;  2DWJ A;  1BP5 A;  5ITP A;  1B3F A;  5HBC A;  4ELO A;  1SYH A;  1MG1 A;  4EUO A;  3QSL A;  3T66 A;  3A09 A;  3VE1 B;  4WED A;  2Z8E A;  1LLS A;  4F18 A;  3E13 X;  3HCQ A;  4ESW A;  1SD3 A;  1JW4 A;  3C9H A;  3HST A;  4BDN A;  3FJM A;  1M5C A;  3O6G A;  3V89 B;  4N07 A;  3LSX A;  1GR2 A;  2O1M A;  1SVX B;  4UAC A;  3KBR A;  3HO7 A;  1MXX A;  1IUD A;  1IIT A;  3KG2 A;  2XX9 A;  3TQW A;  3GXA A;  3T22 A;  1FQA A;  2RF1 A;  4OES A;  5AE4 A;  2B3B A;  4OEU A;  2ZYO A;  3LR1 A;  4OEV A;  4RXL A;  4YB5 A;  1A7L A;  5TP9 A;  4R6H A;  4F3P A;  1SBP A;  2ZNS A;  4C1U A;  4XKN A;  3UK4 A;  1MXW A;  1HSJ A;  3DLN A;  4G4P A;  2I0B A;  2DE4 A;  3EPE A;  3TTL A;  3Q25 A;  3CR9 A;  5BWJ A;  1B32 A;  3VLV A;  4LP2 B;  1FQF A;  3CI8 A;  1R9L A;  2F7B A;  4RK2 A;  4X1D A;  3RN8 A;  5AA2 B;  5K2X A;  2RCB A;  4IY5 A;  1JEU A;  4F3S A;  3KOT A;  4NTL A;  1MXV A;  2HFB A;  1PC3 A;  2F78 A;  3OEK A;  5H8F A;  5I2K A;  3HHG A;  1QUJ A;  1SW5 A;  3K6X A;  5KCJ A;  1AL3 A;  1FTJ A;  2B65 A;  2Z8D A;  1NNK A;  4X9T A;  4F31 B;  2XXH A;  2Q8J A;  1M5B A;  3FAT A;  2FA7 A;  3MP1 A;  4OYV A;  3UN6 A;  3PD8 A;  2CMO A;  3A3U A;  1S9T A;  3QK6 A;  5HM4 B;  4H0W A;  1BTJ A;  4X48 A;  2DWH A;  2A5T A;  5I2N A;  2XXT A;  3MVW A;  1GGG A;  1LFH A;  4U1Z A;  4KYD A;  5I56 A;  1MDQ A;  3MUQ A;  2GFE A;  4JSO A;  3TYH A;  1GVC A;  1EU8 A;  4U21 A;  3HPI A;  2UYE A;  4JWO A;  1N04 A;  1FQD A;  3H6U A;  4ESX A;  1P1N A;  3PD9 A;  2RC9 A;  3Q29 A;  4NF8 A;  3EF7 A;  3FIR A;  3PMW A;  3SEW A;  4K3F A;  4FEC A;  1B0L A;  3JZJ A;  3H6W A;  4ELR A;  4KQP A;  4LQ2 A;  4OXV A;  3IB2 A;  1OLC A;  3TTK A;  4RK9 A;  1ZJL A;  4P0I A;  1Y4T A;  4X1B A;  1B7U A;  3I3V A;  2GHA A;  3L6G A;  4RPO A;  4DCX A;  4QFK A;  3CSG A;  3KSX A;  3PPP A;  4FE8 A;  4QSC A;  2HQ0 A;  4IGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...