1B7ZA

Structure of oxalate substituted diferric mare lactoferrin from colostrum
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of oxalate-substituted diferric mare lactoferrin at 2.7 A resolution.
pubmed doi rcsb
molecule tags Metal transport
molecule keywords PROTEIN (LACTOFERRIN)
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA03
2ZNTA 3ZS6A 1SW1A 1Y3QA 1JW4A 1NKXA 3OSRA 4QSCA 4U22A 4HCYA 5ITOA 2AIXA 2NWJA 1S50A 2VHAA 1Q1KA 4E0WA 2WKYA 1TFAA 1KWHA 1MY1A 2V84A 4NWDA 4Q0CA 5BUUA 1P1WA 5FTHA 4YKJA 1II5A 4DXBA 4GXAA 2I3VA 5I57B 3FIRA 1B4HA 5FHNA 1B7HA 1A8FA 2UYFA 2I0BA 4OXVA 3VVEA 2ALUA 3VVDA 1A55A 5LOMA 2CZLA 1FQBA 1B3LA 1FTMA 4R6KA 2AL5A 2DP8A 2XHDA 3B6WA 4ZS9A 3C33A 3CG1A 3VDFA 1QW0A 2YLNA 1MQHA 1YCJA 3MUQA 2XXXA 3TTKA 2OJTA 4AB6A 4OZ9A 3CFXA 3IOWA 3MP8A 5DEXB 5M2VA 3R6UA 4F29A 1M5FA 1MPDA 1NNPA 3CVGA 2XX9A 1Q35A 2I0CA 4LVQA 5H8FA 1SI1A 2UXAA 4C1TA 1USYH 4KFQA 4F3BA 4R72A 3K0VA 2PT1A 4ZEIA 1UTHA 1QJMA 4U4SA 2I4CA 3DP4A 3PGFA 3Q26A 4UACA 2BJJX 1PB9A 4AB5A 3EHTA 5J1DA 4N13A 1OLAA 2RCAA 1ATGA 3FXQA 3G3KA 4RY1A 5CMCA 3H7MA 3U93A 1QVSA 1DOTA 3ECRA 3TTLA 4OHNA 2GFEA 3ILUB 3PUZE 3K1MA 4WXJA 4H5GA 3N6UA 3SKPA 1B3HA 2VD2A 1P99A 2ONKE 3MP1A 4ISUA 3FV2A 2RC8A 4TQUQ 2F7BA 5CMMA 3H06B 2F97A 4OWDA 4NEDA 4FIMA 1B3FA 1B58A 4LUBA 1JW5A 5IAIA 3KN7A 1I69A 3ILTB 5BWJA 3CFLA 1URGA 3A3CA 3ONMA 5CBRA 1H43A 5EHMA 3RTWB 4DE8A 3PMWA 2QMWA 3DP8A 4F39A 1USYE 1M5DA 2RINA 3KN8A 3OO7A 3C36A 1JNFA 4G8NA 3E3KA 2P0SA 2V3QA 5DVIA 3G3FA 4EQBA 4LQ5A 4YICA 1JVXA 1TFDA 1A99A 1MPCA 1MY3A 3I5OA 3PD8A 4QFNA 3IJOB 4R9GA 4X1BA 4YU0A 2X7QA 1B7UA 3EHSA 3KEIA 3L6HA 3QXMA 5HBCA 3VVFA 3LUYA 3PPRA 1M5EA 4QFKA 2O1MA 3K4UA 3IL1B 1UIVA 1MH3A 4ZEBA 4U1ZA 4O3AA 4IO6A 2DOJA 1I6QA 1SW5A 2CMOA 2F36A 2GRVA 4LZ7A 2NVUB 3CR9A 3H6WA 3T66A 4FATA 5L9OA 5DYHA 1MH4A 3CFZA 1XVYA 3MPKA 2QS4A 3IOTA 1D9VA 4G8MA 2UYEA 4ZE8A 1SYHA 1AIVA 4IO4A 3OELA 4OEVA 3QK6A 5DEXA 5L9SA 1PC3A 1ZKBA 3K1PA 3T9HB 2I58A 4LP2B 3TTNA 1B32A 2XXHA 4OYVA 3TAJA 1FTOA 5DTBA 1N7XA 2NUVA 2XXUA 3HV1A 3PUVE 3GXAA 2G29A 2AYSA 2F8DA 3IB2A 3OEKA 4GLIA 1RYXA 2A5TA 1Y3PA 1S7YA 2Q89A 5ISUA 3N26A 4R73A 4OERA 1B40A 3OO8A 3RGYA 2F6GA 1B46A 2UVGA 4XKRA 5TPAA 3RUMA 3TCHA 5KCJA 4M1VA 1A54A 4Q5TA 4BDMA 4G68A 3PUYE 3VFJA 4YKIA 1URDA 4L17A 5TPAB 4G8HA 3VV5A 3ZSFA 1T0KA 3C4MA 1DSNA 3OMBA 1H45A 3PPQA 1HSJA 3OXNA 2XD2A 5AA4A 3PPOA 3M3LA 2H25A 4YB7A 2HXWA 1OLCA 2RC9A 4TLMB 5CMBA 5TU0A 4MLQA 3U72A 2O51A 1EH3A 2RCBA 3VLUA 4U4XA 3AXFA 4IGRA 4F22A 1ZJLA 3JZJA 1B0HA 1IITA 1CE2A 4F1VA 4FORA 4NF8B 3D4GA 3A3UA 3G7WA 3ZKLA 3RT8A 1O63A 5CRYA 2UVHA 3O66A 1AMFA 3RNNA 4H1XA 4WEPA 1MY0A 1TWYA 2GHBA 3FVNA 3VXCA 5I58A 1IZ1A 4KPTA 3T9VA 3U8QA 2QS3A 3VLWA 1S9TA 3RN8A 1R9LA 4KYDA 1PB7A 4QSEA 3WAEA 3KFMA 3LSWA 4C0RA 3S9EA 3QUJA 2QL3A 2LAOA 3MPLA 3T22A 5I59A 4G77A 5L8DA 3DELB 4I9DA 3PPNA 2XX8A 3MC2A 1B7ZA 2IEEA 3PD9A 2NOOA 3G3HA 2XXWA 1TXFA 3KSXA 4KD5A 5I59B 4LONB 4ELPA 1PEBA 4OVJA 3IO4A 4G2ZA 4QHQA 5CI5A 4WEDA 3TTRA 1SYIA 2GH9A 2VGQA 3I6VA 3JYRA 4Q30B 4ZEDA 5CMKA 5JK4A 2B65A 3USDA 1IXCA 3S4UA 3IOUA 1BTJA 2DYXA 5DVFA 1B5JA 5KDTB 1JEUA 1SD3A 1XHYA 2OWTA 4QFLA 2F7AA 1VFDA 2ZNUA 1MDQA 5AA2B 1B2HA 3HO7A 2OCUA 4U23A 4F19A 5CM6A 1GGGA 1SW2A 4F1YA 1QKBA 4IY6A 5HPQA 3S9NC 4RA1A 3HHFA 2NXOA 2Q2CA 4GIZA 4KQPA 4YKKA 3LSLA 1EU8A 3O6IA 5I2KB 2A5SA 4ZE9A 2IA4A 4P11A 3TYHA 1MPBA 3C34A 3G3IA 4IB2A 3K6UA 1OQHA 4IO2A 4RK2A 1FQDA 1R6ZA 4F2QA 1WDNA 1EZ9A 1MRPA 3BFUA 4QFOA 3SESA 4LA9A 3O2AA 5I56A 1URSA 1JW1A 4EXKA 1LCFA 1XT8A 1D4NA 4EF2A 5H8NB 1FTKA 3KG2A 5I2NB 5AA4B 3LC8A 1IXHA 2Q2AA 1PBPA 1Y4TA 4EF1A 4C1UA 1SW4A 4U2RA 5I2NA 3TQWA 4NTLA 1OVBA 1NNTA 3FXUA 2O84X 2ZYKA 1US4A 4GOTA 2QS2A 1B51A 1H76A 3IR1A 1HSLA 4O3CA 4Q8RA 1N76A 3PPPA 4OEUA 3C9HA 3FVKA 4GL0A 2XXVA 3K1NA 4QF9A 2V3TA 2RC7A 5DT6A 4FAJA 3K01A 1R1NA 4X48A 3ZKKA 4RYAA 3O6GA 3O97A 1B9JA 1LGBC 3UIFA 4DXUA 2F6PA 4R2FA 1MG1A 4EXLA 4DCYA 3FVGA 1DPEA 4NF4A 3F11A 3I3VA 1Y9UA 4YMBA 2I48A 3BKIB 3DLNA 4EDPA 4QRZA 4F3SA 2O69A 4OQOA 3O6HA 2Z23A 3B7DA 1AOVA 3TMGA 3T9UA 2Y7IA 3CSBA 5H8FB 1N84A 4GQOA 4GRKA 1QKAA 1SQYA 1A40A 4FEDA 2QS1A 3FJGA 1JETA 4GL8A 3B6TA 3N6TA 2HAVA 4OETA 4IY5A 5ICTA 2O7UA 3P7IA 3OEMA 3QIMA 4KI0E 2H98A 4IGTA 1UIUA 3SEVA 1YPNA 4H0WA 1Y3NA 5JTYB 1QUJA 3UORA 4JWOA 4AQ4A 3WAFA 2FNCA 1I6AA 3TEPA 1LBBA 1MM6A 4BDNA 3H4ZA 2AL4A 1LFIA 4ELRA 1SDXA 5TP9B 2DQVA 3SEUA 4ESXA 2ZMBA 5ICQA 3DM0A 2OK2A 2B3FA 4NWCA 2XXIA 2QSXA 3OO9A 4RPNA 5DVJA 5FHMA 5TP9A 2VP1A 4NF8A 4PFTA 4MFIA 2HZLA 1J1NA 2DWHA 3H6UA 4PFUA 1QUIA 4F3GA 1IUDA 1NMUA 3FUZA 3FV1A 3EPEA 3HHGA 3VE1B 2P2AA 2H99A 4BDRA 2V93A 3IOVA 3U94A 1NNKA 3M3KA 5K2YA 2ZYMA 5H8HB 1XS5A 3L6GA 4MH5A 4OFJA 4P0GA 4YB6A 1MY4A 1VE4A 1ANFA 5H8QB 3S2VA 2O6AA 1GVCA 4R2BA 5H8HA 4F1UA 3R26A 4H67A 1MQGA 1ZTYA 2Z8DA 3IJXB 4PQJA 1ZMGA 2XD3A 4F31B 3IK6B 4KCDA 5CBSA 2ABHA 3ODBA 2PBWA 3H6VA 3SDFA 4I62A 4ZDMA 4LZ5A 2VD3A 1R9QA 1JVYA 2I49A 1B0LA 2Z8EA 3HPIA 2Q8JA 3OOAA 2FYIA 4FE8A 3PU5A 2HFBA 2FA7A 1MXYA 3TCFA 2DE4A 1OQGA 4Z7EA 3PUXE 3E13X 3TQLA 5AA3A 2X26A 1Y1ZA 1I6BA 1LSTA 1MQIA 3IAZA 4ESWA 1LBCA 1Z7ME 3MZ9A 5FHOA 1Y1MA 4OMBA 2XXPA 2O68A 3HSTA 3EHUA 4OENA 1YAEA 3EF7A 4MLVA 3SETA 3TKDA 3W9VA 4ONYA 4U21A 1POTA 2Y7PA 4DZ1A 5I2KA 3HCQA 2RF1A 1P1UA 2Y7WA 2Y7RA 5AA1A 4DLDA 1MY2A 1QULA 2DS9A 1QUKA 3GLBA 4DXCA 3SEYA 3MVZA 2X7PA 1XOCA 4RNSA 4NE4A 4F18A 5I58B 4PFYA 3M8UA 2RKMA 4HTGA 5ELVA 5I56B 2ESNA 3FJMA 3LR1A 1MQJA 1D3KA 2HAUA 3JV9A 1DTGA 3MVYA 3OD7A 4H65A 4I8CA 3RLFE 1PDAA 1B05A 2YJPA 5JTYA 4GXSB 2DWIA 3C35A 4H8JA 3SEWA 1B1XA 4ECFA 1LFGA 3FZVA 4JSOA 4POXA 4Z0IA 2YPNA 3Q28A 4YB5A 1P1OA 1LAGE 1FQEA 2DXRA 3LSXA 5FTIA 4XXUA 1NL5A 2OBGA 3IB1A 3FGSA 1EZPA 1O7TA 2O7IA 2GHAA 3GZGA 4BDQA 3RPWA 1AH5A 1F9BA 2I4BA 2F78A 4LATA 1LAXA 2XXRA 4PP0A 2V3UA 3MJNA 5A5XA 4BDLA 4KHZE 5F1QA 2M8CA 1CB6A 5K2XA 3TFLA 1FQFA 4UA8A 3UGWA 3MAMA 3K00A 5H8QA 1JQFA 4ZEFA 4DCXA 4G4PA 3PUWE 1SI0A 4U1OA 1JEVA 1LAFE 1O64A 2OLBA 3MW0A 4XKPA 1VR5A 4XKNA 1ZIUA 4POWA 2OZZA 2HCAA 2ZNSA 1DMBA 1PB8A 4N07A 4ZZAA 1ELJA 4KCCA 3K6WA 4DDDA 4H6DA 1DTZA 2PMSA 1ZLQA 2THIA 5H8SA 1MQDA 4LQ2A 4GD5A 1B1HA 4YZZA 3W15C 5B7DA 3KZGA 3KOSA 4JBZA 4QSDA 1LFHA 2Z22A 3R7XA 2DSFA 4WKMA 1OIBA 1MDP1 3V5AA 2ANJA 3TTMA 3TCGA 1B4ZA 3T9XB 2PVUA 3OSQA 3H6TA 1IIWA 5KDTA 3FASA 1L5TA 3IB0A 3FATA 4GF8A 4MF3A 4NMYA 3T96B 4EUOA 3TUSA 3Q29A 1FTLA 1BKAA 2DXYA 2HEUA 4JXIA 1MXWA 1A8EA 2R9JA 4O3BA 1H44A 4X9TA 2F7CA 3KJ7A 3OENA 4RK9A 3TODA 4F3PA 3C32A 5B70A 2DE2A 4RXLA 4NF5B 3K6VA 3UA8A 4DIGA 5F7VA 5HM4B 1POY1 4ELQA 4KYEA 3TZAA 2Y7KA 3KN3A 3S9MC 3S9LC 1NNFA 1RKMA 4H5FA 3GBBA 1UQWA 1B3GA 2Q9TA 4JB7A 5I57A 1B6HA 1FW0A 1ZU0A 2ZXTA 1N3WA 3RTFB 1Y4CA 2F35A 4EQ9A 2XXQA 3A09A 2B3BA 4N6PA 4EQ7A 3KOTA 1OVTA 4GWOA 2PX1A 1MXVA 1IQ7A 3V89B 3MZ1A 3E4RA 4TLLB 3RT6B 5AA2D 1HSEA 1P1QA 3GBAA 4YKPA 4E0XA 2XXYA 1N0TA 3K2DA 3MVXA 1IEJA 1EZOA 1VSOA 3DP6A 3N94A 3EQ1A 3PMXA 4JDFA 5A5XB 4FJPA 3QYTA 5EHSA 1N04A 3MZBA 4IO3A 1M5BA 2Y84A 3CRBA 4KR5A 4R6HA 2REGA 3KSJA 1UTBA 1VFEA 3UP9A 2Z8FA 1MXZA 5KZTA 3SEXA 4ZEKA 1MS7A 3K6XA 3O9PA 2A5TB 3QUFA 4IO5A 1BIYA 1Y20A 1N3XA 2XX7A 4OFOA 3RY3A 3TELA 3U1OA 2R6GE 3CG3A 2QJEA 3H3GA 3UK4A 3V83A 1BLFA 4KYSA 4NF4B 5KCJB 1LLSA 3MVWA 3CSGA 3N5LA 1FTJA 3KJTA 4MBPA 2ONSA 1MXUA 3B6QA 3V8XB 3MP6A 2F5XA 2OWSA 3KBRA 3H03A 2HQ0A 2F34A 3MWBA 2KLFA 4PFWA 2QMXA 1YTVA 1IXGA 1SBPA 2R71A 4OFLA 1RYOA 3QSLA 2QPQA 1GV8A 3VLVA 5IKBA 2D5WA 2O1LA 3TPAA 2DVZA 3U92A 1B3EA 1FQCA 1FCKA 3LBSA 1GR2A 1TT1A 1N7WA 2UVIA 2W7YA 2REJA 4LZ8A 5EYFA 3VXBA 5CC2A 2G93A 2E0SA 4RJZA 1LCTA 2E1SA 2QRYA 2XXTA 3CIJA 2D3IA 2Q88A 3CI8A 3E9XA 3IORA 4GVOA 3PV0E 5JEIA 1LB9A 3Q25A 1NH8A 1MM7A 1DPPA 4HCWA 4OTEA 2PYYA 2PT2A 3C31A 3EN3A 3FD3A 4NF5A 2DWAA 2VOZA 3MQ9A 3K02A 3RQTA 1B5HA 3W9WA 2V25A 4K3FA 2ZYOA 3G3JA 3PMVA 4H8IA 4TOZA 4F2OA 3LSFB 1NH7A 4JWYA 3FXRA 4P0IA 4R74A 3OO6A 4OESA 3O29A 4THIA 1GTKA 3QAXA 4GFRA 1H3DA 2P1SA 1AL3A 4BLAA 4ZECA 4ND9A 3FVOA 5AE4A 4YAHX 1PBQA 4R75A 1IXIA 1UTHB 1XC1A 4FECA 4M4GA 5ITPA 4PE5B 1B5IA 1LB8A 4JWXA 3UN6A 4ELOA 1FQAA 1SVXB 3M3FA 5AA2A 4QFPA 1ZBMA 2UVJA 4YMAA 1P1NA 3MBPA 2H4IA 3T93B 2ONRA 1A7LA 2DVCA 3BFTA 4HW8A 2HZKA 4HS7A 4RPOA 3O28A 1UTBB 1OMPA 3IO6A 4ZZEA 4IO7A 3FJ7A 1WODA 5L9MA 4X1DA 3G3GA 3IX1A 1NFTA 1Z7NE 3HN0A 2DE3A 3Q27A 4NF6B 4PETA 4G68C 1US5A 3TDJA 1WVJA 3BBRA 4NF6A 2H9BA 3D4CA 3SERA 1B52A 2D21A 4I1DA 2I6EA 2I3WA 4XTCQ 5H8NA 3KGCA 4R9FA 4JSDA 4XIGQ 4XKQA 3THIA 1BP5A 1XVXA 4G68B 2ZYNA 5I84A 4BDOA 1M5CA 1MXXA 1D9YA 2H5YA 4FEBA 4R6YA 2DWJA 1LAHE
chains in the Genus database with same CATH superfamily
1FPEA 5EYHA 1Y3QA 4E0WA 2V84A 5BUUA 2UYFA 2I0BA 1B3LA 1FTMA 2AL5A 2XHDA 3B6WA 4ZS9A 3TTKA 1YCJA 3MUQA 3CFXA 3IOWA 5M2VA 1M5FA 4LVQA 1Q35A 2I0CA 4U4SA 4JVCA 1ATGA 3G3KA 1QVSA 1DOTA 4XEQA 2FIEA 4WXJA 1P99A 2ONKE 3FV2A 4LUBA 4G61A 1I69A 1URGA 3D1RA 5CBRA 4DE8A 2QMWA 3DP8A 4G8NA 3OO7A 4IR8A 2ZZXA 3E3KA 5DVIA 4N81A 4NGUA 3KEIA 1M5EA 3IL1B 4MEVA 4U1ZA 4O3AA 4IO6A 2DOJA 1SW5A 4HE1A 2F36A 3CR9A 4OVRA 2QS4A 1AIVA 1D9VA 4PF8A 2UYEA 4H46A 2GQ1A 3K1PA 3T9HB 1NV2A 2XXHA 2NUVA 1FBEA 1G0IA 2OX3A 3N26A 1B40A 4O7IA 5KCJA 4M1VA 1NUYA 4MIJA 4Q5TA 4G68A 4G8HA 3C4MA 3M3LA 4YB7A 1OLCA 2CEYA 4U4XA 4IGRA 4F22A 3JZJA 1B0HA 1IITA 4NF8B 3D4GA 1O63A 4QBAA 2UVHA 3RNNA 4H1XA 3VXCA 1IZ1A 3T9VA 1VDWA 3VLWA 1R9LA 4QSEA 2P3VA 3MC2A 1B7ZA 4XFEA 2XXWA 1TXFA 4ELPA 3IO4A 3I6VA 4ZEDA 3USDA 1FSAA 1BTJA 1XHYA 2OWTA 2Y5KA 1VFDA 2ZNUA 1MDQA 5AA2B 4U23A 5CM6A 1QKBA 5HPQA 3S9NC 3HHFA 2Q2CA 5ESYA 4P11A 1MPBA 3C34A 4RK2A 1R6ZA 3BFUA 4EXKA 5H8NB 1XT8A 4MMPA 1FBCA 5AA4B 2Q2AA 1SW4A 2XXKA 1NNTA 3RPLB 4GOTA 3IR1A 4Q8RA 1FBDA 4MX6A 3C9HA 4GL0A 5IAIA 3FXBA 3K01A 4X48A 4FBPA 2F6PA 1YXIA 4R2FA 3SZPA 4EXLA 4PE3A 4DCYA 3FVGA 1DPEA 3BKIB 4QRZA 2O69A 2Z23A 2Y7IA 5H8FB 1N84A 2WEFA 4N17A 4GRKA 1SQYA 1A40A 4XF5A 3FJGA 1JETA 2HAVA 2O7UA 3P7IA 1KA1A 3SEVA 1YPNA 4H0WA 4O94A 1LBWA 2FNCA 2AL4A 4ELRA 5TP9B 2DQVA 2ZMBA 2XXIA 2QSXA 3OO9A 1GVCA 5DVJA 5FHMA 1IMCA 1INPA 4P1LA 4PFUA 5TP9A 2DWHA 1QUIA 1IUDA 4BDRA 3HHGA 2P2AA 1NUWA 3U94A 1MY4A 5H8QB 2O6AA 4P8BA 3R26A 1KZ8A 5ET8A 1ZTYA 3SDFA 4I62A 1R9QA 2I49A 3HPIA 4NN3A 2FYIA 3TCFA 3LV0A 2X26A 2XWOA 1Y1MA 2XXPA 2O68A 1YAEA 4MLVA 3SETA 4ONYA 5I2KA 3HCQA 4DLDA 1QULA 1QUKA 4RNSA 2X7PA 4PFYA 3M8UA 4HTGA 3ZS6A 3JV9A 5I57A 4H65A 2DWIA 4H8JA 4ECFA 4Z0IA 3Q28A 5L9SA 4XXUA 1NL5A 4OA4A 3IB1A 1O7TA 4BDQA 3RPWA 2VPNA 1F9BA 2F78A 5F1QA 2M8CA 1QGXA 5H8QA 1NV7A 1O64A 1VR5A 1PB8A 3EKIA 2VT5A 1DTZA 4LQ2A 5B7DA 3KZGA 4QSDA 3R7XA 1MDP1 3TCGA 1B4ZA 3T9XB 2PVUA 3OSQA 1FBHA 1LBVA 3FASA 4GF8A 1FTLA 4GX4A 1MXWA 3OENA 4RXLA 4NF5B 3K6VA 1IMFA 5F7VA 4ELQA 1NNFA 3MSTA 2CZIA 4N15A 4EQ9A 1Y4CA 1YZ0A 4N6PA 1Q9DA 3KOTA 1IMDA 1NUXA 3V89B 3RT6B 5AA2D 1HSEA 3GBAA 4E0XA 3IFAA 1N0TA 3MVXA 1EZOA 3EQ1A 1NV0A 5A5XB 5EQ9A 2Y84A 4KR5A 3KSJA 3IFCA 3UP9A 3SEXA 3K6XA 4OFOA 4AS5A 1Y20A 4PBHA 1NV4A 3MVWA 3CSGA 4P56A 3V8XB 1MXUA 3MP6A 2F5XA 2OWSA 2HQ0A 2F34A 3VLVA 2QPQA 4PGNA 2D5WA 3TPAA 1FCKA 1DK4A 3VXBA 5CC2A 2G93A 2E0SA 2XXTA 2D3IA 2Q88A 4OTEA 1CNQA 4HXVA 3K02A 2PFYA 3G3JA 3PMVA 4F2OA 4P0IA 3OO6A 2HHMA 4YAHX 4R75A 3BIGA 5ITPA 1B5IA 4JWXA 3UN6A 1ZBMA 5T3JA 3MBPA 2H4IA 2ONRA 4NG7A 4RPOA 4ZZEA 3IX1A 1NFTA 3HN0A 3Q27A 2H9BA 2I6EA 4R9FA 5I5PA 1LAHE 1SW1A 4U22A 5ITOA 5IZZA 1Q1KA 2B4MA 2WKYA 3RPLA 1KWHA 4O8MA 1P1WA 4YKJA 1B7HA 1A8FA 2ALUA 5LOMA 2DP8A 3VDFA 2YLNA 1MQHA 1NNPA 3CVGA 5H8FA 4C1TA 4R72A 1QJMA 2BJJX 1PB9A 3EHTA 1OLAA 2RCAA 2P3NA 3U93A 3TTLA 3ECRA 2GFEA 4PBQA 3PUZE 3K1MA 3N6UA 4TQUQ 2F7BA 2R8TA 5CMMA 4OWDA 2F97A 5EQ7A 1B3FA 3ILTB 3A3CA 3ONMA 3PMWA 1FPGA 1USYE 1M5DA 3C36A 2P0SA 3G3FA 4LQ5A 4YICA 1JVXA 1MY3A 3PD8A 3IJOB 4YU0A 2X7QA 3EHSA 3L6HA 4QFKA 2QVVA 1UIVA 2GRVA 4FATA 4LZ7A 3H6WA 5ET7A 5DYHA 3CFZA 4N4UA 1XVYA 3IOTA 4G8MA 4IO4A 3OELA 3QK6A 1PC3A 4OYVA 3TAJA 1K9ZA 1IMAA 3KC1A 3PUVE 2F8DA 4GLIA 1RYXA 3RGYA 4OERA 3OO8A 2UVGA 4H45A 1URDA 1T0KA 1DSNA 3OMBA 3PPQA 2XD2A 5AA4A 2HXWA 2RC9A 4TLMB 5CMBA 2L5VA 5TU0A 3VLUA 4FORA 2FBPA 1TWYA 5LDZA 3U8QA 2QS3A 1S9TA 4C0RA 3QUJA 4G77A 5L8DA 4I9DA 4MH5A 3G3HA 1PEBA 4OVJA 4G2ZA 4QHQA 5CI5A 1SYIA 2VGQA 3JYRA 5JK4A 2WBDA 1IXCA 5IZ3B 3IOUA 4GX3A 4PAFA 2DYXA 1SD3A 2OCUA 3ISPA 1GGGA 1SW2A 4RA1A 5FBPA 4YKKA 5I2KB 3CHGA 2A5SA 2IA4A 3K6UA 3PTYA 4F2QA 4QFOA 1MRPA 4LA9A 5F24A 1LCFA 1D4NA 4EF2A 3KG2A 1PBPA 4EF1A 4U2RA 5I2NA 3TQWA 1OVBA 2O84X 1B51A 3GYYA 1N76A 4DI4B 2V3TA 1R1NA 1FBGA 3O6GA 3UIFA 2V4CA 4NF4A 2I48A 3TMGA 3T9UA 4OETA 3B6TA 4IY5A 3HFUA 1Y3NA 5JTYB 1QUJA 4JWOA 1LBBA 3H4ZA 4PFBA 4ESXA 1FJ6A 4RPNA 1FPBA 1J1NA 1NMUA 3FV1A 3EPEA 2H99A 2V93A 4OFJA 1ANFA 3S2VA 1MQGA 3IJXB 4F31B 4KCDA 5CBSA 2ABHA 2PBWA 4NHBA 2VD3A 1EYIA 3U65A 3OOAA 4FE8A 2FA7A 4Z7EA 3PUXE 3B8BA 3IAZA 4ESWA 3MZ9A 3HSTA 3W9VA 5I7IA 2Y7RA 5AA1A 2QVRA 3GLBA 4DXCA 3MVZA 4NE4A 4F18A 5ELVA 5I56B 1MQJA 2HAUA 5JTYA 3SEWA 1B1XA 3FZVA 4JSOA 2YPNA 5FTIA 1P1OA 3LSXA 2DXRA 1AH5A 2I4BA 4PP0A 4LATA 3MJNA 3TFLA 4ZEFA 4G4PA 4GBVA 3PUWE 3MW0A 4POWA 2OZZA 2HCAA 1ELJA 4DDDA 2PMSA 1ZLQA 2THIA 5EYGA 1B1HA 4YZZA 1LFHA 2Z22A 4OVSA 1OIBA 3V5AA 3T96B 3TUSA 3Q29A 1BKAA 1LBYA 2DXYA 2HEUA 4JXIA 1A8EA 4O3BA 3KJ7A 4OVTA 4DIGA 5HM4B 3FBPA 1FRPA 3KN3A 1UQWA 2ZXTA 1N3WA 2B3BA 4GWOA 2PX1A 1MXVA 3KBZA 2XXYA 3PMXA 4GWXA 1N04A 3CRBA 2REGA 1UTBA 1VFEA 3O9PA 2A5TB 4IO5A 1BIYA 1N3XA 3UK4A 2R6GE 2QJEA 3V83A 4NF4B 2ZZWA 4P47A 4MBPA 3KJTA 2ONSA 1K9YA 4X8RA 2R71A 1RYOA 1GV8A 4PGPA 1FQCA 3LBSA 1TT1A 4GVOA 2WX9A 1NH8A 4HCWA 4JVDA 2PYYA 2WYPA 3E79A 2DWAA 3MQ9A 3RQTA 1B5HA 3W9WA 2V25A 2ZYOA 1FBPA 1NH7A 4OESA 2HXRA 3QAXA 4ZECA 4GFRA 2P1SA 3FVOA 5AE4A 1PBQA 4FECA 4P1EA 4PAKA 4M4GA 1LB8A 1FQAA 5AA2A 1P1NA 1RDZA 1NV5A 3T93B 2F3DA 4PAIA 2OWZA 2HZKA 3IO6A 1US5A 4NF6A 3SERA 1B52A 2D21A 5H8NA 4JSDA 4XKQA 4PF6A 4G68B 2Q74A 5I84A 1M5CA 1MXXA 1D9YA 2H5YA 2XXXA 3O97A 2JJKA 2ZNTA 3OSRA 4LN5A 4QSCA 2NWJA 3TTMA 4P9KA 4HCYA 1TFAA 1MY1A 4Q0CA 4NWDA 5FTHA 4DXBA 4GXAA 1B4HA 5FHNA 4OXVA 1FQBA 3CG1A 1QW0A 4AB6A 5DEXB 3MP8A 2HPGA 3R6UA 1SI1A 4F3BA 1USYH 3K0VA 2PT1A 4I40A 1UTHA 1LEVA 3DP4A 4AB5A 5J1DA 4MNPA 4N13A 3FXQA 5CMCA 3H7MA 1FPLA 4PFRA 4H5GA 2VD2A 4ISUA 3H06B 4PDHA 4NEDA 1JW5A 3KN7A 5BWJA 1H43A 2RINA 3KN8A 2V3QA 3I5OA 4QFNA 4R9GA 3VVFA 3PPRA 3K4UA 2CMOA 2NVUB 3T66A 5L9OA 1MH4A 3MPKA 4ZE8A 1SYHA 4OEVA 2I58A 4LP2B 1FTOA 5DTBA 2XXUA 3HV1A 3GXAA 2G29A 2AYSA 1AWBA 5ISUA 2Q89A 2XWVA 4R73A 4XKRA 2ZZVA 5TPAA 3TCHA 4BDMA 3VFJA 3PUYE 4YKIA 5TPAB 3ZSFA 4N91A 3OXNA 2H25A 2Q8MA 2O51A 1EH3A 2RCBA 1ZJLA 3MYUA 4F1VA 3ZKLA 3RT8A 3O66A 3T1BA 4KXPA 1MY0A 3RN8A 4KYDA 1PB7A 3S9EA 3WAEA 3LSWA 1LBZA 2QL3A 2LAOA 4U1OA 1FPDA 4MCOA 2GH9A 5CMKA 5I3SA 5DVFA 4QFLA 2F7AA 1FPKA 3HO7A 4IY6A 2NXOA 4OVQA 2QVUA 3TYHA 4IB2A 3G3IA 1OQHA 4IO2A 1WDNA 2FIXA 3LC8A 4C1UA 4NTLA 1H76A 4GWZA 1IMEA 3PPPA 4OEUA 3FVKA 4FAJA 2RC7A 4RYAA 4DXUA 1B9JA 1LGBC 1IMBA 1MG1A 4YMBA 1Y9UA 4EDPA 4F3SA 4OQOA 3B7DA 1AOVA 2WYKA 3CSBA 4GQOA 1QKAA 1DCUA 2QS1A 4FEDA 3N6TA 3OEMA 3QIMA 4KI0E 4IGTA 4N6KA 4AQ4A 1I6AA 5DW8A 1SDXA 3SEUA 5ET6A 5ICQA 2OK2A 4F1YA 4MFIA 4F3GA 3H6UA 3VE1B 1NNKA 3M3KA 5K2YA 4P0GA 3L6GA 1VE4A 5H8HA 4F1UA 4UABA 4OVPA 4PQJA 4PDDA 2XD3A 3IK6B 3ODBA 1JVYA 1KA0A 2Z8EA 2Q8JA 3BIHA 2HFBA 1MXYA 4GWYA 2DE4A 1OQGA 3E13X 1Y1ZA 1LSTA 4N8GA 1Z7ME 5FHOA 2PCRA 4OMBA 3TKDA 1POTA 2DS9A 3SEYA 1XOCA 2RKMA 3LR1A 3RLFE 3MVYA 3OD7A 2YJPA 4GXSB 3C35A 1LFGA 4POXA 2PFZA 2O7IA 3GZGA 4KHZE 5K2XA 4UA8A 3MAMA 4DCXA 1JQFA 1JEVA 4GX6A 4XKPA 1ZIUA 1NV1A 2XA5A 4ZZAA 4H6DA 3W15C 1MQDA 4NX1A 2FVZA 5KDTA 3IB0A 2R9JA 5LTCA 4F3PA 4RK9A 4O7MA 1RKMA 4H5FA 1B6HA 1FW0A 2XXQA 3A09A 2F3BA 1OVTA 1IQ7A 3MZ1A 4TLLB 1P1QA 1DBZA 3RYDA 3QYTA 5EHSA 1M5BA 4R6HA 5KZTA 2Z8FA 1MXZA 4HE2A 2QFLA 3U1OA 3RY3A 3TELA 4DI3D 1BLFA 4KYSA 5KCJB 4GWSA 3N5LA 3B6QA 3H03A 2KLFA 4PFWA 2QMXA 1IXGA 4OFLA 1FJ9A 2DVZA 1GR2A 1N7WA 2E1SA 3CIJA 3CI8A 3IORA 3PV0E 1LB9A 3Q25A 1MM7A 1DPPA 2PT2A 3C31A 4NF5A 1FPFA 3LSFB 4R74A 4THIA 4BLAA 4PFIA 4ND9A 1IXIA 1XC1A 4I3EA 4ELOA 1SVXB 2UVJA 4YMAA 4N8YA 1A7LA 1UTBB 1OMPA 3ROJA 4PC9A 3FJ7A 5L9MA 4X1DA 1Z7NE 5EQ8A 4G68C 4HE0A 3KGCA 3THIA 1BP5A 4BDOA 1JW4A 1NKXA 3A29A 2AIXA 1S50A 2VHAA 1D9QA 5I57B 1II5A 2I3VA 3FIRA 3VVEA 3VVDA 1A55A 2CZLA 4MJOA 4R6KA 3C33A 2OJTA 4OZ9A 4F29A 1MPDA 2XX9A 4MNCA 2UXAA 4X04A 4KFQA 4ZEIA 2I4CA 3PGFA 4RY1A 4NF0A 2XWKA 1FTAA 4OHNA 3ILUB 3KC0A 3SKPA 1B3HA 3MP1A 2RC8A 4FIMA 1B58A 3CFLA 3RTWB 5EHMA 5IGAA 1JNFA 4EQBA 1BK4A 1TFDA 1A99A 1MPCA 4X1BA 5HBCA 1B7UA 3QXMA 3LUYA 2O1MA 1MH3A 4ZEBA 1I6QA 4JVIA 3E78A 3T0JA 5DEXA 1ZKBA 1B32A 1N7XA 3IB2A 3OEKA 2A5TA 1Y3PA 1S7YA 3LUZA 2F6GA 1B46A 3RUMA 2Y5LA 1A54A 4L17A 3VV5A 1H45A 1HSJA 3NOHA 3PPOA 3U72A 4MLQA 3AXFA 1JP4A 1CE2A 3A3UA 3G7WA 3B50A 5CRYA 4GWUA 1AMFA 4WEPA 3FVNA 2GHBA 1XI6A 4KPTA 3KFMA 3T22A 3MPLA 5I59A 3DELB 3TTNA 3Q26A 4UACA 3PD9A 3PPNA 2XX8A 2IEEA 2NOOA 4KD5A 5I59B 3KSXA 4LONB 4QXDA 4WEDA 3TTRA 4Q30B 2B65A 3S4UA 1LBXA 5KDTB 1B5JA 4NQ8A 1JEUA 4MNIA 1B2HA 4F19A 4GIZA 4KQPA 3LSLA 1EU8A 3O6IA 4ZE9A 1FQDA 1EZ9A 3SESA 4GWWA 3O2AA 5I56A 1URSA 1JW1A 1FTKA 2CZKA 1YYZA 5I2NB 1IXHA 1Y4TA 3FXUA 2KR0A 2ZYKA 1US4A 2QS2A 2MKZA 1HSLA 4O3CA 4QF9A 2XXVA 3K1NA 5DT6A 3ZKKA 3F11A 3I3VA 3DLNA 3O6HA 4GL8A 5ICTA 3QMFA 2H98A 1UIUA 3UORA 1RDXA 3WAFA 3TEPA 1MM6A 4BDNA 1LFIA 3DM0A 2B3FA 1RDYA 4NWCA 4PFTA 2VP1A 4NF8A 2HZLA 3FUZA 2DDKA 3IOVA 5IZ1A 2ZYMA 5H8HB 1EYKA 1XS5A 4YB6A 4R2BA 4H67A 2Z8DA 1ZMGA 3H6VA 4ZDMA 4LZ5A 1B0LA 1NI9A 3PU5A 4AS4A 3TQLA 5AA3A 5ET5A 1I6BA 1MQIA 1LBCA 3EHUA 4OENA 3EF7A 4U21A 2Y7PA 1FBFA 4DZ1A 2RF1A 1P1UA 2Y7WA 1MY2A 5I58B 2ESNA 3FJMA 4I8CA 1D3KA 5I58A 1DTGA 1PDAA 1B05A 4F39A 4YB5A 1LAGE 1FQEA 2OBGA 3FGSA 1EZPA 4OANA 2GHAA 1LAXA 2XXRA 2V3UA 5A5XA 4BDLA 1CB6A 1FQFA 3UGWA 3K00A 4GBWA 4MAGA 1SI0A 1LAFE 2OLBA 4XKNA 2ZNSA 4N07A 1DMBA 4KCCA 3K6WA 2XWIA 5H8SA 4GD5A 3KOSA 4JBZA 2DSFA 4WKMA 2ANJA 1NV3A 3H6TA 1IIWA 1L5TA 3FATA 4MF3A 4NMYA 5EQAA 4EUOA 5A5LA 1H44A 4X9TA 2F7CA 3TODA 5B70A 3C32A 2DE2A 3UA8A 1POY1 4KYEA 3TZAA 2Y7KA 3S9MC 3S9LC 4JB7A 3GBBA 2Q9TA 1B3GA 4P3LA 1ZU0A 3RTFB 2F35A 4EQ7A 5J16A 2B4LA 3E4RA 4YKPA 2VPOA 3K2DA 1IEJA 1VSOA 3DP6A 3N94A 4JDFA 4FJPA 4IO3A 3MZBA 1NUZA 1NV6A 4ZEKA 1MS7A 4PTKA 4I3YA 3QUFA 2XX7A 4NAPA 3H3GA 3CG3A 1LLSA 1FTJA 3KBRA 3MWBA 1SPIA 2WBBA 1YTVA 1SBPA 2CZHA 3QSLA 5IKBA 2O1LA 3U92A 1B3EA 2UVIA 2W7YA 2REJA 4LZ8A 5EYFA 4RJZA 1LCTA 2QRYA 3E9XA 5JEIA 4N6DA 3EN3A 3FD3A 2VOZA 4PCDA 2BJIA 4K3FA 4TOZA 4H8IA 4JWYA 3FXRA 1G0HA 3O29A 1FPIA 1GTKA 1H3DA 1AL3A 4MHFA 5IM2A 5IZ3A 1UTHB 2CEXA 4PE5B 3M3FA 4QFPA 2DVCA 3BFTA 4HW8A 1EYJA 4HS7A 2FHYA 3O28A 4IO7A 1WODA 3G3GA 4NF6B 2DE3A 4PETA 3TDJA 1WVJA 3BBRA 3D4CA 1FPJA 4I1DA 4XTCQ 2I3WA 4XIGQ 1XVXA 2ZYNA 2KQZA 4R6YA 4FEBA 2DWJA
chains in the Genus database with same CATH topology
2ZNTA 3ZS6A 1SW1A 1Y3QA 1JW4A 1NKXA 3OSRA 4QSCA 4U22A 4HCYA 5ITOA 2AIXA 2NWJA 1S50A 2VHAA 1Q1KA 4E0WA 2WKYA 1TFAA 1KWHA 1MY1A 2V84A 4NWDA 4Q0CA 5BUUA 1P1WA 5FTHA 4YKJA 1II5A 4DXBA 4GXAA 2I3VA 5I57B 3FIRA 1B4HA 5FHNA 1B7HA 1A8FA 2UYFA 2I0BA 4OXVA 3VVEA 2ALUA 3VVDA 1A55A 5LOMA 2CZLA 1FQBA 1B3LA 1FTMA 4R6KA 2AL5A 2DP8A 2XHDA 3B6WA 4ZS9A 3C33A 3CG1A 3VDFA 1QW0A 2YLNA 1MQHA 1YCJA 3MUQA 2XXXA 3TTKA 2OJTA 4AB6A 4OZ9A 3CFXA 3IOWA 3MP8A 5DEXB 5M2VA 3R6UA 4F29A 1M5FA 1MPDA 1NNPA 3CVGA 2XX9A 1Q35A 2I0CA 4LVQA 5H8FA 1SI1A 2UXAA 4C1TA 1USYH 4KFQA 4F3BA 4R72A 3K0VA 2PT1A 4ZEIA 1UTHA 1QJMA 4U4SA 2I4CA 3DP4A 3PGFA 3Q26A 4UACA 2BJJX 1PB9A 4AB5A 3EHTA 5J1DA 4N13A 1OLAA 2RCAA 1ATGA 3FXQA 3G3KA 4RY1A 5CMCA 3H7MA 3U93A 1QVSA 1DOTA 3ECRA 3TTLA 4OHNA 2GFEA 3ILUB 3PUZE 3K1MA 4WXJA 4H5GA 3N6UA 3SKPA 1B3HA 2VD2A 1P99A 2ONKE 3MP1A 4ISUA 3FV2A 2RC8A 4TQUQ 2F7BA 5CMMA 3H06B 2F97A 4OWDA 4NEDA 4FIMA 1B3FA 1B58A 4LUBA 1JW5A 5IAIA 3KN7A 1I69A 3ILTB 5BWJA 3CFLA 1URGA 3A3CA 3ONMA 5CBRA 1H43A 5EHMA 3RTWB 4DE8A 3PMWA 2QMWA 3DP8A 4F39A 1USYE 1M5DA 2RINA 3KN8A 3OO7A 3C36A 1JNFA 4G8NA 3E3KA 2P0SA 2V3QA 5DVIA 3G3FA 4EQBA 4LQ5A 4YICA 1JVXA 1TFDA 1A99A 1MPCA 1MY3A 3I5OA 3PD8A 4QFNA 3IJOB 4R9GA 4X1BA 4YU0A 2X7QA 1B7UA 3EHSA 3KEIA 3L6HA 3QXMA 5HBCA 3VVFA 3LUYA 3PPRA 1M5EA 4QFKA 2O1MA 3K4UA 3IL1B 1UIVA 1MH3A 4ZEBA 4U1ZA 4O3AA 4IO6A 2DOJA 1I6QA 1SW5A 2CMOA 2F36A 2GRVA 4LZ7A 2NVUB 3CR9A 3H6WA 3T66A 4FATA 5L9OA 5DYHA 1MH4A 3CFZA 1XVYA 3MPKA 2QS4A 3IOTA 1D9VA 4G8MA 2UYEA 4ZE8A 1SYHA 1AIVA 4IO4A 3OELA 4OEVA 3QK6A 5DEXA 5L9SA 1PC3A 1ZKBA 3K1PA 3T9HB 2I58A 4LP2B 3TTNA 1B32A 2XXHA 4OYVA 3TAJA 1FTOA 5DTBA 1N7XA 2NUVA 2XXUA 3HV1A 3PUVE 3GXAA 2G29A 2AYSA 2F8DA 3IB2A 3OEKA 4GLIA 1RYXA 2A5TA 1Y3PA 1S7YA 2Q89A 5ISUA 3N26A 4R73A 4OERA 1B40A 3OO8A 3RGYA 2F6GA 1B46A 2UVGA 4XKRA 5TPAA 3RUMA 3TCHA 5KCJA 4M1VA 1A54A 4Q5TA 4BDMA 4G68A 3PUYE 3VFJA 4YKIA 1URDA 4L17A 5TPAB 4G8HA 3VV5A 3ZSFA 1T0KA 3C4MA 1DSNA 3OMBA 1H45A 3PPQA 1HSJA 3OXNA 2XD2A 5AA4A 3PPOA 3M3LA 2H25A 4YB7A 2HXWA 1OLCA 2RC9A 4TLMB 5CMBA 5TU0A 4MLQA 3U72A 2O51A 1EH3A 2RCBA 3VLUA 4U4XA 3AXFA 4IGRA 4F22A 1ZJLA 3JZJA 1B0HA 1IITA 1CE2A 4F1VA 4FORA 4NF8B 3D4GA 3A3UA 3G7WA 3ZKLA 3RT8A 1O63A 5CRYA 2UVHA 3O66A 1AMFA 3RNNA 4H1XA 4WEPA 1MY0A 1TWYA 2GHBA 3FVNA 3VXCA 5I58A 1IZ1A 4KPTA 3T9VA 3U8QA 2QS3A 3VLWA 1S9TA 3RN8A 1R9LA 4KYDA 1PB7A 4QSEA 3WAEA 3KFMA 3LSWA 4C0RA 3S9EA 3QUJA 2QL3A 2LAOA 3MPLA 3T22A 5I59A 4G77A 5L8DA 3DELB 4I9DA 3PPNA 2XX8A 3MC2A 1B7ZA 2IEEA 3PD9A 2NOOA 3G3HA 2XXWA 1TXFA 3KSXA 4KD5A 5I59B 4LONB 4ELPA 1PEBA 4OVJA 3IO4A 4G2ZA 4QHQA 5CI5A 4WEDA 3TTRA 1SYIA 2GH9A 2VGQA 3I6VA 3JYRA 4Q30B 4ZEDA 5CMKA 5JK4A 2B65A 3USDA 1IXCA 3S4UA 3IOUA 1BTJA 2DYXA 5DVFA 1B5JA 5KDTB 1JEUA 1SD3A 1XHYA 2OWTA 4QFLA 2F7AA 1VFDA 2ZNUA 1MDQA 5AA2B 1B2HA 3HO7A 2OCUA 4U23A 4F19A 5CM6A 1GGGA 1SW2A 4F1YA 1QKBA 4IY6A 5HPQA 3S9NC 4RA1A 3HHFA 2NXOA 2Q2CA 4GIZA 4KQPA 4YKKA 3LSLA 1EU8A 3O6IA 5I2KB 2A5SA 4ZE9A 2IA4A 4P11A 3TYHA 1MPBA 3C34A 3G3IA 4IB2A 3K6UA 1OQHA 4IO2A 4RK2A 1FQDA 1R6ZA 4F2QA 1WDNA 1EZ9A 1MRPA 3BFUA 4QFOA 3SESA 4LA9A 3O2AA 5I56A 1URSA 1JW1A 4EXKA 1LCFA 1XT8A 1D4NA 4EF2A 5H8NB 1FTKA 3KG2A 5I2NB 5AA4B 3LC8A 1IXHA 2Q2AA 1PBPA 1Y4TA 4EF1A 4C1UA 1SW4A 4U2RA 5I2NA 3TQWA 4NTLA 1OVBA 1NNTA 3FXUA 2O84X 2ZYKA 1US4A 4GOTA 2QS2A 1B51A 1H76A 3IR1A 1HSLA 4O3CA 4Q8RA 1N76A 3PPPA 4OEUA 3C9HA 3FVKA 4GL0A 2XXVA 3K1NA 4QF9A 2V3TA 2RC7A 5DT6A 4FAJA 3K01A 1R1NA 4X48A 3ZKKA 4RYAA 3O6GA 3O97A 1B9JA 1LGBC 3UIFA 4DXUA 2F6PA 4R2FA 1MG1A 4EXLA 4DCYA 3FVGA 1DPEA 4NF4A 3F11A 3I3VA 1Y9UA 4YMBA 2I48A 3BKIB 3DLNA 4EDPA 4QRZA 4F3SA 2O69A 4OQOA 3O6HA 2Z23A 3B7DA 1AOVA 3TMGA 3T9UA 2Y7IA 3CSBA 5H8FB 1N84A 4GQOA 4GRKA 1QKAA 1SQYA 1A40A 4FEDA 2QS1A 3FJGA 1JETA 4GL8A 3B6TA 3N6TA 2HAVA 4OETA 4IY5A 5ICTA 2O7UA 3P7IA 3OEMA 3QIMA 4KI0E 2H98A 4IGTA 1UIUA 3SEVA 1YPNA 4H0WA 1Y3NA 5JTYB 1QUJA 3UORA 4JWOA 4AQ4A 3WAFA 2FNCA 1I6AA 3TEPA 1LBBA 1MM6A 4BDNA 3H4ZA 2AL4A 1LFIA 4ELRA 1SDXA 5TP9B 2DQVA 3SEUA 4ESXA 2ZMBA 5ICQA 3DM0A 2OK2A 2B3FA 4NWCA 2XXIA 2QSXA 3OO9A 4RPNA 5DVJA 5FHMA 5TP9A 2VP1A 4NF8A 4PFTA 4MFIA 2HZLA 1J1NA 2DWHA 3H6UA 4PFUA 1QUIA 4F3GA 1IUDA 1NMUA 3FUZA 3FV1A 3EPEA 3HHGA 3VE1B 2P2AA 2H99A 4BDRA 2V93A 3IOVA 3U94A 1NNKA 3M3KA 5K2YA 2ZYMA 5H8HB 1XS5A 3L6GA 4MH5A 4OFJA 4P0GA 4YB6A 1MY4A 1VE4A 1ANFA 5H8QB 3S2VA 2O6AA 1GVCA 4R2BA 5H8HA 4F1UA 3R26A 4H67A 1MQGA 1ZTYA 2Z8DA 3IJXB 4PQJA 1ZMGA 2XD3A 4F31B 3IK6B 4KCDA 5CBSA 2ABHA 3ODBA 2PBWA 3H6VA 3SDFA 4I62A 4ZDMA 4LZ5A 2VD3A 1R9QA 1JVYA 2I49A 1B0LA 2Z8EA 3HPIA 2Q8JA 3OOAA 2FYIA 4FE8A 3PU5A 2HFBA 2FA7A 1MXYA 3TCFA 2DE4A 1OQGA 4Z7EA 3PUXE 3E13X 3TQLA 5AA3A 2X26A 1Y1ZA 1I6BA 1LSTA 1MQIA 3IAZA 4ESWA 1LBCA 1Z7ME 3MZ9A 5FHOA 1Y1MA 4OMBA 2XXPA 2O68A 3HSTA 3EHUA 4OENA 1YAEA 3EF7A 4MLVA 3SETA 3TKDA 3W9VA 4ONYA 4U21A 1POTA 2Y7PA 4DZ1A 5I2KA 3HCQA 2RF1A 1P1UA 2Y7WA 2Y7RA 5AA1A 4DLDA 1MY2A 1QULA 2DS9A 1QUKA 3GLBA 4DXCA 3SEYA 3MVZA 2X7PA 1XOCA 4RNSA 4NE4A 4F18A 5I58B 4PFYA 3M8UA 2RKMA 4HTGA 5ELVA 5I56B 2ESNA 3FJMA 3LR1A 1MQJA 1D3KA 2HAUA 3JV9A 1DTGA 3MVYA 3OD7A 4H65A 4I8CA 3RLFE 1PDAA 1B05A 2YJPA 5JTYA 4GXSB 2DWIA 3C35A 4H8JA 3SEWA 1B1XA 4ECFA 1LFGA 3FZVA 4JSOA 4POXA 4Z0IA 2YPNA 3Q28A 4YB5A 1P1OA 1LAGE 1FQEA 2DXRA 3LSXA 5FTIA 4XXUA 1NL5A 2OBGA 3IB1A 3FGSA 1EZPA 1O7TA 2O7IA 2GHAA 3GZGA 4BDQA 3RPWA 1AH5A 1F9BA 2I4BA 2F78A 4LATA 1LAXA 2XXRA 4PP0A 2V3UA 3MJNA 5A5XA 4BDLA 4KHZE 5F1QA 2M8CA 1CB6A 5K2XA 3TFLA 1FQFA 4UA8A 3UGWA 3MAMA 3K00A 5H8QA 1JQFA 4ZEFA 4DCXA 4G4PA 3PUWE 1SI0A 4U1OA 1JEVA 1LAFE 1O64A 2OLBA 3MW0A 4XKPA 1VR5A 4XKNA 1ZIUA 4POWA 2OZZA 2HCAA 2ZNSA 1DMBA 1PB8A 4N07A 4ZZAA 1ELJA 4KCCA 3K6WA 4DDDA 4H6DA 1DTZA 2PMSA 1ZLQA 2THIA 5H8SA 1MQDA 4LQ2A 4GD5A 1B1HA 4YZZA 3W15C 5B7DA 3KZGA 3KOSA 4JBZA 4QSDA 1LFHA 2Z22A 3R7XA 2DSFA 4WKMA 1OIBA 1MDP1 3V5AA 2ANJA 3TTMA 3TCGA 1B4ZA 3T9XB 2PVUA 3OSQA 3H6TA 1IIWA 5KDTA 3FASA 1L5TA 3IB0A 3FATA 4GF8A 4MF3A 4NMYA 3T96B 4EUOA 3TUSA 3Q29A 1FTLA 1BKAA 2DXYA 2HEUA 4JXIA 1MXWA 1A8EA 2R9JA 4O3BA 1H44A 4X9TA 2F7CA 3KJ7A 3OENA 4RK9A 3TODA 4F3PA 3C32A 5B70A 2DE2A 4RXLA 4NF5B 3K6VA 3UA8A 4DIGA 5F7VA 5HM4B 1POY1 4ELQA 4KYEA 3TZAA 2Y7KA 3KN3A 3S9MC 3S9LC 1NNFA 1RKMA 4H5FA 3GBBA 1UQWA 1B3GA 2Q9TA 4JB7A 5I57A 1B6HA 1FW0A 1ZU0A 2ZXTA 1N3WA 3RTFB 1Y4CA 2F35A 4EQ9A 2XXQA 3A09A 2B3BA 4N6PA 4EQ7A 3KOTA 1OVTA 4GWOA 2PX1A 1MXVA 1IQ7A 3V89B 3MZ1A 3E4RA 4TLLB 3RT6B 5AA2D 1HSEA 1P1QA 3GBAA 4YKPA 4E0XA 2XXYA 1N0TA 3K2DA 3MVXA 1IEJA 1EZOA 1VSOA 3DP6A 3N94A 3EQ1A 3PMXA 4JDFA 5A5XB 4FJPA 3QYTA 5EHSA 1N04A 3MZBA 4IO3A 1M5BA 2Y84A 3CRBA 4KR5A 4R6HA 2REGA 3KSJA 1UTBA 1VFEA 3UP9A 2Z8FA 1MXZA 5KZTA 3SEXA 4ZEKA 1MS7A 3K6XA 3O9PA 2A5TB 3QUFA 4IO5A 1BIYA 1Y20A 1N3XA 2XX7A 4OFOA 3RY3A 3TELA 3U1OA 2R6GE 3CG3A 2QJEA 3H3GA 3UK4A 3V83A 1BLFA 4KYSA 4NF4B 5KCJB 1LLSA 3MVWA 3CSGA 3N5LA 1FTJA 3KJTA 4MBPA 2ONSA 1MXUA 3B6QA 3V8XB 3MP6A 2F5XA 2OWSA 3KBRA 3H03A 2HQ0A 2F34A 3MWBA 2KLFA 4PFWA 2QMXA 1YTVA 1IXGA 1SBPA 2R71A 4OFLA 1RYOA 3QSLA 2QPQA 1GV8A 3VLVA 5IKBA 2D5WA 2O1LA 3TPAA 2DVZA 3U92A 1B3EA 1FQCA 1FCKA 3LBSA 1GR2A 1TT1A 1N7WA 2UVIA 2W7YA 2REJA 4LZ8A 5EYFA 3VXBA 5CC2A 2G93A 2E0SA 4RJZA 1LCTA 2E1SA 2QRYA 2XXTA 3CIJA 2D3IA 2Q88A 3CI8A 3E9XA 3IORA 4GVOA 3PV0E 5JEIA 1LB9A 3Q25A 1NH8A 1MM7A 1DPPA 4HCWA 4OTEA 2PYYA 2PT2A 3C31A 3EN3A 3FD3A 4NF5A 2DWAA 2VOZA 3MQ9A 3K02A 3RQTA 1B5HA 3W9WA 2V25A 4K3FA 2ZYOA 3G3JA 3PMVA 4H8IA 4TOZA 4F2OA 3LSFB 1NH7A 4JWYA 3FXRA 4P0IA 4R74A 3OO6A 4OESA 3O29A 4THIA 1GTKA 3QAXA 4GFRA 1H3DA 2P1SA 1AL3A 4BLAA 4ZECA 4ND9A 3FVOA 5AE4A 4YAHX 1PBQA 4R75A 1IXIA 1UTHB 1XC1A 4FECA 4M4GA 5ITPA 4PE5B 1B5IA 1LB8A 4JWXA 3UN6A 4ELOA 1FQAA 1SVXB 3M3FA 5AA2A 4QFPA 1ZBMA 2UVJA 4YMAA 1P1NA 3MBPA 2H4IA 3T93B 2ONRA 1A7LA 2DVCA 3BFTA 4HW8A 2HZKA 4HS7A 4RPOA 3O28A 1UTBB 1OMPA 3IO6A 4ZZEA 4IO7A 3FJ7A 1WODA 5L9MA 4X1DA 3G3GA 3IX1A 1NFTA 1Z7NE 3HN0A 2DE3A 3Q27A 4NF6B 4PETA 4G68C 1US5A 3TDJA 1WVJA 3BBRA 4NF6A 2H9BA 3D4CA 3SERA 1B52A 2D21A 4I1DA 2I6EA 2I3WA 4XTCQ 5H8NA 3KGCA 4R9FA 4JSDA 4XIGQ 4XKQA 3THIA 1BP5A 1XVXA 4G68B 2ZYNA 5I84A 4BDOA 1M5CA 1MXXA 1D9YA 2H5YA 4FEBA 4R6YA 2DWJA 1LAHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNT A;  3ZS6 A;  1SW1 A;  1Y3Q A;  1JW4 A;  1NKX A;  3OSR A;  4QSC A;  4U22 A;  4HCY A;  5ITO A;  2AIX A;  2NWJ A;  1S50 A;  2VHA A;  1Q1K A;  4E0W A;  2WKY A;  1TFA A;  1KWH A;  1MY1 A;  2V84 A;  4NWD A;  4Q0C A;  5BUU A;  1P1W A;  5FTH A;  4YKJ A;  1II5 A;  4DXB A;  4GXA A;  2I3V A;  5I57 B;  3FIR A;  1B4H A;  5FHN A;  1B7H A;  1A8F A;  2UYF A;  2I0B A;  4OXV A;  3VVE A;  2ALU A;  3VVD A;  1A55 A;  5LOM A;  2CZL A;  1FQB A;  1B3L A;  1FTM A;  4R6K A;  2AL5 A;  2DP8 A;  2XHD A;  3B6W A;  4ZS9 A;  3C33 A;  3CG1 A;  3VDF A;  1QW0 A;  2YLN A;  1MQH A;  1YCJ A;  3MUQ A;  2XXX A;  3TTK A;  2OJT A;  4AB6 A;  4OZ9 A;  3CFX A;  3IOW A;  3MP8 A;  5DEX B;  5M2V A;  3R6U A;  4F29 A;  1M5F A;  1MPD A;  1NNP A;  3CVG A;  2XX9 A;  1Q35 A;  2I0C A;  4LVQ A;  5H8F A;  1SI1 A;  2UXA A;  4C1T A;  1USY H;  4KFQ A;  4F3B A;  4R72 A;  3K0V A;  2PT1 A;  4ZEI A;  1UTH A;  1QJM A;  4U4S A;  2I4C A;  3DP4 A;  3PGF A;  3Q26 A;  4UAC A;  2BJJ X;  1PB9 A;  4AB5 A;  3EHT A;  5J1D A;  4N13 A;  1OLA A;  2RCA A;  1ATG A;  3FXQ A;  3G3K A;  4RY1 A;  5CMC A;  3H7M A;  3U93 A;  1QVS A;  1DOT A;  3ECR A;  3TTL A;  4OHN A;  2GFE A;  3ILU B;  3PUZ E;  3K1M A;  4WXJ A;  4H5G A;  3N6U A;  3SKP A;  1B3H A;  2VD2 A;  1P99 A;  2ONK E;  3MP1 A;  4ISU A;  3FV2 A;  2RC8 A;  4TQU Q;  2F7B A;  5CMM A;  3H06 B;  2F97 A;  4OWD A;  4NED A;  4FIM A;  1B3F A;  1B58 A;  4LUB A;  1JW5 A;  5IAI A;  3KN7 A;  1I69 A;  3ILT B;  5BWJ A;  3CFL A;  1URG A;  3A3C A;  3ONM A;  5CBR A;  1H43 A;  5EHM A;  3RTW B;  4DE8 A;  3PMW A;  2QMW A;  3DP8 A;  4F39 A;  1USY E;  1M5D A;  2RIN A;  3KN8 A;  3OO7 A;  3C36 A;  1JNF A;  4G8N A;  3E3K A;  2P0S A;  2V3Q A;  5DVI A;  3G3F A;  4EQB A;  4LQ5 A;  4YIC A;  1JVX A;  1TFD A;  1A99 A;  1MPC A;  1MY3 A;  3I5O A;  3PD8 A;  4QFN A;  3IJO B;  4R9G A;  4X1B A;  4YU0 A;  2X7Q A;  1B7U A;  3EHS A;  3KEI A;  3L6H A;  3QXM A;  5HBC A;  3VVF A;  3LUY A;  3PPR A;  1M5E A;  4QFK A;  2O1M A;  3K4U A;  3IL1 B;  1UIV A;  1MH3 A;  4ZEB A;  4U1Z A;  4O3A A;  4IO6 A;  2DOJ A;  1I6Q A;  1SW5 A;  2CMO A;  2F36 A;  2GRV A;  4LZ7 A;  2NVU B;  3CR9 A;  3H6W A;  3T66 A;  4FAT A;  5L9O A;  5DYH A;  1MH4 A;  3CFZ A;  1XVY A;  3MPK A;  2QS4 A;  3IOT A;  1D9V A;  4G8M A;  2UYE A;  4ZE8 A;  1SYH A;  1AIV A;  4IO4 A;  3OEL A;  4OEV A;  3QK6 A;  5DEX A;  5L9S A;  1PC3 A;  1ZKB A;  3K1P A;  3T9H B;  2I58 A;  4LP2 B;  3TTN A;  1B32 A;  2XXH A;  4OYV A;  3TAJ A;  1FTO A;  5DTB A;  1N7X A;  2NUV A;  2XXU A;  3HV1 A;  3PUV E;  3GXA A;  2G29 A;  2AYS A;  2F8D A;  3IB2 A;  3OEK A;  4GLI A;  1RYX A;  2A5T A;  1Y3P A;  1S7Y A;  2Q89 A;  5ISU A;  3N26 A;  4R73 A;  4OER A;  1B40 A;  3OO8 A;  3RGY A;  2F6G A;  1B46 A;  2UVG A;  4XKR A;  5TPA A;  3RUM A;  3TCH A;  5KCJ A;  4M1V A;  1A54 A;  4Q5T A;  4BDM A;  4G68 A;  3PUY E;  3VFJ A;  4YKI A;  1URD A;  4L17 A;  5TPA B;  4G8H A;  3VV5 A;  3ZSF A;  1T0K A;  3C4M A;  1DSN A;  3OMB A;  1H45 A;  3PPQ A;  1HSJ A;  3OXN A;  2XD2 A;  5AA4 A;  3PPO A;  3M3L A;  2H25 A;  4YB7 A;  2HXW A;  1OLC A;  2RC9 A;  4TLM B;  5CMB A;  5TU0 A;  4MLQ A;  3U72 A;  2O51 A;  1EH3 A;  2RCB A;  3VLU A;  4U4X A;  3AXF A;  4IGR A;  4F22 A;  1ZJL A;  3JZJ A;  1B0H A;  1IIT A;  1CE2 A;  4F1V A;  4FOR A;  4NF8 B;  3D4G A;  3A3U A;  3G7W A;  3ZKL A;  3RT8 A;  1O63 A;  5CRY A;  2UVH A;  3O66 A;  1AMF A;  3RNN A;  4H1X A;  4WEP A;  1MY0 A;  1TWY A;  2GHB A;  3FVN A;  3VXC A;  5I58 A;  1IZ1 A;  4KPT A;  3T9V A;  3U8Q A;  2QS3 A;  3VLW A;  1S9T A;  3RN8 A;  1R9L A;  4KYD A;  1PB7 A;  4QSE A;  3WAE A;  3KFM A;  3LSW A;  4C0R A;  3S9E A;  3QUJ A;  2QL3 A;  2LAO A;  3MPL A;  3T22 A;  5I59 A;  4G77 A;  5L8D A;  3DEL B;  4I9D A;  3PPN A;  2XX8 A;  3MC2 A;  1B7Z A;  2IEE A;  3PD9 A;  2NOO A;  3G3H A;  2XXW A;  1TXF A;  3KSX A;  4KD5 A;  5I59 B;  4LON B;  4ELP A;  1PEB A;  4OVJ A;  3IO4 A;  4G2Z A;  4QHQ A;  5CI5 A;  4WED A;  3TTR A;  1SYI A;  2GH9 A;  2VGQ A;  3I6V A;  3JYR A;  4Q30 B;  4ZED A;  5CMK A;  5JK4 A;  2B65 A;  3USD A;  1IXC A;  3S4U A;  3IOU A;  1BTJ A;  2DYX A;  5DVF A;  1B5J A;  5KDT B;  1JEU A;  1SD3 A;  1XHY A;  2OWT A;  4QFL A;  2F7A A;  1VFD A;  2ZNU A;  1MDQ A;  5AA2 B;  1B2H A;  3HO7 A;  2OCU A;  4U23 A;  4F19 A;  5CM6 A;  1GGG A;  1SW2 A;  4F1Y A;  1QKB A;  4IY6 A;  5HPQ A;  3S9N C;  4RA1 A;  3HHF A;  2NXO A;  2Q2C A;  4GIZ A;  4KQP A;  4YKK A;  3LSL A;  1EU8 A;  3O6I A;  5I2K B;  2A5S A;  4ZE9 A;  2IA4 A;  4P11 A;  3TYH A;  1MPB A;  3C34 A;  3G3I A;  4IB2 A;  3K6U A;  1OQH A;  4IO2 A;  4RK2 A;  1FQD A;  1R6Z A;  4F2Q A;  1WDN A;  1EZ9 A;  1MRP A;  3BFU A;  4QFO A;  3SES A;  4LA9 A;  3O2A A;  5I56 A;  1URS A;  1JW1 A;  4EXK A;  1LCF A;  1XT8 A;  1D4N A;  4EF2 A;  5H8N B;  1FTK A;  3KG2 A;  5I2N B;  5AA4 B;  3LC8 A;  1IXH A;  2Q2A A;  1PBP A;  1Y4T A;  4EF1 A;  4C1U A;  1SW4 A;  4U2R A;  5I2N A;  3TQW A;  4NTL A;  1OVB A;  1NNT A;  3FXU A;  2O84 X;  2ZYK A;  1US4 A;  4GOT A;  2QS2 A;  1B51 A;  1H76 A;  3IR1 A;  1HSL A;  4O3C A;  4Q8R A;  1N76 A;  3PPP A;  4OEU A;  3C9H A;  3FVK A;  4GL0 A;  2XXV A;  3K1N A;  4QF9 A;  2V3T A;  2RC7 A;  5DT6 A;  4FAJ A;  3K01 A;  1R1N A;  4X48 A;  3ZKK A;  4RYA A;  3O6G A;  3O97 A;  1B9J A;  1LGB C;  3UIF A;  4DXU A;  2F6P A;  4R2F A;  1MG1 A;  4EXL A;  4DCY A;  3FVG A;  1DPE A;  4NF4 A;  3F11 A;  3I3V A;  1Y9U A;  4YMB A;  2I48 A;  3BKI B;  3DLN A;  4EDP A;  4QRZ A;  4F3S A;  2O69 A;  4OQO A;  3O6H A;  2Z23 A;  3B7D A;  1AOV A;  3TMG A;  3T9U A;  2Y7I A;  3CSB A;  5H8F B;  1N84 A;  4GQO A;  4GRK A;  1QKA A;  1SQY A;  1A40 A;  4FED A;  2QS1 A;  3FJG A;  1JET A;  4GL8 A;  3B6T A;  3N6T A;  2HAV A;  4OET A;  4IY5 A;  5ICT A;  2O7U A;  3P7I A;  3OEM A;  3QIM A;  4KI0 E;  2H98 A;  4IGT A;  1UIU A;  3SEV A;  1YPN A;  4H0W A;  1Y3N A;  5JTY B;  1QUJ A;  3UOR A;  4JWO A;  4AQ4 A;  3WAF A;  2FNC A;  1I6A A;  3TEP A;  1LBB A;  1MM6 A;  4BDN A;  3H4Z A;  2AL4 A;  1LFI A;  4ELR A;  1SDX A;  5TP9 B;  2DQV A;  3SEU A;  4ESX A;  2ZMB A;  5ICQ A;  3DM0 A;  2OK2 A;  2B3F A;  4NWC A;  2XXI A;  2QSX A;  3OO9 A;  4RPN A;  5DVJ A;  5FHM A;  5TP9 A;  2VP1 A;  4NF8 A;  4PFT A;  4MFI A;  2HZL A;  1J1N A;  2DWH A;  3H6U A;  4PFU A;  1QUI A;  4F3G A;  1IUD A;  1NMU A;  3FUZ A;  3FV1 A;  3EPE A;  3HHG A;  3VE1 B;  2P2A A;  2H99 A;  4BDR A;  2V93 A;  3IOV A;  3U94 A;  1NNK A;  3M3K A;  5K2Y A;  2ZYM A;  5H8H B;  1XS5 A;  3L6G A;  4MH5 A;  4OFJ A;  4P0G A;  4YB6 A;  1MY4 A;  1VE4 A;  1ANF A;  5H8Q B;  3S2V A;  2O6A A;  1GVC A;  4R2B A;  5H8H A;  4F1U A;  3R26 A;  4H67 A;  1MQG A;  1ZTY A;  2Z8D A;  3IJX B;  4PQJ A;  1ZMG A;  2XD3 A;  4F31 B;  3IK6 B;  4KCD A;  5CBS A;  2ABH A;  3ODB A;  2PBW A;  3H6V A;  3SDF A;  4I62 A;  4ZDM A;  4LZ5 A;  2VD3 A;  1R9Q A;  1JVY A;  2I49 A;  1B0L A;  2Z8E A;  3HPI A;  2Q8J A;  3OOA A;  2FYI A;  4FE8 A;  3PU5 A;  2HFB A;  2FA7 A;  1MXY A;  3TCF A;  2DE4 A;  1OQG A;  4Z7E A;  3PUX E;  3E13 X;  3TQL A;  5AA3 A;  2X26 A;  1Y1Z A;  1I6B A;  1LST A;  1MQI A;  3IAZ A;  4ESW A;  1LBC A;  1Z7M E;  3MZ9 A;  5FHO A;  1Y1M A;  4OMB A;  2XXP A;  2O68 A;  3HST A;  3EHU A;  4OEN A;  1YAE A;  3EF7 A;  4MLV A;  3SET A;  3TKD A;  3W9V A;  4ONY A;  4U21 A;  1POT A;  2Y7P A;  4DZ1 A;  5I2K A;  3HCQ A;  2RF1 A;  1P1U A;  2Y7W A;  2Y7R A;  5AA1 A;  4DLD A;  1MY2 A;  1QUL A;  2DS9 A;  1QUK A;  3GLB A;  4DXC A;  3SEY A;  3MVZ A;  2X7P A;  1XOC A;  4RNS A;  4NE4 A;  4F18 A;  5I58 B;  4PFY A;  3M8U A;  2RKM A;  4HTG A;  5ELV A;  5I56 B;  2ESN A;  3FJM A;  3LR1 A;  1MQJ A;  1D3K A;  2HAU A;  3JV9 A;  1DTG A;  3MVY A;  3OD7 A;  4H65 A;  4I8C A;  3RLF E;  1PDA A;  1B05 A;  2YJP A;  5JTY A;  4GXS B;  2DWI A;  3C35 A;  4H8J A;  3SEW A;  1B1X A;  4ECF A;  1LFG A;  3FZV A;  4JSO A;  4POX A;  4Z0I A;  2YPN A;  3Q28 A;  4YB5 A;  1P1O A;  1LAG E;  1FQE A;  2DXR A;  3LSX A;  5FTI A;  4XXU A;  1NL5 A;  2OBG A;  3IB1 A;  3FGS A;  1EZP A;  1O7T A;  2O7I A;  2GHA A;  3GZG A;  4BDQ A;  3RPW A;  1AH5 A;  1F9B A;  2I4B A;  2F78 A;  4LAT A;  1LAX A;  2XXR A;  4PP0 A;  2V3U A;  3MJN A;  5A5X A;  4BDL A;  4KHZ E;  5F1Q A;  2M8C A;  1CB6 A;  5K2X A;  3TFL A;  1FQF A;  4UA8 A;  3UGW A;  3MAM A;  3K00 A;  5H8Q A;  1JQF A;  4ZEF A;  4DCX A;  4G4P A;  3PUW E;  1SI0 A;  4U1O A;  1JEV A;  1LAF E;  1O64 A;  2OLB A;  3MW0 A;  4XKP A;  1VR5 A;  4XKN A;  1ZIU A;  4POW A;  2OZZ A;  2HCA A;  2ZNS A;  1DMB A;  1PB8 A;  4N07 A;  4ZZA A;  1ELJ A;  4KCC A;  3K6W A;  4DDD A;  4H6D A;  1DTZ A;  2PMS A;  1ZLQ A;  2THI A;  5H8S A;  1MQD A;  4LQ2 A;  4GD5 A;  1B1H A;  4YZZ A;  3W15 C;  5B7D A;  3KZG A;  3KOS A;  4JBZ A;  4QSD A;  1LFH A;  2Z22 A;  3R7X A;  2DSF A;  4WKM A;  1OIB A;  1MDP 1;  3V5A A;  2ANJ A;  3TTM A;  3TCG A;  1B4Z A;  3T9X B;  2PVU A;  3OSQ A;  3H6T A;  1IIW A;  5KDT A;  3FAS A;  1L5T A;  3IB0 A;  3FAT A;  4GF8 A;  4MF3 A;  4NMY A;  3T96 B;  4EUO A;  3TUS A;  3Q29 A;  1FTL A;  1BKA A;  2DXY A;  2HEU A;  4JXI A;  1MXW A;  1A8E A;  2R9J A;  4O3B A;  1H44 A;  4X9T A;  2F7C A;  3KJ7 A;  3OEN A;  4RK9 A;  3TOD A;  4F3P A;  3C32 A;  5B70 A;  2DE2 A;  4RXL A;  4NF5 B;  3K6V A;  3UA8 A;  4DIG A;  5F7V A;  5HM4 B;  1POY 1;  4ELQ A;  4KYE A;  3TZA A;  2Y7K A;  3KN3 A;  3S9M C;  3S9L C;  1NNF A;  1RKM A;  4H5F A;  3GBB A;  1UQW A;  1B3G A;  2Q9T A;  4JB7 A;  5I57 A;  1B6H A;  1FW0 A;  1ZU0 A;  2ZXT A;  1N3W A;  3RTF B;  1Y4C A;  2F35 A;  4EQ9 A;  2XXQ A;  3A09 A;  2B3B A;  4N6P A;  4EQ7 A;  3KOT A;  1OVT A;  4GWO A;  2PX1 A;  1MXV A;  1IQ7 A;  3V89 B;  3MZ1 A;  3E4R A;  4TLL B;  3RT6 B;  5AA2 D;  1HSE A;  1P1Q A;  3GBA A;  4YKP A;  4E0X A;  2XXY A;  1N0T A;  3K2D A;  3MVX A;  1IEJ A;  1EZO A;  1VSO A;  3DP6 A;  3N94 A;  3EQ1 A;  3PMX A;  4JDF A;  5A5X B;  4FJP A;  3QYT A;  5EHS A;  1N04 A;  3MZB A;  4IO3 A;  1M5B A;  2Y84 A;  3CRB A;  4KR5 A;  4R6H A;  2REG A;  3KSJ A;  1UTB A;  1VFE A;  3UP9 A;  2Z8F A;  1MXZ A;  5KZT A;  3SEX A;  4ZEK A;  1MS7 A;  3K6X A;  3O9P A;  2A5T B;  3QUF A;  4IO5 A;  1BIY A;  1Y20 A;  1N3X A;  2XX7 A;  4OFO A;  3RY3 A;  3TEL A;  3U1O A;  2R6G E;  3CG3 A;  2QJE A;  3H3G A;  3UK4 A;  3V83 A;  1BLF A;  4KYS A;  4NF4 B;  5KCJ B;  1LLS A;  3MVW A;  3CSG A;  3N5L A;  1FTJ A;  3KJT A;  4MBP A;  2ONS A;  1MXU A;  3B6Q A;  3V8X B;  3MP6 A;  2F5X A;  2OWS A;  3KBR A;  3H03 A;  2HQ0 A;  2F34 A;  3MWB A;  2KLF A;  4PFW A;  2QMX A;  1YTV A;  1IXG A;  1SBP A;  2R71 A;  4OFL A;  1RYO A;  3QSL A;  2QPQ A;  1GV8 A;  3VLV A;  5IKB A;  2D5W A;  2O1L A;  3TPA A;  2DVZ A;  3U92 A;  1B3E A;  1FQC A;  1FCK A;  3LBS A;  1GR2 A;  1TT1 A;  1N7W A;  2UVI A;  2W7Y A;  2REJ A;  4LZ8 A;  5EYF A;  3VXB A;  5CC2 A;  2G93 A;  2E0S A;  4RJZ A;  1LCT A;  2E1S A;  2QRY A;  2XXT A;  3CIJ A;  2D3I A;  2Q88 A;  3CI8 A;  3E9X A;  3IOR A;  4GVO A;  3PV0 E;  5JEI A;  1LB9 A;  3Q25 A;  1NH8 A;  1MM7 A;  1DPP A;  4HCW A;  4OTE A;  2PYY A;  2PT2 A;  3C31 A;  3EN3 A;  3FD3 A;  4NF5 A;  2DWA A;  2VOZ A;  3MQ9 A;  3K02 A;  3RQT A;  1B5H A;  3W9W A;  2V25 A;  4K3F A;  2ZYO A;  3G3J A;  3PMV A;  4H8I A;  4TOZ A;  4F2O A;  3LSF B;  1NH7 A;  4JWY A;  3FXR A;  4P0I A;  4R74 A;  3OO6 A;  4OES A;  3O29 A;  4THI A;  1GTK A;  3QAX A;  4GFR A;  1H3D A;  2P1S A;  1AL3 A;  4BLA A;  4ZEC A;  4ND9 A;  3FVO A;  5AE4 A;  4YAH X;  1PBQ A;  4R75 A;  1IXI A;  1UTH B;  1XC1 A;  4FEC A;  4M4G A;  5ITP A;  4PE5 B;  1B5I A;  1LB8 A;  4JWX A;  3UN6 A;  4ELO A;  1FQA A;  1SVX B;  3M3F A;  5AA2 A;  4QFP A;  1ZBM A;  2UVJ A;  4YMA A;  1P1N A;  3MBP A;  2H4I A;  3T93 B;  2ONR A;  1A7L A;  2DVC A;  3BFT A;  4HW8 A;  2HZK A;  4HS7 A;  4RPO A;  3O28 A;  1UTB B;  1OMP A;  3IO6 A;  4ZZE A;  4IO7 A;  3FJ7 A;  1WOD A;  5L9M A;  4X1D A;  3G3G A;  3IX1 A;  1NFT A;  1Z7N E;  3HN0 A;  2DE3 A;  3Q27 A;  4NF6 B;  4PET A;  4G68 C;  1US5 A;  3TDJ A;  1WVJ A;  3BBR A;  4NF6 A;  2H9B A;  3D4C A;  3SER A;  1B52 A;  2D21 A;  4I1D A;  2I6E A;  2I3W A;  4XTC Q;  5H8N A;  3KGC A;  4R9F A;  4JSD A;  4XIG Q;  4XKQ A;  3THI A;  1BP5 A;  1XVX A;  4G68 B;  2ZYN A;  5I84 A;  4BDO A;  1M5C A;  1MXX A;  1D9Y A;  2H5Y A;  4FEB A;  4R6Y A;  2DWJ A;  1LAH E; 
#chains in the Genus database with same CATH topology
 1FPE A;  5EYH A;  1Y3Q A;  4E0W A;  2V84 A;  5BUU A;  2UYF A;  2I0B A;  1B3L A;  1FTM A;  2AL5 A;  2XHD A;  3B6W A;  4ZS9 A;  3TTK A;  1YCJ A;  3MUQ A;  3CFX A;  3IOW A;  5M2V A;  1M5F A;  4LVQ A;  1Q35 A;  2I0C A;  4U4S A;  4JVC A;  1ATG A;  3G3K A;  1QVS A;  1DOT A;  4XEQ A;  2FIE A;  4WXJ A;  1P99 A;  2ONK E;  3FV2 A;  4LUB A;  4G61 A;  1I69 A;  1URG A;  3D1R A;  5CBR A;  4DE8 A;  2QMW A;  3DP8 A;  4G8N A;  3OO7 A;  4IR8 A;  2ZZX A;  3E3K A;  5DVI A;  4N81 A;  4NGU A;  3KEI A;  1M5E A;  3IL1 B;  4MEV A;  4U1Z A;  4O3A A;  4IO6 A;  2DOJ A;  1SW5 A;  4HE1 A;  2F36 A;  3CR9 A;  4OVR A;  2QS4 A;  1AIV A;  1D9V A;  4PF8 A;  2UYE A;  4H46 A;  2GQ1 A;  3K1P A;  3T9H B;  1NV2 A;  2XXH A;  2NUV A;  1FBE A;  1G0I A;  2OX3 A;  3N26 A;  1B40 A;  4O7I A;  5KCJ A;  4M1V A;  1NUY A;  4MIJ A;  4Q5T A;  4G68 A;  4G8H A;  3C4M A;  3M3L A;  4YB7 A;  1OLC A;  2CEY A;  4U4X A;  4IGR A;  4F22 A;  3JZJ A;  1B0H A;  1IIT A;  4NF8 B;  3D4G A;  1O63 A;  4QBA A;  2UVH A;  3RNN A;  4H1X A;  3VXC A;  1IZ1 A;  3T9V A;  1VDW A;  3VLW A;  1R9L A;  4QSE A;  2P3V A;  3MC2 A;  1B7Z A;  4XFE A;  2XXW A;  1TXF A;  4ELP A;  3IO4 A;  3I6V A;  4ZED A;  3USD A;  1FSA A;  1BTJ A;  1XHY A;  2OWT A;  2Y5K A;  1VFD A;  2ZNU A;  1MDQ A;  5AA2 B;  4U23 A;  5CM6 A;  1QKB A;  5HPQ A;  3S9N C;  3HHF A;  2Q2C A;  5ESY A;  4P11 A;  1MPB A;  3C34 A;  4RK2 A;  1R6Z A;  3BFU A;  4EXK A;  5H8N B;  1XT8 A;  4MMP A;  1FBC A;  5AA4 B;  2Q2A A;  1SW4 A;  2XXK A;  1NNT A;  3RPL B;  4GOT A;  3IR1 A;  4Q8R A;  1FBD A;  4MX6 A;  3C9H A;  4GL0 A;  5IAI A;  3FXB A;  3K01 A;  4X48 A;  4FBP A;  2F6P A;  1YXI A;  4R2F A;  3SZP A;  4EXL A;  4PE3 A;  4DCY A;  3FVG A;  1DPE A;  3BKI B;  4QRZ A;  2O69 A;  2Z23 A;  2Y7I A;  5H8F B;  1N84 A;  2WEF A;  4N17 A;  4GRK A;  1SQY A;  1A40 A;  4XF5 A;  3FJG A;  1JET A;  2HAV A;  2O7U A;  3P7I A;  1KA1 A;  3SEV A;  1YPN A;  4H0W A;  4O94 A;  1LBW A;  2FNC A;  2AL4 A;  4ELR A;  5TP9 B;  2DQV A;  2ZMB A;  2XXI A;  2QSX A;  3OO9 A;  1GVC A;  5DVJ A;  5FHM A;  1IMC A;  1INP A;  4P1L A;  4PFU A;  5TP9 A;  2DWH A;  1QUI A;  1IUD A;  4BDR A;  3HHG A;  2P2A A;  1NUW A;  3U94 A;  1MY4 A;  5H8Q B;  2O6A A;  4P8B A;  3R26 A;  1KZ8 A;  5ET8 A;  1ZTY A;  3SDF A;  4I62 A;  1R9Q A;  2I49 A;  3HPI A;  4NN3 A;  2FYI A;  3TCF A;  3LV0 A;  2X26 A;  2XWO A;  1Y1M A;  2XXP A;  2O68 A;  1YAE A;  4MLV A;  3SET A;  4ONY A;  5I2K A;  3HCQ A;  4DLD A;  1QUL A;  1QUK A;  4RNS A;  2X7P A;  4PFY A;  3M8U A;  4HTG A;  3ZS6 A;  3JV9 A;  5I57 A;  4H65 A;  2DWI A;  4H8J A;  4ECF A;  4Z0I A;  3Q28 A;  5L9S A;  4XXU A;  1NL5 A;  4OA4 A;  3IB1 A;  1O7T A;  4BDQ A;  3RPW A;  2VPN A;  1F9B A;  2F78 A;  5F1Q A;  2M8C A;  1QGX A;  5H8Q A;  1NV7 A;  1O64 A;  1VR5 A;  1PB8 A;  3EKI A;  2VT5 A;  1DTZ A;  4LQ2 A;  5B7D A;  3KZG A;  4QSD A;  3R7X A;  1MDP 1;  3TCG A;  1B4Z A;  3T9X B;  2PVU A;  3OSQ A;  1FBH A;  1LBV A;  3FAS A;  4GF8 A;  1FTL A;  4GX4 A;  1MXW A;  3OEN A;  4RXL A;  4NF5 B;  3K6V A;  1IMF A;  5F7V A;  4ELQ A;  1NNF A;  3MST A;  2CZI A;  4N15 A;  4EQ9 A;  1Y4C A;  1YZ0 A;  4N6P A;  1Q9D A;  3KOT A;  1IMD A;  1NUX A;  3V89 B;  3RT6 B;  5AA2 D;  1HSE A;  3GBA A;  4E0X A;  3IFA A;  1N0T A;  3MVX A;  1EZO A;  3EQ1 A;  1NV0 A;  5A5X B;  5EQ9 A;  2Y84 A;  4KR5 A;  3KSJ A;  3IFC A;  3UP9 A;  3SEX A;  3K6X A;  4OFO A;  4AS5 A;  1Y20 A;  4PBH A;  1NV4 A;  3MVW A;  3CSG A;  4P56 A;  3V8X B;  1MXU A;  3MP6 A;  2F5X A;  2OWS A;  2HQ0 A;  2F34 A;  3VLV A;  2QPQ A;  4PGN A;  2D5W A;  3TPA A;  1FCK A;  1DK4 A;  3VXB A;  5CC2 A;  2G93 A;  2E0S A;  2XXT A;  2D3I A;  2Q88 A;  4OTE A;  1CNQ A;  4HXV A;  3K02 A;  2PFY A;  3G3J A;  3PMV A;  4F2O A;  4P0I A;  3OO6 A;  2HHM A;  4YAH X;  4R75 A;  3BIG A;  5ITP A;  1B5I A;  4JWX A;  3UN6 A;  1ZBM A;  5T3J A;  3MBP A;  2H4I A;  2ONR A;  4NG7 A;  4RPO A;  4ZZE A;  3IX1 A;  1NFT A;  3HN0 A;  3Q27 A;  2H9B A;  2I6E A;  4R9F A;  5I5P A;  1LAH E;  1SW1 A;  4U22 A;  5ITO A;  5IZZ A;  1Q1K A;  2B4M A;  2WKY A;  3RPL A;  1KWH A;  4O8M A;  1P1W A;  4YKJ A;  1B7H A;  1A8F A;  2ALU A;  5LOM A;  2DP8 A;  3VDF A;  2YLN A;  1MQH A;  1NNP A;  3CVG A;  5H8F A;  4C1T A;  4R72 A;  1QJM A;  2BJJ X;  1PB9 A;  3EHT A;  1OLA A;  2RCA A;  2P3N A;  3U93 A;  3TTL A;  3ECR A;  2GFE A;  4PBQ A;  3PUZ E;  3K1M A;  3N6U A;  4TQU Q;  2F7B A;  2R8T A;  5CMM A;  4OWD A;  2F97 A;  5EQ7 A;  1B3F A;  3ILT B;  3A3C A;  3ONM A;  3PMW A;  1FPG A;  1USY E;  1M5D A;  3C36 A;  2P0S A;  3G3F A;  4LQ5 A;  4YIC A;  1JVX A;  1MY3 A;  3PD8 A;  3IJO B;  4YU0 A;  2X7Q A;  3EHS A;  3L6H A;  4QFK A;  2QVV A;  1UIV A;  2GRV A;  4FAT A;  4LZ7 A;  3H6W A;  5ET7 A;  5DYH A;  3CFZ A;  4N4U A;  1XVY A;  3IOT A;  4G8M A;  4IO4 A;  3OEL A;  3QK6 A;  1PC3 A;  4OYV A;  3TAJ A;  1K9Z A;  1IMA A;  3KC1 A;  3PUV E;  2F8D A;  4GLI A;  1RYX A;  3RGY A;  4OER A;  3OO8 A;  2UVG A;  4H45 A;  1URD A;  1T0K A;  1DSN A;  3OMB A;  3PPQ A;  2XD2 A;  5AA4 A;  2HXW A;  2RC9 A;  4TLM B;  5CMB A;  2L5V A;  5TU0 A;  3VLU A;  4FOR A;  2FBP A;  1TWY A;  5LDZ A;  3U8Q A;  2QS3 A;  1S9T A;  4C0R A;  3QUJ A;  4G77 A;  5L8D A;  4I9D A;  4MH5 A;  3G3H A;  1PEB A;  4OVJ A;  4G2Z A;  4QHQ A;  5CI5 A;  1SYI A;  2VGQ A;  3JYR A;  5JK4 A;  2WBD A;  1IXC A;  5IZ3 B;  3IOU A;  4GX3 A;  4PAF A;  2DYX A;  1SD3 A;  2OCU A;  3ISP A;  1GGG A;  1SW2 A;  4RA1 A;  5FBP A;  4YKK A;  5I2K B;  3CHG A;  2A5S A;  2IA4 A;  3K6U A;  3PTY A;  4F2Q A;  4QFO A;  1MRP A;  4LA9 A;  5F24 A;  1LCF A;  1D4N A;  4EF2 A;  3KG2 A;  1PBP A;  4EF1 A;  4U2R A;  5I2N A;  3TQW A;  1OVB A;  2O84 X;  1B51 A;  3GYY A;  1N76 A;  4DI4 B;  2V3T A;  1R1N A;  1FBG A;  3O6G A;  3UIF A;  2V4C A;  4NF4 A;  2I48 A;  3TMG A;  3T9U A;  4OET A;  3B6T A;  4IY5 A;  3HFU A;  1Y3N A;  5JTY B;  1QUJ A;  4JWO A;  1LBB A;  3H4Z A;  4PFB A;  4ESX A;  1FJ6 A;  4RPN A;  1FPB A;  1J1N A;  1NMU A;  3FV1 A;  3EPE A;  2H99 A;  2V93 A;  4OFJ A;  1ANF A;  3S2V A;  1MQG A;  3IJX B;  4F31 B;  4KCD A;  5CBS A;  2ABH A;  2PBW A;  4NHB A;  2VD3 A;  1EYI A;  3U65 A;  3OOA A;  4FE8 A;  2FA7 A;  4Z7E A;  3PUX E;  3B8B A;  3IAZ A;  4ESW A;  3MZ9 A;  3HST A;  3W9V A;  5I7I A;  2Y7R A;  5AA1 A;  2QVR A;  3GLB A;  4DXC A;  3MVZ A;  4NE4 A;  4F18 A;  5ELV A;  5I56 B;  1MQJ A;  2HAU A;  5JTY A;  3SEW A;  1B1X A;  3FZV A;  4JSO A;  2YPN A;  5FTI A;  1P1O A;  3LSX A;  2DXR A;  1AH5 A;  2I4B A;  4PP0 A;  4LAT A;  3MJN A;  3TFL A;  4ZEF A;  4G4P A;  4GBV A;  3PUW E;  3MW0 A;  4POW A;  2OZZ A;  2HCA A;  1ELJ A;  4DDD A;  2PMS A;  1ZLQ A;  2THI A;  5EYG A;  1B1H A;  4YZZ A;  1LFH A;  2Z22 A;  4OVS A;  1OIB A;  3V5A A;  3T96 B;  3TUS A;  3Q29 A;  1BKA A;  1LBY A;  2DXY A;  2HEU A;  4JXI A;  1A8E A;  4O3B A;  3KJ7 A;  4OVT A;  4DIG A;  5HM4 B;  3FBP A;  1FRP A;  3KN3 A;  1UQW A;  2ZXT A;  1N3W A;  2B3B A;  4GWO A;  2PX1 A;  1MXV A;  3KBZ A;  2XXY A;  3PMX A;  4GWX A;  1N04 A;  3CRB A;  2REG A;  1UTB A;  1VFE A;  3O9P A;  2A5T B;  4IO5 A;  1BIY A;  1N3X A;  3UK4 A;  2R6G E;  2QJE A;  3V83 A;  4NF4 B;  2ZZW A;  4P47 A;  4MBP A;  3KJT A;  2ONS A;  1K9Y A;  4X8R A;  2R71 A;  1RYO A;  1GV8 A;  4PGP A;  1FQC A;  3LBS A;  1TT1 A;  4GVO A;  2WX9 A;  1NH8 A;  4HCW A;  4JVD A;  2PYY A;  2WYP A;  3E79 A;  2DWA A;  3MQ9 A;  3RQT A;  1B5H A;  3W9W A;  2V25 A;  2ZYO A;  1FBP A;  1NH7 A;  4OES A;  2HXR A;  3QAX A;  4ZEC A;  4GFR A;  2P1S A;  3FVO A;  5AE4 A;  1PBQ A;  4FEC A;  4P1E A;  4PAK A;  4M4G A;  1LB8 A;  1FQA A;  5AA2 A;  1P1N A;  1RDZ A;  1NV5 A;  3T93 B;  2F3D A;  4PAI A;  2OWZ A;  2HZK A;  3IO6 A;  1US5 A;  4NF6 A;  3SER A;  1B52 A;  2D21 A;  5H8N A;  4JSD A;  4XKQ A;  4PF6 A;  4G68 B;  2Q74 A;  5I84 A;  1M5C A;  1MXX A;  1D9Y A;  2H5Y A;  2XXX A;  3O97 A;  2JJK A;  2ZNT A;  3OSR A;  4LN5 A;  4QSC A;  2NWJ A;  3TTM A;  4P9K A;  4HCY A;  1TFA A;  1MY1 A;  4Q0C A;  4NWD A;  5FTH A;  4DXB A;  4GXA A;  1B4H A;  5FHN A;  4OXV A;  1FQB A;  3CG1 A;  1QW0 A;  4AB6 A;  5DEX B;  3MP8 A;  2HPG A;  3R6U A;  1SI1 A;  4F3B A;  1USY H;  3K0V A;  2PT1 A;  4I40 A;  1UTH A;  1LEV A;  3DP4 A;  4AB5 A;  5J1D A;  4MNP A;  4N13 A;  3FXQ A;  5CMC A;  3H7M A;  1FPL A;  4PFR A;  4H5G A;  2VD2 A;  4ISU A;  3H06 B;  4PDH A;  4NED A;  1JW5 A;  3KN7 A;  5BWJ A;  1H43 A;  2RIN A;  3KN8 A;  2V3Q A;  3I5O A;  4QFN A;  4R9G A;  3VVF A;  3PPR A;  3K4U A;  2CMO A;  2NVU B;  3T66 A;  5L9O A;  1MH4 A;  3MPK A;  4ZE8 A;  1SYH A;  4OEV A;  2I58 A;  4LP2 B;  1FTO A;  5DTB A;  2XXU A;  3HV1 A;  3GXA A;  2G29 A;  2AYS A;  1AWB A;  5ISU A;  2Q89 A;  2XWV A;  4R73 A;  4XKR A;  2ZZV A;  5TPA A;  3TCH A;  4BDM A;  3VFJ A;  3PUY E;  4YKI A;  5TPA B;  3ZSF A;  4N91 A;  3OXN A;  2H25 A;  2Q8M A;  2O51 A;  1EH3 A;  2RCB A;  1ZJL A;  3MYU A;  4F1V A;  3ZKL A;  3RT8 A;  3O66 A;  3T1B A;  4KXP A;  1MY0 A;  3RN8 A;  4KYD A;  1PB7 A;  3S9E A;  3WAE A;  3LSW A;  1LBZ A;  2QL3 A;  2LAO A;  4U1O A;  1FPD A;  4MCO A;  2GH9 A;  5CMK A;  5I3S A;  5DVF A;  4QFL A;  2F7A A;  1FPK A;  3HO7 A;  4IY6 A;  2NXO A;  4OVQ A;  2QVU A;  3TYH A;  4IB2 A;  3G3I A;  1OQH A;  4IO2 A;  1WDN A;  2FIX A;  3LC8 A;  4C1U A;  4NTL A;  1H76 A;  4GWZ A;  1IME A;  3PPP A;  4OEU A;  3FVK A;  4FAJ A;  2RC7 A;  4RYA A;  4DXU A;  1B9J A;  1LGB C;  1IMB A;  1MG1 A;  4YMB A;  1Y9U A;  4EDP A;  4F3S A;  4OQO A;  3B7D A;  1AOV A;  2WYK A;  3CSB A;  4GQO A;  1QKA A;  1DCU A;  2QS1 A;  4FED A;  3N6T A;  3OEM A;  3QIM A;  4KI0 E;  4IGT A;  4N6K A;  4AQ4 A;  1I6A A;  5DW8 A;  1SDX A;  3SEU A;  5ET6 A;  5ICQ A;  2OK2 A;  4F1Y A;  4MFI A;  4F3G A;  3H6U A;  3VE1 B;  1NNK A;  3M3K A;  5K2Y A;  4P0G A;  3L6G A;  1VE4 A;  5H8H A;  4F1U A;  4UAB A;  4OVP A;  4PQJ A;  4PDD A;  2XD3 A;  3IK6 B;  3ODB A;  1JVY A;  1KA0 A;  2Z8E A;  2Q8J A;  3BIH A;  2HFB A;  1MXY A;  4GWY A;  2DE4 A;  1OQG A;  3E13 X;  1Y1Z A;  1LST A;  4N8G A;  1Z7M E;  5FHO A;  2PCR A;  4OMB A;  3TKD A;  1POT A;  2DS9 A;  3SEY A;  1XOC A;  2RKM A;  3LR1 A;  3RLF E;  3MVY A;  3OD7 A;  2YJP A;  4GXS B;  3C35 A;  1LFG A;  4POX A;  2PFZ A;  2O7I A;  3GZG A;  4KHZ E;  5K2X A;  4UA8 A;  3MAM A;  4DCX A;  1JQF A;  1JEV A;  4GX6 A;  4XKP A;  1ZIU A;  1NV1 A;  2XA5 A;  4ZZA A;  4H6D A;  3W15 C;  1MQD A;  4NX1 A;  2FVZ A;  5KDT A;  3IB0 A;  2R9J A;  5LTC A;  4F3P A;  4RK9 A;  4O7M A;  1RKM A;  4H5F A;  1B6H A;  1FW0 A;  2XXQ A;  3A09 A;  2F3B A;  1OVT A;  1IQ7 A;  3MZ1 A;  4TLL B;  1P1Q A;  1DBZ A;  3RYD A;  3QYT A;  5EHS A;  1M5B A;  4R6H A;  5KZT A;  2Z8F A;  1MXZ A;  4HE2 A;  2QFL A;  3U1O A;  3RY3 A;  3TEL A;  4DI3 D;  1BLF A;  4KYS A;  5KCJ B;  4GWS A;  3N5L A;  3B6Q A;  3H03 A;  2KLF A;  4PFW A;  2QMX A;  1IXG A;  4OFL A;  1FJ9 A;  2DVZ A;  1GR2 A;  1N7W A;  2E1S A;  3CIJ A;  3CI8 A;  3IOR A;  3PV0 E;  1LB9 A;  3Q25 A;  1MM7 A;  1DPP A;  2PT2 A;  3C31 A;  4NF5 A;  1FPF A;  3LSF B;  4R74 A;  4THI A;  4BLA A;  4PFI A;  4ND9 A;  1IXI A;  1XC1 A;  4I3E A;  4ELO A;  1SVX B;  2UVJ A;  4YMA A;  4N8Y A;  1A7L A;  1UTB B;  1OMP A;  3ROJ A;  4PC9 A;  3FJ7 A;  5L9M A;  4X1D A;  1Z7N E;  5EQ8 A;  4G68 C;  4HE0 A;  3KGC A;  3THI A;  1BP5 A;  4BDO A;  1JW4 A;  1NKX A;  3A29 A;  2AIX A;  1S50 A;  2VHA A;  1D9Q A;  5I57 B;  1II5 A;  2I3V A;  3FIR A;  3VVE A;  3VVD A;  1A55 A;  2CZL A;  4MJO A;  4R6K A;  3C33 A;  2OJT A;  4OZ9 A;  4F29 A;  1MPD A;  2XX9 A;  4MNC A;  2UXA A;  4X04 A;  4KFQ A;  4ZEI A;  2I4C A;  3PGF A;  4RY1 A;  4NF0 A;  2XWK A;  1FTA A;  4OHN A;  3ILU B;  3KC0 A;  3SKP A;  1B3H A;  3MP1 A;  2RC8 A;  4FIM A;  1B58 A;  3CFL A;  3RTW B;  5EHM A;  5IGA A;  1JNF A;  4EQB A;  1BK4 A;  1TFD A;  1A99 A;  1MPC A;  4X1B A;  5HBC A;  1B7U A;  3QXM A;  3LUY A;  2O1M A;  1MH3 A;  4ZEB A;  1I6Q A;  4JVI A;  3E78 A;  3T0J A;  5DEX A;  1ZKB A;  1B32 A;  1N7X A;  3IB2 A;  3OEK A;  2A5T A;  1Y3P A;  1S7Y A;  3LUZ A;  2F6G A;  1B46 A;  3RUM A;  2Y5L A;  1A54 A;  4L17 A;  3VV5 A;  1H45 A;  1HSJ A;  3NOH A;  3PPO A;  3U72 A;  4MLQ A;  3AXF A;  1JP4 A;  1CE2 A;  3A3U A;  3G7W A;  3B50 A;  5CRY A;  4GWU A;  1AMF A;  4WEP A;  3FVN A;  2GHB A;  1XI6 A;  4KPT A;  3KFM A;  3T22 A;  3MPL A;  5I59 A;  3DEL B;  3TTN A;  3Q26 A;  4UAC A;  3PD9 A;  3PPN A;  2XX8 A;  2IEE A;  2NOO A;  4KD5 A;  5I59 B;  3KSX A;  4LON B;  4QXD A;  4WED A;  3TTR A;  4Q30 B;  2B65 A;  3S4U A;  1LBX A;  5KDT B;  1B5J A;  4NQ8 A;  1JEU A;  4MNI A;  1B2H A;  4F19 A;  4GIZ A;  4KQP A;  3LSL A;  1EU8 A;  3O6I A;  4ZE9 A;  1FQD A;  1EZ9 A;  3SES A;  4GWW A;  3O2A A;  5I56 A;  1URS A;  1JW1 A;  1FTK A;  2CZK A;  1YYZ A;  5I2N B;  1IXH A;  1Y4T A;  3FXU A;  2KR0 A;  2ZYK A;  1US4 A;  2QS2 A;  2MKZ A;  1HSL A;  4O3C A;  4QF9 A;  2XXV A;  3K1N A;  5DT6 A;  3ZKK A;  3F11 A;  3I3V A;  3DLN A;  3O6H A;  4GL8 A;  5ICT A;  3QMF A;  2H98 A;  1UIU A;  3UOR A;  1RDX A;  3WAF A;  3TEP A;  1MM6 A;  4BDN A;  1LFI A;  3DM0 A;  2B3F A;  1RDY A;  4NWC A;  4PFT A;  2VP1 A;  4NF8 A;  2HZL A;  3FUZ A;  2DDK A;  3IOV A;  5IZ1 A;  2ZYM A;  5H8H B;  1EYK A;  1XS5 A;  4YB6 A;  4R2B A;  4H67 A;  2Z8D A;  1ZMG A;  3H6V A;  4ZDM A;  4LZ5 A;  1B0L A;  1NI9 A;  3PU5 A;  4AS4 A;  3TQL A;  5AA3 A;  5ET5 A;  1I6B A;  1MQI A;  1LBC A;  3EHU A;  4OEN A;  3EF7 A;  4U21 A;  2Y7P A;  1FBF A;  4DZ1 A;  2RF1 A;  1P1U A;  2Y7W A;  1MY2 A;  5I58 B;  2ESN A;  3FJM A;  4I8C A;  1D3K A;  5I58 A;  1DTG A;  1PDA A;  1B05 A;  4F39 A;  4YB5 A;  1LAG E;  1FQE A;  2OBG A;  3FGS A;  1EZP A;  4OAN A;  2GHA A;  1LAX A;  2XXR A;  2V3U A;  5A5X A;  4BDL A;  1CB6 A;  1FQF A;  3UGW A;  3K00 A;  4GBW A;  4MAG A;  1SI0 A;  1LAF E;  2OLB A;  4XKN A;  2ZNS A;  4N07 A;  1DMB A;  4KCC A;  3K6W A;  2XWI A;  5H8S A;  4GD5 A;  3KOS A;  4JBZ A;  2DSF A;  4WKM A;  2ANJ A;  1NV3 A;  3H6T A;  1IIW A;  1L5T A;  3FAT A;  4MF3 A;  4NMY A;  5EQA A;  4EUO A;  5A5L A;  1H44 A;  4X9T A;  2F7C A;  3TOD A;  5B70 A;  3C32 A;  2DE2 A;  3UA8 A;  1POY 1;  4KYE A;  3TZA A;  2Y7K A;  3S9M C;  3S9L C;  4JB7 A;  3GBB A;  2Q9T A;  1B3G A;  4P3L A;  1ZU0 A;  3RTF B;  2F35 A;  4EQ7 A;  5J16 A;  2B4L A;  3E4R A;  4YKP A;  2VPO A;  3K2D A;  1IEJ A;  1VSO A;  3DP6 A;  3N94 A;  4JDF A;  4FJP A;  4IO3 A;  3MZB A;  1NUZ A;  1NV6 A;  4ZEK A;  1MS7 A;  4PTK A;  4I3Y A;  3QUF A;  2XX7 A;  4NAP A;  3H3G A;  3CG3 A;  1LLS A;  1FTJ A;  3KBR A;  3MWB A;  1SPI A;  2WBB A;  1YTV A;  1SBP A;  2CZH A;  3QSL A;  5IKB A;  2O1L A;  3U92 A;  1B3E A;  2UVI A;  2W7Y A;  2REJ A;  4LZ8 A;  5EYF A;  4RJZ A;  1LCT A;  2QRY A;  3E9X A;  5JEI A;  4N6D A;  3EN3 A;  3FD3 A;  2VOZ A;  4PCD A;  2BJI A;  4K3F A;  4TOZ A;  4H8I A;  4JWY A;  3FXR A;  1G0H A;  3O29 A;  1FPI A;  1GTK A;  1H3D A;  1AL3 A;  4MHF A;  5IM2 A;  5IZ3 A;  1UTH B;  2CEX A;  4PE5 B;  3M3F A;  4QFP A;  2DVC A;  3BFT A;  4HW8 A;  1EYJ A;  4HS7 A;  2FHY A;  3O28 A;  4IO7 A;  1WOD A;  3G3G A;  4NF6 B;  2DE3 A;  4PET A;  3TDJ A;  1WVJ A;  3BBR A;  3D4C A;  1FPJ A;  4I1D A;  4XTC Q;  2I3W A;  4XIG Q;  1XVX A;  2ZYN A;  2KQZ A;  4R6Y A;  4FEB A;  2DWJ A; 
#chains in the Genus database with same CATH homology
 2ZNT A;  3ZS6 A;  1SW1 A;  1Y3Q A;  1JW4 A;  1NKX A;  3OSR A;  4QSC A;  4U22 A;  4HCY A;  5ITO A;  2AIX A;  2NWJ A;  1S50 A;  2VHA A;  1Q1K A;  4E0W A;  2WKY A;  1TFA A;  1KWH A;  1MY1 A;  2V84 A;  4NWD A;  4Q0C A;  5BUU A;  1P1W A;  5FTH A;  4YKJ A;  1II5 A;  4DXB A;  4GXA A;  2I3V A;  5I57 B;  3FIR A;  1B4H A;  5FHN A;  1B7H A;  1A8F A;  2UYF A;  2I0B A;  4OXV A;  3VVE A;  2ALU A;  3VVD A;  1A55 A;  5LOM A;  2CZL A;  1FQB A;  1B3L A;  1FTM A;  4R6K A;  2AL5 A;  2DP8 A;  2XHD A;  3B6W A;  4ZS9 A;  3C33 A;  3CG1 A;  3VDF A;  1QW0 A;  2YLN A;  1MQH A;  1YCJ A;  3MUQ A;  2XXX A;  3TTK A;  2OJT A;  4AB6 A;  4OZ9 A;  3CFX A;  3IOW A;  3MP8 A;  5DEX B;  5M2V A;  3R6U A;  4F29 A;  1M5F A;  1MPD A;  1NNP A;  3CVG A;  2XX9 A;  1Q35 A;  2I0C A;  4LVQ A;  5H8F A;  1SI1 A;  2UXA A;  4C1T A;  1USY H;  4KFQ A;  4F3B A;  4R72 A;  3K0V A;  2PT1 A;  4ZEI A;  1UTH A;  1QJM A;  4U4S A;  2I4C A;  3DP4 A;  3PGF A;  3Q26 A;  4UAC A;  2BJJ X;  1PB9 A;  4AB5 A;  3EHT A;  5J1D A;  4N13 A;  1OLA A;  2RCA A;  1ATG A;  3FXQ A;  3G3K A;  4RY1 A;  5CMC A;  3H7M A;  3U93 A;  1QVS A;  1DOT A;  3ECR A;  3TTL A;  4OHN A;  2GFE A;  3ILU B;  3PUZ E;  3K1M A;  4WXJ A;  4H5G A;  3N6U A;  3SKP A;  1B3H A;  2VD2 A;  1P99 A;  2ONK E;  3MP1 A;  4ISU A;  3FV2 A;  2RC8 A;  4TQU Q;  2F7B A;  5CMM A;  3H06 B;  2F97 A;  4OWD A;  4NED A;  4FIM A;  1B3F A;  1B58 A;  4LUB A;  1JW5 A;  5IAI A;  3KN7 A;  1I69 A;  3ILT B;  5BWJ A;  3CFL A;  1URG A;  3A3C A;  3ONM A;  5CBR A;  1H43 A;  5EHM A;  3RTW B;  4DE8 A;  3PMW A;  2QMW A;  3DP8 A;  4F39 A;  1USY E;  1M5D A;  2RIN A;  3KN8 A;  3OO7 A;  3C36 A;  1JNF A;  4G8N A;  3E3K A;  2P0S A;  2V3Q A;  5DVI A;  3G3F A;  4EQB A;  4LQ5 A;  4YIC A;  1JVX A;  1TFD A;  1A99 A;  1MPC A;  1MY3 A;  3I5O A;  3PD8 A;  4QFN A;  3IJO B;  4R9G A;  4X1B A;  4YU0 A;  2X7Q A;  1B7U A;  3EHS A;  3KEI A;  3L6H A;  3QXM A;  5HBC A;  3VVF A;  3LUY A;  3PPR A;  1M5E A;  4QFK A;  2O1M A;  3K4U A;  3IL1 B;  1UIV A;  1MH3 A;  4ZEB A;  4U1Z A;  4O3A A;  4IO6 A;  2DOJ A;  1I6Q A;  1SW5 A;  2CMO A;  2F36 A;  2GRV A;  4LZ7 A;  2NVU B;  3CR9 A;  3H6W A;  3T66 A;  4FAT A;  5L9O A;  5DYH A;  1MH4 A;  3CFZ A;  1XVY A;  3MPK A;  2QS4 A;  3IOT A;  1D9V A;  4G8M A;  2UYE A;  4ZE8 A;  1SYH A;  1AIV A;  4IO4 A;  3OEL A;  4OEV A;  3QK6 A;  5DEX A;  5L9S A;  1PC3 A;  1ZKB A;  3K1P A;  3T9H B;  2I58 A;  4LP2 B;  3TTN A;  1B32 A;  2XXH A;  4OYV A;  3TAJ A;  1FTO A;  5DTB A;  1N7X A;  2NUV A;  2XXU A;  3HV1 A;  3PUV E;  3GXA A;  2G29 A;  2AYS A;  2F8D A;  3IB2 A;  3OEK A;  4GLI A;  1RYX A;  2A5T A;  1Y3P A;  1S7Y A;  2Q89 A;  5ISU A;  3N26 A;  4R73 A;  4OER A;  1B40 A;  3OO8 A;  3RGY A;  2F6G A;  1B46 A;  2UVG A;  4XKR A;  5TPA A;  3RUM A;  3TCH A;  5KCJ A;  4M1V A;  1A54 A;  4Q5T A;  4BDM A;  4G68 A;  3PUY E;  3VFJ A;  4YKI A;  1URD A;  4L17 A;  5TPA B;  4G8H A;  3VV5 A;  3ZSF A;  1T0K A;  3C4M A;  1DSN A;  3OMB A;  1H45 A;  3PPQ A;  1HSJ A;  3OXN A;  2XD2 A;  5AA4 A;  3PPO A;  3M3L A;  2H25 A;  4YB7 A;  2HXW A;  1OLC A;  2RC9 A;  4TLM B;  5CMB A;  5TU0 A;  4MLQ A;  3U72 A;  2O51 A;  1EH3 A;  2RCB A;  3VLU A;  4U4X A;  3AXF A;  4IGR A;  4F22 A;  1ZJL A;  3JZJ A;  1B0H A;  1IIT A;  1CE2 A;  4F1V A;  4FOR A;  4NF8 B;  3D4G A;  3A3U A;  3G7W A;  3ZKL A;  3RT8 A;  1O63 A;  5CRY A;  2UVH A;  3O66 A;  1AMF A;  3RNN A;  4H1X A;  4WEP A;  1MY0 A;  1TWY A;  2GHB A;  3FVN A;  3VXC A;  5I58 A;  1IZ1 A;  4KPT A;  3T9V A;  3U8Q A;  2QS3 A;  3VLW A;  1S9T A;  3RN8 A;  1R9L A;  4KYD A;  1PB7 A;  4QSE A;  3WAE A;  3KFM A;  3LSW A;  4C0R A;  3S9E A;  3QUJ A;  2QL3 A;  2LAO A;  3MPL A;  3T22 A;  5I59 A;  4G77 A;  5L8D A;  3DEL B;  4I9D A;  3PPN A;  2XX8 A;  3MC2 A;  1B7Z A;  2IEE A;  3PD9 A;  2NOO A;  3G3H A;  2XXW A;  1TXF A;  3KSX A;  4KD5 A;  5I59 B;  4LON B;  4ELP A;  1PEB A;  4OVJ A;  3IO4 A;  4G2Z A;  4QHQ A;  5CI5 A;  4WED A;  3TTR A;  1SYI A;  2GH9 A;  2VGQ A;  3I6V A;  3JYR A;  4Q30 B;  4ZED A;  5CMK A;  5JK4 A;  2B65 A;  3USD A;  1IXC A;  3S4U A;  3IOU A;  1BTJ A;  2DYX A;  5DVF A;  1B5J A;  5KDT B;  1JEU A;  1SD3 A;  1XHY A;  2OWT A;  4QFL A;  2F7A A;  1VFD A;  2ZNU A;  1MDQ A;  5AA2 B;  1B2H A;  3HO7 A;  2OCU A;  4U23 A;  4F19 A;  5CM6 A;  1GGG A;  1SW2 A;  4F1Y A;  1QKB A;  4IY6 A;  5HPQ A;  3S9N C;  4RA1 A;  3HHF A;  2NXO A;  2Q2C A;  4GIZ A;  4KQP A;  4YKK A;  3LSL A;  1EU8 A;  3O6I A;  5I2K B;  2A5S A;  4ZE9 A;  2IA4 A;  4P11 A;  3TYH A;  1MPB A;  3C34 A;  3G3I A;  4IB2 A;  3K6U A;  1OQH A;  4IO2 A;  4RK2 A;  1FQD A;  1R6Z A;  4F2Q A;  1WDN A;  1EZ9 A;  1MRP A;  3BFU A;  4QFO A;  3SES A;  4LA9 A;  3O2A A;  5I56 A;  1URS A;  1JW1 A;  4EXK A;  1LCF A;  1XT8 A;  1D4N A;  4EF2 A;  5H8N B;  1FTK A;  3KG2 A;  5I2N B;  5AA4 B;  3LC8 A;  1IXH A;  2Q2A A;  1PBP A;  1Y4T A;  4EF1 A;  4C1U A;  1SW4 A;  4U2R A;  5I2N A;  3TQW A;  4NTL A;  1OVB A;  1NNT A;  3FXU A;  2O84 X;  2ZYK A;  1US4 A;  4GOT A;  2QS2 A;  1B51 A;  1H76 A;  3IR1 A;  1HSL A;  4O3C A;  4Q8R A;  1N76 A;  3PPP A;  4OEU A;  3C9H A;  3FVK A;  4GL0 A;  2XXV A;  3K1N A;  4QF9 A;  2V3T A;  2RC7 A;  5DT6 A;  4FAJ A;  3K01 A;  1R1N A;  4X48 A;  3ZKK A;  4RYA A;  3O6G A;  3O97 A;  1B9J A;  1LGB C;  3UIF A;  4DXU A;  2F6P A;  4R2F A;  1MG1 A;  4EXL A;  4DCY A;  3FVG A;  1DPE A;  4NF4 A;  3F11 A;  3I3V A;  1Y9U A;  4YMB A;  2I48 A;  3BKI B;  3DLN A;  4EDP A;  4QRZ A;  4F3S A;  2O69 A;  4OQO A;  3O6H A;  2Z23 A;  3B7D A;  1AOV A;  3TMG A;  3T9U A;  2Y7I A;  3CSB A;  5H8F B;  1N84 A;  4GQO A;  4GRK A;  1QKA A;  1SQY A;  1A40 A;  4FED A;  2QS1 A;  3FJG A;  1JET A;  4GL8 A;  3B6T A;  3N6T A;  2HAV A;  4OET A;  4IY5 A;  5ICT A;  2O7U A;  3P7I A;  3OEM A;  3QIM A;  4KI0 E;  2H98 A;  4IGT A;  1UIU A;  3SEV A;  1YPN A;  4H0W A;  1Y3N A;  5JTY B;  1QUJ A;  3UOR A;  4JWO A;  4AQ4 A;  3WAF A;  2FNC A;  1I6A A;  3TEP A;  1LBB A;  1MM6 A;  4BDN A;  3H4Z A;  2AL4 A;  1LFI A;  4ELR A;  1SDX A;  5TP9 B;  2DQV A;  3SEU A;  4ESX A;  2ZMB A;  5ICQ A;  3DM0 A;  2OK2 A;  2B3F A;  4NWC A;  2XXI A;  2QSX A;  3OO9 A;  4RPN A;  5DVJ A;  5FHM A;  5TP9 A;  2VP1 A;  4NF8 A;  4PFT A;  4MFI A;  2HZL A;  1J1N A;  2DWH A;  3H6U A;  4PFU A;  1QUI A;  4F3G A;  1IUD A;  1NMU A;  3FUZ A;  3FV1 A;  3EPE A;  3HHG A;  3VE1 B;  2P2A A;  2H99 A;  4BDR A;  2V93 A;  3IOV A;  3U94 A;  1NNK A;  3M3K A;  5K2Y A;  2ZYM A;  5H8H B;  1XS5 A;  3L6G A;  4MH5 A;  4OFJ A;  4P0G A;  4YB6 A;  1MY4 A;  1VE4 A;  1ANF A;  5H8Q B;  3S2V A;  2O6A A;  1GVC A;  4R2B A;  5H8H A;  4F1U A;  3R26 A;  4H67 A;  1MQG A;  1ZTY A;  2Z8D A;  3IJX B;  4PQJ A;  1ZMG A;  2XD3 A;  4F31 B;  3IK6 B;  4KCD A;  5CBS A;  2ABH A;  3ODB A;  2PBW A;  3H6V A;  3SDF A;  4I62 A;  4ZDM A;  4LZ5 A;  2VD3 A;  1R9Q A;  1JVY A;  2I49 A;  1B0L A;  2Z8E A;  3HPI A;  2Q8J A;  3OOA A;  2FYI A;  4FE8 A;  3PU5 A;  2HFB A;  2FA7 A;  1MXY A;  3TCF A;  2DE4 A;  1OQG A;  4Z7E A;  3PUX E;  3E13 X;  3TQL A;  5AA3 A;  2X26 A;  1Y1Z A;  1I6B A;  1LST A;  1MQI A;  3IAZ A;  4ESW A;  1LBC A;  1Z7M E;  3MZ9 A;  5FHO A;  1Y1M A;  4OMB A;  2XXP A;  2O68 A;  3HST A;  3EHU A;  4OEN A;  1YAE A;  3EF7 A;  4MLV A;  3SET A;  3TKD A;  3W9V A;  4ONY A;  4U21 A;  1POT A;  2Y7P A;  4DZ1 A;  5I2K A;  3HCQ A;  2RF1 A;  1P1U A;  2Y7W A;  2Y7R A;  5AA1 A;  4DLD A;  1MY2 A;  1QUL A;  2DS9 A;  1QUK A;  3GLB A;  4DXC A;  3SEY A;  3MVZ A;  2X7P A;  1XOC A;  4RNS A;  4NE4 A;  4F18 A;  5I58 B;  4PFY A;  3M8U A;  2RKM A;  4HTG A;  5ELV A;  5I56 B;  2ESN A;  3FJM A;  3LR1 A;  1MQJ A;  1D3K A;  2HAU A;  3JV9 A;  1DTG A;  3MVY A;  3OD7 A;  4H65 A;  4I8C A;  3RLF E;  1PDA A;  1B05 A;  2YJP A;  5JTY A;  4GXS B;  2DWI A;  3C35 A;  4H8J A;  3SEW A;  1B1X A;  4ECF A;  1LFG A;  3FZV A;  4JSO A;  4POX A;  4Z0I A;  2YPN A;  3Q28 A;  4YB5 A;  1P1O A;  1LAG E;  1FQE A;  2DXR A;  3LSX A;  5FTI A;  4XXU A;  1NL5 A;  2OBG A;  3IB1 A;  3FGS A;  1EZP A;  1O7T A;  2O7I A;  2GHA A;  3GZG A;  4BDQ A;  3RPW A;  1AH5 A;  1F9B A;  2I4B A;  2F78 A;  4LAT A;  1LAX A;  2XXR A;  4PP0 A;  2V3U A;  3MJN A;  5A5X A;  4BDL A;  4KHZ E;  5F1Q A;  2M8C A;  1CB6 A;  5K2X A;  3TFL A;  1FQF A;  4UA8 A;  3UGW A;  3MAM A;  3K00 A;  5H8Q A;  1JQF A;  4ZEF A;  4DCX A;  4G4P A;  3PUW E;  1SI0 A;  4U1O A;  1JEV A;  1LAF E;  1O64 A;  2OLB A;  3MW0 A;  4XKP A;  1VR5 A;  4XKN A;  1ZIU A;  4POW A;  2OZZ A;  2HCA A;  2ZNS A;  1DMB A;  1PB8 A;  4N07 A;  4ZZA A;  1ELJ A;  4KCC A;  3K6W A;  4DDD A;  4H6D A;  1DTZ A;  2PMS A;  1ZLQ A;  2THI A;  5H8S A;  1MQD A;  4LQ2 A;  4GD5 A;  1B1H A;  4YZZ A;  3W15 C;  5B7D A;  3KZG A;  3KOS A;  4JBZ A;  4QSD A;  1LFH A;  2Z22 A;  3R7X A;  2DSF A;  4WKM A;  1OIB A;  1MDP 1;  3V5A A;  2ANJ A;  3TTM A;  3TCG A;  1B4Z A;  3T9X B;  2PVU A;  3OSQ A;  3H6T A;  1IIW A;  5KDT A;  3FAS A;  1L5T A;  3IB0 A;  3FAT A;  4GF8 A;  4MF3 A;  4NMY A;  3T96 B;  4EUO A;  3TUS A;  3Q29 A;  1FTL A;  1BKA A;  2DXY A;  2HEU A;  4JXI A;  1MXW A;  1A8E A;  2R9J A;  4O3B A;  1H44 A;  4X9T A;  2F7C A;  3KJ7 A;  3OEN A;  4RK9 A;  3TOD A;  4F3P A;  3C32 A;  5B70 A;  2DE2 A;  4RXL A;  4NF5 B;  3K6V A;  3UA8 A;  4DIG A;  5F7V A;  5HM4 B;  1POY 1;  4ELQ A;  4KYE A;  3TZA A;  2Y7K A;  3KN3 A;  3S9M C;  3S9L C;  1NNF A;  1RKM A;  4H5F A;  3GBB A;  1UQW A;  1B3G A;  2Q9T A;  4JB7 A;  5I57 A;  1B6H A;  1FW0 A;  1ZU0 A;  2ZXT A;  1N3W A;  3RTF B;  1Y4C A;  2F35 A;  4EQ9 A;  2XXQ A;  3A09 A;  2B3B A;  4N6P A;  4EQ7 A;  3KOT A;  1OVT A;  4GWO A;  2PX1 A;  1MXV A;  1IQ7 A;  3V89 B;  3MZ1 A;  3E4R A;  4TLL B;  3RT6 B;  5AA2 D;  1HSE A;  1P1Q A;  3GBA A;  4YKP A;  4E0X A;  2XXY A;  1N0T A;  3K2D A;  3MVX A;  1IEJ A;  1EZO A;  1VSO A;  3DP6 A;  3N94 A;  3EQ1 A;  3PMX A;  4JDF A;  5A5X B;  4FJP A;  3QYT A;  5EHS A;  1N04 A;  3MZB A;  4IO3 A;  1M5B A;  2Y84 A;  3CRB A;  4KR5 A;  4R6H A;  2REG A;  3KSJ A;  1UTB A;  1VFE A;  3UP9 A;  2Z8F A;  1MXZ A;  5KZT A;  3SEX A;  4ZEK A;  1MS7 A;  3K6X A;  3O9P A;  2A5T B;  3QUF A;  4IO5 A;  1BIY A;  1Y20 A;  1N3X A;  2XX7 A;  4OFO A;  3RY3 A;  3TEL A;  3U1O A;  2R6G E;  3CG3 A;  2QJE A;  3H3G A;  3UK4 A;  3V83 A;  1BLF A;  4KYS A;  4NF4 B;  5KCJ B;  1LLS A;  3MVW A;  3CSG A;  3N5L A;  1FTJ A;  3KJT A;  4MBP A;  2ONS A;  1MXU A;  3B6Q A;  3V8X B;  3MP6 A;  2F5X A;  2OWS A;  3KBR A;  3H03 A;  2HQ0 A;  2F34 A;  3MWB A;  2KLF A;  4PFW A;  2QMX A;  1YTV A;  1IXG A;  1SBP A;  2R71 A;  4OFL A;  1RYO A;  3QSL A;  2QPQ A;  1GV8 A;  3VLV A;  5IKB A;  2D5W A;  2O1L A;  3TPA A;  2DVZ A;  3U92 A;  1B3E A;  1FQC A;  1FCK A;  3LBS A;  1GR2 A;  1TT1 A;  1N7W A;  2UVI A;  2W7Y A;  2REJ A;  4LZ8 A;  5EYF A;  3VXB A;  5CC2 A;  2G93 A;  2E0S A;  4RJZ A;  1LCT A;  2E1S A;  2QRY A;  2XXT A;  3CIJ A;  2D3I A;  2Q88 A;  3CI8 A;  3E9X A;  3IOR A;  4GVO A;  3PV0 E;  5JEI A;  1LB9 A;  3Q25 A;  1NH8 A;  1MM7 A;  1DPP A;  4HCW A;  4OTE A;  2PYY A;  2PT2 A;  3C31 A;  3EN3 A;  3FD3 A;  4NF5 A;  2DWA A;  2VOZ A;  3MQ9 A;  3K02 A;  3RQT A;  1B5H A;  3W9W A;  2V25 A;  4K3F A;  2ZYO A;  3G3J A;  3PMV A;  4H8I A;  4TOZ A;  4F2O A;  3LSF B;  1NH7 A;  4JWY A;  3FXR A;  4P0I A;  4R74 A;  3OO6 A;  4OES A;  3O29 A;  4THI A;  1GTK A;  3QAX A;  4GFR A;  1H3D A;  2P1S A;  1AL3 A;  4BLA A;  4ZEC A;  4ND9 A;  3FVO A;  5AE4 A;  4YAH X;  1PBQ A;  4R75 A;  1IXI A;  1UTH B;  1XC1 A;  4FEC A;  4M4G A;  5ITP A;  4PE5 B;  1B5I A;  1LB8 A;  4JWX A;  3UN6 A;  4ELO A;  1FQA A;  1SVX B;  3M3F A;  5AA2 A;  4QFP A;  1ZBM A;  2UVJ A;  4YMA A;  1P1N A;  3MBP A;  2H4I A;  3T93 B;  2ONR A;  1A7L A;  2DVC A;  3BFT A;  4HW8 A;  2HZK A;  4HS7 A;  4RPO A;  3O28 A;  1UTB B;  1OMP A;  3IO6 A;  4ZZE A;  4IO7 A;  3FJ7 A;  1WOD A;  5L9M A;  4X1D A;  3G3G A;  3IX1 A;  1NFT A;  1Z7N E;  3HN0 A;  2DE3 A;  3Q27 A;  4NF6 B;  4PET A;  4G68 C;  1US5 A;  3TDJ A;  1WVJ A;  3BBR A;  4NF6 A;  2H9B A;  3D4C A;  3SER A;  1B52 A;  2D21 A;  4I1D A;  2I6E A;  2I3W A;  4XTC Q;  5H8N A;  3KGC A;  4R9F A;  4JSD A;  4XIG Q;  4XKQ A;  3THI A;  1BP5 A;  1XVX A;  4G68 B;  2ZYN A;  5I84 A;  4BDO A;  1M5C A;  1MXX A;  1D9Y A;  2H5Y A;  4FEB A;  4R6Y A;  2DWJ A;  1LAH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...