1B7ZA

Structure of oxalate substituted diferric mare lactoferrin from colostrum
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (LACTOFERRIN)
publication title Structure of oxalate-substituted diferric mare lactoferrin at 2.7 A resolution.
pubmed doi rcsb
molecule tags Metal transport
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA03
3PUVE 4GLIA 2XXUA 2I48A 1SW4A 5L9SA 2F35A 1LSTA 4JSOA 4H5FA 4KYEA 4RJZA 2OK2A 1ZLQA 4LP2B 2R9JA 4R72A 4TOZA 4F29A 2FYIA 2OBGA 3UA8A 1SBPA 4F1UA 1AL3A 1QKBA 2QJEA 1GTKA 2PT1A 4QFNA 1H43A 2QS2A 3QSLA 1MXWA 1VR5A 3SESA 1Y3PA 1SW1A 1OVBA 1P99A 2F6PA 5I59A 3P7IA 2DXYA 1ZBMA 3O66A 2RCAA 3MPKA 2QSXA 2RC7A 5TPAA 1A55A 4NF8A 1MH4A 2AL5A 2DS9A 2GRVA 1MDP1 3IAZA 1B0LA 1PC3A 3H06B 2O1LA 3QIMA 2B65A 3LC8A 3KOTA 3C33A 1PB9A 1EZ9A 2QMWA 4F2QA 1QW0A 2OLBA 4XXUA 2VD3A 2XX8A 2DSFA 3LSLA 1YTVA 1QJMA 3VVEA 5CBSA 1I6QA 1B32A 5I2NA 1DPEA 3DP6A 3VLVA 3C9HA 3USDA 2DWJA 4OWDA 1O63A 3CR9A 1M5FA 4BLAA 4LZ7A 1RYXA 2ZMBA 4Z0IA 4H65A 4TLMB 5AE4A 4F1YA 2ZYOA 3HHGA 4FEDA 4ZEIA 2Z8DA 5ITPA 2HZLA 2DWIA 1FQBA 1D9YA 1ANFA 3IB0A 3PPQA 2A5TA 4LONB 1JVYA 3Q29A 4YU0A 5HBCA 4GOTA 4IO5A 1TFDA 4OTEA 3I5OA 3OSQA 4RYAA 1FTKA 2H4IA 3C35A 5AA4A 2ZXTA 3MPLA 4DXCA 4GFRA 2I4CA 4F22A 4ELOA 4NF4B 2XXRA 3UGWA 1QUJA 5EYFA 3E9XA 3K1NA 3B6TA 1MG1A 1VFEA 3RY3A 2XD3A 1SQYA 1FQFA 4ZEBA 4G68B 4DDDA 1AOVA 1WODA 3C36A 3MUQA 3LBSA 3LSFB 3BFTA 1B52A 3IJXB 4F1VA 3RNNA 1MM7A 1LLSA 3KEIA 4H5GA 1SVXB 3SERA 3TFLA 3JYRA 1MY4A 4YAHX 4MFIA 3PV0E 2BJJX 2D3IA 3H4ZA 4F18A 4MF3A 1R6ZA 2Z23A 2XXVA 4ELRA 1A40A 4Q8RA 3OO8A 4FAJA 4QFOA 2Q2AA 2NWJA 3SEXA 3D4GA 3PPPA 2CMOA 2OZZA 2ABHA 2V25A 1QKAA 5I2KA 1JW1A 1QUKA 1P1UA 1O64A 2X7QA 1CB6A 3PUWE 2HXWA 1MQDA 4PQJA 3W9VA 1SDXA 2F6GA 3U8QA 4QSDA 1I6AA 1N84A 2R71A 1ZTYA 4U23A 1WVJA 3V83A 3S9EA 2ZNSA 3O9PA 2O84X 4H6DA 3FJ7A 1LFIA 1LCFA 5TU0A 3PUXE 3K1MA 1M5BA 3CVGA 1B05A 4QFPA 4KR5A 4R6HA 4U1OA 4Q30B 5K2XA 5I56A 1IZ1A 3O6IA 1S50A 1MXYA 4F3PA 4BDNA 1JETA 4KHZE 3FXRA 5ELVA 4MBPA 3CG3A 4POXA 5TP9B 1B58A 5KDTB 5JTYB 4MLQA 2AIXA 3KGCA 2Y7PA 4H1XA 3BKIB 5FTHA 4JWXA 2HQ0A 3TTNA 1US4A 4HCYA 4XKNA 1N76A 3O28A 2FNCA 4GWOA 2O1MA 1TWYA 3H03A 5DEXB 1P1WA 3K6WA 1USYH 1QULA 3HHFA 4JXIA 1UQWA 2G93A 4LA9A 1LAHE 2F34A 4BDQA 3FXQA 2PT2A 3MVYA 4YMAA 4F31B 1MPCA 4OFJA 4G8MA 4MLVA 4QFLA 4AQ4A 3PPOA 4EF1A 1Z7NE 3N6TA 4GXAA 3I3VA 1FCKA 3FATA 1NNFA 3G3JA 2I3VA 4KPTA 3KN3A 1IQ7A 4QSEA 4H8JA 4GRKA 5AA1A 3CRBA 3W9WA 3CSGA 1LCTA 2M8CA 1M5EA 2Q8JA 2Z8FA 3DP8A 3THIA 1QUIA 3A3UA 3ZKKA 5AA2B 2NXOA 4NTLA 5I58B 4U4SA 1DTZA 1OQGA 1US5A 3T9HB 1DMBA 1R1NA 1H76A 4ZEFA 2XXHA 3O2AA 1PEBA 3Q28A 3MZ9A 4G8NA 1IXHA 1URDA 1TXFA 1Y1MA 1A8EA 2ONKE 3SEYA 3CFXA 1MY2A 2Y7WA 1SD3A 3PMWA 2VOZA 3VLWA 1B5IA 3OELA 1MQGA 1ZIUA 4DXUA 4ZDMA 2OWTA 3IX1A 1B7HA 5FHNA 5JK4A 2F7AA 3K01A 4U1ZA 5CMKA 3E3KA 2UYEA 3R7XA 3UK4A 1J1NA 3PPRA 1NH8A 2RC9A 1BKAA 2VGQA 3KOSA 3EHUA 3DELB 2DE3A 1FQDA 4WXJA 2B3BA 4P0GA 4R2BA 4ESWA 2RCBA 3IR1A 1FTMA 4NWCA 4RY1A 2QRYA 1Q35A 3TQLA 3U1OA 2QPQA 2NUVA 2XXWA 1NFTA 3OEKA 4GL8A 1WDNA 5A5XA 1MS7A 5H8FA 1FQAA 4LVQA 3GLBA 2DVCA 1B3FA 3KSXA 1GGGA 4ZZAA 4X1DA 1PB8A 2XXYA 4BDRA 5DVFA 4GQOA 3TPAA 3ODBA 5H8HA 2I6EA 2IA4A 3IOWA 1HSJA 1USYE 1FW0A 4DE8A 4JB7A 4GIZA 5M2VA 3KJ7A 1FQCA 4AB5A 2O69A 5LOMA 3QXMA 3TTLA 1LBCA 3IJOB 4ECFA 2F5XA 2XXQA 3MZBA 4OVJA 3TQWA 4RK2A 1EZOA 3OENA 3M3KA 2HEUA 3FGSA 1IITA 1VSOA 2THIA 3ZS6A 4EQ9A 5EHSA 4O3CA 1URGA 1JVXA 2HFBA 3TTMA 1B3GA 2HAUA 5H8QA 4WEDA 4R6KA 3C31A 4E0WA 1SI0A 2WKYA 4JSDA 1SI1A 3RT6B 3TAJA 4H8IA 2P0SA 4R9FA 3B7DA 1D4NA 4FIMA 1MQJA 5I57A 2H99A 4Q5TA 4NF6A 4OHNA 4F19A 2F36A 4XKQA 4IO6A 2OCUA 2XD2A 1XC1A 2I58A 2FA7A 3UN6A 3PUZE 4OXVA 4DCXA 3K0VA 4YKPA 2DQVA 3D4CA 1PBPA 4G77A 4ONYA 5AA2D 1Y3NA 3A09A 1XS5A 2ESNA 5B70A 1NNPA 3S2VA 1KWHA 2W7YA 1Y20A 2QL3A 3T96B 3Q25A 2QS3A 3G3HA 4BDOA 1Y9UA 2RKMA 1OLAA 4KFQA 1LAGE 4HCWA 5H8SA 2IEEA 1N04A 3TTRA 1VE4A 4FE8A 3SEVA 4PFUA 3UORA 2ONRA 4PFYA 3K2DA 4EXKA 4YB5A 2RC8A 3EHTA 3HSTA 3RPWA 3QAXA 4R9GA 3K02A 4WKMA 5DTBA 3S9NC 2I0CA 4OERA 2DE2A 2GFEA 1P1QA 3G3GA 4XKPA 2H25A 4ZEDA 1JQFA 3SEWA 2OWSA 3EQ1A 3IO4A 2E0SA 1NKXA 4U22A 4PFWA 2O51A 2O7UA 4EQBA 4G68C 3K00A 1BTJA 1GV8A 4P0IA 1GVCA 1EZPA 3EN3A 3CG1A 1DSNA 4LZ8A 5ICTA 4ND9A 4OMBA 3U72A 2REGA 4F3BA 5HM4B 1JEVA 1OLCA 1R9LA 2UVJA 1A54A 3SETA 2F8DA 4LUBA 1ZJLA 1XHYA 1DPPA 4KCDA 4X9TA 1UIUA 1F9BA 2DE4A 3RTWB 1BIYA 3TEPA 2AYSA 1UTHB 2F7BA 4QRZA 3HCQA 1MRPA 1B3LA 2DWAA 1JNFA 3VVDA 2B3FA 1S9TA 4ZE9A 5KZTA 5KCJB 5K2YA 1FQEA 4YMBA 2UVHA 4XTCQ 2Q9TA 2ZYMA 2D5WA 4LQ2A 3W15C 1UTBB 4I1DA 4KD5A 4R75A 5J1DA 1ATGA 1H45A 3FVNA 4NF4A 5DT6A 3MJNA 3TCHA 2UYFA 3VXBA 3EF7A 2XXXA 4I9DA 3IOUA 2YLNA 3QK6A 4KYDA 3DP4A 4HS7A 2DVZA 3GBAA 3ZSFA 3TZAA 3MWBA 5BWJA 4HW8A 4RNSA 4G68A 3GXAA 3K1PA 3E13X 3MC2A 1LB9A 3RT8A 2DWHA 4M1VA 1IUDA 3MQ9A 5B7DA 2RF1A 4IO3A 3T9UA 3TMGA 5CC2A 1OMPA 2XXTA 4AB6A 3CSBA 2RINA 3ZKLA 4OFLA 1ZU0A 3RTFB 2PX1A 2PYYA 1AIVA 4RXLA 4IO4A 1GR2A 1ZMGA 3RGYA 3IORA 4RPNA 1FTLA 1Q1KA 1M5CA 2V3UA 4YKIA 3TODA 3V5AA 3ILTB 1LFHA 1POTA 4IY6A 1II5A 4N07A 2ZYNA 2I4BA 3TDJA 4IGTA 2H98A 2ZNTA 1H44A 4FECA 3PMXA 1XOCA 1B40A 4EUOA 3PGFA 3KZGA 4OETA 2G29A 2QS1A 4JDFA 4KI0E 3O29A 3RN8A 4NEDA 3CIJA 3PD9A 3T9XB 2ANJA 4QHQA 3O6GA 1N0TA 2UVIA 2Y7KA 4DIGA 4DXBA 3O97A 5I59B 3DLNA 1B7ZA 3C32A 4L17A 3K6UA 4OEUA 4PFTA 5TPAB 4EDPA 2OJTA 3TUSA 4NF8B 2DP8A 4O3BA 1B51A 3VVFA 4GXSB 3OEMA 1MQIA 4X1BA 4O3AA 5TP9A 5KDTA 5JTYA 2X7PA 3KJTA 2LAOA 1SW2A 3MP8A 4C0RA 5CI5A 1JW4A 4ELQA 2H9BA 3LUYA 4GF8A 3MZ1A 5ISUA 4F3SA 1B3EA 5DEXA 2F78A 5I2NB 3IL1B 3FXUA 4TQUQ 3MAMA 4OFOA 3ILUB 3OO7A 1QVSA 5F1QA 3DM0A 4POWA 2GHAA 2REJA 3TELA 1EH3A 1MY1A 3RQTA 5FTIA 2V84A 2Y84A 4R2FA 3LSXA 4XKRA 4LQ5A 4WEPA 3S9LC 3KG2A 3G3IA 1HSLA 3K6XA 4ISUA 2A5TB 4Z7EA 2Y7IA 3BBRA 3PD8A 2X26A 3T9VA 2DOJA 4EF2A 4RA1A 2KLFA 4FATA 3OO9A 3TCGA 1MXZA 2UXAA 1HSEA 5AA4B 1NL5A 1B2HA 2O7IA 3H6UA 3HPIA 3VXCA 3MVXA 4U21A 1B9JA 3LR1A 5AA2A 3IK6B 5I58A 4QFKA 3VE1B 3VDFA 4N6PA 2HCAA 4EXLA 4IB2A 3R6UA 1IIWA 2PVUA 5DYHA 4DZ1A 3HO7A 1XVYA 1AH5A 4R6YA 1IXGA 1BLFA 2O68A 3JZJA 3V89B 1B3HA 2Y7RA 3SDFA 2HAVA 1LAXA 4QF9A 2O6AA 2CZLA 4K3FA 2NOOA 3PPNA 3RUMA 4X48A 4LATA 1AMFA 3SKPA 3FVKA 3Q27A 4QSCA 5FHMA 4YZZA 4ZEKA 1SYIA 3QYTA 1XT8A 4ESXA 2E1SA 2I3WA 3FVGA 3ONMA 4R73A 5ITOA 4YICA 2QMXA 3OSRA 4UACA 2F7CA 3FIRA 3Q26A 5CBRA 4P11A 3FASA 1TFAA 1H3DA 1MXVA 4NMYA 5H8NB 3MP1A 1B4ZA 1R9QA 3T66A 3IB1A 2XXPA 3K6VA 3L6HA 1B46A 5I2KB 4PP0A 3SEUA 1B6HA 1PB7A 2Z22A 1FTJA 3FVOA 4NWDA 3KN8A 4FORA 4THIA 1MM6A 4MH5A 2VD2A 3VV5A 1B5JA 3G3KA 3TYHA 4Q0CA 2P2AA 4I62A 3FJGA 3OMBA 5CM6A 2VP1A 4XIGQ 5CMCA 3H6TA 4IO7A 4FJPA 1JW5A 1N3WA 5EHMA 4HTGA 2R6GE 4NF5B 2V3QA 1D3KA 3K4UA 1Y4CA 2Q89A 1N7XA 1NMUA 3TTKA 4F39A 4YB7A 3M8UA 1Y1ZA 1VFDA 5IAIA 3T22A 3U93A 3BFUA 4ZE8A 5CRYA 3C4MA 4BDMA 1P1NA 1Z7ME 1IEJA 5I56B 2V93A 4G2ZA 5L9MA 2GHBA 3B6QA 1MY0A 4KCCA 4RPOA 1DOTA 3VFJA 1MQHA 1SYHA 4ZS9A 3VLUA 4E0XA 1NNKA 4U4XA 2VHAA 1M5DA 1MPDA 3MBPA 3CFLA 4JWOA 3L6GA 2HZKA 3FUZA 2PBWA 1B7UA 1CE2A 4C1UA 3O6HA 1XVXA 2YJPA 4OZ9A 3OO6A 2F97A 3LSWA 1LGBC 1RYOA 2XX7A 4R74A 2DXRA 1N3XA 1MXUA 4IGRA 1A7LA 2UVGA 3MW0A 3H3GA 4DLDA 3EPEA 2XHDA 3M3FA 3MVWA 4IY5A 3CFZA 1A8FA 5H8NA 1OIBA 4UA8A 4KQPA 4OESA 2PMSA 1URSA 3FV2A 1EU8A 1B4HA 3KBRA 3MVZA 4I8CA 5L9OA 4YKJA 1LB8A 3M3LA 1DTGA 3IOTA 2I49A 1JEUA 1OQHA 3IOVA 4H67A 1B0HA 2ONSA 1I6BA 2ZYKA 4NF5A 3U92A 3WAEA 1BP5A 2NVUB 3V8XB 5DVIA 4IO2A 4JBZA 4DCYA 2DYXA 3TKDA 1UIVA 5F7VA 1Y3QA 1POY1 1P1OA 4BDLA 4KYSA 2D21A 2A5SA 3KN7A 1RKMA 5AA3A 1MDQA 4C1TA 5I84A 5CMBA 5DVJA 3KFMA 2XX9A 3U94A 1MH3A 2AL4A 5ICQA 1YAEA 3I6VA 1NH7A 3N6UA 3OOAA 1SW5A 4YB6A 4OENA 2H5YA 1N7WA 3H7MA 1TT1A 3B6WA 1YPNA 4H0WA 1LAFE 1T0KA 4G8HA 3R26A 1B1HA 1IXCA 3IO6A 5CMMA 1FTOA 1IXIA 4OQOA 5IKBA 3G7WA 3IB2A 4RK9A 1ZKBA 4YKKA 4LZ5A 3GBBA 1I69A 4M4GA 4N13A 3ECRA 4PE5B 2I0BA 3HN0A 3AXFA 4ZZEA 2YPNA 1PBQA 1O7TA 3GZGA 3FJMA 1MY3A 1MPBA 1UTHA 1B5HA 2ZNUA 3EHSA 4GVOA 4F2OA 3T93B 1Y4TA 3UP9A 5KCJA 2ALUA 3QUFA 3F11A 1YCJA 5A5XB 3CI8A 5FHOA 4NE4A 5H8FB 1UTBA 4PETA 4GL0A 5HPQA 3PMVA 3TCFA 3FZVA 3RLFE 3OD7A 2XXIA 3QUJA 1OVTA 4G4PA 3FV1A 5H8HB 3JV9A 3OXNA 5JEIA 3UIFA 3PU5A 3H6VA 3H6WA 1PDAA 3PUYE 4F3GA 2GH9A 1A99A 3N26A 1L5TA 1S7YA 4JWYA 3G3FA 4OEVA 1MXXA 5BUUA 3S4UA 3KSJA 4TLLB 4FEBA 2Q88A 4ELPA 4GD5A 3N5LA 3E4RA 1LBBA 1NNTA 3S9MC 3HV1A 3FD3A 1LFGA 4U2RA 4OYVA 5H8QB 2QS4A 4EQ7A 3WAFA 3N94A 2P1SA 1D9VA 2V3TA 1B1XA 2Z8EA 1ELJA 3A3CA 3MP6A 2Q2CA 5I57B 5L8DA 4ZECA 4NF6B 3C34A
chains in the Genus database with same CATH superfamily
4H46A 5IM2A 3PUVE 4GLIA 2XXUA 2I48A 1SW4A 5L9SA 2F35A 1LSTA 4JSOA 4H5FA 4KYEA 4RJZA 2OK2A 1ZLQA 4LP2B 1NUXA 2R9JA 4R72A 4TOZA 4F29A 2FYIA 2OBGA 3UA8A 1SBPA 4F1UA 1AL3A 1QKBA 2QJEA 3LUZA 3RPLB 1GTKA 2PT1A 4QFNA 1H43A 1FRPA 2QS2A 3QSLA 1MXWA 2XXKA 1VR5A 3SESA 1Y3PA 5EQAA 1SW1A 1OVBA 1P99A 2F6PA 5I59A 1LBYA 3P7IA 2DXYA 1ZBMA 3O66A 2RCAA 3MPKA 2QSXA 2RC7A 5TPAA 1A55A 4NF8A 1MH4A 2AL5A 4N8GA 2DS9A 2Q8MA 2GRVA 1MDP1 3IAZA 1NV0A 1B0LA 1PC3A 3H06B 2CZKA 2O1LA 3QIMA 2B65A 3LC8A 3KOTA 3C33A 1FBDA 1PB9A 1FJ6A 1EZ9A 2QMWA 4F2QA 3MSTA 1QW0A 2OLBA 4XXUA 2VD3A 2XX8A 2DSFA 3LSLA 1QJMA 1YTVA 3VVEA 5CBSA 1I6QA 1B32A 5I2NA 1DPEA 2B4LA 3DP6A 3VLVA 3C9HA 3USDA 2DWJA 5EQ7A 5I7IA 4OWDA 1O63A 3CR9A 5DW8A 2QVUA 1M5FA 2JJKA 4BLAA 4LZ7A 5ET6A 1RYXA 2ZMBA 4Z0IA 4H65A 4TLMB 4GWYA 5AE4A 4F1YA 4PFBA 2ZYOA 3HHGA 5EYGA 4FEDA 4ZEIA 2Z8DA 5ITPA 2HZLA 2DWIA 1FQBA 1D9YA 1ANFA 3IB0A 3PPQA 1K9YA 2QVVA 2A5TA 4LONB 1JVYA 1Q9DA 3Q29A 4YU0A 5HBCA 4GOTA 4IO5A 1TFDA 1FBCA 4OTEA 4O7MA 3I5OA 3OSQA 4LN5A 4RYAA 1G0HA 1FTKA 2H4IA 3C35A 5AA4A 2ZXTA 3MPLA 4DXCA 4GFRA 2I4CA 4PGPA 4F22A 4ELOA 1FSAA 4NF4B 2XXRA 3UGWA 1QUJA 5EYFA 1FBHA 3E9XA 3K1NA 5EQ8A 3B6TA 1MG1A 1VFEA 3RY3A 2XD3A 1SQYA 1FQFA 4ZEBA 4G68B 4DDDA 1AOVA 1WODA 3C36A 4JVCA 3MUQA 5T3JA 3LBSA 3LSFB 3BFTA 1B52A 3IJXB 4F1VA 3RNNA 1MM7A 1LLSA 3KEIA 4H5GA 1SVXB 3SERA 3TFLA 3JYRA 1MY4A 1NV3A 2PCRA 4YAHX 4MFIA 3PV0E 2BJJX 2D3IA 3H4ZA 4GWZA 4F18A 4MF3A 4GWSA 1R6ZA 2Z23A 4JVDA 2XXVA 4ELRA 1A40A 4Q8RA 3OO8A 4FAJA 2ZZWA 4QFOA 2Q2AA 2HXRA 2NWJA 5ET5A 3SEXA 3D4GA 2VPNA 1EYJA 3PPPA 2CMOA 2OZZA 2ABHA 2V25A 4XF5A 1QKAA 5I2KA 4PAKA 1JW1A 1QUKA 1P1UA 1O64A 2X7QA 1CB6A 3PUWE 2HXWA 1MQDA 4PQJA 3W9VA 1SDXA 2XWVA 2F6GA 3U8QA 4QSDA 2DDKA 1IMAA 1I6AA 1N84A 2R71A 1ZTYA 4U23A 1WVJA 3V83A 3S9EA 2ZNSA 1FBFA 3O9PA 2O84X 3BIHA 4H6DA 3FJ7A 1LFIA 1LCFA 2BJIA 5TU0A 4PTKA 3PUXE 3K1MA 1M5BA 1FPKA 3CVGA 1B05A 4MEVA 1FPDA 4P1LA 4QFPA 4KR5A 4PF8A 4R6HA 4U1OA 4Q30B 5K2XA 5I56A 1IZ1A 1RDYA 3O6IA 3SZPA 1S50A 1MXYA 4F3PA 4BDNA 1JETA 4KHZE 3FXRA 5ELVA 4MBPA 3CG3A 4POXA 5TP9B 1B58A 5KDTB 5JTYB 4MLQA 2AIXA 3KGCA 2Y7PA 4H1XA 3BKIB 4HE0A 5FTHA 4JWXA 1YXIA 2HQ0A 1US4A 3TTNA 4HCYA 4N17A 4XKNA 1N76A 3O28A 2FNCA 4GWOA 2O1MA 1TWYA 3H03A 4UABA 2WEFA 5DEXB 1P1WA 1FPGA 3K6WA 1USYH 4PBQA 1NUYA 1LBVA 1QULA 3HHFA 4JXIA 1UQWA 2G93A 4LA9A 1LAHE 2F34A 4OA4A 4BDQA 4OVQA 3FXQA 2PT2A 3MVYA 4YMAA 4F31B 1MPCA 4I3EA 4OFJA 4G8MA 4MLVA 4QFLA 4AQ4A 1BK4A 3PPOA 2V4CA 4EF1A 1Z7NE 3N6TA 1K9ZA 4MNPA 4GXAA 4PDHA 3I3VA 1FCKA 3FATA 1NNFA 3G3JA 2I3VA 4KPTA 3KN3A 4IR8A 1IQ7A 4QSEA 1NUZA 2F3BA 4H8JA 4GRKA 5AA1A 3CRBA 3W9WA 3CSGA 4QXDA 1LCTA 2M8CA 1M5EA 2Q8JA 2Z8FA 3DP8A 1FBEA 4OVTA 3D1RA 3IFCA 3THIA 1QUIA 3A3UA 4MIJA 3ZKKA 5AA2B 2NXOA 4NTLA 5IGAA 5I58B 1KA0A 1DTZA 4U4SA 1OQGA 1DBZA 1US5A 3T9HB 1DMBA 1R1NA 1H76A 4ZEFA 2XXHA 3O2AA 1PEBA 3Q28A 3MZ9A 4G8NA 1IXHA 5J16A 1URDA 1TXFA 4O94A 1A8EA 1Y1MA 2ONKE 3SEYA 3NOHA 3CFXA 1MY2A 2Y7WA 1SD3A 3PMWA 2VOZA 4PBHA 3VLWA 1B5IA 3OELA 4NHBA 1MQGA 1ZIUA 4DXUA 4ZDMA 2OWTA 3IX1A 1B7HA 2QVRA 5FHNA 5JK4A 2F7AA 3K01A 3EKIA 4U1ZA 5CMKA 3E3KA 2UYEA 2Y5KA 3R7XA 3UK4A 1J1NA 3PPRA 1NH8A 2RC9A 1BKAA 2VGQA 3KOSA 3EHUA 4OVPA 3DELB 2DE3A 2P3VA 1FQDA 4WXJA 2B3BA 4P0GA 4R2BA 4ESWA 2RCBA 3IR1A 1FTMA 4MNCA 5F24A 4NWCA 4RY1A 2QRYA 1Q35A 3TQLA 3U1OA 2QPQA 2NUVA 2XXWA 1NFTA 2L5VA 4GX4A 3OEKA 2ZZVA 4GL8A 1WDNA 5IZ3A 5A5XA 3KC1A 1MS7A 5H8FA 1FQAA 1FPLA 3GLBA 4LVQA 2DVCA 1B3FA 3KSXA 4OANA 1GGGA 4ZZAA 2OWZA 4DI4B 4X1DA 2CZHA 1PB8A 2XXYA 2CZIA 4BDRA 5DVFA 4GQOA 3TPAA 3ODBA 5H8HA 1AWBA 4NX1A 2I6EA 2IA4A 5ET8A 1IMFA 3IOWA 1HSJA 1USYE 1FW0A 4DE8A 4JB7A 4GIZA 5M2VA 1NV6A 3KJ7A 1FQCA 4AB5A 2O69A 5LOMA 3QXMA 3TTLA 3B50A 1LBCA 3IJOB 4ECFA 2F5XA 2XXQA 3MZBA 4OVJA 3TQWA 4N91A 4RK2A 4GBVA 1EZOA 3OENA 3M3KA 2HEUA 3FGSA 4HE2A 1IITA 1VSOA 2THIA 2WYKA 3ZS6A 4EQ9A 5EHSA 1FBGA 4O3CA 1URGA 1JVXA 2HFBA 1NV2A 4PCDA 3TTMA 1B3GA 2HAUA 5H8QA 4WEDA 4R6KA 4N6KA 3QMFA 3C31A 4E0WA 1SI0A 5LTCA 2WKYA 4JSDA 1SI1A 3RT6B 3TAJA 4H8IA 2P0SA 4R9FA 3B7DA 1D4NA 4FIMA 4MJOA 1MQJA 5I57A 2H99A 4Q5TA 4NF6A 4OHNA 4F19A 2F36A 4XKQA 1NUWA 4IO6A 3HFUA 2OCUA 2XD2A 1XC1A 2I58A 4GBWA 1QGXA 2FA7A 3UN6A 1LBZA 3PUZE 4OXVA 2CEYA 4DCXA 2XWOA 3K0VA 4YKPA 2DQVA 3D4CA 1PBPA 4G77A 4ONYA 5AA2D 1Y3NA 4NQ8A 3A09A 1XS5A 2ESNA 4X8RA 5B70A 1NNPA 3S2VA 1KWHA 3LV0A 2W7YA 3RPLA 1Y20A 2QL3A 4GWXA 3T96B 3Q25A 2QS3A 3G3HA 4BDOA 4NAPA 1Y9UA 2RKMA 1OLAA 4KFQA 1LAGE 4HCWA 5H8SA 5FBPA 2IEEA 1N04A 3TTRA 1VE4A 4FE8A 3SEVA 4PFUA 3UORA 2ONRA 4PFYA 4NG7A 3K2DA 4EXKA 4YB5A 2RC8A 3EHTA 3HSTA 3RPWA 3QAXA 4R9GA 3K02A 4WKMA 5DTBA 3S9NC 2I0CA 4OERA 2DE2A 2GFEA 1P1QA 3G3GA 2KR0A 4XKPA 2H25A 4ZEDA 1JQFA 3SEWA 4NF0A 2OWSA 3EQ1A 4N81A 3IO4A 1IMEA 2E0SA 1NKXA 4U22A 2FHYA 4PFWA 2O51A 4GWUA 2O7UA 4EQBA 4G68C 3K00A 1BTJA 3U65A 1GV8A 4P0IA 1GVCA 3FXBA 1EZPA 1DCUA 3EN3A 3CG1A 1DSNA 4LZ8A 5ICTA 4ND9A 4OMBA 3U72A 2REGA 4F3BA 5HM4B 1JEVA 1OLCA 1R9LA 2UVJA 1A54A 3SETA 2F8DA 4LUBA 1ZJLA 1XHYA 1DPPA 4KCDA 4X9TA 1UIUA 2XA5A 1F9BA 1KZ8A 2DE4A 3RTWB 1BIYA 3TEPA 1YZ0A 2VPOA 2AYSA 1UTHB 2F7BA 4QRZA 3HCQA 1MRPA 1B3LA 2DWAA 1JNFA 3VVDA 2B3FA 1S9TA 2HPGA 4ZE9A 4HE1A 5KZTA 4MX6A 4MMPA 5KCJB 5K2YA 1FQEA 4YMBA 2UVHA 4XTCQ 2Q9TA 2ZYMA 2D5WA 4LQ2A 3W15C 1UTBB 4I1DA 4KD5A 4R75A 1INPA 5J1DA 1ATGA 1H45A 3FVNA 4NF4A 3E78A 5DT6A 3MJNA 3TCHA 2UYFA 3VXBA 3EF7A 1SPIA 2XXXA 4I9DA 3IOUA 2YLNA 3QK6A 4KYDA 3DP4A 4MNIA 4HS7A 2DVZA 4PC9A 3GBAA 4P8BA 3ZSFA 3TZAA 3IFAA 3MWBA 5BWJA 4HW8A 4RNSA 4G68A 3GXAA 3K1PA 4N4UA 3E13X 3MC2A 1LB9A 1FJ9A 3RT8A 2DWHA 4M1VA 1IUDA 3MQ9A 5B7DA 2RF1A 4IO3A 3T9UA 3TMGA 5CC2A 1OMPA 2XXTA 4AB6A 3CSBA 5EYHA 2RINA 3ZKLA 4OFLA 1ZU0A 3RTFB 2PX1A 2PYYA 4GX6A 1AIVA 4RXLA 4IO4A 1GR2A 1ZMGA 3RGYA 3IORA 4RPNA 1FTLA 5IZ1A 1Q1KA 1M5CA 2V3UA 2OX3A 4YKIA 2GQ1A 3TODA 3V5AA 4P47A 1CNQA 3ILTB 1LFHA 1POTA 4IY6A 3T1BA 2HHMA 1II5A 4N07A 4PF6A 2ZYNA 2I4BA 3TDJA 4IGTA 2H98A 2ZNTA 4I40A 1LBXA 1H44A 4FECA 3PMXA 1XOCA 1B40A 2Y5LA 4EUOA 3PGFA 3KZGA 4OETA 5ET7A 2G29A 2QS1A 4JDFA 4KI0E 3O29A 3RN8A 4NEDA 3CIJA 3PD9A 3T9XB 2ANJA 4QHQA 3O6GA 2FVZA 1N0TA 2UVIA 2Y7KA 4DIGA 4DXBA 1IMCA 3O97A 4DI3D 3DLNA 5I59B 1B7ZA 3C32A 4L17A 3K6UA 4OEUA 3RYDA 4PFTA 5TPAB 4EDPA 5I3SA 2OJTA 3TUSA 4NF8B 2DP8A 4O3BA 1B51A 1NV1A 3VVFA 4GXSB 3OEMA 4XEQA 1LBWA 1MQIA 4X1BA 4O3AA 5TP9A 5KDTA 5JTYA 2X7PA 4PGNA 3KJTA 4FBPA 2LAOA 1SW2A 1YYZA 3MP8A 4C0RA 5CI5A 5A5LA 1JW4A 4ELQA 4PE3A 2H9BA 4N15A 4P9KA 4G61A 3LUYA 4GF8A 3MZ1A 5ISUA 1EYIA 4F3SA 1B3EA 5DEXA 2F78A 4PAFA 5I2NB 3IL1B 1D9QA 3FXUA 4TQUQ 3MAMA 4PFIA 4OFOA 3ILUB 3OO7A 1QVSA 5F1QA 2FBPA 3DM0A 4POWA 2GHAA 2REJA 1NV5A 4JVIA 3TELA 1EH3A 4GX3A 1MY1A 3RQTA 2WBBA 5FTIA 2V84A 2Y84A 4R2FA 3LSXA 4XKRA 4LQ5A 4WEPA 3S9LC 3KG2A 3G3IA 1HSLA 3K6XA 2PFYA 4ISUA 3KC0A 2B4MA 2A5TB 4Z7EA 2Y7IA 3BBRA 3PD8A 1LEVA 2X26A 3T9VA 4AS5A 2DOJA 4EF2A 3PTYA 4RA1A 2KLFA 4FATA 3OO9A 3TCGA 1MXZA 2UXAA 1HSEA 4P56A 5AA4B 1NL5A 4X04A 1B2HA 2O7IA 3H6UA 3HPIA 3VXCA 3MVXA 4U21A 1B9JA 3LR1A 5AA2A 5I5PA 3IK6B 5I58A 4QFKA 3VE1B 3VDFA 4N6PA 2HCAA 4EXLA 4IB2A 2WX9A 2R8TA 3R6UA 4O8MA 1IIWA 2PVUA 5DYHA 4DZ1A 3HO7A 1AH5A 1XVYA 4R6YA 2CEXA 1IXGA 1BLFA 2O68A 3JZJA 3V89B 1B3HA 1FPFA 2Y7RA 3SDFA 4P1EA 2HAVA 1LAXA 4QF9A 2O6AA 4P3LA 2CZLA 4K3FA 2NOOA 3PPNA 3RUMA 4X48A 4LATA 1AMFA 3SKPA 3FVKA 2FIXA 3Q27A 4QSCA 5FHMA 4YZZA 4ZEKA 1SYIA 3QYTA 1XT8A 4ESXA 2E1SA 2I3WA 3FVGA 3ONMA 4R73A 5ITOA 4YICA 2QMXA 2Q74A 3OSRA 4UACA 2F7CA 3FIRA 3Q26A 1NI9A 5CBRA 4P11A 1IMDA 2QFLA 3FASA 1TFAA 1H3DA 1MXVA 5EQ9A 1FPEA 4NMYA 5H8NB 3MP1A 1B4ZA 1R9QA 3T66A 3IB1A 2XXPA 3K6VA 3L6HA 1B46A 5I2KB 4PP0A 3SEUA 1B6HA 1PB7A 1FPIA 2Z22A 1FTJA 3FVOA 4NWDA 3KN8A 4FORA 4OVSA 4THIA 1MM6A 4MH5A 2VD2A 3VV5A 1B5JA 3G3KA 3TYHA 4Q0CA 2P2AA 4I62A 3FJGA 3OMBA 5CM6A 2VP1A 4XIGQ 5CMCA 3H6TA 4IO7A 4FJPA 1JW5A 1N3WA 5EHMA 4HTGA 2R6GE 3ROJA 4NF5B 2V3QA 1D3KA 3K4UA 1Y4CA 2Q89A 1FBPA 1N7XA 1NMUA 3TTKA 4F39A 4YB7A 3M8UA 1Y1ZA 1VFDA 5IAIA 3T22A 2XWIA 3U93A 3BFUA 4ZE8A 5CRYA 3C4MA 4BDMA 1P1NA 1FTAA 1Z7ME 1IEJA 5I56B 2V93A 4G2ZA 5L9MA 2GHBA 3B6QA 1MY0A 4KCCA 4RPOA 1DOTA 4QBAA 3VFJA 1MQHA 1SYHA 4ZS9A 3VLUA 4E0XA 4PFRA 1NNKA 4U4XA 2VHAA 1M5DA 1MPDA 3MBPA 3CFLA 1VDWA 4JWOA 3L6GA 2VT5A 4HXVA 2HZKA 3FUZA 2PBWA 1DK4A 1B7UA 1CE2A 4C1UA 3O6HA 1XVXA 4NN3A 2YJPA 4OZ9A 3OO6A 4PDDA 2F97A 3LSWA 1LGBC 1RYOA 2XX7A 4R74A 2DXRA 1N3XA 1MXUA 4IGRA 1A7LA 2ZZXA 2UVGA 3MW0A 3H3GA 4DLDA 3EPEA 2XHDA 3M3FA 3MVWA 4IY5A 3CFZA 1A8FA 5H8NA 4AS4A 1XI6A 1OIBA 4UA8A 4KQPA 4XFEA 4OESA 2PMSA 1URSA 3FV2A 4MAGA 1EU8A 3KBZA 1B4HA 3KBRA 3MVZA 1KA1A 4I8CA 5L9OA 4YKJA 1LB8A 3M3LA 4N6DA 1DTGA 3BIGA 3IOTA 5LDZA 2I49A 1JEUA 1OQHA 3IOVA 4H67A 1B0HA 2ONSA 1I6BA 2ZYKA 4OVRA 4NF5A 3U92A 3WAEA 1BP5A 2NVUB 3V8XB 5DVIA 4IO2A 4JBZA 3T0JA 4DCYA 2DYXA 1FPJA 3TKDA 2PFZA 1UIVA 5F7VA 1FPBA 1Y3QA 4N8YA 2WYPA 1POY1 1P1OA 1RDXA 4BDLA 4KYSA 2D21A 2A5SA 3KN7A 1RKMA 5AA3A 1MDQA 4C1TA 5I84A 5CMBA 5DVJA 3KFMA 2XX9A 3U94A 4H45A 1MH3A 2AL4A 5ICQA 1YAEA 3I6VA 1NH7A 3N6UA 3OOAA 1SW5A 4YB6A 4OENA 2H5YA 1N7WA 3H7MA 1TT1A 3B6WA 3ISPA 1YPNA 4H0WA 1LAFE 4MHFA 5ESYA 1T0KA 4G8HA 3R26A 1B1HA 1IXCA 3IO6A 5CMMA 1IMBA 1FTOA 1IXIA 4OQOA 5IKBA 3G7WA 3IB2A 4RK9A 1ZKBA 4YKKA 4LZ5A 3GBBA 1I69A 4M4GA 4N13A 3ECRA 4PE5B 2I0BA 3HN0A 3AXFA 4ZZEA 2YPNA 1PBQA 1O7TA 3GZGA 3FJMA 4I3YA 1MY3A 1MPBA 1UTHA 1B5HA 2ZNUA 3EHSA 2WBDA 4GVOA 4F2OA 3T93B 1Y4TA 3UP9A 5KCJA 2ALUA 3QUFA 3F11A 5IZ3B 1YCJA 5A5XB 3CI8A 5FHOA 4NE4A 5H8FB 1UTBA 4O7IA 4PETA 4GL0A 5HPQA 5IZZA 3PMVA 3TCFA 3FBPA 4NGUA 3FZVA 3RLFE 3OD7A 1NV4A 2XXIA 3QUJA 1OVTA 4G4PA 3FV1A 5H8HB 3JV9A 3OXNA 5JEIA 2F3DA 1JP4A 3UIFA 3PU5A 3H6VA 3H6WA 1PDAA 3PUYE 4F3GA 3CHGA 2GH9A 4JWYA 1A99A 1S7YA 2KQZA 3N26A 1L5TA 3G3FA 4OEVA 1MXXA 1NV7A 5BUUA 3S4UA 3KSJA 4TLLB 2MKZA 4FEBA 2Q88A 4ELPA 4GD5A 3N5LA 3E4RA 2XWKA 1LBBA 1NNTA 4MCOA 3S9MC 2FIEA 3HV1A 4KXPA 3FD3A 1LFGA 2P3NA 4U2RA 4OYVA 1EYKA 5H8QB 2QS4A 4GWWA 4EQ7A 3WAFA 3MYUA 3E79A 3N94A 2P1SA 1RDZA 3B8BA 1D9VA 2V3TA 3A29A 1B1XA 1G0IA 1ELJA 2Z8EA 4PAIA 3A3CA 3MP6A 2Q2CA 5I57B 3GYYA 5L8DA 4ZECA 4NF6B 3C34A
chains in the Genus database with same CATH topology
3PUVE 4GLIA 2XXUA 2I48A 1SW4A 5L9SA 2F35A 1LSTA 4JSOA 4H5FA 4KYEA 4RJZA 2OK2A 1ZLQA 4LP2B 2R9JA 4R72A 4TOZA 4F29A 2FYIA 2OBGA 3UA8A 1SBPA 4F1UA 1AL3A 1QKBA 2QJEA 1GTKA 2PT1A 4QFNA 1H43A 2QS2A 3QSLA 1MXWA 1VR5A 3SESA 1Y3PA 1SW1A 1OVBA 1P99A 2F6PA 5I59A 3P7IA 2DXYA 1ZBMA 3O66A 2RCAA 3MPKA 2QSXA 2RC7A 5TPAA 1A55A 4NF8A 1MH4A 2AL5A 2DS9A 2GRVA 1MDP1 3IAZA 1B0LA 1PC3A 3H06B 2O1LA 3QIMA 2B65A 3LC8A 3KOTA 3C33A 1PB9A 1EZ9A 2QMWA 4F2QA 1QW0A 2OLBA 4XXUA 2VD3A 2XX8A 2DSFA 3LSLA 1YTVA 1QJMA 3VVEA 5CBSA 1I6QA 1B32A 5I2NA 1DPEA 3DP6A 3VLVA 3C9HA 3USDA 2DWJA 4OWDA 1O63A 3CR9A 1M5FA 4BLAA 4LZ7A 1RYXA 2ZMBA 4Z0IA 4H65A 4TLMB 5AE4A 4F1YA 2ZYOA 3HHGA 4FEDA 4ZEIA 2Z8DA 5ITPA 2HZLA 2DWIA 1FQBA 1D9YA 1ANFA 3IB0A 3PPQA 2A5TA 4LONB 1JVYA 3Q29A 4YU0A 5HBCA 4GOTA 4IO5A 1TFDA 4OTEA 3I5OA 3OSQA 4RYAA 1FTKA 2H4IA 3C35A 5AA4A 2ZXTA 3MPLA 4DXCA 4GFRA 2I4CA 4F22A 4ELOA 4NF4B 2XXRA 3UGWA 1QUJA 5EYFA 3E9XA 3K1NA 3B6TA 1MG1A 1VFEA 3RY3A 2XD3A 1SQYA 1FQFA 4ZEBA 4G68B 4DDDA 1AOVA 1WODA 3C36A 3MUQA 3LBSA 3LSFB 3BFTA 1B52A 3IJXB 4F1VA 3RNNA 1MM7A 1LLSA 3KEIA 4H5GA 1SVXB 3SERA 3TFLA 3JYRA 1MY4A 4YAHX 4MFIA 3PV0E 2BJJX 2D3IA 3H4ZA 4F18A 4MF3A 1R6ZA 2Z23A 2XXVA 4ELRA 1A40A 4Q8RA 3OO8A 4FAJA 4QFOA 2Q2AA 2NWJA 3SEXA 3D4GA 3PPPA 2CMOA 2OZZA 2ABHA 2V25A 1QKAA 5I2KA 1JW1A 1QUKA 1P1UA 1O64A 2X7QA 1CB6A 3PUWE 2HXWA 1MQDA 4PQJA 3W9VA 1SDXA 2F6GA 3U8QA 4QSDA 1I6AA 1N84A 2R71A 1ZTYA 4U23A 1WVJA 3V83A 3S9EA 2ZNSA 3O9PA 2O84X 4H6DA 3FJ7A 1LFIA 1LCFA 5TU0A 3PUXE 3K1MA 1M5BA 3CVGA 1B05A 4QFPA 4KR5A 4R6HA 4U1OA 4Q30B 5K2XA 5I56A 1IZ1A 3O6IA 1S50A 1MXYA 4F3PA 4BDNA 1JETA 4KHZE 3FXRA 5ELVA 4MBPA 3CG3A 4POXA 5TP9B 1B58A 5KDTB 5JTYB 4MLQA 2AIXA 3KGCA 2Y7PA 4H1XA 3BKIB 5FTHA 4JWXA 2HQ0A 3TTNA 1US4A 4HCYA 4XKNA 1N76A 3O28A 2FNCA 4GWOA 2O1MA 1TWYA 3H03A 5DEXB 1P1WA 3K6WA 1USYH 1QULA 3HHFA 4JXIA 1UQWA 2G93A 4LA9A 1LAHE 2F34A 4BDQA 3FXQA 2PT2A 3MVYA 4YMAA 4F31B 1MPCA 4OFJA 4G8MA 4MLVA 4QFLA 4AQ4A 3PPOA 4EF1A 1Z7NE 3N6TA 4GXAA 3I3VA 1FCKA 3FATA 1NNFA 3G3JA 2I3VA 4KPTA 3KN3A 1IQ7A 4QSEA 4H8JA 4GRKA 5AA1A 3CRBA 3W9WA 3CSGA 1LCTA 2M8CA 1M5EA 2Q8JA 2Z8FA 3DP8A 3THIA 1QUIA 3A3UA 3ZKKA 5AA2B 2NXOA 4NTLA 5I58B 4U4SA 1DTZA 1OQGA 1US5A 3T9HB 1DMBA 1R1NA 1H76A 4ZEFA 2XXHA 3O2AA 1PEBA 3Q28A 3MZ9A 4G8NA 1IXHA 1URDA 1TXFA 1Y1MA 1A8EA 2ONKE 3SEYA 3CFXA 1MY2A 2Y7WA 1SD3A 3PMWA 2VOZA 3VLWA 1B5IA 3OELA 1MQGA 1ZIUA 4DXUA 4ZDMA 2OWTA 3IX1A 1B7HA 5FHNA 5JK4A 2F7AA 3K01A 4U1ZA 5CMKA 3E3KA 2UYEA 3R7XA 3UK4A 1J1NA 3PPRA 1NH8A 2RC9A 1BKAA 2VGQA 3KOSA 3EHUA 3DELB 2DE3A 1FQDA 4WXJA 2B3BA 4P0GA 4R2BA 4ESWA 2RCBA 3IR1A 1FTMA 4NWCA 4RY1A 2QRYA 1Q35A 3TQLA 3U1OA 2QPQA 2NUVA 2XXWA 1NFTA 3OEKA 4GL8A 1WDNA 5A5XA 1MS7A 5H8FA 1FQAA 4LVQA 3GLBA 2DVCA 1B3FA 3KSXA 1GGGA 4ZZAA 4X1DA 1PB8A 2XXYA 4BDRA 5DVFA 4GQOA 3TPAA 3ODBA 5H8HA 2I6EA 2IA4A 3IOWA 1HSJA 1USYE 1FW0A 4DE8A 4JB7A 4GIZA 5M2VA 3KJ7A 1FQCA 4AB5A 2O69A 5LOMA 3QXMA 3TTLA 1LBCA 3IJOB 4ECFA 2F5XA 2XXQA 3MZBA 4OVJA 3TQWA 4RK2A 1EZOA 3OENA 3M3KA 2HEUA 3FGSA 1IITA 1VSOA 2THIA 3ZS6A 4EQ9A 5EHSA 4O3CA 1URGA 1JVXA 2HFBA 3TTMA 1B3GA 2HAUA 5H8QA 4WEDA 4R6KA 3C31A 4E0WA 1SI0A 2WKYA 4JSDA 1SI1A 3RT6B 3TAJA 4H8IA 2P0SA 4R9FA 3B7DA 1D4NA 4FIMA 1MQJA 5I57A 2H99A 4Q5TA 4NF6A 4OHNA 4F19A 2F36A 4XKQA 4IO6A 2OCUA 2XD2A 1XC1A 2I58A 2FA7A 3UN6A 3PUZE 4OXVA 4DCXA 3K0VA 4YKPA 2DQVA 3D4CA 1PBPA 4G77A 4ONYA 5AA2D 1Y3NA 3A09A 1XS5A 2ESNA 5B70A 1NNPA 3S2VA 1KWHA 2W7YA 1Y20A 2QL3A 3T96B 3Q25A 2QS3A 3G3HA 4BDOA 1Y9UA 2RKMA 1OLAA 4KFQA 1LAGE 4HCWA 5H8SA 2IEEA 1N04A 3TTRA 1VE4A 4FE8A 3SEVA 4PFUA 3UORA 2ONRA 4PFYA 3K2DA 4EXKA 4YB5A 2RC8A 3EHTA 3HSTA 3RPWA 3QAXA 4R9GA 3K02A 4WKMA 5DTBA 3S9NC 2I0CA 4OERA 2DE2A 2GFEA 1P1QA 3G3GA 4XKPA 2H25A 4ZEDA 1JQFA 3SEWA 2OWSA 3EQ1A 3IO4A 2E0SA 1NKXA 4U22A 4PFWA 2O51A 2O7UA 4EQBA 4G68C 3K00A 1BTJA 1GV8A 4P0IA 1GVCA 1EZPA 3EN3A 3CG1A 1DSNA 4LZ8A 5ICTA 4ND9A 4OMBA 3U72A 2REGA 4F3BA 5HM4B 1JEVA 1OLCA 1R9LA 2UVJA 1A54A 3SETA 2F8DA 4LUBA 1ZJLA 1XHYA 1DPPA 4KCDA 4X9TA 1UIUA 1F9BA 2DE4A 3RTWB 1BIYA 3TEPA 2AYSA 1UTHB 2F7BA 4QRZA 3HCQA 1MRPA 1B3LA 2DWAA 1JNFA 3VVDA 2B3FA 1S9TA 4ZE9A 5KZTA 5KCJB 5K2YA 1FQEA 4YMBA 2UVHA 4XTCQ 2Q9TA 2ZYMA 2D5WA 4LQ2A 3W15C 1UTBB 4I1DA 4KD5A 4R75A 5J1DA 1ATGA 1H45A 3FVNA 4NF4A 5DT6A 3MJNA 3TCHA 2UYFA 3VXBA 3EF7A 2XXXA 4I9DA 3IOUA 2YLNA 3QK6A 4KYDA 3DP4A 4HS7A 2DVZA 3GBAA 3ZSFA 3TZAA 3MWBA 5BWJA 4HW8A 4RNSA 4G68A 3GXAA 3K1PA 3E13X 3MC2A 1LB9A 3RT8A 2DWHA 4M1VA 1IUDA 3MQ9A 5B7DA 2RF1A 4IO3A 3T9UA 3TMGA 5CC2A 1OMPA 2XXTA 4AB6A 3CSBA 2RINA 3ZKLA 4OFLA 1ZU0A 3RTFB 2PX1A 2PYYA 1AIVA 4RXLA 4IO4A 1GR2A 1ZMGA 3RGYA 3IORA 4RPNA 1FTLA 1Q1KA 1M5CA 2V3UA 4YKIA 3TODA 3V5AA 3ILTB 1LFHA 1POTA 4IY6A 1II5A 4N07A 2ZYNA 2I4BA 3TDJA 4IGTA 2H98A 2ZNTA 1H44A 4FECA 3PMXA 1XOCA 1B40A 4EUOA 3PGFA 3KZGA 4OETA 2G29A 2QS1A 4JDFA 4KI0E 3O29A 3RN8A 4NEDA 3CIJA 3PD9A 3T9XB 2ANJA 4QHQA 3O6GA 1N0TA 2UVIA 2Y7KA 4DIGA 4DXBA 3O97A 5I59B 3DLNA 1B7ZA 3C32A 4L17A 3K6UA 4OEUA 4PFTA 5TPAB 4EDPA 2OJTA 3TUSA 4NF8B 2DP8A 4O3BA 1B51A 3VVFA 4GXSB 3OEMA 1MQIA 4X1BA 4O3AA 5TP9A 5KDTA 5JTYA 2X7PA 3KJTA 2LAOA 1SW2A 3MP8A 4C0RA 5CI5A 1JW4A 4ELQA 2H9BA 3LUYA 4GF8A 3MZ1A 5ISUA 4F3SA 1B3EA 5DEXA 2F78A 5I2NB 3IL1B 3FXUA 4TQUQ 3MAMA 4OFOA 3ILUB 3OO7A 1QVSA 5F1QA 3DM0A 4POWA 2GHAA 2REJA 3TELA 1EH3A 1MY1A 3RQTA 5FTIA 2V84A 2Y84A 4R2FA 3LSXA 4XKRA 4LQ5A 4WEPA 3S9LC 3KG2A 3G3IA 1HSLA 3K6XA 4ISUA 2A5TB 4Z7EA 2Y7IA 3BBRA 3PD8A 2X26A 3T9VA 2DOJA 4EF2A 4RA1A 2KLFA 4FATA 3OO9A 3TCGA 1MXZA 2UXAA 1HSEA 5AA4B 1NL5A 1B2HA 2O7IA 3H6UA 3HPIA 3VXCA 3MVXA 4U21A 1B9JA 3LR1A 5AA2A 3IK6B 5I58A 4QFKA 3VE1B 3VDFA 4N6PA 2HCAA 4EXLA 4IB2A 3R6UA 1IIWA 2PVUA 5DYHA 4DZ1A 3HO7A 1XVYA 1AH5A 4R6YA 1IXGA 1BLFA 2O68A 3JZJA 3V89B 1B3HA 2Y7RA 3SDFA 2HAVA 1LAXA 4QF9A 2O6AA 2CZLA 4K3FA 2NOOA 3PPNA 3RUMA 4X48A 4LATA 1AMFA 3SKPA 3FVKA 3Q27A 4QSCA 5FHMA 4YZZA 4ZEKA 1SYIA 3QYTA 1XT8A 4ESXA 2E1SA 2I3WA 3FVGA 3ONMA 4R73A 5ITOA 4YICA 2QMXA 3OSRA 4UACA 2F7CA 3FIRA 3Q26A 5CBRA 4P11A 3FASA 1TFAA 1H3DA 1MXVA 4NMYA 5H8NB 3MP1A 1B4ZA 1R9QA 3T66A 3IB1A 2XXPA 3K6VA 3L6HA 1B46A 5I2KB 4PP0A 3SEUA 1B6HA 1PB7A 2Z22A 1FTJA 3FVOA 4NWDA 3KN8A 4FORA 4THIA 1MM6A 4MH5A 2VD2A 3VV5A 1B5JA 3G3KA 3TYHA 4Q0CA 2P2AA 4I62A 3FJGA 3OMBA 5CM6A 2VP1A 4XIGQ 5CMCA 3H6TA 4IO7A 4FJPA 1JW5A 1N3WA 5EHMA 4HTGA 2R6GE 4NF5B 2V3QA 1D3KA 3K4UA 1Y4CA 2Q89A 1N7XA 1NMUA 3TTKA 4F39A 4YB7A 3M8UA 1Y1ZA 1VFDA 5IAIA 3T22A 3U93A 3BFUA 4ZE8A 5CRYA 3C4MA 4BDMA 1P1NA 1Z7ME 1IEJA 5I56B 2V93A 4G2ZA 5L9MA 2GHBA 3B6QA 1MY0A 4KCCA 4RPOA 1DOTA 3VFJA 1MQHA 1SYHA 4ZS9A 3VLUA 4E0XA 1NNKA 4U4XA 2VHAA 1M5DA 1MPDA 3MBPA 3CFLA 4JWOA 3L6GA 2HZKA 3FUZA 2PBWA 1B7UA 1CE2A 4C1UA 3O6HA 1XVXA 2YJPA 4OZ9A 3OO6A 2F97A 3LSWA 1LGBC 1RYOA 2XX7A 4R74A 2DXRA 1N3XA 1MXUA 4IGRA 1A7LA 2UVGA 3MW0A 3H3GA 4DLDA 3EPEA 2XHDA 3M3FA 3MVWA 4IY5A 3CFZA 1A8FA 5H8NA 1OIBA 4UA8A 4KQPA 4OESA 2PMSA 1URSA 3FV2A 1EU8A 1B4HA 3KBRA 3MVZA 4I8CA 5L9OA 4YKJA 1LB8A 3M3LA 1DTGA 3IOTA 2I49A 1JEUA 1OQHA 3IOVA 4H67A 1B0HA 2ONSA 1I6BA 2ZYKA 4NF5A 3U92A 3WAEA 1BP5A 2NVUB 3V8XB 5DVIA 4IO2A 4JBZA 4DCYA 2DYXA 3TKDA 1UIVA 5F7VA 1Y3QA 1POY1 1P1OA 4BDLA 4KYSA 2D21A 2A5SA 3KN7A 1RKMA 5AA3A 1MDQA 4C1TA 5I84A 5CMBA 5DVJA 3KFMA 2XX9A 3U94A 1MH3A 2AL4A 5ICQA 1YAEA 3I6VA 1NH7A 3N6UA 3OOAA 1SW5A 4YB6A 4OENA 2H5YA 1N7WA 3H7MA 1TT1A 3B6WA 1YPNA 4H0WA 1LAFE 1T0KA 4G8HA 3R26A 1B1HA 1IXCA 3IO6A 5CMMA 1FTOA 1IXIA 4OQOA 5IKBA 3G7WA 3IB2A 4RK9A 1ZKBA 4YKKA 4LZ5A 3GBBA 1I69A 4M4GA 4N13A 3ECRA 4PE5B 2I0BA 3HN0A 3AXFA 4ZZEA 2YPNA 1PBQA 1O7TA 3GZGA 3FJMA 1MY3A 1MPBA 1UTHA 1B5HA 2ZNUA 3EHSA 4GVOA 4F2OA 3T93B 1Y4TA 3UP9A 5KCJA 2ALUA 3QUFA 3F11A 1YCJA 5A5XB 3CI8A 5FHOA 4NE4A 5H8FB 1UTBA 4PETA 4GL0A 5HPQA 3PMVA 3TCFA 3FZVA 3RLFE 3OD7A 2XXIA 3QUJA 1OVTA 4G4PA 3FV1A 5H8HB 3JV9A 3OXNA 5JEIA 3UIFA 3PU5A 3H6VA 3H6WA 1PDAA 3PUYE 4F3GA 2GH9A 1A99A 3N26A 1L5TA 1S7YA 4JWYA 3G3FA 4OEVA 1MXXA 5BUUA 3S4UA 3KSJA 4TLLB 4FEBA 2Q88A 4ELPA 4GD5A 3N5LA 3E4RA 1LBBA 1NNTA 3S9MC 3HV1A 3FD3A 1LFGA 4U2RA 4OYVA 5H8QB 2QS4A 4EQ7A 3WAFA 3N94A 2P1SA 1D9VA 2V3TA 1B1XA 2Z8EA 1ELJA 3A3CA 3MP6A 2Q2CA 5I57B 5L8DA 4ZECA 4NF6B 3C34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUV E;  4GLI A;  2XXU A;  2I48 A;  1SW4 A;  5L9S A;  2F35 A;  1LST A;  4JSO A;  4H5F A;  4KYE A;  4RJZ A;  2OK2 A;  1ZLQ A;  4LP2 B;  2R9J A;  4R72 A;  4TOZ A;  4F29 A;  2FYI A;  2OBG A;  3UA8 A;  1SBP A;  4F1U A;  1AL3 A;  1QKB A;  2QJE A;  1GTK A;  2PT1 A;  4QFN A;  1H43 A;  2QS2 A;  3QSL A;  1MXW A;  1VR5 A;  3SES A;  1Y3P A;  1SW1 A;  1OVB A;  1P99 A;  2F6P A;  5I59 A;  3P7I A;  2DXY A;  1ZBM A;  3O66 A;  2RCA A;  3MPK A;  2QSX A;  2RC7 A;  5TPA A;  1A55 A;  4NF8 A;  1MH4 A;  2AL5 A;  2DS9 A;  2GRV A;  1MDP 1;  3IAZ A;  1B0L A;  1PC3 A;  3H06 B;  2O1L A;  3QIM A;  2B65 A;  3LC8 A;  3KOT A;  3C33 A;  1PB9 A;  1EZ9 A;  2QMW A;  4F2Q A;  1QW0 A;  2OLB A;  4XXU A;  2VD3 A;  2XX8 A;  2DSF A;  3LSL A;  1YTV A;  1QJM A;  3VVE A;  5CBS A;  1I6Q A;  1B32 A;  5I2N A;  1DPE A;  3DP6 A;  3VLV A;  3C9H A;  3USD A;  2DWJ A;  4OWD A;  1O63 A;  3CR9 A;  1M5F A;  4BLA A;  4LZ7 A;  1RYX A;  2ZMB A;  4Z0I A;  4H65 A;  4TLM B;  5AE4 A;  4F1Y A;  2ZYO A;  3HHG A;  4FED A;  4ZEI A;  2Z8D A;  5ITP A;  2HZL A;  2DWI A;  1FQB A;  1D9Y A;  1ANF A;  3IB0 A;  3PPQ A;  2A5T A;  4LON B;  1JVY A;  3Q29 A;  4YU0 A;  5HBC A;  4GOT A;  4IO5 A;  1TFD A;  4OTE A;  3I5O A;  3OSQ A;  4RYA A;  1FTK A;  2H4I A;  3C35 A;  5AA4 A;  2ZXT A;  3MPL A;  4DXC A;  4GFR A;  2I4C A;  4F22 A;  4ELO A;  4NF4 B;  2XXR A;  3UGW A;  1QUJ A;  5EYF A;  3E9X A;  3K1N A;  3B6T A;  1MG1 A;  1VFE A;  3RY3 A;  2XD3 A;  1SQY A;  1FQF A;  4ZEB A;  4G68 B;  4DDD A;  1AOV A;  1WOD A;  3C36 A;  3MUQ A;  3LBS A;  3LSF B;  3BFT A;  1B52 A;  3IJX B;  4F1V A;  3RNN A;  1MM7 A;  1LLS A;  3KEI A;  4H5G A;  1SVX B;  3SER A;  3TFL A;  3JYR A;  1MY4 A;  4YAH X;  4MFI A;  3PV0 E;  2BJJ X;  2D3I A;  3H4Z A;  4F18 A;  4MF3 A;  1R6Z A;  2Z23 A;  2XXV A;  4ELR A;  1A40 A;  4Q8R A;  3OO8 A;  4FAJ A;  4QFO A;  2Q2A A;  2NWJ A;  3SEX A;  3D4G A;  3PPP A;  2CMO A;  2OZZ A;  2ABH A;  2V25 A;  1QKA A;  5I2K A;  1JW1 A;  1QUK A;  1P1U A;  1O64 A;  2X7Q A;  1CB6 A;  3PUW E;  2HXW A;  1MQD A;  4PQJ A;  3W9V A;  1SDX A;  2F6G A;  3U8Q A;  4QSD A;  1I6A A;  1N84 A;  2R71 A;  1ZTY A;  4U23 A;  1WVJ A;  3V83 A;  3S9E A;  2ZNS A;  3O9P A;  2O84 X;  4H6D A;  3FJ7 A;  1LFI A;  1LCF A;  5TU0 A;  3PUX E;  3K1M A;  1M5B A;  3CVG A;  1B05 A;  4QFP A;  4KR5 A;  4R6H A;  4U1O A;  4Q30 B;  5K2X A;  5I56 A;  1IZ1 A;  3O6I A;  1S50 A;  1MXY A;  4F3P A;  4BDN A;  1JET A;  4KHZ E;  3FXR A;  5ELV A;  4MBP A;  3CG3 A;  4POX A;  5TP9 B;  1B58 A;  5KDT B;  5JTY B;  4MLQ A;  2AIX A;  3KGC A;  2Y7P A;  4H1X A;  3BKI B;  5FTH A;  4JWX A;  2HQ0 A;  3TTN A;  1US4 A;  4HCY A;  4XKN A;  1N76 A;  3O28 A;  2FNC A;  4GWO A;  2O1M A;  1TWY A;  3H03 A;  5DEX B;  1P1W A;  3K6W A;  1USY H;  1QUL A;  3HHF A;  4JXI A;  1UQW A;  2G93 A;  4LA9 A;  1LAH E;  2F34 A;  4BDQ A;  3FXQ A;  2PT2 A;  3MVY A;  4YMA A;  4F31 B;  1MPC A;  4OFJ A;  4G8M A;  4MLV A;  4QFL A;  4AQ4 A;  3PPO A;  4EF1 A;  1Z7N E;  3N6T A;  4GXA A;  3I3V A;  1FCK A;  3FAT A;  1NNF A;  3G3J A;  2I3V A;  4KPT A;  3KN3 A;  1IQ7 A;  4QSE A;  4H8J A;  4GRK A;  5AA1 A;  3CRB A;  3W9W A;  3CSG A;  1LCT A;  2M8C A;  1M5E A;  2Q8J A;  2Z8F A;  3DP8 A;  3THI A;  1QUI A;  3A3U A;  3ZKK A;  5AA2 B;  2NXO A;  4NTL A;  5I58 B;  4U4S A;  1DTZ A;  1OQG A;  1US5 A;  3T9H B;  1DMB A;  1R1N A;  1H76 A;  4ZEF A;  2XXH A;  3O2A A;  1PEB A;  3Q28 A;  3MZ9 A;  4G8N A;  1IXH A;  1URD A;  1TXF A;  1Y1M A;  1A8E A;  2ONK E;  3SEY A;  3CFX A;  1MY2 A;  2Y7W A;  1SD3 A;  3PMW A;  2VOZ A;  3VLW A;  1B5I A;  3OEL A;  1MQG A;  1ZIU A;  4DXU A;  4ZDM A;  2OWT A;  3IX1 A;  1B7H A;  5FHN A;  5JK4 A;  2F7A A;  3K01 A;  4U1Z A;  5CMK A;  3E3K A;  2UYE A;  3R7X A;  3UK4 A;  1J1N A;  3PPR A;  1NH8 A;  2RC9 A;  1BKA A;  2VGQ A;  3KOS A;  3EHU A;  3DEL B;  2DE3 A;  1FQD A;  4WXJ A;  2B3B A;  4P0G A;  4R2B A;  4ESW A;  2RCB A;  3IR1 A;  1FTM A;  4NWC A;  4RY1 A;  2QRY A;  1Q35 A;  3TQL A;  3U1O A;  2QPQ A;  2NUV A;  2XXW A;  1NFT A;  3OEK A;  4GL8 A;  1WDN A;  5A5X A;  1MS7 A;  5H8F A;  1FQA A;  4LVQ A;  3GLB A;  2DVC A;  1B3F A;  3KSX A;  1GGG A;  4ZZA A;  4X1D A;  1PB8 A;  2XXY A;  4BDR A;  5DVF A;  4GQO A;  3TPA A;  3ODB A;  5H8H A;  2I6E A;  2IA4 A;  3IOW A;  1HSJ A;  1USY E;  1FW0 A;  4DE8 A;  4JB7 A;  4GIZ A;  5M2V A;  3KJ7 A;  1FQC A;  4AB5 A;  2O69 A;  5LOM A;  3QXM A;  3TTL A;  1LBC A;  3IJO B;  4ECF A;  2F5X A;  2XXQ A;  3MZB A;  4OVJ A;  3TQW A;  4RK2 A;  1EZO A;  3OEN A;  3M3K A;  2HEU A;  3FGS A;  1IIT A;  1VSO A;  2THI A;  3ZS6 A;  4EQ9 A;  5EHS A;  4O3C A;  1URG A;  1JVX A;  2HFB A;  3TTM A;  1B3G A;  2HAU A;  5H8Q A;  4WED A;  4R6K A;  3C31 A;  4E0W A;  1SI0 A;  2WKY A;  4JSD A;  1SI1 A;  3RT6 B;  3TAJ A;  4H8I A;  2P0S A;  4R9F A;  3B7D A;  1D4N A;  4FIM A;  1MQJ A;  5I57 A;  2H99 A;  4Q5T A;  4NF6 A;  4OHN A;  4F19 A;  2F36 A;  4XKQ A;  4IO6 A;  2OCU A;  2XD2 A;  1XC1 A;  2I58 A;  2FA7 A;  3UN6 A;  3PUZ E;  4OXV A;  4DCX A;  3K0V A;  4YKP A;  2DQV A;  3D4C A;  1PBP A;  4G77 A;  4ONY A;  5AA2 D;  1Y3N A;  3A09 A;  1XS5 A;  2ESN A;  5B70 A;  1NNP A;  3S2V A;  1KWH A;  2W7Y A;  1Y20 A;  2QL3 A;  3T96 B;  3Q25 A;  2QS3 A;  3G3H A;  4BDO A;  1Y9U A;  2RKM A;  1OLA A;  4KFQ A;  1LAG E;  4HCW A;  5H8S A;  2IEE A;  1N04 A;  3TTR A;  1VE4 A;  4FE8 A;  3SEV A;  4PFU A;  3UOR A;  2ONR A;  4PFY A;  3K2D A;  4EXK A;  4YB5 A;  2RC8 A;  3EHT A;  3HST A;  3RPW A;  3QAX A;  4R9G A;  3K02 A;  4WKM A;  5DTB A;  3S9N C;  2I0C A;  4OER A;  2DE2 A;  2GFE A;  1P1Q A;  3G3G A;  4XKP A;  2H25 A;  4ZED A;  1JQF A;  3SEW A;  2OWS A;  3EQ1 A;  3IO4 A;  2E0S A;  1NKX A;  4U22 A;  4PFW A;  2O51 A;  2O7U A;  4EQB A;  4G68 C;  3K00 A;  1BTJ A;  1GV8 A;  4P0I A;  1GVC A;  1EZP A;  3EN3 A;  3CG1 A;  1DSN A;  4LZ8 A;  5ICT A;  4ND9 A;  4OMB A;  3U72 A;  2REG A;  4F3B A;  5HM4 B;  1JEV A;  1OLC A;  1R9L A;  2UVJ A;  1A54 A;  3SET A;  2F8D A;  4LUB A;  1ZJL A;  1XHY A;  1DPP A;  4KCD A;  4X9T A;  1UIU A;  1F9B A;  2DE4 A;  3RTW B;  1BIY A;  3TEP A;  2AYS A;  1UTH B;  2F7B A;  4QRZ A;  3HCQ A;  1MRP A;  1B3L A;  2DWA A;  1JNF A;  3VVD A;  2B3F A;  1S9T A;  4ZE9 A;  5KZT A;  5KCJ B;  5K2Y A;  1FQE A;  4YMB A;  2UVH A;  4XTC Q;  2Q9T A;  2ZYM A;  2D5W A;  4LQ2 A;  3W15 C;  1UTB B;  4I1D A;  4KD5 A;  4R75 A;  5J1D A;  1ATG A;  1H45 A;  3FVN A;  4NF4 A;  5DT6 A;  3MJN A;  3TCH A;  2UYF A;  3VXB A;  3EF7 A;  2XXX A;  4I9D A;  3IOU A;  2YLN A;  3QK6 A;  4KYD A;  3DP4 A;  4HS7 A;  2DVZ A;  3GBA A;  3ZSF A;  3TZA A;  3MWB A;  5BWJ A;  4HW8 A;  4RNS A;  4G68 A;  3GXA A;  3K1P A;  3E13 X;  3MC2 A;  1LB9 A;  3RT8 A;  2DWH A;  4M1V A;  1IUD A;  3MQ9 A;  5B7D A;  2RF1 A;  4IO3 A;  3T9U A;  3TMG A;  5CC2 A;  1OMP A;  2XXT A;  4AB6 A;  3CSB A;  2RIN A;  3ZKL A;  4OFL A;  1ZU0 A;  3RTF B;  2PX1 A;  2PYY A;  1AIV A;  4RXL A;  4IO4 A;  1GR2 A;  1ZMG A;  3RGY A;  3IOR A;  4RPN A;  1FTL A;  1Q1K A;  1M5C A;  2V3U A;  4YKI A;  3TOD A;  3V5A A;  3ILT B;  1LFH A;  1POT A;  4IY6 A;  1II5 A;  4N07 A;  2ZYN A;  2I4B A;  3TDJ A;  4IGT A;  2H98 A;  2ZNT A;  1H44 A;  4FEC A;  3PMX A;  1XOC A;  1B40 A;  4EUO A;  3PGF A;  3KZG A;  4OET A;  2G29 A;  2QS1 A;  4JDF A;  4KI0 E;  3O29 A;  3RN8 A;  4NED A;  3CIJ A;  3PD9 A;  3T9X B;  2ANJ A;  4QHQ A;  3O6G A;  1N0T A;  2UVI A;  2Y7K A;  4DIG A;  4DXB A;  3O97 A;  5I59 B;  3DLN A;  1B7Z A;  3C32 A;  4L17 A;  3K6U A;  4OEU A;  4PFT A;  5TPA B;  4EDP A;  2OJT A;  3TUS A;  4NF8 B;  2DP8 A;  4O3B A;  1B51 A;  3VVF A;  4GXS B;  3OEM A;  1MQI A;  4X1B A;  4O3A A;  5TP9 A;  5KDT A;  5JTY A;  2X7P A;  3KJT A;  2LAO A;  1SW2 A;  3MP8 A;  4C0R A;  5CI5 A;  1JW4 A;  4ELQ A;  2H9B A;  3LUY A;  4GF8 A;  3MZ1 A;  5ISU A;  4F3S A;  1B3E A;  5DEX A;  2F78 A;  5I2N B;  3IL1 B;  3FXU A;  4TQU Q;  3MAM A;  4OFO A;  3ILU B;  3OO7 A;  1QVS A;  5F1Q A;  3DM0 A;  4POW A;  2GHA A;  2REJ A;  3TEL A;  1EH3 A;  1MY1 A;  3RQT A;  5FTI A;  2V84 A;  2Y84 A;  4R2F A;  3LSX A;  4XKR A;  4LQ5 A;  4WEP A;  3S9L C;  3KG2 A;  3G3I A;  1HSL A;  3K6X A;  4ISU A;  2A5T B;  4Z7E A;  2Y7I A;  3BBR A;  3PD8 A;  2X26 A;  3T9V A;  2DOJ A;  4EF2 A;  4RA1 A;  2KLF A;  4FAT A;  3OO9 A;  3TCG A;  1MXZ A;  2UXA A;  1HSE A;  5AA4 B;  1NL5 A;  1B2H A;  2O7I A;  3H6U A;  3HPI A;  3VXC A;  3MVX A;  4U21 A;  1B9J A;  3LR1 A;  5AA2 A;  3IK6 B;  5I58 A;  4QFK A;  3VE1 B;  3VDF A;  4N6P A;  2HCA A;  4EXL A;  4IB2 A;  3R6U A;  1IIW A;  2PVU A;  5DYH A;  4DZ1 A;  3HO7 A;  1XVY A;  1AH5 A;  4R6Y A;  1IXG A;  1BLF A;  2O68 A;  3JZJ A;  3V89 B;  1B3H A;  2Y7R A;  3SDF A;  2HAV A;  1LAX A;  4QF9 A;  2O6A A;  2CZL A;  4K3F A;  2NOO A;  3PPN A;  3RUM A;  4X48 A;  4LAT A;  1AMF A;  3SKP A;  3FVK A;  3Q27 A;  4QSC A;  5FHM A;  4YZZ A;  4ZEK A;  1SYI A;  3QYT A;  1XT8 A;  4ESX A;  2E1S A;  2I3W A;  3FVG A;  3ONM A;  4R73 A;  5ITO A;  4YIC A;  2QMX A;  3OSR A;  4UAC A;  2F7C A;  3FIR A;  3Q26 A;  5CBR A;  4P11 A;  3FAS A;  1TFA A;  1H3D A;  1MXV A;  4NMY A;  5H8N B;  3MP1 A;  1B4Z A;  1R9Q A;  3T66 A;  3IB1 A;  2XXP A;  3K6V A;  3L6H A;  1B46 A;  5I2K B;  4PP0 A;  3SEU A;  1B6H A;  1PB7 A;  2Z22 A;  1FTJ A;  3FVO A;  4NWD A;  3KN8 A;  4FOR A;  4THI A;  1MM6 A;  4MH5 A;  2VD2 A;  3VV5 A;  1B5J A;  3G3K A;  3TYH A;  4Q0C A;  2P2A A;  4I62 A;  3FJG A;  3OMB A;  5CM6 A;  2VP1 A;  4XIG Q;  5CMC A;  3H6T A;  4IO7 A;  4FJP A;  1JW5 A;  1N3W A;  5EHM A;  4HTG A;  2R6G E;  4NF5 B;  2V3Q A;  1D3K A;  3K4U A;  1Y4C A;  2Q89 A;  1N7X A;  1NMU A;  3TTK A;  4F39 A;  4YB7 A;  3M8U A;  1Y1Z A;  1VFD A;  5IAI A;  3T22 A;  3U93 A;  3BFU A;  4ZE8 A;  5CRY A;  3C4M A;  4BDM A;  1P1N A;  1Z7M E;  1IEJ A;  5I56 B;  2V93 A;  4G2Z A;  5L9M A;  2GHB A;  3B6Q A;  1MY0 A;  4KCC A;  4RPO A;  1DOT A;  3VFJ A;  1MQH A;  1SYH A;  4ZS9 A;  3VLU A;  4E0X A;  1NNK A;  4U4X A;  2VHA A;  1M5D A;  1MPD A;  3MBP A;  3CFL A;  4JWO A;  3L6G A;  2HZK A;  3FUZ A;  2PBW A;  1B7U A;  1CE2 A;  4C1U A;  3O6H A;  1XVX A;  2YJP A;  4OZ9 A;  3OO6 A;  2F97 A;  3LSW A;  1LGB C;  1RYO A;  2XX7 A;  4R74 A;  2DXR A;  1N3X A;  1MXU A;  4IGR A;  1A7L A;  2UVG A;  3MW0 A;  3H3G A;  4DLD A;  3EPE A;  2XHD A;  3M3F A;  3MVW A;  4IY5 A;  3CFZ A;  1A8F A;  5H8N A;  1OIB A;  4UA8 A;  4KQP A;  4OES A;  2PMS A;  1URS A;  3FV2 A;  1EU8 A;  1B4H A;  3KBR A;  3MVZ A;  4I8C A;  5L9O A;  4YKJ A;  1LB8 A;  3M3L A;  1DTG A;  3IOT A;  2I49 A;  1JEU A;  1OQH A;  3IOV A;  4H67 A;  1B0H A;  2ONS A;  1I6B A;  2ZYK A;  4NF5 A;  3U92 A;  3WAE A;  1BP5 A;  2NVU B;  3V8X B;  5DVI A;  4IO2 A;  4JBZ A;  4DCY A;  2DYX A;  3TKD A;  1UIV A;  5F7V A;  1Y3Q A;  1POY 1;  1P1O A;  4BDL A;  4KYS A;  2D21 A;  2A5S A;  3KN7 A;  1RKM A;  5AA3 A;  1MDQ A;  4C1T A;  5I84 A;  5CMB A;  5DVJ A;  3KFM A;  2XX9 A;  3U94 A;  1MH3 A;  2AL4 A;  5ICQ A;  1YAE A;  3I6V A;  1NH7 A;  3N6U A;  3OOA A;  1SW5 A;  4YB6 A;  4OEN A;  2H5Y A;  1N7W A;  3H7M A;  1TT1 A;  3B6W A;  1YPN A;  4H0W A;  1LAF E;  1T0K A;  4G8H A;  3R26 A;  1B1H A;  1IXC A;  3IO6 A;  5CMM A;  1FTO A;  1IXI A;  4OQO A;  5IKB A;  3G7W A;  3IB2 A;  4RK9 A;  1ZKB A;  4YKK A;  4LZ5 A;  3GBB A;  1I69 A;  4M4G A;  4N13 A;  3ECR A;  4PE5 B;  2I0B A;  3HN0 A;  3AXF A;  4ZZE A;  2YPN A;  1PBQ A;  1O7T A;  3GZG A;  3FJM A;  1MY3 A;  1MPB A;  1UTH A;  1B5H A;  2ZNU A;  3EHS A;  4GVO A;  4F2O A;  3T93 B;  1Y4T A;  3UP9 A;  5KCJ A;  2ALU A;  3QUF A;  3F11 A;  1YCJ A;  5A5X B;  3CI8 A;  5FHO A;  4NE4 A;  5H8F B;  1UTB A;  4PET A;  4GL0 A;  5HPQ A;  3PMV A;  3TCF A;  3FZV A;  3RLF E;  3OD7 A;  2XXI A;  3QUJ A;  1OVT A;  4G4P A;  3FV1 A;  5H8H B;  3JV9 A;  3OXN A;  5JEI A;  3UIF A;  3PU5 A;  3H6V A;  3H6W A;  1PDA A;  3PUY E;  4F3G A;  2GH9 A;  1A99 A;  3N26 A;  1L5T A;  1S7Y A;  4JWY A;  3G3F A;  4OEV A;  1MXX A;  5BUU A;  3S4U A;  3KSJ A;  4TLL B;  4FEB A;  2Q88 A;  4ELP A;  4GD5 A;  3N5L A;  3E4R A;  1LBB A;  1NNT A;  3S9M C;  3HV1 A;  3FD3 A;  1LFG A;  4U2R A;  4OYV A;  5H8Q B;  2QS4 A;  4EQ7 A;  3WAF A;  3N94 A;  2P1S A;  1D9V A;  2V3T A;  1B1X A;  2Z8E A;  1ELJ A;  3A3C A;  3MP6 A;  2Q2C A;  5I57 B;  5L8D A;  4ZEC A;  4NF6 B;  3C34 A; 
#chains in the Genus database with same CATH topology
 4H46 A;  5IM2 A;  3PUV E;  4GLI A;  2XXU A;  2I48 A;  1SW4 A;  5L9S A;  2F35 A;  1LST A;  4JSO A;  4H5F A;  4KYE A;  4RJZ A;  2OK2 A;  1ZLQ A;  4LP2 B;  1NUX A;  2R9J A;  4R72 A;  4TOZ A;  4F29 A;  2FYI A;  2OBG A;  3UA8 A;  1SBP A;  4F1U A;  1AL3 A;  1QKB A;  2QJE A;  3LUZ A;  3RPL B;  1GTK A;  2PT1 A;  4QFN A;  1H43 A;  1FRP A;  2QS2 A;  3QSL A;  1MXW A;  2XXK A;  1VR5 A;  3SES A;  1Y3P A;  5EQA A;  1SW1 A;  1OVB A;  1P99 A;  2F6P A;  5I59 A;  1LBY A;  3P7I A;  2DXY A;  1ZBM A;  3O66 A;  2RCA A;  3MPK A;  2QSX A;  2RC7 A;  5TPA A;  1A55 A;  4NF8 A;  1MH4 A;  2AL5 A;  4N8G A;  2DS9 A;  2Q8M A;  2GRV A;  1MDP 1;  3IAZ A;  1NV0 A;  1B0L A;  1PC3 A;  3H06 B;  2CZK A;  2O1L A;  3QIM A;  2B65 A;  3LC8 A;  3KOT A;  3C33 A;  1FBD A;  1PB9 A;  1FJ6 A;  1EZ9 A;  2QMW A;  4F2Q A;  3MST A;  1QW0 A;  2OLB A;  4XXU A;  2VD3 A;  2XX8 A;  2DSF A;  3LSL A;  1QJM A;  1YTV A;  3VVE A;  5CBS A;  1I6Q A;  1B32 A;  5I2N A;  1DPE A;  2B4L A;  3DP6 A;  3VLV A;  3C9H A;  3USD A;  2DWJ A;  5EQ7 A;  5I7I A;  4OWD A;  1O63 A;  3CR9 A;  5DW8 A;  2QVU A;  1M5F A;  2JJK A;  4BLA A;  4LZ7 A;  5ET6 A;  1RYX A;  2ZMB A;  4Z0I A;  4H65 A;  4TLM B;  4GWY A;  5AE4 A;  4F1Y A;  4PFB A;  2ZYO A;  3HHG A;  5EYG A;  4FED A;  4ZEI A;  2Z8D A;  5ITP A;  2HZL A;  2DWI A;  1FQB A;  1D9Y A;  1ANF A;  3IB0 A;  3PPQ A;  1K9Y A;  2QVV A;  2A5T A;  4LON B;  1JVY A;  1Q9D A;  3Q29 A;  4YU0 A;  5HBC A;  4GOT A;  4IO5 A;  1TFD A;  1FBC A;  4OTE A;  4O7M A;  3I5O A;  3OSQ A;  4LN5 A;  4RYA A;  1G0H A;  1FTK A;  2H4I A;  3C35 A;  5AA4 A;  2ZXT A;  3MPL A;  4DXC A;  4GFR A;  2I4C A;  4PGP A;  4F22 A;  4ELO A;  1FSA A;  4NF4 B;  2XXR A;  3UGW A;  1QUJ A;  5EYF A;  1FBH A;  3E9X A;  3K1N A;  5EQ8 A;  3B6T A;  1MG1 A;  1VFE A;  3RY3 A;  2XD3 A;  1SQY A;  1FQF A;  4ZEB A;  4G68 B;  4DDD A;  1AOV A;  1WOD A;  3C36 A;  4JVC A;  3MUQ A;  5T3J A;  3LBS A;  3LSF B;  3BFT A;  1B52 A;  3IJX B;  4F1V A;  3RNN A;  1MM7 A;  1LLS A;  3KEI A;  4H5G A;  1SVX B;  3SER A;  3TFL A;  3JYR A;  1MY4 A;  1NV3 A;  2PCR A;  4YAH X;  4MFI A;  3PV0 E;  2BJJ X;  2D3I A;  3H4Z A;  4GWZ A;  4F18 A;  4MF3 A;  4GWS A;  1R6Z A;  2Z23 A;  4JVD A;  2XXV A;  4ELR A;  1A40 A;  4Q8R A;  3OO8 A;  4FAJ A;  2ZZW A;  4QFO A;  2Q2A A;  2HXR A;  2NWJ A;  5ET5 A;  3SEX A;  3D4G A;  2VPN A;  1EYJ A;  3PPP A;  2CMO A;  2OZZ A;  2ABH A;  2V25 A;  4XF5 A;  1QKA A;  5I2K A;  4PAK A;  1JW1 A;  1QUK A;  1P1U A;  1O64 A;  2X7Q A;  1CB6 A;  3PUW E;  2HXW A;  1MQD A;  4PQJ A;  3W9V A;  1SDX A;  2XWV A;  2F6G A;  3U8Q A;  4QSD A;  2DDK A;  1IMA A;  1I6A A;  1N84 A;  2R71 A;  1ZTY A;  4U23 A;  1WVJ A;  3V83 A;  3S9E A;  2ZNS A;  1FBF A;  3O9P A;  2O84 X;  3BIH A;  4H6D A;  3FJ7 A;  1LFI A;  1LCF A;  2BJI A;  5TU0 A;  4PTK A;  3PUX E;  3K1M A;  1M5B A;  1FPK A;  3CVG A;  1B05 A;  4MEV A;  1FPD A;  4P1L A;  4QFP A;  4KR5 A;  4PF8 A;  4R6H A;  4U1O A;  4Q30 B;  5K2X A;  5I56 A;  1IZ1 A;  1RDY A;  3O6I A;  3SZP A;  1S50 A;  1MXY A;  4F3P A;  4BDN A;  1JET A;  4KHZ E;  3FXR A;  5ELV A;  4MBP A;  3CG3 A;  4POX A;  5TP9 B;  1B58 A;  5KDT B;  5JTY B;  4MLQ A;  2AIX A;  3KGC A;  2Y7P A;  4H1X A;  3BKI B;  4HE0 A;  5FTH A;  4JWX A;  1YXI A;  2HQ0 A;  1US4 A;  3TTN A;  4HCY A;  4N17 A;  4XKN A;  1N76 A;  3O28 A;  2FNC A;  4GWO A;  2O1M A;  1TWY A;  3H03 A;  4UAB A;  2WEF A;  5DEX B;  1P1W A;  1FPG A;  3K6W A;  1USY H;  4PBQ A;  1NUY A;  1LBV A;  1QUL A;  3HHF A;  4JXI A;  1UQW A;  2G93 A;  4LA9 A;  1LAH E;  2F34 A;  4OA4 A;  4BDQ A;  4OVQ A;  3FXQ A;  2PT2 A;  3MVY A;  4YMA A;  4F31 B;  1MPC A;  4I3E A;  4OFJ A;  4G8M A;  4MLV A;  4QFL A;  4AQ4 A;  1BK4 A;  3PPO A;  2V4C A;  4EF1 A;  1Z7N E;  3N6T A;  1K9Z A;  4MNP A;  4GXA A;  4PDH A;  3I3V A;  1FCK A;  3FAT A;  1NNF A;  3G3J A;  2I3V A;  4KPT A;  3KN3 A;  4IR8 A;  1IQ7 A;  4QSE A;  1NUZ A;  2F3B A;  4H8J A;  4GRK A;  5AA1 A;  3CRB A;  3W9W A;  3CSG A;  4QXD A;  1LCT A;  2M8C A;  1M5E A;  2Q8J A;  2Z8F A;  3DP8 A;  1FBE A;  4OVT A;  3D1R A;  3IFC A;  3THI A;  1QUI A;  3A3U A;  4MIJ A;  3ZKK A;  5AA2 B;  2NXO A;  4NTL A;  5IGA A;  5I58 B;  1KA0 A;  1DTZ A;  4U4S A;  1OQG A;  1DBZ A;  1US5 A;  3T9H B;  1DMB A;  1R1N A;  1H76 A;  4ZEF A;  2XXH A;  3O2A A;  1PEB A;  3Q28 A;  3MZ9 A;  4G8N A;  1IXH A;  5J16 A;  1URD A;  1TXF A;  4O94 A;  1A8E A;  1Y1M A;  2ONK E;  3SEY A;  3NOH A;  3CFX A;  1MY2 A;  2Y7W A;  1SD3 A;  3PMW A;  2VOZ A;  4PBH A;  3VLW A;  1B5I A;  3OEL A;  4NHB A;  1MQG A;  1ZIU A;  4DXU A;  4ZDM A;  2OWT A;  3IX1 A;  1B7H A;  2QVR A;  5FHN A;  5JK4 A;  2F7A A;  3K01 A;  3EKI A;  4U1Z A;  5CMK A;  3E3K A;  2UYE A;  2Y5K A;  3R7X A;  3UK4 A;  1J1N A;  3PPR A;  1NH8 A;  2RC9 A;  1BKA A;  2VGQ A;  3KOS A;  3EHU A;  4OVP A;  3DEL B;  2DE3 A;  2P3V A;  1FQD A;  4WXJ A;  2B3B A;  4P0G A;  4R2B A;  4ESW A;  2RCB A;  3IR1 A;  1FTM A;  4MNC A;  5F24 A;  4NWC A;  4RY1 A;  2QRY A;  1Q35 A;  3TQL A;  3U1O A;  2QPQ A;  2NUV A;  2XXW A;  1NFT A;  2L5V A;  4GX4 A;  3OEK A;  2ZZV A;  4GL8 A;  1WDN A;  5IZ3 A;  5A5X A;  3KC1 A;  1MS7 A;  5H8F A;  1FQA A;  1FPL A;  3GLB A;  4LVQ A;  2DVC A;  1B3F A;  3KSX A;  4OAN A;  1GGG A;  4ZZA A;  2OWZ A;  4DI4 B;  4X1D A;  2CZH A;  1PB8 A;  2XXY A;  2CZI A;  4BDR A;  5DVF A;  4GQO A;  3TPA A;  3ODB A;  5H8H A;  1AWB A;  4NX1 A;  2I6E A;  2IA4 A;  5ET8 A;  1IMF A;  3IOW A;  1HSJ A;  1USY E;  1FW0 A;  4DE8 A;  4JB7 A;  4GIZ A;  5M2V A;  1NV6 A;  3KJ7 A;  1FQC A;  4AB5 A;  2O69 A;  5LOM A;  3QXM A;  3TTL A;  3B50 A;  1LBC A;  3IJO B;  4ECF A;  2F5X A;  2XXQ A;  3MZB A;  4OVJ A;  3TQW A;  4N91 A;  4RK2 A;  4GBV A;  1EZO A;  3OEN A;  3M3K A;  2HEU A;  3FGS A;  4HE2 A;  1IIT A;  1VSO A;  2THI A;  2WYK A;  3ZS6 A;  4EQ9 A;  5EHS A;  1FBG A;  4O3C A;  1URG A;  1JVX A;  2HFB A;  1NV2 A;  4PCD A;  3TTM A;  1B3G A;  2HAU A;  5H8Q A;  4WED A;  4R6K A;  4N6K A;  3QMF A;  3C31 A;  4E0W A;  1SI0 A;  5LTC A;  2WKY A;  4JSD A;  1SI1 A;  3RT6 B;  3TAJ A;  4H8I A;  2P0S A;  4R9F A;  3B7D A;  1D4N A;  4FIM A;  4MJO A;  1MQJ A;  5I57 A;  2H99 A;  4Q5T A;  4NF6 A;  4OHN A;  4F19 A;  2F36 A;  4XKQ A;  1NUW A;  4IO6 A;  3HFU A;  2OCU A;  2XD2 A;  1XC1 A;  2I58 A;  4GBW A;  1QGX A;  2FA7 A;  3UN6 A;  1LBZ A;  3PUZ E;  4OXV A;  2CEY A;  4DCX A;  2XWO A;  3K0V A;  4YKP A;  2DQV A;  3D4C A;  1PBP A;  4G77 A;  4ONY A;  5AA2 D;  1Y3N A;  4NQ8 A;  3A09 A;  1XS5 A;  2ESN A;  4X8R A;  5B70 A;  1NNP A;  3S2V A;  1KWH A;  3LV0 A;  2W7Y A;  3RPL A;  1Y20 A;  2QL3 A;  4GWX A;  3T96 B;  3Q25 A;  2QS3 A;  3G3H A;  4BDO A;  4NAP A;  1Y9U A;  2RKM A;  1OLA A;  4KFQ A;  1LAG E;  4HCW A;  5H8S A;  5FBP A;  2IEE A;  1N04 A;  3TTR A;  1VE4 A;  4FE8 A;  3SEV A;  4PFU A;  3UOR A;  2ONR A;  4PFY A;  4NG7 A;  3K2D A;  4EXK A;  4YB5 A;  2RC8 A;  3EHT A;  3HST A;  3RPW A;  3QAX A;  4R9G A;  3K02 A;  4WKM A;  5DTB A;  3S9N C;  2I0C A;  4OER A;  2DE2 A;  2GFE A;  1P1Q A;  3G3G A;  2KR0 A;  4XKP A;  2H25 A;  4ZED A;  1JQF A;  3SEW A;  4NF0 A;  2OWS A;  3EQ1 A;  4N81 A;  3IO4 A;  1IME A;  2E0S A;  1NKX A;  4U22 A;  2FHY A;  4PFW A;  2O51 A;  4GWU A;  2O7U A;  4EQB A;  4G68 C;  3K00 A;  1BTJ A;  3U65 A;  1GV8 A;  4P0I A;  1GVC A;  3FXB A;  1EZP A;  1DCU A;  3EN3 A;  3CG1 A;  1DSN A;  4LZ8 A;  5ICT A;  4ND9 A;  4OMB A;  3U72 A;  2REG A;  4F3B A;  5HM4 B;  1JEV A;  1OLC A;  1R9L A;  2UVJ A;  1A54 A;  3SET A;  2F8D A;  4LUB A;  1ZJL A;  1XHY A;  1DPP A;  4KCD A;  4X9T A;  1UIU A;  2XA5 A;  1F9B A;  1KZ8 A;  2DE4 A;  3RTW B;  1BIY A;  3TEP A;  1YZ0 A;  2VPO A;  2AYS A;  1UTH B;  2F7B A;  4QRZ A;  3HCQ A;  1MRP A;  1B3L A;  2DWA A;  1JNF A;  3VVD A;  2B3F A;  1S9T A;  2HPG A;  4ZE9 A;  4HE1 A;  5KZT A;  4MX6 A;  4MMP A;  5KCJ B;  5K2Y A;  1FQE A;  4YMB A;  2UVH A;  4XTC Q;  2Q9T A;  2ZYM A;  2D5W A;  4LQ2 A;  3W15 C;  1UTB B;  4I1D A;  4KD5 A;  4R75 A;  1INP A;  5J1D A;  1ATG A;  1H45 A;  3FVN A;  4NF4 A;  3E78 A;  5DT6 A;  3MJN A;  3TCH A;  2UYF A;  3VXB A;  3EF7 A;  1SPI A;  2XXX A;  4I9D A;  3IOU A;  2YLN A;  3QK6 A;  4KYD A;  3DP4 A;  4MNI A;  4HS7 A;  2DVZ A;  4PC9 A;  3GBA A;  4P8B A;  3ZSF A;  3TZA A;  3IFA A;  3MWB A;  5BWJ A;  4HW8 A;  4RNS A;  4G68 A;  3GXA A;  3K1P A;  4N4U A;  3E13 X;  3MC2 A;  1LB9 A;  1FJ9 A;  3RT8 A;  2DWH A;  4M1V A;  1IUD A;  3MQ9 A;  5B7D A;  2RF1 A;  4IO3 A;  3T9U A;  3TMG A;  5CC2 A;  1OMP A;  2XXT A;  4AB6 A;  3CSB A;  5EYH A;  2RIN A;  3ZKL A;  4OFL A;  1ZU0 A;  3RTF B;  2PX1 A;  2PYY A;  4GX6 A;  1AIV A;  4RXL A;  4IO4 A;  1GR2 A;  1ZMG A;  3RGY A;  3IOR A;  4RPN A;  1FTL A;  5IZ1 A;  1Q1K A;  1M5C A;  2V3U A;  2OX3 A;  4YKI A;  2GQ1 A;  3TOD A;  3V5A A;  4P47 A;  1CNQ A;  3ILT B;  1LFH A;  1POT A;  4IY6 A;  3T1B A;  2HHM A;  1II5 A;  4N07 A;  4PF6 A;  2ZYN A;  2I4B A;  3TDJ A;  4IGT A;  2H98 A;  2ZNT A;  4I40 A;  1LBX A;  1H44 A;  4FEC A;  3PMX A;  1XOC A;  1B40 A;  2Y5L A;  4EUO A;  3PGF A;  3KZG A;  4OET A;  5ET7 A;  2G29 A;  2QS1 A;  4JDF A;  4KI0 E;  3O29 A;  3RN8 A;  4NED A;  3CIJ A;  3PD9 A;  3T9X B;  2ANJ A;  4QHQ A;  3O6G A;  2FVZ A;  1N0T A;  2UVI A;  2Y7K A;  4DIG A;  4DXB A;  1IMC A;  3O97 A;  4DI3 D;  3DLN A;  5I59 B;  1B7Z A;  3C32 A;  4L17 A;  3K6U A;  4OEU A;  3RYD A;  4PFT A;  5TPA B;  4EDP A;  5I3S A;  2OJT A;  3TUS A;  4NF8 B;  2DP8 A;  4O3B A;  1B51 A;  1NV1 A;  3VVF A;  4GXS B;  3OEM A;  4XEQ A;  1LBW A;  1MQI A;  4X1B A;  4O3A A;  5TP9 A;  5KDT A;  5JTY A;  2X7P A;  4PGN A;  3KJT A;  4FBP A;  2LAO A;  1SW2 A;  1YYZ A;  3MP8 A;  4C0R A;  5CI5 A;  5A5L A;  1JW4 A;  4ELQ A;  4PE3 A;  2H9B A;  4N15 A;  4P9K A;  4G61 A;  3LUY A;  4GF8 A;  3MZ1 A;  5ISU A;  1EYI A;  4F3S A;  1B3E A;  5DEX A;  2F78 A;  4PAF A;  5I2N B;  3IL1 B;  1D9Q A;  3FXU A;  4TQU Q;  3MAM A;  4PFI A;  4OFO A;  3ILU B;  3OO7 A;  1QVS A;  5F1Q A;  2FBP A;  3DM0 A;  4POW A;  2GHA A;  2REJ A;  1NV5 A;  4JVI A;  3TEL A;  1EH3 A;  4GX3 A;  1MY1 A;  3RQT A;  2WBB A;  5FTI A;  2V84 A;  2Y84 A;  4R2F A;  3LSX A;  4XKR A;  4LQ5 A;  4WEP A;  3S9L C;  3KG2 A;  3G3I A;  1HSL A;  3K6X A;  2PFY A;  4ISU A;  3KC0 A;  2B4M A;  2A5T B;  4Z7E A;  2Y7I A;  3BBR A;  3PD8 A;  1LEV A;  2X26 A;  3T9V A;  4AS5 A;  2DOJ A;  4EF2 A;  3PTY A;  4RA1 A;  2KLF A;  4FAT A;  3OO9 A;  3TCG A;  1MXZ A;  2UXA A;  1HSE A;  4P56 A;  5AA4 B;  1NL5 A;  4X04 A;  1B2H A;  2O7I A;  3H6U A;  3HPI A;  3VXC A;  3MVX A;  4U21 A;  1B9J A;  3LR1 A;  5AA2 A;  5I5P A;  3IK6 B;  5I58 A;  4QFK A;  3VE1 B;  3VDF A;  4N6P A;  2HCA A;  4EXL A;  4IB2 A;  2WX9 A;  2R8T A;  3R6U A;  4O8M A;  1IIW A;  2PVU A;  5DYH A;  4DZ1 A;  3HO7 A;  1AH5 A;  1XVY A;  4R6Y A;  2CEX A;  1IXG A;  1BLF A;  2O68 A;  3JZJ A;  3V89 B;  1B3H A;  1FPF A;  2Y7R A;  3SDF A;  4P1E A;  2HAV A;  1LAX A;  4QF9 A;  2O6A A;  4P3L A;  2CZL A;  4K3F A;  2NOO A;  3PPN A;  3RUM A;  4X48 A;  4LAT A;  1AMF A;  3SKP A;  3FVK A;  2FIX A;  3Q27 A;  4QSC A;  5FHM A;  4YZZ A;  4ZEK A;  1SYI A;  3QYT A;  1XT8 A;  4ESX A;  2E1S A;  2I3W A;  3FVG A;  3ONM A;  4R73 A;  5ITO A;  4YIC A;  2QMX A;  2Q74 A;  3OSR A;  4UAC A;  2F7C A;  3FIR A;  3Q26 A;  1NI9 A;  5CBR A;  4P11 A;  1IMD A;  2QFL A;  3FAS A;  1TFA A;  1H3D A;  1MXV A;  5EQ9 A;  1FPE A;  4NMY A;  5H8N B;  3MP1 A;  1B4Z A;  1R9Q A;  3T66 A;  3IB1 A;  2XXP A;  3K6V A;  3L6H A;  1B46 A;  5I2K B;  4PP0 A;  3SEU A;  1B6H A;  1PB7 A;  1FPI A;  2Z22 A;  1FTJ A;  3FVO A;  4NWD A;  3KN8 A;  4FOR A;  4OVS A;  4THI A;  1MM6 A;  4MH5 A;  2VD2 A;  3VV5 A;  1B5J A;  3G3K A;  3TYH A;  4Q0C A;  2P2A A;  4I62 A;  3FJG A;  3OMB A;  5CM6 A;  2VP1 A;  4XIG Q;  5CMC A;  3H6T A;  4IO7 A;  4FJP A;  1JW5 A;  1N3W A;  5EHM A;  4HTG A;  2R6G E;  3ROJ A;  4NF5 B;  2V3Q A;  1D3K A;  3K4U A;  1Y4C A;  2Q89 A;  1FBP A;  1N7X A;  1NMU A;  3TTK A;  4F39 A;  4YB7 A;  3M8U A;  1Y1Z A;  1VFD A;  5IAI A;  3T22 A;  2XWI A;  3U93 A;  3BFU A;  4ZE8 A;  5CRY A;  3C4M A;  4BDM A;  1P1N A;  1FTA A;  1Z7M E;  1IEJ A;  5I56 B;  2V93 A;  4G2Z A;  5L9M A;  2GHB A;  3B6Q A;  1MY0 A;  4KCC A;  4RPO A;  1DOT A;  4QBA A;  3VFJ A;  1MQH A;  1SYH A;  4ZS9 A;  3VLU A;  4E0X A;  4PFR A;  1NNK A;  4U4X A;  2VHA A;  1M5D A;  1MPD A;  3MBP A;  3CFL A;  1VDW A;  4JWO A;  3L6G A;  2VT5 A;  4HXV A;  2HZK A;  3FUZ A;  2PBW A;  1DK4 A;  1B7U A;  1CE2 A;  4C1U A;  3O6H A;  1XVX A;  4NN3 A;  2YJP A;  4OZ9 A;  3OO6 A;  4PDD A;  2F97 A;  3LSW A;  1LGB C;  1RYO A;  2XX7 A;  4R74 A;  2DXR A;  1N3X A;  1MXU A;  4IGR A;  1A7L A;  2ZZX A;  2UVG A;  3MW0 A;  3H3G A;  4DLD A;  3EPE A;  2XHD A;  3M3F A;  3MVW A;  4IY5 A;  3CFZ A;  1A8F A;  5H8N A;  4AS4 A;  1XI6 A;  1OIB A;  4UA8 A;  4KQP A;  4XFE A;  4OES A;  2PMS A;  1URS A;  3FV2 A;  4MAG A;  1EU8 A;  3KBZ A;  1B4H A;  3KBR A;  3MVZ A;  1KA1 A;  4I8C A;  5L9O A;  4YKJ A;  1LB8 A;  3M3L A;  4N6D A;  1DTG A;  3BIG A;  3IOT A;  5LDZ A;  2I49 A;  1JEU A;  1OQH A;  3IOV A;  4H67 A;  1B0H A;  2ONS A;  1I6B A;  2ZYK A;  4OVR A;  4NF5 A;  3U92 A;  3WAE A;  1BP5 A;  2NVU B;  3V8X B;  5DVI A;  4IO2 A;  4JBZ A;  3T0J A;  4DCY A;  2DYX A;  1FPJ A;  3TKD A;  2PFZ A;  1UIV A;  5F7V A;  1FPB A;  1Y3Q A;  4N8Y A;  2WYP A;  1POY 1;  1P1O A;  1RDX A;  4BDL A;  4KYS A;  2D21 A;  2A5S A;  3KN7 A;  1RKM A;  5AA3 A;  1MDQ A;  4C1T A;  5I84 A;  5CMB A;  5DVJ A;  3KFM A;  2XX9 A;  3U94 A;  4H45 A;  1MH3 A;  2AL4 A;  5ICQ A;  1YAE A;  3I6V A;  1NH7 A;  3N6U A;  3OOA A;  1SW5 A;  4YB6 A;  4OEN A;  2H5Y A;  1N7W A;  3H7M A;  1TT1 A;  3B6W A;  3ISP A;  1YPN A;  4H0W A;  1LAF E;  4MHF A;  5ESY A;  1T0K A;  4G8H A;  3R26 A;  1B1H A;  1IXC A;  3IO6 A;  5CMM A;  1IMB A;  1FTO A;  1IXI A;  4OQO A;  5IKB A;  3G7W A;  3IB2 A;  4RK9 A;  1ZKB A;  4YKK A;  4LZ5 A;  3GBB A;  1I69 A;  4M4G A;  4N13 A;  3ECR A;  4PE5 B;  2I0B A;  3HN0 A;  3AXF A;  4ZZE A;  2YPN A;  1PBQ A;  1O7T A;  3GZG A;  3FJM A;  4I3Y A;  1MY3 A;  1MPB A;  1UTH A;  1B5H A;  2ZNU A;  3EHS A;  2WBD A;  4GVO A;  4F2O A;  3T93 B;  1Y4T A;  3UP9 A;  5KCJ A;  2ALU A;  3QUF A;  3F11 A;  5IZ3 B;  1YCJ A;  5A5X B;  3CI8 A;  5FHO A;  4NE4 A;  5H8F B;  1UTB A;  4O7I A;  4PET A;  4GL0 A;  5HPQ A;  5IZZ A;  3PMV A;  3TCF A;  3FBP A;  4NGU A;  3FZV A;  3RLF E;  3OD7 A;  1NV4 A;  2XXI A;  3QUJ A;  1OVT A;  4G4P A;  3FV1 A;  5H8H B;  3JV9 A;  3OXN A;  5JEI A;  2F3D A;  1JP4 A;  3UIF A;  3PU5 A;  3H6V A;  3H6W A;  1PDA A;  3PUY E;  4F3G A;  3CHG A;  2GH9 A;  4JWY A;  1A99 A;  1S7Y A;  2KQZ A;  3N26 A;  1L5T A;  3G3F A;  4OEV A;  1MXX A;  1NV7 A;  5BUU A;  3S4U A;  3KSJ A;  4TLL B;  2MKZ A;  4FEB A;  2Q88 A;  4ELP A;  4GD5 A;  3N5L A;  3E4R A;  2XWK A;  1LBB A;  1NNT A;  4MCO A;  3S9M C;  2FIE A;  3HV1 A;  4KXP A;  3FD3 A;  1LFG A;  2P3N A;  4U2R A;  4OYV A;  1EYK A;  5H8Q B;  2QS4 A;  4GWW A;  4EQ7 A;  3WAF A;  3MYU A;  3E79 A;  3N94 A;  2P1S A;  1RDZ A;  3B8B A;  1D9V A;  2V3T A;  3A29 A;  1B1X A;  1G0I A;  1ELJ A;  2Z8E A;  4PAI A;  3A3C A;  3MP6 A;  2Q2C A;  5I57 B;  3GYY A;  5L8D A;  4ZEC A;  4NF6 B;  3C34 A; 
#chains in the Genus database with same CATH homology
 3PUV E;  4GLI A;  2XXU A;  2I48 A;  1SW4 A;  5L9S A;  2F35 A;  1LST A;  4JSO A;  4H5F A;  4KYE A;  4RJZ A;  2OK2 A;  1ZLQ A;  4LP2 B;  2R9J A;  4R72 A;  4TOZ A;  4F29 A;  2FYI A;  2OBG A;  3UA8 A;  1SBP A;  4F1U A;  1AL3 A;  1QKB A;  2QJE A;  1GTK A;  2PT1 A;  4QFN A;  1H43 A;  2QS2 A;  3QSL A;  1MXW A;  1VR5 A;  3SES A;  1Y3P A;  1SW1 A;  1OVB A;  1P99 A;  2F6P A;  5I59 A;  3P7I A;  2DXY A;  1ZBM A;  3O66 A;  2RCA A;  3MPK A;  2QSX A;  2RC7 A;  5TPA A;  1A55 A;  4NF8 A;  1MH4 A;  2AL5 A;  2DS9 A;  2GRV A;  1MDP 1;  3IAZ A;  1B0L A;  1PC3 A;  3H06 B;  2O1L A;  3QIM A;  2B65 A;  3LC8 A;  3KOT A;  3C33 A;  1PB9 A;  1EZ9 A;  2QMW A;  4F2Q A;  1QW0 A;  2OLB A;  4XXU A;  2VD3 A;  2XX8 A;  2DSF A;  3LSL A;  1YTV A;  1QJM A;  3VVE A;  5CBS A;  1I6Q A;  1B32 A;  5I2N A;  1DPE A;  3DP6 A;  3VLV A;  3C9H A;  3USD A;  2DWJ A;  4OWD A;  1O63 A;  3CR9 A;  1M5F A;  4BLA A;  4LZ7 A;  1RYX A;  2ZMB A;  4Z0I A;  4H65 A;  4TLM B;  5AE4 A;  4F1Y A;  2ZYO A;  3HHG A;  4FED A;  4ZEI A;  2Z8D A;  5ITP A;  2HZL A;  2DWI A;  1FQB A;  1D9Y A;  1ANF A;  3IB0 A;  3PPQ A;  2A5T A;  4LON B;  1JVY A;  3Q29 A;  4YU0 A;  5HBC A;  4GOT A;  4IO5 A;  1TFD A;  4OTE A;  3I5O A;  3OSQ A;  4RYA A;  1FTK A;  2H4I A;  3C35 A;  5AA4 A;  2ZXT A;  3MPL A;  4DXC A;  4GFR A;  2I4C A;  4F22 A;  4ELO A;  4NF4 B;  2XXR A;  3UGW A;  1QUJ A;  5EYF A;  3E9X A;  3K1N A;  3B6T A;  1MG1 A;  1VFE A;  3RY3 A;  2XD3 A;  1SQY A;  1FQF A;  4ZEB A;  4G68 B;  4DDD A;  1AOV A;  1WOD A;  3C36 A;  3MUQ A;  3LBS A;  3LSF B;  3BFT A;  1B52 A;  3IJX B;  4F1V A;  3RNN A;  1MM7 A;  1LLS A;  3KEI A;  4H5G A;  1SVX B;  3SER A;  3TFL A;  3JYR A;  1MY4 A;  4YAH X;  4MFI A;  3PV0 E;  2BJJ X;  2D3I A;  3H4Z A;  4F18 A;  4MF3 A;  1R6Z A;  2Z23 A;  2XXV A;  4ELR A;  1A40 A;  4Q8R A;  3OO8 A;  4FAJ A;  4QFO A;  2Q2A A;  2NWJ A;  3SEX A;  3D4G A;  3PPP A;  2CMO A;  2OZZ A;  2ABH A;  2V25 A;  1QKA A;  5I2K A;  1JW1 A;  1QUK A;  1P1U A;  1O64 A;  2X7Q A;  1CB6 A;  3PUW E;  2HXW A;  1MQD A;  4PQJ A;  3W9V A;  1SDX A;  2F6G A;  3U8Q A;  4QSD A;  1I6A A;  1N84 A;  2R71 A;  1ZTY A;  4U23 A;  1WVJ A;  3V83 A;  3S9E A;  2ZNS A;  3O9P A;  2O84 X;  4H6D A;  3FJ7 A;  1LFI A;  1LCF A;  5TU0 A;  3PUX E;  3K1M A;  1M5B A;  3CVG A;  1B05 A;  4QFP A;  4KR5 A;  4R6H A;  4U1O A;  4Q30 B;  5K2X A;  5I56 A;  1IZ1 A;  3O6I A;  1S50 A;  1MXY A;  4F3P A;  4BDN A;  1JET A;  4KHZ E;  3FXR A;  5ELV A;  4MBP A;  3CG3 A;  4POX A;  5TP9 B;  1B58 A;  5KDT B;  5JTY B;  4MLQ A;  2AIX A;  3KGC A;  2Y7P A;  4H1X A;  3BKI B;  5FTH A;  4JWX A;  2HQ0 A;  3TTN A;  1US4 A;  4HCY A;  4XKN A;  1N76 A;  3O28 A;  2FNC A;  4GWO A;  2O1M A;  1TWY A;  3H03 A;  5DEX B;  1P1W A;  3K6W A;  1USY H;  1QUL A;  3HHF A;  4JXI A;  1UQW A;  2G93 A;  4LA9 A;  1LAH E;  2F34 A;  4BDQ A;  3FXQ A;  2PT2 A;  3MVY A;  4YMA A;  4F31 B;  1MPC A;  4OFJ A;  4G8M A;  4MLV A;  4QFL A;  4AQ4 A;  3PPO A;  4EF1 A;  1Z7N E;  3N6T A;  4GXA A;  3I3V A;  1FCK A;  3FAT A;  1NNF A;  3G3J A;  2I3V A;  4KPT A;  3KN3 A;  1IQ7 A;  4QSE A;  4H8J A;  4GRK A;  5AA1 A;  3CRB A;  3W9W A;  3CSG A;  1LCT A;  2M8C A;  1M5E A;  2Q8J A;  2Z8F A;  3DP8 A;  3THI A;  1QUI A;  3A3U A;  3ZKK A;  5AA2 B;  2NXO A;  4NTL A;  5I58 B;  4U4S A;  1DTZ A;  1OQG A;  1US5 A;  3T9H B;  1DMB A;  1R1N A;  1H76 A;  4ZEF A;  2XXH A;  3O2A A;  1PEB A;  3Q28 A;  3MZ9 A;  4G8N A;  1IXH A;  1URD A;  1TXF A;  1Y1M A;  1A8E A;  2ONK E;  3SEY A;  3CFX A;  1MY2 A;  2Y7W A;  1SD3 A;  3PMW A;  2VOZ A;  3VLW A;  1B5I A;  3OEL A;  1MQG A;  1ZIU A;  4DXU A;  4ZDM A;  2OWT A;  3IX1 A;  1B7H A;  5FHN A;  5JK4 A;  2F7A A;  3K01 A;  4U1Z A;  5CMK A;  3E3K A;  2UYE A;  3R7X A;  3UK4 A;  1J1N A;  3PPR A;  1NH8 A;  2RC9 A;  1BKA A;  2VGQ A;  3KOS A;  3EHU A;  3DEL B;  2DE3 A;  1FQD A;  4WXJ A;  2B3B A;  4P0G A;  4R2B A;  4ESW A;  2RCB A;  3IR1 A;  1FTM A;  4NWC A;  4RY1 A;  2QRY A;  1Q35 A;  3TQL A;  3U1O A;  2QPQ A;  2NUV A;  2XXW A;  1NFT A;  3OEK A;  4GL8 A;  1WDN A;  5A5X A;  1MS7 A;  5H8F A;  1FQA A;  4LVQ A;  3GLB A;  2DVC A;  1B3F A;  3KSX A;  1GGG A;  4ZZA A;  4X1D A;  1PB8 A;  2XXY A;  4BDR A;  5DVF A;  4GQO A;  3TPA A;  3ODB A;  5H8H A;  2I6E A;  2IA4 A;  3IOW A;  1HSJ A;  1USY E;  1FW0 A;  4DE8 A;  4JB7 A;  4GIZ A;  5M2V A;  3KJ7 A;  1FQC A;  4AB5 A;  2O69 A;  5LOM A;  3QXM A;  3TTL A;  1LBC A;  3IJO B;  4ECF A;  2F5X A;  2XXQ A;  3MZB A;  4OVJ A;  3TQW A;  4RK2 A;  1EZO A;  3OEN A;  3M3K A;  2HEU A;  3FGS A;  1IIT A;  1VSO A;  2THI A;  3ZS6 A;  4EQ9 A;  5EHS A;  4O3C A;  1URG A;  1JVX A;  2HFB A;  3TTM A;  1B3G A;  2HAU A;  5H8Q A;  4WED A;  4R6K A;  3C31 A;  4E0W A;  1SI0 A;  2WKY A;  4JSD A;  1SI1 A;  3RT6 B;  3TAJ A;  4H8I A;  2P0S A;  4R9F A;  3B7D A;  1D4N A;  4FIM A;  1MQJ A;  5I57 A;  2H99 A;  4Q5T A;  4NF6 A;  4OHN A;  4F19 A;  2F36 A;  4XKQ A;  4IO6 A;  2OCU A;  2XD2 A;  1XC1 A;  2I58 A;  2FA7 A;  3UN6 A;  3PUZ E;  4OXV A;  4DCX A;  3K0V A;  4YKP A;  2DQV A;  3D4C A;  1PBP A;  4G77 A;  4ONY A;  5AA2 D;  1Y3N A;  3A09 A;  1XS5 A;  2ESN A;  5B70 A;  1NNP A;  3S2V A;  1KWH A;  2W7Y A;  1Y20 A;  2QL3 A;  3T96 B;  3Q25 A;  2QS3 A;  3G3H A;  4BDO A;  1Y9U A;  2RKM A;  1OLA A;  4KFQ A;  1LAG E;  4HCW A;  5H8S A;  2IEE A;  1N04 A;  3TTR A;  1VE4 A;  4FE8 A;  3SEV A;  4PFU A;  3UOR A;  2ONR A;  4PFY A;  3K2D A;  4EXK A;  4YB5 A;  2RC8 A;  3EHT A;  3HST A;  3RPW A;  3QAX A;  4R9G A;  3K02 A;  4WKM A;  5DTB A;  3S9N C;  2I0C A;  4OER A;  2DE2 A;  2GFE A;  1P1Q A;  3G3G A;  4XKP A;  2H25 A;  4ZED A;  1JQF A;  3SEW A;  2OWS A;  3EQ1 A;  3IO4 A;  2E0S A;  1NKX A;  4U22 A;  4PFW A;  2O51 A;  2O7U A;  4EQB A;  4G68 C;  3K00 A;  1BTJ A;  1GV8 A;  4P0I A;  1GVC A;  1EZP A;  3EN3 A;  3CG1 A;  1DSN A;  4LZ8 A;  5ICT A;  4ND9 A;  4OMB A;  3U72 A;  2REG A;  4F3B A;  5HM4 B;  1JEV A;  1OLC A;  1R9L A;  2UVJ A;  1A54 A;  3SET A;  2F8D A;  4LUB A;  1ZJL A;  1XHY A;  1DPP A;  4KCD A;  4X9T A;  1UIU A;  1F9B A;  2DE4 A;  3RTW B;  1BIY A;  3TEP A;  2AYS A;  1UTH B;  2F7B A;  4QRZ A;  3HCQ A;  1MRP A;  1B3L A;  2DWA A;  1JNF A;  3VVD A;  2B3F A;  1S9T A;  4ZE9 A;  5KZT A;  5KCJ B;  5K2Y A;  1FQE A;  4YMB A;  2UVH A;  4XTC Q;  2Q9T A;  2ZYM A;  2D5W A;  4LQ2 A;  3W15 C;  1UTB B;  4I1D A;  4KD5 A;  4R75 A;  5J1D A;  1ATG A;  1H45 A;  3FVN A;  4NF4 A;  5DT6 A;  3MJN A;  3TCH A;  2UYF A;  3VXB A;  3EF7 A;  2XXX A;  4I9D A;  3IOU A;  2YLN A;  3QK6 A;  4KYD A;  3DP4 A;  4HS7 A;  2DVZ A;  3GBA A;  3ZSF A;  3TZA A;  3MWB A;  5BWJ A;  4HW8 A;  4RNS A;  4G68 A;  3GXA A;  3K1P A;  3E13 X;  3MC2 A;  1LB9 A;  3RT8 A;  2DWH A;  4M1V A;  1IUD A;  3MQ9 A;  5B7D A;  2RF1 A;  4IO3 A;  3T9U A;  3TMG A;  5CC2 A;  1OMP A;  2XXT A;  4AB6 A;  3CSB A;  2RIN A;  3ZKL A;  4OFL A;  1ZU0 A;  3RTF B;  2PX1 A;  2PYY A;  1AIV A;  4RXL A;  4IO4 A;  1GR2 A;  1ZMG A;  3RGY A;  3IOR A;  4RPN A;  1FTL A;  1Q1K A;  1M5C A;  2V3U A;  4YKI A;  3TOD A;  3V5A A;  3ILT B;  1LFH A;  1POT A;  4IY6 A;  1II5 A;  4N07 A;  2ZYN A;  2I4B A;  3TDJ A;  4IGT A;  2H98 A;  2ZNT A;  1H44 A;  4FEC A;  3PMX A;  1XOC A;  1B40 A;  4EUO A;  3PGF A;  3KZG A;  4OET A;  2G29 A;  2QS1 A;  4JDF A;  4KI0 E;  3O29 A;  3RN8 A;  4NED A;  3CIJ A;  3PD9 A;  3T9X B;  2ANJ A;  4QHQ A;  3O6G A;  1N0T A;  2UVI A;  2Y7K A;  4DIG A;  4DXB A;  3O97 A;  5I59 B;  3DLN A;  1B7Z A;  3C32 A;  4L17 A;  3K6U A;  4OEU A;  4PFT A;  5TPA B;  4EDP A;  2OJT A;  3TUS A;  4NF8 B;  2DP8 A;  4O3B A;  1B51 A;  3VVF A;  4GXS B;  3OEM A;  1MQI A;  4X1B A;  4O3A A;  5TP9 A;  5KDT A;  5JTY A;  2X7P A;  3KJT A;  2LAO A;  1SW2 A;  3MP8 A;  4C0R A;  5CI5 A;  1JW4 A;  4ELQ A;  2H9B A;  3LUY A;  4GF8 A;  3MZ1 A;  5ISU A;  4F3S A;  1B3E A;  5DEX A;  2F78 A;  5I2N B;  3IL1 B;  3FXU A;  4TQU Q;  3MAM A;  4OFO A;  3ILU B;  3OO7 A;  1QVS A;  5F1Q A;  3DM0 A;  4POW A;  2GHA A;  2REJ A;  3TEL A;  1EH3 A;  1MY1 A;  3RQT A;  5FTI A;  2V84 A;  2Y84 A;  4R2F A;  3LSX A;  4XKR A;  4LQ5 A;  4WEP A;  3S9L C;  3KG2 A;  3G3I A;  1HSL A;  3K6X A;  4ISU A;  2A5T B;  4Z7E A;  2Y7I A;  3BBR A;  3PD8 A;  2X26 A;  3T9V A;  2DOJ A;  4EF2 A;  4RA1 A;  2KLF A;  4FAT A;  3OO9 A;  3TCG A;  1MXZ A;  2UXA A;  1HSE A;  5AA4 B;  1NL5 A;  1B2H A;  2O7I A;  3H6U A;  3HPI A;  3VXC A;  3MVX A;  4U21 A;  1B9J A;  3LR1 A;  5AA2 A;  3IK6 B;  5I58 A;  4QFK A;  3VE1 B;  3VDF A;  4N6P A;  2HCA A;  4EXL A;  4IB2 A;  3R6U A;  1IIW A;  2PVU A;  5DYH A;  4DZ1 A;  3HO7 A;  1XVY A;  1AH5 A;  4R6Y A;  1IXG A;  1BLF A;  2O68 A;  3JZJ A;  3V89 B;  1B3H A;  2Y7R A;  3SDF A;  2HAV A;  1LAX A;  4QF9 A;  2O6A A;  2CZL A;  4K3F A;  2NOO A;  3PPN A;  3RUM A;  4X48 A;  4LAT A;  1AMF A;  3SKP A;  3FVK A;  3Q27 A;  4QSC A;  5FHM A;  4YZZ A;  4ZEK A;  1SYI A;  3QYT A;  1XT8 A;  4ESX A;  2E1S A;  2I3W A;  3FVG A;  3ONM A;  4R73 A;  5ITO A;  4YIC A;  2QMX A;  3OSR A;  4UAC A;  2F7C A;  3FIR A;  3Q26 A;  5CBR A;  4P11 A;  3FAS A;  1TFA A;  1H3D A;  1MXV A;  4NMY A;  5H8N B;  3MP1 A;  1B4Z A;  1R9Q A;  3T66 A;  3IB1 A;  2XXP A;  3K6V A;  3L6H A;  1B46 A;  5I2K B;  4PP0 A;  3SEU A;  1B6H A;  1PB7 A;  2Z22 A;  1FTJ A;  3FVO A;  4NWD A;  3KN8 A;  4FOR A;  4THI A;  1MM6 A;  4MH5 A;  2VD2 A;  3VV5 A;  1B5J A;  3G3K A;  3TYH A;  4Q0C A;  2P2A A;  4I62 A;  3FJG A;  3OMB A;  5CM6 A;  2VP1 A;  4XIG Q;  5CMC A;  3H6T A;  4IO7 A;  4FJP A;  1JW5 A;  1N3W A;  5EHM A;  4HTG A;  2R6G E;  4NF5 B;  2V3Q A;  1D3K A;  3K4U A;  1Y4C A;  2Q89 A;  1N7X A;  1NMU A;  3TTK A;  4F39 A;  4YB7 A;  3M8U A;  1Y1Z A;  1VFD A;  5IAI A;  3T22 A;  3U93 A;  3BFU A;  4ZE8 A;  5CRY A;  3C4M A;  4BDM A;  1P1N A;  1Z7M E;  1IEJ A;  5I56 B;  2V93 A;  4G2Z A;  5L9M A;  2GHB A;  3B6Q A;  1MY0 A;  4KCC A;  4RPO A;  1DOT A;  3VFJ A;  1MQH A;  1SYH A;  4ZS9 A;  3VLU A;  4E0X A;  1NNK A;  4U4X A;  2VHA A;  1M5D A;  1MPD A;  3MBP A;  3CFL A;  4JWO A;  3L6G A;  2HZK A;  3FUZ A;  2PBW A;  1B7U A;  1CE2 A;  4C1U A;  3O6H A;  1XVX A;  2YJP A;  4OZ9 A;  3OO6 A;  2F97 A;  3LSW A;  1LGB C;  1RYO A;  2XX7 A;  4R74 A;  2DXR A;  1N3X A;  1MXU A;  4IGR A;  1A7L A;  2UVG A;  3MW0 A;  3H3G A;  4DLD A;  3EPE A;  2XHD A;  3M3F A;  3MVW A;  4IY5 A;  3CFZ A;  1A8F A;  5H8N A;  1OIB A;  4UA8 A;  4KQP A;  4OES A;  2PMS A;  1URS A;  3FV2 A;  1EU8 A;  1B4H A;  3KBR A;  3MVZ A;  4I8C A;  5L9O A;  4YKJ A;  1LB8 A;  3M3L A;  1DTG A;  3IOT A;  2I49 A;  1JEU A;  1OQH A;  3IOV A;  4H67 A;  1B0H A;  2ONS A;  1I6B A;  2ZYK A;  4NF5 A;  3U92 A;  3WAE A;  1BP5 A;  2NVU B;  3V8X B;  5DVI A;  4IO2 A;  4JBZ A;  4DCY A;  2DYX A;  3TKD A;  1UIV A;  5F7V A;  1Y3Q A;  1POY 1;  1P1O A;  4BDL A;  4KYS A;  2D21 A;  2A5S A;  3KN7 A;  1RKM A;  5AA3 A;  1MDQ A;  4C1T A;  5I84 A;  5CMB A;  5DVJ A;  3KFM A;  2XX9 A;  3U94 A;  1MH3 A;  2AL4 A;  5ICQ A;  1YAE A;  3I6V A;  1NH7 A;  3N6U A;  3OOA A;  1SW5 A;  4YB6 A;  4OEN A;  2H5Y A;  1N7W A;  3H7M A;  1TT1 A;  3B6W A;  1YPN A;  4H0W A;  1LAF E;  1T0K A;  4G8H A;  3R26 A;  1B1H A;  1IXC A;  3IO6 A;  5CMM A;  1FTO A;  1IXI A;  4OQO A;  5IKB A;  3G7W A;  3IB2 A;  4RK9 A;  1ZKB A;  4YKK A;  4LZ5 A;  3GBB A;  1I69 A;  4M4G A;  4N13 A;  3ECR A;  4PE5 B;  2I0B A;  3HN0 A;  3AXF A;  4ZZE A;  2YPN A;  1PBQ A;  1O7T A;  3GZG A;  3FJM A;  1MY3 A;  1MPB A;  1UTH A;  1B5H A;  2ZNU A;  3EHS A;  4GVO A;  4F2O A;  3T93 B;  1Y4T A;  3UP9 A;  5KCJ A;  2ALU A;  3QUF A;  3F11 A;  1YCJ A;  5A5X B;  3CI8 A;  5FHO A;  4NE4 A;  5H8F B;  1UTB A;  4PET A;  4GL0 A;  5HPQ A;  3PMV A;  3TCF A;  3FZV A;  3RLF E;  3OD7 A;  2XXI A;  3QUJ A;  1OVT A;  4G4P A;  3FV1 A;  5H8H B;  3JV9 A;  3OXN A;  5JEI A;  3UIF A;  3PU5 A;  3H6V A;  3H6W A;  1PDA A;  3PUY E;  4F3G A;  2GH9 A;  1A99 A;  3N26 A;  1L5T A;  1S7Y A;  4JWY A;  3G3F A;  4OEV A;  1MXX A;  5BUU A;  3S4U A;  3KSJ A;  4TLL B;  4FEB A;  2Q88 A;  4ELP A;  4GD5 A;  3N5L A;  3E4R A;  1LBB A;  1NNT A;  3S9M C;  3HV1 A;  3FD3 A;  1LFG A;  4U2R A;  4OYV A;  5H8Q B;  2QS4 A;  4EQ7 A;  3WAF A;  3N94 A;  2P1S A;  1D9V A;  2V3T A;  1B1X A;  2Z8E A;  1ELJ A;  3A3C A;  3MP6 A;  2Q2C A;  5I57 B;  5L8D A;  4ZEC A;  4NF6 B;  3C34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...