1B7ZA

Structure of oxalate substituted diferric mare lactoferrin from colostrum
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords PROTEIN (LACTOFERRIN)
publication title Structure of oxalate-substituted diferric mare lactoferrin at 2.7 A resolution.
pubmed doi rcsb
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA03
4BDMA 1DTZA 3CFZA 1OVTA 2XXXA 3PPRA 4RPOA 1B2HA 4BDQA 3PV0E 1LLSA 3C36A 1TFDA 3L6HA 1PC3A 1ZKBA 2RC9A 3UORA 3O6GA 4FATA 2DXYA 2P2AA 1B05A 1SYHA 5AA2A 3K02A 3KN7A 1CE2A 4NF6A 4DDDA 3B6WA 1IQ7A 4QHQA 5ICQA 1OQHA 2AYSA 3O66A 4KPTA 2PT2A 1MY2A 4R9GA 3ONMA 1HSEA 4U21A 3LBSA 2OCUA 1VR5A 1SBPA 1VFDA 1LCTA 4PP0A 4ZE8A 5CBSA 3K2DA 3TCGA 1A8FA 3BFUA 4DCXA 4F19A 1MQGA 3TAJA 3OO9A 3FATA 3G3JA 4IO5A 2ZMBA 3V5AA 1XVYA 4RNSA 4LQ2A 1ZIUA 3VXCA 1F9BA 2I48A 4NF4B 4FORA 5FHOA 1NNFA 4X9TA 1O63A 3W9WA 1B9JA 4F2OA 5HPQA 3CIJA 1B46A 4LVQA 2DE3A 5JTYB 2LAOA 2PX1A 2X26A 4I62A 4IO7A 5ICTA 1SQYA 5TPAA 1MQHA 4OQOA 4C0RA 1LBBA 4RXLA 3RT8A 1LFGA 4YICA 4POWA 2QPQA 1US4A 1FQDA 1N7XA 3M3LA 1B0LA 3SERA 4ECFA 3MZBA 1N7WA 4I1DA 2Z8DA 2Q2CA 3H03A 4N13A 4G68B 4H0WA 2OZZA 4HW8A 5I2NA 3Q27A 3FVGA 1JETA 1A40A 3FVNA 2I0BA 2V25A 3OELA 4TLLB 2H98A 2HEUA 2OLBA 5H8FB 4JB7A 4YMAA 4U4XA 3PGFA 2ALUA 3KFMA 3IAZA 3LSXA 4QRZA 2UVJA 3O2AA 4OEUA 4EF2A 3MP8A 2XXTA 3TYHA 2RINA 4NF5A 4F1UA 4ZZEA 1QUIA 1AH5A 3Q28A 4ND9A 1PDAA 5FTIA 1SD3A 3S9MC 1EZPA 1P1QA 3QK6A 1QJMA 3VXBA 3H7MA 2THIA 3G3KA 4JXIA 3O9PA 3T93B 1EZ9A 1MY3A 2HAUA 4GVOA 3UIFA 1YCJA 3KJ7A 5I56B 4H5FA 4ZECA 4X1BA 2XX9A 5K2YA 1I6QA 1MXXA 2FYIA 4YKKA 3FXUA 2F6PA 3A3CA 1A54A 4U1OA 2DVCA 5B7DA 1H3DA 3LSLA 5KCJB 1WDNA 1EU8A 3OOAA 3IOTA 5AA3A 1ATGA 5EHMA 1LFHA 1MXZA 4KR5A 1SVXB 2ZYKA 3OO6A 3O28A 3U72A 5A5XB 5ELVA 5AA4A 3IB2A 5CRYA 3V83A 2QSXA 3EHSA 5DEXA 3TTKA 2OK2A 4OFOA 2I49A 2HAVA 1NMUA 1XOCA 2W7YA 5BUUA 2XX7A 3FIRA 3LSWA 5HM4B 1MY0A 5I59A 5EYFA 1IEJA 4AQ4A 2H5YA 1MXWA 4KD5A 5ITOA 3EF7A 1MQDA 3PD9A 4DXBA 2G29A 4ESXA 3TEPA 1MM6A 2V93A 3FD3A 2DS9A 1DPEA 3CSGA 4TLMB 4FEBA 1RKMA 1YPNA 1JW1A 1JEUA 4KCDA 3I6VA 3R26A 1FTOA 4KYDA 1OQGA 1NNPA 2VOZA 2H4IA 1N0TA 3HCQA 3ODBA 2H99A 1MXYA 1ZMGA 3I3VA 4GQOA 2M8CA 3KSXA 4LZ5A 1BLFA 1POY1 3IB0A 3RTFB 5LOMA 1MS7A 4F3BA 3USDA 4XKPA 1SW2A 5DVJA 5M2VA 3O6HA 3C35A 2O51A 1B3HA 3IB1A 3RY3A 4KYSA 1WODA 4YZZA 2V3TA 1HSLA 1R9QA 3JYRA 4XXUA 3UK4A 1I6BA 2CMOA 5H8NB 1P1UA 4R6YA 1DMBA 5DYHA 4G68C 3PUWE 2P1SA 2Q89A 1JQFA 1LB8A 2DWAA 3H6UA 3K00A 1B5JA 1LAFE 2Z8FA 4FEDA 2O6AA 3IO4A 3FV2A 4H8JA 3QSLA 2XXWA 4BDRA 4HS7A 2DXRA 3MZ1A 3E3KA 1TWYA 2ZXTA 4HCYA 3IK6B 1N3WA 3WAEA 2DE4A 3MPLA 2ZNSA 3OXNA 4BDLA 4NF8B 4NEDA 4KQPA 4E0WA 3VLVA 1GGGA 1O64A 1UIVA 3U92A 4G8MA 2OWTA 2RF1A 4KHZE 3CFLA 1URGA 2DWHA 1UTBA 4H1XA 1ZLQA 1EH3A 2FNCA 4OVJA 1UTHA 4BDNA 3TQLA 1Z7ME 3BKIB 4IO6A 4POXA 4OWDA 3T9XB 4LONB 1LAHE 2QS2A 1MY1A 1URSA 2QRYA 3N6TA 3ZKKA 3CFXA 3UN6A 2B3BA 1GR2A 4QFKA 3G3HA 1ZU0A 3U94A 2GHAA 4R74A 3EPEA 2I3WA 1O7TA 4O3CA 2XXPA 4DXUA 4JWYA 4RYAA 1GTKA 1OVBA 4G2ZA 1USYE 4YB7A 3VVFA 3S2VA 4PETA 2PBWA 3IJXB 3MAMA 3TKDA 4FECA 1FW0A 3IJOB 3G7WA 1Q35A 4H65A 4NWDA 3TTNA 4H8IA 4F3SA 2CZLA 4F18A 4F1VA 2F34A 3RLFE 1JVYA 2AL5A 3N94A 1TXFA 3GBBA 1TT1A 3KN8A 1AL3A 2XXHA 1B52A 2QS4A 4OESA 3FGSA 2HQ0A 4GWOA 3G3IA 1BTJA 5L9OA 1YAEA 2QJEA 4ISUA 5F7VA 3TTLA 2B65A 3R6UA 1R1NA 3B7DA 4ELPA 4DCYA 2BJJX 2V3UA 3HPIA 3VLWA 3K1PA 1FQEA 1MDP1 2ESNA 1LBCA 4YB5A 3EQ1A 2XXRA 4Q8RA 3SEVA 5TP9A 1OLCA 3QIMA 4U23A 4GF8A 3GZGA 4GIZA 3LUYA 1JW5A 3O29A 3FUZA 1SDXA 2Y7RA 5I57A 4G8NA 3K4UA 1Y3QA 1MG1A 2I0CA 4RK9A 5K2XA 3TPAA 3KN3A 3IOWA 4LP2B 1A99A 5KDTA 4MH5A 1MH4A 4I9DA 1SW5A 4LZ8A 3MWBA 3C31A 2Y7PA 2D5WA 5FTHA 3FVKA 1T0KA 1WVJA 1M5EA 5CC2A 3PMXA 4G8HA 2UYFA 2DOJA 1FQFA 1MRPA 3C34A 4ELOA 2YLNA 4U4SA 4GD5A 4HCWA 2GFEA 3SEUA 3AXFA 3VV5A 2DYXA 2RC8A 3GXAA 1BKAA 2R71A 3Q29A 3FV1A 3UGWA 3BBRA 1B32A 3CI8A 3CG1A 3PU5A 4QFPA 4OENA 2ZYOA 2Y7WA 1GV8A 3T9UA 1LAGE 3S9LC 3O6IA 3RNNA 3THIA 2D21A 4JSDA 1IUDA 3SETA 4UA8A 4FE8A 1Y9UA 2QS3A 4FIMA 4DZ1A 2A5SA 1VSOA 1NKXA 3QXMA 4OXVA 3K1MA 4O3AA 3H3GA 4AB5A 2VGQA 2REGA 1FQBA 4P0GA 4PFYA 3T22A 2Y7IA 3HSTA 3TZAA 4IO2A 3SESA 4IO3A 2F5XA 4LQ5A 4F2QA 3KJTA 1H43A 4DLDA 4ZEDA 3BFTA 4PFWA 2R9JA 5I2KB 5CMBA 4N6PA 4DE8A 2Z22A 4ZZAA 1MM7A 5FHNA 3U8QA 4OFLA 4H6DA 3OEKA 5H8QB 3MJNA 3QAXA 1IIWA 3JV9A 2D3IA 2F7CA 4C1TA 4NTLA 1QKBA 4WEDA 4NF4A 2A5TB 3T9HB 1JNFA 1EZOA 4BLAA 3KGCA 2V3QA 3KEIA 1MXUA 1MPDA 1H44A 1CB6A 5JTYA 3FVOA 3V89B 5L9MA 3EN3A 3IX1A 4I8CA 1LFIA 3PUXE 2UVHA 3K1NA 5H8HB 2X7QA 4EDPA 4ELRA 4U1ZA 2NVUB 3M8UA 1M5DA 4QSEA 4XKQA 2RC7A 2O84X 4MBPA 4R73A 3T9VA 3W9VA 1A7LA 4H67A 4MLVA 2XXIA 4G68A 1LAXA 2UVIA 5FHMA 3B6TA 3N6UA 3ECRA 4GFRA 1FQAA 2UYEA 5I58B 2I6EA 4JWXA 5H8FA 2ZNUA 2O1LA 1XT8A 3IOVA 4YMBA 2F6GA 4YKJA 1Y20A 1A8EA 3OENA 3S9NC 1OMPA 1ZBMA 3HO7A 3PPQA 1KWHA 1SI0A 5CBRA 1XC1A 3K6WA 5EHSA 4YKIA 2XXQA 1USYH 1MXVA 3E9XA 1SI1A 1PB7A 5HBCA 5KZTA 3RT6B 3TCHA 2GHBA 2AL4A 1B0HA 2P0SA 5I56A 1XS5A 3OSQA 2O7UA 5AA2B 4O3BA 1N04A 4NF6B 4U2RA 3C32A 3MBPA 1ZTYA 2OJTA 2E1SA 1I6AA 4RY1A 3KSJA 1N84A 2Z23A 4QFOA 1SW4A 1HSJA 4KCCA 3C9HA 4DXCA 5AA1A 5ISUA 4F1YA 1MDQA 1J1NA 3TTMA 4PQJA 1JVXA 3TELA 3RN8A 4C1UA 1N76A 5KCJA 4GRKA 1B3LA 1LGBC 4Q0CA 4DIGA 2QMWA 4U22A 3MW0A 1OLAA 2F35A 1B3EA 3GLBA 2G93A 3D4CA 4WXJA 5A5XA 5DT6A 2XXYA 2DVZA 2RKMA 1QVSA 4OZ9A 4LUBA 3E13X 1N3XA 2O7IA 3FASA 1L5TA 2PT1A 2Z8EA 4GXAA 4BDOA 3QYTA 2GH9A 3M3FA 2O69A 4ONYA 3VLUA 4OFJA 3HV1A 3FXQA 2NWJA 1B7UA 1FCKA 5TPAB 2O68A 1B3GA 1US5A 4GLIA 3HHGA 4WKMA 1FTKA 3OO8A 3UP9A 1LSTA 4Z0IA 3K6VA 1URDA 2DSFA 3MPKA 4EQ7A 4R6HA 3F11A 3LSFB 2XHDA 5H8SA 1MQIA 2IA4A 4IY5A 3S9EA 4QFLA 1UIUA 4R75A 4YAHX 4K3FA 5I2NB 4ZEIA 4F39A 2IEEA 1S7YA 4TOZA 2VHAA 2REJA 1VE4A 3B6QA 4JWOA 4WEPA 4Q5TA 2V84A 4PFUA 4P11A 3PPPA 1PB9A 3MVXA 4ZDMA 4GXSB 3TQWA 3MC2A 1QUKA 4F3PA 3FJ7A 4Z7EA 4FJPA 3RTWB 3SDFA 1NNKA 3SEWA 2F78A 2WKYA 4GL8A 1NFTA 3H06B 4XTCQ 2AIXA 4EF1A 3TUSA 4NF5B 1IXIA 3MP1A 4QSCA 1QKAA 3IO6A 2Q9TA 1BP5A 3VVEA 4NE4A 1SYIA 3N26A 3GBAA 1TFAA 1MPCA 4F3GA 4R9FA 1B1HA 1ANFA 2Y84A 3QUJA 5H8NA 3DM0A 3A3UA 1MQJA 2ZYNA 4IY6A 4JBZA 2I58A 3H6VA 5ITPA 3R7XA 3OD7A 4KI0E 2QS1A 2HCAA 4AB6A 1Z7NE 3K6XA 3HHFA 3IORA 3CR9A 4IO4A 3PMWA 1R9LA 4OTEA 2F7AA 3QUFA 1NL5A 4NF8A 1DOTA 3PPNA 3FXRA 3DELB 4F22A 1RYOA 4N07A 4QSDA 4RJZA 2E0SA 1B7ZA 1A55A 5AA4B 3Q26A 3LC8A 4OEVA 4Q30B 5DEXB 4GOTA 4X1DA 4JSOA 5CMMA 3A09A 3IL1B 3PD8A 1M5FA 3RGYA 3ILTB 3K01A 4PFTA 5I59B 1B4HA 2QMXA 1M5CA 1DTGA 5AE4A 2O1MA 1ELJA 1IXHA 1PB8A 3T66A 2PYYA 3WAFA 3PUVE 1FQCA 4F29A 5CM6A 3C33A 4ZEKA 1DPPA 2RCBA 3OEMA 4EUOA 3H4ZA 5L8DA 2PMSA 1H45A 3U1OA 1Y1MA 1S50A 1IXGA 4LA9A 1D9YA 4L17A 4R2BA 4HTGA 3T96B 3TCFA 4XKNA 1Y4TA 2Q2AA 4E0XA 4M1VA 1B7HA 4OHNA 3IR1A 2ABHA 3TTRA 1FTLA 1H76A 3G3GA 1IXCA 1B40A 4MF3A 2X7PA 3MVYA 1D4NA 4EQBA 3OSRA 2UXAA 3N5LA 4IB2A 4EXLA 3E4RA 3DP4A 3CVGA 5TU0A 4EXKA 1PBPA 3MVZA 2DQVA 2H9BA 1UQWA 5IAIA 2HXWA 3EHUA 2DP8A 4MLQA 2NUVA 2KLFA 4UACA 1D9VA 2QL3A 4OERA 1FTJA 1XVXA 5L9SA 2R6GE 3G3FA 4KYEA 1Y3NA 1POTA 4F31B 3FJGA 1JEVA 3CRBA 4OETA 2ANJA 4G4PA 3RPWA 4ESWA 3M3KA 4P0IA 4IGTA 1D3KA 4ZEBA 5I84A 4R72A 2F97A 3TFLA 3RUMA 1RYXA 1SW1A 2FA7A 3LR1A 1P99A 1Y4CA 3DP8A 3PUZE 1OIBA 2I3VA 3P7IA 3DP6A 3VFJA 3SEYA 2VD2A 1AIVA 3MUQA 2Q88A 3KOSA 2DWJA 1QW0A 3ILUB 4KFQA 4OMBA 3MP6A 3U93A 2UVGA 3KG2A 4YU0A 3KBRA 3CSBA 3TDJA 3H6WA 4PE5B 1UTBB 2ONKE 3K0VA 2DWIA 5J1DA 2OWSA 3VDFA 3OO7A 2VP1A 1UTHB 1IZ1A 3K6UA 2HZKA 1QULA 3TMGA 3RQTA 4QFNA 1II5A 5CMCA 1MY4A 2H25A 1B58A 4LATA 3O97A 4EQ9A 3EHTA 3PUYE 1XHYA 1Q1KA 2GRVA 1BIYA 3IOUA 3KZGA 3KOTA 2F8DA 2ONRA 2RCAA 1VFEA 2PVUA 1B4ZA 5JEIA 3ZSFA 1AMFA 3SKPA 4H5GA 1NH8A 3FZVA 3HN0A 2VD3A 3I5OA 4ELQA 3MZ9A 5BWJA 3CG3A 4R2FA 4G77A 1QUJA 5CMKA 3PMVA 3D4GA 3JZJA 3C4MA 4TQUQ 4ZE9A 4X48A 2ZNTA 4M4GA 1NH7A 2XXUA 5I2KA 4RK2A 2I4BA 3TODA 1B3FA 1PEBA 4GL0A 2HFBA 4YKPA 1MH3A 1LB9A 4QF9A 3UA8A 1B51A 2F36A 3L6GA 2OBGA 4XIGQ 5H8QA 1B6HA 1I69A 3H6TA 3VE1B 4ZEFA 2NOOA 2XX8A 3SEXA 2A5TA 1PBQA 1LCFA 1M5BA 1P1WA 4NWCA 1P1OA 2XD2A 1JW4A 5TP9B 5DTBA 3FJMA 1S9TA 4RPNA 2Q8JA 2B3FA 5I57B 5H8HA 1B5HA 5CI5A 1YTVA 3PPOA 5DVFA 1B5IA 1GVCA 4LZ7A 5KDTB 1Y1ZA 3MQ9A 2NXOA 4THIA 4XKRA 4IGRA 5IKBA 1FTMA 2ONSA 4JDFA 2Y7KA 3S4UA 4MFIA 4RA1A 3V8XB 1ZJLA 2XD3A 2YJPA 3DLNA 5F1QA 2F7BA 3ZKLA 3MVWA 1Y3PA 2DE2A 1MPBA 5I58A 2I4CA 4NMYA 3VVDA 5AA2D 4FAJA 4ZS9A 5B70A 3Q25A 1P1NA 1IITA 2HZLA 1NNTA 1DSNA 3OMBA 5DVIA 3ZS6A 4YB6A 3W15C 5JK4A 2XXVA 2YPNA 4R6KA 1B1XA 4OYVA 2ZYMA 1R6ZA 1AOVA
chains in the Genus database with same CATH superfamily
4BDMA 1DTZA 1NV0A 2ZZXA 3CFZA 1OVTA 2XXXA 3PPRA 2OWZA 4RPOA 1B2HA 4BDQA 3PV0E 1RDXA 1LLSA 1NV5A 3C36A 1TFDA 3L6HA 1PC3A 1ZKBA 1LEVA 2RC9A 3UORA 3O6GA 4FATA 2DXYA 2P2AA 1B05A 1SYHA 5AA2A 3K02A 3KN7A 1CE2A 4NF6A 4DDDA 3B6WA 1IQ7A 4QHQA 5ICQA 1OQHA 2AYSA 3O66A 1DCUA 4GWXA 4KPTA 2PT2A 1FPGA 5J16A 1MY2A 4R9GA 3ONMA 1HSEA 4U21A 3LBSA 2OCUA 4X8RA 1VR5A 1D9QA 1SBPA 1VFDA 1LCTA 4PP0A 4ZE8A 5CBSA 1LBYA 4GBWA 3K2DA 3TCGA 1A8FA 3BFUA 4DCXA 4F19A 1MQGA 1NV6A 4PBHA 3TAJA 3OO9A 3FATA 3G3JA 4IO5A 3RYDA 2ZMBA 3V5AA 1XVYA 4RNSA 4LQ2A 1ZIUA 3VXCA 1F9BA 2I48A 1FRPA 4NF4B 4FORA 5FHOA 1NNFA 4X9TA 1YZ0A 4MMPA 1O63A 3W9WA 1B9JA 1QGXA 1FBPA 4F2OA 5HPQA 4GWWA 3CIJA 1B46A 4LVQA 2DE3A 5JTYB 2LAOA 2PX1A 2X26A 5ET6A 4I62A 4IO7A 5ICTA 2XWOA 1SQYA 5TPAA 2V4CA 1MQHA 4OQOA 4N91A 4C0RA 1LBBA 4PFBA 4RXLA 1FPIA 3RT8A 1LFGA 4YICA 4POWA 2QPQA 1US4A 1FQDA 1N7XA 3M3LA 1B0LA 3SERA 4H45A 2B4MA 4ECFA 3MZBA 4GBVA 1N7WA 4I1DA 2Z8DA 2Q2CA 3H03A 5ET5A 4N13A 4G68B 4H0WA 2OZZA 4HW8A 3LUZA 5I2NA 1NUXA 3Q27A 3FVGA 1JETA 1A40A 4GWUA 3FVNA 1IMCA 2I0BA 3B8BA 2V25A 3OELA 1NV3A 4H46A 2H98A 2HEUA 4TLLB 2OLBA 5H8FB 4JB7A 4YMAA 4U4XA 3PGFA 2FVZA 2ALUA 3KFMA 3IAZA 2HPGA 3LSXA 4QRZA 2UVJA 5IZZA 3O2AA 4OEUA 4EF2A 5F24A 3MP8A 2XXTA 3TYHA 2RINA 4NF5A 4F1UA 4ZZEA 1QUIA 1AH5A 3Q28A 4ND9A 1PDAA 5EQAA 5FTIA 1SD3A 3S9MC 1EZPA 1P1QA 2ZZWA 3QK6A 1QJMA 3VXBA 3H7MA 2VT5A 2THIA 3G3KA 4JXIA 3T0JA 3O9PA 3T93B 1EZ9A 1FBGA 1MY3A 2HAUA 4GVOA 3UIFA 1YCJA 3KJ7A 5I56B 4NQ8A 4H5FA 4MNCA 4ZECA 4X1BA 2XX9A 5K2YA 1LBXA 1I6QA 1MXXA 2FYIA 4YKKA 3FXUA 1JP4A 2F6PA 3A3CA 1YXIA 1A54A 4U1OA 2DVCA 5B7DA 4PGPA 1H3DA 3LSLA 5KCJB 1WDNA 1EU8A 3OOAA 3IOTA 5AA3A 1ATGA 5EHMA 4JVIA 1LFHA 1MXZA 4KR5A 1SVXB 2ZYKA 3OO6A 3O28A 3E79A 3U72A 5A5XB 4MNIA 5ELVA 5AA4A 3IB2A 5CRYA 3V83A 2QSXA 5T3JA 1NI9A 3EHSA 5DEXA 3TTKA 2OK2A 4OFOA 2I49A 4N15A 2HAVA 1NMUA 1XOCA 2W7YA 5BUUA 2XX7A 3FIRA 3LSWA 5HM4B 1MY0A 5I59A 5EYFA 1IEJA 4AQ4A 2H5YA 1MXWA 4KD5A 5ITOA 3EF7A 1MQDA 3PD9A 4DXBA 2G29A 4IR8A 1NUWA 4ESXA 3TEPA 1MM6A 5IM2A 2V93A 1RDYA 3FD3A 2DS9A 1DPEA 3CSGA 4TLMB 4FEBA 1RKMA 1YPNA 1NUYA 1JW1A 3FBPA 1JEUA 4KCDA 3I6VA 3R26A 1FTOA 4KYDA 1OQGA 1NNPA 2VOZA 2H4IA 1N0TA 3HCQA 3ODBA 2H99A 1MXYA 2F3BA 4MAGA 1ZMGA 3I3VA 5LDZA 4GQOA 2M8CA 3KSXA 4LZ5A 1BLFA 1POY1 3IB0A 3RTFB 5LOMA 1MS7A 4F3BA 3USDA 4XKPA 2QVVA 5I3SA 1SW2A 2F3DA 5DW8A 5DVJA 1FBCA 5M2VA 3O6HA 3C35A 2O51A 1B3HA 1NUZA 3IB1A 3RY3A 4KYSA 1WODA 4KXPA 4YZZA 2V3TA 1HSLA 1R9QA 3JYRA 4XXUA 1FPJA 3UK4A 1I6BA 2CMOA 2CZHA 5I5PA 5H8NB 1P1UA 4R6YA 2ZZVA 1DMBA 5DYHA 4G68C 3PUWE 2P1SA 2Q89A 1JQFA 1LB8A 4I3EA 2DWAA 3H6UA 3K00A 1B5JA 1LAFE 2WBDA 2Z8FA 4FEDA 2O6AA 3IO4A 3FV2A 4H8JA 3QSLA 1K9YA 2XXWA 4BDRA 1CNQA 4HS7A 2DXRA 3MZ1A 3E3KA 1TWYA 2ZXTA 4HCYA 3IK6B 1N3WA 2PCRA 3WAEA 2DE4A 3MPLA 2ZNSA 4MNPA 3OXNA 4BDLA 4NF8B 4NEDA 3E78A 4KQPA 4E0WA 3VLVA 1GGGA 1O64A 1UIVA 4PGNA 3U92A 4G8MA 2OWTA 2RF1A 4KHZE 3CFLA 1URGA 2DWHA 1UTBA 2VPOA 4H1XA 1ZLQA 1EH3A 4PDHA 2FNCA 1INPA 3EKIA 4OVJA 1UTHA 4BDNA 3TQLA 1Z7ME 3BKIB 4IO6A 4POXA 2VPNA 4OWDA 3T9XB 4LONB 1LAHE 2QS2A 1MY1A 2KQZA 1URSA 2QRYA 3N6TA 3ZKKA 3CFXA 2Y5LA 3UN6A 2B3BA 1FBHA 1GR2A 4QFKA 4I40A 3G3HA 1ZU0A 3U94A 2GHAA 4R74A 3EPEA 2I3WA 1O7TA 4O3CA 4O7MA 1K9ZA 2XXPA 4DXUA 4JWYA 4RYAA 1GTKA 1OVBA 5EYHA 4G2ZA 1USYE 4OVSA 4YB7A 5EYGA 3VVFA 3S2VA 4PETA 2PBWA 1IMBA 3IJXB 3MAMA 3TKDA 4FECA 1FW0A 3FXBA 3IJOB 3G7WA 1Q35A 4H65A 4NWDA 3TTNA 4H8IA 1FPFA 4F3SA 4GWSA 2CZLA 2XWKA 5EQ8A 4F18A 4PTKA 4F1VA 2F34A 3RLFE 1JVYA 4P1EA 2AL5A 2CEYA 3N94A 1TXFA 3GBBA 3HFUA 1TT1A 3KN8A 1AL3A 2XXHA 1B52A 4MEVA 2QS4A 4OESA 3FGSA 2HQ0A 4GWOA 3G3IA 1KA1A 1BTJA 5L9OA 1YAEA 2QJEA 4ISUA 5F7VA 3TTLA 2B65A 3R6UA 2HXRA 1R1NA 3B7DA 4ELPA 4DCYA 2BJJX 2V3UA 3HPIA 3VLWA 3K1PA 1FQEA 1MDP1 2ESNA 1LBCA 4YB5A 3EQ1A 2XXRA 4Q8RA 3SEVA 5TP9A 1OLCA 3QIMA 4U23A 4GF8A 3GZGA 1IMFA 4GIZA 3LUYA 1JW5A 3O29A 4N8GA 3FUZA 1SDXA 2Y7RA 5I57A 4G8NA 3K4UA 4JVDA 1Y3QA 1MG1A 1XI6A 2I0CA 4RK9A 5K2XA 4HXVA 3KN3A 3TPAA 3IOWA 4LP2B 1A99A 5KDTA 4MH5A 1MH4A 4I9DA 1SW5A 1YYZA 4LZ8A 3MWBA 3C31A 2Y7PA 2D5WA 5FTHA 3FVKA 1T0KA 1WVJA 1M5EA 5CC2A 1AWBA 3PMXA 4G8HA 5ET7A 2UYFA 2MKZA 2DOJA 1FQFA 3IFCA 1MRPA 3C34A 4ELOA 1RDZA 2YLNA 4U4SA 3ROJA 4GD5A 4HCWA 2GFEA 4NHBA 3SEUA 3AXFA 3VV5A 2DYXA 2RC8A 3GXAA 1BKAA 2R71A 3Q29A 3FV1A 3UGWA 3BBRA 4OA4A 1B32A 4PCDA 3CI8A 2L5VA 3CG1A 3PU5A 4QFPA 4OENA 2ZYOA 4O94A 1FBFA 2Y7WA 1GV8A 3T9UA 1LAGE 3S9LC 3O6IA 3RNNA 3THIA 1IMAA 2PFZA 2D21A 4JSDA 1IUDA 3SETA 4P47A 4UA8A 5FBPA 4FE8A 1Y9UA 2QS3A 4FIMA 4DZ1A 2A5SA 5I7IA 1VSOA 1NKXA 3QXMA 4OXVA 3K1MA 2WX9A 4O3AA 3H3GA 4AB5A 2VGQA 2REGA 1FQBA 4P0GA 4PFYA 3T22A 1NV4A 2Y7IA 3RPLB 3HSTA 3TZAA 4OVTA 4IO2A 3SESA 4IO3A 2F5XA 3T1BA 3QMFA 4LQ5A 4F2QA 3KJTA 4N6DA 1H43A 4DLDA 4ZEDA 3BFTA 4PFWA 2R9JA 5I2KB 5CMBA 2WYKA 4N6PA 4DE8A 2Z22A 4ZZAA 1MM7A 5FHNA 3U8QA 4GX4A 4OFLA 4H6DA 3OEKA 5H8QB 3MJNA 3QAXA 1IIWA 3JV9A 2WBBA 2D3IA 2F7CA 4C1TA 4NTLA 1QKBA 4WEDA 4NF4A 2A5TB 3T9HB 3U65A 1JNFA 1EZOA 4BLAA 2HHMA 3KGCA 2V3QA 3KEIA 1MXUA 1MPDA 1H44A 1CB6A 5JTYA 2QVRA 3FVOA 1NV1A 3V89B 5L9MA 3EN3A 4P8BA 3IX1A 4I8CA 1FPDA 1LFIA 3PUXE 2UVHA 3K1NA 5H8HB 2X7QA 3CHGA 4EDPA 4ELRA 1EYIA 2KR0A 4U1ZA 2NVUB 3M8UA 4P1LA 1M5DA 4QSEA 4XKQA 1FPLA 2RC7A 2O84X 4MBPA 4R73A 3T9VA 3W9VA 1A7LA 4H67A 4MLVA 2XXIA 4G68A 1LAXA 2UVIA 5FHMA 3B6TA 3N6UA 4O7IA 3ECRA 4GFRA 1FQAA 2UYEA 5I58B 2I6EA 4JWXA 5H8FA 2ZNUA 2O1LA 1XT8A 4NF0A 2FBPA 3BIHA 5IZ3B 3IOVA 4YMBA 2F6GA 4YKJA 1Y20A 1A8EA 3OENA 3S9NC 1OMPA 1ZBMA 3HO7A 3PPQA 1KWHA 1SI0A 5CBRA 1XC1A 3K6WA 4N81A 5EHSA 4YKIA 2XXQA 1FJ9A 1USYH 2CZIA 1MXVA 4HE2A 3E9XA 1SI1A 1PB7A 3IFAA 1DBZA 3KC1A 5HBCA 4PAFA 5IZ1A 5KZTA 3RT6B 3TCHA 2GHBA 1IMEA 4GWYA 2AL4A 1B0HA 2P0SA 5I56A 1XS5A 3OSQA 2O7UA 5AA2B 4O3BA 1N04A 4NX1A 4NF6B 4U2RA 3C32A 3MBPA 1ZTYA 2OJTA 2E1SA 1I6AA 4RY1A 2QVUA 3KSJA 1N84A 2Z23A 1KA0A 4QFOA 1SW4A 1HSJA 2CEXA 4KCCA 3C9HA 4DXCA 5AA1A 5ISUA 4F1YA 1MDQA 1J1NA 3TTMA 4OVQA 4PQJA 1JVXA 3TELA 3RN8A 4C1UA 1N76A 5KCJA 4GRKA 1FSAA 1B3LA 1LGBC 1FPKA 4Q0CA 4DIGA 3SZPA 2QMWA 4DI4B 2CZKA 4U22A 3MW0A 1OLAA 2F35A 1B3EA 5ET8A 3GLBA 2G93A 3D4CA 4WXJA 5A5XA 5DT6A 2XXYA 2DVZA 2RKMA 1FPEA 1QVSA 4OZ9A 1G0HA 4LUBA 3E13X 1N3XA 3MYUA 2O7IA 1FJ6A 3FASA 1L5TA 2PT1A 2Z8EA 4GXAA 4BDOA 3QYTA 2GH9A 4MIJA 3M3FA 2O69A 4ONYA 3VLUA 1FBEA 1FTAA 4OFJA 3HV1A 3FXQA 2NWJA 4HE1A 1B7UA 1FCKA 5TPAB 2PFYA 2O68A 1B3GA 1US5A 4GLIA 4I3YA 3HHGA 2XA5A 4WKMA 1FTKA 4PC9A 3OO8A 3UP9A 4XF5A 1LSTA 4Z0IA 3K6VA 1URDA 4PAIA 2DSFA 3MPKA 4EQ7A 4R6HA 3F11A 3LSFB 2XHDA 5H8SA 1MQIA 2IA4A 4IY5A 3S9EA 4QFLA 1UIUA 4R75A 4YAHX 4K3FA 2XWVA 5I2NB 4ZEIA 4F39A 2IEEA 1S7YA 4TOZA 2VHAA 2REJA 1VE4A 3B6QA 4JWOA 4WEPA 4Q5TA 2V84A 4NAPA 4PFUA 4P11A 3PPPA 1PB9A 3MVXA 4PBQA 4ZDMA 4GXSB 3TQWA 3MC2A 1QUKA 4F3PA 3FJ7A 4Z7EA 4FJPA 3RTWB 3SDFA 1NNKA 3SEWA 2F78A 2WKYA 4GL8A 1NFTA 3H06B 4XTCQ 2AIXA 4EF1A 3NOHA 3TUSA 4NF5B 4PFIA 1IXIA 2Q8MA 4AS5A 3MP1A 4QSCA 1QKAA 3IO6A 2Q9TA 1BP5A 3VVEA 4NE4A 1SYIA 3KBZA 4NG7A 3N26A 3GBAA 1TFAA 1NV2A 1MPCA 4F3GA 4R9FA 1B1HA 4XFEA 1ANFA 2Y84A 3QUJA 5H8NA 4PF8A 3DM0A 3A3UA 1MQJA 2ZYNA 3B50A 2Y5KA 4IY6A 4JBZA 2I58A 3H6VA 5ITPA 4MX6A 3R7XA 4N8YA 3OD7A 4KI0E 1NV7A 2QS1A 5EQ7A 1SPIA 2HCAA 2JJKA 4AB6A 1Z7NE 2DDKA 3K6XA 2FIEA 4LN5A 3HHFA 3IORA 2BJIA 3CR9A 4IO4A 3PMWA 1R9LA 4OTEA 2F7AA 3QUFA 2GQ1A 1NL5A 4DI3D 4NF8A 1DOTA 4P9KA 3PPNA 3FXRA 3DELB 4F22A 1RYOA 4G61A 4N07A 4QSDA 4RJZA 1KZ8A 2E0SA 1B7ZA 5LTCA 1A55A 5AA4B 3Q26A 3LC8A 4OEVA 4Q30B 5DEXB 4GOTA 4X1DA 1BK4A 4JSOA 5CMMA 3A09A 4JVCA 3IL1B 3PD8A 1M5FA 3RGYA 3ILTB 4PAKA 3K01A 4PFTA 4QBAA 5I59B 1B4HA 2QMXA 3GYYA 1M5CA 1DTGA 4MHFA 5AE4A 2O1MA 1ELJA 1IXHA 1PB8A 3T66A 2PYYA 3WAFA 3PUVE 1FQCA 4F29A 5CM6A 3C33A 4N6KA 4ZEKA 1DPPA 4MCOA 2RCBA 1FPBA 1FBDA 3OEMA 4EUOA 3H4ZA 5L8DA 2PMSA 3ISPA 1H45A 3U1OA 1Y1MA 1S50A 1IXGA 2XWIA 4FBPA 4LA9A 1D9YA 4L17A 4R2BA 4HTGA 3T96B 3TCFA 4NGUA 4XKNA 1Y4TA 2Q2AA 4E0XA 4M1VA 1B7HA 4OHNA 3IR1A 2FIXA 2ABHA 3TTRA 1FTLA 1H76A 3G3GA 1IXCA 1B40A 1EYJA 4MF3A 2X7PA 3MVYA 1D4NA 4EQBA 3OSRA 2UXAA 3N5LA 2R8TA 4IB2A 4EXLA 3E4RA 2B4LA 3DP4A 3CVGA 5TU0A 4EXKA 1PBPA 3MVZA 2DQVA 2H9BA 1UQWA 5IAIA 4NN3A 2HXWA 4OVPA 3EHUA 2DP8A 4MLQA 2NUVA 2KLFA 4UACA 1D9VA 1G0IA 2QL3A 4OERA 1FTJA 1XVXA 5L9SA 2R6GE 3G3FA 4KYEA 1Y3NA 1POTA 4F31B 1EYKA 3FJGA 1JEVA 4PF6A 3CRBA 4OETA 2ANJA 4G4PA 3RPWA 4ESWA 3M3KA 4P0IA 4IGTA 2OX3A 1D3KA 4ZEBA 5I84A 4R72A 4PE3A 2F97A 3TFLA 3RUMA 2WEFA 1RYXA 1SW1A 2FA7A 3LR1A 1P99A 1Y4CA 3DP8A 3PUZE 1OIBA 2I3VA 3P7IA 3DP6A 3VFJA 3SEYA 4OANA 2VD2A 1AIVA 3MUQA 2Q88A 3KOSA 2DWJA 1QW0A 3ILUB 4KFQA 4OMBA 1LBVA 3LV0A 3MP6A 3U93A 2UVGA 1LBZA 4AS4A 3KG2A 4YU0A 3KBRA 3CSBA 3TDJA 3H6WA 4PE5B 3D1RA 1UTBB 4GWZA 2ONKE 3KC0A 3K0VA 2DWIA 5J1DA 2OWSA 2XXKA 4UABA 3BIGA 3VDFA 3OO7A 2VP1A 4P3LA 1UTHB 4GX6A 1IZ1A 4OVRA 3K6UA 2HZKA 1QULA 3TMGA 2QFLA 4PDDA 3RQTA 4QFNA 1II5A 4N17A 5CMCA 5A5LA 1MY4A 2H25A 1VDWA 2P3NA 1B58A 4LATA 3O97A 4EQ9A 3EHTA 3PUYE 1XHYA 1Q1KA 4O8MA 2GRVA 1BIYA 3IOUA 3KZGA 3KOTA 4XEQA 2F8DA 2ONRA 1LBWA 5IGAA 2RCAA 1VFEA 4N4UA 2PVUA 1B4ZA 5JEIA 2Q74A 3ZSFA 1AMFA 3SKPA 4H5GA 1NH8A 3FZVA 3HN0A 2VD3A 3RPLA 3I5OA 4ELQA 3MZ9A 5BWJA 3CG3A 4R2FA 4G77A 1QUJA 5CMKA 3PMVA 3D4GA 3JZJA 3C4MA 4TQUQ 4ZE9A 4X48A 2ZNTA 4M4GA 1NH7A 2XXUA 5I2KA 4RK2A 2I4BA 3TODA 1B3FA 1PEBA 4GL0A 2HFBA 4YKPA 1MH3A 1LB9A 1Q9DA 4QF9A 3UA8A 1B51A 2F36A 3L6GA 2OBGA 4XIGQ 5H8QA 1B6HA 1I69A 2FHYA 3H6TA 3VE1B 4ZEFA 2NOOA 2XX8A 1DK4A 4PFRA 3SEXA 2A5TA 1PBQA 3PTYA 1LCFA 4QXDA 1M5BA 5EQ9A 1P1WA 4NWCA 1P1OA 2XD2A 1JW4A 5TP9B 5DTBA 3FJMA 1S9TA 4RPNA 2Q8JA 2B3FA 1IMDA 5I57B 5H8HA 1B5HA 5CI5A 3A29A 1YTVA 3PPOA 5DVFA 1B5IA 1GVCA 4LZ7A 5KDTB 1Y1ZA 5ESYA 3MQ9A 2NXOA 4THIA 4XKRA 4IGRA 5IKBA 1FTMA 2ONSA 4P56A 4JDFA 2Y7KA 3S4UA 4MFIA 4RA1A 3V8XB 1ZJLA 2XD3A 2YJPA 3DLNA 5F1QA 2F7BA 3ZKLA 3MVWA 4HE0A 1Y3PA 2DE2A 1MPBA 5I58A 2I4CA 4NMYA 3VVDA 5AA2D 4FAJA 4ZS9A 5IZ3A 5B70A 3Q25A 4MJOA 2P3VA 2WYPA 1P1NA 4GX3A 3MSTA 1IITA 2HZLA 1NNTA 1DSNA 3OMBA 5DVIA 4X04A 3ZS6A 4YB6A 3W15C 5JK4A 2XXVA 2YPNA 4R6KA 1B1XA 4OYVA 2ZYMA 1R6ZA 1AOVA
chains in the Genus database with same CATH topology
4BDMA 1DTZA 3CFZA 1OVTA 2XXXA 3PPRA 4RPOA 1B2HA 4BDQA 3PV0E 1LLSA 3C36A 1TFDA 3L6HA 1PC3A 1ZKBA 2RC9A 3UORA 3O6GA 4FATA 2DXYA 2P2AA 1B05A 1SYHA 5AA2A 3K02A 3KN7A 1CE2A 4NF6A 4DDDA 3B6WA 1IQ7A 4QHQA 5ICQA 1OQHA 2AYSA 3O66A 4KPTA 2PT2A 1MY2A 4R9GA 3ONMA 1HSEA 4U21A 3LBSA 2OCUA 1VR5A 1SBPA 1VFDA 1LCTA 4PP0A 4ZE8A 5CBSA 3K2DA 3TCGA 1A8FA 3BFUA 4DCXA 4F19A 1MQGA 3TAJA 3OO9A 3FATA 3G3JA 4IO5A 2ZMBA 3V5AA 1XVYA 4RNSA 4LQ2A 1ZIUA 3VXCA 1F9BA 2I48A 4NF4B 4FORA 5FHOA 1NNFA 4X9TA 1O63A 3W9WA 1B9JA 4F2OA 5HPQA 3CIJA 1B46A 4LVQA 2DE3A 5JTYB 2LAOA 2PX1A 2X26A 4I62A 4IO7A 5ICTA 1SQYA 5TPAA 1MQHA 4OQOA 4C0RA 1LBBA 4RXLA 3RT8A 1LFGA 4YICA 4POWA 2QPQA 1US4A 1FQDA 1N7XA 3M3LA 1B0LA 3SERA 4ECFA 3MZBA 1N7WA 4I1DA 2Z8DA 2Q2CA 3H03A 4N13A 4G68B 4H0WA 2OZZA 4HW8A 5I2NA 3Q27A 3FVGA 1JETA 1A40A 3FVNA 2I0BA 2V25A 3OELA 4TLLB 2H98A 2HEUA 2OLBA 5H8FB 4JB7A 4YMAA 4U4XA 3PGFA 2ALUA 3KFMA 3IAZA 3LSXA 4QRZA 2UVJA 3O2AA 4OEUA 4EF2A 3MP8A 2XXTA 3TYHA 2RINA 4NF5A 4F1UA 4ZZEA 1QUIA 1AH5A 3Q28A 4ND9A 1PDAA 5FTIA 1SD3A 3S9MC 1EZPA 1P1QA 3QK6A 1QJMA 3VXBA 3H7MA 2THIA 3G3KA 4JXIA 3O9PA 3T93B 1EZ9A 1MY3A 2HAUA 4GVOA 3UIFA 1YCJA 3KJ7A 5I56B 4H5FA 4ZECA 4X1BA 2XX9A 5K2YA 1I6QA 1MXXA 2FYIA 4YKKA 3FXUA 2F6PA 3A3CA 1A54A 4U1OA 2DVCA 5B7DA 1H3DA 3LSLA 5KCJB 1WDNA 1EU8A 3OOAA 3IOTA 5AA3A 1ATGA 5EHMA 1LFHA 1MXZA 4KR5A 1SVXB 2ZYKA 3OO6A 3O28A 3U72A 5A5XB 5ELVA 5AA4A 3IB2A 5CRYA 3V83A 2QSXA 3EHSA 5DEXA 3TTKA 2OK2A 4OFOA 2I49A 2HAVA 1NMUA 1XOCA 2W7YA 5BUUA 2XX7A 3FIRA 3LSWA 5HM4B 1MY0A 5I59A 5EYFA 1IEJA 4AQ4A 2H5YA 1MXWA 4KD5A 5ITOA 3EF7A 1MQDA 3PD9A 4DXBA 2G29A 4ESXA 3TEPA 1MM6A 2V93A 3FD3A 2DS9A 1DPEA 3CSGA 4TLMB 4FEBA 1RKMA 1YPNA 1JW1A 1JEUA 4KCDA 3I6VA 3R26A 1FTOA 4KYDA 1OQGA 1NNPA 2VOZA 2H4IA 1N0TA 3HCQA 3ODBA 2H99A 1MXYA 1ZMGA 3I3VA 4GQOA 2M8CA 3KSXA 4LZ5A 1BLFA 1POY1 3IB0A 3RTFB 5LOMA 1MS7A 4F3BA 3USDA 4XKPA 1SW2A 5DVJA 5M2VA 3O6HA 3C35A 2O51A 1B3HA 3IB1A 3RY3A 4KYSA 1WODA 4YZZA 2V3TA 1HSLA 1R9QA 3JYRA 4XXUA 3UK4A 1I6BA 2CMOA 5H8NB 1P1UA 4R6YA 1DMBA 5DYHA 4G68C 3PUWE 2P1SA 2Q89A 1JQFA 1LB8A 2DWAA 3H6UA 3K00A 1B5JA 1LAFE 2Z8FA 4FEDA 2O6AA 3IO4A 3FV2A 4H8JA 3QSLA 2XXWA 4BDRA 4HS7A 2DXRA 3MZ1A 3E3KA 1TWYA 2ZXTA 4HCYA 3IK6B 1N3WA 3WAEA 2DE4A 3MPLA 2ZNSA 3OXNA 4BDLA 4NF8B 4NEDA 4KQPA 4E0WA 3VLVA 1GGGA 1O64A 1UIVA 3U92A 4G8MA 2OWTA 2RF1A 4KHZE 3CFLA 1URGA 2DWHA 1UTBA 4H1XA 1ZLQA 1EH3A 2FNCA 4OVJA 1UTHA 4BDNA 3TQLA 1Z7ME 3BKIB 4IO6A 4POXA 4OWDA 3T9XB 4LONB 1LAHE 2QS2A 1MY1A 1URSA 2QRYA 3N6TA 3ZKKA 3CFXA 3UN6A 2B3BA 1GR2A 4QFKA 3G3HA 1ZU0A 3U94A 2GHAA 4R74A 3EPEA 2I3WA 1O7TA 4O3CA 2XXPA 4DXUA 4JWYA 4RYAA 1GTKA 1OVBA 4G2ZA 1USYE 4YB7A 3VVFA 3S2VA 4PETA 2PBWA 3IJXB 3MAMA 3TKDA 4FECA 1FW0A 3IJOB 3G7WA 1Q35A 4H65A 4NWDA 3TTNA 4H8IA 4F3SA 2CZLA 4F18A 4F1VA 2F34A 3RLFE 1JVYA 2AL5A 3N94A 1TXFA 3GBBA 1TT1A 3KN8A 1AL3A 2XXHA 1B52A 2QS4A 4OESA 3FGSA 2HQ0A 4GWOA 3G3IA 1BTJA 5L9OA 1YAEA 2QJEA 4ISUA 5F7VA 3TTLA 2B65A 3R6UA 1R1NA 3B7DA 4ELPA 4DCYA 2BJJX 2V3UA 3HPIA 3VLWA 3K1PA 1FQEA 1MDP1 2ESNA 1LBCA 4YB5A 3EQ1A 2XXRA 4Q8RA 3SEVA 5TP9A 1OLCA 3QIMA 4U23A 4GF8A 3GZGA 4GIZA 3LUYA 1JW5A 3O29A 3FUZA 1SDXA 2Y7RA 5I57A 4G8NA 3K4UA 1Y3QA 1MG1A 2I0CA 4RK9A 5K2XA 3TPAA 3KN3A 3IOWA 4LP2B 1A99A 5KDTA 4MH5A 1MH4A 4I9DA 1SW5A 4LZ8A 3MWBA 3C31A 2Y7PA 2D5WA 5FTHA 3FVKA 1T0KA 1WVJA 1M5EA 5CC2A 3PMXA 4G8HA 2UYFA 2DOJA 1FQFA 1MRPA 3C34A 4ELOA 2YLNA 4U4SA 4GD5A 4HCWA 2GFEA 3SEUA 3AXFA 3VV5A 2DYXA 2RC8A 3GXAA 1BKAA 2R71A 3Q29A 3FV1A 3UGWA 3BBRA 1B32A 3CI8A 3CG1A 3PU5A 4QFPA 4OENA 2ZYOA 2Y7WA 1GV8A 3T9UA 1LAGE 3S9LC 3O6IA 3RNNA 3THIA 2D21A 4JSDA 1IUDA 3SETA 4UA8A 4FE8A 1Y9UA 2QS3A 4FIMA 4DZ1A 2A5SA 1VSOA 1NKXA 3QXMA 4OXVA 3K1MA 4O3AA 3H3GA 4AB5A 2VGQA 2REGA 1FQBA 4P0GA 4PFYA 3T22A 2Y7IA 3HSTA 3TZAA 4IO2A 3SESA 4IO3A 2F5XA 4LQ5A 4F2QA 3KJTA 1H43A 4DLDA 4ZEDA 3BFTA 4PFWA 2R9JA 5I2KB 5CMBA 4N6PA 4DE8A 2Z22A 4ZZAA 1MM7A 5FHNA 3U8QA 4OFLA 4H6DA 3OEKA 5H8QB 3MJNA 3QAXA 1IIWA 3JV9A 2D3IA 2F7CA 4C1TA 4NTLA 1QKBA 4WEDA 4NF4A 2A5TB 3T9HB 1JNFA 1EZOA 4BLAA 3KGCA 2V3QA 3KEIA 1MXUA 1MPDA 1H44A 1CB6A 5JTYA 3FVOA 3V89B 5L9MA 3EN3A 3IX1A 4I8CA 1LFIA 3PUXE 2UVHA 3K1NA 5H8HB 2X7QA 4EDPA 4ELRA 4U1ZA 2NVUB 3M8UA 1M5DA 4QSEA 4XKQA 2RC7A 2O84X 4MBPA 4R73A 3T9VA 3W9VA 1A7LA 4H67A 4MLVA 2XXIA 4G68A 1LAXA 2UVIA 5FHMA 3B6TA 3N6UA 3ECRA 4GFRA 1FQAA 2UYEA 5I58B 2I6EA 4JWXA 5H8FA 2ZNUA 2O1LA 1XT8A 3IOVA 4YMBA 2F6GA 4YKJA 1Y20A 1A8EA 3OENA 3S9NC 1OMPA 1ZBMA 3HO7A 3PPQA 1KWHA 1SI0A 5CBRA 1XC1A 3K6WA 5EHSA 4YKIA 2XXQA 1USYH 1MXVA 3E9XA 1SI1A 1PB7A 5HBCA 5KZTA 3RT6B 3TCHA 2GHBA 2AL4A 1B0HA 2P0SA 5I56A 1XS5A 3OSQA 2O7UA 5AA2B 4O3BA 1N04A 4NF6B 4U2RA 3C32A 3MBPA 1ZTYA 2OJTA 2E1SA 1I6AA 4RY1A 3KSJA 1N84A 2Z23A 4QFOA 1SW4A 1HSJA 4KCCA 3C9HA 4DXCA 5AA1A 5ISUA 4F1YA 1MDQA 1J1NA 3TTMA 4PQJA 1JVXA 3TELA 3RN8A 4C1UA 1N76A 5KCJA 4GRKA 1B3LA 1LGBC 4Q0CA 4DIGA 2QMWA 4U22A 3MW0A 1OLAA 2F35A 1B3EA 3GLBA 2G93A 3D4CA 4WXJA 5A5XA 5DT6A 2XXYA 2DVZA 2RKMA 1QVSA 4OZ9A 4LUBA 3E13X 1N3XA 2O7IA 3FASA 1L5TA 2PT1A 2Z8EA 4GXAA 4BDOA 3QYTA 2GH9A 3M3FA 2O69A 4ONYA 3VLUA 4OFJA 3HV1A 3FXQA 2NWJA 1B7UA 1FCKA 5TPAB 2O68A 1B3GA 1US5A 4GLIA 3HHGA 4WKMA 1FTKA 3OO8A 3UP9A 1LSTA 4Z0IA 3K6VA 1URDA 2DSFA 3MPKA 4EQ7A 4R6HA 3F11A 3LSFB 2XHDA 5H8SA 1MQIA 2IA4A 4IY5A 3S9EA 4QFLA 1UIUA 4R75A 4YAHX 4K3FA 5I2NB 4ZEIA 4F39A 2IEEA 1S7YA 4TOZA 2VHAA 2REJA 1VE4A 3B6QA 4JWOA 4WEPA 4Q5TA 2V84A 4PFUA 4P11A 3PPPA 1PB9A 3MVXA 4ZDMA 4GXSB 3TQWA 3MC2A 1QUKA 4F3PA 3FJ7A 4Z7EA 4FJPA 3RTWB 3SDFA 1NNKA 3SEWA 2F78A 2WKYA 4GL8A 1NFTA 3H06B 4XTCQ 2AIXA 4EF1A 3TUSA 4NF5B 1IXIA 3MP1A 4QSCA 1QKAA 3IO6A 2Q9TA 1BP5A 3VVEA 4NE4A 1SYIA 3N26A 3GBAA 1TFAA 1MPCA 4F3GA 4R9FA 1B1HA 1ANFA 2Y84A 3QUJA 5H8NA 3DM0A 3A3UA 1MQJA 2ZYNA 4IY6A 4JBZA 2I58A 3H6VA 5ITPA 3R7XA 3OD7A 4KI0E 2QS1A 2HCAA 4AB6A 1Z7NE 3K6XA 3HHFA 3IORA 3CR9A 4IO4A 3PMWA 1R9LA 4OTEA 2F7AA 3QUFA 1NL5A 4NF8A 1DOTA 3PPNA 3FXRA 3DELB 4F22A 1RYOA 4N07A 4QSDA 4RJZA 2E0SA 1B7ZA 1A55A 5AA4B 3Q26A 3LC8A 4OEVA 4Q30B 5DEXB 4GOTA 4X1DA 4JSOA 5CMMA 3A09A 3IL1B 3PD8A 1M5FA 3RGYA 3ILTB 3K01A 4PFTA 5I59B 1B4HA 2QMXA 1M5CA 1DTGA 5AE4A 2O1MA 1ELJA 1IXHA 1PB8A 3T66A 2PYYA 3WAFA 3PUVE 1FQCA 4F29A 5CM6A 3C33A 4ZEKA 1DPPA 2RCBA 3OEMA 4EUOA 3H4ZA 5L8DA 2PMSA 1H45A 3U1OA 1Y1MA 1S50A 1IXGA 4LA9A 1D9YA 4L17A 4R2BA 4HTGA 3T96B 3TCFA 4XKNA 1Y4TA 2Q2AA 4E0XA 4M1VA 1B7HA 4OHNA 3IR1A 2ABHA 3TTRA 1FTLA 1H76A 3G3GA 1IXCA 1B40A 4MF3A 2X7PA 3MVYA 1D4NA 4EQBA 3OSRA 2UXAA 3N5LA 4IB2A 4EXLA 3E4RA 3DP4A 3CVGA 5TU0A 4EXKA 1PBPA 3MVZA 2DQVA 2H9BA 1UQWA 5IAIA 2HXWA 3EHUA 2DP8A 4MLQA 2NUVA 2KLFA 4UACA 1D9VA 2QL3A 4OERA 1FTJA 1XVXA 5L9SA 2R6GE 3G3FA 4KYEA 1Y3NA 1POTA 4F31B 3FJGA 1JEVA 3CRBA 4OETA 2ANJA 4G4PA 3RPWA 4ESWA 3M3KA 4P0IA 4IGTA 1D3KA 4ZEBA 5I84A 4R72A 2F97A 3TFLA 3RUMA 1RYXA 1SW1A 2FA7A 3LR1A 1P99A 1Y4CA 3DP8A 3PUZE 1OIBA 2I3VA 3P7IA 3DP6A 3VFJA 3SEYA 2VD2A 1AIVA 3MUQA 2Q88A 3KOSA 2DWJA 1QW0A 3ILUB 4KFQA 4OMBA 3MP6A 3U93A 2UVGA 3KG2A 4YU0A 3KBRA 3CSBA 3TDJA 3H6WA 4PE5B 1UTBB 2ONKE 3K0VA 2DWIA 5J1DA 2OWSA 3VDFA 3OO7A 2VP1A 1UTHB 1IZ1A 3K6UA 2HZKA 1QULA 3TMGA 3RQTA 4QFNA 1II5A 5CMCA 1MY4A 2H25A 1B58A 4LATA 3O97A 4EQ9A 3EHTA 3PUYE 1XHYA 1Q1KA 2GRVA 1BIYA 3IOUA 3KZGA 3KOTA 2F8DA 2ONRA 2RCAA 1VFEA 2PVUA 1B4ZA 5JEIA 3ZSFA 1AMFA 3SKPA 4H5GA 1NH8A 3FZVA 3HN0A 2VD3A 3I5OA 4ELQA 3MZ9A 5BWJA 3CG3A 4R2FA 4G77A 1QUJA 5CMKA 3PMVA 3D4GA 3JZJA 3C4MA 4TQUQ 4ZE9A 4X48A 2ZNTA 4M4GA 1NH7A 2XXUA 5I2KA 4RK2A 2I4BA 3TODA 1B3FA 1PEBA 4GL0A 2HFBA 4YKPA 1MH3A 1LB9A 4QF9A 3UA8A 1B51A 2F36A 3L6GA 2OBGA 4XIGQ 5H8QA 1B6HA 1I69A 3H6TA 3VE1B 4ZEFA 2NOOA 2XX8A 3SEXA 2A5TA 1PBQA 1LCFA 1M5BA 1P1WA 4NWCA 1P1OA 2XD2A 1JW4A 5TP9B 5DTBA 3FJMA 1S9TA 4RPNA 2Q8JA 2B3FA 5I57B 5H8HA 1B5HA 5CI5A 1YTVA 3PPOA 5DVFA 1B5IA 1GVCA 4LZ7A 5KDTB 1Y1ZA 3MQ9A 2NXOA 4THIA 4XKRA 4IGRA 5IKBA 1FTMA 2ONSA 4JDFA 2Y7KA 3S4UA 4MFIA 4RA1A 3V8XB 1ZJLA 2XD3A 2YJPA 3DLNA 5F1QA 2F7BA 3ZKLA 3MVWA 1Y3PA 2DE2A 1MPBA 5I58A 2I4CA 4NMYA 3VVDA 5AA2D 4FAJA 4ZS9A 5B70A 3Q25A 1P1NA 1IITA 2HZLA 1NNTA 1DSNA 3OMBA 5DVIA 3ZS6A 4YB6A 3W15C 5JK4A 2XXVA 2YPNA 4R6KA 1B1XA 4OYVA 2ZYMA 1R6ZA 1AOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDM A;  1DTZ A;  3CFZ A;  1OVT A;  2XXX A;  3PPR A;  4RPO A;  1B2H A;  4BDQ A;  3PV0 E;  1LLS A;  3C36 A;  1TFD A;  3L6H A;  1PC3 A;  1ZKB A;  2RC9 A;  3UOR A;  3O6G A;  4FAT A;  2DXY A;  2P2A A;  1B05 A;  1SYH A;  5AA2 A;  3K02 A;  3KN7 A;  1CE2 A;  4NF6 A;  4DDD A;  3B6W A;  1IQ7 A;  4QHQ A;  5ICQ A;  1OQH A;  2AYS A;  3O66 A;  4KPT A;  2PT2 A;  1MY2 A;  4R9G A;  3ONM A;  1HSE A;  4U21 A;  3LBS A;  2OCU A;  1VR5 A;  1SBP A;  1VFD A;  1LCT A;  4PP0 A;  4ZE8 A;  5CBS A;  3K2D A;  3TCG A;  1A8F A;  3BFU A;  4DCX A;  4F19 A;  1MQG A;  3TAJ A;  3OO9 A;  3FAT A;  3G3J A;  4IO5 A;  2ZMB A;  3V5A A;  1XVY A;  4RNS A;  4LQ2 A;  1ZIU A;  3VXC A;  1F9B A;  2I48 A;  4NF4 B;  4FOR A;  5FHO A;  1NNF A;  4X9T A;  1O63 A;  3W9W A;  1B9J A;  4F2O A;  5HPQ A;  3CIJ A;  1B46 A;  4LVQ A;  2DE3 A;  5JTY B;  2LAO A;  2PX1 A;  2X26 A;  4I62 A;  4IO7 A;  5ICT A;  1SQY A;  5TPA A;  1MQH A;  4OQO A;  4C0R A;  1LBB A;  4RXL A;  3RT8 A;  1LFG A;  4YIC A;  4POW A;  2QPQ A;  1US4 A;  1FQD A;  1N7X A;  3M3L A;  1B0L A;  3SER A;  4ECF A;  3MZB A;  1N7W A;  4I1D A;  2Z8D A;  2Q2C A;  3H03 A;  4N13 A;  4G68 B;  4H0W A;  2OZZ A;  4HW8 A;  5I2N A;  3Q27 A;  3FVG A;  1JET A;  1A40 A;  3FVN A;  2I0B A;  2V25 A;  3OEL A;  4TLL B;  2H98 A;  2HEU A;  2OLB A;  5H8F B;  4JB7 A;  4YMA A;  4U4X A;  3PGF A;  2ALU A;  3KFM A;  3IAZ A;  3LSX A;  4QRZ A;  2UVJ A;  3O2A A;  4OEU A;  4EF2 A;  3MP8 A;  2XXT A;  3TYH A;  2RIN A;  4NF5 A;  4F1U A;  4ZZE A;  1QUI A;  1AH5 A;  3Q28 A;  4ND9 A;  1PDA A;  5FTI A;  1SD3 A;  3S9M C;  1EZP A;  1P1Q A;  3QK6 A;  1QJM A;  3VXB A;  3H7M A;  2THI A;  3G3K A;  4JXI A;  3O9P A;  3T93 B;  1EZ9 A;  1MY3 A;  2HAU A;  4GVO A;  3UIF A;  1YCJ A;  3KJ7 A;  5I56 B;  4H5F A;  4ZEC A;  4X1B A;  2XX9 A;  5K2Y A;  1I6Q A;  1MXX A;  2FYI A;  4YKK A;  3FXU A;  2F6P A;  3A3C A;  1A54 A;  4U1O A;  2DVC A;  5B7D A;  1H3D A;  3LSL A;  5KCJ B;  1WDN A;  1EU8 A;  3OOA A;  3IOT A;  5AA3 A;  1ATG A;  5EHM A;  1LFH A;  1MXZ A;  4KR5 A;  1SVX B;  2ZYK A;  3OO6 A;  3O28 A;  3U72 A;  5A5X B;  5ELV A;  5AA4 A;  3IB2 A;  5CRY A;  3V83 A;  2QSX A;  3EHS A;  5DEX A;  3TTK A;  2OK2 A;  4OFO A;  2I49 A;  2HAV A;  1NMU A;  1XOC A;  2W7Y A;  5BUU A;  2XX7 A;  3FIR A;  3LSW A;  5HM4 B;  1MY0 A;  5I59 A;  5EYF A;  1IEJ A;  4AQ4 A;  2H5Y A;  1MXW A;  4KD5 A;  5ITO A;  3EF7 A;  1MQD A;  3PD9 A;  4DXB A;  2G29 A;  4ESX A;  3TEP A;  1MM6 A;  2V93 A;  3FD3 A;  2DS9 A;  1DPE A;  3CSG A;  4TLM B;  4FEB A;  1RKM A;  1YPN A;  1JW1 A;  1JEU A;  4KCD A;  3I6V A;  3R26 A;  1FTO A;  4KYD A;  1OQG A;  1NNP A;  2VOZ A;  2H4I A;  1N0T A;  3HCQ A;  3ODB A;  2H99 A;  1MXY A;  1ZMG A;  3I3V A;  4GQO A;  2M8C A;  3KSX A;  4LZ5 A;  1BLF A;  1POY 1;  3IB0 A;  3RTF B;  5LOM A;  1MS7 A;  4F3B A;  3USD A;  4XKP A;  1SW2 A;  5DVJ A;  5M2V A;  3O6H A;  3C35 A;  2O51 A;  1B3H A;  3IB1 A;  3RY3 A;  4KYS A;  1WOD A;  4YZZ A;  2V3T A;  1HSL A;  1R9Q A;  3JYR A;  4XXU A;  3UK4 A;  1I6B A;  2CMO A;  5H8N B;  1P1U A;  4R6Y A;  1DMB A;  5DYH A;  4G68 C;  3PUW E;  2P1S A;  2Q89 A;  1JQF A;  1LB8 A;  2DWA A;  3H6U A;  3K00 A;  1B5J A;  1LAF E;  2Z8F A;  4FED A;  2O6A A;  3IO4 A;  3FV2 A;  4H8J A;  3QSL A;  2XXW A;  4BDR A;  4HS7 A;  2DXR A;  3MZ1 A;  3E3K A;  1TWY A;  2ZXT A;  4HCY A;  3IK6 B;  1N3W A;  3WAE A;  2DE4 A;  3MPL A;  2ZNS A;  3OXN A;  4BDL A;  4NF8 B;  4NED A;  4KQP A;  4E0W A;  3VLV A;  1GGG A;  1O64 A;  1UIV A;  3U92 A;  4G8M A;  2OWT A;  2RF1 A;  4KHZ E;  3CFL A;  1URG A;  2DWH A;  1UTB A;  4H1X A;  1ZLQ A;  1EH3 A;  2FNC A;  4OVJ A;  1UTH A;  4BDN A;  3TQL A;  1Z7M E;  3BKI B;  4IO6 A;  4POX A;  4OWD A;  3T9X B;  4LON B;  1LAH E;  2QS2 A;  1MY1 A;  1URS A;  2QRY A;  3N6T A;  3ZKK A;  3CFX A;  3UN6 A;  2B3B A;  1GR2 A;  4QFK A;  3G3H A;  1ZU0 A;  3U94 A;  2GHA A;  4R74 A;  3EPE A;  2I3W A;  1O7T A;  4O3C A;  2XXP A;  4DXU A;  4JWY A;  4RYA A;  1GTK A;  1OVB A;  4G2Z A;  1USY E;  4YB7 A;  3VVF A;  3S2V A;  4PET A;  2PBW A;  3IJX B;  3MAM A;  3TKD A;  4FEC A;  1FW0 A;  3IJO B;  3G7W A;  1Q35 A;  4H65 A;  4NWD A;  3TTN A;  4H8I A;  4F3S A;  2CZL A;  4F18 A;  4F1V A;  2F34 A;  3RLF E;  1JVY A;  2AL5 A;  3N94 A;  1TXF A;  3GBB A;  1TT1 A;  3KN8 A;  1AL3 A;  2XXH A;  1B52 A;  2QS4 A;  4OES A;  3FGS A;  2HQ0 A;  4GWO A;  3G3I A;  1BTJ A;  5L9O A;  1YAE A;  2QJE A;  4ISU A;  5F7V A;  3TTL A;  2B65 A;  3R6U A;  1R1N A;  3B7D A;  4ELP A;  4DCY A;  2BJJ X;  2V3U A;  3HPI A;  3VLW A;  3K1P A;  1FQE A;  1MDP 1;  2ESN A;  1LBC A;  4YB5 A;  3EQ1 A;  2XXR A;  4Q8R A;  3SEV A;  5TP9 A;  1OLC A;  3QIM A;  4U23 A;  4GF8 A;  3GZG A;  4GIZ A;  3LUY A;  1JW5 A;  3O29 A;  3FUZ A;  1SDX A;  2Y7R A;  5I57 A;  4G8N A;  3K4U A;  1Y3Q A;  1MG1 A;  2I0C A;  4RK9 A;  5K2X A;  3TPA A;  3KN3 A;  3IOW A;  4LP2 B;  1A99 A;  5KDT A;  4MH5 A;  1MH4 A;  4I9D A;  1SW5 A;  4LZ8 A;  3MWB A;  3C31 A;  2Y7P A;  2D5W A;  5FTH A;  3FVK A;  1T0K A;  1WVJ A;  1M5E A;  5CC2 A;  3PMX A;  4G8H A;  2UYF A;  2DOJ A;  1FQF A;  1MRP A;  3C34 A;  4ELO A;  2YLN A;  4U4S A;  4GD5 A;  4HCW A;  2GFE A;  3SEU A;  3AXF A;  3VV5 A;  2DYX A;  2RC8 A;  3GXA A;  1BKA A;  2R71 A;  3Q29 A;  3FV1 A;  3UGW A;  3BBR A;  1B32 A;  3CI8 A;  3CG1 A;  3PU5 A;  4QFP A;  4OEN A;  2ZYO A;  2Y7W A;  1GV8 A;  3T9U A;  1LAG E;  3S9L C;  3O6I A;  3RNN A;  3THI A;  2D21 A;  4JSD A;  1IUD A;  3SET A;  4UA8 A;  4FE8 A;  1Y9U A;  2QS3 A;  4FIM A;  4DZ1 A;  2A5S A;  1VSO A;  1NKX A;  3QXM A;  4OXV A;  3K1M A;  4O3A A;  3H3G A;  4AB5 A;  2VGQ A;  2REG A;  1FQB A;  4P0G A;  4PFY A;  3T22 A;  2Y7I A;  3HST A;  3TZA A;  4IO2 A;  3SES A;  4IO3 A;  2F5X A;  4LQ5 A;  4F2Q A;  3KJT A;  1H43 A;  4DLD A;  4ZED A;  3BFT A;  4PFW A;  2R9J A;  5I2K B;  5CMB A;  4N6P A;  4DE8 A;  2Z22 A;  4ZZA A;  1MM7 A;  5FHN A;  3U8Q A;  4OFL A;  4H6D A;  3OEK A;  5H8Q B;  3MJN A;  3QAX A;  1IIW A;  3JV9 A;  2D3I A;  2F7C A;  4C1T A;  4NTL A;  1QKB A;  4WED A;  4NF4 A;  2A5T B;  3T9H B;  1JNF A;  1EZO A;  4BLA A;  3KGC A;  2V3Q A;  3KEI A;  1MXU A;  1MPD A;  1H44 A;  1CB6 A;  5JTY A;  3FVO A;  3V89 B;  5L9M A;  3EN3 A;  3IX1 A;  4I8C A;  1LFI A;  3PUX E;  2UVH A;  3K1N A;  5H8H B;  2X7Q A;  4EDP A;  4ELR A;  4U1Z A;  2NVU B;  3M8U A;  1M5D A;  4QSE A;  4XKQ A;  2RC7 A;  2O84 X;  4MBP A;  4R73 A;  3T9V A;  3W9V A;  1A7L A;  4H67 A;  4MLV A;  2XXI A;  4G68 A;  1LAX A;  2UVI A;  5FHM A;  3B6T A;  3N6U A;  3ECR A;  4GFR A;  1FQA A;  2UYE A;  5I58 B;  2I6E A;  4JWX A;  5H8F A;  2ZNU A;  2O1L A;  1XT8 A;  3IOV A;  4YMB A;  2F6G A;  4YKJ A;  1Y20 A;  1A8E A;  3OEN A;  3S9N C;  1OMP A;  1ZBM A;  3HO7 A;  3PPQ A;  1KWH A;  1SI0 A;  5CBR A;  1XC1 A;  3K6W A;  5EHS A;  4YKI A;  2XXQ A;  1USY H;  1MXV A;  3E9X A;  1SI1 A;  1PB7 A;  5HBC A;  5KZT A;  3RT6 B;  3TCH A;  2GHB A;  2AL4 A;  1B0H A;  2P0S A;  5I56 A;  1XS5 A;  3OSQ A;  2O7U A;  5AA2 B;  4O3B A;  1N04 A;  4NF6 B;  4U2R A;  3C32 A;  3MBP A;  1ZTY A;  2OJT A;  2E1S A;  1I6A A;  4RY1 A;  3KSJ A;  1N84 A;  2Z23 A;  4QFO A;  1SW4 A;  1HSJ A;  4KCC A;  3C9H A;  4DXC A;  5AA1 A;  5ISU A;  4F1Y A;  1MDQ A;  1J1N A;  3TTM A;  4PQJ A;  1JVX A;  3TEL A;  3RN8 A;  4C1U A;  1N76 A;  5KCJ A;  4GRK A;  1B3L A;  1LGB C;  4Q0C A;  4DIG A;  2QMW A;  4U22 A;  3MW0 A;  1OLA A;  2F35 A;  1B3E A;  3GLB A;  2G93 A;  3D4C A;  4WXJ A;  5A5X A;  5DT6 A;  2XXY A;  2DVZ A;  2RKM A;  1QVS A;  4OZ9 A;  4LUB A;  3E13 X;  1N3X A;  2O7I A;  3FAS A;  1L5T A;  2PT1 A;  2Z8E A;  4GXA A;  4BDO A;  3QYT A;  2GH9 A;  3M3F A;  2O69 A;  4ONY A;  3VLU A;  4OFJ A;  3HV1 A;  3FXQ A;  2NWJ A;  1B7U A;  1FCK A;  5TPA B;  2O68 A;  1B3G A;  1US5 A;  4GLI A;  3HHG A;  4WKM A;  1FTK A;  3OO8 A;  3UP9 A;  1LST A;  4Z0I A;  3K6V A;  1URD A;  2DSF A;  3MPK A;  4EQ7 A;  4R6H A;  3F11 A;  3LSF B;  2XHD A;  5H8S A;  1MQI A;  2IA4 A;  4IY5 A;  3S9E A;  4QFL A;  1UIU A;  4R75 A;  4YAH X;  4K3F A;  5I2N B;  4ZEI A;  4F39 A;  2IEE A;  1S7Y A;  4TOZ A;  2VHA A;  2REJ A;  1VE4 A;  3B6Q A;  4JWO A;  4WEP A;  4Q5T A;  2V84 A;  4PFU A;  4P11 A;  3PPP A;  1PB9 A;  3MVX A;  4ZDM A;  4GXS B;  3TQW A;  3MC2 A;  1QUK A;  4F3P A;  3FJ7 A;  4Z7E A;  4FJP A;  3RTW B;  3SDF A;  1NNK A;  3SEW A;  2F78 A;  2WKY A;  4GL8 A;  1NFT A;  3H06 B;  4XTC Q;  2AIX A;  4EF1 A;  3TUS A;  4NF5 B;  1IXI A;  3MP1 A;  4QSC A;  1QKA A;  3IO6 A;  2Q9T A;  1BP5 A;  3VVE A;  4NE4 A;  1SYI A;  3N26 A;  3GBA A;  1TFA A;  1MPC A;  4F3G A;  4R9F A;  1B1H A;  1ANF A;  2Y84 A;  3QUJ A;  5H8N A;  3DM0 A;  3A3U A;  1MQJ A;  2ZYN A;  4IY6 A;  4JBZ A;  2I58 A;  3H6V A;  5ITP A;  3R7X A;  3OD7 A;  4KI0 E;  2QS1 A;  2HCA A;  4AB6 A;  1Z7N E;  3K6X A;  3HHF A;  3IOR A;  3CR9 A;  4IO4 A;  3PMW A;  1R9L A;  4OTE A;  2F7A A;  3QUF A;  1NL5 A;  4NF8 A;  1DOT A;  3PPN A;  3FXR A;  3DEL B;  4F22 A;  1RYO A;  4N07 A;  4QSD A;  4RJZ A;  2E0S A;  1B7Z A;  1A55 A;  5AA4 B;  3Q26 A;  3LC8 A;  4OEV A;  4Q30 B;  5DEX B;  4GOT A;  4X1D A;  4JSO A;  5CMM A;  3A09 A;  3IL1 B;  3PD8 A;  1M5F A;  3RGY A;  3ILT B;  3K01 A;  4PFT A;  5I59 B;  1B4H A;  2QMX A;  1M5C A;  1DTG A;  5AE4 A;  2O1M A;  1ELJ A;  1IXH A;  1PB8 A;  3T66 A;  2PYY A;  3WAF A;  3PUV E;  1FQC A;  4F29 A;  5CM6 A;  3C33 A;  4ZEK A;  1DPP A;  2RCB A;  3OEM A;  4EUO A;  3H4Z A;  5L8D A;  2PMS A;  1H45 A;  3U1O A;  1Y1M A;  1S50 A;  1IXG A;  4LA9 A;  1D9Y A;  4L17 A;  4R2B A;  4HTG A;  3T96 B;  3TCF A;  4XKN A;  1Y4T A;  2Q2A A;  4E0X A;  4M1V A;  1B7H A;  4OHN A;  3IR1 A;  2ABH A;  3TTR A;  1FTL A;  1H76 A;  3G3G A;  1IXC A;  1B40 A;  4MF3 A;  2X7P A;  3MVY A;  1D4N A;  4EQB A;  3OSR A;  2UXA A;  3N5L A;  4IB2 A;  4EXL A;  3E4R A;  3DP4 A;  3CVG A;  5TU0 A;  4EXK A;  1PBP A;  3MVZ A;  2DQV A;  2H9B A;  1UQW A;  5IAI A;  2HXW A;  3EHU A;  2DP8 A;  4MLQ A;  2NUV A;  2KLF A;  4UAC A;  1D9V A;  2QL3 A;  4OER A;  1FTJ A;  1XVX A;  5L9S A;  2R6G E;  3G3F A;  4KYE A;  1Y3N A;  1POT A;  4F31 B;  3FJG A;  1JEV A;  3CRB A;  4OET A;  2ANJ A;  4G4P A;  3RPW A;  4ESW A;  3M3K A;  4P0I A;  4IGT A;  1D3K A;  4ZEB A;  5I84 A;  4R72 A;  2F97 A;  3TFL A;  3RUM A;  1RYX A;  1SW1 A;  2FA7 A;  3LR1 A;  1P99 A;  1Y4C A;  3DP8 A;  3PUZ E;  1OIB A;  2I3V A;  3P7I A;  3DP6 A;  3VFJ A;  3SEY A;  2VD2 A;  1AIV A;  3MUQ A;  2Q88 A;  3KOS A;  2DWJ A;  1QW0 A;  3ILU B;  4KFQ A;  4OMB A;  3MP6 A;  3U93 A;  2UVG A;  3KG2 A;  4YU0 A;  3KBR A;  3CSB A;  3TDJ A;  3H6W A;  4PE5 B;  1UTB B;  2ONK E;  3K0V A;  2DWI A;  5J1D A;  2OWS A;  3VDF A;  3OO7 A;  2VP1 A;  1UTH B;  1IZ1 A;  3K6U A;  2HZK A;  1QUL A;  3TMG A;  3RQT A;  4QFN A;  1II5 A;  5CMC A;  1MY4 A;  2H25 A;  1B58 A;  4LAT A;  3O97 A;  4EQ9 A;  3EHT A;  3PUY E;  1XHY A;  1Q1K A;  2GRV A;  1BIY A;  3IOU A;  3KZG A;  3KOT A;  2F8D A;  2ONR A;  2RCA A;  1VFE A;  2PVU A;  1B4Z A;  5JEI A;  3ZSF A;  1AMF A;  3SKP A;  4H5G A;  1NH8 A;  3FZV A;  3HN0 A;  2VD3 A;  3I5O A;  4ELQ A;  3MZ9 A;  5BWJ A;  3CG3 A;  4R2F A;  4G77 A;  1QUJ A;  5CMK A;  3PMV A;  3D4G A;  3JZJ A;  3C4M A;  4TQU Q;  4ZE9 A;  4X48 A;  2ZNT A;  4M4G A;  1NH7 A;  2XXU A;  5I2K A;  4RK2 A;  2I4B A;  3TOD A;  1B3F A;  1PEB A;  4GL0 A;  2HFB A;  4YKP A;  1MH3 A;  1LB9 A;  4QF9 A;  3UA8 A;  1B51 A;  2F36 A;  3L6G A;  2OBG A;  4XIG Q;  5H8Q A;  1B6H A;  1I69 A;  3H6T A;  3VE1 B;  4ZEF A;  2NOO A;  2XX8 A;  3SEX A;  2A5T A;  1PBQ A;  1LCF A;  1M5B A;  1P1W A;  4NWC A;  1P1O A;  2XD2 A;  1JW4 A;  5TP9 B;  5DTB A;  3FJM A;  1S9T A;  4RPN A;  2Q8J A;  2B3F A;  5I57 B;  5H8H A;  1B5H A;  5CI5 A;  1YTV A;  3PPO A;  5DVF A;  1B5I A;  1GVC A;  4LZ7 A;  5KDT B;  1Y1Z A;  3MQ9 A;  2NXO A;  4THI A;  4XKR A;  4IGR A;  5IKB A;  1FTM A;  2ONS A;  4JDF A;  2Y7K A;  3S4U A;  4MFI A;  4RA1 A;  3V8X B;  1ZJL A;  2XD3 A;  2YJP A;  3DLN A;  5F1Q A;  2F7B A;  3ZKL A;  3MVW A;  1Y3P A;  2DE2 A;  1MPB A;  5I58 A;  2I4C A;  4NMY A;  3VVD A;  5AA2 D;  4FAJ A;  4ZS9 A;  5B70 A;  3Q25 A;  1P1N A;  1IIT A;  2HZL A;  1NNT A;  1DSN A;  3OMB A;  5DVI A;  3ZS6 A;  4YB6 A;  3W15 C;  5JK4 A;  2XXV A;  2YPN A;  4R6K A;  1B1X A;  4OYV A;  2ZYM A;  1R6Z A;  1AOV A; 
#chains in the Genus database with same CATH topology
 4BDM A;  1DTZ A;  1NV0 A;  2ZZX A;  3CFZ A;  1OVT A;  2XXX A;  3PPR A;  2OWZ A;  4RPO A;  1B2H A;  4BDQ A;  3PV0 E;  1RDX A;  1LLS A;  1NV5 A;  3C36 A;  1TFD A;  3L6H A;  1PC3 A;  1ZKB A;  1LEV A;  2RC9 A;  3UOR A;  3O6G A;  4FAT A;  2DXY A;  2P2A A;  1B05 A;  1SYH A;  5AA2 A;  3K02 A;  3KN7 A;  1CE2 A;  4NF6 A;  4DDD A;  3B6W A;  1IQ7 A;  4QHQ A;  5ICQ A;  1OQH A;  2AYS A;  3O66 A;  1DCU A;  4GWX A;  4KPT A;  2PT2 A;  1FPG A;  5J16 A;  1MY2 A;  4R9G A;  3ONM A;  1HSE A;  4U21 A;  3LBS A;  2OCU A;  4X8R A;  1VR5 A;  1D9Q A;  1SBP A;  1VFD A;  1LCT A;  4PP0 A;  4ZE8 A;  5CBS A;  1LBY A;  4GBW A;  3K2D A;  3TCG A;  1A8F A;  3BFU A;  4DCX A;  4F19 A;  1MQG A;  1NV6 A;  4PBH A;  3TAJ A;  3OO9 A;  3FAT A;  3G3J A;  4IO5 A;  3RYD A;  2ZMB A;  3V5A A;  1XVY A;  4RNS A;  4LQ2 A;  1ZIU A;  3VXC A;  1F9B A;  2I48 A;  1FRP A;  4NF4 B;  4FOR A;  5FHO A;  1NNF A;  4X9T A;  1YZ0 A;  4MMP A;  1O63 A;  3W9W A;  1B9J A;  1QGX A;  1FBP A;  4F2O A;  5HPQ A;  4GWW A;  3CIJ A;  1B46 A;  4LVQ A;  2DE3 A;  5JTY B;  2LAO A;  2PX1 A;  2X26 A;  5ET6 A;  4I62 A;  4IO7 A;  5ICT A;  2XWO A;  1SQY A;  5TPA A;  2V4C A;  1MQH A;  4OQO A;  4N91 A;  4C0R A;  1LBB A;  4PFB A;  4RXL A;  1FPI A;  3RT8 A;  1LFG A;  4YIC A;  4POW A;  2QPQ A;  1US4 A;  1FQD A;  1N7X A;  3M3L A;  1B0L A;  3SER A;  4H45 A;  2B4M A;  4ECF A;  3MZB A;  4GBV A;  1N7W A;  4I1D A;  2Z8D A;  2Q2C A;  3H03 A;  5ET5 A;  4N13 A;  4G68 B;  4H0W A;  2OZZ A;  4HW8 A;  3LUZ A;  5I2N A;  1NUX A;  3Q27 A;  3FVG A;  1JET A;  1A40 A;  4GWU A;  3FVN A;  1IMC A;  2I0B A;  3B8B A;  2V25 A;  3OEL A;  1NV3 A;  4H46 A;  2H98 A;  2HEU A;  4TLL B;  2OLB A;  5H8F B;  4JB7 A;  4YMA A;  4U4X A;  3PGF A;  2FVZ A;  2ALU A;  3KFM A;  3IAZ A;  2HPG A;  3LSX A;  4QRZ A;  2UVJ A;  5IZZ A;  3O2A A;  4OEU A;  4EF2 A;  5F24 A;  3MP8 A;  2XXT A;  3TYH A;  2RIN A;  4NF5 A;  4F1U A;  4ZZE A;  1QUI A;  1AH5 A;  3Q28 A;  4ND9 A;  1PDA A;  5EQA A;  5FTI A;  1SD3 A;  3S9M C;  1EZP A;  1P1Q A;  2ZZW A;  3QK6 A;  1QJM A;  3VXB A;  3H7M A;  2VT5 A;  2THI A;  3G3K A;  4JXI A;  3T0J A;  3O9P A;  3T93 B;  1EZ9 A;  1FBG A;  1MY3 A;  2HAU A;  4GVO A;  3UIF A;  1YCJ A;  3KJ7 A;  5I56 B;  4NQ8 A;  4H5F A;  4MNC A;  4ZEC A;  4X1B A;  2XX9 A;  5K2Y A;  1LBX A;  1I6Q A;  1MXX A;  2FYI A;  4YKK A;  3FXU A;  1JP4 A;  2F6P A;  3A3C A;  1YXI A;  1A54 A;  4U1O A;  2DVC A;  5B7D A;  4PGP A;  1H3D A;  3LSL A;  5KCJ B;  1WDN A;  1EU8 A;  3OOA A;  3IOT A;  5AA3 A;  1ATG A;  5EHM A;  4JVI A;  1LFH A;  1MXZ A;  4KR5 A;  1SVX B;  2ZYK A;  3OO6 A;  3O28 A;  3E79 A;  3U72 A;  5A5X B;  4MNI A;  5ELV A;  5AA4 A;  3IB2 A;  5CRY A;  3V83 A;  2QSX A;  5T3J A;  1NI9 A;  3EHS A;  5DEX A;  3TTK A;  2OK2 A;  4OFO A;  2I49 A;  4N15 A;  2HAV A;  1NMU A;  1XOC A;  2W7Y A;  5BUU A;  2XX7 A;  3FIR A;  3LSW A;  5HM4 B;  1MY0 A;  5I59 A;  5EYF A;  1IEJ A;  4AQ4 A;  2H5Y A;  1MXW A;  4KD5 A;  5ITO A;  3EF7 A;  1MQD A;  3PD9 A;  4DXB A;  2G29 A;  4IR8 A;  1NUW A;  4ESX A;  3TEP A;  1MM6 A;  5IM2 A;  2V93 A;  1RDY A;  3FD3 A;  2DS9 A;  1DPE A;  3CSG A;  4TLM B;  4FEB A;  1RKM A;  1YPN A;  1NUY A;  1JW1 A;  3FBP A;  1JEU A;  4KCD A;  3I6V A;  3R26 A;  1FTO A;  4KYD A;  1OQG A;  1NNP A;  2VOZ A;  2H4I A;  1N0T A;  3HCQ A;  3ODB A;  2H99 A;  1MXY A;  2F3B A;  4MAG A;  1ZMG A;  3I3V A;  5LDZ A;  4GQO A;  2M8C A;  3KSX A;  4LZ5 A;  1BLF A;  1POY 1;  3IB0 A;  3RTF B;  5LOM A;  1MS7 A;  4F3B A;  3USD A;  4XKP A;  2QVV A;  5I3S A;  1SW2 A;  2F3D A;  5DW8 A;  5DVJ A;  1FBC A;  5M2V A;  3O6H A;  3C35 A;  2O51 A;  1B3H A;  1NUZ A;  3IB1 A;  3RY3 A;  4KYS A;  1WOD A;  4KXP A;  4YZZ A;  2V3T A;  1HSL A;  1R9Q A;  3JYR A;  4XXU A;  1FPJ A;  3UK4 A;  1I6B A;  2CMO A;  2CZH A;  5I5P A;  5H8N B;  1P1U A;  4R6Y A;  2ZZV A;  1DMB A;  5DYH A;  4G68 C;  3PUW E;  2P1S A;  2Q89 A;  1JQF A;  1LB8 A;  4I3E A;  2DWA A;  3H6U A;  3K00 A;  1B5J A;  1LAF E;  2WBD A;  2Z8F A;  4FED A;  2O6A A;  3IO4 A;  3FV2 A;  4H8J A;  3QSL A;  1K9Y A;  2XXW A;  4BDR A;  1CNQ A;  4HS7 A;  2DXR A;  3MZ1 A;  3E3K A;  1TWY A;  2ZXT A;  4HCY A;  3IK6 B;  1N3W A;  2PCR A;  3WAE A;  2DE4 A;  3MPL A;  2ZNS A;  4MNP A;  3OXN A;  4BDL A;  4NF8 B;  4NED A;  3E78 A;  4KQP A;  4E0W A;  3VLV A;  1GGG A;  1O64 A;  1UIV A;  4PGN A;  3U92 A;  4G8M A;  2OWT A;  2RF1 A;  4KHZ E;  3CFL A;  1URG A;  2DWH A;  1UTB A;  2VPO A;  4H1X A;  1ZLQ A;  1EH3 A;  4PDH A;  2FNC A;  1INP A;  3EKI A;  4OVJ A;  1UTH A;  4BDN A;  3TQL A;  1Z7M E;  3BKI B;  4IO6 A;  4POX A;  2VPN A;  4OWD A;  3T9X B;  4LON B;  1LAH E;  2QS2 A;  1MY1 A;  2KQZ A;  1URS A;  2QRY A;  3N6T A;  3ZKK A;  3CFX A;  2Y5L A;  3UN6 A;  2B3B A;  1FBH A;  1GR2 A;  4QFK A;  4I40 A;  3G3H A;  1ZU0 A;  3U94 A;  2GHA A;  4R74 A;  3EPE A;  2I3W A;  1O7T A;  4O3C A;  4O7M A;  1K9Z A;  2XXP A;  4DXU A;  4JWY A;  4RYA A;  1GTK A;  1OVB A;  5EYH A;  4G2Z A;  1USY E;  4OVS A;  4YB7 A;  5EYG A;  3VVF A;  3S2V A;  4PET A;  2PBW A;  1IMB A;  3IJX B;  3MAM A;  3TKD A;  4FEC A;  1FW0 A;  3FXB A;  3IJO B;  3G7W A;  1Q35 A;  4H65 A;  4NWD A;  3TTN A;  4H8I A;  1FPF A;  4F3S A;  4GWS A;  2CZL A;  2XWK A;  5EQ8 A;  4F18 A;  4PTK A;  4F1V A;  2F34 A;  3RLF E;  1JVY A;  4P1E A;  2AL5 A;  2CEY A;  3N94 A;  1TXF A;  3GBB A;  3HFU A;  1TT1 A;  3KN8 A;  1AL3 A;  2XXH A;  1B52 A;  4MEV A;  2QS4 A;  4OES A;  3FGS A;  2HQ0 A;  4GWO A;  3G3I A;  1KA1 A;  1BTJ A;  5L9O A;  1YAE A;  2QJE A;  4ISU A;  5F7V A;  3TTL A;  2B65 A;  3R6U A;  2HXR A;  1R1N A;  3B7D A;  4ELP A;  4DCY A;  2BJJ X;  2V3U A;  3HPI A;  3VLW A;  3K1P A;  1FQE A;  1MDP 1;  2ESN A;  1LBC A;  4YB5 A;  3EQ1 A;  2XXR A;  4Q8R A;  3SEV A;  5TP9 A;  1OLC A;  3QIM A;  4U23 A;  4GF8 A;  3GZG A;  1IMF A;  4GIZ A;  3LUY A;  1JW5 A;  3O29 A;  4N8G A;  3FUZ A;  1SDX A;  2Y7R A;  5I57 A;  4G8N A;  3K4U A;  4JVD A;  1Y3Q A;  1MG1 A;  1XI6 A;  2I0C A;  4RK9 A;  5K2X A;  4HXV A;  3KN3 A;  3TPA A;  3IOW A;  4LP2 B;  1A99 A;  5KDT A;  4MH5 A;  1MH4 A;  4I9D A;  1SW5 A;  1YYZ A;  4LZ8 A;  3MWB A;  3C31 A;  2Y7P A;  2D5W A;  5FTH A;  3FVK A;  1T0K A;  1WVJ A;  1M5E A;  5CC2 A;  1AWB A;  3PMX A;  4G8H A;  5ET7 A;  2UYF A;  2MKZ A;  2DOJ A;  1FQF A;  3IFC A;  1MRP A;  3C34 A;  4ELO A;  1RDZ A;  2YLN A;  4U4S A;  3ROJ A;  4GD5 A;  4HCW A;  2GFE A;  4NHB A;  3SEU A;  3AXF A;  3VV5 A;  2DYX A;  2RC8 A;  3GXA A;  1BKA A;  2R71 A;  3Q29 A;  3FV1 A;  3UGW A;  3BBR A;  4OA4 A;  1B32 A;  4PCD A;  3CI8 A;  2L5V A;  3CG1 A;  3PU5 A;  4QFP A;  4OEN A;  2ZYO A;  4O94 A;  1FBF A;  2Y7W A;  1GV8 A;  3T9U A;  1LAG E;  3S9L C;  3O6I A;  3RNN A;  3THI A;  1IMA A;  2PFZ A;  2D21 A;  4JSD A;  1IUD A;  3SET A;  4P47 A;  4UA8 A;  5FBP A;  4FE8 A;  1Y9U A;  2QS3 A;  4FIM A;  4DZ1 A;  2A5S A;  5I7I A;  1VSO A;  1NKX A;  3QXM A;  4OXV A;  3K1M A;  2WX9 A;  4O3A A;  3H3G A;  4AB5 A;  2VGQ A;  2REG A;  1FQB A;  4P0G A;  4PFY A;  3T22 A;  1NV4 A;  2Y7I A;  3RPL B;  3HST A;  3TZA A;  4OVT A;  4IO2 A;  3SES A;  4IO3 A;  2F5X A;  3T1B A;  3QMF A;  4LQ5 A;  4F2Q A;  3KJT A;  4N6D A;  1H43 A;  4DLD A;  4ZED A;  3BFT A;  4PFW A;  2R9J A;  5I2K B;  5CMB A;  2WYK A;  4N6P A;  4DE8 A;  2Z22 A;  4ZZA A;  1MM7 A;  5FHN A;  3U8Q A;  4GX4 A;  4OFL A;  4H6D A;  3OEK A;  5H8Q B;  3MJN A;  3QAX A;  1IIW A;  3JV9 A;  2WBB A;  2D3I A;  2F7C A;  4C1T A;  4NTL A;  1QKB A;  4WED A;  4NF4 A;  2A5T B;  3T9H B;  3U65 A;  1JNF A;  1EZO A;  4BLA A;  2HHM A;  3KGC A;  2V3Q A;  3KEI A;  1MXU A;  1MPD A;  1H44 A;  1CB6 A;  5JTY A;  2QVR A;  3FVO A;  1NV1 A;  3V89 B;  5L9M A;  3EN3 A;  4P8B A;  3IX1 A;  4I8C A;  1FPD A;  1LFI A;  3PUX E;  2UVH A;  3K1N A;  5H8H B;  2X7Q A;  3CHG A;  4EDP A;  4ELR A;  1EYI A;  2KR0 A;  4U1Z A;  2NVU B;  3M8U A;  4P1L A;  1M5D A;  4QSE A;  4XKQ A;  1FPL A;  2RC7 A;  2O84 X;  4MBP A;  4R73 A;  3T9V A;  3W9V A;  1A7L A;  4H67 A;  4MLV A;  2XXI A;  4G68 A;  1LAX A;  2UVI A;  5FHM A;  3B6T A;  3N6U A;  4O7I A;  3ECR A;  4GFR A;  1FQA A;  2UYE A;  5I58 B;  2I6E A;  4JWX A;  5H8F A;  2ZNU A;  2O1L A;  1XT8 A;  4NF0 A;  2FBP A;  3BIH A;  5IZ3 B;  3IOV A;  4YMB A;  2F6G A;  4YKJ A;  1Y20 A;  1A8E A;  3OEN A;  3S9N C;  1OMP A;  1ZBM A;  3HO7 A;  3PPQ A;  1KWH A;  1SI0 A;  5CBR A;  1XC1 A;  3K6W A;  4N81 A;  5EHS A;  4YKI A;  2XXQ A;  1FJ9 A;  1USY H;  2CZI A;  1MXV A;  4HE2 A;  3E9X A;  1SI1 A;  1PB7 A;  3IFA A;  1DBZ A;  3KC1 A;  5HBC A;  4PAF A;  5IZ1 A;  5KZT A;  3RT6 B;  3TCH A;  2GHB A;  1IME A;  4GWY A;  2AL4 A;  1B0H A;  2P0S A;  5I56 A;  1XS5 A;  3OSQ A;  2O7U A;  5AA2 B;  4O3B A;  1N04 A;  4NX1 A;  4NF6 B;  4U2R A;  3C32 A;  3MBP A;  1ZTY A;  2OJT A;  2E1S A;  1I6A A;  4RY1 A;  2QVU A;  3KSJ A;  1N84 A;  2Z23 A;  1KA0 A;  4QFO A;  1SW4 A;  1HSJ A;  2CEX A;  4KCC A;  3C9H A;  4DXC A;  5AA1 A;  5ISU A;  4F1Y A;  1MDQ A;  1J1N A;  3TTM A;  4OVQ A;  4PQJ A;  1JVX A;  3TEL A;  3RN8 A;  4C1U A;  1N76 A;  5KCJ A;  4GRK A;  1FSA A;  1B3L A;  1LGB C;  1FPK A;  4Q0C A;  4DIG A;  3SZP A;  2QMW A;  4DI4 B;  2CZK A;  4U22 A;  3MW0 A;  1OLA A;  2F35 A;  1B3E A;  5ET8 A;  3GLB A;  2G93 A;  3D4C A;  4WXJ A;  5A5X A;  5DT6 A;  2XXY A;  2DVZ A;  2RKM A;  1FPE A;  1QVS A;  4OZ9 A;  1G0H A;  4LUB A;  3E13 X;  1N3X A;  3MYU A;  2O7I A;  1FJ6 A;  3FAS A;  1L5T A;  2PT1 A;  2Z8E A;  4GXA A;  4BDO A;  3QYT A;  2GH9 A;  4MIJ A;  3M3F A;  2O69 A;  4ONY A;  3VLU A;  1FBE A;  1FTA A;  4OFJ A;  3HV1 A;  3FXQ A;  2NWJ A;  4HE1 A;  1B7U A;  1FCK A;  5TPA B;  2PFY A;  2O68 A;  1B3G A;  1US5 A;  4GLI A;  4I3Y A;  3HHG A;  2XA5 A;  4WKM A;  1FTK A;  4PC9 A;  3OO8 A;  3UP9 A;  4XF5 A;  1LST A;  4Z0I A;  3K6V A;  1URD A;  4PAI A;  2DSF A;  3MPK A;  4EQ7 A;  4R6H A;  3F11 A;  3LSF B;  2XHD A;  5H8S A;  1MQI A;  2IA4 A;  4IY5 A;  3S9E A;  4QFL A;  1UIU A;  4R75 A;  4YAH X;  4K3F A;  2XWV A;  5I2N B;  4ZEI A;  4F39 A;  2IEE A;  1S7Y A;  4TOZ A;  2VHA A;  2REJ A;  1VE4 A;  3B6Q A;  4JWO A;  4WEP A;  4Q5T A;  2V84 A;  4NAP A;  4PFU A;  4P11 A;  3PPP A;  1PB9 A;  3MVX A;  4PBQ A;  4ZDM A;  4GXS B;  3TQW A;  3MC2 A;  1QUK A;  4F3P A;  3FJ7 A;  4Z7E A;  4FJP A;  3RTW B;  3SDF A;  1NNK A;  3SEW A;  2F78 A;  2WKY A;  4GL8 A;  1NFT A;  3H06 B;  4XTC Q;  2AIX A;  4EF1 A;  3NOH A;  3TUS A;  4NF5 B;  4PFI A;  1IXI A;  2Q8M A;  4AS5 A;  3MP1 A;  4QSC A;  1QKA A;  3IO6 A;  2Q9T A;  1BP5 A;  3VVE A;  4NE4 A;  1SYI A;  3KBZ A;  4NG7 A;  3N26 A;  3GBA A;  1TFA A;  1NV2 A;  1MPC A;  4F3G A;  4R9F A;  1B1H A;  4XFE A;  1ANF A;  2Y84 A;  3QUJ A;  5H8N A;  4PF8 A;  3DM0 A;  3A3U A;  1MQJ A;  2ZYN A;  3B50 A;  2Y5K A;  4IY6 A;  4JBZ A;  2I58 A;  3H6V A;  5ITP A;  4MX6 A;  3R7X A;  4N8Y A;  3OD7 A;  4KI0 E;  1NV7 A;  2QS1 A;  5EQ7 A;  1SPI A;  2HCA A;  2JJK A;  4AB6 A;  1Z7N E;  2DDK A;  3K6X A;  2FIE A;  4LN5 A;  3HHF A;  3IOR A;  2BJI A;  3CR9 A;  4IO4 A;  3PMW A;  1R9L A;  4OTE A;  2F7A A;  3QUF A;  2GQ1 A;  1NL5 A;  4DI3 D;  4NF8 A;  1DOT A;  4P9K A;  3PPN A;  3FXR A;  3DEL B;  4F22 A;  1RYO A;  4G61 A;  4N07 A;  4QSD A;  4RJZ A;  1KZ8 A;  2E0S A;  1B7Z A;  5LTC A;  1A55 A;  5AA4 B;  3Q26 A;  3LC8 A;  4OEV A;  4Q30 B;  5DEX B;  4GOT A;  4X1D A;  1BK4 A;  4JSO A;  5CMM A;  3A09 A;  4JVC A;  3IL1 B;  3PD8 A;  1M5F A;  3RGY A;  3ILT B;  4PAK A;  3K01 A;  4PFT A;  4QBA A;  5I59 B;  1B4H A;  2QMX A;  3GYY A;  1M5C A;  1DTG A;  4MHF A;  5AE4 A;  2O1M A;  1ELJ A;  1IXH A;  1PB8 A;  3T66 A;  2PYY A;  3WAF A;  3PUV E;  1FQC A;  4F29 A;  5CM6 A;  3C33 A;  4N6K A;  4ZEK A;  1DPP A;  4MCO A;  2RCB A;  1FPB A;  1FBD A;  3OEM A;  4EUO A;  3H4Z A;  5L8D A;  2PMS A;  3ISP A;  1H45 A;  3U1O A;  1Y1M A;  1S50 A;  1IXG A;  2XWI A;  4FBP A;  4LA9 A;  1D9Y A;  4L17 A;  4R2B A;  4HTG A;  3T96 B;  3TCF A;  4NGU A;  4XKN A;  1Y4T A;  2Q2A A;  4E0X A;  4M1V A;  1B7H A;  4OHN A;  3IR1 A;  2FIX A;  2ABH A;  3TTR A;  1FTL A;  1H76 A;  3G3G A;  1IXC A;  1B40 A;  1EYJ A;  4MF3 A;  2X7P A;  3MVY A;  1D4N A;  4EQB A;  3OSR A;  2UXA A;  3N5L A;  2R8T A;  4IB2 A;  4EXL A;  3E4R A;  2B4L A;  3DP4 A;  3CVG A;  5TU0 A;  4EXK A;  1PBP A;  3MVZ A;  2DQV A;  2H9B A;  1UQW A;  5IAI A;  4NN3 A;  2HXW A;  4OVP A;  3EHU A;  2DP8 A;  4MLQ A;  2NUV A;  2KLF A;  4UAC A;  1D9V A;  1G0I A;  2QL3 A;  4OER A;  1FTJ A;  1XVX A;  5L9S A;  2R6G E;  3G3F A;  4KYE A;  1Y3N A;  1POT A;  4F31 B;  1EYK A;  3FJG A;  1JEV A;  4PF6 A;  3CRB A;  4OET A;  2ANJ A;  4G4P A;  3RPW A;  4ESW A;  3M3K A;  4P0I A;  4IGT A;  2OX3 A;  1D3K A;  4ZEB A;  5I84 A;  4R72 A;  4PE3 A;  2F97 A;  3TFL A;  3RUM A;  2WEF A;  1RYX A;  1SW1 A;  2FA7 A;  3LR1 A;  1P99 A;  1Y4C A;  3DP8 A;  3PUZ E;  1OIB A;  2I3V A;  3P7I A;  3DP6 A;  3VFJ A;  3SEY A;  4OAN A;  2VD2 A;  1AIV A;  3MUQ A;  2Q88 A;  3KOS A;  2DWJ A;  1QW0 A;  3ILU B;  4KFQ A;  4OMB A;  1LBV A;  3LV0 A;  3MP6 A;  3U93 A;  2UVG A;  1LBZ A;  4AS4 A;  3KG2 A;  4YU0 A;  3KBR A;  3CSB A;  3TDJ A;  3H6W A;  4PE5 B;  3D1R A;  1UTB B;  4GWZ A;  2ONK E;  3KC0 A;  3K0V A;  2DWI A;  5J1D A;  2OWS A;  2XXK A;  4UAB A;  3BIG A;  3VDF A;  3OO7 A;  2VP1 A;  4P3L A;  1UTH B;  4GX6 A;  1IZ1 A;  4OVR A;  3K6U A;  2HZK A;  1QUL A;  3TMG A;  2QFL A;  4PDD A;  3RQT A;  4QFN A;  1II5 A;  4N17 A;  5CMC A;  5A5L A;  1MY4 A;  2H25 A;  1VDW A;  2P3N A;  1B58 A;  4LAT A;  3O97 A;  4EQ9 A;  3EHT A;  3PUY E;  1XHY A;  1Q1K A;  4O8M A;  2GRV A;  1BIY A;  3IOU A;  3KZG A;  3KOT A;  4XEQ A;  2F8D A;  2ONR A;  1LBW A;  5IGA A;  2RCA A;  1VFE A;  4N4U A;  2PVU A;  1B4Z A;  5JEI A;  2Q74 A;  3ZSF A;  1AMF A;  3SKP A;  4H5G A;  1NH8 A;  3FZV A;  3HN0 A;  2VD3 A;  3RPL A;  3I5O A;  4ELQ A;  3MZ9 A;  5BWJ A;  3CG3 A;  4R2F A;  4G77 A;  1QUJ A;  5CMK A;  3PMV A;  3D4G A;  3JZJ A;  3C4M A;  4TQU Q;  4ZE9 A;  4X48 A;  2ZNT A;  4M4G A;  1NH7 A;  2XXU A;  5I2K A;  4RK2 A;  2I4B A;  3TOD A;  1B3F A;  1PEB A;  4GL0 A;  2HFB A;  4YKP A;  1MH3 A;  1LB9 A;  1Q9D A;  4QF9 A;  3UA8 A;  1B51 A;  2F36 A;  3L6G A;  2OBG A;  4XIG Q;  5H8Q A;  1B6H A;  1I69 A;  2FHY A;  3H6T A;  3VE1 B;  4ZEF A;  2NOO A;  2XX8 A;  1DK4 A;  4PFR A;  3SEX A;  2A5T A;  1PBQ A;  3PTY A;  1LCF A;  4QXD A;  1M5B A;  5EQ9 A;  1P1W A;  4NWC A;  1P1O A;  2XD2 A;  1JW4 A;  5TP9 B;  5DTB A;  3FJM A;  1S9T A;  4RPN A;  2Q8J A;  2B3F A;  1IMD A;  5I57 B;  5H8H A;  1B5H A;  5CI5 A;  3A29 A;  1YTV A;  3PPO A;  5DVF A;  1B5I A;  1GVC A;  4LZ7 A;  5KDT B;  1Y1Z A;  5ESY A;  3MQ9 A;  2NXO A;  4THI A;  4XKR A;  4IGR A;  5IKB A;  1FTM A;  2ONS A;  4P56 A;  4JDF A;  2Y7K A;  3S4U A;  4MFI A;  4RA1 A;  3V8X B;  1ZJL A;  2XD3 A;  2YJP A;  3DLN A;  5F1Q A;  2F7B A;  3ZKL A;  3MVW A;  4HE0 A;  1Y3P A;  2DE2 A;  1MPB A;  5I58 A;  2I4C A;  4NMY A;  3VVD A;  5AA2 D;  4FAJ A;  4ZS9 A;  5IZ3 A;  5B70 A;  3Q25 A;  4MJO A;  2P3V A;  2WYP A;  1P1N A;  4GX3 A;  3MST A;  1IIT A;  2HZL A;  1NNT A;  1DSN A;  3OMB A;  5DVI A;  4X04 A;  3ZS6 A;  4YB6 A;  3W15 C;  5JK4 A;  2XXV A;  2YPN A;  4R6K A;  1B1X A;  4OYV A;  2ZYM A;  1R6Z A;  1AOV A; 
#chains in the Genus database with same CATH homology
 4BDM A;  1DTZ A;  3CFZ A;  1OVT A;  2XXX A;  3PPR A;  4RPO A;  1B2H A;  4BDQ A;  3PV0 E;  1LLS A;  3C36 A;  1TFD A;  3L6H A;  1PC3 A;  1ZKB A;  2RC9 A;  3UOR A;  3O6G A;  4FAT A;  2DXY A;  2P2A A;  1B05 A;  1SYH A;  5AA2 A;  3K02 A;  3KN7 A;  1CE2 A;  4NF6 A;  4DDD A;  3B6W A;  1IQ7 A;  4QHQ A;  5ICQ A;  1OQH A;  2AYS A;  3O66 A;  4KPT A;  2PT2 A;  1MY2 A;  4R9G A;  3ONM A;  1HSE A;  4U21 A;  3LBS A;  2OCU A;  1VR5 A;  1SBP A;  1VFD A;  1LCT A;  4PP0 A;  4ZE8 A;  5CBS A;  3K2D A;  3TCG A;  1A8F A;  3BFU A;  4DCX A;  4F19 A;  1MQG A;  3TAJ A;  3OO9 A;  3FAT A;  3G3J A;  4IO5 A;  2ZMB A;  3V5A A;  1XVY A;  4RNS A;  4LQ2 A;  1ZIU A;  3VXC A;  1F9B A;  2I48 A;  4NF4 B;  4FOR A;  5FHO A;  1NNF A;  4X9T A;  1O63 A;  3W9W A;  1B9J A;  4F2O A;  5HPQ A;  3CIJ A;  1B46 A;  4LVQ A;  2DE3 A;  5JTY B;  2LAO A;  2PX1 A;  2X26 A;  4I62 A;  4IO7 A;  5ICT A;  1SQY A;  5TPA A;  1MQH A;  4OQO A;  4C0R A;  1LBB A;  4RXL A;  3RT8 A;  1LFG A;  4YIC A;  4POW A;  2QPQ A;  1US4 A;  1FQD A;  1N7X A;  3M3L A;  1B0L A;  3SER A;  4ECF A;  3MZB A;  1N7W A;  4I1D A;  2Z8D A;  2Q2C A;  3H03 A;  4N13 A;  4G68 B;  4H0W A;  2OZZ A;  4HW8 A;  5I2N A;  3Q27 A;  3FVG A;  1JET A;  1A40 A;  3FVN A;  2I0B A;  2V25 A;  3OEL A;  4TLL B;  2H98 A;  2HEU A;  2OLB A;  5H8F B;  4JB7 A;  4YMA A;  4U4X A;  3PGF A;  2ALU A;  3KFM A;  3IAZ A;  3LSX A;  4QRZ A;  2UVJ A;  3O2A A;  4OEU A;  4EF2 A;  3MP8 A;  2XXT A;  3TYH A;  2RIN A;  4NF5 A;  4F1U A;  4ZZE A;  1QUI A;  1AH5 A;  3Q28 A;  4ND9 A;  1PDA A;  5FTI A;  1SD3 A;  3S9M C;  1EZP A;  1P1Q A;  3QK6 A;  1QJM A;  3VXB A;  3H7M A;  2THI A;  3G3K A;  4JXI A;  3O9P A;  3T93 B;  1EZ9 A;  1MY3 A;  2HAU A;  4GVO A;  3UIF A;  1YCJ A;  3KJ7 A;  5I56 B;  4H5F A;  4ZEC A;  4X1B A;  2XX9 A;  5K2Y A;  1I6Q A;  1MXX A;  2FYI A;  4YKK A;  3FXU A;  2F6P A;  3A3C A;  1A54 A;  4U1O A;  2DVC A;  5B7D A;  1H3D A;  3LSL A;  5KCJ B;  1WDN A;  1EU8 A;  3OOA A;  3IOT A;  5AA3 A;  1ATG A;  5EHM A;  1LFH A;  1MXZ A;  4KR5 A;  1SVX B;  2ZYK A;  3OO6 A;  3O28 A;  3U72 A;  5A5X B;  5ELV A;  5AA4 A;  3IB2 A;  5CRY A;  3V83 A;  2QSX A;  3EHS A;  5DEX A;  3TTK A;  2OK2 A;  4OFO A;  2I49 A;  2HAV A;  1NMU A;  1XOC A;  2W7Y A;  5BUU A;  2XX7 A;  3FIR A;  3LSW A;  5HM4 B;  1MY0 A;  5I59 A;  5EYF A;  1IEJ A;  4AQ4 A;  2H5Y A;  1MXW A;  4KD5 A;  5ITO A;  3EF7 A;  1MQD A;  3PD9 A;  4DXB A;  2G29 A;  4ESX A;  3TEP A;  1MM6 A;  2V93 A;  3FD3 A;  2DS9 A;  1DPE A;  3CSG A;  4TLM B;  4FEB A;  1RKM A;  1YPN A;  1JW1 A;  1JEU A;  4KCD A;  3I6V A;  3R26 A;  1FTO A;  4KYD A;  1OQG A;  1NNP A;  2VOZ A;  2H4I A;  1N0T A;  3HCQ A;  3ODB A;  2H99 A;  1MXY A;  1ZMG A;  3I3V A;  4GQO A;  2M8C A;  3KSX A;  4LZ5 A;  1BLF A;  1POY 1;  3IB0 A;  3RTF B;  5LOM A;  1MS7 A;  4F3B A;  3USD A;  4XKP A;  1SW2 A;  5DVJ A;  5M2V A;  3O6H A;  3C35 A;  2O51 A;  1B3H A;  3IB1 A;  3RY3 A;  4KYS A;  1WOD A;  4YZZ A;  2V3T A;  1HSL A;  1R9Q A;  3JYR A;  4XXU A;  3UK4 A;  1I6B A;  2CMO A;  5H8N B;  1P1U A;  4R6Y A;  1DMB A;  5DYH A;  4G68 C;  3PUW E;  2P1S A;  2Q89 A;  1JQF A;  1LB8 A;  2DWA A;  3H6U A;  3K00 A;  1B5J A;  1LAF E;  2Z8F A;  4FED A;  2O6A A;  3IO4 A;  3FV2 A;  4H8J A;  3QSL A;  2XXW A;  4BDR A;  4HS7 A;  2DXR A;  3MZ1 A;  3E3K A;  1TWY A;  2ZXT A;  4HCY A;  3IK6 B;  1N3W A;  3WAE A;  2DE4 A;  3MPL A;  2ZNS A;  3OXN A;  4BDL A;  4NF8 B;  4NED A;  4KQP A;  4E0W A;  3VLV A;  1GGG A;  1O64 A;  1UIV A;  3U92 A;  4G8M A;  2OWT A;  2RF1 A;  4KHZ E;  3CFL A;  1URG A;  2DWH A;  1UTB A;  4H1X A;  1ZLQ A;  1EH3 A;  2FNC A;  4OVJ A;  1UTH A;  4BDN A;  3TQL A;  1Z7M E;  3BKI B;  4IO6 A;  4POX A;  4OWD A;  3T9X B;  4LON B;  1LAH E;  2QS2 A;  1MY1 A;  1URS A;  2QRY A;  3N6T A;  3ZKK A;  3CFX A;  3UN6 A;  2B3B A;  1GR2 A;  4QFK A;  3G3H A;  1ZU0 A;  3U94 A;  2GHA A;  4R74 A;  3EPE A;  2I3W A;  1O7T A;  4O3C A;  2XXP A;  4DXU A;  4JWY A;  4RYA A;  1GTK A;  1OVB A;  4G2Z A;  1USY E;  4YB7 A;  3VVF A;  3S2V A;  4PET A;  2PBW A;  3IJX B;  3MAM A;  3TKD A;  4FEC A;  1FW0 A;  3IJO B;  3G7W A;  1Q35 A;  4H65 A;  4NWD A;  3TTN A;  4H8I A;  4F3S A;  2CZL A;  4F18 A;  4F1V A;  2F34 A;  3RLF E;  1JVY A;  2AL5 A;  3N94 A;  1TXF A;  3GBB A;  1TT1 A;  3KN8 A;  1AL3 A;  2XXH A;  1B52 A;  2QS4 A;  4OES A;  3FGS A;  2HQ0 A;  4GWO A;  3G3I A;  1BTJ A;  5L9O A;  1YAE A;  2QJE A;  4ISU A;  5F7V A;  3TTL A;  2B65 A;  3R6U A;  1R1N A;  3B7D A;  4ELP A;  4DCY A;  2BJJ X;  2V3U A;  3HPI A;  3VLW A;  3K1P A;  1FQE A;  1MDP 1;  2ESN A;  1LBC A;  4YB5 A;  3EQ1 A;  2XXR A;  4Q8R A;  3SEV A;  5TP9 A;  1OLC A;  3QIM A;  4U23 A;  4GF8 A;  3GZG A;  4GIZ A;  3LUY A;  1JW5 A;  3O29 A;  3FUZ A;  1SDX A;  2Y7R A;  5I57 A;  4G8N A;  3K4U A;  1Y3Q A;  1MG1 A;  2I0C A;  4RK9 A;  5K2X A;  3TPA A;  3KN3 A;  3IOW A;  4LP2 B;  1A99 A;  5KDT A;  4MH5 A;  1MH4 A;  4I9D A;  1SW5 A;  4LZ8 A;  3MWB A;  3C31 A;  2Y7P A;  2D5W A;  5FTH A;  3FVK A;  1T0K A;  1WVJ A;  1M5E A;  5CC2 A;  3PMX A;  4G8H A;  2UYF A;  2DOJ A;  1FQF A;  1MRP A;  3C34 A;  4ELO A;  2YLN A;  4U4S A;  4GD5 A;  4HCW A;  2GFE A;  3SEU A;  3AXF A;  3VV5 A;  2DYX A;  2RC8 A;  3GXA A;  1BKA A;  2R71 A;  3Q29 A;  3FV1 A;  3UGW A;  3BBR A;  1B32 A;  3CI8 A;  3CG1 A;  3PU5 A;  4QFP A;  4OEN A;  2ZYO A;  2Y7W A;  1GV8 A;  3T9U A;  1LAG E;  3S9L C;  3O6I A;  3RNN A;  3THI A;  2D21 A;  4JSD A;  1IUD A;  3SET A;  4UA8 A;  4FE8 A;  1Y9U A;  2QS3 A;  4FIM A;  4DZ1 A;  2A5S A;  1VSO A;  1NKX A;  3QXM A;  4OXV A;  3K1M A;  4O3A A;  3H3G A;  4AB5 A;  2VGQ A;  2REG A;  1FQB A;  4P0G A;  4PFY A;  3T22 A;  2Y7I A;  3HST A;  3TZA A;  4IO2 A;  3SES A;  4IO3 A;  2F5X A;  4LQ5 A;  4F2Q A;  3KJT A;  1H43 A;  4DLD A;  4ZED A;  3BFT A;  4PFW A;  2R9J A;  5I2K B;  5CMB A;  4N6P A;  4DE8 A;  2Z22 A;  4ZZA A;  1MM7 A;  5FHN A;  3U8Q A;  4OFL A;  4H6D A;  3OEK A;  5H8Q B;  3MJN A;  3QAX A;  1IIW A;  3JV9 A;  2D3I A;  2F7C A;  4C1T A;  4NTL A;  1QKB A;  4WED A;  4NF4 A;  2A5T B;  3T9H B;  1JNF A;  1EZO A;  4BLA A;  3KGC A;  2V3Q A;  3KEI A;  1MXU A;  1MPD A;  1H44 A;  1CB6 A;  5JTY A;  3FVO A;  3V89 B;  5L9M A;  3EN3 A;  3IX1 A;  4I8C A;  1LFI A;  3PUX E;  2UVH A;  3K1N A;  5H8H B;  2X7Q A;  4EDP A;  4ELR A;  4U1Z A;  2NVU B;  3M8U A;  1M5D A;  4QSE A;  4XKQ A;  2RC7 A;  2O84 X;  4MBP A;  4R73 A;  3T9V A;  3W9V A;  1A7L A;  4H67 A;  4MLV A;  2XXI A;  4G68 A;  1LAX A;  2UVI A;  5FHM A;  3B6T A;  3N6U A;  3ECR A;  4GFR A;  1FQA A;  2UYE A;  5I58 B;  2I6E A;  4JWX A;  5H8F A;  2ZNU A;  2O1L A;  1XT8 A;  3IOV A;  4YMB A;  2F6G A;  4YKJ A;  1Y20 A;  1A8E A;  3OEN A;  3S9N C;  1OMP A;  1ZBM A;  3HO7 A;  3PPQ A;  1KWH A;  1SI0 A;  5CBR A;  1XC1 A;  3K6W A;  5EHS A;  4YKI A;  2XXQ A;  1USY H;  1MXV A;  3E9X A;  1SI1 A;  1PB7 A;  5HBC A;  5KZT A;  3RT6 B;  3TCH A;  2GHB A;  2AL4 A;  1B0H A;  2P0S A;  5I56 A;  1XS5 A;  3OSQ A;  2O7U A;  5AA2 B;  4O3B A;  1N04 A;  4NF6 B;  4U2R A;  3C32 A;  3MBP A;  1ZTY A;  2OJT A;  2E1S A;  1I6A A;  4RY1 A;  3KSJ A;  1N84 A;  2Z23 A;  4QFO A;  1SW4 A;  1HSJ A;  4KCC A;  3C9H A;  4DXC A;  5AA1 A;  5ISU A;  4F1Y A;  1MDQ A;  1J1N A;  3TTM A;  4PQJ A;  1JVX A;  3TEL A;  3RN8 A;  4C1U A;  1N76 A;  5KCJ A;  4GRK A;  1B3L A;  1LGB C;  4Q0C A;  4DIG A;  2QMW A;  4U22 A;  3MW0 A;  1OLA A;  2F35 A;  1B3E A;  3GLB A;  2G93 A;  3D4C A;  4WXJ A;  5A5X A;  5DT6 A;  2XXY A;  2DVZ A;  2RKM A;  1QVS A;  4OZ9 A;  4LUB A;  3E13 X;  1N3X A;  2O7I A;  3FAS A;  1L5T A;  2PT1 A;  2Z8E A;  4GXA A;  4BDO A;  3QYT A;  2GH9 A;  3M3F A;  2O69 A;  4ONY A;  3VLU A;  4OFJ A;  3HV1 A;  3FXQ A;  2NWJ A;  1B7U A;  1FCK A;  5TPA B;  2O68 A;  1B3G A;  1US5 A;  4GLI A;  3HHG A;  4WKM A;  1FTK A;  3OO8 A;  3UP9 A;  1LST A;  4Z0I A;  3K6V A;  1URD A;  2DSF A;  3MPK A;  4EQ7 A;  4R6H A;  3F11 A;  3LSF B;  2XHD A;  5H8S A;  1MQI A;  2IA4 A;  4IY5 A;  3S9E A;  4QFL A;  1UIU A;  4R75 A;  4YAH X;  4K3F A;  5I2N B;  4ZEI A;  4F39 A;  2IEE A;  1S7Y A;  4TOZ A;  2VHA A;  2REJ A;  1VE4 A;  3B6Q A;  4JWO A;  4WEP A;  4Q5T A;  2V84 A;  4PFU A;  4P11 A;  3PPP A;  1PB9 A;  3MVX A;  4ZDM A;  4GXS B;  3TQW A;  3MC2 A;  1QUK A;  4F3P A;  3FJ7 A;  4Z7E A;  4FJP A;  3RTW B;  3SDF A;  1NNK A;  3SEW A;  2F78 A;  2WKY A;  4GL8 A;  1NFT A;  3H06 B;  4XTC Q;  2AIX A;  4EF1 A;  3TUS A;  4NF5 B;  1IXI A;  3MP1 A;  4QSC A;  1QKA A;  3IO6 A;  2Q9T A;  1BP5 A;  3VVE A;  4NE4 A;  1SYI A;  3N26 A;  3GBA A;  1TFA A;  1MPC A;  4F3G A;  4R9F A;  1B1H A;  1ANF A;  2Y84 A;  3QUJ A;  5H8N A;  3DM0 A;  3A3U A;  1MQJ A;  2ZYN A;  4IY6 A;  4JBZ A;  2I58 A;  3H6V A;  5ITP A;  3R7X A;  3OD7 A;  4KI0 E;  2QS1 A;  2HCA A;  4AB6 A;  1Z7N E;  3K6X A;  3HHF A;  3IOR A;  3CR9 A;  4IO4 A;  3PMW A;  1R9L A;  4OTE A;  2F7A A;  3QUF A;  1NL5 A;  4NF8 A;  1DOT A;  3PPN A;  3FXR A;  3DEL B;  4F22 A;  1RYO A;  4N07 A;  4QSD A;  4RJZ A;  2E0S A;  1B7Z A;  1A55 A;  5AA4 B;  3Q26 A;  3LC8 A;  4OEV A;  4Q30 B;  5DEX B;  4GOT A;  4X1D A;  4JSO A;  5CMM A;  3A09 A;  3IL1 B;  3PD8 A;  1M5F A;  3RGY A;  3ILT B;  3K01 A;  4PFT A;  5I59 B;  1B4H A;  2QMX A;  1M5C A;  1DTG A;  5AE4 A;  2O1M A;  1ELJ A;  1IXH A;  1PB8 A;  3T66 A;  2PYY A;  3WAF A;  3PUV E;  1FQC A;  4F29 A;  5CM6 A;  3C33 A;  4ZEK A;  1DPP A;  2RCB A;  3OEM A;  4EUO A;  3H4Z A;  5L8D A;  2PMS A;  1H45 A;  3U1O A;  1Y1M A;  1S50 A;  1IXG A;  4LA9 A;  1D9Y A;  4L17 A;  4R2B A;  4HTG A;  3T96 B;  3TCF A;  4XKN A;  1Y4T A;  2Q2A A;  4E0X A;  4M1V A;  1B7H A;  4OHN A;  3IR1 A;  2ABH A;  3TTR A;  1FTL A;  1H76 A;  3G3G A;  1IXC A;  1B40 A;  4MF3 A;  2X7P A;  3MVY A;  1D4N A;  4EQB A;  3OSR A;  2UXA A;  3N5L A;  4IB2 A;  4EXL A;  3E4R A;  3DP4 A;  3CVG A;  5TU0 A;  4EXK A;  1PBP A;  3MVZ A;  2DQV A;  2H9B A;  1UQW A;  5IAI A;  2HXW A;  3EHU A;  2DP8 A;  4MLQ A;  2NUV A;  2KLF A;  4UAC A;  1D9V A;  2QL3 A;  4OER A;  1FTJ A;  1XVX A;  5L9S A;  2R6G E;  3G3F A;  4KYE A;  1Y3N A;  1POT A;  4F31 B;  3FJG A;  1JEV A;  3CRB A;  4OET A;  2ANJ A;  4G4P A;  3RPW A;  4ESW A;  3M3K A;  4P0I A;  4IGT A;  1D3K A;  4ZEB A;  5I84 A;  4R72 A;  2F97 A;  3TFL A;  3RUM A;  1RYX A;  1SW1 A;  2FA7 A;  3LR1 A;  1P99 A;  1Y4C A;  3DP8 A;  3PUZ E;  1OIB A;  2I3V A;  3P7I A;  3DP6 A;  3VFJ A;  3SEY A;  2VD2 A;  1AIV A;  3MUQ A;  2Q88 A;  3KOS A;  2DWJ A;  1QW0 A;  3ILU B;  4KFQ A;  4OMB A;  3MP6 A;  3U93 A;  2UVG A;  3KG2 A;  4YU0 A;  3KBR A;  3CSB A;  3TDJ A;  3H6W A;  4PE5 B;  1UTB B;  2ONK E;  3K0V A;  2DWI A;  5J1D A;  2OWS A;  3VDF A;  3OO7 A;  2VP1 A;  1UTH B;  1IZ1 A;  3K6U A;  2HZK A;  1QUL A;  3TMG A;  3RQT A;  4QFN A;  1II5 A;  5CMC A;  1MY4 A;  2H25 A;  1B58 A;  4LAT A;  3O97 A;  4EQ9 A;  3EHT A;  3PUY E;  1XHY A;  1Q1K A;  2GRV A;  1BIY A;  3IOU A;  3KZG A;  3KOT A;  2F8D A;  2ONR A;  2RCA A;  1VFE A;  2PVU A;  1B4Z A;  5JEI A;  3ZSF A;  1AMF A;  3SKP A;  4H5G A;  1NH8 A;  3FZV A;  3HN0 A;  2VD3 A;  3I5O A;  4ELQ A;  3MZ9 A;  5BWJ A;  3CG3 A;  4R2F A;  4G77 A;  1QUJ A;  5CMK A;  3PMV A;  3D4G A;  3JZJ A;  3C4M A;  4TQU Q;  4ZE9 A;  4X48 A;  2ZNT A;  4M4G A;  1NH7 A;  2XXU A;  5I2K A;  4RK2 A;  2I4B A;  3TOD A;  1B3F A;  1PEB A;  4GL0 A;  2HFB A;  4YKP A;  1MH3 A;  1LB9 A;  4QF9 A;  3UA8 A;  1B51 A;  2F36 A;  3L6G A;  2OBG A;  4XIG Q;  5H8Q A;  1B6H A;  1I69 A;  3H6T A;  3VE1 B;  4ZEF A;  2NOO A;  2XX8 A;  3SEX A;  2A5T A;  1PBQ A;  1LCF A;  1M5B A;  1P1W A;  4NWC A;  1P1O A;  2XD2 A;  1JW4 A;  5TP9 B;  5DTB A;  3FJM A;  1S9T A;  4RPN A;  2Q8J A;  2B3F A;  5I57 B;  5H8H A;  1B5H A;  5CI5 A;  1YTV A;  3PPO A;  5DVF A;  1B5I A;  1GVC A;  4LZ7 A;  5KDT B;  1Y1Z A;  3MQ9 A;  2NXO A;  4THI A;  4XKR A;  4IGR A;  5IKB A;  1FTM A;  2ONS A;  4JDF A;  2Y7K A;  3S4U A;  4MFI A;  4RA1 A;  3V8X B;  1ZJL A;  2XD3 A;  2YJP A;  3DLN A;  5F1Q A;  2F7B A;  3ZKL A;  3MVW A;  1Y3P A;  2DE2 A;  1MPB A;  5I58 A;  2I4C A;  4NMY A;  3VVD A;  5AA2 D;  4FAJ A;  4ZS9 A;  5B70 A;  3Q25 A;  1P1N A;  1IIT A;  2HZL A;  1NNT A;  1DSN A;  3OMB A;  5DVI A;  3ZS6 A;  4YB6 A;  3W15 C;  5JK4 A;  2XXV A;  2YPN A;  4R6K A;  1B1X A;  4OYV A;  2ZYM A;  1R6Z A;  1AOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...