1B7ZA

Structure of oxalate substituted diferric mare lactoferrin from colostrum
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of oxalate-substituted diferric mare lactoferrin at 2.7 A resolution.
pubmed doi rcsb
molecule tags Metal transport
molecule keywords PROTEIN (LACTOFERRIN)
total genus 218
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1999-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7zA03
4ZDMA 4R6KA 1N76A 4OFOA 1M5EA 4BLAA 1A8FA 3LUYA 1B32A 1B3FA 3VLUA 2O1LA 4YKJA 4F19A 1Y1MA 4ZEDA 1A7LA 1XOCA 1SYIA 3PPRA 3VVFA 1N0TA 1Y3PA 2I49A 5CI5A 1GR2A 1MXXA 5DTBA 3O29A 4NF8A 4NF5A 4E0XA 4EUOA 5H8NB 3SESA 1LCTA 4G8MA 5B70A 3MJNA 4OEUA 5HPQA 3SKPA 1A99A 3OMBA 5TP9A 1MS7A 5DVIA 4PQJA 5EHSA 1YAEA 1MXZA 1S7YA 1UIVA 1EU8A 3FJGA 2NWJA 3H6UA 3W15C 3S9MC 3ZKLA 3T66A 3CFLA 3EQ1A 4LQ5A 2F5XA 1OLCA 4ZS9A 2Y7RA 2Y7PA 1FTMA 4ZEIA 4IO3A 5JTYB 4U23A 1QW0A 4XKPA 3EPEA 3O2AA 1BLFA 4H8IA 5M2VA 5DYHA 3W9WA 1FQBA 1NFTA 5B7DA 1B6HA 1MRPA 2DYXA 3H03A 4HS7A 5CM6A 1VFDA 1MDQA 1R9LA 4F1VA 1S9TA 1MQIA 1Z7ME 2I0BA 3B6WA 3KOSA 3PUYE 4M4GA 4QSCA 4R73A 4YKKA 5DT6A 1DMBA 4K3FA 3AXFA 3KFMA 3THIA 5LOMA 1MY0A 1OVBA 3Q25A 2XXIA 3G3JA 3EHSA 1S50A 4JXIA 1PBPA 3RY3A 3K0VA 4XTCQ 1LFHA 2XXVA 4F2QA 4IB2A 1DSNA 5KDTA 1H76A 3GZGA 2P2AA 3ZS6A 2FNCA 4IO5A 1D9YA 1UTHA 2F6PA 3TAJA 3KJ7A 3R6UA 2Y84A 3LR1A 3CSGA 1MPBA 3O6GA 3K2DA 4THIA 2XX7A 4GXAA 1XVYA 4Q0CA 3SEXA 1FQDA 1SW1A 1YTVA 3TQWA 4C0RA 2ZYMA 5CMCA 3SEWA 3WAEA 2X7PA 3VE1B 2X26A 1AMFA 2ZMBA 3HPIA 3I3VA 1JW5A 4RNSA 3KEIA 4YICA 1QJMA 5FTIA 4FAJA 3HSTA 4GD5A 5L8DA 3L6GA 3I5OA 3RQTA 3Q26A 4QF9A 4ZEKA 3JZJA 4MFIA 1SYHA 2PT2A 4MLQA 3KN8A 3T22A 3ZKKA 5CMKA 1JW1A 2OWTA 1B51A 3V5AA 2QS3A 2RF1A 3DP8A 3FXRA 1IUDA 1ZKBA 1P1WA 1VFEA 1ZU0A 2F7BA 2O1MA 2XXUA 3TCFA 1SI0A 2V3TA 3U94A 4F22A 4ZEFA 1LAXA 4DCXA 3FVGA 1Z7NE 3BKIB 2XXPA 4GL8A 2PX1A 3U1OA 5KCJB 4OENA 1LB9A 2Q2AA 1ANFA 1WVJA 1UTBB 2ESNA 4G8HA 2AL4A 1A8EA 3RPWA 3P7IA 1UIUA 1XC1A 4BDLA 1YCJA 4HW8A 4EQ9A 1B7UA 3MVXA 1D4NA 4IO4A 4KR5A 2DVZA 3SEYA 4BDQA 4EQBA 3FJMA 1R6ZA 3MZ1A 3KN3A 2OK2A 2THIA 5CMBA 3A3CA 5DVJA 3U92A 3K1NA 3K00A 4YAHX 2DWAA 3MWBA 3FVOA 1LBBA 4QFKA 5AA4A 2Z22A 3CRBA 1KWHA 1M5BA 1QVSA 3MZBA 2ZNSA 3PV0E 3QIMA 4O3AA 3GBBA 4XKRA 1FTLA 1OLAA 3SERA 2F97A 4PFTA 5I2KA 3FD3A 2NVUB 5I2KB 3TTLA 2GH9A 3DELB 4FORA 4LONB 2AYSA 3T9VA 2RCBA 4LUBA 1POY1 2O7UA 2Z8EA 3FV2A 2Z8FA 3C9HA 4G68A 3H6WA 3BFTA 1FQAA 1N7WA 1I6QA 2G93A 3E9XA 2IA4A 2XXHA 4G77A 1LAGE 2HQ0A 2W7YA 4OERA 5JK4A 1WODA 3HN0A 4JSDA 2PYYA 3IB1A 5TU0A 3RLFE 3FATA 4FIMA 3VXBA 1SW2A 2UYEA 3CG3A 5L9OA 1B0HA 4UA8A 3UN6A 4H1XA 1JEVA 1CB6A 2PVUA 2DXRA 4R6HA 3PMWA 4WXJA 5DVFA 3RUMA 3VVEA 1Q35A 2DWIA 2Y7KA 1B40A 4I1DA 3OOAA 1VR5A 1RKMA 1SW5A 1O64A 2HAVA 1XS5A 3OSRA 5I57B 5L9MA 2ABHA 2Y7WA 2DE4A 2ZXTA 4H5FA 4BDRA 1F9BA 3IAZA 1JQFA 2V3QA 3QUFA 4HTGA 4PFUA 5F1QA 3TPAA 3UA8A 2OJTA 1NNTA 4H6DA 4RYAA 1TFAA 3S9EA 1Y20A 4YB6A 3IX1A 4IGRA 1IXIA 3FVNA 3K6UA 3M8UA 1Y3QA 3TMGA 5CBSA 4AB6A 4F29A 1P99A 1GVCA 1GGGA 1JNFA 2V3UA 3TQLA 4KCCA 2OCUA 3QSLA 3PU5A 3GLBA 4F1UA 1B46A 4M1VA 3T9XB 3FIRA 3KN7A 5EHMA 4F39A 4KD5A 4ONYA 4YU0A 1MM6A 1JVXA 2REJA 3KSJA 4OEVA 1MXWA 1UTHB 3B6QA 4OFLA 4AQ4A 1XT8A 4LZ5A 4Q5TA 4H67A 4OESA 3F11A 1R1NA 2XX8A 5AA3A 2UYFA 1URSA 3QXMA 1PB8A 2UVHA 1P1OA 4C1UA 1LAHE 4KPTA 5ISUA 2I58A 4EXKA 1B4ZA 3IL1B 5DEXB 1OIBA 1P1NA 1B3LA 3Q29A 5I59A 5ICQA 3ILTB 3N6UA 3B7DA 1M5FA 3N94A 3RT6B 1LFIA 1SI1A 1EH3A 4POXA 4YB5A 3K6VA 3ONMA 2DOJA 3MPKA 4NMYA 1AOVA 4KYSA 1EZ9A 3PUZE 3A09A 4JWYA 3ZSFA 4BDNA 4EF2A 1UQWA 2QJEA 1MQDA 5F7VA 1H45A 3M3KA 4KCDA 4H65A 1RYOA 3OSQA 5FHNA 4G68C 2VD2A 2NOOA 4IY5A 5FHMA 1ZJLA 3K6XA 3E13X 3K1PA 3KSXA 4HCYA 4JWOA 4X1DA 3RT8A 3TUSA 3LC8A 1PEBA 3QAXA 2D21A 2D5WA 2I0CA 2V84A 5TP9B 4LVQA 2GRVA 4G4PA 5I57A 3MVWA 3PUWE 3TYHA 1PB9A 3A3UA 5I58A 3O66A 2O68A 3DLNA 3MP6A 3U8QA 1B1HA 1ZIUA 3JV9A 3PPOA 4WEPA 3KJTA 3G3IA 5H8FB 4PE5B 1LLSA 2B3BA 3PD8A 1MY2A 4WKMA 5BWJA 1P1QA 1LGBC 1QULA 3CG1A 4DXBA 3KBRA 1IXHA 3C36A 3OO8A 4H0WA 1M5DA 3OD7A 5TPAA 5A5XB 4RA1A 4LZ8A 4POWA 1FQCA 1BTJA 4YMAA 5KCJA 3UIFA 3M3FA 4RK2A 2VD3A 3CFZA 3Q28A 4GFRA 4GL0A 4ZE8A 1O7TA 2HCAA 3ILUB 2B65A 3CVGA 4G68B 4GLIA 3VLVA 3H7MA 1MG1A 1MPDA 2O69A 3ECRA 4GXSB 1MY4A 1WDNA 4RXLA 3S9NC 1N3WA 5H8HB 3IB2A 2V25A 3EF7A 1PB7A 4F2OA 5ITOA 1LSTA 3D4CA 1Y9UA 3OO9A 2XXQA 1MH3A 2DQVA 2GFEA 4N6PA 4OFJA 1J1NA 2HFBA 3LSXA 2RC7A 4P11A 4QFOA 4I62A 4PP0A 2F36A 4NE4A 3V89B 3N5LA 1QUJA 3C35A 3V83A 3MW0A 3C33A 4EF1A 1NMUA 2XD2A 3G3KA 4IO7A 4JDFA 4LA9A 3VXCA 3PMVA 1AIVA 4O3BA 1YPNA 2DVCA 1XHYA 3GBAA 3TFLA 5ITPA 4R75A 2XD3A 3FVKA 2UVIA 2Q88A 3FXQA 1Y3NA 3O6IA 4FEBA 3E3KA 2I4CA 4JBZA 4YKPA 1I69A 4ISUA 4U21A 3H6VA 4R2FA 4F3GA 4XKNA 5EYFA 4L17A 3TKDA 1MQHA 4LQ2A 4QRZA 1IITA 2F6GA 3Q27A 4NF6A 1SDXA 3PGFA 5K2YA 3G3HA 5J1DA 4NF6B 2V93A 3TCHA 5I58B 2D3IA 3T9HB 3TTMA 2IEEA 2Q89A 4U4XA 1B2HA 2RCAA 3C4MA 2DWJA 1B1XA 5AA2B 2XXYA 3MVYA 1JETA 4ZZAA 4RY1A 5I59B 1NL5A 3IB0A 3CSBA 2DP8A 5KZTA 1RYXA 1SVXB 4ESWA 2GHAA 2HZLA 1N7XA 3K4UA 3QYTA 3RNNA 3R26A 4OZ9A 3FV1A 3H6TA 5DEXA 2DS9A 2I6EA 3CI8A 1QKBA 1VSOA 4U22A 4DIGA 1XVXA 4EDPA 5AA4B 1FCKA 1SQYA 2XXRA 2NUVA 2ZNUA 3MBPA 4RK9A 4IY6A 1L5TA 1OMPA 2DWHA 1MY3A 1NNFA 1LAFE 3EHUA 4MLVA 4OHNA 4GWOA 1Q1KA 1N04A 2R6GE 2H5YA 3N6TA 1PDAA 2CZLA 3TTKA 2YLNA 5K2XA 3HV1A 4Z7EA 1D3KA 3UP9A 1TWYA 1N84A 3OELA 2YPNA 4H8JA 1B4HA 3TEPA 4NTLA 3TTNA 1TT1A 5H8QA 5L9SA 1NNKA 4MBPA 3IOWA 3UORA 3VFJA 3MUQA 4ESXA 2OBGA 3OEMA 2ALUA 4NF8B 4NF5B 2O7IA 1D9VA 4BDMA 2F7CA 5CBRA 2Z23A 1H44A 3FUZA 2CMOA 2H25A 3IORA 3PPQA 3PUVE 3CIJA 4PFWA 4F1YA 1B05A 4KQPA 2A5TA 1SW4A 4RPOA 1B3EA 2Y7IA 4RPNA 4IO2A 4PETA 3VLWA 4I9DA 4IO6A 4ELPA 4ZZEA 5I56A 2B3FA 3SEUA 5FTHA 1MQGA 5AA2A 3QUJA 1IXGA 1I6BA 3W9VA 2DE2A 1MQJA 2R71A 3FXUA 4OXVA 1B5JA 2ONSA 3T93B 3RGYA 2QS4A 2RC9A 5A5XA 3T96B 1HSJA 1I6AA 1DTZA 5BUUA 4NF4A 2AIXA 3HHFA 3O9PA 1P1UA 1NH7A 4JSOA 2NXOA 4E0WA 4I8CA 3IOUA 1NNPA 1AL3A 3FZVA 3HCQA 3TTRA 1EZPA 2F8DA 3G3GA 4OWDA 4QSDA 1AH5A 2DXYA 3QK6A 5HM4B 1FTOA 2ZNTA 1MXVA 3I6VA 3O97A 3IO4A 2Q8JA 4ECFA 2RKMA 1BKAA 1JEUA 2G29A 3OO6A 1URGA 5AA2D 4HCWA 1ZLQA 4ELOA 1POTA 1H3DA 1US5A 2HAUA 1FQFA 2QS1A 1ZMGA 1DPEA 3MC2A 4KYDA 4OYVA 4DCYA 3OEKA 5I2NB 2LAOA 3PPPA 4G2ZA 1TFDA 1N3XA 2ONKE 4GQOA 4F31B 4QSEA 5H8SA 4GF8A 4H5GA 1BP5A 3R7XA 3K02A 3SDFA 2ZYOA 4EXLA 4DXUA 4YMBA 3FJ7A 4F3SA 2QMWA 5I56B 1B52A 4X9TA 1DPPA 3LSWA 2PBWA 1SBPA 3DP4A 2I48A 3H3GA 1DOTA 4LZ7A 4OETA 2F34A 3UGWA 3SEVA 1QKAA 4EQ7A 2X7QA 3KGCA 2QL3A 2R9JA 3S4UA 3PD9A 4QHQA 2VP1A 1B3HA 4QFLA 2P0SA 2E1SA 4U4SA 3RTWB 1M5CA 2A5TB 2VGQA 4U1OA 4C1TA 1A54A 3E4RA 3RN8A 4MF3A 3HO7A 3IK6B 4OTEA 4P0IA 2ANJA 5JTYA 2PMSA 2DSFA 4QFNA 4Q8RA 4DZ1A 4R9GA 3OXNA 2OWSA 4TOZA 3TCGA 4Z0IA 1QUKA 4KFQA 2OZZA 1MDP1 3FASA 4DDDA 4ND9A 3SETA 4JB7A 3C31A 3MQ9A 3HHGA 4KI0E 2VHAA 2O84X 1FTKA 3O28A 3LSFB 3IOTA 4R6YA 1UTBA 2O6AA 1OQHA 3LSLA 4KHZE 1MXUA 4R9FA 5ELVA 5TPAB 4O3CA 1B7HA 1HSEA 2KLFA 4BDOA 3PPNA 3MP8A 5I2NA 3CR9A 4X1BA 1II5A 3L6HA 3U72A 4AB5A 2UVJA 1FW0A 1URDA 3EHTA 5CMMA 3VV5A 3CFXA 3MAMA 1LBCA 1TXFA 2UVGA 3G7WA 3USDA 5H8QB 3VVDA 3WAFA 2O51A 4GVOA 3IR1A 1FQEA 2A5SA 4GIZA 4NWCA 4Q30B 4WEDA 5JEIA 2VOZA 3U93A 1IQ7A 2GHBA 1ATGA 3IO6A 1B58A 1HSLA 2OLBA 3B6TA 3D4GA 2H4IA 3K1MA 5AA1A 1B7ZA 4N13A 3KZGA 5CRYA 4ELQA 5IKBA 2YJPA 1USYH 1ELJA 3IJXB 3OENA 1B9JA 2QSXA 2Z8DA 2F35A 3H06B 3S2VA 4GOTA 1MPCA 4ZECA 1ZBMA 2HEUA 1ZTYA 1B3GA 3OO7A 2H98A 1B0LA 1IXCA 4YKIA 2RC8A 3PUXE 4GRKA 4MH5A 2H99A 5H8HA 4OQOA 3K6WA 4JWXA 4RJZA 5KDTB 4R72A 1SD3A 2F78A 2FYIA 4F18A 3MVZA 4XKQA 1USYE 1Y4CA 3BFUA 3RTFB 4DE8A 3BBRA 3DM0A 1JW4A 1LB8A 2F7AA 4NF4B 2RINA 1FTJA 5HBCA 3GXAA 4UACA 2P1SA 2DE3A 2Q2CA 2UXAA 3FGSA 3JYRA 2Q9TA 2ONRA 3LBSA 1JVYA 4OMBA 1IEJA 3PMXA 2I3VA 3O6HA 3C32A 4NWDA 4TLLB 4XIGQ 1R9QA 2H9BA 1A40A 4R2BA 5FHOA 4U1ZA 4ZE9A 4LATA 5IAIA 3S9LC 2XX9A 3KOTA 1O63A 3C34A 2QPQA 4TLMB 1DTGA 1EZOA 3M3LA 4P0GA 1B5IA 3T9UA 1GV8A 2AL5A 3IOVA 1Y1ZA 3V8XB 4FECA 4F3PA 4U2RA 5H8FA 5I84A 5H8NA 2XXWA 2QS2A 3ODBA 4N07A 1OVTA 2ZYKA 2BJJX 2XXTA 4FEDA 4QFPA 1MM7A 4TQUQ 2REGA 3MZ9A 3VDFA 4DLDA 2QMXA 4FATA 3TODA 1QUIA 1LCFA 3K01A 4PFYA 4XXUA 1PBQA 4YZZA 4F3BA 2HXWA 4IGTA 5AE4A 1NKXA 3TZAA 1GTKA 1LFGA 1Y4TA 3N26A 3DP6A 1IIWA 3UK4A 4FE8A 1A55A 3MP1A 2XHDA 1BIYA 4YB7A 1MY1A 1PC3A 2XXXA 1MH4A 3H4ZA 4KYEA 3G3FA 5CC2A 2E0SA 1MXYA 2HZKA 2I4BA 3TELA 2WKYA 4X48A 4R74A 4ELRA 1CE2A 3MPLA 4LP2B 1IZ1A 4NEDA 5ICTA 3IJOB 1VE4A 4FJPA 4DXCA 2PT1A 2QRYA 3KG2A 1NH8A 3EN3A 1OQGA 3TDJA 1H43A 2FA7A 2I3WA 2M8CA 1B5HA 2ZYNA 4G8NA 4OVJA 4ZEBA 1T0KA 1US4A
chains in the Genus database with same CATH superfamily
4R6KA 1IMEA 1N0TA 5CI5A 2FIXA 4NF8A 3SESA 1LCTA 5HPQA 3SKPA 5EHSA 1FTAA 1YAEA 3FJGA 4PCDA 3ZKLA 3EQ1A 2OX3A 4XKPA 3O2AA 1NV4A 5M2VA 4GWXA 2Q8MA 5CM6A 1VFDA 1MDQA 4M4GA 3PUYE 5LOMA 3D1RA 3THIA 3KFMA 1OVBA 4N91A 1S50A 1DSNA 3GZGA 2F6PA 2Y84A 3LR1A 1MPBA 3IFAA 3O6GA 4Q0CA 4GXAA 1XVYA 1FQDA 1YTVA 2X7PA 2X26A 2ZMBA 3HPIA 3GYYA 4FAJA 3L6GA 3I5OA 4MFIA 1LBYA 3KN8A 5CMKA 1B51A 2PFYA 5F24A 1Z7NE 3BKIB 4GL8A 1LB9A 2AL4A 2PCRA 1XC1A 4BDLA 4HW8A 4EQBA 3U92A 3KN3A 5I5PA 3K00A 4YAHX 2Q74A 3MWBA 2WYPA 3FVOA 4XKRA 4O3AA 3GBBA 4PFTA 5I2KA 3FD3A 4NX1A 2GH9A 3TTLA 2RCBA 4LUBA 2O7UA 2Z8EA 2Z8FA 1FQAA 1I6QA 2IA4A 5JK4A 5TU0A 3RLFE 2PYYA 4UA8A 2DWIA 4I1DA 1VR5A 1KA0A 4H5FA 4BDRA 1F9BA 5IM2A 4PAFA 1NNTA 3S9EA 4YB6A 3M8UA 5I7IA 5CBSA 3QSLA 3PU5A 1B46A 4PBQA 4KD5A 1MM6A 4OEVA 4OFLA 4AQ4A 1R1NA 2XX8A 3A29A 1PB8A 1P1OA 1LAHE 1DBZA 5ISUA 2I58A 1FPEA 1B4ZA 4MIJA 4P1EA 4EXKA 5DEXB 5I59A 3B7DA 1EH3A 3K6VA 3ONMA 4KYSA 1MQDA 3M3KA 4KCDA 4PAIA 5FHNA 5FHMA 1ZJLA 3E13X 2I0CA 4G4PA 3MVWA 1PB9A 1FBCA 3DLNA 3MP6A 3U8QA 4WEPA 2B3BA 1LGBC 4DXBA 3KBRA 4LZ8A 1IMFA 1IMBA 4POWA 1FQCA 1DK4A 1KA1A 1IMCA 1O7TA 2B65A 3CVGA 3VLVA 4GLIA 1MG1A 1FBGA 1MY4A 1N3WA 3IB2A 2V25A 1JP4A 1PB7A 3EF7A 4P47A 1Y9UA 1LEVA 3LSXA 4MNPA 3V89B 2XD2A 3G3KA 3VXCA 3PMVA 4O3BA 1YPNA 2DVCA 4XEQA 4O94A 5LDZA 1Y3NA 2HPGA 4FEBA 4R2FA 5EYFA 4LQ2A 1IITA 2F6GA 3G3HA 3TCHA 4U4XA 1B1XA 1JETA 4RY1A 3CSBA 4DI4B 4PFIA 1N7XA 1FJ9A 3K4UA 3FV1A 3H6TA 2DS9A 1QKBA 1VSOA 1FCKA 1OMPA 4OHNA 4I40A 4MAGA 4MLVA 1N04A 2R6GE 1PDAA 1KZ8A 2YPNA 1B4HA 3TEPA 2OBGA 3OEMA 4NF5B 2O7IA 4BDMA 5CBRA 3PUVE 2H25A 3IORA 1SW4A 2MKZA 1FBDA 2B4MA 2B3FA 3SEUA 1IXGA 2R71A 1FPLA 5A5XA 5IGAA 3T96B 4NF4A 1FPIA 1NH7A 1AL3A 3FZVA 4QSDA 3QK6A 3IO4A 3OO6A 1URGA 1G0HA 2XA5A 1H3DA 2HAUA 4OYVA 1ZMGA 1DPEA 4KYDA 4F31B 3K02A 2ZYOA 4EXLA 1K9YA 5I56B 3LSWA 1NV0A 3DP4A 4EQ7A 3UGWA 1QKAA 2QL3A 4QHQA 3RTWB 1M5CA 2VGQA 4U1OA 4C1TA 4O8MA 3RN8A 3HO7A 4DZ1A 4R9GA 3OXNA 4Z0IA 3KBZA 2VHAA 2O84X 4R6YA 2O6AA 1OQHA 5TPAB 4O3CA 5I2NA 3PPNA 3MP8A 5DW8A 3CR9A 4OANA 1URDA 3EHTA 3MAMA 1LBCA 3USDA 5H8QB 2O51A 4GIZA 4Q30B 1EYKA 2GHBA 1ATGA 5AA1A 2OLBA 2YJPA 1ELJA 1FBEA 4ZECA 2F35A 3H06B 1ZTYA 2H99A 4RJZA 3NOHA 1SD3A 2FYIA 4F18A 4XKQA 2WX9A 1JW4A 1LB8A 1XI6A 2RINA 1FTJA 2P1SA 3FGSA 3JYRA 4OMBA 1IEJA 3PMXA 1YZ0A 3C32A 1R9QA 4R2BA 1A40A 4ZE9A 2XX9A 2QPQA 3M3LA 1Y1ZA 4MMPA 5H8NA 1LBVA 4FEDA 4PFYA 4GBWA 4F3BA 1LFGA 3UK4A 1MY1A 1MH4A 1DCUA 5CC2A 1MXYA 2I4BA 4X48A 2FBPA 3MPLA 4N15A 1NV1A 4NEDA 3KG2A 3EN3A 4PC9A 3T0JA 2FA7A 1A8FA 4F19A 2O1LA 4ZEDA 1Y1MA 1XOCA 1RDYA 4NF5A 4G8MA 5B70A 1A99A 1D9QA 5TP9A 5EYHA 2ZZVA 3T66A 3CFLA 5A5LA 1FTMA 3EPEA 1BLFA 3B50A 3W9WA 1NFTA 5B7DA 4HS7A 1R9LA 1S9TA 1MQIA 4R73A 4QSCA 5I59B 4FATA 1DMBA 4K3FA 3AXFA 1FPBA 3LV0A 4IB2A 5KDTA 1H76A 5T3JA 3KJ7A 5EQ7A 1FPJA 4THIA 5CMCA 3SEWA 2F3BA 3KEIA 1QJMA 3HSTA 3Q26A 4ZEKA 1SYHA 4MLQA 3T22A 3ZKKA 3EKIA 3V5AA 2QS3A 4N8GA 3DP8A 1ZU0A 1P1WA 4PF8A 3U94A 4F22A 3FVGA 2VPNA 1NUWA 4OENA 1ANFA 4HE1A 1UTBB 1IMDA 2ESNA 4MHFA 1A8EA 3P7IA 4EQ9A 4OVRA 3KC1A 3MVXA 4OVSA 3FJMA 5AA4A 3PV0E 4Z7EA 1KWHA 3T9VA 1OLAA 2F97A 1POY1 3C9HA 2G93A 3E9XA 4OERA 4G77A 2W7YA 3HN0A 3FATA 4JVCA 3CG3A 5L9OA 4WXJA 3RUMA 3VVEA 4PAKA 1Q35A 1RKMA 5I57B 1NV2A 2ZXTA 5ESYA 1JQFA 2V3QA 3QUFA 4HTGA 4H6DA 4RYAA 1IXIA 3K6UA 1Y3QA 2XWKA 3TMGA 1LBWA 3T1BA 5IZ1A 4KCCA 3GLBA 4F1UA 5EHMA 2REJA 1MXWA 1UTHB 4N4UA 4LZ5A 4H67A 4OESA 4PTKA 4PBHA 4HE2A 1P1NA 3Q29A 5ICQA 3ILTB 3N6UA 3RYDA 1EZ9A 3A09A 3ZSFA 4EF2A 2KR0A 1RYOA 3OSQA 4X04A 4FBPA 4G61A 3K6XA 4X1DA 3K1PA 3TUSA 3QAXA 2GRVA 5I57A 2WBBA 3A3UA 1FPDA 1ZIUA 1MY2A 5BWJA 1P1QA 4H0WA 5A5XB 1M5DA 2JJKA 4RA1A 4YMAA 5KCJA 3M3FA 2VD3A 3CFZA 4GFRA 4G68B 2O69A 1FJ6A 4F2OA 5ITOA 3OO9A 2RC7A 4QFOA 2F36A 4NE4A 3V83A 4JDFA 1XHYA 4R75A 2I4CA 1I69A 4ISUA 4U21A 3H6VA 4F3GA 4XKNA 4L17A 5K2YA 3Q27A 1SDXA 4NF6B 2WBDA 1B2HA 4P56A 2DWJA 5AA2B 2XXYA 1RYXA 1SVXB 4ESWA 4MNIA 3QYTA 3RNNA 3R26A 2I6EA 4EDPA 1SQYA 2ZNUA 1FPKA 3MBPA 4RK9A 1L5TA 4IY6A 1MY3A 1NNFA 3EHUA 1Q1KA 3TTKA 3B8BA 2H5YA 2CZLA 3HV1A 3UP9A 3OELA 4H8JA 3TTNA 1TT1A 5H8QA 3IOWA 3MUQA 1H44A 3FUZA 3CIJA 4F1YA 4KQPA 1B3EA 1SPIA 4IO2A 3VLWA 4I9DA 4IO6A 5FTHA 1MQGA 1I6BA 2QS4A 4PF6A 1HSJA 1I6AA 1P1UA 4JSOA 2B4LA 1NNPA 2F8DA 1AH5A 5HM4B 3I6VA 2FHYA 5AA2D 4HCWA 4PGNA 2QS1A 3MC2A 1TFDA 4GF8A 4H5GA 3R7XA 1BK4A 5EQ9A 1DPPA 2PBWA 1SBPA 3H3GA 1DOTA 2R9JA 1B3HA 4MF3A 3IK6B 4OTEA 1EYJA 4P0IA 4AS4A 2ANJA 4Q8RA 2DSFA 3TCGA 4KFQA 4DDDA 4ND9A 3C31A 3MQ9A 1FTKA 5IZZA 1B7HA 4X1BA 3U72A 5CMMA 3VV5A 3CFXA 3WAFA 3G7WA 1NV3A 3IR1A 4XFEA 4WEDA 5JEIA 1IQ7A 1B58A 3K1MA 2H4IA 1B7ZA 4N13A 1NV7A 3IJXB 1B9JA 2QSXA 4GOTA 1MPCA 1ZBMA 4N6DA 1B3GA 4YKIA 4GRKA 4MH5A 4JWXA 5KDTB 4R72A 2F78A 5EYGA 1Y4CA 2WEFA 2P3VA 4QXDA 2UXAA 2ONRA 4XIGQ 3O6HA 2R8TA 2H9BA 5IAIA 4U1ZA 1O63A 3C34A 3SZPA 1EZOA 1B5IA 5H8FA 3IOVA 4F3PA 4U2RA 4N07A 2QS2A 3VDFA 4TQUQ 3MZ9A 4DLDA 2QMXA 4IGTA 5AE4A 1GTKA 2HZKA 5ICTA 4FJPA 2Y5KA 1H43A 2M8CA 2ZYNA 4OVJA 4ZEBA 1US4A 4ZDMA 1N76A 4BLAA 2XWIA 3LUYA 1B3FA 4NAPA 3VLUA 4YKJA 1SYIA 4H46A 3VVFA 1Y3PA 2I49A 5DTBA 4E0XA 1GR2A 3O29A 5H8NB 4EUOA 2XWVA 3OMBA 4PQJA 1MXZA 1NV5A 1EU8A 3W15C 4LQ5A 2F5XA 1OLCA 4ZS9A 2Y7RA 2Y7PA 1QW0A 4H8IA 5DYHA 4JVIA 1FQBA 1B6HA 1MRPA 2DYXA 3KOSA 4YKKA 4PE3A 3Q25A 3G3JA 1PBPA 3RY3A 3K0VA 4KXPA 4XTCQ 1LFHA 2XXVA 4F2QA 2P2AA 4IO5A 1UTHA 3TAJA 3R6UA 5LTCA 3K2DA 3SEXA 2XX7A 3TQWA 2ZYMA 1JW5A 4RNSA 2QVUA 5FTIA 4GD5A 5L8DA 5ET5A 3JZJA 2PT2A 2OWTA 3FXRA 1IUDA 3HFUA 2V3TA 4ZEFA 3U1OA 5KCJB 4AS5A 1WVJA 2Y5LA 4NF0A 1UIUA 4N17A 4KR5A 3SEYA 2DVZA 2OK2A 3K1NA 2CZKA 2DWAA 2Z22A 3CRBA 1M5BA 1QVSA 3MZBA 3QIMA 3SERA 1FTLA 2FVZA 1YXIA 4P8BA 5I2KB 3DELB 4FORA 5IZ3A 4G68A 3H6WA 3IFCA 3BFTA 2HQ0A 1B0HA 4H1XA 2PVUA 2DXRA 4R6HA 2Y7KA 1O64A 1XS5A 5L9MA 2Y7WA 2XXKA 3IAZA 4PFUA 3TPAA 5F1QA 2OJTA 1TFAA 1Y20A 3IX1A 3FVNA 4AB6A 4F29A 1GVCA 1GGGA 3TQLA 4M1VA 3FIRA 3KN7A 4YU0A 1JVXA 1XT8A 2FIEA 1FRPA 5AA3A 3QXMA 4KPTA 1M5FA 3N94A 1LFIA 1SI1A 4POXA 4YB5A 2DOJA 4NMYA 4JWYA 5F7VA 1H45A 4NGUA 2NOOA 4IY5A 4OA4A 3RT8A 4JWOA 3LC8A 2D21A 4LVQA 5I58A 3O66A 4OVQA 1CNQA 3PPOA 3G3IA 5H8FB 4PE5B 3PD8A 1QULA 3C36A 3OO8A 3OD7A 5TPAA 4PFRA 2L5VA 4RK2A 4GL0A 2HCAA 3ILUB 3H7MA 1MPDA 3ECRA 4GXSB 4RXLA 1WDNA 1LSTA 4N6PA 1MH3A 2GFEA 1J1NA 1NI9A 3N5LA 1QUJA 3MW0A 3C33A 1NMUA 4IO7A 3TFLA 5ITPA 2XD3A 3FVKA 2UVIA 2Q88A 4N6KA 3O6IA 3E3KA 4YKPA 4UABA 5EQ8A 1FBFA 4P3LA 3TKDA 1MQHA 2VPOA 2V93A 5I58B 2D3IA 3T9HB 2Q89A 3BIGA 2RCAA 4N81A 3FXBA 3MVYA 1NL5A 4GWSA 2GHAA 1LBXA 4HXVA 4DIGA 1XVXA 2XXRA 4GWOA 3N6TA 1D3KA 1TWYA 1N84A 4MBPA 3UORA 3VFJA 4ESXA 4H45A 1D9VA 2F7CA 2Z23A 1FSAA 5FBPA 4RPNA 5EQAA 4ELPA 4ZZEA 5AA2A 3QUJA 3W9VA 1MQJA 3FXUA 4OXVA 2RC9A 4P9KA 5BUUA 2AIXA 3O9PA 3IOUA 1EZPA 3G3GA 1LBZA 2DXYA 1FTOA 2G29A 3ROJA 1FQFA 4DCYA 3PTYA 3OEKA 2ONKE 4QSEA 1FPFA 5H8SA 1BP5A 3SDFA 4X8RA 3KC0A 4N8YA 4DXUA 3FJ7A 2QMWA 5J16A 4OETA 4ELOA 2F34A 3SEVA 3KGCA 3PD9A 4U4SA 1G0IA 2HHMA 1NUXA 3E4RA 4P1LA 2PMSA 2OWSA 2OZZA 1MDP1 3FASA 3SETA 4PFBA 4KI0E 3LSFB 3IOTA 4HE0A 1UTBA 3LSLA 4KHZE 1MXUA 1HSEA 2KLFA 1TXFA 2UVGA 4GVOA 1FQEA 2A5SA 4NWCA 3U93A 3D4GA 5CRYA 1USYH 4MJOA 5ET7A 3OENA 4YMBA 2Z8DA 4GX4A 2HEUA 2CEYA 3LUZA 1B0LA 1IXCA 2RC8A 3PUXE 3FBPA 4OQOA 3BFUA 3RTFB 2DDKA 4I3EA 4GWYA 5HBCA 3GXAA 4UACA 1FPGA 3LBSA 2Q9TA 4NWDA 2I3VA 4LATA 3KOTA 3E78A 4TLMB 1DTGA 3T9UA 2AL5A 3V8XB 4FECA 2XXWA 3ODBA 2ZYKA 2BJJX 2XXTA 4QFPA 2REGA 2VT5A 1LCFA 3K01A 2HXWA 1NV6A 3RPLA 1Y4TA 1A55A 3MP1A 1PC3A 3H4ZA 1K9ZA 3G3FA 2E0SA 3TELA 2WKYA 4R74A 4ELRA 4IR8A 1NH8A 1B5HA 4NHBA 4OFOA 1M5EA 1B32A 1A7LA 3PPRA 1MXXA 3MJNA 4OEUA 1MS7A 5DVIA 2WYKA 1S7YA 1UIVA 2NWJA 3H6UA 3S9MC 2ZZXA 4O7IA 4ZEIA 3MSTA 4IO3A 5JTYB 4U23A 3H03A 4F1VA 1Z7ME 3B6WA 2I0BA 5DT6A 1MY0A 2XXIA 3EHSA 4JXIA 2QVRA 2QFLA 3ZS6A 2FNCA 1D9YA 3CSGA 4C0RA 1SW1A 3WAEA 3VE1B 1AMFA 3I3VA 4YICA 3RQTA 4QF9A 1JW1A 2RF1A 4MX6A 3RT6B 1ZKBA 3TCFA 1VFEA 2F7BA 2O1MA 2XXUA 2V4CA 1SI0A 2GQ1A 1LAXA 4DCXA 2XXPA 2PX1A 2Q2AA 4G8HA 3RPWA 1YCJA 1B7UA 2QVVA 1D4NA 4IO4A 4BDQA 1R6ZA 3MZ1A 5DVJA 2THIA 5CMBA 3A3CA 4QFKA 1LBBA 5J1DA 2ZNSA 2NVUB 1RDZA 4GWWA 4LONB 2AYSA 3FV2A 1N7WA 2XXHA 1LAGE 4JVDA 4NG7A 1WODA 4JSDA 3IB1A 3VXBA 4FIMA 1SW2A 2UYEA 3UN6A 1JEVA 3CHGA 1CB6A 3PMWA 5DVFA 2XWOA 1B40A 3OOAA 1SW5A 2HAVA 3OSRA 2ABHA 2DE4A 2PFZA 3UA8A 1INPA 4GBVA 4IGRA 1P99A 1JNFA 2V3UA 2OCUA 3T9XB 4F39A 4ONYA 4PDDA 3KSJA 3B6QA 4Q5TA 1YYZA 3F11A 2UYFA 1URSA 2UVHA 4C1UA 2OWZA 3IL1B 3QMFA 1OIBA 1B3LA 3MPKA 1FBHA 1AOVA 3PUZE 4DI3D 4BDNA 1UQWA 2ZZWA 2QJEA 4PDHA 4H65A 4MEVA 4G68C 2VD2A 3KSXA 4HCYA 1PEBA 5TP9B 2D5WA 2BJIA 1NUZA 2V84A 3PUWE 3TYHA 2O68A 1B1HA 3JV9A 3KJTA 2CZHA 1LLSA 4WKMA 3CG1A 1IXHA 3MYUA 1BTJA 2P3NA 3UIFA 3Q28A 4ZE8A 3U65A 3S9NC 1QGXA 5H8HB 3D4CA 2XXQA 2DQVA 4OFJA 1AWBA 2HFBA 4P11A 4I62A 4PP0A 1RDXA 3C35A 4EF1A 4LA9A 4GWZA 2CZIA 1AIVA 3GBAA 3FXQA 4JBZA 4QRZA 4NF6A 4XF5A 3PGFA 3TTMA 3E79A 2IEEA 3C4MA 4ZZAA 2F3DA 3IB0A 2DP8A 5KZTA 2KQZA 2HZLA 1NUYA 4OZ9A 5DEXA 3CI8A 4U22A 5AA4B 2NUVA 2DWHA 4PGPA 1LAFE 2HXRA 2YLNA 5K2XA 4O7MA 4NTLA 5L9SA 1NNKA 2ALUA 4NF8B 1EYIA 2CMOA 3PPQA 4PFWA 1B05A 2A5TA 4RPOA 2Y7IA 1FBPA 4PETA 5I56A 5ET6A 2DE2A 1B5JA 2ONSA 3T93B 3RGYA 3ISPA 1DTZA 3HHFA 3RPLB 2NXOA 3BIHA 4E0WA 4I8CA 3HCQA 3TTRA 1Q9DA 4OWDA 2ZNTA 1MXVA 2Q8JA 3O97A 4ECFA 2RKMA 1BKAA 1JEUA 4MCOA 1ZLQA 1POTA 1US5A 5ET8A 4MNCA 5I2NB 2LAOA 3PPPA 4G2ZA 4GQOA 1N3XA 4GX6A 4F3SA 1B52A 4X9TA 1VDWA 2I48A 4LZ7A 2X7QA 3S4UA 4QBAA 2VP1A 4QFLA 2P0SA 2E1SA 2A5TB 1A54A 5JTYA 4QFNA 4TOZA 5I3SA 1QUKA 4JB7A 3HHGA 3O28A 4R9FA 5ELVA 4BDOA 1II5A 3L6HA 4AB5A 2UVJA 1FW0A 4GWUA 3VVDA 1IMAA 2VOZA 3IO6A 1HSLA 3B6TA 4ELQA 5IKBA 3KZGA 3S2VA 5IZ3B 3OO7A 2H98A 4NQ8A 4I3YA 4GX3A 5H8HA 3K6WA 4OVPA 3MVZA 1USYE 4DE8A 3BBRA 3DM0A 2F7AA 4NF4B 2DE3A 2Q2CA 1JVYA 4LN5A 5FHOA 4TLLB 3S9LC 4NN3A 4P0GA 1GV8A 5I84A 1OVTA 2CEXA 1MM7A 3TODA 1QUIA 4XXUA 1PBQA 4YZZA 1NKXA 3TZAA 3N26A 3DP6A 1IIWA 4FE8A 2XHDA 1BIYA 4YB7A 2XXXA 4KYEA 4OVTA 1CE2A 4LP2B 1IZ1A 3IJOB 1VE4A 4DXCA 2PT1A 2QRYA 1OQGA 3TDJA 2I3WA 4G8NA 1T0KA
chains in the Genus database with same CATH topology
4ZDMA 4R6KA 1N76A 4OFOA 1M5EA 4BLAA 1A8FA 3LUYA 1B32A 1B3FA 3VLUA 2O1LA 4YKJA 4F19A 1Y1MA 4ZEDA 1A7LA 1XOCA 1SYIA 3PPRA 3VVFA 1N0TA 1Y3PA 2I49A 5CI5A 1GR2A 1MXXA 5DTBA 3O29A 4NF8A 4NF5A 4E0XA 4EUOA 5H8NB 3SESA 1LCTA 4G8MA 5B70A 3MJNA 4OEUA 5HPQA 3SKPA 1A99A 3OMBA 5TP9A 1MS7A 5DVIA 4PQJA 5EHSA 1YAEA 1MXZA 1S7YA 1UIVA 1EU8A 3FJGA 2NWJA 3H6UA 3W15C 3S9MC 3ZKLA 3T66A 3CFLA 3EQ1A 4LQ5A 2F5XA 1OLCA 4ZS9A 2Y7RA 2Y7PA 1FTMA 4ZEIA 4IO3A 5JTYB 4U23A 1QW0A 4XKPA 3EPEA 3O2AA 1BLFA 4H8IA 5M2VA 5DYHA 3W9WA 1FQBA 1NFTA 5B7DA 1B6HA 1MRPA 2DYXA 3H03A 4HS7A 5CM6A 1VFDA 1MDQA 1R9LA 4F1VA 1S9TA 1MQIA 1Z7ME 2I0BA 3B6WA 3KOSA 3PUYE 4M4GA 4QSCA 4R73A 4YKKA 5DT6A 1DMBA 4K3FA 3AXFA 3KFMA 3THIA 5LOMA 1MY0A 1OVBA 3Q25A 2XXIA 3G3JA 3EHSA 1S50A 4JXIA 1PBPA 3RY3A 3K0VA 4XTCQ 1LFHA 2XXVA 4F2QA 4IB2A 1DSNA 5KDTA 1H76A 3GZGA 2P2AA 3ZS6A 2FNCA 4IO5A 1D9YA 1UTHA 2F6PA 3TAJA 3KJ7A 3R6UA 2Y84A 3LR1A 3CSGA 1MPBA 3O6GA 3K2DA 4THIA 2XX7A 4GXAA 1XVYA 4Q0CA 3SEXA 1FQDA 1SW1A 1YTVA 3TQWA 4C0RA 2ZYMA 5CMCA 3SEWA 3WAEA 2X7PA 3VE1B 2X26A 1AMFA 2ZMBA 3HPIA 3I3VA 1JW5A 4RNSA 3KEIA 4YICA 1QJMA 5FTIA 4FAJA 3HSTA 4GD5A 5L8DA 3L6GA 3I5OA 3RQTA 3Q26A 4QF9A 4ZEKA 3JZJA 4MFIA 1SYHA 2PT2A 4MLQA 3KN8A 3T22A 3ZKKA 5CMKA 1JW1A 2OWTA 1B51A 3V5AA 2QS3A 2RF1A 3DP8A 3FXRA 1IUDA 1ZKBA 1P1WA 1VFEA 1ZU0A 2F7BA 2O1MA 2XXUA 3TCFA 1SI0A 2V3TA 3U94A 4F22A 4ZEFA 1LAXA 4DCXA 3FVGA 1Z7NE 3BKIB 2XXPA 4GL8A 2PX1A 3U1OA 5KCJB 4OENA 1LB9A 2Q2AA 1ANFA 1WVJA 1UTBB 2ESNA 4G8HA 2AL4A 1A8EA 3RPWA 3P7IA 1UIUA 1XC1A 4BDLA 1YCJA 4HW8A 4EQ9A 1B7UA 3MVXA 1D4NA 4IO4A 4KR5A 2DVZA 3SEYA 4BDQA 4EQBA 3FJMA 1R6ZA 3MZ1A 3KN3A 2OK2A 2THIA 5CMBA 3A3CA 5DVJA 3U92A 3K1NA 3K00A 4YAHX 2DWAA 3MWBA 3FVOA 1LBBA 4QFKA 5AA4A 2Z22A 3CRBA 1KWHA 1M5BA 1QVSA 3MZBA 2ZNSA 3PV0E 3QIMA 4O3AA 3GBBA 4XKRA 1FTLA 1OLAA 3SERA 2F97A 4PFTA 5I2KA 3FD3A 2NVUB 5I2KB 3TTLA 2GH9A 3DELB 4FORA 4LONB 2AYSA 3T9VA 2RCBA 4LUBA 1POY1 2O7UA 2Z8EA 3FV2A 2Z8FA 3C9HA 4G68A 3H6WA 3BFTA 1FQAA 1N7WA 1I6QA 2G93A 3E9XA 2IA4A 2XXHA 4G77A 1LAGE 2HQ0A 2W7YA 4OERA 5JK4A 1WODA 3HN0A 4JSDA 2PYYA 3IB1A 5TU0A 3RLFE 3FATA 4FIMA 3VXBA 1SW2A 2UYEA 3CG3A 5L9OA 1B0HA 4UA8A 3UN6A 4H1XA 1JEVA 1CB6A 2PVUA 2DXRA 4R6HA 3PMWA 4WXJA 5DVFA 3RUMA 3VVEA 1Q35A 2DWIA 2Y7KA 1B40A 4I1DA 3OOAA 1VR5A 1RKMA 1SW5A 1O64A 2HAVA 1XS5A 3OSRA 5I57B 5L9MA 2ABHA 2Y7WA 2DE4A 2ZXTA 4H5FA 4BDRA 1F9BA 3IAZA 1JQFA 2V3QA 3QUFA 4HTGA 4PFUA 5F1QA 3TPAA 3UA8A 2OJTA 1NNTA 4H6DA 4RYAA 1TFAA 3S9EA 1Y20A 4YB6A 3IX1A 4IGRA 1IXIA 3FVNA 3K6UA 3M8UA 1Y3QA 3TMGA 5CBSA 4AB6A 4F29A 1P99A 1GVCA 1GGGA 1JNFA 2V3UA 3TQLA 4KCCA 2OCUA 3QSLA 3PU5A 3GLBA 4F1UA 1B46A 4M1VA 3T9XB 3FIRA 3KN7A 5EHMA 4F39A 4KD5A 4ONYA 4YU0A 1MM6A 1JVXA 2REJA 3KSJA 4OEVA 1MXWA 1UTHB 3B6QA 4OFLA 4AQ4A 1XT8A 4LZ5A 4Q5TA 4H67A 4OESA 3F11A 1R1NA 2XX8A 5AA3A 2UYFA 1URSA 3QXMA 1PB8A 2UVHA 1P1OA 4C1UA 1LAHE 4KPTA 5ISUA 2I58A 4EXKA 1B4ZA 3IL1B 5DEXB 1OIBA 1P1NA 1B3LA 3Q29A 5I59A 5ICQA 3ILTB 3N6UA 3B7DA 1M5FA 3N94A 3RT6B 1LFIA 1SI1A 1EH3A 4POXA 4YB5A 3K6VA 3ONMA 2DOJA 3MPKA 4NMYA 1AOVA 4KYSA 1EZ9A 3PUZE 3A09A 4JWYA 3ZSFA 4BDNA 4EF2A 1UQWA 2QJEA 1MQDA 5F7VA 1H45A 3M3KA 4KCDA 4H65A 1RYOA 3OSQA 5FHNA 4G68C 2VD2A 2NOOA 4IY5A 5FHMA 1ZJLA 3K6XA 3E13X 3K1PA 3KSXA 4HCYA 4JWOA 4X1DA 3RT8A 3TUSA 3LC8A 1PEBA 3QAXA 2D21A 2D5WA 2I0CA 2V84A 5TP9B 4LVQA 2GRVA 4G4PA 5I57A 3MVWA 3PUWE 3TYHA 1PB9A 3A3UA 5I58A 3O66A 2O68A 3DLNA 3MP6A 3U8QA 1B1HA 1ZIUA 3JV9A 3PPOA 4WEPA 3KJTA 3G3IA 5H8FB 4PE5B 1LLSA 2B3BA 3PD8A 1MY2A 4WKMA 5BWJA 1P1QA 1LGBC 1QULA 3CG1A 4DXBA 3KBRA 1IXHA 3C36A 3OO8A 4H0WA 1M5DA 3OD7A 5TPAA 5A5XB 4RA1A 4LZ8A 4POWA 1FQCA 1BTJA 4YMAA 5KCJA 3UIFA 3M3FA 4RK2A 2VD3A 3CFZA 3Q28A 4GFRA 4GL0A 4ZE8A 1O7TA 2HCAA 3ILUB 2B65A 3CVGA 4G68B 4GLIA 3VLVA 3H7MA 1MG1A 1MPDA 2O69A 3ECRA 4GXSB 1MY4A 1WDNA 4RXLA 3S9NC 1N3WA 5H8HB 3IB2A 2V25A 3EF7A 1PB7A 4F2OA 5ITOA 1LSTA 3D4CA 1Y9UA 3OO9A 2XXQA 1MH3A 2DQVA 2GFEA 4N6PA 4OFJA 1J1NA 2HFBA 3LSXA 2RC7A 4P11A 4QFOA 4I62A 4PP0A 2F36A 4NE4A 3V89B 3N5LA 1QUJA 3C35A 3V83A 3MW0A 3C33A 4EF1A 1NMUA 2XD2A 3G3KA 4IO7A 4JDFA 4LA9A 3VXCA 3PMVA 1AIVA 4O3BA 1YPNA 2DVCA 1XHYA 3GBAA 3TFLA 5ITPA 4R75A 2XD3A 3FVKA 2UVIA 2Q88A 3FXQA 1Y3NA 3O6IA 4FEBA 3E3KA 2I4CA 4JBZA 4YKPA 1I69A 4ISUA 4U21A 3H6VA 4R2FA 4F3GA 4XKNA 5EYFA 4L17A 3TKDA 1MQHA 4LQ2A 4QRZA 1IITA 2F6GA 3Q27A 4NF6A 1SDXA 3PGFA 5K2YA 3G3HA 5J1DA 4NF6B 2V93A 3TCHA 5I58B 2D3IA 3T9HB 3TTMA 2IEEA 2Q89A 4U4XA 1B2HA 2RCAA 3C4MA 2DWJA 1B1XA 5AA2B 2XXYA 3MVYA 1JETA 4ZZAA 4RY1A 5I59B 1NL5A 3IB0A 3CSBA 2DP8A 5KZTA 1RYXA 1SVXB 4ESWA 2GHAA 2HZLA 1N7XA 3K4UA 3QYTA 3RNNA 3R26A 4OZ9A 3FV1A 3H6TA 5DEXA 2DS9A 2I6EA 3CI8A 1QKBA 1VSOA 4U22A 4DIGA 1XVXA 4EDPA 5AA4B 1FCKA 1SQYA 2XXRA 2NUVA 2ZNUA 3MBPA 4RK9A 4IY6A 1L5TA 1OMPA 2DWHA 1MY3A 1NNFA 1LAFE 3EHUA 4MLVA 4OHNA 4GWOA 1Q1KA 1N04A 2R6GE 2H5YA 3N6TA 1PDAA 2CZLA 3TTKA 2YLNA 5K2XA 3HV1A 4Z7EA 1D3KA 3UP9A 1TWYA 1N84A 3OELA 2YPNA 4H8JA 1B4HA 3TEPA 4NTLA 3TTNA 1TT1A 5H8QA 5L9SA 1NNKA 4MBPA 3IOWA 3UORA 3VFJA 3MUQA 4ESXA 2OBGA 3OEMA 2ALUA 4NF8B 4NF5B 2O7IA 1D9VA 4BDMA 2F7CA 5CBRA 2Z23A 1H44A 3FUZA 2CMOA 2H25A 3IORA 3PPQA 3PUVE 3CIJA 4PFWA 4F1YA 1B05A 4KQPA 2A5TA 1SW4A 4RPOA 1B3EA 2Y7IA 4RPNA 4IO2A 4PETA 3VLWA 4I9DA 4IO6A 4ELPA 4ZZEA 5I56A 2B3FA 3SEUA 5FTHA 1MQGA 5AA2A 3QUJA 1IXGA 1I6BA 3W9VA 2DE2A 1MQJA 2R71A 3FXUA 4OXVA 1B5JA 2ONSA 3T93B 3RGYA 2QS4A 2RC9A 5A5XA 3T96B 1HSJA 1I6AA 1DTZA 5BUUA 4NF4A 2AIXA 3HHFA 3O9PA 1P1UA 1NH7A 4JSOA 2NXOA 4E0WA 4I8CA 3IOUA 1NNPA 1AL3A 3FZVA 3HCQA 3TTRA 1EZPA 2F8DA 3G3GA 4OWDA 4QSDA 1AH5A 2DXYA 3QK6A 5HM4B 1FTOA 2ZNTA 1MXVA 3I6VA 3O97A 3IO4A 2Q8JA 4ECFA 2RKMA 1BKAA 1JEUA 2G29A 3OO6A 1URGA 5AA2D 4HCWA 1ZLQA 4ELOA 1POTA 1H3DA 1US5A 2HAUA 1FQFA 2QS1A 1ZMGA 1DPEA 3MC2A 4KYDA 4OYVA 4DCYA 3OEKA 5I2NB 2LAOA 3PPPA 4G2ZA 1TFDA 1N3XA 2ONKE 4GQOA 4F31B 4QSEA 5H8SA 4GF8A 4H5GA 1BP5A 3R7XA 3K02A 3SDFA 2ZYOA 4EXLA 4DXUA 4YMBA 3FJ7A 4F3SA 2QMWA 5I56B 1B52A 4X9TA 1DPPA 3LSWA 2PBWA 1SBPA 3DP4A 2I48A 3H3GA 1DOTA 4LZ7A 4OETA 2F34A 3UGWA 3SEVA 1QKAA 4EQ7A 2X7QA 3KGCA 2QL3A 2R9JA 3S4UA 3PD9A 4QHQA 2VP1A 1B3HA 4QFLA 2P0SA 2E1SA 4U4SA 3RTWB 1M5CA 2A5TB 2VGQA 4U1OA 4C1TA 1A54A 3E4RA 3RN8A 4MF3A 3HO7A 3IK6B 4OTEA 4P0IA 2ANJA 5JTYA 2PMSA 2DSFA 4QFNA 4Q8RA 4DZ1A 4R9GA 3OXNA 2OWSA 4TOZA 3TCGA 4Z0IA 1QUKA 4KFQA 2OZZA 1MDP1 3FASA 4DDDA 4ND9A 3SETA 4JB7A 3C31A 3MQ9A 3HHGA 4KI0E 2VHAA 2O84X 1FTKA 3O28A 3LSFB 3IOTA 4R6YA 1UTBA 2O6AA 1OQHA 3LSLA 4KHZE 1MXUA 4R9FA 5ELVA 5TPAB 4O3CA 1B7HA 1HSEA 2KLFA 4BDOA 3PPNA 3MP8A 5I2NA 3CR9A 4X1BA 1II5A 3L6HA 3U72A 4AB5A 2UVJA 1FW0A 1URDA 3EHTA 5CMMA 3VV5A 3CFXA 3MAMA 1LBCA 1TXFA 2UVGA 3G7WA 3USDA 5H8QB 3VVDA 3WAFA 2O51A 4GVOA 3IR1A 1FQEA 2A5SA 4GIZA 4NWCA 4Q30B 4WEDA 5JEIA 2VOZA 3U93A 1IQ7A 2GHBA 1ATGA 3IO6A 1B58A 1HSLA 2OLBA 3B6TA 3D4GA 2H4IA 3K1MA 5AA1A 1B7ZA 4N13A 3KZGA 5CRYA 4ELQA 5IKBA 2YJPA 1USYH 1ELJA 3IJXB 3OENA 1B9JA 2QSXA 2Z8DA 2F35A 3H06B 3S2VA 4GOTA 1MPCA 4ZECA 1ZBMA 2HEUA 1ZTYA 1B3GA 3OO7A 2H98A 1B0LA 1IXCA 4YKIA 2RC8A 3PUXE 4GRKA 4MH5A 2H99A 5H8HA 4OQOA 3K6WA 4JWXA 4RJZA 5KDTB 4R72A 1SD3A 2F78A 2FYIA 4F18A 3MVZA 4XKQA 1USYE 1Y4CA 3BFUA 3RTFB 4DE8A 3BBRA 3DM0A 1JW4A 1LB8A 2F7AA 4NF4B 2RINA 1FTJA 5HBCA 3GXAA 4UACA 2P1SA 2DE3A 2Q2CA 2UXAA 3FGSA 3JYRA 2Q9TA 2ONRA 3LBSA 1JVYA 4OMBA 1IEJA 3PMXA 2I3VA 3O6HA 3C32A 4NWDA 4TLLB 4XIGQ 1R9QA 2H9BA 1A40A 4R2BA 5FHOA 4U1ZA 4ZE9A 4LATA 5IAIA 3S9LC 2XX9A 3KOTA 1O63A 3C34A 2QPQA 4TLMB 1DTGA 1EZOA 3M3LA 4P0GA 1B5IA 3T9UA 1GV8A 2AL5A 3IOVA 1Y1ZA 3V8XB 4FECA 4F3PA 4U2RA 5H8FA 5I84A 5H8NA 2XXWA 2QS2A 3ODBA 4N07A 1OVTA 2ZYKA 2BJJX 2XXTA 4FEDA 4QFPA 1MM7A 4TQUQ 2REGA 3MZ9A 3VDFA 4DLDA 2QMXA 4FATA 3TODA 1QUIA 1LCFA 3K01A 4PFYA 4XXUA 1PBQA 4YZZA 4F3BA 2HXWA 4IGTA 5AE4A 1NKXA 3TZAA 1GTKA 1LFGA 1Y4TA 3N26A 3DP6A 1IIWA 3UK4A 4FE8A 1A55A 3MP1A 2XHDA 1BIYA 4YB7A 1MY1A 1PC3A 2XXXA 1MH4A 3H4ZA 4KYEA 3G3FA 5CC2A 2E0SA 1MXYA 2HZKA 2I4BA 3TELA 2WKYA 4X48A 4R74A 4ELRA 1CE2A 3MPLA 4LP2B 1IZ1A 4NEDA 5ICTA 3IJOB 1VE4A 4FJPA 4DXCA 2PT1A 2QRYA 3KG2A 1NH8A 3EN3A 1OQGA 3TDJA 1H43A 2FA7A 2I3WA 2M8CA 1B5HA 2ZYNA 4G8NA 4OVJA 4ZEBA 1T0KA 1US4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDM A;  4R6K A;  1N76 A;  4OFO A;  1M5E A;  4BLA A;  1A8F A;  3LUY A;  1B32 A;  1B3F A;  3VLU A;  2O1L A;  4YKJ A;  4F19 A;  1Y1M A;  4ZED A;  1A7L A;  1XOC A;  1SYI A;  3PPR A;  3VVF A;  1N0T A;  1Y3P A;  2I49 A;  5CI5 A;  1GR2 A;  1MXX A;  5DTB A;  3O29 A;  4NF8 A;  4NF5 A;  4E0X A;  4EUO A;  5H8N B;  3SES A;  1LCT A;  4G8M A;  5B70 A;  3MJN A;  4OEU A;  5HPQ A;  3SKP A;  1A99 A;  3OMB A;  5TP9 A;  1MS7 A;  5DVI A;  4PQJ A;  5EHS A;  1YAE A;  1MXZ A;  1S7Y A;  1UIV A;  1EU8 A;  3FJG A;  2NWJ A;  3H6U A;  3W15 C;  3S9M C;  3ZKL A;  3T66 A;  3CFL A;  3EQ1 A;  4LQ5 A;  2F5X A;  1OLC A;  4ZS9 A;  2Y7R A;  2Y7P A;  1FTM A;  4ZEI A;  4IO3 A;  5JTY B;  4U23 A;  1QW0 A;  4XKP A;  3EPE A;  3O2A A;  1BLF A;  4H8I A;  5M2V A;  5DYH A;  3W9W A;  1FQB A;  1NFT A;  5B7D A;  1B6H A;  1MRP A;  2DYX A;  3H03 A;  4HS7 A;  5CM6 A;  1VFD A;  1MDQ A;  1R9L A;  4F1V A;  1S9T A;  1MQI A;  1Z7M E;  2I0B A;  3B6W A;  3KOS A;  3PUY E;  4M4G A;  4QSC A;  4R73 A;  4YKK A;  5DT6 A;  1DMB A;  4K3F A;  3AXF A;  3KFM A;  3THI A;  5LOM A;  1MY0 A;  1OVB A;  3Q25 A;  2XXI A;  3G3J A;  3EHS A;  1S50 A;  4JXI A;  1PBP A;  3RY3 A;  3K0V A;  4XTC Q;  1LFH A;  2XXV A;  4F2Q A;  4IB2 A;  1DSN A;  5KDT A;  1H76 A;  3GZG A;  2P2A A;  3ZS6 A;  2FNC A;  4IO5 A;  1D9Y A;  1UTH A;  2F6P A;  3TAJ A;  3KJ7 A;  3R6U A;  2Y84 A;  3LR1 A;  3CSG A;  1MPB A;  3O6G A;  3K2D A;  4THI A;  2XX7 A;  4GXA A;  1XVY A;  4Q0C A;  3SEX A;  1FQD A;  1SW1 A;  1YTV A;  3TQW A;  4C0R A;  2ZYM A;  5CMC A;  3SEW A;  3WAE A;  2X7P A;  3VE1 B;  2X26 A;  1AMF A;  2ZMB A;  3HPI A;  3I3V A;  1JW5 A;  4RNS A;  3KEI A;  4YIC A;  1QJM A;  5FTI A;  4FAJ A;  3HST A;  4GD5 A;  5L8D A;  3L6G A;  3I5O A;  3RQT A;  3Q26 A;  4QF9 A;  4ZEK A;  3JZJ A;  4MFI A;  1SYH A;  2PT2 A;  4MLQ A;  3KN8 A;  3T22 A;  3ZKK A;  5CMK A;  1JW1 A;  2OWT A;  1B51 A;  3V5A A;  2QS3 A;  2RF1 A;  3DP8 A;  3FXR A;  1IUD A;  1ZKB A;  1P1W A;  1VFE A;  1ZU0 A;  2F7B A;  2O1M A;  2XXU A;  3TCF A;  1SI0 A;  2V3T A;  3U94 A;  4F22 A;  4ZEF A;  1LAX A;  4DCX A;  3FVG A;  1Z7N E;  3BKI B;  2XXP A;  4GL8 A;  2PX1 A;  3U1O A;  5KCJ B;  4OEN A;  1LB9 A;  2Q2A A;  1ANF A;  1WVJ A;  1UTB B;  2ESN A;  4G8H A;  2AL4 A;  1A8E A;  3RPW A;  3P7I A;  1UIU A;  1XC1 A;  4BDL A;  1YCJ A;  4HW8 A;  4EQ9 A;  1B7U A;  3MVX A;  1D4N A;  4IO4 A;  4KR5 A;  2DVZ A;  3SEY A;  4BDQ A;  4EQB A;  3FJM A;  1R6Z A;  3MZ1 A;  3KN3 A;  2OK2 A;  2THI A;  5CMB A;  3A3C A;  5DVJ A;  3U92 A;  3K1N A;  3K00 A;  4YAH X;  2DWA A;  3MWB A;  3FVO A;  1LBB A;  4QFK A;  5AA4 A;  2Z22 A;  3CRB A;  1KWH A;  1M5B A;  1QVS A;  3MZB A;  2ZNS A;  3PV0 E;  3QIM A;  4O3A A;  3GBB A;  4XKR A;  1FTL A;  1OLA A;  3SER A;  2F97 A;  4PFT A;  5I2K A;  3FD3 A;  2NVU B;  5I2K B;  3TTL A;  2GH9 A;  3DEL B;  4FOR A;  4LON B;  2AYS A;  3T9V A;  2RCB A;  4LUB A;  1POY 1;  2O7U A;  2Z8E A;  3FV2 A;  2Z8F A;  3C9H A;  4G68 A;  3H6W A;  3BFT A;  1FQA A;  1N7W A;  1I6Q A;  2G93 A;  3E9X A;  2IA4 A;  2XXH A;  4G77 A;  1LAG E;  2HQ0 A;  2W7Y A;  4OER A;  5JK4 A;  1WOD A;  3HN0 A;  4JSD A;  2PYY A;  3IB1 A;  5TU0 A;  3RLF E;  3FAT A;  4FIM A;  3VXB A;  1SW2 A;  2UYE A;  3CG3 A;  5L9O A;  1B0H A;  4UA8 A;  3UN6 A;  4H1X A;  1JEV A;  1CB6 A;  2PVU A;  2DXR A;  4R6H A;  3PMW A;  4WXJ A;  5DVF A;  3RUM A;  3VVE A;  1Q35 A;  2DWI A;  2Y7K A;  1B40 A;  4I1D A;  3OOA A;  1VR5 A;  1RKM A;  1SW5 A;  1O64 A;  2HAV A;  1XS5 A;  3OSR A;  5I57 B;  5L9M A;  2ABH A;  2Y7W A;  2DE4 A;  2ZXT A;  4H5F A;  4BDR A;  1F9B A;  3IAZ A;  1JQF A;  2V3Q A;  3QUF A;  4HTG A;  4PFU A;  5F1Q A;  3TPA A;  3UA8 A;  2OJT A;  1NNT A;  4H6D A;  4RYA A;  1TFA A;  3S9E A;  1Y20 A;  4YB6 A;  3IX1 A;  4IGR A;  1IXI A;  3FVN A;  3K6U A;  3M8U A;  1Y3Q A;  3TMG A;  5CBS A;  4AB6 A;  4F29 A;  1P99 A;  1GVC A;  1GGG A;  1JNF A;  2V3U A;  3TQL A;  4KCC A;  2OCU A;  3QSL A;  3PU5 A;  3GLB A;  4F1U A;  1B46 A;  4M1V A;  3T9X B;  3FIR A;  3KN7 A;  5EHM A;  4F39 A;  4KD5 A;  4ONY A;  4YU0 A;  1MM6 A;  1JVX A;  2REJ A;  3KSJ A;  4OEV A;  1MXW A;  1UTH B;  3B6Q A;  4OFL A;  4AQ4 A;  1XT8 A;  4LZ5 A;  4Q5T A;  4H67 A;  4OES A;  3F11 A;  1R1N A;  2XX8 A;  5AA3 A;  2UYF A;  1URS A;  3QXM A;  1PB8 A;  2UVH A;  1P1O A;  4C1U A;  1LAH E;  4KPT A;  5ISU A;  2I58 A;  4EXK A;  1B4Z A;  3IL1 B;  5DEX B;  1OIB A;  1P1N A;  1B3L A;  3Q29 A;  5I59 A;  5ICQ A;  3ILT B;  3N6U A;  3B7D A;  1M5F A;  3N94 A;  3RT6 B;  1LFI A;  1SI1 A;  1EH3 A;  4POX A;  4YB5 A;  3K6V A;  3ONM A;  2DOJ A;  3MPK A;  4NMY A;  1AOV A;  4KYS A;  1EZ9 A;  3PUZ E;  3A09 A;  4JWY A;  3ZSF A;  4BDN A;  4EF2 A;  1UQW A;  2QJE A;  1MQD A;  5F7V A;  1H45 A;  3M3K A;  4KCD A;  4H65 A;  1RYO A;  3OSQ A;  5FHN A;  4G68 C;  2VD2 A;  2NOO A;  4IY5 A;  5FHM A;  1ZJL A;  3K6X A;  3E13 X;  3K1P A;  3KSX A;  4HCY A;  4JWO A;  4X1D A;  3RT8 A;  3TUS A;  3LC8 A;  1PEB A;  3QAX A;  2D21 A;  2D5W A;  2I0C A;  2V84 A;  5TP9 B;  4LVQ A;  2GRV A;  4G4P A;  5I57 A;  3MVW A;  3PUW E;  3TYH A;  1PB9 A;  3A3U A;  5I58 A;  3O66 A;  2O68 A;  3DLN A;  3MP6 A;  3U8Q A;  1B1H A;  1ZIU A;  3JV9 A;  3PPO A;  4WEP A;  3KJT A;  3G3I A;  5H8F B;  4PE5 B;  1LLS A;  2B3B A;  3PD8 A;  1MY2 A;  4WKM A;  5BWJ A;  1P1Q A;  1LGB C;  1QUL A;  3CG1 A;  4DXB A;  3KBR A;  1IXH A;  3C36 A;  3OO8 A;  4H0W A;  1M5D A;  3OD7 A;  5TPA A;  5A5X B;  4RA1 A;  4LZ8 A;  4POW A;  1FQC A;  1BTJ A;  4YMA A;  5KCJ A;  3UIF A;  3M3F A;  4RK2 A;  2VD3 A;  3CFZ A;  3Q28 A;  4GFR A;  4GL0 A;  4ZE8 A;  1O7T A;  2HCA A;  3ILU B;  2B65 A;  3CVG A;  4G68 B;  4GLI A;  3VLV A;  3H7M A;  1MG1 A;  1MPD A;  2O69 A;  3ECR A;  4GXS B;  1MY4 A;  1WDN A;  4RXL A;  3S9N C;  1N3W A;  5H8H B;  3IB2 A;  2V25 A;  3EF7 A;  1PB7 A;  4F2O A;  5ITO A;  1LST A;  3D4C A;  1Y9U A;  3OO9 A;  2XXQ A;  1MH3 A;  2DQV A;  2GFE A;  4N6P A;  4OFJ A;  1J1N A;  2HFB A;  3LSX A;  2RC7 A;  4P11 A;  4QFO A;  4I62 A;  4PP0 A;  2F36 A;  4NE4 A;  3V89 B;  3N5L A;  1QUJ A;  3C35 A;  3V83 A;  3MW0 A;  3C33 A;  4EF1 A;  1NMU A;  2XD2 A;  3G3K A;  4IO7 A;  4JDF A;  4LA9 A;  3VXC A;  3PMV A;  1AIV A;  4O3B A;  1YPN A;  2DVC A;  1XHY A;  3GBA A;  3TFL A;  5ITP A;  4R75 A;  2XD3 A;  3FVK A;  2UVI A;  2Q88 A;  3FXQ A;  1Y3N A;  3O6I A;  4FEB A;  3E3K A;  2I4C A;  4JBZ A;  4YKP A;  1I69 A;  4ISU A;  4U21 A;  3H6V A;  4R2F A;  4F3G A;  4XKN A;  5EYF A;  4L17 A;  3TKD A;  1MQH A;  4LQ2 A;  4QRZ A;  1IIT A;  2F6G A;  3Q27 A;  4NF6 A;  1SDX A;  3PGF A;  5K2Y A;  3G3H A;  5J1D A;  4NF6 B;  2V93 A;  3TCH A;  5I58 B;  2D3I A;  3T9H B;  3TTM A;  2IEE A;  2Q89 A;  4U4X A;  1B2H A;  2RCA A;  3C4M A;  2DWJ A;  1B1X A;  5AA2 B;  2XXY A;  3MVY A;  1JET A;  4ZZA A;  4RY1 A;  5I59 B;  1NL5 A;  3IB0 A;  3CSB A;  2DP8 A;  5KZT A;  1RYX A;  1SVX B;  4ESW A;  2GHA A;  2HZL A;  1N7X A;  3K4U A;  3QYT A;  3RNN A;  3R26 A;  4OZ9 A;  3FV1 A;  3H6T A;  5DEX A;  2DS9 A;  2I6E A;  3CI8 A;  1QKB A;  1VSO A;  4U22 A;  4DIG A;  1XVX A;  4EDP A;  5AA4 B;  1FCK A;  1SQY A;  2XXR A;  2NUV A;  2ZNU A;  3MBP A;  4RK9 A;  4IY6 A;  1L5T A;  1OMP A;  2DWH A;  1MY3 A;  1NNF A;  1LAF E;  3EHU A;  4MLV A;  4OHN A;  4GWO A;  1Q1K A;  1N04 A;  2R6G E;  2H5Y A;  3N6T A;  1PDA A;  2CZL A;  3TTK A;  2YLN A;  5K2X A;  3HV1 A;  4Z7E A;  1D3K A;  3UP9 A;  1TWY A;  1N84 A;  3OEL A;  2YPN A;  4H8J A;  1B4H A;  3TEP A;  4NTL A;  3TTN A;  1TT1 A;  5H8Q A;  5L9S A;  1NNK A;  4MBP A;  3IOW A;  3UOR A;  3VFJ A;  3MUQ A;  4ESX A;  2OBG A;  3OEM A;  2ALU A;  4NF8 B;  4NF5 B;  2O7I A;  1D9V A;  4BDM A;  2F7C A;  5CBR A;  2Z23 A;  1H44 A;  3FUZ A;  2CMO A;  2H25 A;  3IOR A;  3PPQ A;  3PUV E;  3CIJ A;  4PFW A;  4F1Y A;  1B05 A;  4KQP A;  2A5T A;  1SW4 A;  4RPO A;  1B3E A;  2Y7I A;  4RPN A;  4IO2 A;  4PET A;  3VLW A;  4I9D A;  4IO6 A;  4ELP A;  4ZZE A;  5I56 A;  2B3F A;  3SEU A;  5FTH A;  1MQG A;  5AA2 A;  3QUJ A;  1IXG A;  1I6B A;  3W9V A;  2DE2 A;  1MQJ A;  2R71 A;  3FXU A;  4OXV A;  1B5J A;  2ONS A;  3T93 B;  3RGY A;  2QS4 A;  2RC9 A;  5A5X A;  3T96 B;  1HSJ A;  1I6A A;  1DTZ A;  5BUU A;  4NF4 A;  2AIX A;  3HHF A;  3O9P A;  1P1U A;  1NH7 A;  4JSO A;  2NXO A;  4E0W A;  4I8C A;  3IOU A;  1NNP A;  1AL3 A;  3FZV A;  3HCQ A;  3TTR A;  1EZP A;  2F8D A;  3G3G A;  4OWD A;  4QSD A;  1AH5 A;  2DXY A;  3QK6 A;  5HM4 B;  1FTO A;  2ZNT A;  1MXV A;  3I6V A;  3O97 A;  3IO4 A;  2Q8J A;  4ECF A;  2RKM A;  1BKA A;  1JEU A;  2G29 A;  3OO6 A;  1URG A;  5AA2 D;  4HCW A;  1ZLQ A;  4ELO A;  1POT A;  1H3D A;  1US5 A;  2HAU A;  1FQF A;  2QS1 A;  1ZMG A;  1DPE A;  3MC2 A;  4KYD A;  4OYV A;  4DCY A;  3OEK A;  5I2N B;  2LAO A;  3PPP A;  4G2Z A;  1TFD A;  1N3X A;  2ONK E;  4GQO A;  4F31 B;  4QSE A;  5H8S A;  4GF8 A;  4H5G A;  1BP5 A;  3R7X A;  3K02 A;  3SDF A;  2ZYO A;  4EXL A;  4DXU A;  4YMB A;  3FJ7 A;  4F3S A;  2QMW A;  5I56 B;  1B52 A;  4X9T A;  1DPP A;  3LSW A;  2PBW A;  1SBP A;  3DP4 A;  2I48 A;  3H3G A;  1DOT A;  4LZ7 A;  4OET A;  2F34 A;  3UGW A;  3SEV A;  1QKA A;  4EQ7 A;  2X7Q A;  3KGC A;  2QL3 A;  2R9J A;  3S4U A;  3PD9 A;  4QHQ A;  2VP1 A;  1B3H A;  4QFL A;  2P0S A;  2E1S A;  4U4S A;  3RTW B;  1M5C A;  2A5T B;  2VGQ A;  4U1O A;  4C1T A;  1A54 A;  3E4R A;  3RN8 A;  4MF3 A;  3HO7 A;  3IK6 B;  4OTE A;  4P0I A;  2ANJ A;  5JTY A;  2PMS A;  2DSF A;  4QFN A;  4Q8R A;  4DZ1 A;  4R9G A;  3OXN A;  2OWS A;  4TOZ A;  3TCG A;  4Z0I A;  1QUK A;  4KFQ A;  2OZZ A;  1MDP 1;  3FAS A;  4DDD A;  4ND9 A;  3SET A;  4JB7 A;  3C31 A;  3MQ9 A;  3HHG A;  4KI0 E;  2VHA A;  2O84 X;  1FTK A;  3O28 A;  3LSF B;  3IOT A;  4R6Y A;  1UTB A;  2O6A A;  1OQH A;  3LSL A;  4KHZ E;  1MXU A;  4R9F A;  5ELV A;  5TPA B;  4O3C A;  1B7H A;  1HSE A;  2KLF A;  4BDO A;  3PPN A;  3MP8 A;  5I2N A;  3CR9 A;  4X1B A;  1II5 A;  3L6H A;  3U72 A;  4AB5 A;  2UVJ A;  1FW0 A;  1URD A;  3EHT A;  5CMM A;  3VV5 A;  3CFX A;  3MAM A;  1LBC A;  1TXF A;  2UVG A;  3G7W A;  3USD A;  5H8Q B;  3VVD A;  3WAF A;  2O51 A;  4GVO A;  3IR1 A;  1FQE A;  2A5S A;  4GIZ A;  4NWC A;  4Q30 B;  4WED A;  5JEI A;  2VOZ A;  3U93 A;  1IQ7 A;  2GHB A;  1ATG A;  3IO6 A;  1B58 A;  1HSL A;  2OLB A;  3B6T A;  3D4G A;  2H4I A;  3K1M A;  5AA1 A;  1B7Z A;  4N13 A;  3KZG A;  5CRY A;  4ELQ A;  5IKB A;  2YJP A;  1USY H;  1ELJ A;  3IJX B;  3OEN A;  1B9J A;  2QSX A;  2Z8D A;  2F35 A;  3H06 B;  3S2V A;  4GOT A;  1MPC A;  4ZEC A;  1ZBM A;  2HEU A;  1ZTY A;  1B3G A;  3OO7 A;  2H98 A;  1B0L A;  1IXC A;  4YKI A;  2RC8 A;  3PUX E;  4GRK A;  4MH5 A;  2H99 A;  5H8H A;  4OQO A;  3K6W A;  4JWX A;  4RJZ A;  5KDT B;  4R72 A;  1SD3 A;  2F78 A;  2FYI A;  4F18 A;  3MVZ A;  4XKQ A;  1USY E;  1Y4C A;  3BFU A;  3RTF B;  4DE8 A;  3BBR A;  3DM0 A;  1JW4 A;  1LB8 A;  2F7A A;  4NF4 B;  2RIN A;  1FTJ A;  5HBC A;  3GXA A;  4UAC A;  2P1S A;  2DE3 A;  2Q2C A;  2UXA A;  3FGS A;  3JYR A;  2Q9T A;  2ONR A;  3LBS A;  1JVY A;  4OMB A;  1IEJ A;  3PMX A;  2I3V A;  3O6H A;  3C32 A;  4NWD A;  4TLL B;  4XIG Q;  1R9Q A;  2H9B A;  1A40 A;  4R2B A;  5FHO A;  4U1Z A;  4ZE9 A;  4LAT A;  5IAI A;  3S9L C;  2XX9 A;  3KOT A;  1O63 A;  3C34 A;  2QPQ A;  4TLM B;  1DTG A;  1EZO A;  3M3L A;  4P0G A;  1B5I A;  3T9U A;  1GV8 A;  2AL5 A;  3IOV A;  1Y1Z A;  3V8X B;  4FEC A;  4F3P A;  4U2R A;  5H8F A;  5I84 A;  5H8N A;  2XXW A;  2QS2 A;  3ODB A;  4N07 A;  1OVT A;  2ZYK A;  2BJJ X;  2XXT A;  4FED A;  4QFP A;  1MM7 A;  4TQU Q;  2REG A;  3MZ9 A;  3VDF A;  4DLD A;  2QMX A;  4FAT A;  3TOD A;  1QUI A;  1LCF A;  3K01 A;  4PFY A;  4XXU A;  1PBQ A;  4YZZ A;  4F3B A;  2HXW A;  4IGT A;  5AE4 A;  1NKX A;  3TZA A;  1GTK A;  1LFG A;  1Y4T A;  3N26 A;  3DP6 A;  1IIW A;  3UK4 A;  4FE8 A;  1A55 A;  3MP1 A;  2XHD A;  1BIY A;  4YB7 A;  1MY1 A;  1PC3 A;  2XXX A;  1MH4 A;  3H4Z A;  4KYE A;  3G3F A;  5CC2 A;  2E0S A;  1MXY A;  2HZK A;  2I4B A;  3TEL A;  2WKY A;  4X48 A;  4R74 A;  4ELR A;  1CE2 A;  3MPL A;  4LP2 B;  1IZ1 A;  4NED A;  5ICT A;  3IJO B;  1VE4 A;  4FJP A;  4DXC A;  2PT1 A;  2QRY A;  3KG2 A;  1NH8 A;  3EN3 A;  1OQG A;  3TDJ A;  1H43 A;  2FA7 A;  2I3W A;  2M8C A;  1B5H A;  2ZYN A;  4G8N A;  4OVJ A;  4ZEB A;  1T0K A;  1US4 A; 
#chains in the Genus database with same CATH topology
 4R6K A;  1IME A;  1N0T A;  5CI5 A;  2FIX A;  4NF8 A;  3SES A;  1LCT A;  5HPQ A;  3SKP A;  5EHS A;  1FTA A;  1YAE A;  3FJG A;  4PCD A;  3ZKL A;  3EQ1 A;  2OX3 A;  4XKP A;  3O2A A;  1NV4 A;  5M2V A;  4GWX A;  2Q8M A;  5CM6 A;  1VFD A;  1MDQ A;  4M4G A;  3PUY E;  5LOM A;  3D1R A;  3THI A;  3KFM A;  1OVB A;  4N91 A;  1S50 A;  1DSN A;  3GZG A;  2F6P A;  2Y84 A;  3LR1 A;  1MPB A;  3IFA A;  3O6G A;  4Q0C A;  4GXA A;  1XVY A;  1FQD A;  1YTV A;  2X7P A;  2X26 A;  2ZMB A;  3HPI A;  3GYY A;  4FAJ A;  3L6G A;  3I5O A;  4MFI A;  1LBY A;  3KN8 A;  5CMK A;  1B51 A;  2PFY A;  5F24 A;  1Z7N E;  3BKI B;  4GL8 A;  1LB9 A;  2AL4 A;  2PCR A;  1XC1 A;  4BDL A;  4HW8 A;  4EQB A;  3U92 A;  3KN3 A;  5I5P A;  3K00 A;  4YAH X;  2Q74 A;  3MWB A;  2WYP A;  3FVO A;  4XKR A;  4O3A A;  3GBB A;  4PFT A;  5I2K A;  3FD3 A;  4NX1 A;  2GH9 A;  3TTL A;  2RCB A;  4LUB A;  2O7U A;  2Z8E A;  2Z8F A;  1FQA A;  1I6Q A;  2IA4 A;  5JK4 A;  5TU0 A;  3RLF E;  2PYY A;  4UA8 A;  2DWI A;  4I1D A;  1VR5 A;  1KA0 A;  4H5F A;  4BDR A;  1F9B A;  5IM2 A;  4PAF A;  1NNT A;  3S9E A;  4YB6 A;  3M8U A;  5I7I A;  5CBS A;  3QSL A;  3PU5 A;  1B46 A;  4PBQ A;  4KD5 A;  1MM6 A;  4OEV A;  4OFL A;  4AQ4 A;  1R1N A;  2XX8 A;  3A29 A;  1PB8 A;  1P1O A;  1LAH E;  1DBZ A;  5ISU A;  2I58 A;  1FPE A;  1B4Z A;  4MIJ A;  4P1E A;  4EXK A;  5DEX B;  5I59 A;  3B7D A;  1EH3 A;  3K6V A;  3ONM A;  4KYS A;  1MQD A;  3M3K A;  4KCD A;  4PAI A;  5FHN A;  5FHM A;  1ZJL A;  3E13 X;  2I0C A;  4G4P A;  3MVW A;  1PB9 A;  1FBC A;  3DLN A;  3MP6 A;  3U8Q A;  4WEP A;  2B3B A;  1LGB C;  4DXB A;  3KBR A;  4LZ8 A;  1IMF A;  1IMB A;  4POW A;  1FQC A;  1DK4 A;  1KA1 A;  1IMC A;  1O7T A;  2B65 A;  3CVG A;  3VLV A;  4GLI A;  1MG1 A;  1FBG A;  1MY4 A;  1N3W A;  3IB2 A;  2V25 A;  1JP4 A;  1PB7 A;  3EF7 A;  4P47 A;  1Y9U A;  1LEV A;  3LSX A;  4MNP A;  3V89 B;  2XD2 A;  3G3K A;  3VXC A;  3PMV A;  4O3B A;  1YPN A;  2DVC A;  4XEQ A;  4O94 A;  5LDZ A;  1Y3N A;  2HPG A;  4FEB A;  4R2F A;  5EYF A;  4LQ2 A;  1IIT A;  2F6G A;  3G3H A;  3TCH A;  4U4X A;  1B1X A;  1JET A;  4RY1 A;  3CSB A;  4DI4 B;  4PFI A;  1N7X A;  1FJ9 A;  3K4U A;  3FV1 A;  3H6T A;  2DS9 A;  1QKB A;  1VSO A;  1FCK A;  1OMP A;  4OHN A;  4I40 A;  4MAG A;  4MLV A;  1N04 A;  2R6G E;  1PDA A;  1KZ8 A;  2YPN A;  1B4H A;  3TEP A;  2OBG A;  3OEM A;  4NF5 B;  2O7I A;  4BDM A;  5CBR A;  3PUV E;  2H25 A;  3IOR A;  1SW4 A;  2MKZ A;  1FBD A;  2B4M A;  2B3F A;  3SEU A;  1IXG A;  2R71 A;  1FPL A;  5A5X A;  5IGA A;  3T96 B;  4NF4 A;  1FPI A;  1NH7 A;  1AL3 A;  3FZV A;  4QSD A;  3QK6 A;  3IO4 A;  3OO6 A;  1URG A;  1G0H A;  2XA5 A;  1H3D A;  2HAU A;  4OYV A;  1ZMG A;  1DPE A;  4KYD A;  4F31 B;  3K02 A;  2ZYO A;  4EXL A;  1K9Y A;  5I56 B;  3LSW A;  1NV0 A;  3DP4 A;  4EQ7 A;  3UGW A;  1QKA A;  2QL3 A;  4QHQ A;  3RTW B;  1M5C A;  2VGQ A;  4U1O A;  4C1T A;  4O8M A;  3RN8 A;  3HO7 A;  4DZ1 A;  4R9G A;  3OXN A;  4Z0I A;  3KBZ A;  2VHA A;  2O84 X;  4R6Y A;  2O6A A;  1OQH A;  5TPA B;  4O3C A;  5I2N A;  3PPN A;  3MP8 A;  5DW8 A;  3CR9 A;  4OAN A;  1URD A;  3EHT A;  3MAM A;  1LBC A;  3USD A;  5H8Q B;  2O51 A;  4GIZ A;  4Q30 B;  1EYK A;  2GHB A;  1ATG A;  5AA1 A;  2OLB A;  2YJP A;  1ELJ A;  1FBE A;  4ZEC A;  2F35 A;  3H06 B;  1ZTY A;  2H99 A;  4RJZ A;  3NOH A;  1SD3 A;  2FYI A;  4F18 A;  4XKQ A;  2WX9 A;  1JW4 A;  1LB8 A;  1XI6 A;  2RIN A;  1FTJ A;  2P1S A;  3FGS A;  3JYR A;  4OMB A;  1IEJ A;  3PMX A;  1YZ0 A;  3C32 A;  1R9Q A;  4R2B A;  1A40 A;  4ZE9 A;  2XX9 A;  2QPQ A;  3M3L A;  1Y1Z A;  4MMP A;  5H8N A;  1LBV A;  4FED A;  4PFY A;  4GBW A;  4F3B A;  1LFG A;  3UK4 A;  1MY1 A;  1MH4 A;  1DCU A;  5CC2 A;  1MXY A;  2I4B A;  4X48 A;  2FBP A;  3MPL A;  4N15 A;  1NV1 A;  4NED A;  3KG2 A;  3EN3 A;  4PC9 A;  3T0J A;  2FA7 A;  1A8F A;  4F19 A;  2O1L A;  4ZED A;  1Y1M A;  1XOC A;  1RDY A;  4NF5 A;  4G8M A;  5B70 A;  1A99 A;  1D9Q A;  5TP9 A;  5EYH A;  2ZZV A;  3T66 A;  3CFL A;  5A5L A;  1FTM A;  3EPE A;  1BLF A;  3B50 A;  3W9W A;  1NFT A;  5B7D A;  4HS7 A;  1R9L A;  1S9T A;  1MQI A;  4R73 A;  4QSC A;  5I59 B;  4FAT A;  1DMB A;  4K3F A;  3AXF A;  1FPB A;  3LV0 A;  4IB2 A;  5KDT A;  1H76 A;  5T3J A;  3KJ7 A;  5EQ7 A;  1FPJ A;  4THI A;  5CMC A;  3SEW A;  2F3B A;  3KEI A;  1QJM A;  3HST A;  3Q26 A;  4ZEK A;  1SYH A;  4MLQ A;  3T22 A;  3ZKK A;  3EKI A;  3V5A A;  2QS3 A;  4N8G A;  3DP8 A;  1ZU0 A;  1P1W A;  4PF8 A;  3U94 A;  4F22 A;  3FVG A;  2VPN A;  1NUW A;  4OEN A;  1ANF A;  4HE1 A;  1UTB B;  1IMD A;  2ESN A;  4MHF A;  1A8E A;  3P7I A;  4EQ9 A;  4OVR A;  3KC1 A;  3MVX A;  4OVS A;  3FJM A;  5AA4 A;  3PV0 E;  4Z7E A;  1KWH A;  3T9V A;  1OLA A;  2F97 A;  1POY 1;  3C9H A;  2G93 A;  3E9X A;  4OER A;  4G77 A;  2W7Y A;  3HN0 A;  3FAT A;  4JVC A;  3CG3 A;  5L9O A;  4WXJ A;  3RUM A;  3VVE A;  4PAK A;  1Q35 A;  1RKM A;  5I57 B;  1NV2 A;  2ZXT A;  5ESY A;  1JQF A;  2V3Q A;  3QUF A;  4HTG A;  4H6D A;  4RYA A;  1IXI A;  3K6U A;  1Y3Q A;  2XWK A;  3TMG A;  1LBW A;  3T1B A;  5IZ1 A;  4KCC A;  3GLB A;  4F1U A;  5EHM A;  2REJ A;  1MXW A;  1UTH B;  4N4U A;  4LZ5 A;  4H67 A;  4OES A;  4PTK A;  4PBH A;  4HE2 A;  1P1N A;  3Q29 A;  5ICQ A;  3ILT B;  3N6U A;  3RYD A;  1EZ9 A;  3A09 A;  3ZSF A;  4EF2 A;  2KR0 A;  1RYO A;  3OSQ A;  4X04 A;  4FBP A;  4G61 A;  3K6X A;  4X1D A;  3K1P A;  3TUS A;  3QAX A;  2GRV A;  5I57 A;  2WBB A;  3A3U A;  1FPD A;  1ZIU A;  1MY2 A;  5BWJ A;  1P1Q A;  4H0W A;  5A5X B;  1M5D A;  2JJK A;  4RA1 A;  4YMA A;  5KCJ A;  3M3F A;  2VD3 A;  3CFZ A;  4GFR A;  4G68 B;  2O69 A;  1FJ6 A;  4F2O A;  5ITO A;  3OO9 A;  2RC7 A;  4QFO A;  2F36 A;  4NE4 A;  3V83 A;  4JDF A;  1XHY A;  4R75 A;  2I4C A;  1I69 A;  4ISU A;  4U21 A;  3H6V A;  4F3G A;  4XKN A;  4L17 A;  5K2Y A;  3Q27 A;  1SDX A;  4NF6 B;  2WBD A;  1B2H A;  4P56 A;  2DWJ A;  5AA2 B;  2XXY A;  1RYX A;  1SVX B;  4ESW A;  4MNI A;  3QYT A;  3RNN A;  3R26 A;  2I6E A;  4EDP A;  1SQY A;  2ZNU A;  1FPK A;  3MBP A;  4RK9 A;  1L5T A;  4IY6 A;  1MY3 A;  1NNF A;  3EHU A;  1Q1K A;  3TTK A;  3B8B A;  2H5Y A;  2CZL A;  3HV1 A;  3UP9 A;  3OEL A;  4H8J A;  3TTN A;  1TT1 A;  5H8Q A;  3IOW A;  3MUQ A;  1H44 A;  3FUZ A;  3CIJ A;  4F1Y A;  4KQP A;  1B3E A;  1SPI A;  4IO2 A;  3VLW A;  4I9D A;  4IO6 A;  5FTH A;  1MQG A;  1I6B A;  2QS4 A;  4PF6 A;  1HSJ A;  1I6A A;  1P1U A;  4JSO A;  2B4L A;  1NNP A;  2F8D A;  1AH5 A;  5HM4 B;  3I6V A;  2FHY A;  5AA2 D;  4HCW A;  4PGN A;  2QS1 A;  3MC2 A;  1TFD A;  4GF8 A;  4H5G A;  3R7X A;  1BK4 A;  5EQ9 A;  1DPP A;  2PBW A;  1SBP A;  3H3G A;  1DOT A;  2R9J A;  1B3H A;  4MF3 A;  3IK6 B;  4OTE A;  1EYJ A;  4P0I A;  4AS4 A;  2ANJ A;  4Q8R A;  2DSF A;  3TCG A;  4KFQ A;  4DDD A;  4ND9 A;  3C31 A;  3MQ9 A;  1FTK A;  5IZZ A;  1B7H A;  4X1B A;  3U72 A;  5CMM A;  3VV5 A;  3CFX A;  3WAF A;  3G7W A;  1NV3 A;  3IR1 A;  4XFE A;  4WED A;  5JEI A;  1IQ7 A;  1B58 A;  3K1M A;  2H4I A;  1B7Z A;  4N13 A;  1NV7 A;  3IJX B;  1B9J A;  2QSX A;  4GOT A;  1MPC A;  1ZBM A;  4N6D A;  1B3G A;  4YKI A;  4GRK A;  4MH5 A;  4JWX A;  5KDT B;  4R72 A;  2F78 A;  5EYG A;  1Y4C A;  2WEF A;  2P3V A;  4QXD A;  2UXA A;  2ONR A;  4XIG Q;  3O6H A;  2R8T A;  2H9B A;  5IAI A;  4U1Z A;  1O63 A;  3C34 A;  3SZP A;  1EZO A;  1B5I A;  5H8F A;  3IOV A;  4F3P A;  4U2R A;  4N07 A;  2QS2 A;  3VDF A;  4TQU Q;  3MZ9 A;  4DLD A;  2QMX A;  4IGT A;  5AE4 A;  1GTK A;  2HZK A;  5ICT A;  4FJP A;  2Y5K A;  1H43 A;  2M8C A;  2ZYN A;  4OVJ A;  4ZEB A;  1US4 A;  4ZDM A;  1N76 A;  4BLA A;  2XWI A;  3LUY A;  1B3F A;  4NAP A;  3VLU A;  4YKJ A;  1SYI A;  4H46 A;  3VVF A;  1Y3P A;  2I49 A;  5DTB A;  4E0X A;  1GR2 A;  3O29 A;  5H8N B;  4EUO A;  2XWV A;  3OMB A;  4PQJ A;  1MXZ A;  1NV5 A;  1EU8 A;  3W15 C;  4LQ5 A;  2F5X A;  1OLC A;  4ZS9 A;  2Y7R A;  2Y7P A;  1QW0 A;  4H8I A;  5DYH A;  4JVI A;  1FQB A;  1B6H A;  1MRP A;  2DYX A;  3KOS A;  4YKK A;  4PE3 A;  3Q25 A;  3G3J A;  1PBP A;  3RY3 A;  3K0V A;  4KXP A;  4XTC Q;  1LFH A;  2XXV A;  4F2Q A;  2P2A A;  4IO5 A;  1UTH A;  3TAJ A;  3R6U A;  5LTC A;  3K2D A;  3SEX A;  2XX7 A;  3TQW A;  2ZYM A;  1JW5 A;  4RNS A;  2QVU A;  5FTI A;  4GD5 A;  5L8D A;  5ET5 A;  3JZJ A;  2PT2 A;  2OWT A;  3FXR A;  1IUD A;  3HFU A;  2V3T A;  4ZEF A;  3U1O A;  5KCJ B;  4AS5 A;  1WVJ A;  2Y5L A;  4NF0 A;  1UIU A;  4N17 A;  4KR5 A;  3SEY A;  2DVZ A;  2OK2 A;  3K1N A;  2CZK A;  2DWA A;  2Z22 A;  3CRB A;  1M5B A;  1QVS A;  3MZB A;  3QIM A;  3SER A;  1FTL A;  2FVZ A;  1YXI A;  4P8B A;  5I2K B;  3DEL B;  4FOR A;  5IZ3 A;  4G68 A;  3H6W A;  3IFC A;  3BFT A;  2HQ0 A;  1B0H A;  4H1X A;  2PVU A;  2DXR A;  4R6H A;  2Y7K A;  1O64 A;  1XS5 A;  5L9M A;  2Y7W A;  2XXK A;  3IAZ A;  4PFU A;  3TPA A;  5F1Q A;  2OJT A;  1TFA A;  1Y20 A;  3IX1 A;  3FVN A;  4AB6 A;  4F29 A;  1GVC A;  1GGG A;  3TQL A;  4M1V A;  3FIR A;  3KN7 A;  4YU0 A;  1JVX A;  1XT8 A;  2FIE A;  1FRP A;  5AA3 A;  3QXM A;  4KPT A;  1M5F A;  3N94 A;  1LFI A;  1SI1 A;  4POX A;  4YB5 A;  2DOJ A;  4NMY A;  4JWY A;  5F7V A;  1H45 A;  4NGU A;  2NOO A;  4IY5 A;  4OA4 A;  3RT8 A;  4JWO A;  3LC8 A;  2D21 A;  4LVQ A;  5I58 A;  3O66 A;  4OVQ A;  1CNQ A;  3PPO A;  3G3I A;  5H8F B;  4PE5 B;  3PD8 A;  1QUL A;  3C36 A;  3OO8 A;  3OD7 A;  5TPA A;  4PFR A;  2L5V A;  4RK2 A;  4GL0 A;  2HCA A;  3ILU B;  3H7M A;  1MPD A;  3ECR A;  4GXS B;  4RXL A;  1WDN A;  1LST A;  4N6P A;  1MH3 A;  2GFE A;  1J1N A;  1NI9 A;  3N5L A;  1QUJ A;  3MW0 A;  3C33 A;  1NMU A;  4IO7 A;  3TFL A;  5ITP A;  2XD3 A;  3FVK A;  2UVI A;  2Q88 A;  4N6K A;  3O6I A;  3E3K A;  4YKP A;  4UAB A;  5EQ8 A;  1FBF A;  4P3L A;  3TKD A;  1MQH A;  2VPO A;  2V93 A;  5I58 B;  2D3I A;  3T9H B;  2Q89 A;  3BIG A;  2RCA A;  4N81 A;  3FXB A;  3MVY A;  1NL5 A;  4GWS A;  2GHA A;  1LBX A;  4HXV A;  4DIG A;  1XVX A;  2XXR A;  4GWO A;  3N6T A;  1D3K A;  1TWY A;  1N84 A;  4MBP A;  3UOR A;  3VFJ A;  4ESX A;  4H45 A;  1D9V A;  2F7C A;  2Z23 A;  1FSA A;  5FBP A;  4RPN A;  5EQA A;  4ELP A;  4ZZE A;  5AA2 A;  3QUJ A;  3W9V A;  1MQJ A;  3FXU A;  4OXV A;  2RC9 A;  4P9K A;  5BUU A;  2AIX A;  3O9P A;  3IOU A;  1EZP A;  3G3G A;  1LBZ A;  2DXY A;  1FTO A;  2G29 A;  3ROJ A;  1FQF A;  4DCY A;  3PTY A;  3OEK A;  2ONK E;  4QSE A;  1FPF A;  5H8S A;  1BP5 A;  3SDF A;  4X8R A;  3KC0 A;  4N8Y A;  4DXU A;  3FJ7 A;  2QMW A;  5J16 A;  4OET A;  4ELO A;  2F34 A;  3SEV A;  3KGC A;  3PD9 A;  4U4S A;  1G0I A;  2HHM A;  1NUX A;  3E4R A;  4P1L A;  2PMS A;  2OWS A;  2OZZ A;  1MDP 1;  3FAS A;  3SET A;  4PFB A;  4KI0 E;  3LSF B;  3IOT A;  4HE0 A;  1UTB A;  3LSL A;  4KHZ E;  1MXU A;  1HSE A;  2KLF A;  1TXF A;  2UVG A;  4GVO A;  1FQE A;  2A5S A;  4NWC A;  3U93 A;  3D4G A;  5CRY A;  1USY H;  4MJO A;  5ET7 A;  3OEN A;  4YMB A;  2Z8D A;  4GX4 A;  2HEU A;  2CEY A;  3LUZ A;  1B0L A;  1IXC A;  2RC8 A;  3PUX E;  3FBP A;  4OQO A;  3BFU A;  3RTF B;  2DDK A;  4I3E A;  4GWY A;  5HBC A;  3GXA A;  4UAC A;  1FPG A;  3LBS A;  2Q9T A;  4NWD A;  2I3V A;  4LAT A;  3KOT A;  3E78 A;  4TLM B;  1DTG A;  3T9U A;  2AL5 A;  3V8X B;  4FEC A;  2XXW A;  3ODB A;  2ZYK A;  2BJJ X;  2XXT A;  4QFP A;  2REG A;  2VT5 A;  1LCF A;  3K01 A;  2HXW A;  1NV6 A;  3RPL A;  1Y4T A;  1A55 A;  3MP1 A;  1PC3 A;  3H4Z A;  1K9Z A;  3G3F A;  2E0S A;  3TEL A;  2WKY A;  4R74 A;  4ELR A;  4IR8 A;  1NH8 A;  1B5H A;  4NHB A;  4OFO A;  1M5E A;  1B32 A;  1A7L A;  3PPR A;  1MXX A;  3MJN A;  4OEU A;  1MS7 A;  5DVI A;  2WYK A;  1S7Y A;  1UIV A;  2NWJ A;  3H6U A;  3S9M C;  2ZZX A;  4O7I A;  4ZEI A;  3MST A;  4IO3 A;  5JTY B;  4U23 A;  3H03 A;  4F1V A;  1Z7M E;  3B6W A;  2I0B A;  5DT6 A;  1MY0 A;  2XXI A;  3EHS A;  4JXI A;  2QVR A;  2QFL A;  3ZS6 A;  2FNC A;  1D9Y A;  3CSG A;  4C0R A;  1SW1 A;  3WAE A;  3VE1 B;  1AMF A;  3I3V A;  4YIC A;  3RQT A;  4QF9 A;  1JW1 A;  2RF1 A;  4MX6 A;  3RT6 B;  1ZKB A;  3TCF A;  1VFE A;  2F7B A;  2O1M A;  2XXU A;  2V4C A;  1SI0 A;  2GQ1 A;  1LAX A;  4DCX A;  2XXP A;  2PX1 A;  2Q2A A;  4G8H A;  3RPW A;  1YCJ A;  1B7U A;  2QVV A;  1D4N A;  4IO4 A;  4BDQ A;  1R6Z A;  3MZ1 A;  5DVJ A;  2THI A;  5CMB A;  3A3C A;  4QFK A;  1LBB A;  5J1D A;  2ZNS A;  2NVU B;  1RDZ A;  4GWW A;  4LON B;  2AYS A;  3FV2 A;  1N7W A;  2XXH A;  1LAG E;  4JVD A;  4NG7 A;  1WOD A;  4JSD A;  3IB1 A;  3VXB A;  4FIM A;  1SW2 A;  2UYE A;  3UN6 A;  1JEV A;  3CHG A;  1CB6 A;  3PMW A;  5DVF A;  2XWO A;  1B40 A;  3OOA A;  1SW5 A;  2HAV A;  3OSR A;  2ABH A;  2DE4 A;  2PFZ A;  3UA8 A;  1INP A;  4GBV A;  4IGR A;  1P99 A;  1JNF A;  2V3U A;  2OCU A;  3T9X B;  4F39 A;  4ONY A;  4PDD A;  3KSJ A;  3B6Q A;  4Q5T A;  1YYZ A;  3F11 A;  2UYF A;  1URS A;  2UVH A;  4C1U A;  2OWZ A;  3IL1 B;  3QMF A;  1OIB A;  1B3L A;  3MPK A;  1FBH A;  1AOV A;  3PUZ E;  4DI3 D;  4BDN A;  1UQW A;  2ZZW A;  2QJE A;  4PDH A;  4H65 A;  4MEV A;  4G68 C;  2VD2 A;  3KSX A;  4HCY A;  1PEB A;  5TP9 B;  2D5W A;  2BJI A;  1NUZ A;  2V84 A;  3PUW E;  3TYH A;  2O68 A;  1B1H A;  3JV9 A;  3KJT A;  2CZH A;  1LLS A;  4WKM A;  3CG1 A;  1IXH A;  3MYU A;  1BTJ A;  2P3N A;  3UIF A;  3Q28 A;  4ZE8 A;  3U65 A;  3S9N C;  1QGX A;  5H8H B;  3D4C A;  2XXQ A;  2DQV A;  4OFJ A;  1AWB A;  2HFB A;  4P11 A;  4I62 A;  4PP0 A;  1RDX A;  3C35 A;  4EF1 A;  4LA9 A;  4GWZ A;  2CZI A;  1AIV A;  3GBA A;  3FXQ A;  4JBZ A;  4QRZ A;  4NF6 A;  4XF5 A;  3PGF A;  3TTM A;  3E79 A;  2IEE A;  3C4M A;  4ZZA A;  2F3D A;  3IB0 A;  2DP8 A;  5KZT A;  2KQZ A;  2HZL A;  1NUY A;  4OZ9 A;  5DEX A;  3CI8 A;  4U22 A;  5AA4 B;  2NUV A;  2DWH A;  4PGP A;  1LAF E;  2HXR A;  2YLN A;  5K2X A;  4O7M A;  4NTL A;  5L9S A;  1NNK A;  2ALU A;  4NF8 B;  1EYI A;  2CMO A;  3PPQ A;  4PFW A;  1B05 A;  2A5T A;  4RPO A;  2Y7I A;  1FBP A;  4PET A;  5I56 A;  5ET6 A;  2DE2 A;  1B5J A;  2ONS A;  3T93 B;  3RGY A;  3ISP A;  1DTZ A;  3HHF A;  3RPL B;  2NXO A;  3BIH A;  4E0W A;  4I8C A;  3HCQ A;  3TTR A;  1Q9D A;  4OWD A;  2ZNT A;  1MXV A;  2Q8J A;  3O97 A;  4ECF A;  2RKM A;  1BKA A;  1JEU A;  4MCO A;  1ZLQ A;  1POT A;  1US5 A;  5ET8 A;  4MNC A;  5I2N B;  2LAO A;  3PPP A;  4G2Z A;  4GQO A;  1N3X A;  4GX6 A;  4F3S A;  1B52 A;  4X9T A;  1VDW A;  2I48 A;  4LZ7 A;  2X7Q A;  3S4U A;  4QBA A;  2VP1 A;  4QFL A;  2P0S A;  2E1S A;  2A5T B;  1A54 A;  5JTY A;  4QFN A;  4TOZ A;  5I3S A;  1QUK A;  4JB7 A;  3HHG A;  3O28 A;  4R9F A;  5ELV A;  4BDO A;  1II5 A;  3L6H A;  4AB5 A;  2UVJ A;  1FW0 A;  4GWU A;  3VVD A;  1IMA A;  2VOZ A;  3IO6 A;  1HSL A;  3B6T A;  4ELQ A;  5IKB A;  3KZG A;  3S2V A;  5IZ3 B;  3OO7 A;  2H98 A;  4NQ8 A;  4I3Y A;  4GX3 A;  5H8H A;  3K6W A;  4OVP A;  3MVZ A;  1USY E;  4DE8 A;  3BBR A;  3DM0 A;  2F7A A;  4NF4 B;  2DE3 A;  2Q2C A;  1JVY A;  4LN5 A;  5FHO A;  4TLL B;  3S9L C;  4NN3 A;  4P0G A;  1GV8 A;  5I84 A;  1OVT A;  2CEX A;  1MM7 A;  3TOD A;  1QUI A;  4XXU A;  1PBQ A;  4YZZ A;  1NKX A;  3TZA A;  3N26 A;  3DP6 A;  1IIW A;  4FE8 A;  2XHD A;  1BIY A;  4YB7 A;  2XXX A;  4KYE A;  4OVT A;  1CE2 A;  4LP2 B;  1IZ1 A;  3IJO B;  1VE4 A;  4DXC A;  2PT1 A;  2QRY A;  1OQG A;  3TDJ A;  2I3W A;  4G8N A;  1T0K A; 
#chains in the Genus database with same CATH homology
 4ZDM A;  4R6K A;  1N76 A;  4OFO A;  1M5E A;  4BLA A;  1A8F A;  3LUY A;  1B32 A;  1B3F A;  3VLU A;  2O1L A;  4YKJ A;  4F19 A;  1Y1M A;  4ZED A;  1A7L A;  1XOC A;  1SYI A;  3PPR A;  3VVF A;  1N0T A;  1Y3P A;  2I49 A;  5CI5 A;  1GR2 A;  1MXX A;  5DTB A;  3O29 A;  4NF8 A;  4NF5 A;  4E0X A;  4EUO A;  5H8N B;  3SES A;  1LCT A;  4G8M A;  5B70 A;  3MJN A;  4OEU A;  5HPQ A;  3SKP A;  1A99 A;  3OMB A;  5TP9 A;  1MS7 A;  5DVI A;  4PQJ A;  5EHS A;  1YAE A;  1MXZ A;  1S7Y A;  1UIV A;  1EU8 A;  3FJG A;  2NWJ A;  3H6U A;  3W15 C;  3S9M C;  3ZKL A;  3T66 A;  3CFL A;  3EQ1 A;  4LQ5 A;  2F5X A;  1OLC A;  4ZS9 A;  2Y7R A;  2Y7P A;  1FTM A;  4ZEI A;  4IO3 A;  5JTY B;  4U23 A;  1QW0 A;  4XKP A;  3EPE A;  3O2A A;  1BLF A;  4H8I A;  5M2V A;  5DYH A;  3W9W A;  1FQB A;  1NFT A;  5B7D A;  1B6H A;  1MRP A;  2DYX A;  3H03 A;  4HS7 A;  5CM6 A;  1VFD A;  1MDQ A;  1R9L A;  4F1V A;  1S9T A;  1MQI A;  1Z7M E;  2I0B A;  3B6W A;  3KOS A;  3PUY E;  4M4G A;  4QSC A;  4R73 A;  4YKK A;  5DT6 A;  1DMB A;  4K3F A;  3AXF A;  3KFM A;  3THI A;  5LOM A;  1MY0 A;  1OVB A;  3Q25 A;  2XXI A;  3G3J A;  3EHS A;  1S50 A;  4JXI A;  1PBP A;  3RY3 A;  3K0V A;  4XTC Q;  1LFH A;  2XXV A;  4F2Q A;  4IB2 A;  1DSN A;  5KDT A;  1H76 A;  3GZG A;  2P2A A;  3ZS6 A;  2FNC A;  4IO5 A;  1D9Y A;  1UTH A;  2F6P A;  3TAJ A;  3KJ7 A;  3R6U A;  2Y84 A;  3LR1 A;  3CSG A;  1MPB A;  3O6G A;  3K2D A;  4THI A;  2XX7 A;  4GXA A;  1XVY A;  4Q0C A;  3SEX A;  1FQD A;  1SW1 A;  1YTV A;  3TQW A;  4C0R A;  2ZYM A;  5CMC A;  3SEW A;  3WAE A;  2X7P A;  3VE1 B;  2X26 A;  1AMF A;  2ZMB A;  3HPI A;  3I3V A;  1JW5 A;  4RNS A;  3KEI A;  4YIC A;  1QJM A;  5FTI A;  4FAJ A;  3HST A;  4GD5 A;  5L8D A;  3L6G A;  3I5O A;  3RQT A;  3Q26 A;  4QF9 A;  4ZEK A;  3JZJ A;  4MFI A;  1SYH A;  2PT2 A;  4MLQ A;  3KN8 A;  3T22 A;  3ZKK A;  5CMK A;  1JW1 A;  2OWT A;  1B51 A;  3V5A A;  2QS3 A;  2RF1 A;  3DP8 A;  3FXR A;  1IUD A;  1ZKB A;  1P1W A;  1VFE A;  1ZU0 A;  2F7B A;  2O1M A;  2XXU A;  3TCF A;  1SI0 A;  2V3T A;  3U94 A;  4F22 A;  4ZEF A;  1LAX A;  4DCX A;  3FVG A;  1Z7N E;  3BKI B;  2XXP A;  4GL8 A;  2PX1 A;  3U1O A;  5KCJ B;  4OEN A;  1LB9 A;  2Q2A A;  1ANF A;  1WVJ A;  1UTB B;  2ESN A;  4G8H A;  2AL4 A;  1A8E A;  3RPW A;  3P7I A;  1UIU A;  1XC1 A;  4BDL A;  1YCJ A;  4HW8 A;  4EQ9 A;  1B7U A;  3MVX A;  1D4N A;  4IO4 A;  4KR5 A;  2DVZ A;  3SEY A;  4BDQ A;  4EQB A;  3FJM A;  1R6Z A;  3MZ1 A;  3KN3 A;  2OK2 A;  2THI A;  5CMB A;  3A3C A;  5DVJ A;  3U92 A;  3K1N A;  3K00 A;  4YAH X;  2DWA A;  3MWB A;  3FVO A;  1LBB A;  4QFK A;  5AA4 A;  2Z22 A;  3CRB A;  1KWH A;  1M5B A;  1QVS A;  3MZB A;  2ZNS A;  3PV0 E;  3QIM A;  4O3A A;  3GBB A;  4XKR A;  1FTL A;  1OLA A;  3SER A;  2F97 A;  4PFT A;  5I2K A;  3FD3 A;  2NVU B;  5I2K B;  3TTL A;  2GH9 A;  3DEL B;  4FOR A;  4LON B;  2AYS A;  3T9V A;  2RCB A;  4LUB A;  1POY 1;  2O7U A;  2Z8E A;  3FV2 A;  2Z8F A;  3C9H A;  4G68 A;  3H6W A;  3BFT A;  1FQA A;  1N7W A;  1I6Q A;  2G93 A;  3E9X A;  2IA4 A;  2XXH A;  4G77 A;  1LAG E;  2HQ0 A;  2W7Y A;  4OER A;  5JK4 A;  1WOD A;  3HN0 A;  4JSD A;  2PYY A;  3IB1 A;  5TU0 A;  3RLF E;  3FAT A;  4FIM A;  3VXB A;  1SW2 A;  2UYE A;  3CG3 A;  5L9O A;  1B0H A;  4UA8 A;  3UN6 A;  4H1X A;  1JEV A;  1CB6 A;  2PVU A;  2DXR A;  4R6H A;  3PMW A;  4WXJ A;  5DVF A;  3RUM A;  3VVE A;  1Q35 A;  2DWI A;  2Y7K A;  1B40 A;  4I1D A;  3OOA A;  1VR5 A;  1RKM A;  1SW5 A;  1O64 A;  2HAV A;  1XS5 A;  3OSR A;  5I57 B;  5L9M A;  2ABH A;  2Y7W A;  2DE4 A;  2ZXT A;  4H5F A;  4BDR A;  1F9B A;  3IAZ A;  1JQF A;  2V3Q A;  3QUF A;  4HTG A;  4PFU A;  5F1Q A;  3TPA A;  3UA8 A;  2OJT A;  1NNT A;  4H6D A;  4RYA A;  1TFA A;  3S9E A;  1Y20 A;  4YB6 A;  3IX1 A;  4IGR A;  1IXI A;  3FVN A;  3K6U A;  3M8U A;  1Y3Q A;  3TMG A;  5CBS A;  4AB6 A;  4F29 A;  1P99 A;  1GVC A;  1GGG A;  1JNF A;  2V3U A;  3TQL A;  4KCC A;  2OCU A;  3QSL A;  3PU5 A;  3GLB A;  4F1U A;  1B46 A;  4M1V A;  3T9X B;  3FIR A;  3KN7 A;  5EHM A;  4F39 A;  4KD5 A;  4ONY A;  4YU0 A;  1MM6 A;  1JVX A;  2REJ A;  3KSJ A;  4OEV A;  1MXW A;  1UTH B;  3B6Q A;  4OFL A;  4AQ4 A;  1XT8 A;  4LZ5 A;  4Q5T A;  4H67 A;  4OES A;  3F11 A;  1R1N A;  2XX8 A;  5AA3 A;  2UYF A;  1URS A;  3QXM A;  1PB8 A;  2UVH A;  1P1O A;  4C1U A;  1LAH E;  4KPT A;  5ISU A;  2I58 A;  4EXK A;  1B4Z A;  3IL1 B;  5DEX B;  1OIB A;  1P1N A;  1B3L A;  3Q29 A;  5I59 A;  5ICQ A;  3ILT B;  3N6U A;  3B7D A;  1M5F A;  3N94 A;  3RT6 B;  1LFI A;  1SI1 A;  1EH3 A;  4POX A;  4YB5 A;  3K6V A;  3ONM A;  2DOJ A;  3MPK A;  4NMY A;  1AOV A;  4KYS A;  1EZ9 A;  3PUZ E;  3A09 A;  4JWY A;  3ZSF A;  4BDN A;  4EF2 A;  1UQW A;  2QJE A;  1MQD A;  5F7V A;  1H45 A;  3M3K A;  4KCD A;  4H65 A;  1RYO A;  3OSQ A;  5FHN A;  4G68 C;  2VD2 A;  2NOO A;  4IY5 A;  5FHM A;  1ZJL A;  3K6X A;  3E13 X;  3K1P A;  3KSX A;  4HCY A;  4JWO A;  4X1D A;  3RT8 A;  3TUS A;  3LC8 A;  1PEB A;  3QAX A;  2D21 A;  2D5W A;  2I0C A;  2V84 A;  5TP9 B;  4LVQ A;  2GRV A;  4G4P A;  5I57 A;  3MVW A;  3PUW E;  3TYH A;  1PB9 A;  3A3U A;  5I58 A;  3O66 A;  2O68 A;  3DLN A;  3MP6 A;  3U8Q A;  1B1H A;  1ZIU A;  3JV9 A;  3PPO A;  4WEP A;  3KJT A;  3G3I A;  5H8F B;  4PE5 B;  1LLS A;  2B3B A;  3PD8 A;  1MY2 A;  4WKM A;  5BWJ A;  1P1Q A;  1LGB C;  1QUL A;  3CG1 A;  4DXB A;  3KBR A;  1IXH A;  3C36 A;  3OO8 A;  4H0W A;  1M5D A;  3OD7 A;  5TPA A;  5A5X B;  4RA1 A;  4LZ8 A;  4POW A;  1FQC A;  1BTJ A;  4YMA A;  5KCJ A;  3UIF A;  3M3F A;  4RK2 A;  2VD3 A;  3CFZ A;  3Q28 A;  4GFR A;  4GL0 A;  4ZE8 A;  1O7T A;  2HCA A;  3ILU B;  2B65 A;  3CVG A;  4G68 B;  4GLI A;  3VLV A;  3H7M A;  1MG1 A;  1MPD A;  2O69 A;  3ECR A;  4GXS B;  1MY4 A;  1WDN A;  4RXL A;  3S9N C;  1N3W A;  5H8H B;  3IB2 A;  2V25 A;  3EF7 A;  1PB7 A;  4F2O A;  5ITO A;  1LST A;  3D4C A;  1Y9U A;  3OO9 A;  2XXQ A;  1MH3 A;  2DQV A;  2GFE A;  4N6P A;  4OFJ A;  1J1N A;  2HFB A;  3LSX A;  2RC7 A;  4P11 A;  4QFO A;  4I62 A;  4PP0 A;  2F36 A;  4NE4 A;  3V89 B;  3N5L A;  1QUJ A;  3C35 A;  3V83 A;  3MW0 A;  3C33 A;  4EF1 A;  1NMU A;  2XD2 A;  3G3K A;  4IO7 A;  4JDF A;  4LA9 A;  3VXC A;  3PMV A;  1AIV A;  4O3B A;  1YPN A;  2DVC A;  1XHY A;  3GBA A;  3TFL A;  5ITP A;  4R75 A;  2XD3 A;  3FVK A;  2UVI A;  2Q88 A;  3FXQ A;  1Y3N A;  3O6I A;  4FEB A;  3E3K A;  2I4C A;  4JBZ A;  4YKP A;  1I69 A;  4ISU A;  4U21 A;  3H6V A;  4R2F A;  4F3G A;  4XKN A;  5EYF A;  4L17 A;  3TKD A;  1MQH A;  4LQ2 A;  4QRZ A;  1IIT A;  2F6G A;  3Q27 A;  4NF6 A;  1SDX A;  3PGF A;  5K2Y A;  3G3H A;  5J1D A;  4NF6 B;  2V93 A;  3TCH A;  5I58 B;  2D3I A;  3T9H B;  3TTM A;  2IEE A;  2Q89 A;  4U4X A;  1B2H A;  2RCA A;  3C4M A;  2DWJ A;  1B1X A;  5AA2 B;  2XXY A;  3MVY A;  1JET A;  4ZZA A;  4RY1 A;  5I59 B;  1NL5 A;  3IB0 A;  3CSB A;  2DP8 A;  5KZT A;  1RYX A;  1SVX B;  4ESW A;  2GHA A;  2HZL A;  1N7X A;  3K4U A;  3QYT A;  3RNN A;  3R26 A;  4OZ9 A;  3FV1 A;  3H6T A;  5DEX A;  2DS9 A;  2I6E A;  3CI8 A;  1QKB A;  1VSO A;  4U22 A;  4DIG A;  1XVX A;  4EDP A;  5AA4 B;  1FCK A;  1SQY A;  2XXR A;  2NUV A;  2ZNU A;  3MBP A;  4RK9 A;  4IY6 A;  1L5T A;  1OMP A;  2DWH A;  1MY3 A;  1NNF A;  1LAF E;  3EHU A;  4MLV A;  4OHN A;  4GWO A;  1Q1K A;  1N04 A;  2R6G E;  2H5Y A;  3N6T A;  1PDA A;  2CZL A;  3TTK A;  2YLN A;  5K2X A;  3HV1 A;  4Z7E A;  1D3K A;  3UP9 A;  1TWY A;  1N84 A;  3OEL A;  2YPN A;  4H8J A;  1B4H A;  3TEP A;  4NTL A;  3TTN A;  1TT1 A;  5H8Q A;  5L9S A;  1NNK A;  4MBP A;  3IOW A;  3UOR A;  3VFJ A;  3MUQ A;  4ESX A;  2OBG A;  3OEM A;  2ALU A;  4NF8 B;  4NF5 B;  2O7I A;  1D9V A;  4BDM A;  2F7C A;  5CBR A;  2Z23 A;  1H44 A;  3FUZ A;  2CMO A;  2H25 A;  3IOR A;  3PPQ A;  3PUV E;  3CIJ A;  4PFW A;  4F1Y A;  1B05 A;  4KQP A;  2A5T A;  1SW4 A;  4RPO A;  1B3E A;  2Y7I A;  4RPN A;  4IO2 A;  4PET A;  3VLW A;  4I9D A;  4IO6 A;  4ELP A;  4ZZE A;  5I56 A;  2B3F A;  3SEU A;  5FTH A;  1MQG A;  5AA2 A;  3QUJ A;  1IXG A;  1I6B A;  3W9V A;  2DE2 A;  1MQJ A;  2R71 A;  3FXU A;  4OXV A;  1B5J A;  2ONS A;  3T93 B;  3RGY A;  2QS4 A;  2RC9 A;  5A5X A;  3T96 B;  1HSJ A;  1I6A A;  1DTZ A;  5BUU A;  4NF4 A;  2AIX A;  3HHF A;  3O9P A;  1P1U A;  1NH7 A;  4JSO A;  2NXO A;  4E0W A;  4I8C A;  3IOU A;  1NNP A;  1AL3 A;  3FZV A;  3HCQ A;  3TTR A;  1EZP A;  2F8D A;  3G3G A;  4OWD A;  4QSD A;  1AH5 A;  2DXY A;  3QK6 A;  5HM4 B;  1FTO A;  2ZNT A;  1MXV A;  3I6V A;  3O97 A;  3IO4 A;  2Q8J A;  4ECF A;  2RKM A;  1BKA A;  1JEU A;  2G29 A;  3OO6 A;  1URG A;  5AA2 D;  4HCW A;  1ZLQ A;  4ELO A;  1POT A;  1H3D A;  1US5 A;  2HAU A;  1FQF A;  2QS1 A;  1ZMG A;  1DPE A;  3MC2 A;  4KYD A;  4OYV A;  4DCY A;  3OEK A;  5I2N B;  2LAO A;  3PPP A;  4G2Z A;  1TFD A;  1N3X A;  2ONK E;  4GQO A;  4F31 B;  4QSE A;  5H8S A;  4GF8 A;  4H5G A;  1BP5 A;  3R7X A;  3K02 A;  3SDF A;  2ZYO A;  4EXL A;  4DXU A;  4YMB A;  3FJ7 A;  4F3S A;  2QMW A;  5I56 B;  1B52 A;  4X9T A;  1DPP A;  3LSW A;  2PBW A;  1SBP A;  3DP4 A;  2I48 A;  3H3G A;  1DOT A;  4LZ7 A;  4OET A;  2F34 A;  3UGW A;  3SEV A;  1QKA A;  4EQ7 A;  2X7Q A;  3KGC A;  2QL3 A;  2R9J A;  3S4U A;  3PD9 A;  4QHQ A;  2VP1 A;  1B3H A;  4QFL A;  2P0S A;  2E1S A;  4U4S A;  3RTW B;  1M5C A;  2A5T B;  2VGQ A;  4U1O A;  4C1T A;  1A54 A;  3E4R A;  3RN8 A;  4MF3 A;  3HO7 A;  3IK6 B;  4OTE A;  4P0I A;  2ANJ A;  5JTY A;  2PMS A;  2DSF A;  4QFN A;  4Q8R A;  4DZ1 A;  4R9G A;  3OXN A;  2OWS A;  4TOZ A;  3TCG A;  4Z0I A;  1QUK A;  4KFQ A;  2OZZ A;  1MDP 1;  3FAS A;  4DDD A;  4ND9 A;  3SET A;  4JB7 A;  3C31 A;  3MQ9 A;  3HHG A;  4KI0 E;  2VHA A;  2O84 X;  1FTK A;  3O28 A;  3LSF B;  3IOT A;  4R6Y A;  1UTB A;  2O6A A;  1OQH A;  3LSL A;  4KHZ E;  1MXU A;  4R9F A;  5ELV A;  5TPA B;  4O3C A;  1B7H A;  1HSE A;  2KLF A;  4BDO A;  3PPN A;  3MP8 A;  5I2N A;  3CR9 A;  4X1B A;  1II5 A;  3L6H A;  3U72 A;  4AB5 A;  2UVJ A;  1FW0 A;  1URD A;  3EHT A;  5CMM A;  3VV5 A;  3CFX A;  3MAM A;  1LBC A;  1TXF A;  2UVG A;  3G7W A;  3USD A;  5H8Q B;  3VVD A;  3WAF A;  2O51 A;  4GVO A;  3IR1 A;  1FQE A;  2A5S A;  4GIZ A;  4NWC A;  4Q30 B;  4WED A;  5JEI A;  2VOZ A;  3U93 A;  1IQ7 A;  2GHB A;  1ATG A;  3IO6 A;  1B58 A;  1HSL A;  2OLB A;  3B6T A;  3D4G A;  2H4I A;  3K1M A;  5AA1 A;  1B7Z A;  4N13 A;  3KZG A;  5CRY A;  4ELQ A;  5IKB A;  2YJP A;  1USY H;  1ELJ A;  3IJX B;  3OEN A;  1B9J A;  2QSX A;  2Z8D A;  2F35 A;  3H06 B;  3S2V A;  4GOT A;  1MPC A;  4ZEC A;  1ZBM A;  2HEU A;  1ZTY A;  1B3G A;  3OO7 A;  2H98 A;  1B0L A;  1IXC A;  4YKI A;  2RC8 A;  3PUX E;  4GRK A;  4MH5 A;  2H99 A;  5H8H A;  4OQO A;  3K6W A;  4JWX A;  4RJZ A;  5KDT B;  4R72 A;  1SD3 A;  2F78 A;  2FYI A;  4F18 A;  3MVZ A;  4XKQ A;  1USY E;  1Y4C A;  3BFU A;  3RTF B;  4DE8 A;  3BBR A;  3DM0 A;  1JW4 A;  1LB8 A;  2F7A A;  4NF4 B;  2RIN A;  1FTJ A;  5HBC A;  3GXA A;  4UAC A;  2P1S A;  2DE3 A;  2Q2C A;  2UXA A;  3FGS A;  3JYR A;  2Q9T A;  2ONR A;  3LBS A;  1JVY A;  4OMB A;  1IEJ A;  3PMX A;  2I3V A;  3O6H A;  3C32 A;  4NWD A;  4TLL B;  4XIG Q;  1R9Q A;  2H9B A;  1A40 A;  4R2B A;  5FHO A;  4U1Z A;  4ZE9 A;  4LAT A;  5IAI A;  3S9L C;  2XX9 A;  3KOT A;  1O63 A;  3C34 A;  2QPQ A;  4TLM B;  1DTG A;  1EZO A;  3M3L A;  4P0G A;  1B5I A;  3T9U A;  1GV8 A;  2AL5 A;  3IOV A;  1Y1Z A;  3V8X B;  4FEC A;  4F3P A;  4U2R A;  5H8F A;  5I84 A;  5H8N A;  2XXW A;  2QS2 A;  3ODB A;  4N07 A;  1OVT A;  2ZYK A;  2BJJ X;  2XXT A;  4FED A;  4QFP A;  1MM7 A;  4TQU Q;  2REG A;  3MZ9 A;  3VDF A;  4DLD A;  2QMX A;  4FAT A;  3TOD A;  1QUI A;  1LCF A;  3K01 A;  4PFY A;  4XXU A;  1PBQ A;  4YZZ A;  4F3B A;  2HXW A;  4IGT A;  5AE4 A;  1NKX A;  3TZA A;  1GTK A;  1LFG A;  1Y4T A;  3N26 A;  3DP6 A;  1IIW A;  3UK4 A;  4FE8 A;  1A55 A;  3MP1 A;  2XHD A;  1BIY A;  4YB7 A;  1MY1 A;  1PC3 A;  2XXX A;  1MH4 A;  3H4Z A;  4KYE A;  3G3F A;  5CC2 A;  2E0S A;  1MXY A;  2HZK A;  2I4B A;  3TEL A;  2WKY A;  4X48 A;  4R74 A;  4ELR A;  1CE2 A;  3MPL A;  4LP2 B;  1IZ1 A;  4NED A;  5ICT A;  3IJO B;  1VE4 A;  4FJP A;  4DXC A;  2PT1 A;  2QRY A;  3KG2 A;  1NH8 A;  3EN3 A;  1OQG A;  3TDJ A;  1H43 A;  2FA7 A;  2I3W A;  2M8C A;  1B5H A;  2ZYN A;  4G8N A;  4OVJ A;  4ZEB A;  1T0K A;  1US4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...